data_5K79
# 
_entry.id   5K79 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5K79         
WWPDB D_1000221580 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5K79 
_pdbx_database_status.recvd_initial_deposition_date   2016-05-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Matei, E.'        1 
'Basu, R.'         2 
'Furey, W.'        3 
'Shi, J.'          4 
'Calnan, C.'       5 
'Aiken, C.'        6 
'Gronenborn, A.M.' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            291 
_citation.language                  ? 
_citation.page_first                18967 
_citation.page_last                 18976 
_citation.title                     'Structure and Glycan Binding of a New Cyanovirin-N Homolog.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M116.740415 
_citation.pdbx_database_id_PubMed   27402833 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Matei, E.'        1 ? 
primary 'Basu, R.'         2 ? 
primary 'Furey, W.'        3 ? 
primary 'Shi, J.'          4 ? 
primary 'Calnan, C.'       5 ? 
primary 'Aiken, C.'        6 ? 
primary 'Gronenborn, A.M.' 7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5K79 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     93.840 
_cell.length_a_esd                 ? 
_cell.length_b                     74.396 
_cell.length_b_esd                 ? 
_cell.length_c                     36.499 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5K79 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cyanovirin-N domain protein' 11935.921 2   ? ? 'residues 32-139' ? 
2 non-polymer syn 'DI(HYDROXYETHYL)ETHER'       106.120   2   ? ? ?                 ? 
3 non-polymer syn 1,2-ETHANEDIOL                62.068    1   ? ? ?                 ? 
4 water       nat water                         18.015    217 ? ? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TGQFSKTCEDITLDGSTLSAFCQKADGYTLNETSINLDEEIGNLDGTLSWGDHNFSLTCDSIGLAQSLFTRTYVLAAECE
RRDGYTYIPTEIELDEHIANIDGTLTYE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TGQFSKTCEDITLDGSTLSAFCQKADGYTLNETSINLDEEIGNLDGTLSWGDHNFSLTCDSIGLAQSLFTRTYVLAAECE
RRDGYTYIPTEIELDEHIANIDGTLTYE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   GLY n 
1 3   GLN n 
1 4   PHE n 
1 5   SER n 
1 6   LYS n 
1 7   THR n 
1 8   CYS n 
1 9   GLU n 
1 10  ASP n 
1 11  ILE n 
1 12  THR n 
1 13  LEU n 
1 14  ASP n 
1 15  GLY n 
1 16  SER n 
1 17  THR n 
1 18  LEU n 
1 19  SER n 
1 20  ALA n 
1 21  PHE n 
1 22  CYS n 
1 23  GLN n 
1 24  LYS n 
1 25  ALA n 
1 26  ASP n 
1 27  GLY n 
1 28  TYR n 
1 29  THR n 
1 30  LEU n 
1 31  ASN n 
1 32  GLU n 
1 33  THR n 
1 34  SER n 
1 35  ILE n 
1 36  ASN n 
1 37  LEU n 
1 38  ASP n 
1 39  GLU n 
1 40  GLU n 
1 41  ILE n 
1 42  GLY n 
1 43  ASN n 
1 44  LEU n 
1 45  ASP n 
1 46  GLY n 
1 47  THR n 
1 48  LEU n 
1 49  SER n 
1 50  TRP n 
1 51  GLY n 
1 52  ASP n 
1 53  HIS n 
1 54  ASN n 
1 55  PHE n 
1 56  SER n 
1 57  LEU n 
1 58  THR n 
1 59  CYS n 
1 60  ASP n 
1 61  SER n 
1 62  ILE n 
1 63  GLY n 
1 64  LEU n 
1 65  ALA n 
1 66  GLN n 
1 67  SER n 
1 68  LEU n 
1 69  PHE n 
1 70  THR n 
1 71  ARG n 
1 72  THR n 
1 73  TYR n 
1 74  VAL n 
1 75  LEU n 
1 76  ALA n 
1 77  ALA n 
1 78  GLU n 
1 79  CYS n 
1 80  GLU n 
1 81  ARG n 
1 82  ARG n 
1 83  ASP n 
1 84  GLY n 
1 85  TYR n 
1 86  THR n 
1 87  TYR n 
1 88  ILE n 
1 89  PRO n 
1 90  THR n 
1 91  GLU n 
1 92  ILE n 
1 93  GLU n 
1 94  LEU n 
1 95  ASP n 
1 96  GLU n 
1 97  HIS n 
1 98  ILE n 
1 99  ALA n 
1 100 ASN n 
1 101 ILE n 
1 102 ASP n 
1 103 GLY n 
1 104 THR n 
1 105 LEU n 
1 106 THR n 
1 107 TYR n 
1 108 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   108 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PCC7424_1905 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'PCC 7424' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Cyanothece sp. (strain PCC 7424)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     65393 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET26B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B7KDN5_CYAP7 
_struct_ref.pdbx_db_accession          B7KDN5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TGQFSKTCEDITLDGSTLSAFCQKADGYTLNETSINLDEEIGNLDGTLSWGDHNFSLTCDSIGLAQSLFTRTYVLAAECE
RRDGYTYIPTEIELDEHIANIDGTLTYE
;
_struct_ref.pdbx_align_begin           32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5K79 A 1 ? 108 ? B7KDN5 32 ? 139 ? 1 108 
2 1 5K79 B 1 ? 108 ? B7KDN5 32 ? 139 ? 1 108 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL          'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE               ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                 'C6 H15 N2 O2 1' 147.195 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ?                 'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5K79 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.670 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.000 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'25% W/V POLYETHYLENE GLYCOL (PEG), 335015% ETHYLENE GLYCOL, 0.2 M MAGNESIUM CHLORIDE HEXAHYDRATE' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           93.0 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      MIRRORS 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-07-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'SI 111' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            17.090 
_reflns.entry_id                         5K79 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.600 
_reflns.d_resolution_low                 34.580 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       34474 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       0.000 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.100 
_reflns.pdbx_Rmerge_I_obs                0.136 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            23.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.600 
_reflns_shell.d_res_low                   1.700 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.700 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        95.600 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.8 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.500 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                44.900 
_refine.B_iso_mean                               18 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5K79 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.6000 
_refine.ls_d_res_low                             34.5800 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     34474 
_refine.ls_number_reflns_R_free                  1792 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7800 
_refine.ls_percent_reflns_R_free                 5.2000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2030 
_refine.ls_R_factor_R_free                       0.2327 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2015 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 2EZM' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.2500 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.6000 
_refine_hist.d_res_low                        34.5800 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             217 
_refine_hist.number_atoms_total               1892 
_refine_hist.pdbx_number_residues_total       219 
_refine_hist.pdbx_B_iso_mean_solvent          25.47 
_refine_hist.pdbx_number_atoms_protein        1674 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 1723 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.086  ? 2331 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.047  ? 269  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 305  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 11.920 ? 610  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.6000 1.6433  2583 . 134 2449 99.0000  . . . 0.2629 . 0.2283 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.6433 1.6916  2616 . 137 2479 100.0000 . . . 0.2424 . 0.2253 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.6916 1.7462  2608 . 136 2472 100.0000 . . . 0.2563 . 0.2207 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.7462 1.8086  2609 . 135 2474 100.0000 . . . 0.2645 . 0.2140 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.8086 1.8811  2601 . 135 2466 100.0000 . . . 0.2674 . 0.2015 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.8811 1.9667  2645 . 138 2507 100.0000 . . . 0.2052 . 0.1908 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.9667 2.0703  2635 . 137 2498 100.0000 . . . 0.2604 . 0.1838 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.0703 2.2000  2620 . 137 2483 100.0000 . . . 0.2197 . 0.1982 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.2000 2.3699  2654 . 138 2516 100.0000 . . . 0.2536 . 0.2000 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.3699 2.6083  2682 . 138 2544 100.0000 . . . 0.2197 . 0.2119 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.6083 2.9855  2666 . 138 2528 100.0000 . . . 0.2165 . 0.2156 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.9855 3.7607  2707 . 140 2567 100.0000 . . . 0.2479 . 0.2041 . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 3.7607 34.5883 2848 . 149 2699 100.0000 . . . 0.2121 . 0.1858 . . . . . . 13 . . . 
# 
_struct.entry_id                     5K79 
_struct.title                        'Structure and anti-HIV activity of CYT-CVNH, a new cyanovirin-n homolog' 
_struct.pdbx_descriptor              'Cyanovirin-N domain protein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5K79 
_struct_keywords.text            'Sugar binding lectiN, HIV-inactivating, antiviral protein, oligosaccharide' 
_struct_keywords.pdbx_keywords   'ANTIVIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLN A 3  ? LYS A 6  ? GLN A 3  LYS A 6  5 ? 4 
HELX_P HELX_P2 AA2 ASN A 54 ? LEU A 57 ? ASN A 54 LEU A 57 5 ? 4 
HELX_P HELX_P3 AA3 GLN B 3  ? LYS B 6  ? GLN B 3  LYS B 6  5 ? 4 
HELX_P HELX_P4 AA4 ASN B 54 ? LEU B 57 ? ASN B 54 LEU B 57 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 8  SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 8  A CYS 22 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf2 disulf ? ? A CYS 59 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 59 A CYS 79 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3 disulf ? ? B CYS 8  SG ? ? ? 1_555 B CYS 22 SG ? ? B CYS 8  B CYS 22 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf4 disulf ? ? B CYS 59 SG ? ? ? 1_555 B CYS 79 SG ? ? B CYS 59 B CYS 79 1_555 ? ? ? ? ? ? ? 2.041 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 2 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 CYS A 8   ? ASP A 14  ? CYS A 8   ASP A 14  
AA1 2 THR A 17  ? GLN A 23  ? THR A 17  GLN A 23  
AA1 3 LEU A 30  ? ASN A 36  ? LEU A 30  ASN A 36  
AA2 1 ILE A 41  ? LEU A 44  ? ILE A 41  LEU A 44  
AA2 2 THR A 47  ? TRP A 50  ? THR A 47  TRP A 50  
AA3 1 CYS A 59  ? GLN A 66  ? CYS A 59  GLN A 66  
AA3 2 TYR A 73  ? GLU A 80  ? TYR A 73  GLU A 80  
AA3 3 TYR A 87  ? GLU A 93  ? TYR A 87  GLU A 93  
AA4 1 ILE A 98  ? ILE A 101 ? ILE A 98  ILE A 101 
AA4 2 THR A 104 ? TYR A 107 ? THR A 104 TYR A 107 
AA5 1 CYS B 8   ? ASP B 14  ? CYS B 8   ASP B 14  
AA5 2 THR B 17  ? GLN B 23  ? THR B 17  GLN B 23  
AA5 3 LEU B 30  ? ASN B 36  ? LEU B 30  ASN B 36  
AA6 1 ILE B 41  ? LEU B 44  ? ILE B 41  LEU B 44  
AA6 2 THR B 47  ? TRP B 50  ? THR B 47  TRP B 50  
AA7 1 CYS B 59  ? GLN B 66  ? CYS B 59  GLN B 66  
AA7 2 TYR B 73  ? GLU B 80  ? TYR B 73  GLU B 80  
AA7 3 TYR B 87  ? GLU B 93  ? TYR B 87  GLU B 93  
AA8 1 ILE B 98  ? ILE B 101 ? ILE B 98  ILE B 101 
AA8 2 THR B 104 ? TYR B 107 ? THR B 104 TYR B 107 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 9  ? N GLU A 9  O PHE A 21  ? O PHE A 21  
AA1 2 3 N CYS A 22 ? N CYS A 22 O ASN A 31  ? O ASN A 31  
AA2 1 2 N LEU A 44 ? N LEU A 44 O THR A 47  ? O THR A 47  
AA3 1 2 N ASP A 60 ? N ASP A 60 O GLU A 78  ? O GLU A 78  
AA3 2 3 N CYS A 79 ? N CYS A 79 O ILE A 88  ? O ILE A 88  
AA4 1 2 N ALA A 99 ? N ALA A 99 O THR A 106 ? O THR A 106 
AA5 1 2 N GLU B 9  ? N GLU B 9  O PHE B 21  ? O PHE B 21  
AA5 2 3 N CYS B 22 ? N CYS B 22 O ASN B 31  ? O ASN B 31  
AA6 1 2 N LEU B 44 ? N LEU B 44 O THR B 47  ? O THR B 47  
AA7 1 2 N ASP B 60 ? N ASP B 60 O GLU B 78  ? O GLU B 78  
AA7 2 3 N CYS B 79 ? N CYS B 79 O ILE B 88  ? O ILE B 88  
AA8 1 2 N ALA B 99 ? N ALA B 99 O THR B 106 ? O THR B 106 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PEG 201 ? 1 'binding site for residue PEG A 201' 
AC2 Software A PEG 202 ? 1 'binding site for residue PEG A 202' 
AC3 Software B EDO 201 ? 1 'binding site for residue EDO B 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 1 TYR A 107 ? TYR A 107 . ? 1_555 ? 
2 AC2 1 GLU B 40  ? GLU B 40  . ? 1_555 ? 
3 AC3 1 GLU B 32  ? GLU B 32  . ? 2_565 ? 
# 
_atom_sites.entry_id                    5K79 
_atom_sites.fract_transf_matrix[1][1]   0.010656 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013442 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.027398 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 1   ? -20.655 17.882 -18.012 1.00 30.99 ?  1   THR A N   1 
ATOM   2    C CA  . THR A 1 1   ? -20.824 16.547 -17.452 1.00 27.58 ?  1   THR A CA  1 
ATOM   3    C C   . THR A 1 1   ? -21.399 16.597 -16.034 1.00 27.78 ?  1   THR A C   1 
ATOM   4    O O   . THR A 1 1   ? -21.460 17.656 -15.398 1.00 27.78 ?  1   THR A O   1 
ATOM   5    C CB  . THR A 1 1   ? -19.494 15.763 -17.438 1.00 32.36 ?  1   THR A CB  1 
ATOM   6    O OG1 . THR A 1 1   ? -18.428 16.630 -17.032 1.00 34.78 ?  1   THR A OG1 1 
ATOM   7    C CG2 . THR A 1 1   ? -19.181 15.217 -18.823 1.00 34.06 ?  1   THR A CG2 1 
ATOM   8    N N   . GLY A 1 2   ? -21.827 15.442 -15.552 1.00 19.61 ?  2   GLY A N   1 
ATOM   9    C CA  . GLY A 1 2   ? -22.413 15.335 -14.230 1.00 14.43 ?  2   GLY A CA  1 
ATOM   10   C C   . GLY A 1 2   ? -23.735 16.075 -14.106 1.00 13.93 ?  2   GLY A C   1 
ATOM   11   O O   . GLY A 1 2   ? -24.572 16.044 -15.009 1.00 15.10 ?  2   GLY A O   1 
ATOM   12   N N   . GLN A 1 3   ? -23.913 16.716 -12.955 1.00 14.20 ?  3   GLN A N   1 
ATOM   13   C CA  . GLN A 1 3   ? -25.075 17.567 -12.660 1.00 13.09 ?  3   GLN A CA  1 
ATOM   14   C C   . GLN A 1 3   ? -26.410 16.843 -12.629 1.00 13.28 ?  3   GLN A C   1 
ATOM   15   O O   . GLN A 1 3   ? -27.436 17.428 -12.999 1.00 14.48 ?  3   GLN A O   1 
ATOM   16   C CB  . GLN A 1 3   ? -25.164 18.715 -13.662 1.00 15.18 ?  3   GLN A CB  1 
ATOM   17   C CG  . GLN A 1 3   ? -23.906 19.567 -13.676 1.00 13.93 ?  3   GLN A CG  1 
ATOM   18   C CD  . GLN A 1 3   ? -24.165 20.956 -14.194 1.00 15.35 ?  3   GLN A CD  1 
ATOM   19   O OE1 . GLN A 1 3   ? -24.871 21.137 -15.183 1.00 15.93 ?  3   GLN A OE1 1 
ATOM   20   N NE2 . GLN A 1 3   ? -23.601 21.958 -13.514 1.00 14.05 ?  3   GLN A NE2 1 
ATOM   21   N N   . PHE A 1 4   ? -26.423 15.597 -12.163 1.00 12.15 ?  4   PHE A N   1 
ATOM   22   C CA  . PHE A 1 4   ? -27.698 14.884 -12.041 1.00 12.83 ?  4   PHE A CA  1 
ATOM   23   C C   . PHE A 1 4   ? -28.752 15.649 -11.230 1.00 13.52 ?  4   PHE A C   1 
ATOM   24   O O   . PHE A 1 4   ? -29.938 15.490 -11.480 1.00 14.43 ?  4   PHE A O   1 
ATOM   25   C CB  . PHE A 1 4   ? -27.492 13.499 -11.414 1.00 12.82 ?  4   PHE A CB  1 
ATOM   26   C CG  . PHE A 1 4   ? -27.296 13.530 -9.934  1.00 12.08 ?  4   PHE A CG  1 
ATOM   27   C CD1 . PHE A 1 4   ? -26.054 13.814 -9.388  1.00 12.65 ?  4   PHE A CD1 1 
ATOM   28   C CD2 . PHE A 1 4   ? -28.358 13.278 -9.075  1.00 11.72 ?  4   PHE A CD2 1 
ATOM   29   C CE1 . PHE A 1 4   ? -25.880 13.858 -8.011  1.00 11.57 ?  4   PHE A CE1 1 
ATOM   30   C CE2 . PHE A 1 4   ? -28.183 13.326 -7.704  1.00 14.10 ?  4   PHE A CE2 1 
ATOM   31   C CZ  . PHE A 1 4   ? -26.947 13.606 -7.174  1.00 13.79 ?  4   PHE A CZ  1 
ATOM   32   N N   . SER A 1 5   ? -28.347 16.467 -10.259 1.00 12.63 ?  5   SER A N   1 
ATOM   33   C CA  . SER A 1 5   ? -29.351 17.056 -9.362  1.00 11.60 ?  5   SER A CA  1 
ATOM   34   C C   . SER A 1 5   ? -30.239 18.066 -10.082 1.00 14.33 ?  5   SER A C   1 
ATOM   35   O O   . SER A 1 5   ? -31.309 18.411 -9.588  1.00 15.54 ?  5   SER A O   1 
ATOM   36   C CB  . SER A 1 5   ? -28.695 17.725 -8.154  1.00 13.67 ?  5   SER A CB  1 
ATOM   37   O OG  . SER A 1 5   ? -27.979 18.888 -8.545  1.00 14.98 ?  5   SER A OG  1 
ATOM   38   N N   . LYS A 1 6   ? -29.800 18.546 -11.236 1.00 15.19 ?  6   LYS A N   1 
ATOM   39   C CA  . LYS A 1 6   ? -30.614 19.508 -11.973 1.00 15.26 ?  6   LYS A CA  1 
ATOM   40   C C   . LYS A 1 6   ? -31.884 18.886 -12.553 1.00 15.98 ?  6   LYS A C   1 
ATOM   41   O O   . LYS A 1 6   ? -32.862 19.595 -12.810 1.00 15.32 ?  6   LYS A O   1 
ATOM   42   C CB  . LYS A 1 6   ? -29.805 20.154 -13.096 1.00 15.95 ?  6   LYS A CB  1 
ATOM   43   C CG  . LYS A 1 6   ? -28.777 21.158 -12.607 1.00 14.49 ?  6   LYS A CG  1 
ATOM   44   C CD  . LYS A 1 6   ? -28.149 21.902 -13.778 1.00 16.22 ?  6   LYS A CD  1 
ATOM   45   C CE  . LYS A 1 6   ? -29.185 22.758 -14.476 1.00 16.27 ?  6   LYS A CE  1 
ATOM   46   N NZ  . LYS A 1 6   ? -28.558 23.784 -15.359 1.00 18.28 1  6   LYS A NZ  1 
ATOM   47   N N   . THR A 1 7   ? -31.878 17.569 -12.753 1.00 13.81 ?  7   THR A N   1 
ATOM   48   C CA  . THR A 1 7   ? -33.001 16.906 -13.412 1.00 15.04 ?  7   THR A CA  1 
ATOM   49   C C   . THR A 1 7   ? -33.455 15.670 -12.643 1.00 14.10 ?  7   THR A C   1 
ATOM   50   O O   . THR A 1 7   ? -34.135 14.809 -13.200 1.00 16.06 ?  7   THR A O   1 
ATOM   51   C CB  . THR A 1 7   ? -32.649 16.492 -14.866 1.00 15.09 ?  7   THR A CB  1 
ATOM   52   O OG1 . THR A 1 7   ? -31.453 15.697 -14.864 1.00 15.65 ?  7   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 7   ? -32.448 17.729 -15.750 1.00 17.07 ?  7   THR A CG2 1 
ATOM   54   N N   . CYS A 1 8   ? -33.064 15.579 -11.375 1.00 14.87 ?  8   CYS A N   1 
ATOM   55   C CA  . CYS A 1 8   ? -33.474 14.469 -10.523 1.00 15.32 ?  8   CYS A CA  1 
ATOM   56   C C   . CYS A 1 8   ? -34.116 15.002 -9.242  1.00 18.04 ?  8   CYS A C   1 
ATOM   57   O O   . CYS A 1 8   ? -33.713 16.051 -8.724  1.00 18.99 ?  8   CYS A O   1 
ATOM   58   C CB  . CYS A 1 8   ? -32.282 13.583 -10.189 1.00 14.01 ?  8   CYS A CB  1 
ATOM   59   S SG  . CYS A 1 8   ? -31.554 12.754 -11.617 1.00 15.41 ?  8   CYS A SG  1 
ATOM   60   N N   . GLU A 1 9   ? -35.097 14.262 -8.735  1.00 15.46 ?  9   GLU A N   1 
ATOM   61   C CA  . GLU A 1 9   ? -35.835 14.639 -7.533  1.00 16.88 ?  9   GLU A CA  1 
ATOM   62   C C   . GLU A 1 9   ? -35.787 13.564 -6.454  1.00 14.74 ?  9   GLU A C   1 
ATOM   63   O O   . GLU A 1 9   ? -35.465 12.411 -6.734  1.00 14.43 ?  9   GLU A O   1 
ATOM   64   C CB  . GLU A 1 9   ? -37.298 14.898 -7.873  1.00 23.12 ?  9   GLU A CB  1 
ATOM   65   C CG  . GLU A 1 9   ? -37.515 15.804 -9.042  1.00 30.22 ?  9   GLU A CG  1 
ATOM   66   C CD  . GLU A 1 9   ? -38.949 15.791 -9.466  1.00 31.57 ?  9   GLU A CD  1 
ATOM   67   O OE1 . GLU A 1 9   ? -39.813 15.756 -8.564  1.00 32.60 ?  9   GLU A OE1 1 
ATOM   68   O OE2 . GLU A 1 9   ? -39.210 15.806 -10.685 1.00 34.25 -1 9   GLU A OE2 1 
ATOM   69   N N   . ASP A 1 10  ? -36.164 13.942 -5.236  1.00 15.85 ?  10  ASP A N   1 
ATOM   70   C CA  . ASP A 1 10  ? -36.155 13.026 -4.097  1.00 16.08 ?  10  ASP A CA  1 
ATOM   71   C C   . ASP A 1 10  ? -34.847 12.242 -4.011  1.00 14.98 ?  10  ASP A C   1 
ATOM   72   O O   . ASP A 1 10  ? -34.828 11.010 -4.043  1.00 15.23 ?  10  ASP A O   1 
ATOM   73   C CB  . ASP A 1 10  ? -37.352 12.074 -4.177  1.00 12.60 ?  10  ASP A CB  1 
ATOM   74   C CG  . ASP A 1 10  ? -37.505 11.223 -2.930  1.00 17.16 ?  10  ASP A CG  1 
ATOM   75   O OD1 . ASP A 1 10  ? -36.984 11.632 -1.870  1.00 17.61 ?  10  ASP A OD1 1 
ATOM   76   O OD2 . ASP A 1 10  ? -38.166 10.165 -3.007  1.00 17.80 -1 10  ASP A OD2 1 
ATOM   77   N N   . ILE A 1 11  ? -33.750 12.979 -3.911  1.00 13.62 ?  11  ILE A N   1 
ATOM   78   C CA  . ILE A 1 11  ? -32.432 12.365 -3.873  1.00 14.52 ?  11  ILE A CA  1 
ATOM   79   C C   . ILE A 1 11  ? -32.162 11.834 -2.475  1.00 14.23 ?  11  ILE A C   1 
ATOM   80   O O   . ILE A 1 11  ? -32.309 12.563 -1.499  1.00 16.61 ?  11  ILE A O   1 
ATOM   81   C CB  . ILE A 1 11  ? -31.348 13.370 -4.295  1.00 13.92 ?  11  ILE A CB  1 
ATOM   82   C CG1 . ILE A 1 11  ? -31.637 13.890 -5.706  1.00 14.93 ?  11  ILE A CG1 1 
ATOM   83   C CG2 . ILE A 1 11  ? -29.960 12.728 -4.227  1.00 13.84 ?  11  ILE A CG2 1 
ATOM   84   C CD1 . ILE A 1 11  ? -30.904 15.193 -6.038  1.00 17.02 ?  11  ILE A CD1 1 
ATOM   85   N N   . THR A 1 12  ? -31.786 10.560 -2.377  1.00 14.97 ?  12  THR A N   1 
ATOM   86   C CA  . THR A 1 12  ? -31.580 9.911  -1.077  1.00 13.78 ?  12  THR A CA  1 
ATOM   87   C C   . THR A 1 12  ? -30.360 9.003  -1.061  1.00 14.39 ?  12  THR A C   1 
ATOM   88   O O   . THR A 1 12  ? -29.859 8.609  -2.111  1.00 13.73 ?  12  THR A O   1 
ATOM   89   C CB  . THR A 1 12  ? -32.787 9.055  -0.673  1.00 17.54 ?  12  THR A CB  1 
ATOM   90   O OG1 . THR A 1 12  ? -32.963 8.003  -1.634  1.00 16.57 ?  12  THR A OG1 1 
ATOM   91   C CG2 . THR A 1 12  ? -34.040 9.901  -0.614  1.00 15.99 ?  12  THR A CG2 1 
ATOM   92   N N   . LEU A 1 13  ? -29.920 8.645  0.142   1.00 13.89 ?  13  LEU A N   1 
ATOM   93   C CA  . LEU A 1 13  ? -28.821 7.711  0.312   1.00 14.76 ?  13  LEU A CA  1 
ATOM   94   C C   . LEU A 1 13  ? -29.213 6.621  1.301   1.00 16.75 ?  13  LEU A C   1 
ATOM   95   O O   . LEU A 1 13  ? -29.740 6.901  2.377   1.00 20.27 ?  13  LEU A O   1 
ATOM   96   C CB  . LEU A 1 13  ? -27.575 8.444  0.801   1.00 15.76 ?  13  LEU A CB  1 
ATOM   97   C CG  . LEU A 1 13  ? -26.313 7.608  1.001   1.00 16.06 ?  13  LEU A CG  1 
ATOM   98   C CD1 . LEU A 1 13  ? -25.697 7.265  -0.348  1.00 15.88 ?  13  LEU A CD1 1 
ATOM   99   C CD2 . LEU A 1 13  ? -25.320 8.363  1.863   1.00 19.01 ?  13  LEU A CD2 1 
ATOM   100  N N   . ASP A 1 14  ? -28.963 5.379  0.914   1.00 15.68 ?  14  ASP A N   1 
ATOM   101  C CA  . ASP A 1 14  ? -29.156 4.229  1.787   1.00 16.92 ?  14  ASP A CA  1 
ATOM   102  C C   . ASP A 1 14  ? -27.850 3.452  1.738   1.00 19.28 ?  14  ASP A C   1 
ATOM   103  O O   . ASP A 1 14  ? -27.496 2.908  0.694   1.00 18.55 ?  14  ASP A O   1 
ATOM   104  C CB  . ASP A 1 14  ? -30.337 3.374  1.318   1.00 20.45 ?  14  ASP A CB  1 
ATOM   105  C CG  . ASP A 1 14  ? -30.668 2.244  2.281   1.00 25.14 ?  14  ASP A CG  1 
ATOM   106  O OD1 . ASP A 1 14  ? -29.973 2.097  3.303   1.00 30.11 ?  14  ASP A OD1 1 
ATOM   107  O OD2 . ASP A 1 14  ? -31.626 1.493  2.001   1.00 37.20 -1 14  ASP A OD2 1 
ATOM   108  N N   . GLY A 1 15  ? -27.124 3.421  2.852   1.00 22.57 ?  15  GLY A N   1 
ATOM   109  C CA  . GLY A 1 15  ? -25.801 2.825  2.853   1.00 19.48 ?  15  GLY A CA  1 
ATOM   110  C C   . GLY A 1 15  ? -24.912 3.631  1.924   1.00 15.06 ?  15  GLY A C   1 
ATOM   111  O O   . GLY A 1 15  ? -24.714 4.823  2.135   1.00 20.76 ?  15  GLY A O   1 
ATOM   112  N N   . SER A 1 16  ? -24.389 2.991  0.884   1.00 15.58 ?  16  SER A N   1 
ATOM   113  C CA  . SER A 1 16  ? -23.585 3.716  -0.089  1.00 16.23 ?  16  SER A CA  1 
ATOM   114  C C   . SER A 1 16  ? -24.332 3.887  -1.407  1.00 17.59 ?  16  SER A C   1 
ATOM   115  O O   . SER A 1 16  ? -23.752 4.315  -2.393  1.00 16.03 ?  16  SER A O   1 
ATOM   116  C CB  . SER A 1 16  ? -22.255 3.003  -0.321  1.00 20.00 ?  16  SER A CB  1 
ATOM   117  O OG  . SER A 1 16  ? -22.479 1.696  -0.807  1.00 22.60 ?  16  SER A OG  1 
ATOM   118  N N   . THR A 1 17  ? -25.621 3.566  -1.420  1.00 14.96 ?  17  THR A N   1 
ATOM   119  C CA  . THR A 1 17  ? -26.377 3.625  -2.665  1.00 14.48 ?  17  THR A CA  1 
ATOM   120  C C   . THR A 1 17  ? -27.180 4.915  -2.739  1.00 16.76 ?  17  THR A C   1 
ATOM   121  O O   . THR A 1 17  ? -28.057 5.174  -1.912  1.00 18.41 ?  17  THR A O   1 
ATOM   122  C CB  . THR A 1 17  ? -27.319 2.429  -2.811  1.00 17.96 ?  17  THR A CB  1 
ATOM   123  O OG1 . THR A 1 17  ? -26.546 1.224  -2.818  1.00 20.94 ?  17  THR A OG1 1 
ATOM   124  C CG2 . THR A 1 17  ? -28.115 2.523  -4.119  1.00 19.84 ?  17  THR A CG2 1 
ATOM   125  N N   . LEU A 1 18  ? -26.860 5.714  -3.748  1.00 13.77 ?  18  LEU A N   1 
ATOM   126  C CA  . LEU A 1 18  ? -27.565 6.956  -4.024  1.00 12.27 ?  18  LEU A CA  1 
ATOM   127  C C   . LEU A 1 18  ? -28.764 6.671  -4.911  1.00 13.42 ?  18  LEU A C   1 
ATOM   128  O O   . LEU A 1 18  ? -28.612 6.029  -5.942  1.00 15.63 ?  18  LEU A O   1 
ATOM   129  C CB  . LEU A 1 18  ? -26.620 7.936  -4.721  1.00 12.99 ?  18  LEU A CB  1 
ATOM   130  C CG  . LEU A 1 18  ? -27.153 9.331  -5.042  1.00 13.29 ?  18  LEU A CG  1 
ATOM   131  C CD1 . LEU A 1 18  ? -27.290 10.162 -3.779  1.00 16.72 ?  18  LEU A CD1 1 
ATOM   132  C CD2 . LEU A 1 18  ? -26.240 10.028 -6.039  1.00 16.61 ?  18  LEU A CD2 1 
ATOM   133  N N   . SER A 1 19  ? -29.948 7.138  -4.522  1.00 12.69 ?  19  SER A N   1 
ATOM   134  C CA  . SER A 1 19  ? -31.136 6.961  -5.363  1.00 15.35 ?  19  SER A CA  1 
ATOM   135  C C   . SER A 1 19  ? -31.829 8.280  -5.642  1.00 13.33 ?  19  SER A C   1 
ATOM   136  O O   . SER A 1 19  ? -31.673 9.258  -4.904  1.00 13.67 ?  19  SER A O   1 
ATOM   137  C CB  . SER A 1 19  ? -32.148 5.997  -4.719  1.00 17.79 ?  19  SER A CB  1 
ATOM   138  O OG  . SER A 1 19  ? -31.607 4.699  -4.547  1.00 20.73 ?  19  SER A OG  1 
ATOM   139  N N   . ALA A 1 20  ? -32.593 8.306  -6.727  1.00 13.85 ?  20  ALA A N   1 
ATOM   140  C CA  . ALA A 1 20  ? -33.372 9.486  -7.079  1.00 12.55 ?  20  ALA A CA  1 
ATOM   141  C C   . ALA A 1 20  ? -34.453 9.119  -8.086  1.00 14.38 ?  20  ALA A C   1 
ATOM   142  O O   . ALA A 1 20  ? -34.490 7.999  -8.605  1.00 14.09 ?  20  ALA A O   1 
ATOM   143  C CB  . ALA A 1 20  ? -32.474 10.588 -7.649  1.00 13.48 ?  20  ALA A CB  1 
ATOM   144  N N   . PHE A 1 21  ? -35.337 10.071 -8.348  1.00 13.10 ?  21  PHE A N   1 
ATOM   145  C CA  . PHE A 1 21  ? -36.282 9.955  -9.449  1.00 13.19 ?  21  PHE A CA  1 
ATOM   146  C C   . PHE A 1 21  ? -35.866 10.948 -10.514 1.00 15.42 ?  21  PHE A C   1 
ATOM   147  O O   . PHE A 1 21  ? -35.967 12.160 -10.313 1.00 14.64 ?  21  PHE A O   1 
ATOM   148  C CB  . PHE A 1 21  ? -37.715 10.215 -8.976  1.00 12.40 ?  21  PHE A CB  1 
ATOM   149  C CG  . PHE A 1 21  ? -38.255 9.139  -8.074  1.00 14.65 ?  21  PHE A CG  1 
ATOM   150  C CD1 . PHE A 1 21  ? -37.873 9.075  -6.743  1.00 15.40 ?  21  PHE A CD1 1 
ATOM   151  C CD2 . PHE A 1 21  ? -39.134 8.188  -8.557  1.00 16.50 ?  21  PHE A CD2 1 
ATOM   152  C CE1 . PHE A 1 21  ? -38.359 8.085  -5.911  1.00 16.45 ?  21  PHE A CE1 1 
ATOM   153  C CE2 . PHE A 1 21  ? -39.628 7.198  -7.725  1.00 15.86 ?  21  PHE A CE2 1 
ATOM   154  C CZ  . PHE A 1 21  ? -39.236 7.146  -6.406  1.00 14.81 ?  21  PHE A CZ  1 
ATOM   155  N N   . CYS A 1 22  ? -35.376 10.439 -11.636 1.00 13.15 ?  22  CYS A N   1 
ATOM   156  C CA  . CYS A 1 22  ? -34.764 11.299 -12.641 1.00 13.24 ?  22  CYS A CA  1 
ATOM   157  C C   . CYS A 1 22  ? -35.584 11.430 -13.911 1.00 15.06 ?  22  CYS A C   1 
ATOM   158  O O   . CYS A 1 22  ? -36.227 10.474 -14.360 1.00 15.25 ?  22  CYS A O   1 
ATOM   159  C CB  . CYS A 1 22  ? -33.369 10.791 -13.012 1.00 13.81 ?  22  CYS A CB  1 
ATOM   160  S SG  . CYS A 1 22  ? -32.143 10.806 -11.664 1.00 15.57 ?  22  CYS A SG  1 
ATOM   161  N N   . GLN A 1 23  ? -35.535 12.624 -14.487 1.00 12.61 ?  23  GLN A N   1 
ATOM   162  C CA  . GLN A 1 23  ? -36.212 12.890 -15.751 1.00 14.60 ?  23  GLN A CA  1 
ATOM   163  C C   . GLN A 1 23  ? -35.569 12.125 -16.891 1.00 15.86 ?  23  GLN A C   1 
ATOM   164  O O   . GLN A 1 23  ? -34.350 12.153 -17.053 1.00 17.54 ?  23  GLN A O   1 
ATOM   165  C CB  . GLN A 1 23  ? -36.186 14.373 -16.084 1.00 16.89 ?  23  GLN A CB  1 
ATOM   166  C CG  . GLN A 1 23  ? -36.950 15.245 -15.127 1.00 19.55 ?  23  GLN A CG  1 
ATOM   167  C CD  . GLN A 1 23  ? -36.495 16.678 -15.221 1.00 22.43 ?  23  GLN A CD  1 
ATOM   168  O OE1 . GLN A 1 23  ? -35.901 17.080 -16.220 1.00 27.89 ?  23  GLN A OE1 1 
ATOM   169  N NE2 . GLN A 1 23  ? -36.786 17.464 -14.193 1.00 30.77 ?  23  GLN A NE2 1 
ATOM   170  N N   . LYS A 1 24  ? -36.392 11.476 -17.710 1.00 16.49 ?  24  LYS A N   1 
ATOM   171  C CA  . LYS A 1 24  ? -35.886 10.906 -18.948 1.00 15.91 ?  24  LYS A CA  1 
ATOM   172  C C   . LYS A 1 24  ? -35.637 12.018 -19.972 1.00 17.12 ?  24  LYS A C   1 
ATOM   173  O O   . LYS A 1 24  ? -35.864 13.193 -19.685 1.00 17.42 ?  24  LYS A O   1 
ATOM   174  C CB  . LYS A 1 24  ? -36.845 9.856  -19.486 1.00 18.38 ?  24  LYS A CB  1 
ATOM   175  C CG  . LYS A 1 24  ? -36.985 8.644  -18.566 1.00 17.42 ?  24  LYS A CG  1 
ATOM   176  C CD  . LYS A 1 24  ? -37.660 7.482  -19.289 1.00 18.99 ?  24  LYS A CD  1 
ATOM   177  C CE  . LYS A 1 24  ? -37.350 6.155  -18.633 1.00 32.92 ?  24  LYS A CE  1 
ATOM   178  N NZ  . LYS A 1 24  ? -37.557 5.027  -19.588 1.00 40.75 1  24  LYS A NZ  1 
ATOM   179  N N   . ALA A 1 25  ? -35.176 11.644 -21.163 1.00 16.53 ?  25  ALA A N   1 
ATOM   180  C CA  . ALA A 1 25  ? -34.826 12.622 -22.193 1.00 22.66 ?  25  ALA A CA  1 
ATOM   181  C C   . ALA A 1 25  ? -35.963 13.588 -22.567 1.00 20.27 ?  25  ALA A C   1 
ATOM   182  O O   . ALA A 1 25  ? -35.706 14.702 -23.013 1.00 22.24 ?  25  ALA A O   1 
ATOM   183  C CB  . ALA A 1 25  ? -34.327 11.895 -23.440 1.00 26.32 ?  25  ALA A CB  1 
ATOM   184  N N   . ASP A 1 26  ? -37.214 13.180 -22.385 1.00 20.05 ?  26  ASP A N   1 
ATOM   185  C CA  . ASP A 1 26  ? -38.328 14.062 -22.734 1.00 21.67 ?  26  ASP A CA  1 
ATOM   186  C C   . ASP A 1 26  ? -38.515 15.201 -21.731 1.00 24.98 ?  26  ASP A C   1 
ATOM   187  O O   . ASP A 1 26  ? -39.297 16.123 -21.961 1.00 25.95 ?  26  ASP A O   1 
ATOM   188  C CB  . ASP A 1 26  ? -39.637 13.257 -22.894 1.00 23.10 ?  26  ASP A CB  1 
ATOM   189  C CG  . ASP A 1 26  ? -40.072 12.535 -21.617 1.00 23.16 ?  26  ASP A CG  1 
ATOM   190  O OD1 . ASP A 1 26  ? -39.565 12.839 -20.522 1.00 21.07 ?  26  ASP A OD1 1 
ATOM   191  O OD2 . ASP A 1 26  ? -40.941 11.645 -21.716 1.00 25.15 -1 26  ASP A OD2 1 
ATOM   192  N N   . GLY A 1 27  ? -37.795 15.135 -20.618 1.00 20.76 ?  27  GLY A N   1 
ATOM   193  C CA  . GLY A 1 27  ? -37.837 16.188 -19.627 1.00 21.91 ?  27  GLY A CA  1 
ATOM   194  C C   . GLY A 1 27  ? -38.939 16.104 -18.585 1.00 20.95 ?  27  GLY A C   1 
ATOM   195  O O   . GLY A 1 27  ? -39.042 16.992 -17.746 1.00 25.86 ?  27  GLY A O   1 
ATOM   196  N N   . TYR A 1 28  ? -39.763 15.058 -18.608 1.00 19.62 ?  28  TYR A N   1 
ATOM   197  C CA  . TYR A 1 28  ? -40.817 14.963 -17.596 1.00 23.03 ?  28  TYR A CA  1 
ATOM   198  C C   . TYR A 1 28  ? -41.117 13.543 -17.124 1.00 18.93 ?  28  TYR A C   1 
ATOM   199  O O   . TYR A 1 28  ? -41.576 13.361 -16.003 1.00 20.27 ?  28  TYR A O   1 
ATOM   200  C CB  . TYR A 1 28  ? -42.112 15.608 -18.103 1.00 27.06 ?  28  TYR A CB  1 
ATOM   201  C CG  . TYR A 1 28  ? -42.644 15.015 -19.382 1.00 25.52 ?  28  TYR A CG  1 
ATOM   202  C CD1 . TYR A 1 28  ? -43.484 13.908 -19.365 1.00 28.66 ?  28  TYR A CD1 1 
ATOM   203  C CD2 . TYR A 1 28  ? -42.317 15.570 -20.611 1.00 28.91 ?  28  TYR A CD2 1 
ATOM   204  C CE1 . TYR A 1 28  ? -43.971 13.361 -20.542 1.00 30.95 ?  28  TYR A CE1 1 
ATOM   205  C CE2 . TYR A 1 28  ? -42.801 15.033 -21.791 1.00 31.36 ?  28  TYR A CE2 1 
ATOM   206  C CZ  . TYR A 1 28  ? -43.625 13.933 -21.751 1.00 29.88 ?  28  TYR A CZ  1 
ATOM   207  O OH  . TYR A 1 28  ? -44.107 13.402 -22.927 1.00 39.06 ?  28  TYR A OH  1 
ATOM   208  N N   . THR A 1 29  ? -40.869 12.543 -17.962 1.00 18.96 ?  29  THR A N   1 
ATOM   209  C CA  . THR A 1 29  ? -41.047 11.159 -17.534 1.00 16.33 ?  29  THR A CA  1 
ATOM   210  C C   . THR A 1 29  ? -40.033 10.818 -16.451 1.00 16.19 ?  29  THR A C   1 
ATOM   211  O O   . THR A 1 29  ? -38.831 10.912 -16.679 1.00 16.97 ?  29  THR A O   1 
ATOM   212  C CB  . THR A 1 29  ? -40.893 10.183 -18.710 1.00 18.20 ?  29  THR A CB  1 
ATOM   213  O OG1 . THR A 1 29  ? -41.912 10.462 -19.682 1.00 19.25 ?  29  THR A OG1 1 
ATOM   214  C CG2 . THR A 1 29  ? -41.033 8.752  -18.235 1.00 16.96 ?  29  THR A CG2 1 
ATOM   215  N N   . LEU A 1 30  ? -40.518 10.426 -15.278 1.00 14.19 ?  30  LEU A N   1 
ATOM   216  C CA  . LEU A 1 30  ? -39.640 10.103 -14.159 1.00 14.33 ?  30  LEU A CA  1 
ATOM   217  C C   . LEU A 1 30  ? -39.244 8.628  -14.131 1.00 16.74 ?  30  LEU A C   1 
ATOM   218  O O   . LEU A 1 30  ? -40.006 7.745  -14.538 1.00 16.66 ?  30  LEU A O   1 
ATOM   219  C CB  . LEU A 1 30  ? -40.306 10.504 -12.839 1.00 14.97 ?  30  LEU A CB  1 
ATOM   220  C CG  . LEU A 1 30  ? -40.478 12.018 -12.646 1.00 15.93 ?  30  LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 30  ? -41.170 12.321 -11.324 1.00 18.21 ?  30  LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 30  ? -39.129 12.728 -12.712 1.00 16.50 ?  30  LEU A CD2 1 
ATOM   223  N N   . ASN A 1 31  ? -38.023 8.377  -13.664 1.00 14.31 ?  31  ASN A N   1 
ATOM   224  C CA  . ASN A 1 31  ? -37.489 7.029  -13.561 1.00 15.35 ?  31  ASN A CA  1 
ATOM   225  C C   . ASN A 1 31  ? -36.754 6.863  -12.240 1.00 15.82 ?  31  ASN A C   1 
ATOM   226  O O   . ASN A 1 31  ? -35.829 7.625  -11.936 1.00 16.41 ?  31  ASN A O   1 
ATOM   227  C CB  . ASN A 1 31  ? -36.540 6.730  -14.727 1.00 14.81 ?  31  ASN A CB  1 
ATOM   228  C CG  . ASN A 1 31  ? -35.983 5.319  -14.685 1.00 18.94 ?  31  ASN A CG  1 
ATOM   229  O OD1 . ASN A 1 31  ? -36.712 4.355  -14.889 1.00 19.78 ?  31  ASN A OD1 1 
ATOM   230  N ND2 . ASN A 1 31  ? -34.679 5.192  -14.431 1.00 18.33 ?  31  ASN A ND2 1 
ATOM   231  N N   . GLU A 1 32  ? -37.158 5.877  -11.453 1.00 13.85 ?  32  GLU A N   1 
ATOM   232  C CA  . GLU A 1 32  ? -36.453 5.598  -10.215 1.00 14.15 ?  32  GLU A CA  1 
ATOM   233  C C   . GLU A 1 32  ? -35.143 4.905  -10.558 1.00 16.23 ?  32  GLU A C   1 
ATOM   234  O O   . GLU A 1 32  ? -35.126 3.899  -11.277 1.00 16.56 ?  32  GLU A O   1 
ATOM   235  C CB  . GLU A 1 32  ? -37.297 4.735  -9.274  1.00 16.44 ?  32  GLU A CB  1 
ATOM   236  C CG  . GLU A 1 32  ? -36.681 4.655  -7.886  1.00 18.86 ?  32  GLU A CG  1 
ATOM   237  C CD  . GLU A 1 32  ? -37.467 3.786  -6.929  1.00 26.39 ?  32  GLU A CD  1 
ATOM   238  O OE1 . GLU A 1 32  ? -38.215 2.892  -7.398  1.00 24.79 ?  32  GLU A OE1 1 
ATOM   239  O OE2 . GLU A 1 32  ? -37.343 4.017  -5.704  1.00 29.41 -1 32  GLU A OE2 1 
ATOM   240  N N   . THR A 1 33  ? -34.050 5.455  -10.043 1.00 12.43 ?  33  THR A N   1 
ATOM   241  C CA  . THR A 1 33  ? -32.716 5.010  -10.418 1.00 12.41 ?  33  THR A CA  1 
ATOM   242  C C   . THR A 1 33  ? -31.790 5.040  -9.202  1.00 15.99 ?  33  THR A C   1 
ATOM   243  O O   . THR A 1 33  ? -31.996 5.825  -8.272  1.00 13.58 ?  33  THR A O   1 
ATOM   244  C CB  . THR A 1 33  ? -32.166 5.889  -11.568 1.00 13.61 ?  33  THR A CB  1 
ATOM   245  O OG1 . THR A 1 33  ? -30.817 5.512  -11.896 1.00 15.41 ?  33  THR A OG1 1 
ATOM   246  C CG2 . THR A 1 33  ? -32.231 7.363  -11.191 1.00 14.28 ?  33  THR A CG2 1 
ATOM   247  N N   . SER A 1 34  ? -30.794 4.159  -9.204  1.00 13.90 ?  34  SER A N   1 
ATOM   248  C CA  A SER A 1 34  ? -29.840 4.090  -8.107  0.39 13.69 ?  34  SER A CA  1 
ATOM   249  C CA  B SER A 1 34  ? -29.846 4.054  -8.099  0.61 13.65 ?  34  SER A CA  1 
ATOM   250  C C   . SER A 1 34  ? -28.430 3.892  -8.633  1.00 14.90 ?  34  SER A C   1 
ATOM   251  O O   . SER A 1 34  ? -28.229 3.420  -9.750  1.00 14.35 ?  34  SER A O   1 
ATOM   252  C CB  A SER A 1 34  ? -30.195 2.959  -7.146  0.39 16.94 ?  34  SER A CB  1 
ATOM   253  C CB  B SER A 1 34  ? -30.188 2.871  -7.184  0.61 16.96 ?  34  SER A CB  1 
ATOM   254  O OG  A SER A 1 34  ? -29.995 1.700  -7.760  0.39 16.76 ?  34  SER A OG  1 
ATOM   255  O OG  B SER A 1 34  ? -31.432 3.046  -6.518  0.61 16.94 ?  34  SER A OG  1 
ATOM   256  N N   . ILE A 1 35  ? -27.457 4.274  -7.825  1.00 13.66 ?  35  ILE A N   1 
ATOM   257  C CA  . ILE A 1 35  ? -26.063 4.095  -8.211  1.00 13.43 ?  35  ILE A CA  1 
ATOM   258  C C   . ILE A 1 35  ? -25.249 3.864  -6.938  1.00 13.69 ?  35  ILE A C   1 
ATOM   259  O O   . ILE A 1 35  ? -25.483 4.508  -5.920  1.00 13.71 ?  35  ILE A O   1 
ATOM   260  C CB  . ILE A 1 35  ? -25.567 5.309  -9.026  1.00 13.18 ?  35  ILE A CB  1 
ATOM   261  C CG1 . ILE A 1 35  ? -24.225 5.018  -9.703  1.00 12.98 ?  35  ILE A CG1 1 
ATOM   262  C CG2 . ILE A 1 35  ? -25.538 6.577  -8.174  1.00 15.82 ?  35  ILE A CG2 1 
ATOM   263  C CD1 . ILE A 1 35  ? -23.820 6.060  -10.758 1.00 16.00 ?  35  ILE A CD1 1 
ATOM   264  N N   . ASN A 1 36  ? -24.338 2.894  -6.981  1.00 13.83 ?  36  ASN A N   1 
ATOM   265  C CA  . ASN A 1 36  ? -23.559 2.538  -5.803  1.00 13.12 ?  36  ASN A CA  1 
ATOM   266  C C   . ASN A 1 36  ? -22.299 3.391  -5.720  1.00 13.10 ?  36  ASN A C   1 
ATOM   267  O O   . ASN A 1 36  ? -21.397 3.249  -6.544  1.00 14.56 ?  36  ASN A O   1 
ATOM   268  C CB  . ASN A 1 36  ? -23.194 1.051  -5.839  1.00 15.96 ?  36  ASN A CB  1 
ATOM   269  C CG  . ASN A 1 36  ? -22.562 0.571  -4.540  1.00 17.43 ?  36  ASN A CG  1 
ATOM   270  O OD1 . ASN A 1 36  ? -22.070 1.367  -3.741  1.00 18.94 ?  36  ASN A OD1 1 
ATOM   271  N ND2 . ASN A 1 36  ? -22.557 -0.740 -4.336  1.00 26.05 ?  36  ASN A ND2 1 
ATOM   272  N N   . LEU A 1 37  ? -22.249 4.270  -4.726  1.00 12.74 ?  37  LEU A N   1 
ATOM   273  C CA  . LEU A 1 37  ? -21.129 5.198  -4.586  1.00 12.47 ?  37  LEU A CA  1 
ATOM   274  C C   . LEU A 1 37  ? -19.818 4.518  -4.220  1.00 14.87 ?  37  LEU A C   1 
ATOM   275  O O   . LEU A 1 37  ? -18.752 5.068  -4.480  1.00 13.40 ?  37  LEU A O   1 
ATOM   276  C CB  . LEU A 1 37  ? -21.462 6.272  -3.544  1.00 14.31 ?  37  LEU A CB  1 
ATOM   277  C CG  . LEU A 1 37  ? -22.679 7.128  -3.912  1.00 12.29 ?  37  LEU A CG  1 
ATOM   278  C CD1 . LEU A 1 37  ? -22.925 8.187  -2.846  1.00 14.12 ?  37  LEU A CD1 1 
ATOM   279  C CD2 . LEU A 1 37  ? -22.495 7.767  -5.286  1.00 14.10 ?  37  LEU A CD2 1 
ATOM   280  N N   . ASP A 1 38  ? -19.880 3.321  -3.646  1.00 13.72 ?  38  ASP A N   1 
ATOM   281  C CA  . ASP A 1 38  ? -18.650 2.589  -3.350  1.00 13.39 ?  38  ASP A CA  1 
ATOM   282  C C   . ASP A 1 38  ? -17.892 2.206  -4.612  1.00 15.19 ?  38  ASP A C   1 
ATOM   283  O O   . ASP A 1 38  ? -16.697 1.919  -4.557  1.00 14.73 ?  38  ASP A O   1 
ATOM   284  C CB  . ASP A 1 38  ? -18.951 1.331  -2.527  1.00 13.93 ?  38  ASP A CB  1 
ATOM   285  C CG  . ASP A 1 38  ? -18.861 1.572  -1.036  1.00 17.00 ?  38  ASP A CG  1 
ATOM   286  O OD1 . ASP A 1 38  ? -18.100 2.465  -0.614  1.00 16.54 ?  38  ASP A OD1 1 
ATOM   287  O OD2 . ASP A 1 38  ? -19.587 0.889  -0.278  1.00 19.62 -1 38  ASP A OD2 1 
ATOM   288  N N   . GLU A 1 39  ? -18.577 2.189  -5.750  1.00 13.27 ?  39  GLU A N   1 
ATOM   289  C CA  . GLU A 1 39  ? -17.923 1.787  -6.987  1.00 12.78 ?  39  GLU A CA  1 
ATOM   290  C C   . GLU A 1 39  ? -16.937 2.834  -7.512  1.00 15.32 ?  39  GLU A C   1 
ATOM   291  O O   . GLU A 1 39  ? -15.986 2.472  -8.188  1.00 17.02 ?  39  GLU A O   1 
ATOM   292  C CB  . GLU A 1 39  ? -18.984 1.425  -8.035  1.00 15.84 ?  39  GLU A CB  1 
ATOM   293  C CG  . GLU A 1 39  ? -19.614 0.071  -7.708  1.00 15.51 ?  39  GLU A CG  1 
ATOM   294  C CD  . GLU A 1 39  ? -20.879 -0.249 -8.490  1.00 18.52 ?  39  GLU A CD  1 
ATOM   295  O OE1 . GLU A 1 39  ? -21.244 0.497  -9.417  1.00 20.49 ?  39  GLU A OE1 1 
ATOM   296  O OE2 . GLU A 1 39  ? -21.481 -1.296 -8.188  1.00 20.84 -1 39  GLU A OE2 1 
ATOM   297  N N   . GLU A 1 40  ? -17.140 4.116  -7.199  1.00 13.23 ?  40  GLU A N   1 
ATOM   298  C CA  . GLU A 1 40  ? -16.246 5.153  -7.729  1.00 14.96 ?  40  GLU A CA  1 
ATOM   299  C C   . GLU A 1 40  ? -15.837 6.223  -6.727  1.00 13.14 ?  40  GLU A C   1 
ATOM   300  O O   . GLU A 1 40  ? -15.276 7.247  -7.113  1.00 16.26 ?  40  GLU A O   1 
ATOM   301  C CB  . GLU A 1 40  ? -16.884 5.842  -8.941  1.00 16.62 ?  40  GLU A CB  1 
ATOM   302  C CG  . GLU A 1 40  ? -16.995 4.956  -10.183 1.00 17.44 ?  40  GLU A CG  1 
ATOM   303  C CD  . GLU A 1 40  ? -15.655 4.523  -10.747 1.00 22.05 ?  40  GLU A CD  1 
ATOM   304  O OE1 . GLU A 1 40  ? -14.610 5.083  -10.354 1.00 22.81 ?  40  GLU A OE1 1 
ATOM   305  O OE2 . GLU A 1 40  ? -15.649 3.594  -11.585 1.00 25.16 -1 40  GLU A OE2 1 
ATOM   306  N N   . ILE A 1 41  ? -16.111 5.996  -5.446  1.00 12.02 ?  41  ILE A N   1 
ATOM   307  C CA  . ILE A 1 41  ? -15.615 6.896  -4.410  1.00 12.24 ?  41  ILE A CA  1 
ATOM   308  C C   . ILE A 1 41  ? -14.874 6.096  -3.353  1.00 13.90 ?  41  ILE A C   1 
ATOM   309  O O   . ILE A 1 41  ? -15.394 5.119  -2.815  1.00 15.13 ?  41  ILE A O   1 
ATOM   310  C CB  . ILE A 1 41  ? -16.755 7.715  -3.756  1.00 11.87 ?  41  ILE A CB  1 
ATOM   311  C CG1 . ILE A 1 41  ? -17.438 8.578  -4.815  1.00 12.40 ?  41  ILE A CG1 1 
ATOM   312  C CG2 . ILE A 1 41  ? -16.215 8.578  -2.608  1.00 14.59 ?  41  ILE A CG2 1 
ATOM   313  C CD1 . ILE A 1 41  ? -18.671 9.335  -4.314  1.00 13.27 ?  41  ILE A CD1 1 
ATOM   314  N N   . GLY A 1 42  ? -13.647 6.506  -3.082  1.00 12.96 ?  42  GLY A N   1 
ATOM   315  C CA  . GLY A 1 42  ? -12.851 5.869  -2.059  1.00 14.30 ?  42  GLY A CA  1 
ATOM   316  C C   . GLY A 1 42  ? -12.374 6.852  -1.014  1.00 15.16 ?  42  GLY A C   1 
ATOM   317  O O   . GLY A 1 42  ? -12.654 8.049  -1.065  1.00 14.74 ?  42  GLY A O   1 
ATOM   318  N N   . ASN A 1 43  ? -11.632 6.322  -0.050  1.00 16.05 ?  43  ASN A N   1 
ATOM   319  C CA  . ASN A 1 43  ? -11.091 7.126  1.029   1.00 15.33 ?  43  ASN A CA  1 
ATOM   320  C C   . ASN A 1 43  ? -9.583  7.200  0.891   1.00 15.42 ?  43  ASN A C   1 
ATOM   321  O O   . ASN A 1 43  ? -8.890  6.213  1.103   1.00 19.42 ?  43  ASN A O   1 
ATOM   322  C CB  . ASN A 1 43  ? -11.498 6.538  2.377   1.00 13.42 ?  43  ASN A CB  1 
ATOM   323  C CG  . ASN A 1 43  ? -10.772 7.184  3.540   1.00 15.03 ?  43  ASN A CG  1 
ATOM   324  O OD1 . ASN A 1 43  ? -10.162 8.243  3.398   1.00 16.82 ?  43  ASN A OD1 1 
ATOM   325  N ND2 . ASN A 1 43  ? -10.843 6.545  4.702   1.00 17.39 ?  43  ASN A ND2 1 
ATOM   326  N N   . LEU A 1 44  ? -9.079  8.371  0.507   1.00 16.06 ?  44  LEU A N   1 
ATOM   327  C CA  . LEU A 1 44  ? -7.643  8.592  0.411   1.00 16.07 ?  44  LEU A CA  1 
ATOM   328  C C   . LEU A 1 44  ? -7.150  9.411  1.605   1.00 16.72 ?  44  LEU A C   1 
ATOM   329  O O   . LEU A 1 44  ? -7.283  10.636 1.620   1.00 16.72 ?  44  LEU A O   1 
ATOM   330  C CB  . LEU A 1 44  ? -7.295  9.293  -0.906  1.00 18.20 ?  44  LEU A CB  1 
ATOM   331  C CG  . LEU A 1 44  ? -5.808  9.468  -1.225  1.00 23.00 ?  44  LEU A CG  1 
ATOM   332  C CD1 . LEU A 1 44  ? -5.184  8.135  -1.595  1.00 29.38 ?  44  LEU A CD1 1 
ATOM   333  C CD2 . LEU A 1 44  ? -5.602  10.485 -2.343  1.00 30.11 ?  44  LEU A CD2 1 
ATOM   334  N N   . ASP A 1 45  ? -6.609  8.718  2.610   1.00 15.62 ?  45  ASP A N   1 
ATOM   335  C CA  . ASP A 1 45  ? -6.071  9.354  3.817   1.00 17.77 ?  45  ASP A CA  1 
ATOM   336  C C   . ASP A 1 45  ? -7.071  10.351 4.408   1.00 15.47 ?  45  ASP A C   1 
ATOM   337  O O   . ASP A 1 45  ? -6.705  11.459 4.779   1.00 16.28 ?  45  ASP A O   1 
ATOM   338  C CB  . ASP A 1 45  ? -4.732  10.044 3.499   1.00 20.06 ?  45  ASP A CB  1 
ATOM   339  C CG  . ASP A 1 45  ? -4.017  10.572 4.742   1.00 21.69 ?  45  ASP A CG  1 
ATOM   340  O OD1 . ASP A 1 45  ? -4.195  10.015 5.845   1.00 19.85 ?  45  ASP A OD1 1 
ATOM   341  O OD2 . ASP A 1 45  ? -3.266  11.560 4.602   1.00 23.46 -1 45  ASP A OD2 1 
ATOM   342  N N   . GLY A 1 46  ? -8.343  9.963  4.473   1.00 14.85 ?  46  GLY A N   1 
ATOM   343  C CA  . GLY A 1 46  ? -9.354  10.811 5.081   1.00 16.57 ?  46  GLY A CA  1 
ATOM   344  C C   . GLY A 1 46  ? -10.152 11.668 4.115   1.00 14.45 ?  46  GLY A C   1 
ATOM   345  O O   . GLY A 1 46  ? -11.056 12.390 4.529   1.00 14.98 ?  46  GLY A O   1 
ATOM   346  N N   . THR A 1 47  ? -9.819  11.590 2.831   1.00 14.17 ?  47  THR A N   1 
ATOM   347  C CA  . THR A 1 47  ? -10.497 12.410 1.829   1.00 13.79 ?  47  THR A CA  1 
ATOM   348  C C   . THR A 1 47  ? -11.303 11.568 0.848   1.00 14.37 ?  47  THR A C   1 
ATOM   349  O O   . THR A 1 47  ? -10.739 10.724 0.151   1.00 15.44 ?  47  THR A O   1 
ATOM   350  C CB  . THR A 1 47  ? -9.490  13.256 1.045   1.00 15.64 ?  47  THR A CB  1 
ATOM   351  O OG1 . THR A 1 47  ? -8.718  14.045 1.963   1.00 14.74 ?  47  THR A OG1 1 
ATOM   352  C CG2 . THR A 1 47  ? -10.211 14.157 0.062   1.00 14.71 ?  47  THR A CG2 1 
ATOM   353  N N   . LEU A 1 48  ? -12.617 11.800 0.789   1.00 13.65 ?  48  LEU A N   1 
ATOM   354  C CA  . LEU A 1 48  ? -13.451 11.153 -0.225  1.00 11.88 ?  48  LEU A CA  1 
ATOM   355  C C   . LEU A 1 48  ? -12.965 11.547 -1.606  1.00 13.57 ?  48  LEU A C   1 
ATOM   356  O O   . LEU A 1 48  ? -12.854 12.737 -1.919  1.00 15.82 ?  48  LEU A O   1 
ATOM   357  C CB  . LEU A 1 48  ? -14.922 11.521 -0.043  1.00 14.20 ?  48  LEU A CB  1 
ATOM   358  C CG  . LEU A 1 48  ? -15.549 10.957 1.237   1.00 12.58 ?  48  LEU A CG  1 
ATOM   359  C CD1 . LEU A 1 48  ? -16.904 11.575 1.494   1.00 12.53 ?  48  LEU A CD1 1 
ATOM   360  C CD2 . LEU A 1 48  ? -15.654 9.435  1.214   1.00 14.15 ?  48  LEU A CD2 1 
ATOM   361  N N   . SER A 1 49  ? -12.680 10.544 -2.427  1.00 13.58 ?  49  SER A N   1 
ATOM   362  C CA  . SER A 1 49  ? -11.979 10.773 -3.678  1.00 14.37 ?  49  SER A CA  1 
ATOM   363  C C   . SER A 1 49  ? -12.586 9.997  -4.827  1.00 13.58 ?  49  SER A C   1 
ATOM   364  O O   . SER A 1 49  ? -12.778 8.787  -4.740  1.00 15.12 ?  49  SER A O   1 
ATOM   365  C CB  . SER A 1 49  ? -10.504 10.393 -3.517  1.00 16.44 ?  49  SER A CB  1 
ATOM   366  O OG  . SER A 1 49  ? -9.899  11.149 -2.481  1.00 20.75 ?  49  SER A OG  1 
ATOM   367  N N   . TRP A 1 50  ? -12.872 10.705 -5.914  1.00 13.68 ?  50  TRP A N   1 
ATOM   368  C CA  . TRP A 1 50  ? -13.376 10.075 -7.117  1.00 13.54 ?  50  TRP A CA  1 
ATOM   369  C C   . TRP A 1 50  ? -12.345 9.131  -7.721  1.00 15.10 ?  50  TRP A C   1 
ATOM   370  O O   . TRP A 1 50  ? -11.154 9.430  -7.714  1.00 17.06 ?  50  TRP A O   1 
ATOM   371  C CB  . TRP A 1 50  ? -13.739 11.123 -8.162  1.00 16.13 ?  50  TRP A CB  1 
ATOM   372  C CG  . TRP A 1 50  ? -14.894 12.010 -7.850  1.00 14.17 ?  50  TRP A CG  1 
ATOM   373  C CD1 . TRP A 1 50  ? -14.840 13.341 -7.558  1.00 14.87 ?  50  TRP A CD1 1 
ATOM   374  C CD2 . TRP A 1 50  ? -16.288 11.659 -7.873  1.00 14.04 ?  50  TRP A CD2 1 
ATOM   375  N NE1 . TRP A 1 50  ? -16.111 13.838 -7.375  1.00 16.79 ?  50  TRP A NE1 1 
ATOM   376  C CE2 . TRP A 1 50  ? -17.016 12.823 -7.553  1.00 14.82 ?  50  TRP A CE2 1 
ATOM   377  C CE3 . TRP A 1 50  ? -16.987 10.468 -8.113  1.00 13.19 ?  50  TRP A CE3 1 
ATOM   378  C CZ2 . TRP A 1 50  ? -18.415 12.840 -7.475  1.00 14.51 ?  50  TRP A CZ2 1 
ATOM   379  C CZ3 . TRP A 1 50  ? -18.382 10.483 -8.034  1.00 14.20 ?  50  TRP A CZ3 1 
ATOM   380  C CH2 . TRP A 1 50  ? -19.077 11.667 -7.718  1.00 13.96 ?  50  TRP A CH2 1 
ATOM   381  N N   . GLY A 1 51  ? -12.811 8.004  -8.248  1.00 15.51 ?  51  GLY A N   1 
ATOM   382  C CA  . GLY A 1 51  ? -11.944 7.097  -8.981  1.00 17.71 ?  51  GLY A CA  1 
ATOM   383  C C   . GLY A 1 51  ? -11.326 6.020  -8.119  1.00 20.04 ?  51  GLY A C   1 
ATOM   384  O O   . GLY A 1 51  ? -10.774 5.049  -8.631  1.00 20.68 ?  51  GLY A O   1 
ATOM   385  N N   . ASP A 1 52  ? -11.386 6.213  -6.808  1.00 18.16 ?  52  ASP A N   1 
ATOM   386  C CA  . ASP A 1 52  ? -11.064 5.157  -5.862  1.00 18.82 ?  52  ASP A CA  1 
ATOM   387  C C   . ASP A 1 52  ? -12.358 4.412  -5.534  1.00 16.70 ?  52  ASP A C   1 
ATOM   388  O O   . ASP A 1 52  ? -13.400 4.674  -6.142  1.00 18.40 ?  52  ASP A O   1 
ATOM   389  C CB  . ASP A 1 52  ? -10.405 5.725  -4.603  1.00 17.51 ?  52  ASP A CB  1 
ATOM   390  C CG  . ASP A 1 52  ? -9.025  6.319  -4.874  1.00 27.98 ?  52  ASP A CG  1 
ATOM   391  O OD1 . ASP A 1 52  ? -8.249  5.736  -5.668  1.00 28.97 ?  52  ASP A OD1 1 
ATOM   392  O OD2 . ASP A 1 52  ? -8.713  7.381  -4.294  1.00 33.93 -1 52  ASP A OD2 1 
ATOM   393  N N   . HIS A 1 53  ? -12.310 3.472  -4.595  1.00 15.87 ?  53  HIS A N   1 
ATOM   394  C CA  . HIS A 1 53  ? -13.452 2.591  -4.367  1.00 13.80 ?  53  HIS A CA  1 
ATOM   395  C C   . HIS A 1 53  ? -13.648 2.292  -2.888  1.00 15.63 ?  53  HIS A C   1 
ATOM   396  O O   . HIS A 1 53  ? -12.716 2.408  -2.098  1.00 15.85 ?  53  HIS A O   1 
ATOM   397  C CB  . HIS A 1 53  ? -13.268 1.281  -5.136  1.00 17.66 ?  53  HIS A CB  1 
ATOM   398  C CG  . HIS A 1 53  ? -12.655 1.472  -6.489  1.00 22.71 ?  53  HIS A CG  1 
ATOM   399  N ND1 . HIS A 1 53  ? -13.369 1.940  -7.568  1.00 24.18 ?  53  HIS A ND1 1 
ATOM   400  C CD2 . HIS A 1 53  ? -11.382 1.303  -6.923  1.00 22.79 ?  53  HIS A CD2 1 
ATOM   401  C CE1 . HIS A 1 53  ? -12.571 2.033  -8.618  1.00 20.86 ?  53  HIS A CE1 1 
ATOM   402  N NE2 . HIS A 1 53  ? -11.360 1.650  -8.254  1.00 26.14 ?  53  HIS A NE2 1 
ATOM   403  N N   . ASN A 1 54  ? -14.876 1.918  -2.528  1.00 15.75 ?  54  ASN A N   1 
ATOM   404  C CA  . ASN A 1 54  ? -15.185 1.344  -1.221  1.00 13.18 ?  54  ASN A CA  1 
ATOM   405  C C   . ASN A 1 54  ? -14.908 2.239  -0.030  1.00 15.05 ?  54  ASN A C   1 
ATOM   406  O O   . ASN A 1 54  ? -14.469 1.760  1.018   1.00 16.95 ?  54  ASN A O   1 
ATOM   407  C CB  . ASN A 1 54  ? -14.438 0.018  -1.038  1.00 15.31 ?  54  ASN A CB  1 
ATOM   408  C CG  . ASN A 1 54  ? -14.806 -0.991 -2.100  1.00 17.81 ?  54  ASN A CG  1 
ATOM   409  O OD1 . ASN A 1 54  ? -15.961 -1.068 -2.515  1.00 19.24 ?  54  ASN A OD1 1 
ATOM   410  N ND2 . ASN A 1 54  ? -13.824 -1.754 -2.565  1.00 25.36 ?  54  ASN A ND2 1 
ATOM   411  N N   . PHE A 1 55  ? -15.200 3.530  -0.172  1.00 13.47 ?  55  PHE A N   1 
ATOM   412  C CA  . PHE A 1 55  ? -15.041 4.459  0.945   1.00 15.92 ?  55  PHE A CA  1 
ATOM   413  C C   . PHE A 1 55  ? -15.754 3.978  2.211   1.00 14.23 ?  55  PHE A C   1 
ATOM   414  O O   . PHE A 1 55  ? -15.301 4.255  3.328   1.00 14.35 ?  55  PHE A O   1 
ATOM   415  C CB  . PHE A 1 55  ? -15.566 5.853  0.568   1.00 12.50 ?  55  PHE A CB  1 
ATOM   416  C CG  . PHE A 1 55  ? -17.066 5.955  0.596   1.00 14.16 ?  55  PHE A CG  1 
ATOM   417  C CD1 . PHE A 1 55  ? -17.808 5.612  -0.520  1.00 14.70 ?  55  PHE A CD1 1 
ATOM   418  C CD2 . PHE A 1 55  ? -17.738 6.358  1.748   1.00 13.77 ?  55  PHE A CD2 1 
ATOM   419  C CE1 . PHE A 1 55  ? -19.191 5.678  -0.494  1.00 14.39 ?  55  PHE A CE1 1 
ATOM   420  C CE2 . PHE A 1 55  ? -19.114 6.420  1.776   1.00 14.36 ?  55  PHE A CE2 1 
ATOM   421  C CZ  . PHE A 1 55  ? -19.841 6.078  0.656   1.00 17.77 ?  55  PHE A CZ  1 
ATOM   422  N N   . SER A 1 56  ? -16.875 3.274  2.049   1.00 15.43 ?  56  SER A N   1 
ATOM   423  C CA  . SER A 1 56  ? -17.726 2.964  3.195   1.00 16.38 ?  56  SER A CA  1 
ATOM   424  C C   . SER A 1 56  ? -17.046 2.017  4.175   1.00 15.79 ?  56  SER A C   1 
ATOM   425  O O   . SER A 1 56  ? -17.466 1.916  5.326   1.00 18.48 ?  56  SER A O   1 
ATOM   426  C CB  . SER A 1 56  ? -19.067 2.373  2.741   1.00 15.97 ?  56  SER A CB  1 
ATOM   427  O OG  . SER A 1 56  ? -18.903 1.051  2.259   1.00 17.75 ?  56  SER A OG  1 
ATOM   428  N N   . LEU A 1 57  ? -15.998 1.328  3.735   1.00 16.30 ?  57  LEU A N   1 
ATOM   429  C CA  . LEU A 1 57  ? -15.322 0.376  4.611   1.00 14.70 ?  57  LEU A CA  1 
ATOM   430  C C   . LEU A 1 57  ? -14.442 1.064  5.644   1.00 20.59 ?  57  LEU A C   1 
ATOM   431  O O   . LEU A 1 57  ? -14.060 0.449  6.632   1.00 21.46 ?  57  LEU A O   1 
ATOM   432  C CB  . LEU A 1 57  ? -14.473 -0.600 3.795   1.00 18.52 ?  57  LEU A CB  1 
ATOM   433  C CG  . LEU A 1 57  ? -15.244 -1.459 2.794   1.00 19.25 ?  57  LEU A CG  1 
ATOM   434  C CD1 . LEU A 1 57  ? -14.295 -2.424 2.101   1.00 19.26 ?  57  LEU A CD1 1 
ATOM   435  C CD2 . LEU A 1 57  ? -16.397 -2.204 3.458   1.00 18.22 ?  57  LEU A CD2 1 
ATOM   436  N N   . THR A 1 58  ? -14.099 2.325  5.409   1.00 18.79 ?  58  THR A N   1 
ATOM   437  C CA  . THR A 1 58  ? -13.202 3.038  6.317   1.00 17.37 ?  58  THR A CA  1 
ATOM   438  C C   . THR A 1 58  ? -13.715 4.435  6.668   1.00 15.52 ?  58  THR A C   1 
ATOM   439  O O   . THR A 1 58  ? -12.939 5.306  7.049   1.00 18.61 ?  58  THR A O   1 
ATOM   440  C CB  . THR A 1 58  ? -11.779 3.168  5.729   1.00 18.56 ?  58  THR A CB  1 
ATOM   441  O OG1 . THR A 1 58  ? -11.833 3.855  4.473   1.00 18.40 ?  58  THR A OG1 1 
ATOM   442  C CG2 . THR A 1 58  ? -11.153 1.787  5.527   1.00 18.69 ?  58  THR A CG2 1 
ATOM   443  N N   . CYS A 1 59  ? -15.016 4.650  6.513   1.00 17.63 ?  59  CYS A N   1 
ATOM   444  C CA  . CYS A 1 59  ? -15.642 5.915  6.875   1.00 17.28 ?  59  CYS A CA  1 
ATOM   445  C C   . CYS A 1 59  ? -16.881 5.669  7.741   1.00 19.36 ?  59  CYS A C   1 
ATOM   446  O O   . CYS A 1 59  ? -17.576 4.663  7.580   1.00 19.63 ?  59  CYS A O   1 
ATOM   447  C CB  . CYS A 1 59  ? -16.021 6.719  5.622   1.00 19.86 ?  59  CYS A CB  1 
ATOM   448  S SG  . CYS A 1 59  ? -14.633 7.161  4.536   1.00 17.65 ?  59  CYS A SG  1 
ATOM   449  N N   . ASP A 1 60  ? -17.127 6.581  8.675   1.00 19.18 ?  60  ASP A N   1 
ATOM   450  C CA  . ASP A 1 60  ? -18.272 6.514  9.580   1.00 19.62 ?  60  ASP A CA  1 
ATOM   451  C C   . ASP A 1 60  ? -19.196 7.692  9.330   1.00 15.97 ?  60  ASP A C   1 
ATOM   452  O O   . ASP A 1 60  ? -18.826 8.624  8.612   1.00 19.06 ?  60  ASP A O   1 
ATOM   453  C CB  . ASP A 1 60  ? -17.822 6.535  11.046  1.00 26.66 ?  60  ASP A CB  1 
ATOM   454  C CG  . ASP A 1 60  ? -17.014 5.321  11.428  1.00 34.86 ?  60  ASP A CG  1 
ATOM   455  O OD1 . ASP A 1 60  ? -17.228 4.252  10.820  1.00 35.40 ?  60  ASP A OD1 1 
ATOM   456  O OD2 . ASP A 1 60  ? -16.169 5.437  12.342  1.00 40.32 -1 60  ASP A OD2 1 
ATOM   457  N N   . SER A 1 61  ? -20.376 7.665  9.950   1.00 17.11 ?  61  SER A N   1 
ATOM   458  C CA  . SER A 1 61  ? -21.299 8.800  9.929   1.00 17.73 ?  61  SER A CA  1 
ATOM   459  C C   . SER A 1 61  ? -21.561 9.275  8.508   1.00 18.51 ?  61  SER A C   1 
ATOM   460  O O   . SER A 1 61  ? -21.483 10.465 8.206   1.00 18.60 ?  61  SER A O   1 
ATOM   461  C CB  . SER A 1 61  ? -20.746 9.948  10.774  1.00 20.10 ?  61  SER A CB  1 
ATOM   462  O OG  . SER A 1 61  ? -20.509 9.516  12.106  1.00 27.51 ?  61  SER A OG  1 
ATOM   463  N N   . ILE A 1 62  ? -21.843 8.313  7.641   1.00 16.28 ?  62  ILE A N   1 
ATOM   464  C CA  . ILE A 1 62  ? -22.054 8.564  6.231   1.00 15.67 ?  62  ILE A CA  1 
ATOM   465  C C   . ILE A 1 62  ? -23.447 9.128  5.988   1.00 20.76 ?  62  ILE A C   1 
ATOM   466  O O   . ILE A 1 62  ? -24.428 8.597  6.496   1.00 20.74 ?  62  ILE A O   1 
ATOM   467  C CB  . ILE A 1 62  ? -21.862 7.273  5.435   1.00 17.17 ?  62  ILE A CB  1 
ATOM   468  C CG1 . ILE A 1 62  ? -20.425 6.759  5.595   1.00 15.27 ?  62  ILE A CG1 1 
ATOM   469  C CG2 . ILE A 1 62  ? -22.220 7.483  3.972   1.00 16.59 ?  62  ILE A CG2 1 
ATOM   470  C CD1 . ILE A 1 62  ? -20.257 5.307  5.198   1.00 18.86 ?  62  ILE A CD1 1 
ATOM   471  N N   . GLY A 1 63  ? -23.534 10.201 5.210   1.00 14.28 ?  63  GLY A N   1 
ATOM   472  C CA  . GLY A 1 63  ? -24.823 10.800 4.939   1.00 13.86 ?  63  GLY A CA  1 
ATOM   473  C C   . GLY A 1 63  ? -24.818 11.632 3.678   1.00 14.83 ?  63  GLY A C   1 
ATOM   474  O O   . GLY A 1 63  ? -23.758 11.947 3.118   1.00 14.70 ?  63  GLY A O   1 
ATOM   475  N N   . LEU A 1 64  ? -26.018 11.956 3.219   1.00 16.44 ?  64  LEU A N   1 
ATOM   476  C CA  . LEU A 1 64  ? -26.212 12.847 2.097   1.00 16.17 ?  64  LEU A CA  1 
ATOM   477  C C   . LEU A 1 64  ? -26.637 14.205 2.638   1.00 16.22 ?  64  LEU A C   1 
ATOM   478  O O   . LEU A 1 64  ? -27.482 14.280 3.527   1.00 19.21 ?  64  LEU A O   1 
ATOM   479  C CB  . LEU A 1 64  ? -27.277 12.287 1.154   1.00 16.20 ?  64  LEU A CB  1 
ATOM   480  C CG  . LEU A 1 64  ? -27.702 13.187 -0.003  1.00 16.78 ?  64  LEU A CG  1 
ATOM   481  C CD1 . LEU A 1 64  ? -26.594 13.295 -1.053  1.00 15.93 ?  64  LEU A CD1 1 
ATOM   482  C CD2 . LEU A 1 64  ? -29.006 12.675 -0.622  1.00 17.96 ?  64  LEU A CD2 1 
ATOM   483  N N   . ALA A 1 65  ? -26.060 15.277 2.118   1.00 14.98 ?  65  ALA A N   1 
ATOM   484  C CA  . ALA A 1 65  ? -26.428 16.606 2.579   1.00 17.34 ?  65  ALA A CA  1 
ATOM   485  C C   . ALA A 1 65  ? -26.321 17.607 1.450   1.00 16.46 ?  65  ALA A C   1 
ATOM   486  O O   . ALA A 1 65  ? -25.805 17.286 0.380   1.00 16.40 ?  65  ALA A O   1 
ATOM   487  C CB  . ALA A 1 65  ? -25.540 17.030 3.743   1.00 18.35 ?  65  ALA A CB  1 
ATOM   488  N N   . GLN A 1 66  ? -26.840 18.809 1.691   1.00 16.50 ?  66  GLN A N   1 
ATOM   489  C CA  . GLN A 1 66  ? -26.547 19.953 0.845   1.00 18.83 ?  66  GLN A CA  1 
ATOM   490  C C   . GLN A 1 66  ? -25.559 20.800 1.623   1.00 19.61 ?  66  GLN A C   1 
ATOM   491  O O   . GLN A 1 66  ? -25.828 21.160 2.773   1.00 23.01 ?  66  GLN A O   1 
ATOM   492  C CB  . GLN A 1 66  ? -27.819 20.734 0.491   1.00 20.56 ?  66  GLN A CB  1 
ATOM   493  C CG  . GLN A 1 66  ? -28.718 20.011 -0.514  1.00 20.46 ?  66  GLN A CG  1 
ATOM   494  C CD  . GLN A 1 66  ? -30.173 20.427 -0.411  1.00 24.24 ?  66  GLN A CD  1 
ATOM   495  O OE1 . GLN A 1 66  ? -30.877 20.066 0.536   1.00 37.29 ?  66  GLN A OE1 1 
ATOM   496  N NE2 . GLN A 1 66  ? -30.630 21.190 -1.383  1.00 26.94 ?  66  GLN A NE2 1 
ATOM   497  N N   . SER A 1 67  ? -24.400 21.065 1.024   1.00 19.48 ?  67  SER A N   1 
ATOM   498  C CA  . SER A 1 67  ? -23.317 21.763 1.711   1.00 18.68 ?  67  SER A CA  1 
ATOM   499  C C   . SER A 1 67  ? -23.805 23.100 2.236   1.00 19.12 ?  67  SER A C   1 
ATOM   500  O O   . SER A 1 67  ? -24.637 23.746 1.611   1.00 20.33 ?  67  SER A O   1 
ATOM   501  C CB  . SER A 1 67  ? -22.115 21.950 0.784   1.00 20.66 ?  67  SER A CB  1 
ATOM   502  O OG  . SER A 1 67  ? -20.928 22.119 1.545   1.00 25.12 ?  67  SER A OG  1 
ATOM   503  N N   . LEU A 1 68  ? -23.322 23.495 3.410   1.00 17.09 ?  68  LEU A N   1 
ATOM   504  C CA  . LEU A 1 68  ? -23.901 24.639 4.097   1.00 15.74 ?  68  LEU A CA  1 
ATOM   505  C C   . LEU A 1 68  ? -23.912 25.937 3.302   1.00 20.64 ?  68  LEU A C   1 
ATOM   506  O O   . LEU A 1 68  ? -24.949 26.585 3.187   1.00 21.50 ?  68  LEU A O   1 
ATOM   507  C CB  . LEU A 1 68  ? -23.181 24.880 5.418   1.00 19.28 ?  68  LEU A CB  1 
ATOM   508  C CG  . LEU A 1 68  ? -23.717 26.124 6.128   1.00 21.56 ?  68  LEU A CG  1 
ATOM   509  C CD1 . LEU A 1 68  ? -25.147 25.928 6.581   1.00 25.56 ?  68  LEU A CD1 1 
ATOM   510  C CD2 . LEU A 1 68  ? -22.838 26.444 7.298   1.00 23.88 ?  68  LEU A CD2 1 
ATOM   511  N N   . PHE A 1 69  ? -22.770 26.330 2.756   1.00 20.71 ?  69  PHE A N   1 
ATOM   512  C CA  . PHE A 1 69  ? -22.695 27.625 2.096   1.00 19.43 ?  69  PHE A CA  1 
ATOM   513  C C   . PHE A 1 69  ? -23.122 27.567 0.637   1.00 21.54 ?  69  PHE A C   1 
ATOM   514  O O   . PHE A 1 69  ? -23.749 28.496 0.134   1.00 24.51 ?  69  PHE A O   1 
ATOM   515  C CB  . PHE A 1 69  ? -21.275 28.181 2.207   1.00 18.65 ?  69  PHE A CB  1 
ATOM   516  C CG  . PHE A 1 69  ? -20.836 28.417 3.616   1.00 19.54 ?  69  PHE A CG  1 
ATOM   517  C CD1 . PHE A 1 69  ? -21.449 29.385 4.391   1.00 20.80 ?  69  PHE A CD1 1 
ATOM   518  C CD2 . PHE A 1 69  ? -19.798 27.671 4.165   1.00 22.88 ?  69  PHE A CD2 1 
ATOM   519  C CE1 . PHE A 1 69  ? -21.049 29.607 5.697   1.00 23.81 ?  69  PHE A CE1 1 
ATOM   520  C CE2 . PHE A 1 69  ? -19.389 27.888 5.467   1.00 23.40 ?  69  PHE A CE2 1 
ATOM   521  C CZ  . PHE A 1 69  ? -20.013 28.857 6.235   1.00 25.13 ?  69  PHE A CZ  1 
ATOM   522  N N   . THR A 1 70  ? -22.773 26.474 -0.033  1.00 21.94 ?  70  THR A N   1 
ATOM   523  C CA  . THR A 1 70  ? -22.934 26.372 -1.477  1.00 24.21 ?  70  THR A CA  1 
ATOM   524  C C   . THR A 1 70  ? -24.196 25.620 -1.902  1.00 22.47 ?  70  THR A C   1 
ATOM   525  O O   . THR A 1 70  ? -24.615 25.720 -3.050  1.00 22.40 ?  70  THR A O   1 
ATOM   526  C CB  . THR A 1 70  ? -21.728 25.670 -2.102  1.00 17.90 ?  70  THR A CB  1 
ATOM   527  O OG1 . THR A 1 70  ? -21.561 24.392 -1.479  1.00 23.66 ?  70  THR A OG1 1 
ATOM   528  C CG2 . THR A 1 70  ? -20.458 26.481 -1.864  1.00 26.14 ?  70  THR A CG2 1 
ATOM   529  N N   . ARG A 1 71  ? -24.777 24.848 -0.982  1.00 18.47 ?  71  ARG A N   1 
ATOM   530  C CA  . ARG A 1 71  ? -25.955 24.017 -1.248  1.00 19.30 ?  71  ARG A CA  1 
ATOM   531  C C   . ARG A 1 71  ? -25.669 22.979 -2.336  1.00 17.62 ?  71  ARG A C   1 
ATOM   532  O O   . ARG A 1 71  ? -26.567 22.559 -3.058  1.00 18.14 ?  71  ARG A O   1 
ATOM   533  C CB  . ARG A 1 71  ? -27.166 24.871 -1.644  1.00 22.08 ?  71  ARG A CB  1 
ATOM   534  C CG  . ARG A 1 71  ? -27.345 26.138 -0.820  1.00 26.57 ?  71  ARG A CG  1 
ATOM   535  C CD  . ARG A 1 71  ? -27.291 25.839 0.656   1.00 26.54 ?  71  ARG A CD  1 
ATOM   536  N NE  . ARG A 1 71  ? -28.429 25.054 1.113   1.00 30.59 ?  71  ARG A NE  1 
ATOM   537  C CZ  . ARG A 1 71  ? -28.451 24.387 2.262   1.00 33.70 ?  71  ARG A CZ  1 
ATOM   538  N NH1 . ARG A 1 71  ? -27.386 24.400 3.056   1.00 27.87 1  71  ARG A NH1 1 
ATOM   539  N NH2 . ARG A 1 71  ? -29.527 23.697 2.609   1.00 32.79 ?  71  ARG A NH2 1 
ATOM   540  N N   . THR A 1 72  ? -24.410 22.581 -2.462  1.00 16.57 ?  72  THR A N   1 
ATOM   541  C CA  . THR A 1 72  ? -24.060 21.504 -3.376  1.00 16.10 ?  72  THR A CA  1 
ATOM   542  C C   . THR A 1 72  ? -24.451 20.171 -2.751  1.00 16.22 ?  72  THR A C   1 
ATOM   543  O O   . THR A 1 72  ? -24.363 20.002 -1.545  1.00 15.40 ?  72  THR A O   1 
ATOM   544  C CB  . THR A 1 72  ? -22.546 21.494 -3.708  1.00 18.05 ?  72  THR A CB  1 
ATOM   545  O OG1 . THR A 1 72  ? -21.785 21.350 -2.499  1.00 19.08 ?  72  THR A OG1 1 
ATOM   546  C CG2 . THR A 1 72  ? -22.142 22.785 -4.414  1.00 17.59 ?  72  THR A CG2 1 
ATOM   547  N N   . TYR A 1 73  ? -24.879 19.221 -3.574  1.00 14.77 ?  73  TYR A N   1 
ATOM   548  C CA  . TYR A 1 73  ? -25.167 17.888 -3.074  1.00 14.69 ?  73  TYR A CA  1 
ATOM   549  C C   . TYR A 1 73  ? -23.885 17.142 -2.755  1.00 15.07 ?  73  TYR A C   1 
ATOM   550  O O   . TYR A 1 73  ? -23.050 16.920 -3.629  1.00 15.55 ?  73  TYR A O   1 
ATOM   551  C CB  . TYR A 1 73  ? -25.990 17.106 -4.092  1.00 14.81 ?  73  TYR A CB  1 
ATOM   552  C CG  . TYR A 1 73  ? -27.434 17.480 -3.998  1.00 15.86 ?  73  TYR A CG  1 
ATOM   553  C CD1 . TYR A 1 73  ? -28.266 16.847 -3.091  1.00 15.66 ?  73  TYR A CD1 1 
ATOM   554  C CD2 . TYR A 1 73  ? -27.955 18.498 -4.779  1.00 17.60 ?  73  TYR A CD2 1 
ATOM   555  C CE1 . TYR A 1 73  ? -29.600 17.202 -2.980  1.00 16.64 ?  73  TYR A CE1 1 
ATOM   556  C CE2 . TYR A 1 73  ? -29.282 18.857 -4.677  1.00 22.16 ?  73  TYR A CE2 1 
ATOM   557  C CZ  . TYR A 1 73  ? -30.091 18.206 -3.776  1.00 17.83 ?  73  TYR A CZ  1 
ATOM   558  O OH  . TYR A 1 73  ? -31.421 18.557 -3.666  1.00 25.40 ?  73  TYR A OH  1 
ATOM   559  N N   . VAL A 1 74  ? -23.732 16.757 -1.495  1.00 13.56 ?  74  VAL A N   1 
ATOM   560  C CA  . VAL A 1 74  ? -22.506 16.100 -1.068  1.00 15.13 ?  74  VAL A CA  1 
ATOM   561  C C   . VAL A 1 74  ? -22.770 14.773 -0.365  1.00 14.46 ?  74  VAL A C   1 
ATOM   562  O O   . VAL A 1 74  ? -23.775 14.596 0.330   1.00 15.33 ?  74  VAL A O   1 
ATOM   563  C CB  . VAL A 1 74  ? -21.666 17.014 -0.127  1.00 15.76 ?  74  VAL A CB  1 
ATOM   564  C CG1 . VAL A 1 74  ? -21.159 18.236 -0.889  1.00 15.01 ?  74  VAL A CG1 1 
ATOM   565  C CG2 . VAL A 1 74  ? -22.474 17.428 1.104   1.00 15.11 ?  74  VAL A CG2 1 
ATOM   566  N N   . LEU A 1 75  ? -21.868 13.828 -0.609  1.00 12.90 ?  75  LEU A N   1 
ATOM   567  C CA  . LEU A 1 75  ? -21.672 12.698 0.282   1.00 11.96 ?  75  LEU A CA  1 
ATOM   568  C C   . LEU A 1 75  ? -20.732 13.186 1.370   1.00 14.20 ?  75  LEU A C   1 
ATOM   569  O O   . LEU A 1 75  ? -19.652 13.724 1.075   1.00 14.19 ?  75  LEU A O   1 
ATOM   570  C CB  . LEU A 1 75  ? -21.089 11.498 -0.462  1.00 14.45 ?  75  LEU A CB  1 
ATOM   571  C CG  . LEU A 1 75  ? -20.581 10.324 0.372   1.00 14.04 ?  75  LEU A CG  1 
ATOM   572  C CD1 . LEU A 1 75  ? -21.742 9.559  0.979   1.00 15.29 ?  75  LEU A CD1 1 
ATOM   573  C CD2 . LEU A 1 75  ? -19.704 9.411  -0.485  1.00 14.95 ?  75  LEU A CD2 1 
ATOM   574  N N   . ALA A 1 76  ? -21.165 13.049 2.620   1.00 14.47 ?  76  ALA A N   1 
ATOM   575  C CA  . ALA A 1 76  ? -20.392 13.525 3.761   1.00 14.83 ?  76  ALA A CA  1 
ATOM   576  C C   . ALA A 1 76  ? -20.143 12.380 4.718   1.00 15.44 ?  76  ALA A C   1 
ATOM   577  O O   . ALA A 1 76  ? -21.009 11.530 4.920   1.00 15.68 ?  76  ALA A O   1 
ATOM   578  C CB  . ALA A 1 76  ? -21.118 14.661 4.461   1.00 17.07 ?  76  ALA A CB  1 
ATOM   579  N N   . ALA A 1 77  ? -18.957 12.363 5.313   1.00 13.33 ?  77  ALA A N   1 
ATOM   580  C CA  . ALA A 1 77  ? -18.619 11.321 6.256   1.00 13.80 ?  77  ALA A CA  1 
ATOM   581  C C   . ALA A 1 77  ? -17.474 11.747 7.158   1.00 15.58 ?  77  ALA A C   1 
ATOM   582  O O   . ALA A 1 77  ? -16.904 12.838 7.006   1.00 15.12 ?  77  ALA A O   1 
ATOM   583  C CB  . ALA A 1 77  ? -18.263 10.043 5.513   1.00 16.14 ?  77  ALA A CB  1 
ATOM   584  N N   . GLU A 1 78  ? -17.158 10.884 8.112   1.00 14.39 ?  78  GLU A N   1 
ATOM   585  C CA  . GLU A 1 78  ? -15.934 11.012 8.895   1.00 15.71 ?  78  GLU A CA  1 
ATOM   586  C C   . GLU A 1 78  ? -15.038 9.880  8.460   1.00 16.40 ?  78  GLU A C   1 
ATOM   587  O O   . GLU A 1 78  ? -15.354 8.730  8.717   1.00 18.32 ?  78  GLU A O   1 
ATOM   588  C CB  . GLU A 1 78  ? -16.230 10.927 10.390  1.00 17.07 ?  78  GLU A CB  1 
ATOM   589  C CG  . GLU A 1 78  ? -17.166 12.011 10.878  1.00 19.82 ?  78  GLU A CG  1 
ATOM   590  C CD  . GLU A 1 78  ? -16.429 13.273 11.268  1.00 23.15 ?  78  GLU A CD  1 
ATOM   591  O OE1 . GLU A 1 78  ? -15.185 13.231 11.340  1.00 26.74 ?  78  GLU A OE1 1 
ATOM   592  O OE2 . GLU A 1 78  ? -17.099 14.299 11.515  1.00 33.66 -1 78  GLU A OE2 1 
ATOM   593  N N   . CYS A 1 79  ? -13.946 10.184 7.774   1.00 16.21 ?  79  CYS A N   1 
ATOM   594  C CA  . CYS A 1 79  ? -13.143 9.121  7.191   1.00 15.84 ?  79  CYS A CA  1 
ATOM   595  C C   . CYS A 1 79  ? -11.852 8.888  7.954   1.00 16.10 ?  79  CYS A C   1 
ATOM   596  O O   . CYS A 1 79  ? -11.233 9.825  8.466   1.00 17.29 ?  79  CYS A O   1 
ATOM   597  C CB  . CYS A 1 79  ? -12.843 9.419  5.722   1.00 17.09 ?  79  CYS A CB  1 
ATOM   598  S SG  . CYS A 1 79  ? -14.316 9.171  4.673   1.00 16.82 ?  79  CYS A SG  1 
ATOM   599  N N   . GLU A 1 80  ? -11.451 7.623  8.012   1.00 15.94 ?  80  GLU A N   1 
ATOM   600  C CA  . GLU A 1 80  ? -10.224 7.226  8.691   1.00 19.97 ?  80  GLU A CA  1 
ATOM   601  C C   . GLU A 1 80  ? -8.993  7.650  7.897   1.00 19.47 ?  80  GLU A C   1 
ATOM   602  O O   . GLU A 1 80  ? -8.923  7.466  6.677   1.00 19.01 ?  80  GLU A O   1 
ATOM   603  C CB  . GLU A 1 80  ? -10.230 5.708  8.928   1.00 19.37 ?  80  GLU A CB  1 
ATOM   604  C CG  . GLU A 1 80  ? -9.076  5.202  9.794   1.00 22.21 ?  80  GLU A CG  1 
ATOM   605  C CD  . GLU A 1 80  ? -8.990  3.681  9.835   1.00 33.53 ?  80  GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 80  ? -9.527  3.020  8.919   1.00 35.67 ?  80  GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 80  ? -8.370  3.144  10.777  1.00 34.99 -1 80  GLU A OE2 1 
ATOM   608  N N   . ARG A 1 81  ? -8.014  8.238  8.580   1.00 17.60 ?  81  ARG A N   1 
ATOM   609  C CA  . ARG A 1 81  ? -6.784  8.601  7.900   1.00 19.28 ?  81  ARG A CA  1 
ATOM   610  C C   . ARG A 1 81  ? -5.831  7.412  7.882   1.00 20.79 ?  81  ARG A C   1 
ATOM   611  O O   . ARG A 1 81  ? -6.081  6.395  8.531   1.00 21.45 ?  81  ARG A O   1 
ATOM   612  C CB  . ARG A 1 81  ? -6.154  9.830  8.560   1.00 16.13 ?  81  ARG A CB  1 
ATOM   613  C CG  . ARG A 1 81  ? -7.058  11.064 8.479   1.00 17.09 ?  81  ARG A CG  1 
ATOM   614  C CD  . ARG A 1 81  ? -6.282  12.341 8.691   1.00 16.58 ?  81  ARG A CD  1 
ATOM   615  N NE  . ARG A 1 81  ? -5.263  12.478 7.658   1.00 18.30 ?  81  ARG A NE  1 
ATOM   616  C CZ  . ARG A 1 81  ? -4.335  13.427 7.647   1.00 20.13 ?  81  ARG A CZ  1 
ATOM   617  N NH1 . ARG A 1 81  ? -4.307  14.336 8.616   1.00 18.00 1  81  ARG A NH1 1 
ATOM   618  N NH2 . ARG A 1 81  ? -3.435  13.456 6.670   1.00 20.29 ?  81  ARG A NH2 1 
ATOM   619  N N   . ARG A 1 82  ? -4.754  7.550  7.118   1.00 18.71 ?  82  ARG A N   1 
ATOM   620  C CA  . ARG A 1 82  ? -3.813  6.469  6.867   1.00 24.86 ?  82  ARG A CA  1 
ATOM   621  C C   . ARG A 1 82  ? -3.186  5.920  8.147   1.00 24.55 ?  82  ARG A C   1 
ATOM   622  O O   . ARG A 1 82  ? -2.824  4.747  8.204   1.00 25.07 ?  82  ARG A O   1 
ATOM   623  C CB  . ARG A 1 82  ? -2.727  6.959  5.909   1.00 25.59 ?  82  ARG A CB  1 
ATOM   624  C CG  . ARG A 1 82  ? -1.861  5.868  5.306   1.00 37.45 ?  82  ARG A CG  1 
ATOM   625  C CD  . ARG A 1 82  ? -1.078  6.396  4.117   1.00 41.90 ?  82  ARG A CD  1 
ATOM   626  N NE  . ARG A 1 82  ? -1.937  6.567  2.946   1.00 44.90 ?  82  ARG A NE  1 
ATOM   627  C CZ  . ARG A 1 82  ? -1.942  7.645  2.167   1.00 40.92 ?  82  ARG A CZ  1 
ATOM   628  N NH1 . ARG A 1 82  ? -1.131  8.662  2.435   1.00 43.97 1  82  ARG A NH1 1 
ATOM   629  N NH2 . ARG A 1 82  ? -2.760  7.709  1.122   1.00 37.41 ?  82  ARG A NH2 1 
ATOM   630  N N   . ASP A 1 83  ? -3.077  6.756  9.178   1.00 23.01 ?  83  ASP A N   1 
ATOM   631  C CA  . ASP A 1 83  ? -2.406  6.338  10.408  1.00 25.02 ?  83  ASP A CA  1 
ATOM   632  C C   . ASP A 1 83  ? -3.208  5.300  11.187  1.00 26.32 ?  83  ASP A C   1 
ATOM   633  O O   . ASP A 1 83  ? -2.694  4.685  12.124  1.00 28.78 ?  83  ASP A O   1 
ATOM   634  C CB  . ASP A 1 83  ? -2.087  7.550  11.298  1.00 27.66 ?  83  ASP A CB  1 
ATOM   635  C CG  . ASP A 1 83  ? -3.325  8.254  11.835  1.00 25.13 ?  83  ASP A CG  1 
ATOM   636  O OD1 . ASP A 1 83  ? -4.446  7.716  11.743  1.00 26.89 ?  83  ASP A OD1 1 
ATOM   637  O OD2 . ASP A 1 83  ? -3.160  9.369  12.376  1.00 28.99 -1 83  ASP A OD2 1 
ATOM   638  N N   . GLY A 1 84  ? -4.468  5.113  10.806  1.00 24.68 ?  84  GLY A N   1 
ATOM   639  C CA  . GLY A 1 84  ? -5.292  4.070  11.388  1.00 28.46 ?  84  GLY A CA  1 
ATOM   640  C C   . GLY A 1 84  ? -6.075  4.428  12.637  1.00 29.18 ?  84  GLY A C   1 
ATOM   641  O O   . GLY A 1 84  ? -6.757  3.570  13.191  1.00 35.34 ?  84  GLY A O   1 
ATOM   642  N N   . TYR A 1 85  ? -5.988  5.675  13.096  1.00 28.10 ?  85  TYR A N   1 
ATOM   643  C CA  . TYR A 1 85  ? -6.776  6.083  14.263  1.00 26.31 ?  85  TYR A CA  1 
ATOM   644  C C   . TYR A 1 85  ? -7.373  7.489  14.159  1.00 26.48 ?  85  TYR A C   1 
ATOM   645  O O   . TYR A 1 85  ? -8.383  7.778  14.803  1.00 25.83 ?  85  TYR A O   1 
ATOM   646  C CB  . TYR A 1 85  ? -5.932  5.961  15.546  1.00 24.82 ?  85  TYR A CB  1 
ATOM   647  C CG  . TYR A 1 85  ? -4.626  6.721  15.527  1.00 29.86 ?  85  TYR A CG  1 
ATOM   648  C CD1 . TYR A 1 85  ? -4.562  8.044  15.937  1.00 31.89 ?  85  TYR A CD1 1 
ATOM   649  C CD2 . TYR A 1 85  ? -3.451  6.104  15.117  1.00 30.02 ?  85  TYR A CD2 1 
ATOM   650  C CE1 . TYR A 1 85  ? -3.361  8.738  15.924  1.00 29.59 ?  85  TYR A CE1 1 
ATOM   651  C CE2 . TYR A 1 85  ? -2.250  6.790  15.100  1.00 33.33 ?  85  TYR A CE2 1 
ATOM   652  C CZ  . TYR A 1 85  ? -2.215  8.105  15.500  1.00 29.22 ?  85  TYR A CZ  1 
ATOM   653  O OH  . TYR A 1 85  ? -1.021  8.788  15.491  1.00 38.28 ?  85  TYR A OH  1 
ATOM   654  N N   . THR A 1 86  ? -6.768  8.353  13.348  1.00 21.41 ?  86  THR A N   1 
ATOM   655  C CA  . THR A 1 86  ? -7.272  9.714  13.172  1.00 21.01 ?  86  THR A CA  1 
ATOM   656  C C   . THR A 1 86  ? -8.397  9.750  12.152  1.00 19.83 ?  86  THR A C   1 
ATOM   657  O O   . THR A 1 86  ? -8.262  9.193  11.063  1.00 22.32 ?  86  THR A O   1 
ATOM   658  C CB  . THR A 1 86  ? -6.151  10.668 12.714  1.00 21.56 ?  86  THR A CB  1 
ATOM   659  O OG1 . THR A 1 86  ? -5.108  10.671 13.690  1.00 22.95 ?  86  THR A OG1 1 
ATOM   660  C CG2 . THR A 1 86  ? -6.677  12.091 12.533  1.00 19.16 ?  86  THR A CG2 1 
ATOM   661  N N   . TYR A 1 87  ? -9.501  10.403 12.503  1.00 19.24 ?  87  TYR A N   1 
ATOM   662  C CA  . TYR A 1 87  ? -10.590 10.613 11.554  1.00 17.12 ?  87  TYR A CA  1 
ATOM   663  C C   . TYR A 1 87  ? -10.675 12.090 11.197  1.00 18.98 ?  87  TYR A C   1 
ATOM   664  O O   . TYR A 1 87  ? -10.215 12.949 11.941  1.00 17.88 ?  87  TYR A O   1 
ATOM   665  C CB  . TYR A 1 87  ? -11.925 10.126 12.120  1.00 19.44 ?  87  TYR A CB  1 
ATOM   666  C CG  . TYR A 1 87  ? -12.081 8.625  12.070  1.00 19.72 ?  87  TYR A CG  1 
ATOM   667  C CD1 . TYR A 1 87  ? -11.270 7.803  12.843  1.00 25.17 ?  87  TYR A CD1 1 
ATOM   668  C CD2 . TYR A 1 87  ? -13.024 8.029  11.242  1.00 22.10 ?  87  TYR A CD2 1 
ATOM   669  C CE1 . TYR A 1 87  ? -11.395 6.428  12.800  1.00 24.67 ?  87  TYR A CE1 1 
ATOM   670  C CE2 . TYR A 1 87  ? -13.161 6.649  11.195  1.00 26.23 ?  87  TYR A CE2 1 
ATOM   671  C CZ  . TYR A 1 87  ? -12.340 5.856  11.976  1.00 30.39 ?  87  TYR A CZ  1 
ATOM   672  O OH  . TYR A 1 87  ? -12.463 4.485  11.940  1.00 38.35 ?  87  TYR A OH  1 
ATOM   673  N N   . ILE A 1 88  ? -11.266 12.383 10.049  1.00 16.10 ?  88  ILE A N   1 
ATOM   674  C CA  . ILE A 1 88  ? -11.403 13.760 9.604   1.00 14.85 ?  88  ILE A CA  1 
ATOM   675  C C   . ILE A 1 88  ? -12.712 13.881 8.830   1.00 15.87 ?  88  ILE A C   1 
ATOM   676  O O   . ILE A 1 88  ? -13.080 12.975 8.090   1.00 14.83 ?  88  ILE A O   1 
ATOM   677  C CB  . ILE A 1 88  ? -10.178 14.192 8.740   1.00 15.50 ?  88  ILE A CB  1 
ATOM   678  C CG1 . ILE A 1 88  ? -10.231 15.685 8.398   1.00 12.97 ?  88  ILE A CG1 1 
ATOM   679  C CG2 . ILE A 1 88  ? -10.020 13.317 7.491   1.00 14.04 ?  88  ILE A CG2 1 
ATOM   680  C CD1 . ILE A 1 88  ? -9.011  16.170 7.643   1.00 14.14 ?  88  ILE A CD1 1 
ATOM   681  N N   . PRO A 1 89  ? -13.451 14.983 9.035   1.00 14.07 ?  89  PRO A N   1 
ATOM   682  C CA  . PRO A 1 89  ? -14.659 15.161 8.229   1.00 14.04 ?  89  PRO A CA  1 
ATOM   683  C C   . PRO A 1 89  ? -14.301 15.395 6.772   1.00 13.13 ?  89  PRO A C   1 
ATOM   684  O O   . PRO A 1 89  ? -13.274 15.992 6.477   1.00 13.27 ?  89  PRO A O   1 
ATOM   685  C CB  . PRO A 1 89  ? -15.314 16.399 8.839   1.00 15.12 ?  89  PRO A CB  1 
ATOM   686  C CG  . PRO A 1 89  ? -14.179 17.142 9.480   1.00 15.66 ?  89  PRO A CG  1 
ATOM   687  C CD  . PRO A 1 89  ? -13.269 16.075 10.007  1.00 14.68 ?  89  PRO A CD  1 
ATOM   688  N N   . THR A 1 90  ? -15.153 14.923 5.875   1.00 14.42 ?  90  THR A N   1 
ATOM   689  C CA  . THR A 1 90  ? -14.901 15.059 4.448   1.00 15.06 ?  90  THR A CA  1 
ATOM   690  C C   . THR A 1 90  ? -16.234 15.123 3.711   1.00 14.69 ?  90  THR A C   1 
ATOM   691  O O   . THR A 1 90  ? -17.223 14.541 4.154   1.00 15.44 ?  90  THR A O   1 
ATOM   692  C CB  . THR A 1 90  ? -14.010 13.894 3.934   1.00 13.35 ?  90  THR A CB  1 
ATOM   693  O OG1 . THR A 1 90  ? -13.823 13.989 2.519   1.00 14.49 ?  90  THR A OG1 1 
ATOM   694  C CG2 . THR A 1 90  ? -14.612 12.536 4.308   1.00 13.45 ?  90  THR A CG2 1 
ATOM   695  N N   . GLU A 1 91  ? -16.250 15.865 2.609   1.00 15.78 ?  91  GLU A N   1 
ATOM   696  C CA  . GLU A 1 91  ? -17.421 16.032 1.755   1.00 14.12 ?  91  GLU A CA  1 
ATOM   697  C C   . GLU A 1 91  ? -16.977 15.872 0.314   1.00 15.03 ?  91  GLU A C   1 
ATOM   698  O O   . GLU A 1 91  ? -15.894 16.336 -0.051  1.00 17.53 ?  91  GLU A O   1 
ATOM   699  C CB  . GLU A 1 91  ? -18.047 17.417 1.925   1.00 18.58 ?  91  GLU A CB  1 
ATOM   700  C CG  . GLU A 1 91  ? -18.870 17.628 3.171   1.00 21.52 ?  91  GLU A CG  1 
ATOM   701  C CD  . GLU A 1 91  ? -19.634 18.946 3.126   1.00 22.22 ?  91  GLU A CD  1 
ATOM   702  O OE1 . GLU A 1 91  ? -19.450 19.705 2.149   1.00 24.90 ?  91  GLU A OE1 1 
ATOM   703  O OE2 . GLU A 1 91  ? -20.423 19.212 4.057   1.00 29.11 -1 91  GLU A OE2 1 
ATOM   704  N N   . ILE A 1 92  ? -17.804 15.252 -0.519  1.00 12.87 ?  92  ILE A N   1 
ATOM   705  C CA  . ILE A 1 92  ? -17.486 15.203 -1.946  1.00 13.68 ?  92  ILE A CA  1 
ATOM   706  C C   . ILE A 1 92  ? -18.731 15.586 -2.756  1.00 13.29 ?  92  ILE A C   1 
ATOM   707  O O   . ILE A 1 92  ? -19.841 15.135 -2.465  1.00 13.41 ?  92  ILE A O   1 
ATOM   708  C CB  . ILE A 1 92  ? -16.934 13.807 -2.369  1.00 13.60 ?  92  ILE A CB  1 
ATOM   709  C CG1 . ILE A 1 92  ? -16.502 13.805 -3.839  1.00 14.64 ?  92  ILE A CG1 1 
ATOM   710  C CG2 . ILE A 1 92  ? -17.909 12.678 -2.048  1.00 15.65 ?  92  ILE A CG2 1 
ATOM   711  C CD1 . ILE A 1 92  ? -15.669 12.593 -4.206  1.00 14.82 ?  92  ILE A CD1 1 
ATOM   712  N N   . GLU A 1 93  ? -18.541 16.449 -3.753  1.00 12.78 ?  93  GLU A N   1 
ATOM   713  C CA  . GLU A 1 93  ? -19.670 16.988 -4.514  1.00 12.51 ?  93  GLU A CA  1 
ATOM   714  C C   . GLU A 1 93  ? -20.121 16.006 -5.588  1.00 12.71 ?  93  GLU A C   1 
ATOM   715  O O   . GLU A 1 93  ? -19.459 15.807 -6.599  1.00 13.30 ?  93  GLU A O   1 
ATOM   716  C CB  . GLU A 1 93  ? -19.301 18.339 -5.135  1.00 16.05 ?  93  GLU A CB  1 
ATOM   717  C CG  . GLU A 1 93  ? -18.996 19.400 -4.094  1.00 15.74 ?  93  GLU A CG  1 
ATOM   718  C CD  . GLU A 1 93  ? -18.540 20.707 -4.700  1.00 23.90 ?  93  GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 93  ? -19.005 21.044 -5.806  1.00 23.85 ?  93  GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 93  ? -17.720 21.405 -4.070  1.00 30.66 -1 93  GLU A OE2 1 
ATOM   721  N N   . LEU A 1 94  ? -21.277 15.400 -5.356  1.00 12.17 ?  94  LEU A N   1 
ATOM   722  C CA  . LEU A 1 94  ? -21.717 14.285 -6.182  1.00 11.95 ?  94  LEU A CA  1 
ATOM   723  C C   . LEU A 1 94  ? -22.013 14.691 -7.625  1.00 13.01 ?  94  LEU A C   1 
ATOM   724  O O   . LEU A 1 94  ? -21.897 13.864 -8.531  1.00 13.15 ?  94  LEU A O   1 
ATOM   725  C CB  . LEU A 1 94  ? -22.950 13.631 -5.552  1.00 11.87 ?  94  LEU A CB  1 
ATOM   726  C CG  . LEU A 1 94  ? -22.644 12.932 -4.222  1.00 11.49 ?  94  LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 94  ? -23.925 12.544 -3.499  1.00 15.86 ?  94  LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 94  ? -21.765 11.696 -4.452  1.00 14.87 ?  94  LEU A CD2 1 
ATOM   729  N N   . ASP A 1 95  ? -22.373 15.956 -7.837  1.00 12.83 ?  95  ASP A N   1 
ATOM   730  C CA  . ASP A 1 95  ? -22.691 16.441 -9.181  1.00 11.66 ?  95  ASP A CA  1 
ATOM   731  C C   . ASP A 1 95  ? -21.471 16.539 -10.090 1.00 12.02 ?  95  ASP A C   1 
ATOM   732  O O   . ASP A 1 95  ? -21.609 16.730 -11.304 1.00 13.01 ?  95  ASP A O   1 
ATOM   733  C CB  . ASP A 1 95  ? -23.388 17.803 -9.104  1.00 11.71 ?  95  ASP A CB  1 
ATOM   734  C CG  . ASP A 1 95  ? -24.891 17.677 -8.948  1.00 13.56 ?  95  ASP A CG  1 
ATOM   735  O OD1 . ASP A 1 95  ? -25.500 16.852 -9.657  1.00 15.90 ?  95  ASP A OD1 1 
ATOM   736  O OD2 . ASP A 1 95  ? -25.460 18.397 -8.109  1.00 14.63 -1 95  ASP A OD2 1 
ATOM   737  N N   . GLU A 1 96  ? -20.284 16.391 -9.511  1.00 12.69 ?  96  GLU A N   1 
ATOM   738  C CA  . GLU A 1 96  ? -19.056 16.446 -10.298 1.00 14.12 ?  96  GLU A CA  1 
ATOM   739  C C   . GLU A 1 96  ? -18.985 15.313 -11.313 1.00 14.79 ?  96  GLU A C   1 
ATOM   740  O O   . GLU A 1 96  ? -18.494 15.512 -12.426 1.00 16.36 ?  96  GLU A O   1 
ATOM   741  C CB  . GLU A 1 96  ? -17.819 16.402 -9.387  1.00 12.28 ?  96  GLU A CB  1 
ATOM   742  C CG  . GLU A 1 96  ? -17.623 17.675 -8.580  1.00 14.92 ?  96  GLU A CG  1 
ATOM   743  C CD  . GLU A 1 96  ? -16.396 17.641 -7.681  1.00 20.23 ?  96  GLU A CD  1 
ATOM   744  O OE1 . GLU A 1 96  ? -15.784 16.569 -7.525  1.00 19.01 ?  96  GLU A OE1 1 
ATOM   745  O OE2 . GLU A 1 96  ? -16.044 18.705 -7.128  1.00 22.89 -1 96  GLU A OE2 1 
ATOM   746  N N   . HIS A 1 97  ? -19.444 14.119 -10.934 1.00 12.05 ?  97  HIS A N   1 
ATOM   747  C CA  . HIS A 1 97  ? -19.241 12.958 -11.802 1.00 14.27 ?  97  HIS A CA  1 
ATOM   748  C C   . HIS A 1 97  ? -20.410 12.005 -11.870 1.00 13.56 ?  97  HIS A C   1 
ATOM   749  O O   . HIS A 1 97  ? -20.254 10.873 -12.333 1.00 14.35 ?  97  HIS A O   1 
ATOM   750  C CB  . HIS A 1 97  ? -17.979 12.195 -11.367 1.00 14.56 ?  97  HIS A CB  1 
ATOM   751  C CG  . HIS A 1 97  ? -16.719 12.913 -11.717 1.00 15.34 ?  97  HIS A CG  1 
ATOM   752  N ND1 . HIS A 1 97  ? -16.282 13.037 -13.018 1.00 16.29 ?  97  HIS A ND1 1 
ATOM   753  C CD2 . HIS A 1 97  ? -15.832 13.597 -10.954 1.00 16.55 ?  97  HIS A CD2 1 
ATOM   754  C CE1 . HIS A 1 97  ? -15.166 13.746 -13.038 1.00 19.34 ?  97  HIS A CE1 1 
ATOM   755  N NE2 . HIS A 1 97  ? -14.875 14.102 -11.800 1.00 18.54 ?  97  HIS A NE2 1 
ATOM   756  N N   . ILE A 1 98  ? -21.579 12.453 -11.427 1.00 11.69 ?  98  ILE A N   1 
ATOM   757  C CA  . ILE A 1 98  ? -22.786 11.654 -11.580 1.00 12.58 ?  98  ILE A CA  1 
ATOM   758  C C   . ILE A 1 98  ? -23.774 12.461 -12.418 1.00 12.51 ?  98  ILE A C   1 
ATOM   759  O O   . ILE A 1 98  ? -24.123 13.591 -12.080 1.00 12.86 ?  98  ILE A O   1 
ATOM   760  C CB  . ILE A 1 98  ? -23.388 11.254 -10.227 1.00 12.73 ?  98  ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 98  ? -22.403 10.368 -9.477  1.00 13.17 ?  98  ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 98  ? -24.716 10.504 -10.417 1.00 13.06 ?  98  ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 98  ? -22.779 10.112 -8.061  1.00 14.78 ?  98  ILE A CD1 1 
ATOM   764  N N   . ALA A 1 99  ? -24.177 11.875 -13.537 1.00 13.41 ?  99  ALA A N   1 
ATOM   765  C CA  . ALA A 1 99  ? -25.086 12.509 -14.473 1.00 12.36 ?  99  ALA A CA  1 
ATOM   766  C C   . ALA A 1 99  ? -26.398 11.768 -14.511 1.00 12.99 ?  99  ALA A C   1 
ATOM   767  O O   . ALA A 1 99  ? -26.487 10.614 -14.087 1.00 14.11 ?  99  ALA A O   1 
ATOM   768  C CB  . ALA A 1 99  ? -24.471 12.547 -15.873 1.00 15.79 ?  99  ALA A CB  1 
ATOM   769  N N   . ASN A 1 100 ? -27.411 12.448 -15.014 1.00 12.34 ?  100 ASN A N   1 
ATOM   770  C CA  . ASN A 1 100 ? -28.657 11.799 -15.363 1.00 12.75 ?  100 ASN A CA  1 
ATOM   771  C C   . ASN A 1 100 ? -28.666 11.590 -16.868 1.00 10.82 ?  100 ASN A C   1 
ATOM   772  O O   . ASN A 1 100 ? -28.811 12.535 -17.639 1.00 15.17 ?  100 ASN A O   1 
ATOM   773  C CB  . ASN A 1 100 ? -29.845 12.647 -14.903 1.00 13.23 ?  100 ASN A CB  1 
ATOM   774  C CG  . ASN A 1 100 ? -31.159 12.171 -15.482 1.00 15.06 ?  100 ASN A CG  1 
ATOM   775  O OD1 . ASN A 1 100 ? -31.269 11.036 -15.933 1.00 15.09 ?  100 ASN A OD1 1 
ATOM   776  N ND2 . ASN A 1 100 ? -32.167 13.028 -15.448 1.00 15.18 ?  100 ASN A ND2 1 
ATOM   777  N N   . ILE A 1 101 ? -28.479 10.345 -17.286 1.00 13.89 ?  101 ILE A N   1 
ATOM   778  C CA  . ILE A 1 101 ? -28.538 10.029 -18.703 1.00 15.02 ?  101 ILE A CA  1 
ATOM   779  C C   . ILE A 1 101 ? -29.846 9.311  -18.993 1.00 14.71 ?  101 ILE A C   1 
ATOM   780  O O   . ILE A 1 101 ? -30.001 8.140  -18.640 1.00 14.30 ?  101 ILE A O   1 
ATOM   781  C CB  . ILE A 1 101 ? -27.365 9.151  -19.156 1.00 15.01 ?  101 ILE A CB  1 
ATOM   782  C CG1 . ILE A 1 101 ? -26.021 9.764  -18.725 1.00 17.35 ?  101 ILE A CG1 1 
ATOM   783  C CG2 . ILE A 1 101 ? -27.437 8.934  -20.666 1.00 14.41 ?  101 ILE A CG2 1 
ATOM   784  C CD1 . ILE A 1 101 ? -25.724 11.088 -19.370 1.00 19.34 ?  101 ILE A CD1 1 
ATOM   785  N N   . ASP A 1 102 ? -30.784 10.035 -19.608 1.00 14.16 ?  102 ASP A N   1 
ATOM   786  C CA  . ASP A 1 102 ? -32.099 9.486  -19.987 1.00 16.62 ?  102 ASP A CA  1 
ATOM   787  C C   . ASP A 1 102 ? -32.769 8.759  -18.822 1.00 17.38 ?  102 ASP A C   1 
ATOM   788  O O   . ASP A 1 102 ? -33.372 7.688  -18.987 1.00 17.73 ?  102 ASP A O   1 
ATOM   789  C CB  . ASP A 1 102 ? -31.958 8.549  -21.194 1.00 18.21 ?  102 ASP A CB  1 
ATOM   790  C CG  . ASP A 1 102 ? -33.299 8.209  -21.838 1.00 18.59 ?  102 ASP A CG  1 
ATOM   791  O OD1 . ASP A 1 102 ? -34.260 9.010  -21.720 1.00 20.77 ?  102 ASP A OD1 1 
ATOM   792  O OD2 . ASP A 1 102 ? -33.389 7.138  -22.475 1.00 25.30 -1 102 ASP A OD2 1 
ATOM   793  N N   . GLY A 1 103 ? -32.643 9.341  -17.631 1.00 15.16 ?  103 GLY A N   1 
ATOM   794  C CA  . GLY A 1 103 ? -33.347 8.843  -16.465 1.00 15.30 ?  103 GLY A CA  1 
ATOM   795  C C   . GLY A 1 103 ? -32.523 7.957  -15.551 1.00 14.34 ?  103 GLY A C   1 
ATOM   796  O O   . GLY A 1 103 ? -32.997 7.551  -14.491 1.00 15.19 ?  103 GLY A O   1 
ATOM   797  N N   . THR A 1 104 ? -31.286 7.670  -15.943 1.00 13.55 ?  104 THR A N   1 
ATOM   798  C CA  . THR A 1 104 ? -30.442 6.737  -15.205 1.00 13.93 ?  104 THR A CA  1 
ATOM   799  C C   . THR A 1 104 ? -29.191 7.435  -14.667 1.00 12.99 ?  104 THR A C   1 
ATOM   800  O O   . THR A 1 104 ? -28.455 8.058  -15.427 1.00 12.13 ?  104 THR A O   1 
ATOM   801  C CB  . THR A 1 104 ? -30.027 5.549  -16.113 1.00 17.00 ?  104 THR A CB  1 
ATOM   802  O OG1 . THR A 1 104 ? -31.206 4.820  -16.498 1.00 15.45 ?  104 THR A OG1 1 
ATOM   803  C CG2 . THR A 1 104 ? -29.063 4.616  -15.404 1.00 13.89 ?  104 THR A CG2 1 
ATOM   804  N N   . LEU A 1 105 ? -28.980 7.356  -13.358 1.00 13.38 ?  105 LEU A N   1 
ATOM   805  C CA  . LEU A 1 105 ? -27.760 7.895  -12.757 1.00 10.87 ?  105 LEU A CA  1 
ATOM   806  C C   . LEU A 1 105 ? -26.550 7.170  -13.339 1.00 12.22 ?  105 LEU A C   1 
ATOM   807  O O   . LEU A 1 105 ? -26.497 5.934  -13.373 1.00 13.38 ?  105 LEU A O   1 
ATOM   808  C CB  . LEU A 1 105 ? -27.802 7.760  -11.232 1.00 12.09 ?  105 LEU A CB  1 
ATOM   809  C CG  . LEU A 1 105 ? -28.890 8.590  -10.542 1.00 13.31 ?  105 LEU A CG  1 
ATOM   810  C CD1 . LEU A 1 105 ? -29.106 8.114  -9.104  1.00 14.73 ?  105 LEU A CD1 1 
ATOM   811  C CD2 . LEU A 1 105 ? -28.543 10.081 -10.578 1.00 14.39 ?  105 LEU A CD2 1 
ATOM   812  N N   . THR A 1 106 ? -25.565 7.952  -13.768 1.00 13.70 ?  106 THR A N   1 
ATOM   813  C CA  . THR A 1 106 ? -24.467 7.421  -14.561 1.00 11.98 ?  106 THR A CA  1 
ATOM   814  C C   . THR A 1 106 ? -23.179 8.119  -14.189 1.00 13.06 ?  106 THR A C   1 
ATOM   815  O O   . THR A 1 106 ? -23.153 9.336  -14.102 1.00 13.88 ?  106 THR A O   1 
ATOM   816  C CB  . THR A 1 106 ? -24.732 7.622  -16.065 1.00 14.06 ?  106 THR A CB  1 
ATOM   817  O OG1 . THR A 1 106 ? -26.015 7.071  -16.407 1.00 14.42 ?  106 THR A OG1 1 
ATOM   818  C CG2 . THR A 1 106 ? -23.654 6.951  -16.896 1.00 16.05 ?  106 THR A CG2 1 
ATOM   819  N N   . TYR A 1 107 ? -22.112 7.359  -13.962 1.00 12.77 ?  107 TYR A N   1 
ATOM   820  C CA  . TYR A 1 107 ? -20.808 7.979  -13.756 1.00 14.13 ?  107 TYR A CA  1 
ATOM   821  C C   . TYR A 1 107 ? -20.285 8.549  -15.076 1.00 15.26 ?  107 TYR A C   1 
ATOM   822  O O   . TYR A 1 107 ? -20.373 7.895  -16.115 1.00 15.64 ?  107 TYR A O   1 
ATOM   823  C CB  . TYR A 1 107 ? -19.812 6.971  -13.191 1.00 12.89 ?  107 TYR A CB  1 
ATOM   824  C CG  . TYR A 1 107 ? -20.076 6.569  -11.760 1.00 12.16 ?  107 TYR A CG  1 
ATOM   825  C CD1 . TYR A 1 107 ? -20.078 7.513  -10.745 1.00 12.46 ?  107 TYR A CD1 1 
ATOM   826  C CD2 . TYR A 1 107 ? -20.300 5.241  -11.426 1.00 13.07 ?  107 TYR A CD2 1 
ATOM   827  C CE1 . TYR A 1 107 ? -20.319 7.152  -9.437  1.00 15.58 ?  107 TYR A CE1 1 
ATOM   828  C CE2 . TYR A 1 107 ? -20.538 4.863  -10.115 1.00 14.57 ?  107 TYR A CE2 1 
ATOM   829  C CZ  . TYR A 1 107 ? -20.545 5.825  -9.128  1.00 15.33 ?  107 TYR A CZ  1 
ATOM   830  O OH  . TYR A 1 107 ? -20.763 5.484  -7.819  1.00 15.90 ?  107 TYR A OH  1 
ATOM   831  N N   . GLU A 1 108 ? -19.739 9.764  -15.013 1.00 14.90 ?  108 GLU A N   1 
ATOM   832  C CA  . GLU A 1 108 ? -19.232 10.490 -16.180 1.00 15.93 ?  108 GLU A CA  1 
ATOM   833  C C   . GLU A 1 108 ? -17.979 11.230 -15.788 1.00 20.55 ?  108 GLU A C   1 
ATOM   834  O O   . GLU A 1 108 ? -17.872 11.615 -14.621 1.00 18.35 ?  108 GLU A O   1 
ATOM   835  C CB  . GLU A 1 108 ? -20.238 11.525 -16.689 1.00 20.98 ?  108 GLU A CB  1 
ATOM   836  C CG  . GLU A 1 108 ? -21.342 11.060 -17.584 1.00 30.18 ?  108 GLU A CG  1 
ATOM   837  C CD  . GLU A 1 108 ? -21.982 12.234 -18.309 1.00 25.61 ?  108 GLU A CD  1 
ATOM   838  O OE1 . GLU A 1 108 ? -21.959 13.374 -17.771 1.00 26.48 ?  108 GLU A OE1 1 
ATOM   839  O OE2 . GLU A 1 108 ? -22.499 12.027 -19.424 1.00 38.29 -1 108 GLU A OE2 1 
ATOM   840  O OXT . GLU A 1 108 ? -17.113 11.507 -16.619 1.00 23.66 -1 108 GLU A OXT 1 
ATOM   841  N N   . THR B 1 1   ? -13.947 19.436 0.117   1.00 30.69 ?  1   THR B N   1 
ATOM   842  C CA  . THR B 1 1   ? -13.844 20.767 0.701   1.00 28.37 ?  1   THR B CA  1 
ATOM   843  C C   . THR B 1 1   ? -13.301 20.701 2.132   1.00 27.57 ?  1   THR B C   1 
ATOM   844  O O   . THR B 1 1   ? -13.232 19.628 2.745   1.00 28.45 ?  1   THR B O   1 
ATOM   845  C CB  . THR B 1 1   ? -15.211 21.501 0.689   1.00 33.57 ?  1   THR B CB  1 
ATOM   846  O OG1 . THR B 1 1   ? -16.258 20.592 1.053   1.00 35.37 ?  1   THR B OG1 1 
ATOM   847  C CG2 . THR B 1 1   ? -15.512 22.059 -0.700  1.00 33.09 ?  1   THR B CG2 1 
ATOM   848  N N   . GLY B 1 2   ? -12.913 21.855 2.656   1.00 21.62 ?  2   GLY B N   1 
ATOM   849  C CA  . GLY B 1 2   ? -12.357 21.945 3.994   1.00 17.06 ?  2   GLY B CA  1 
ATOM   850  C C   . GLY B 1 2   ? -11.025 21.226 4.126   1.00 14.61 ?  2   GLY B C   1 
ATOM   851  O O   . GLY B 1 2   ? -10.202 21.272 3.224   1.00 16.62 ?  2   GLY B O   1 
ATOM   852  N N   . GLN B 1 3   ? -10.829 20.574 5.271   1.00 13.64 ?  3   GLN B N   1 
ATOM   853  C CA  . GLN B 1 3   ? -9.656  19.728 5.553   1.00 12.92 ?  3   GLN B CA  1 
ATOM   854  C C   . GLN B 1 3   ? -8.318  20.448 5.582   1.00 14.41 ?  3   GLN B C   1 
ATOM   855  O O   . GLN B 1 3   ? -7.297  19.858 5.212   1.00 13.68 ?  3   GLN B O   1 
ATOM   856  C CB  . GLN B 1 3   ? -9.565  18.581 4.548   1.00 14.51 ?  3   GLN B CB  1 
ATOM   857  C CG  . GLN B 1 3   ? -10.810 17.702 4.540   1.00 13.26 ?  3   GLN B CG  1 
ATOM   858  C CD  . GLN B 1 3   ? -10.534 16.321 4.008   1.00 14.66 ?  3   GLN B CD  1 
ATOM   859  O OE1 . GLN B 1 3   ? -9.832  16.156 3.005   1.00 16.01 ?  3   GLN B OE1 1 
ATOM   860  N NE2 . GLN B 1 3   ? -11.094 15.310 4.674   1.00 14.91 ?  3   GLN B NE2 1 
ATOM   861  N N   . PHE B 1 4   ? -8.304  21.693 6.046   1.00 12.48 ?  4   PHE B N   1 
ATOM   862  C CA  . PHE B 1 4   ? -7.042  22.424 6.163   1.00 12.64 ?  4   PHE B CA  1 
ATOM   863  C C   . PHE B 1 4   ? -5.979  21.664 6.970   1.00 15.00 ?  4   PHE B C   1 
ATOM   864  O O   . PHE B 1 4   ? -4.790  21.830 6.709   1.00 15.22 ?  4   PHE B O   1 
ATOM   865  C CB  . PHE B 1 4   ? -7.272  23.796 6.804   1.00 13.25 ?  4   PHE B CB  1 
ATOM   866  C CG  . PHE B 1 4   ? -7.447  23.741 8.292   1.00 13.38 ?  4   PHE B CG  1 
ATOM   867  C CD1 . PHE B 1 4   ? -8.667  23.387 8.846   1.00 14.15 ?  4   PHE B CD1 1 
ATOM   868  C CD2 . PHE B 1 4   ? -6.388  24.044 9.141   1.00 11.85 ?  4   PHE B CD2 1 
ATOM   869  C CE1 . PHE B 1 4   ? -8.831  23.329 10.221  1.00 15.69 ?  4   PHE B CE1 1 
ATOM   870  C CE2 . PHE B 1 4   ? -6.550  23.988 10.517  1.00 13.86 ?  4   PHE B CE2 1 
ATOM   871  C CZ  . PHE B 1 4   ? -7.762  23.628 11.059  1.00 16.29 ?  4   PHE B CZ  1 
ATOM   872  N N   . SER B 1 5   ? -6.374  20.837 7.940   1.00 13.18 ?  5   SER B N   1 
ATOM   873  C CA  . SER B 1 5   ? -5.370  20.247 8.835   1.00 13.76 ?  5   SER B CA  1 
ATOM   874  C C   . SER B 1 5   ? -4.472  19.246 8.106   1.00 16.30 ?  5   SER B C   1 
ATOM   875  O O   . SER B 1 5   ? -3.374  18.927 8.574   1.00 15.15 ?  5   SER B O   1 
ATOM   876  C CB  . SER B 1 5   ? -6.035  19.571 10.043  1.00 16.97 ?  5   SER B CB  1 
ATOM   877  O OG  . SER B 1 5   ? -6.725  18.390 9.653   1.00 17.21 ?  5   SER B OG  1 
ATOM   878  N N   . LYS B 1 6   ? -4.916  18.769 6.949   1.00 15.68 ?  6   LYS B N   1 
ATOM   879  C CA  . LYS B 1 6   ? -4.105  17.817 6.202   1.00 15.97 ?  6   LYS B CA  1 
ATOM   880  C C   . LYS B 1 6   ? -2.839  18.460 5.632   1.00 16.30 ?  6   LYS B C   1 
ATOM   881  O O   . LYS B 1 6   ? -1.855  17.759 5.350   1.00 18.70 ?  6   LYS B O   1 
ATOM   882  C CB  . LYS B 1 6   ? -4.917  17.177 5.074   1.00 16.27 ?  6   LYS B CB  1 
ATOM   883  C CG  . LYS B 1 6   ? -5.946  16.165 5.554   1.00 16.36 ?  6   LYS B CG  1 
ATOM   884  C CD  . LYS B 1 6   ? -6.571  15.426 4.373   1.00 17.19 ?  6   LYS B CD  1 
ATOM   885  C CE  . LYS B 1 6   ? -5.525  14.574 3.671   1.00 20.10 ?  6   LYS B CE  1 
ATOM   886  N NZ  . LYS B 1 6   ? -6.163  13.567 2.780   1.00 18.84 1  6   LYS B NZ  1 
ATOM   887  N N   . THR B 1 7   ? -2.854  19.782 5.461   1.00 14.97 ?  7   THR B N   1 
ATOM   888  C CA  . THR B 1 7   ? -1.726  20.471 4.829   1.00 16.21 ?  7   THR B CA  1 
ATOM   889  C C   . THR B 1 7   ? -1.280  21.706 5.614   1.00 15.18 ?  7   THR B C   1 
ATOM   890  O O   . THR B 1 7   ? -0.616  22.591 5.066   1.00 17.95 ?  7   THR B O   1 
ATOM   891  C CB  . THR B 1 7   ? -2.061  20.905 3.384   1.00 17.52 ?  7   THR B CB  1 
ATOM   892  O OG1 . THR B 1 7   ? -3.267  21.686 3.381   1.00 17.53 ?  7   THR B OG1 1 
ATOM   893  C CG2 . THR B 1 7   ? -2.242  19.684 2.485   1.00 16.44 ?  7   THR B CG2 1 
ATOM   894  N N   . CYS B 1 8   ? -1.676  21.780 6.881   1.00 14.88 ?  8   CYS B N   1 
ATOM   895  C CA  . CYS B 1 8   ? -1.278  22.884 7.742   1.00 15.97 ?  8   CYS B CA  1 
ATOM   896  C C   . CYS B 1 8   ? -0.629  22.324 9.002   1.00 20.45 ?  8   CYS B C   1 
ATOM   897  O O   . CYS B 1 8   ? -0.988  21.243 9.478   1.00 19.94 ?  8   CYS B O   1 
ATOM   898  C CB  . CYS B 1 8   ? -2.474  23.764 8.085   1.00 16.36 ?  8   CYS B CB  1 
ATOM   899  S SG  . CYS B 1 8   ? -3.191  24.616 6.655   1.00 15.53 ?  8   CYS B SG  1 
ATOM   900  N N   . GLU B 1 9   ? 0.350   23.054 9.521   1.00 16.76 ?  9   GLU B N   1 
ATOM   901  C CA  . GLU B 1 9   ? 1.062   22.639 10.722  1.00 18.92 ?  9   GLU B CA  1 
ATOM   902  C C   . GLU B 1 9   ? 1.011   23.694 11.807  1.00 16.53 ?  9   GLU B C   1 
ATOM   903  O O   . GLU B 1 9   ? 0.710   24.852 11.536  1.00 13.78 ?  9   GLU B O   1 
ATOM   904  C CB  . GLU B 1 9   ? 2.526   22.347 10.404  1.00 23.01 ?  9   GLU B CB  1 
ATOM   905  C CG  . GLU B 1 9   ? 2.715   21.441 9.223   1.00 27.86 ?  9   GLU B CG  1 
ATOM   906  C CD  . GLU B 1 9   ? 4.150   21.396 8.794   1.00 30.77 ?  9   GLU B CD  1 
ATOM   907  O OE1 . GLU B 1 9   ? 4.409   21.388 7.573   1.00 34.71 ?  9   GLU B OE1 1 
ATOM   908  O OE2 . GLU B 1 9   ? 5.020   21.373 9.687   1.00 31.98 -1 9   GLU B OE2 1 
ATOM   909  N N   . ASP B 1 10  ? 1.375   23.284 13.021  1.00 17.83 ?  10  ASP B N   1 
ATOM   910  C CA  . ASP B 1 10  ? 1.385   24.174 14.182  1.00 16.44 ?  10  ASP B CA  1 
ATOM   911  C C   . ASP B 1 10  ? 0.105   24.995 14.260  1.00 15.96 ?  10  ASP B C   1 
ATOM   912  O O   . ASP B 1 10  ? 0.126   26.225 14.252  1.00 15.37 ?  10  ASP B O   1 
ATOM   913  C CB  . ASP B 1 10  ? 2.609   25.093 14.156  1.00 13.57 ?  10  ASP B CB  1 
ATOM   914  C CG  . ASP B 1 10  ? 2.750   25.910 15.430  1.00 16.22 ?  10  ASP B CG  1 
ATOM   915  O OD1 . ASP B 1 10  ? 2.203   25.480 16.468  1.00 16.26 ?  10  ASP B OD1 1 
ATOM   916  O OD2 . ASP B 1 10  ? 3.386   26.983 15.391  1.00 17.48 -1 10  ASP B OD2 1 
ATOM   917  N N   . ILE B 1 11  ? -1.012  24.285 14.323  1.00 13.87 ?  11  ILE B N   1 
ATOM   918  C CA  . ILE B 1 11  ? -2.325  24.914 14.373  1.00 15.16 ?  11  ILE B CA  1 
ATOM   919  C C   . ILE B 1 11  ? -2.584  25.428 15.787  1.00 15.63 ?  11  ILE B C   1 
ATOM   920  O O   . ILE B 1 11  ? -2.424  24.680 16.753  1.00 17.98 ?  11  ILE B O   1 
ATOM   921  C CB  . ILE B 1 11  ? -3.416  23.924 13.966  1.00 13.43 ?  11  ILE B CB  1 
ATOM   922  C CG1 . ILE B 1 11  ? -3.144  23.383 12.556  1.00 14.40 ?  11  ILE B CG1 1 
ATOM   923  C CG2 . ILE B 1 11  ? -4.789  24.591 14.056  1.00 13.99 ?  11  ILE B CG2 1 
ATOM   924  C CD1 . ILE B 1 11  ? -3.888  22.060 12.237  1.00 13.92 ?  11  ILE B CD1 1 
ATOM   925  N N   . THR B 1 12  ? -2.962  26.702 15.905  1.00 13.85 ?  12  THR B N   1 
ATOM   926  C CA  . THR B 1 12  ? -3.155  27.349 17.207  1.00 14.80 ?  12  THR B CA  1 
ATOM   927  C C   . THR B 1 12  ? -4.379  28.247 17.226  1.00 15.44 ?  12  THR B C   1 
ATOM   928  O O   . THR B 1 12  ? -4.902  28.623 16.179  1.00 14.41 ?  12  THR B O   1 
ATOM   929  C CB  . THR B 1 12  ? -1.948  28.223 17.608  1.00 14.80 ?  12  THR B CB  1 
ATOM   930  O OG1 . THR B 1 12  ? -1.789  29.278 16.646  1.00 18.43 ?  12  THR B OG1 1 
ATOM   931  C CG2 . THR B 1 12  ? -0.671  27.381 17.676  1.00 16.09 ?  12  THR B CG2 1 
ATOM   932  N N   . LEU B 1 13  ? -4.822  28.598 18.428  1.00 13.85 ?  13  LEU B N   1 
ATOM   933  C CA  . LEU B 1 13  ? -5.947  29.506 18.579  1.00 14.61 ?  13  LEU B CA  1 
ATOM   934  C C   . LEU B 1 13  ? -5.603  30.584 19.590  1.00 16.56 ?  13  LEU B C   1 
ATOM   935  O O   . LEU B 1 13  ? -5.074  30.292 20.661  1.00 19.64 ?  13  LEU B O   1 
ATOM   936  C CB  . LEU B 1 13  ? -7.199  28.741 19.009  1.00 15.02 ?  13  LEU B CB  1 
ATOM   937  C CG  . LEU B 1 13  ? -8.473  29.560 19.185  1.00 17.02 ?  13  LEU B CG  1 
ATOM   938  C CD1 . LEU B 1 13  ? -9.044  29.924 17.830  1.00 16.90 ?  13  LEU B CD1 1 
ATOM   939  C CD2 . LEU B 1 13  ? -9.508  28.804 20.028  1.00 17.34 ?  13  LEU B CD2 1 
ATOM   940  N N   . ASP B 1 14  ? -5.882  31.827 19.226  1.00 13.47 ?  14  ASP B N   1 
ATOM   941  C CA  . ASP B 1 14  ? -5.723  32.964 20.119  1.00 18.87 ?  14  ASP B CA  1 
ATOM   942  C C   . ASP B 1 14  ? -7.024  33.747 20.070  1.00 17.14 ?  14  ASP B C   1 
ATOM   943  O O   . ASP B 1 14  ? -7.359  34.329 19.043  1.00 17.77 ?  14  ASP B O   1 
ATOM   944  C CB  . ASP B 1 14  ? -4.528  33.826 19.701  1.00 20.82 ?  14  ASP B CB  1 
ATOM   945  C CG  . ASP B 1 14  ? -4.243  34.967 20.672  1.00 27.85 ?  14  ASP B CG  1 
ATOM   946  O OD1 . ASP B 1 14  ? -4.995  35.144 21.648  1.00 32.71 ?  14  ASP B OD1 1 
ATOM   947  O OD2 . ASP B 1 14  ? -3.244  35.685 20.459  1.00 34.30 -1 14  ASP B OD2 1 
ATOM   948  N N   . GLY B 1 15  ? -7.756  33.748 21.175  1.00 19.17 ?  15  GLY B N   1 
ATOM   949  C CA  . GLY B 1 15  ? -9.071  34.349 21.189  1.00 19.88 ?  15  GLY B CA  1 
ATOM   950  C C   . GLY B 1 15  ? -9.933  33.560 20.231  1.00 16.41 ?  15  GLY B C   1 
ATOM   951  O O   . GLY B 1 15  ? -10.094 32.353 20.394  1.00 20.85 ?  15  GLY B O   1 
ATOM   952  N N   . SER B 1 16  ? -10.448 34.222 19.201  1.00 16.46 ?  16  SER B N   1 
ATOM   953  C CA  . SER B 1 16  ? -11.263 33.519 18.223  1.00 15.32 ?  16  SER B CA  1 
ATOM   954  C C   . SER B 1 16  ? -10.510 33.322 16.920  1.00 17.12 ?  16  SER B C   1 
ATOM   955  O O   . SER B 1 16  ? -11.082 32.859 15.936  1.00 16.25 ?  16  SER B O   1 
ATOM   956  C CB  . SER B 1 16  ? -12.557 34.285 17.963  1.00 15.96 ?  16  SER B CB  1 
ATOM   957  O OG  . SER B 1 16  ? -12.269 35.571 17.466  1.00 18.63 ?  16  SER B OG  1 
ATOM   958  N N   . THR B 1 17  ? -9.214  33.636 16.926  1.00 15.40 ?  17  THR B N   1 
ATOM   959  C CA  . THR B 1 17  ? -8.443  33.584 15.690  1.00 15.02 ?  17  THR B CA  1 
ATOM   960  C C   . THR B 1 17  ? -7.618  32.309 15.607  1.00 16.39 ?  17  THR B C   1 
ATOM   961  O O   . THR B 1 17  ? -6.774  32.046 16.455  1.00 15.47 ?  17  THR B O   1 
ATOM   962  C CB  . THR B 1 17  ? -7.527  34.818 15.552  1.00 17.58 ?  17  THR B CB  1 
ATOM   963  O OG1 . THR B 1 17  ? -8.342  35.994 15.520  1.00 20.32 ?  17  THR B OG1 1 
ATOM   964  C CG2 . THR B 1 17  ? -6.713  34.753 14.255  1.00 19.06 ?  17  THR B CG2 1 
ATOM   965  N N   . LEU B 1 18  ? -7.908  31.514 14.583  1.00 12.53 ?  18  LEU B N   1 
ATOM   966  C CA  . LEU B 1 18  ? -7.175  30.292 14.283  1.00 13.44 ?  18  LEU B CA  1 
ATOM   967  C C   . LEU B 1 18  ? -5.989  30.618 13.390  1.00 15.06 ?  18  LEU B C   1 
ATOM   968  O O   . LEU B 1 18  ? -6.153  31.300 12.385  1.00 15.71 ?  18  LEU B O   1 
ATOM   969  C CB  . LEU B 1 18  ? -8.111  29.300 13.590  1.00 12.71 ?  18  LEU B CB  1 
ATOM   970  C CG  . LEU B 1 18  ? -7.559  27.921 13.247  1.00 14.94 ?  18  LEU B CG  1 
ATOM   971  C CD1 . LEU B 1 18  ? -7.416  27.105 14.510  1.00 16.80 ?  18  LEU B CD1 1 
ATOM   972  C CD2 . LEU B 1 18  ? -8.491  27.232 12.253  1.00 17.82 ?  18  LEU B CD2 1 
ATOM   973  N N   . SER B 1 19  ? -4.796  30.159 13.763  1.00 12.86 ?  19  SER B N   1 
ATOM   974  C CA  . SER B 1 19  ? -3.613  30.359 12.930  1.00 12.65 ?  19  SER B CA  1 
ATOM   975  C C   . SER B 1 19  ? -2.925  29.044 12.640  1.00 15.11 ?  19  SER B C   1 
ATOM   976  O O   . SER B 1 19  ? -3.055  28.087 13.392  1.00 13.29 ?  19  SER B O   1 
ATOM   977  C CB  . SER B 1 19  ? -2.612  31.311 13.602  1.00 17.83 ?  19  SER B CB  1 
ATOM   978  O OG  . SER B 1 19  ? -3.174  32.592 13.798  1.00 19.81 ?  19  SER B OG  1 
ATOM   979  N N   . ALA B 1 20  ? -2.167  29.005 11.548  1.00 12.55 ?  20  ALA B N   1 
ATOM   980  C CA  . ALA B 1 20  ? -1.411  27.813 11.197  1.00 12.06 ?  20  ALA B CA  1 
ATOM   981  C C   . ALA B 1 20  ? -0.318  28.176 10.210  1.00 14.10 ?  20  ALA B C   1 
ATOM   982  O O   . ALA B 1 20  ? -0.282  29.289 9.689   1.00 14.23 ?  20  ALA B O   1 
ATOM   983  C CB  . ALA B 1 20  ? -2.329  26.731 10.606  1.00 13.30 ?  20  ALA B CB  1 
ATOM   984  N N   . PHE B 1 21  ? 0.569   27.223 9.958   1.00 13.10 ?  21  PHE B N   1 
ATOM   985  C CA  . PHE B 1 21  ? 1.547   27.346 8.890   1.00 13.67 ?  21  PHE B CA  1 
ATOM   986  C C   . PHE B 1 21  ? 1.122   26.377 7.809   1.00 13.25 ?  21  PHE B C   1 
ATOM   987  O O   . PHE B 1 21  ? 1.218   25.167 7.984   1.00 15.89 ?  21  PHE B O   1 
ATOM   988  C CB  . PHE B 1 21  ? 2.967   27.042 9.391   1.00 12.43 ?  21  PHE B CB  1 
ATOM   989  C CG  . PHE B 1 21  ? 3.517   28.091 10.327  1.00 13.94 ?  21  PHE B CG  1 
ATOM   990  C CD1 . PHE B 1 21  ? 3.106   28.143 11.654  1.00 14.67 ?  21  PHE B CD1 1 
ATOM   991  C CD2 . PHE B 1 21  ? 4.427   29.039 9.875   1.00 15.75 ?  21  PHE B CD2 1 
ATOM   992  C CE1 . PHE B 1 21  ? 3.607   29.103 12.515  1.00 16.33 ?  21  PHE B CE1 1 
ATOM   993  C CE2 . PHE B 1 21  ? 4.927   30.007 10.731  1.00 17.43 ?  21  PHE B CE2 1 
ATOM   994  C CZ  . PHE B 1 21  ? 4.520   30.038 12.052  1.00 15.78 ?  21  PHE B CZ  1 
ATOM   995  N N   . CYS B 1 22  ? 0.646   26.914 6.692   1.00 14.06 ?  22  CYS B N   1 
ATOM   996  C CA  . CYS B 1 22  ? 0.025   26.080 5.669   1.00 12.52 ?  22  CYS B CA  1 
ATOM   997  C C   . CYS B 1 22  ? 0.840   25.966 4.401   1.00 15.02 ?  22  CYS B C   1 
ATOM   998  O O   . CYS B 1 22  ? 1.486   26.924 3.967   1.00 16.46 ?  22  CYS B O   1 
ATOM   999  C CB  . CYS B 1 22  ? -1.364  26.612 5.312   1.00 13.79 ?  22  CYS B CB  1 
ATOM   1000 S SG  . CYS B 1 22  ? -2.575  26.551 6.659   1.00 16.28 ?  22  CYS B SG  1 
ATOM   1001 N N   . GLN B 1 23  ? 0.784   24.784 3.804   1.00 14.24 ?  23  GLN B N   1 
ATOM   1002 C CA  . GLN B 1 23  ? 1.449   24.520 2.525   1.00 15.76 ?  23  GLN B CA  1 
ATOM   1003 C C   . GLN B 1 23  ? 0.810   25.298 1.389   1.00 16.94 ?  23  GLN B C   1 
ATOM   1004 O O   . GLN B 1 23  ? -0.414  25.319 1.242   1.00 17.73 ?  23  GLN B O   1 
ATOM   1005 C CB  . GLN B 1 23  ? 1.410   23.032 2.185   1.00 18.72 ?  23  GLN B CB  1 
ATOM   1006 C CG  . GLN B 1 23  ? 2.206   22.142 3.109   1.00 18.67 ?  23  GLN B CG  1 
ATOM   1007 C CD  . GLN B 1 23  ? 1.724   20.708 3.064   1.00 22.55 ?  23  GLN B CD  1 
ATOM   1008 O OE1 . GLN B 1 23  ? 1.068   20.293 2.110   1.00 28.24 ?  23  GLN B OE1 1 
ATOM   1009 N NE2 . GLN B 1 23  ? 2.056   19.940 4.093   1.00 30.15 ?  23  GLN B NE2 1 
ATOM   1010 N N   . LYS B 1 24  ? 1.641   25.929 0.573   1.00 15.10 ?  24  LYS B N   1 
ATOM   1011 C CA  . LYS B 1 24  ? 1.153   26.507 -0.659  1.00 16.05 ?  24  LYS B CA  1 
ATOM   1012 C C   . LYS B 1 24  ? 0.910   25.392 -1.681  1.00 17.69 ?  24  LYS B C   1 
ATOM   1013 O O   . LYS B 1 24  ? 1.152   24.214 -1.405  1.00 17.89 ?  24  LYS B O   1 
ATOM   1014 C CB  . LYS B 1 24  ? 2.131   27.543 -1.188  1.00 21.33 ?  24  LYS B CB  1 
ATOM   1015 C CG  . LYS B 1 24  ? 2.299   28.743 -0.276  1.00 19.67 ?  24  LYS B CG  1 
ATOM   1016 C CD  . LYS B 1 24  ? 2.990   29.864 -1.033  1.00 22.53 ?  24  LYS B CD  1 
ATOM   1017 C CE  . LYS B 1 24  ? 2.716   31.214 -0.430  1.00 30.10 ?  24  LYS B CE  1 
ATOM   1018 N NZ  . LYS B 1 24  ? 2.946   32.270 -1.457  1.00 38.06 1  24  LYS B NZ  1 
ATOM   1019 N N   . ALA B 1 25  ? 0.449   25.777 -2.866  1.00 20.04 ?  25  ALA B N   1 
ATOM   1020 C CA  . ALA B 1 25  ? 0.091   24.818 -3.909  1.00 24.29 ?  25  ALA B CA  1 
ATOM   1021 C C   . ALA B 1 25  ? 1.235   23.865 -4.289  1.00 24.23 ?  25  ALA B C   1 
ATOM   1022 O O   . ALA B 1 25  ? 0.990   22.744 -4.738  1.00 20.63 ?  25  ALA B O   1 
ATOM   1023 C CB  . ALA B 1 25  ? -0.403  25.570 -5.144  1.00 25.14 ?  25  ALA B CB  1 
ATOM   1024 N N   . ASP B 1 26  ? 2.480   24.291 -4.103  1.00 20.33 ?  26  ASP B N   1 
ATOM   1025 C CA  . ASP B 1 26  ? 3.600   23.417 -4.444  1.00 22.12 ?  26  ASP B CA  1 
ATOM   1026 C C   . ASP B 1 26  ? 3.766   22.277 -3.443  1.00 23.67 ?  26  ASP B C   1 
ATOM   1027 O O   . ASP B 1 26  ? 4.529   21.345 -3.681  1.00 29.03 ?  26  ASP B O   1 
ATOM   1028 C CB  . ASP B 1 26  ? 4.909   24.213 -4.582  1.00 23.43 ?  26  ASP B CB  1 
ATOM   1029 C CG  . ASP B 1 26  ? 5.321   24.939 -3.305  1.00 23.10 ?  26  ASP B CG  1 
ATOM   1030 O OD1 . ASP B 1 26  ? 4.773   24.654 -2.221  1.00 22.40 ?  26  ASP B OD1 1 
ATOM   1031 O OD2 . ASP B 1 26  ? 6.222   25.804 -3.388  1.00 23.69 -1 26  ASP B OD2 1 
ATOM   1032 N N   . GLY B 1 27  ? 3.038   22.342 -2.331  1.00 20.21 ?  27  GLY B N   1 
ATOM   1033 C CA  . GLY B 1 27  ? 3.044   21.264 -1.361  1.00 18.91 ?  27  GLY B CA  1 
ATOM   1034 C C   . GLY B 1 27  ? 4.131   21.302 -0.301  1.00 22.40 ?  27  GLY B C   1 
ATOM   1035 O O   . GLY B 1 27  ? 4.227   20.389 0.517   1.00 26.22 ?  27  GLY B O   1 
ATOM   1036 N N   . TYR B 1 28  ? 4.954   22.342 -0.303  1.00 19.27 ?  28  TYR B N   1 
ATOM   1037 C CA  . TYR B 1 28  ? 6.002   22.429 0.706   1.00 24.27 ?  28  TYR B CA  1 
ATOM   1038 C C   . TYR B 1 28  ? 6.324   23.844 1.197   1.00 18.61 ?  28  TYR B C   1 
ATOM   1039 O O   . TYR B 1 28  ? 6.803   24.001 2.315   1.00 22.77 ?  28  TYR B O   1 
ATOM   1040 C CB  . TYR B 1 28  ? 7.279   21.770 0.185   1.00 25.82 ?  28  TYR B CB  1 
ATOM   1041 C CG  . TYR B 1 28  ? 7.790   22.360 -1.098  1.00 22.97 ?  28  TYR B CG  1 
ATOM   1042 C CD1 . TYR B 1 28  ? 8.635   23.462 -1.090  1.00 31.15 ?  28  TYR B CD1 1 
ATOM   1043 C CD2 . TYR B 1 28  ? 7.435   21.813 -2.324  1.00 32.34 ?  28  TYR B CD2 1 
ATOM   1044 C CE1 . TYR B 1 28  ? 9.106   24.007 -2.270  1.00 30.98 ?  28  TYR B CE1 1 
ATOM   1045 C CE2 . TYR B 1 28  ? 7.904   22.351 -3.509  1.00 32.14 ?  28  TYR B CE2 1 
ATOM   1046 C CZ  . TYR B 1 28  ? 8.736   23.447 -3.473  1.00 31.01 ?  28  TYR B CZ  1 
ATOM   1047 O OH  . TYR B 1 28  ? 9.205   23.983 -4.650  1.00 43.01 ?  28  TYR B OH  1 
ATOM   1048 N N   . THR B 1 29  ? 6.089   24.866 0.381   1.00 17.43 ?  29  THR B N   1 
ATOM   1049 C CA  . THR B 1 29  ? 6.305   26.240 0.843   1.00 14.23 ?  29  THR B CA  1 
ATOM   1050 C C   . THR B 1 29  ? 5.308   26.571 1.942   1.00 17.85 ?  29  THR B C   1 
ATOM   1051 O O   . THR B 1 29  ? 4.097   26.511 1.716   1.00 18.91 ?  29  THR B O   1 
ATOM   1052 C CB  . THR B 1 29  ? 6.166   27.268 -0.302  1.00 17.64 ?  29  THR B CB  1 
ATOM   1053 O OG1 . THR B 1 29  ? 7.158   26.997 -1.298  1.00 18.10 ?  29  THR B OG1 1 
ATOM   1054 C CG2 . THR B 1 29  ? 6.360   28.682 0.219   1.00 18.41 ?  29  THR B CG2 1 
ATOM   1055 N N   . LEU B 1 30  ? 5.804   26.924 3.126   1.00 16.25 ?  30  LEU B N   1 
ATOM   1056 C CA  . LEU B 1 30  ? 4.909   27.238 4.234   1.00 16.70 ?  30  LEU B CA  1 
ATOM   1057 C C   . LEU B 1 30  ? 4.535   28.709 4.267   1.00 16.36 ?  30  LEU B C   1 
ATOM   1058 O O   . LEU B 1 30  ? 5.316   29.579 3.877   1.00 16.40 ?  30  LEU B O   1 
ATOM   1059 C CB  . LEU B 1 30  ? 5.530   26.827 5.570   1.00 13.28 ?  30  LEU B CB  1 
ATOM   1060 C CG  . LEU B 1 30  ? 5.671   25.316 5.784   1.00 15.54 ?  30  LEU B CG  1 
ATOM   1061 C CD1 . LEU B 1 30  ? 6.305   25.043 7.130   1.00 17.47 ?  30  LEU B CD1 1 
ATOM   1062 C CD2 . LEU B 1 30  ? 4.312   24.640 5.708   1.00 17.58 ?  30  LEU B CD2 1 
ATOM   1063 N N   . ASN B 1 31  ? 3.305   28.967 4.707   1.00 14.87 ?  31  ASN B N   1 
ATOM   1064 C CA  . ASN B 1 31  ? 2.781   30.315 4.843   1.00 14.24 ?  31  ASN B CA  1 
ATOM   1065 C C   . ASN B 1 31  ? 2.013   30.450 6.145   1.00 16.19 ?  31  ASN B C   1 
ATOM   1066 O O   . ASN B 1 31  ? 1.072   29.692 6.394   1.00 16.20 ?  31  ASN B O   1 
ATOM   1067 C CB  . ASN B 1 31  ? 1.858   30.682 3.673   1.00 14.94 ?  31  ASN B CB  1 
ATOM   1068 C CG  . ASN B 1 31  ? 1.328   32.096 3.788   1.00 19.05 ?  31  ASN B CG  1 
ATOM   1069 O OD1 . ASN B 1 31  ? 2.082   33.062 3.656   1.00 20.78 ?  31  ASN B OD1 1 
ATOM   1070 N ND2 . ASN B 1 31  ? 0.033   32.231 4.047   1.00 19.51 ?  31  ASN B ND2 1 
ATOM   1071 N N   . GLU B 1 32  ? 2.410   31.404 6.979   1.00 14.18 ?  32  GLU B N   1 
ATOM   1072 C CA  . GLU B 1 32  ? 1.687   31.653 8.213   1.00 12.70 ?  32  GLU B CA  1 
ATOM   1073 C C   . GLU B 1 32  ? 0.412   32.401 7.870   1.00 17.82 ?  32  GLU B C   1 
ATOM   1074 O O   . GLU B 1 32  ? 0.437   33.442 7.193   1.00 16.34 ?  32  GLU B O   1 
ATOM   1075 C CB  . GLU B 1 32  ? 2.540   32.435 9.217   1.00 16.45 ?  32  GLU B CB  1 
ATOM   1076 C CG  . GLU B 1 32  ? 1.930   32.505 10.608  1.00 17.23 ?  32  GLU B CG  1 
ATOM   1077 C CD  . GLU B 1 32  ? 2.780   33.306 11.581  1.00 28.84 ?  32  GLU B CD  1 
ATOM   1078 O OE1 . GLU B 1 32  ? 3.600   34.138 11.124  1.00 31.36 ?  32  GLU B OE1 1 
ATOM   1079 O OE2 . GLU B 1 32  ? 2.622   33.111 12.806  1.00 31.52 -1 32  GLU B OE2 1 
ATOM   1080 N N   . THR B 1 33  ? -0.701  31.848 8.335   1.00 14.06 ?  33  THR B N   1 
ATOM   1081 C CA  . THR B 1 33  ? -2.020  32.345 7.962   1.00 13.07 ?  33  THR B CA  1 
ATOM   1082 C C   . THR B 1 33  ? -2.968  32.300 9.152   1.00 14.54 ?  33  THR B C   1 
ATOM   1083 O O   . THR B 1 33  ? -2.823  31.469 10.041  1.00 15.53 ?  33  THR B O   1 
ATOM   1084 C CB  . THR B 1 33  ? -2.577  31.525 6.772   1.00 14.90 ?  33  THR B CB  1 
ATOM   1085 O OG1 . THR B 1 33  ? -3.919  31.930 6.464   1.00 15.44 ?  33  THR B OG1 1 
ATOM   1086 C CG2 . THR B 1 33  ? -2.553  30.044 7.080   1.00 16.65 ?  33  THR B CG2 1 
ATOM   1087 N N   . SER B 1 34  ? -3.922  33.221 9.173   1.00 14.67 ?  34  SER B N   1 
ATOM   1088 C CA  . SER B 1 34  ? -4.883  33.325 10.273  1.00 13.91 ?  34  SER B CA  1 
ATOM   1089 C C   . SER B 1 34  ? -6.280  33.477 9.721   1.00 12.32 ?  34  SER B C   1 
ATOM   1090 O O   . SER B 1 34  ? -6.459  33.962 8.616   1.00 14.23 ?  34  SER B O   1 
ATOM   1091 C CB  . SER B 1 34  ? -4.566  34.517 11.185  1.00 17.08 ?  34  SER B CB  1 
ATOM   1092 O OG  . SER B 1 34  ? -3.309  34.383 11.827  1.00 22.07 ?  34  SER B OG  1 
ATOM   1093 N N   . ILE B 1 35  ? -7.271  33.049 10.495  1.00 13.25 ?  35  ILE B N   1 
ATOM   1094 C CA  . ILE B 1 35  ? -8.671  33.248 10.105  1.00 12.71 ?  35  ILE B CA  1 
ATOM   1095 C C   . ILE B 1 35  ? -9.490  33.440 11.387  1.00 15.85 ?  35  ILE B C   1 
ATOM   1096 O O   . ILE B 1 35  ? -9.263  32.765 12.396  1.00 14.72 ?  35  ILE B O   1 
ATOM   1097 C CB  . ILE B 1 35  ? -9.209  32.065 9.238   1.00 13.13 ?  35  ILE B CB  1 
ATOM   1098 C CG1 . ILE B 1 35  ? -10.564 32.401 8.604   1.00 15.49 ?  35  ILE B CG1 1 
ATOM   1099 C CG2 . ILE B 1 35  ? -9.272  30.765 10.045  1.00 16.47 ?  35  ILE B CG2 1 
ATOM   1100 C CD1 . ILE B 1 35  ? -10.992 31.404 7.526   1.00 17.60 ?  35  ILE B CD1 1 
ATOM   1101 N N   . ASN B 1 36  ? -10.401 34.405 11.368  1.00 13.86 ?  36  ASN B N   1 
ATOM   1102 C CA  . ASN B 1 36  ? -11.190 34.697 12.557  1.00 12.64 ?  36  ASN B CA  1 
ATOM   1103 C C   . ASN B 1 36  ? -12.432 33.800 12.579  1.00 13.20 ?  36  ASN B C   1 
ATOM   1104 O O   . ASN B 1 36  ? -13.296 33.907 11.714  1.00 13.70 ?  36  ASN B O   1 
ATOM   1105 C CB  . ASN B 1 36  ? -11.576 36.178 12.592  1.00 14.07 ?  36  ASN B CB  1 
ATOM   1106 C CG  . ASN B 1 36  ? -12.192 36.593 13.911  1.00 15.18 ?  36  ASN B CG  1 
ATOM   1107 O OD1 . ASN B 1 36  ? -12.675 35.760 14.677  1.00 16.18 ?  36  ASN B OD1 1 
ATOM   1108 N ND2 . ASN B 1 36  ? -12.179 37.891 14.185  1.00 22.59 ?  36  ASN B ND2 1 
ATOM   1109 N N   . LEU B 1 37  ? -12.490 32.893 13.549  1.00 12.35 ?  37  LEU B N   1 
ATOM   1110 C CA  . LEU B 1 37  ? -13.600 31.942 13.641  1.00 11.86 ?  37  LEU B CA  1 
ATOM   1111 C C   . LEU B 1 37  ? -14.925 32.604 13.972  1.00 13.19 ?  37  LEU B C   1 
ATOM   1112 O O   . LEU B 1 37  ? -15.982 32.023 13.725  1.00 14.09 ?  37  LEU B O   1 
ATOM   1113 C CB  . LEU B 1 37  ? -13.299 30.867 14.685  1.00 14.50 ?  37  LEU B CB  1 
ATOM   1114 C CG  . LEU B 1 37  ? -12.056 30.043 14.353  1.00 12.82 ?  37  LEU B CG  1 
ATOM   1115 C CD1 . LEU B 1 37  ? -11.821 28.973 15.391  1.00 13.23 ?  37  LEU B CD1 1 
ATOM   1116 C CD2 . LEU B 1 37  ? -12.218 29.420 12.977  1.00 13.96 ?  37  LEU B CD2 1 
ATOM   1117 N N   . ASP B 1 38  ? -14.881 33.812 14.519  1.00 12.01 ?  38  ASP B N   1 
ATOM   1118 C CA  . ASP B 1 38  ? -16.126 34.530 14.792  1.00 13.35 ?  38  ASP B CA  1 
ATOM   1119 C C   . ASP B 1 38  ? -16.904 34.846 13.512  1.00 13.83 ?  38  ASP B C   1 
ATOM   1120 O O   . ASP B 1 38  ? -18.116 35.098 13.563  1.00 14.42 ?  38  ASP B O   1 
ATOM   1121 C CB  . ASP B 1 38  ? -15.860 35.838 15.543  1.00 14.62 ?  38  ASP B CB  1 
ATOM   1122 C CG  . ASP B 1 38  ? -15.897 35.671 17.046  1.00 16.10 ?  38  ASP B CG  1 
ATOM   1123 O OD1 . ASP B 1 38  ? -16.529 34.711 17.526  1.00 15.11 ?  38  ASP B OD1 1 
ATOM   1124 O OD2 . ASP B 1 38  ? -15.350 36.541 17.753  1.00 18.30 -1 38  ASP B OD2 1 
ATOM   1125 N N   . GLU B 1 39  ? -16.230 34.828 12.366  1.00 13.33 ?  39  GLU B N   1 
ATOM   1126 C CA  . GLU B 1 39  ? -16.909 35.197 11.130  1.00 14.78 ?  39  GLU B CA  1 
ATOM   1127 C C   . GLU B 1 39  ? -17.927 34.154 10.685  1.00 14.33 ?  39  GLU B C   1 
ATOM   1128 O O   . GLU B 1 39  ? -18.915 34.490 10.038  1.00 16.98 ?  39  GLU B O   1 
ATOM   1129 C CB  . GLU B 1 39  ? -15.913 35.400 9.993   1.00 15.88 ?  39  GLU B CB  1 
ATOM   1130 C CG  . GLU B 1 39  ? -15.058 36.626 10.130  1.00 17.43 ?  39  GLU B CG  1 
ATOM   1131 C CD  . GLU B 1 39  ? -13.964 36.666 9.077   1.00 20.29 ?  39  GLU B CD  1 
ATOM   1132 O OE1 . GLU B 1 39  ? -14.025 35.864 8.113   1.00 21.44 ?  39  GLU B OE1 1 
ATOM   1133 O OE2 . GLU B 1 39  ? -13.046 37.485 9.221   1.00 21.39 -1 39  GLU B OE2 1 
ATOM   1134 N N   . GLU B 1 40  ? -17.692 32.886 11.011  1.00 13.61 ?  40  GLU B N   1 
ATOM   1135 C CA  . GLU B 1 40  ? -18.610 31.852 10.525  1.00 14.52 ?  40  GLU B CA  1 
ATOM   1136 C C   . GLU B 1 40  ? -18.963 30.797 11.551  1.00 12.28 ?  40  GLU B C   1 
ATOM   1137 O O   . GLU B 1 40  ? -19.553 29.767 11.206  1.00 13.61 ?  40  GLU B O   1 
ATOM   1138 C CB  . GLU B 1 40  ? -18.040 31.162 9.279   1.00 17.09 ?  40  GLU B CB  1 
ATOM   1139 C CG  . GLU B 1 40  ? -17.973 32.043 8.017   1.00 19.40 ?  40  GLU B CG  1 
ATOM   1140 C CD  . GLU B 1 40  ? -19.334 32.498 7.504   1.00 22.60 ?  40  GLU B CD  1 
ATOM   1141 O OE1 . GLU B 1 40  ? -20.374 31.979 7.961   1.00 19.50 ?  40  GLU B OE1 1 
ATOM   1142 O OE2 . GLU B 1 40  ? -19.362 33.381 6.622   1.00 24.92 -1 40  GLU B OE2 1 
ATOM   1143 N N   . ILE B 1 41  ? -18.630 31.053 12.812  1.00 12.39 ?  41  ILE B N   1 
ATOM   1144 C CA  . ILE B 1 41  ? -19.104 30.182 13.881  1.00 12.56 ?  41  ILE B CA  1 
ATOM   1145 C C   . ILE B 1 41  ? -19.840 31.010 14.922  1.00 10.55 ?  41  ILE B C   1 
ATOM   1146 O O   . ILE B 1 41  ? -19.321 32.000 15.415  1.00 13.61 ?  41  ILE B O   1 
ATOM   1147 C CB  . ILE B 1 41  ? -17.954 29.415 14.553  1.00 11.31 ?  41  ILE B CB  1 
ATOM   1148 C CG1 . ILE B 1 41  ? -17.275 28.520 13.529  1.00 13.26 ?  41  ILE B CG1 1 
ATOM   1149 C CG2 . ILE B 1 41  ? -18.497 28.573 15.716  1.00 13.45 ?  41  ILE B CG2 1 
ATOM   1150 C CD1 . ILE B 1 41  ? -16.043 27.822 14.048  1.00 13.77 ?  41  ILE B CD1 1 
ATOM   1151 N N   . GLY B 1 42  ? -21.072 30.617 15.218  1.00 12.56 ?  42  GLY B N   1 
ATOM   1152 C CA  . GLY B 1 42  ? -21.855 31.298 16.228  1.00 13.59 ?  42  GLY B CA  1 
ATOM   1153 C C   . GLY B 1 42  ? -22.328 30.334 17.295  1.00 14.45 ?  42  GLY B C   1 
ATOM   1154 O O   . GLY B 1 42  ? -22.060 29.136 17.236  1.00 15.50 ?  42  GLY B O   1 
ATOM   1155 N N   . ASN B 1 43  ? -23.054 30.874 18.266  1.00 14.56 ?  43  ASN B N   1 
ATOM   1156 C CA  . ASN B 1 43  ? -23.584 30.087 19.369  1.00 12.90 ?  43  ASN B CA  1 
ATOM   1157 C C   . ASN B 1 43  ? -25.096 30.024 19.245  1.00 14.99 ?  43  ASN B C   1 
ATOM   1158 O O   . ASN B 1 43  ? -25.784 31.017 19.473  1.00 17.18 ?  43  ASN B O   1 
ATOM   1159 C CB  . ASN B 1 43  ? -23.150 30.709 20.694  1.00 12.74 ?  43  ASN B CB  1 
ATOM   1160 C CG  . ASN B 1 43  ? -23.830 30.084 21.894  1.00 17.08 ?  43  ASN B CG  1 
ATOM   1161 O OD1 . ASN B 1 43  ? -24.426 29.013 21.804  1.00 15.72 ?  43  ASN B OD1 1 
ATOM   1162 N ND2 . ASN B 1 43  ? -23.713 30.746 23.039  1.00 15.94 ?  43  ASN B ND2 1 
ATOM   1163 N N   . LEU B 1 44  ? -25.604 28.854 18.870  1.00 14.28 ?  44  LEU B N   1 
ATOM   1164 C CA  . LEU B 1 44  ? -27.036 28.630 18.770  1.00 13.47 ?  44  LEU B CA  1 
ATOM   1165 C C   . LEU B 1 44  ? -27.533 27.832 19.981  1.00 15.66 ?  44  LEU B C   1 
ATOM   1166 O O   . LEU B 1 44  ? -27.428 26.606 20.012  1.00 15.26 ?  44  LEU B O   1 
ATOM   1167 C CB  . LEU B 1 44  ? -27.375 27.894 17.466  1.00 18.03 ?  44  LEU B CB  1 
ATOM   1168 C CG  . LEU B 1 44  ? -28.856 27.697 17.133  1.00 20.86 ?  44  LEU B CG  1 
ATOM   1169 C CD1 . LEU B 1 44  ? -29.489 29.000 16.706  1.00 24.47 ?  44  LEU B CD1 1 
ATOM   1170 C CD2 . LEU B 1 44  ? -29.055 26.626 16.062  1.00 24.97 ?  44  LEU B CD2 1 
ATOM   1171 N N   . ASP B 1 45  ? -28.051 28.542 20.978  1.00 14.73 ?  45  ASP B N   1 
ATOM   1172 C CA  . ASP B 1 45  ? -28.596 27.921 22.183  1.00 14.82 ?  45  ASP B CA  1 
ATOM   1173 C C   . ASP B 1 45  ? -27.611 26.912 22.766  1.00 14.75 ?  45  ASP B C   1 
ATOM   1174 O O   . ASP B 1 45  ? -27.987 25.800 23.133  1.00 15.61 ?  45  ASP B O   1 
ATOM   1175 C CB  . ASP B 1 45  ? -29.950 27.266 21.874  1.00 14.80 ?  45  ASP B CB  1 
ATOM   1176 C CG  . ASP B 1 45  ? -30.652 26.737 23.112  1.00 17.66 ?  45  ASP B CG  1 
ATOM   1177 O OD1 . ASP B 1 45  ? -30.414 27.274 24.217  1.00 17.53 ?  45  ASP B OD1 1 
ATOM   1178 O OD2 . ASP B 1 45  ? -31.442 25.787 22.968  1.00 19.19 -1 45  ASP B OD2 1 
ATOM   1179 N N   . GLY B 1 46  ? -26.340 27.297 22.831  1.00 13.19 ?  46  GLY B N   1 
ATOM   1180 C CA  . GLY B 1 46  ? -25.325 26.442 23.423  1.00 15.60 ?  46  GLY B CA  1 
ATOM   1181 C C   . GLY B 1 46  ? -24.523 25.585 22.452  1.00 14.92 ?  46  GLY B C   1 
ATOM   1182 O O   . GLY B 1 46  ? -23.588 24.900 22.864  1.00 14.95 ?  46  GLY B O   1 
ATOM   1183 N N   . THR B 1 47  ? -24.866 25.642 21.166  1.00 13.96 ?  47  THR B N   1 
ATOM   1184 C CA  . THR B 1 47  ? -24.190 24.819 20.166  1.00 13.85 ?  47  THR B CA  1 
ATOM   1185 C C   . THR B 1 47  ? -23.381 25.665 19.195  1.00 13.35 ?  47  THR B C   1 
ATOM   1186 O O   . THR B 1 47  ? -23.931 26.526 18.509  1.00 14.70 ?  47  THR B O   1 
ATOM   1187 C CB  . THR B 1 47  ? -25.198 23.977 19.365  1.00 14.99 ?  47  THR B CB  1 
ATOM   1188 O OG1 . THR B 1 47  ? -25.973 23.165 20.260  1.00 15.03 ?  47  THR B OG1 1 
ATOM   1189 C CG2 . THR B 1 47  ? -24.474 23.097 18.367  1.00 13.36 ?  47  THR B CG2 1 
ATOM   1190 N N   . LEU B 1 48  ? -22.074 25.423 19.135  1.00 13.06 ?  48  LEU B N   1 
ATOM   1191 C CA  . LEU B 1 48  ? -21.251 26.056 18.113  1.00 11.66 ?  48  LEU B CA  1 
ATOM   1192 C C   . LEU B 1 48  ? -21.756 25.640 16.737  1.00 13.34 ?  48  LEU B C   1 
ATOM   1193 O O   . LEU B 1 48  ? -21.875 24.451 16.439  1.00 15.03 ?  48  LEU B O   1 
ATOM   1194 C CB  . LEU B 1 48  ? -19.784 25.671 18.284  1.00 14.27 ?  48  LEU B CB  1 
ATOM   1195 C CG  . LEU B 1 48  ? -19.118 26.222 19.546  1.00 11.95 ?  48  LEU B CG  1 
ATOM   1196 C CD1 . LEU B 1 48  ? -17.751 25.576 19.781  1.00 14.36 ?  48  LEU B CD1 1 
ATOM   1197 C CD2 . LEU B 1 48  ? -18.996 27.729 19.483  1.00 12.82 ?  48  LEU B CD2 1 
ATOM   1198 N N   . SER B 1 49  ? -22.055 26.625 15.905  1.00 12.21 ?  49  SER B N   1 
ATOM   1199 C CA  . SER B 1 49  ? -22.766 26.355 14.667  1.00 15.16 ?  49  SER B CA  1 
ATOM   1200 C C   . SER B 1 49  ? -22.189 27.126 13.494  1.00 12.36 ?  49  SER B C   1 
ATOM   1201 O O   . SER B 1 49  ? -22.057 28.346 13.553  1.00 13.32 ?  49  SER B O   1 
ATOM   1202 C CB  . SER B 1 49  ? -24.248 26.704 14.828  1.00 15.95 ?  49  SER B CB  1 
ATOM   1203 O OG  . SER B 1 49  ? -24.841 25.979 15.891  1.00 18.94 ?  49  SER B OG  1 
ATOM   1204 N N   . TRP B 1 50  ? -21.875 26.408 12.419  1.00 13.31 ?  50  TRP B N   1 
ATOM   1205 C CA  . TRP B 1 50  ? -21.398 27.044 11.204  1.00 15.07 ?  50  TRP B CA  1 
ATOM   1206 C C   . TRP B 1 50  ? -22.462 27.939 10.594  1.00 14.18 ?  50  TRP B C   1 
ATOM   1207 O O   . TRP B 1 50  ? -23.639 27.567 10.540  1.00 15.14 ?  50  TRP B O   1 
ATOM   1208 C CB  . TRP B 1 50  ? -21.008 26.003 10.157  1.00 16.64 ?  50  TRP B CB  1 
ATOM   1209 C CG  . TRP B 1 50  ? -19.840 25.138 10.457  1.00 13.88 ?  50  TRP B CG  1 
ATOM   1210 C CD1 . TRP B 1 50  ? -19.867 23.801 10.730  1.00 13.72 ?  50  TRP B CD1 1 
ATOM   1211 C CD2 . TRP B 1 50  ? -18.456 25.520 10.458  1.00 13.58 ?  50  TRP B CD2 1 
ATOM   1212 N NE1 . TRP B 1 50  ? -18.587 23.328 10.912  1.00 15.25 ?  50  TRP B NE1 1 
ATOM   1213 C CE2 . TRP B 1 50  ? -17.705 24.365 10.758  1.00 15.66 ?  50  TRP B CE2 1 
ATOM   1214 C CE3 . TRP B 1 50  ? -17.781 26.730 10.242  1.00 14.04 ?  50  TRP B CE3 1 
ATOM   1215 C CZ2 . TRP B 1 50  ? -16.310 24.378 10.841  1.00 13.75 ?  50  TRP B CZ2 1 
ATOM   1216 C CZ3 . TRP B 1 50  ? -16.398 26.746 10.331  1.00 17.41 ?  50  TRP B CZ3 1 
ATOM   1217 C CH2 . TRP B 1 50  ? -15.675 25.575 10.627  1.00 15.17 ?  50  TRP B CH2 1 
ATOM   1218 N N   . GLY B 1 51  ? -22.028 29.085 10.083  1.00 16.14 ?  51  GLY B N   1 
ATOM   1219 C CA  . GLY B 1 51  ? -22.908 29.984 9.362   1.00 15.18 ?  51  GLY B CA  1 
ATOM   1220 C C   . GLY B 1 51  ? -23.530 31.031 10.258  1.00 17.71 ?  51  GLY B C   1 
ATOM   1221 O O   . GLY B 1 51  ? -24.088 32.014 9.773   1.00 17.77 ?  51  GLY B O   1 
ATOM   1222 N N   . ASP B 1 52  ? -23.461 30.805 11.564  1.00 15.57 ?  52  ASP B N   1 
ATOM   1223 C CA  . ASP B 1 52  ? -23.783 31.853 12.514  1.00 14.62 ?  52  ASP B CA  1 
ATOM   1224 C C   . ASP B 1 52  ? -22.484 32.590 12.823  1.00 14.12 ?  52  ASP B C   1 
ATOM   1225 O O   . ASP B 1 52  ? -21.458 32.296 12.217  1.00 16.05 ?  52  ASP B O   1 
ATOM   1226 C CB  . ASP B 1 52  ? -24.456 31.276 13.762  1.00 16.75 ?  52  ASP B CB  1 
ATOM   1227 C CG  . ASP B 1 52  ? -25.846 30.710 13.456  1.00 24.73 ?  52  ASP B CG  1 
ATOM   1228 O OD1 . ASP B 1 52  ? -26.569 31.330 12.646  1.00 22.35 ?  52  ASP B OD1 1 
ATOM   1229 O OD2 . ASP B 1 52  ? -26.217 29.652 14.005  1.00 27.46 -1 52  ASP B OD2 1 
ATOM   1230 N N   . HIS B 1 53  ? -22.521 33.555 13.734  1.00 15.95 ?  53  HIS B N   1 
ATOM   1231 C CA  . HIS B 1 53  ? -21.374 34.442 13.923  1.00 13.23 ?  53  HIS B CA  1 
ATOM   1232 C C   . HIS B 1 53  ? -21.143 34.791 15.383  1.00 13.48 ?  53  HIS B C   1 
ATOM   1233 O O   . HIS B 1 53  ? -22.060 34.736 16.202  1.00 13.26 ?  53  HIS B O   1 
ATOM   1234 C CB  . HIS B 1 53  ? -21.566 35.744 13.132  1.00 15.82 ?  53  HIS B CB  1 
ATOM   1235 C CG  . HIS B 1 53  ? -22.181 35.539 11.784  1.00 16.32 ?  53  HIS B CG  1 
ATOM   1236 N ND1 . HIS B 1 53  ? -21.469 35.056 10.709  1.00 18.46 ?  53  HIS B ND1 1 
ATOM   1237 C CD2 . HIS B 1 53  ? -23.452 35.718 11.346  1.00 17.63 ?  53  HIS B CD2 1 
ATOM   1238 C CE1 . HIS B 1 53  ? -22.266 34.966 9.660   1.00 18.67 ?  53  HIS B CE1 1 
ATOM   1239 N NE2 . HIS B 1 53  ? -23.473 35.364 10.019  1.00 16.77 ?  53  HIS B NE2 1 
ATOM   1240 N N   . ASN B 1 54  ? -19.899 35.160 15.682  1.00 14.42 ?  54  ASN B N   1 
ATOM   1241 C CA  . ASN B 1 54  ? -19.528 35.793 16.939  1.00 12.56 ?  54  ASN B CA  1 
ATOM   1242 C C   . ASN B 1 54  ? -19.757 34.940 18.172  1.00 13.34 ?  54  ASN B C   1 
ATOM   1243 O O   . ASN B 1 54  ? -20.159 35.453 19.216  1.00 15.85 ?  54  ASN B O   1 
ATOM   1244 C CB  . ASN B 1 54  ? -20.289 37.117 17.081  1.00 15.47 ?  54  ASN B CB  1 
ATOM   1245 C CG  . ASN B 1 54  ? -20.036 38.042 15.910  1.00 13.93 ?  54  ASN B CG  1 
ATOM   1246 O OD1 . ASN B 1 54  ? -20.973 38.446 15.191  1.00 21.26 ?  54  ASN B OD1 1 
ATOM   1247 N ND2 . ASN B 1 54  ? -18.779 38.331 15.666  1.00 12.73 ?  54  ASN B ND2 1 
ATOM   1248 N N   . PHE B 1 55  ? -19.481 33.646 18.058  1.00 12.71 ?  55  PHE B N   1 
ATOM   1249 C CA  . PHE B 1 55  ? -19.611 32.742 19.199  1.00 12.27 ?  55  PHE B CA  1 
ATOM   1250 C C   . PHE B 1 55  ? -18.851 33.236 20.436  1.00 12.91 ?  55  PHE B C   1 
ATOM   1251 O O   . PHE B 1 55  ? -19.279 32.980 21.562  1.00 14.78 ?  55  PHE B O   1 
ATOM   1252 C CB  . PHE B 1 55  ? -19.107 31.336 18.837  1.00 11.37 ?  55  PHE B CB  1 
ATOM   1253 C CG  . PHE B 1 55  ? -17.618 31.222 18.858  1.00 12.29 ?  55  PHE B CG  1 
ATOM   1254 C CD1 . PHE B 1 55  ? -16.872 31.562 17.743  1.00 13.66 ?  55  PHE B CD1 1 
ATOM   1255 C CD2 . PHE B 1 55  ? -16.951 30.792 20.007  1.00 11.63 ?  55  PHE B CD2 1 
ATOM   1256 C CE1 . PHE B 1 55  ? -15.496 31.484 17.776  1.00 12.38 ?  55  PHE B CE1 1 
ATOM   1257 C CE2 . PHE B 1 55  ? -15.572 30.710 20.029  1.00 12.80 ?  55  PHE B CE2 1 
ATOM   1258 C CZ  . PHE B 1 55  ? -14.850 31.060 18.920  1.00 17.44 ?  55  PHE B CZ  1 
ATOM   1259 N N   . SER B 1 56  ? -17.726 33.928 20.235  1.00 13.93 ?  56  SER B N   1 
ATOM   1260 C CA  . SER B 1 56  ? -16.833 34.236 21.355  1.00 14.65 ?  56  SER B CA  1 
ATOM   1261 C C   . SER B 1 56  ? -17.482 35.176 22.359  1.00 15.34 ?  56  SER B C   1 
ATOM   1262 O O   . SER B 1 56  ? -17.043 35.259 23.503  1.00 17.56 ?  56  SER B O   1 
ATOM   1263 C CB  . SER B 1 56  ? -15.510 34.839 20.856  1.00 13.81 ?  56  SER B CB  1 
ATOM   1264 O OG  . SER B 1 56  ? -15.704 36.154 20.370  1.00 17.34 ?  56  SER B OG  1 
ATOM   1265 N N   . LEU B 1 57  ? -18.533 35.875 21.943  1.00 13.83 ?  57  LEU B N   1 
ATOM   1266 C CA  . LEU B 1 57  ? -19.189 36.822 22.839  1.00 15.23 ?  57  LEU B CA  1 
ATOM   1267 C C   . LEU B 1 57  ? -20.071 36.145 23.874  1.00 17.42 ?  57  LEU B C   1 
ATOM   1268 O O   . LEU B 1 57  ? -20.431 36.757 24.881  1.00 19.04 ?  57  LEU B O   1 
ATOM   1269 C CB  . LEU B 1 57  ? -20.025 37.821 22.045  1.00 17.79 ?  57  LEU B CB  1 
ATOM   1270 C CG  . LEU B 1 57  ? -19.256 38.693 21.058  1.00 18.65 ?  57  LEU B CG  1 
ATOM   1271 C CD1 . LEU B 1 57  ? -20.197 39.685 20.385  1.00 17.79 ?  57  LEU B CD1 1 
ATOM   1272 C CD2 . LEU B 1 57  ? -18.123 39.415 21.763  1.00 20.40 ?  57  LEU B CD2 1 
ATOM   1273 N N   . THR B 1 58  ? -20.436 34.891 23.631  1.00 16.62 ?  58  THR B N   1 
ATOM   1274 C CA  . THR B 1 58  ? -21.349 34.207 24.545  1.00 15.25 ?  58  THR B CA  1 
ATOM   1275 C C   . THR B 1 58  ? -20.856 32.815 24.918  1.00 16.96 ?  58  THR B C   1 
ATOM   1276 O O   . THR B 1 58  ? -21.640 31.974 25.354  1.00 16.95 ?  58  THR B O   1 
ATOM   1277 C CB  . THR B 1 58  ? -22.756 34.087 23.943  1.00 18.95 ?  58  THR B CB  1 
ATOM   1278 O OG1 . THR B 1 58  ? -22.681 33.411 22.682  1.00 17.25 ?  58  THR B OG1 1 
ATOM   1279 C CG2 . THR B 1 58  ? -23.372 35.466 23.729  1.00 16.79 ?  58  THR B CG2 1 
ATOM   1280 N N   . CYS B 1 59  ? -19.557 32.578 24.760  1.00 15.06 ?  59  CYS B N   1 
ATOM   1281 C CA  . CYS B 1 59  ? -18.962 31.295 25.136  1.00 16.15 ?  59  CYS B CA  1 
ATOM   1282 C C   . CYS B 1 59  ? -17.728 31.512 26.006  1.00 16.70 ?  59  CYS B C   1 
ATOM   1283 O O   . CYS B 1 59  ? -16.996 32.488 25.827  1.00 17.27 ?  59  CYS B O   1 
ATOM   1284 C CB  . CYS B 1 59  ? -18.590 30.470 23.896  1.00 16.53 ?  59  CYS B CB  1 
ATOM   1285 S SG  . CYS B 1 59  ? -19.981 30.039 22.806  1.00 16.86 ?  59  CYS B SG  1 
ATOM   1286 N N   . ASP B 1 60  ? -17.515 30.595 26.944  1.00 16.94 ?  60  ASP B N   1 
ATOM   1287 C CA  . ASP B 1 60  ? -16.382 30.645 27.862  1.00 19.96 ?  60  ASP B CA  1 
ATOM   1288 C C   . ASP B 1 60  ? -15.450 29.474 27.597  1.00 15.98 ?  60  ASP B C   1 
ATOM   1289 O O   . ASP B 1 60  ? -15.802 28.553 26.854  1.00 16.25 ?  60  ASP B O   1 
ATOM   1290 C CB  . ASP B 1 60  ? -16.856 30.586 29.321  1.00 19.64 ?  60  ASP B CB  1 
ATOM   1291 C CG  . ASP B 1 60  ? -17.681 31.783 29.725  1.00 32.20 ?  60  ASP B CG  1 
ATOM   1292 O OD1 . ASP B 1 60  ? -17.474 32.876 29.156  1.00 35.71 ?  60  ASP B OD1 1 
ATOM   1293 O OD2 . ASP B 1 60  ? -18.530 31.627 30.625  1.00 34.95 -1 60  ASP B OD2 1 
ATOM   1294 N N   . SER B 1 61  ? -14.279 29.494 28.227  1.00 16.98 ?  61  SER B N   1 
ATOM   1295 C CA  . SER B 1 61  ? -13.367 28.354 28.191  1.00 17.19 ?  61  SER B CA  1 
ATOM   1296 C C   . SER B 1 61  ? -13.104 27.881 26.774  1.00 15.15 ?  61  SER B C   1 
ATOM   1297 O O   . SER B 1 61  ? -13.169 26.686 26.481  1.00 16.97 ?  61  SER B O   1 
ATOM   1298 C CB  . SER B 1 61  ? -13.933 27.208 29.024  1.00 18.42 ?  61  SER B CB  1 
ATOM   1299 O OG  . SER B 1 61  ? -14.152 27.633 30.360  1.00 24.30 ?  61  SER B OG  1 
ATOM   1300 N N   . ILE B 1 62  ? -12.818 28.840 25.902  1.00 15.08 ?  62  ILE B N   1 
ATOM   1301 C CA  . ILE B 1 62  ? -12.608 28.571 24.487  1.00 13.89 ?  62  ILE B CA  1 
ATOM   1302 C C   . ILE B 1 62  ? -11.220 28.002 24.232  1.00 16.88 ?  62  ILE B C   1 
ATOM   1303 O O   . ILE B 1 62  ? -10.219 28.542 24.708  1.00 19.44 ?  62  ILE B O   1 
ATOM   1304 C CB  . ILE B 1 62  ? -12.799 29.847 23.678  1.00 16.31 ?  62  ILE B CB  1 
ATOM   1305 C CG1 . ILE B 1 62  ? -14.222 30.380 23.884  1.00 13.94 ?  62  ILE B CG1 1 
ATOM   1306 C CG2 . ILE B 1 62  ? -12.469 29.607 22.204  1.00 16.50 ?  62  ILE B CG2 1 
ATOM   1307 C CD1 . ILE B 1 62  ? -14.405 31.826 23.492  1.00 14.94 ?  62  ILE B CD1 1 
ATOM   1308 N N   . GLY B 1 63  ? -11.152 26.923 23.466  1.00 13.97 ?  63  GLY B N   1 
ATOM   1309 C CA  . GLY B 1 63  ? -9.869  26.323 23.177  1.00 14.62 ?  63  GLY B CA  1 
ATOM   1310 C C   . GLY B 1 63  ? -9.872  25.481 21.926  1.00 14.68 ?  63  GLY B C   1 
ATOM   1311 O O   . GLY B 1 63  ? -10.923 25.142 21.379  1.00 15.97 ?  63  GLY B O   1 
ATOM   1312 N N   . LEU B 1 64  ? -8.670  25.159 21.467  1.00 15.43 ?  64  LEU B N   1 
ATOM   1313 C CA  . LEU B 1 64  ? -8.479  24.275 20.345  1.00 15.57 ?  64  LEU B CA  1 
ATOM   1314 C C   . LEU B 1 64  ? -8.047  22.924 20.898  1.00 17.02 ?  64  LEU B C   1 
ATOM   1315 O O   . LEU B 1 64  ? -7.207  22.862 21.794  1.00 18.65 ?  64  LEU B O   1 
ATOM   1316 C CB  . LEU B 1 64  ? -7.426  24.855 19.396  1.00 15.93 ?  64  LEU B CB  1 
ATOM   1317 C CG  . LEU B 1 64  ? -6.981  24.004 18.216  1.00 17.60 ?  64  LEU B CG  1 
ATOM   1318 C CD1 . LEU B 1 64  ? -8.110  23.900 17.193  1.00 17.50 ?  64  LEU B CD1 1 
ATOM   1319 C CD2 . LEU B 1 64  ? -5.750  24.626 17.594  1.00 17.48 ?  64  LEU B CD2 1 
ATOM   1320 N N   . ALA B 1 65  ? -8.627  21.846 20.387  1.00 16.01 ?  65  ALA B N   1 
ATOM   1321 C CA  . ALA B 1 65  ? -8.256  20.520 20.849  1.00 16.21 ?  65  ALA B CA  1 
ATOM   1322 C C   . ALA B 1 65  ? -8.363  19.530 19.716  1.00 16.38 ?  65  ALA B C   1 
ATOM   1323 O O   . ALA B 1 65  ? -8.877  19.849 18.643  1.00 15.80 ?  65  ALA B O   1 
ATOM   1324 C CB  . ALA B 1 65  ? -9.142  20.085 22.024  1.00 19.77 ?  65  ALA B CB  1 
ATOM   1325 N N   . GLN B 1 66  ? -7.840  18.336 19.953  1.00 19.52 ?  66  GLN B N   1 
ATOM   1326 C CA  . GLN B 1 66  ? -8.113  17.197 19.097  1.00 18.28 ?  66  GLN B CA  1 
ATOM   1327 C C   . GLN B 1 66  ? -9.105  16.342 19.856  1.00 19.95 ?  66  GLN B C   1 
ATOM   1328 O O   . GLN B 1 66  ? -8.851  15.978 21.006  1.00 22.44 ?  66  GLN B O   1 
ATOM   1329 C CB  . GLN B 1 66  ? -6.836  16.430 18.761  1.00 22.68 ?  66  GLN B CB  1 
ATOM   1330 C CG  . GLN B 1 66  ? -5.931  17.168 17.784  1.00 23.01 ?  66  GLN B CG  1 
ATOM   1331 C CD  . GLN B 1 66  ? -4.471  16.765 17.906  1.00 30.68 ?  66  GLN B CD  1 
ATOM   1332 O OE1 . GLN B 1 66  ? -3.946  16.059 17.054  1.00 30.41 ?  66  GLN B OE1 1 
ATOM   1333 N NE2 . GLN B 1 66  ? -3.807  17.226 18.963  1.00 34.12 ?  66  GLN B NE2 1 
ATOM   1334 N N   . SER B 1 67  ? -10.252 16.072 19.240  1.00 18.83 ?  67  SER B N   1 
ATOM   1335 C CA  . SER B 1 67  ? -11.338 15.367 19.917  1.00 17.72 ?  67  SER B CA  1 
ATOM   1336 C C   . SER B 1 67  ? -10.867 14.028 20.455  1.00 18.50 ?  67  SER B C   1 
ATOM   1337 O O   . SER B 1 67  ? -10.043 13.366 19.841  1.00 21.66 ?  67  SER B O   1 
ATOM   1338 C CB  . SER B 1 67  ? -12.524 15.169 18.980  1.00 21.20 ?  67  SER B CB  1 
ATOM   1339 O OG  . SER B 1 67  ? -13.723 14.992 19.721  1.00 27.10 ?  67  SER B OG  1 
ATOM   1340 N N   . LEU B 1 68  ? -11.377 13.643 21.619  1.00 17.07 ?  68  LEU B N   1 
ATOM   1341 C CA  . LEU B 1 68  ? -10.836 12.491 22.325  1.00 18.53 ?  68  LEU B CA  1 
ATOM   1342 C C   . LEU B 1 68  ? -10.844 11.194 21.515  1.00 21.87 ?  68  LEU B C   1 
ATOM   1343 O O   . LEU B 1 68  ? -9.832  10.506 21.429  1.00 22.90 ?  68  LEU B O   1 
ATOM   1344 C CB  . LEU B 1 68  ? -11.600 12.263 23.625  1.00 21.44 ?  68  LEU B CB  1 
ATOM   1345 C CG  . LEU B 1 68  ? -11.072 11.028 24.359  1.00 25.70 ?  68  LEU B CG  1 
ATOM   1346 C CD1 . LEU B 1 68  ? -9.662  11.268 24.882  1.00 29.42 ?  68  LEU B CD1 1 
ATOM   1347 C CD2 . LEU B 1 68  ? -12.008 10.618 25.459  1.00 27.62 ?  68  LEU B CD2 1 
ATOM   1348 N N   . PHE B 1 69  ? -11.985 10.841 20.937  1.00 22.24 ?  69  PHE B N   1 
ATOM   1349 C CA  . PHE B 1 69  ? -12.083 9.550  20.266  1.00 21.92 ?  69  PHE B CA  1 
ATOM   1350 C C   . PHE B 1 69  ? -11.626 9.590  18.819  1.00 24.25 ?  69  PHE B C   1 
ATOM   1351 O O   . PHE B 1 69  ? -10.994 8.655  18.336  1.00 26.29 ?  69  PHE B O   1 
ATOM   1352 C CB  . PHE B 1 69  ? -13.522 9.030  20.338  1.00 23.06 ?  69  PHE B CB  1 
ATOM   1353 C CG  . PHE B 1 69  ? -13.997 8.773  21.736  1.00 23.08 ?  69  PHE B CG  1 
ATOM   1354 C CD1 . PHE B 1 69  ? -13.427 7.765  22.497  1.00 26.00 ?  69  PHE B CD1 1 
ATOM   1355 C CD2 . PHE B 1 69  ? -15.017 9.535  22.292  1.00 28.77 ?  69  PHE B CD2 1 
ATOM   1356 C CE1 . PHE B 1 69  ? -13.856 7.520  23.792  1.00 26.83 ?  69  PHE B CE1 1 
ATOM   1357 C CE2 . PHE B 1 69  ? -15.455 9.294  23.583  1.00 28.55 ?  69  PHE B CE2 1 
ATOM   1358 C CZ  . PHE B 1 69  ? -14.874 8.285  24.335  1.00 29.42 ?  69  PHE B CZ  1 
ATOM   1359 N N   . THR B 1 70  ? -11.946 10.684 18.139  1.00 25.95 ?  70  THR B N   1 
ATOM   1360 C CA  . THR B 1 70  ? -11.759 10.791 16.697  1.00 28.00 ?  70  THR B CA  1 
ATOM   1361 C C   . THR B 1 70  ? -10.478 11.527 16.289  1.00 25.60 ?  70  THR B C   1 
ATOM   1362 O O   . THR B 1 70  ? -10.011 11.392 15.154  1.00 25.34 ?  70  THR B O   1 
ATOM   1363 C CB  . THR B 1 70  ? -12.964 11.509 16.068  1.00 20.33 ?  70  THR B CB  1 
ATOM   1364 O OG1 . THR B 1 70  ? -13.138 12.784 16.701  1.00 26.07 ?  70  THR B OG1 1 
ATOM   1365 C CG2 . THR B 1 70  ? -14.232 10.701 16.293  1.00 32.39 ?  70  THR B CG2 1 
ATOM   1366 N N   . ARG B 1 71  ? -9.914  12.300 17.220  1.00 20.51 ?  71  ARG B N   1 
ATOM   1367 C CA  . ARG B 1 71  ? -8.729  13.128 16.971  1.00 21.60 ?  71  ARG B CA  1 
ATOM   1368 C C   . ARG B 1 71  ? -9.002  14.171 15.882  1.00 18.95 ?  71  ARG B C   1 
ATOM   1369 O O   . ARG B 1 71  ? -8.097  14.603 15.178  1.00 21.71 ?  71  ARG B O   1 
ATOM   1370 C CB  . ARG B 1 71  ? -7.518  12.267 16.598  1.00 25.02 ?  71  ARG B CB  1 
ATOM   1371 C CG  . ARG B 1 71  ? -7.355  11.027 17.462  1.00 29.10 ?  71  ARG B CG  1 
ATOM   1372 C CD  . ARG B 1 71  ? -7.385  11.376 18.936  1.00 26.48 ?  71  ARG B CD  1 
ATOM   1373 N NE  . ARG B 1 71  ? -6.213  12.140 19.351  1.00 34.15 ?  71  ARG B NE  1 
ATOM   1374 C CZ  . ARG B 1 71  ? -6.142  12.836 20.481  1.00 37.62 ?  71  ARG B CZ  1 
ATOM   1375 N NH1 . ARG B 1 71  ? -7.181  12.870 21.306  1.00 32.62 1  71  ARG B NH1 1 
ATOM   1376 N NH2 . ARG B 1 71  ? -5.034  13.498 20.785  1.00 36.88 ?  71  ARG B NH2 1 
ATOM   1377 N N   . THR B 1 72  ? -10.260 14.566 15.751  1.00 17.25 ?  72  THR B N   1 
ATOM   1378 C CA  . THR B 1 72  ? -10.612 15.643 14.837  1.00 16.43 ?  72  THR B CA  1 
ATOM   1379 C C   . THR B 1 72  ? -10.223 16.965 15.471  1.00 16.33 ?  72  THR B C   1 
ATOM   1380 O O   . THR B 1 72  ? -10.285 17.114 16.688  1.00 16.22 ?  72  THR B O   1 
ATOM   1381 C CB  . THR B 1 72  ? -12.125 15.654 14.492  1.00 18.10 ?  72  THR B CB  1 
ATOM   1382 O OG1 . THR B 1 72  ? -12.897 15.801 15.693  1.00 22.24 ?  72  THR B OG1 1 
ATOM   1383 C CG2 . THR B 1 72  ? -12.532 14.362 13.777  1.00 18.45 ?  72  THR B CG2 1 
ATOM   1384 N N   . TYR B 1 73  ? -9.812  17.922 14.649  1.00 14.95 ?  73  TYR B N   1 
ATOM   1385 C CA  . TYR B 1 73  ? -9.520  19.257 15.148  1.00 16.79 ?  73  TYR B CA  1 
ATOM   1386 C C   . TYR B 1 73  ? -10.784 20.002 15.488  1.00 13.86 ?  73  TYR B C   1 
ATOM   1387 O O   . TYR B 1 73  ? -11.633 20.227 14.624  1.00 15.79 ?  73  TYR B O   1 
ATOM   1388 C CB  . TYR B 1 73  ? -8.718  20.044 14.122  1.00 15.68 ?  73  TYR B CB  1 
ATOM   1389 C CG  . TYR B 1 73  ? -7.269  19.713 14.216  1.00 16.53 ?  73  TYR B CG  1 
ATOM   1390 C CD1 . TYR B 1 73  ? -6.453  20.392 15.105  1.00 14.03 ?  73  TYR B CD1 1 
ATOM   1391 C CD2 . TYR B 1 73  ? -6.730  18.686 13.468  1.00 18.17 ?  73  TYR B CD2 1 
ATOM   1392 C CE1 . TYR B 1 73  ? -5.112  20.075 15.219  1.00 20.47 ?  73  TYR B CE1 1 
ATOM   1393 C CE2 . TYR B 1 73  ? -5.398  18.365 13.568  1.00 21.98 ?  73  TYR B CE2 1 
ATOM   1394 C CZ  . TYR B 1 73  ? -4.596  19.064 14.445  1.00 20.57 ?  73  TYR B CZ  1 
ATOM   1395 O OH  . TYR B 1 73  ? -3.257  18.743 14.550  1.00 26.11 ?  73  TYR B OH  1 
ATOM   1396 N N   . VAL B 1 74  ? -10.926 20.376 16.753  1.00 13.63 ?  74  VAL B N   1 
ATOM   1397 C CA  . VAL B 1 74  ? -12.159 21.028 17.180  1.00 12.95 ?  74  VAL B CA  1 
ATOM   1398 C C   . VAL B 1 74  ? -11.916 22.356 17.901  1.00 13.12 ?  74  VAL B C   1 
ATOM   1399 O O   . VAL B 1 74  ? -10.924 22.531 18.608  1.00 14.34 ?  74  VAL B O   1 
ATOM   1400 C CB  . VAL B 1 74  ? -13.002 20.103 18.103  1.00 15.29 ?  74  VAL B CB  1 
ATOM   1401 C CG1 . VAL B 1 74  ? -13.519 18.892 17.325  1.00 15.95 ?  74  VAL B CG1 1 
ATOM   1402 C CG2 . VAL B 1 74  ? -12.215 19.678 19.333  1.00 14.24 ?  74  VAL B CG2 1 
ATOM   1403 N N   . LEU B 1 75  ? -12.820 23.300 17.663  1.00 12.81 ?  75  LEU B N   1 
ATOM   1404 C CA  . LEU B 1 75  ? -13.011 24.434 18.553  1.00 14.10 ?  75  LEU B CA  1 
ATOM   1405 C C   . LEU B 1 75  ? -13.941 23.952 19.649  1.00 13.13 ?  75  LEU B C   1 
ATOM   1406 O O   . LEU B 1 75  ? -15.011 23.399 19.360  1.00 15.08 ?  75  LEU B O   1 
ATOM   1407 C CB  . LEU B 1 75  ? -13.599 25.636 17.810  1.00 13.83 ?  75  LEU B CB  1 
ATOM   1408 C CG  . LEU B 1 75  ? -14.080 26.810 18.660  1.00 14.88 ?  75  LEU B CG  1 
ATOM   1409 C CD1 . LEU B 1 75  ? -12.908 27.558 19.251  1.00 14.68 ?  75  LEU B CD1 1 
ATOM   1410 C CD2 . LEU B 1 75  ? -14.934 27.738 17.812  1.00 14.45 ?  75  LEU B CD2 1 
ATOM   1411 N N   . ALA B 1 76  ? -13.507 24.106 20.897  1.00 14.50 ?  76  ALA B N   1 
ATOM   1412 C CA  . ALA B 1 76  ? -14.276 23.634 22.043  1.00 12.20 ?  76  ALA B CA  1 
ATOM   1413 C C   . ALA B 1 76  ? -14.551 24.773 22.983  1.00 13.61 ?  76  ALA B C   1 
ATOM   1414 O O   . ALA B 1 76  ? -13.697 25.624 23.204  1.00 16.55 ?  76  ALA B O   1 
ATOM   1415 C CB  . ALA B 1 76  ? -13.526 22.526 22.763  1.00 14.61 ?  76  ALA B CB  1 
ATOM   1416 N N   . ALA B 1 77  ? -15.732 24.776 23.579  1.00 12.47 ?  77  ALA B N   1 
ATOM   1417 C CA  . ALA B 1 77  ? -16.057 25.831 24.510  1.00 12.58 ?  77  ALA B CA  1 
ATOM   1418 C C   . ALA B 1 77  ? -17.178 25.405 25.423  1.00 14.31 ?  77  ALA B C   1 
ATOM   1419 O O   . ALA B 1 77  ? -17.730 24.309 25.279  1.00 15.51 ?  77  ALA B O   1 
ATOM   1420 C CB  . ALA B 1 77  ? -16.442 27.099 23.760  1.00 15.03 ?  77  ALA B CB  1 
ATOM   1421 N N   . GLU B 1 78  ? -17.483 26.277 26.375  1.00 13.69 ?  78  GLU B N   1 
ATOM   1422 C CA  . GLU B 1 78  ? -18.689 26.171 27.179  1.00 13.92 ?  78  GLU B CA  1 
ATOM   1423 C C   . GLU B 1 78  ? -19.580 27.316 26.751  1.00 15.46 ?  78  GLU B C   1 
ATOM   1424 O O   . GLU B 1 78  ? -19.248 28.468 26.999  1.00 18.04 ?  78  GLU B O   1 
ATOM   1425 C CB  . GLU B 1 78  ? -18.365 26.264 28.670  1.00 16.20 ?  78  GLU B CB  1 
ATOM   1426 C CG  . GLU B 1 78  ? -17.450 25.166 29.154  1.00 20.13 ?  78  GLU B CG  1 
ATOM   1427 C CD  . GLU B 1 78  ? -18.221 23.935 29.554  1.00 23.15 ?  78  GLU B CD  1 
ATOM   1428 O OE1 . GLU B 1 78  ? -19.462 24.027 29.641  1.00 24.09 ?  78  GLU B OE1 1 
ATOM   1429 O OE2 . GLU B 1 78  ? -17.587 22.881 29.769  1.00 30.95 -1 78  GLU B OE2 1 
ATOM   1430 N N   . CYS B 1 79  ? -20.684 27.020 26.081  1.00 14.83 ?  79  CYS B N   1 
ATOM   1431 C CA  . CYS B 1 79  ? -21.483 28.094 25.513  1.00 13.39 ?  79  CYS B CA  1 
ATOM   1432 C C   . CYS B 1 79  ? -22.766 28.347 26.290  1.00 16.10 ?  79  CYS B C   1 
ATOM   1433 O O   . CYS B 1 79  ? -23.393 27.421 26.823  1.00 16.87 ?  79  CYS B O   1 
ATOM   1434 C CB  . CYS B 1 79  ? -21.799 27.803 24.042  1.00 15.24 ?  79  CYS B CB  1 
ATOM   1435 S SG  . CYS B 1 79  ? -20.339 28.036 22.961  1.00 16.57 ?  79  CYS B SG  1 
ATOM   1436 N N   . GLU B 1 80  ? -23.144 29.619 26.349  1.00 15.03 ?  80  GLU B N   1 
ATOM   1437 C CA  . GLU B 1 80  ? -24.356 30.038 27.038  1.00 15.12 ?  80  GLU B CA  1 
ATOM   1438 C C   . GLU B 1 80  ? -25.583 29.633 26.234  1.00 14.78 ?  80  GLU B C   1 
ATOM   1439 O O   . GLU B 1 80  ? -25.655 29.869 25.017  1.00 15.90 ?  80  GLU B O   1 
ATOM   1440 C CB  . GLU B 1 80  ? -24.357 31.561 27.259  1.00 17.12 ?  80  GLU B CB  1 
ATOM   1441 C CG  . GLU B 1 80  ? -25.511 32.046 28.149  1.00 19.95 ?  80  GLU B CG  1 
ATOM   1442 C CD  . GLU B 1 80  ? -25.688 33.562 28.160  1.00 26.09 ?  80  GLU B CD  1 
ATOM   1443 O OE1 . GLU B 1 80  ? -25.265 34.231 27.195  1.00 34.10 ?  80  GLU B OE1 1 
ATOM   1444 O OE2 . GLU B 1 80  ? -26.244 34.085 29.148  1.00 31.20 -1 80  GLU B OE2 1 
ATOM   1445 N N   . ARG B 1 81  ? -26.566 29.037 26.907  1.00 13.79 ?  81  ARG B N   1 
ATOM   1446 C CA  . ARG B 1 81  ? -27.805 28.689 26.232  1.00 15.30 ?  81  ARG B CA  1 
ATOM   1447 C C   . ARG B 1 81  ? -28.764 29.869 26.224  1.00 16.67 ?  81  ARG B C   1 
ATOM   1448 O O   . ARG B 1 81  ? -28.511 30.883 26.881  1.00 15.98 ?  81  ARG B O   1 
ATOM   1449 C CB  . ARG B 1 81  ? -28.431 27.460 26.883  1.00 14.72 ?  81  ARG B CB  1 
ATOM   1450 C CG  . ARG B 1 81  ? -27.536 26.233 26.776  1.00 15.31 ?  81  ARG B CG  1 
ATOM   1451 C CD  . ARG B 1 81  ? -28.317 24.956 27.007  1.00 13.79 ?  81  ARG B CD  1 
ATOM   1452 N NE  . ARG B 1 81  ? -29.371 24.826 26.014  1.00 16.72 ?  81  ARG B NE  1 
ATOM   1453 C CZ  . ARG B 1 81  ? -30.308 23.884 26.030  1.00 18.23 ?  81  ARG B CZ  1 
ATOM   1454 N NH1 . ARG B 1 81  ? -30.309 22.964 26.988  1.00 17.35 1  81  ARG B NH1 1 
ATOM   1455 N NH2 . ARG B 1 81  ? -31.252 23.871 25.088  1.00 17.38 ?  81  ARG B NH2 1 
ATOM   1456 N N   . ARG B 1 82  ? -29.847 29.728 25.464  1.00 17.28 ?  82  ARG B N   1 
ATOM   1457 C CA  . ARG B 1 82  ? -30.785 30.818 25.205  1.00 19.99 ?  82  ARG B CA  1 
ATOM   1458 C C   . ARG B 1 82  ? -31.395 31.374 26.493  1.00 21.07 ?  82  ARG B C   1 
ATOM   1459 O O   . ARG B 1 82  ? -31.734 32.554 26.562  1.00 21.24 ?  82  ARG B O   1 
ATOM   1460 C CB  . ARG B 1 82  ? -31.886 30.335 24.255  1.00 21.61 ?  82  ARG B CB  1 
ATOM   1461 C CG  . ARG B 1 82  ? -32.736 31.432 23.631  1.00 31.41 ?  82  ARG B CG  1 
ATOM   1462 C CD  . ARG B 1 82  ? -33.547 30.886 22.461  1.00 32.81 ?  82  ARG B CD  1 
ATOM   1463 N NE  . ARG B 1 82  ? -32.721 30.650 21.275  1.00 37.95 ?  82  ARG B NE  1 
ATOM   1464 C CZ  . ARG B 1 82  ? -32.768 29.548 20.529  1.00 31.79 ?  82  ARG B CZ  1 
ATOM   1465 N NH1 . ARG B 1 82  ? -33.603 28.566 20.844  1.00 36.70 1  82  ARG B NH1 1 
ATOM   1466 N NH2 . ARG B 1 82  ? -31.979 29.427 19.466  1.00 31.04 ?  82  ARG B NH2 1 
ATOM   1467 N N   . ASP B 1 83  ? -31.504 30.540 27.523  1.00 16.17 ?  83  ASP B N   1 
ATOM   1468 C CA  . ASP B 1 83  ? -32.139 30.981 28.761  1.00 18.68 ?  83  ASP B CA  1 
ATOM   1469 C C   . ASP B 1 83  ? -31.291 32.004 29.522  1.00 19.04 ?  83  ASP B C   1 
ATOM   1470 O O   . ASP B 1 83  ? -31.769 32.643 30.468  1.00 20.00 ?  83  ASP B O   1 
ATOM   1471 C CB  . ASP B 1 83  ? -32.488 29.776 29.662  1.00 18.15 ?  83  ASP B CB  1 
ATOM   1472 C CG  . ASP B 1 83  ? -31.267 29.022 30.185  1.00 18.18 ?  83  ASP B CG  1 
ATOM   1473 O OD1 . ASP B 1 83  ? -30.128 29.515 30.086  1.00 20.78 ?  83  ASP B OD1 1 
ATOM   1474 O OD2 . ASP B 1 83  ? -31.470 27.911 30.715  1.00 22.16 -1 83  ASP B OD2 1 
ATOM   1475 N N   . GLY B 1 84  ? -30.035 32.162 29.118  1.00 19.08 ?  84  GLY B N   1 
ATOM   1476 C CA  . GLY B 1 84  ? -29.193 33.195 29.692  1.00 22.91 ?  84  GLY B CA  1 
ATOM   1477 C C   . GLY B 1 84  ? -28.419 32.815 30.938  1.00 23.11 ?  84  GLY B C   1 
ATOM   1478 O O   . GLY B 1 84  ? -27.703 33.652 31.491  1.00 27.02 ?  84  GLY B O   1 
ATOM   1479 N N   . TYR B 1 85  ? -28.540 31.570 31.394  1.00 19.84 ?  85  TYR B N   1 
ATOM   1480 C CA  . TYR B 1 85  ? -27.761 31.163 32.558  1.00 20.25 ?  85  TYR B CA  1 
ATOM   1481 C C   . TYR B 1 85  ? -27.199 29.747 32.461  1.00 22.26 ?  85  TYR B C   1 
ATOM   1482 O O   . TYR B 1 85  ? -26.193 29.439 33.102  1.00 21.78 ?  85  TYR B O   1 
ATOM   1483 C CB  . TYR B 1 85  ? -28.599 31.306 33.840  1.00 17.73 ?  85  TYR B CB  1 
ATOM   1484 C CG  . TYR B 1 85  ? -29.899 30.531 33.868  1.00 20.81 ?  85  TYR B CG  1 
ATOM   1485 C CD1 . TYR B 1 85  ? -29.948 29.237 34.370  1.00 23.03 ?  85  TYR B CD1 1 
ATOM   1486 C CD2 . TYR B 1 85  ? -31.084 31.102 33.424  1.00 20.78 ?  85  TYR B CD2 1 
ATOM   1487 C CE1 . TYR B 1 85  ? -31.139 28.521 34.408  1.00 22.32 ?  85  TYR B CE1 1 
ATOM   1488 C CE2 . TYR B 1 85  ? -32.281 30.397 33.461  1.00 22.20 ?  85  TYR B CE2 1 
ATOM   1489 C CZ  . TYR B 1 85  ? -32.299 29.107 33.953  1.00 23.80 ?  85  TYR B CZ  1 
ATOM   1490 O OH  . TYR B 1 85  ? -33.483 28.407 33.995  1.00 28.25 ?  85  TYR B OH  1 
ATOM   1491 N N   . THR B 1 86  ? -27.830 28.895 31.661  1.00 17.81 ?  86  THR B N   1 
ATOM   1492 C CA  . THR B 1 86  ? -27.354 27.523 31.506  1.00 16.39 ?  86  THR B CA  1 
ATOM   1493 C C   . THR B 1 86  ? -26.226 27.472 30.491  1.00 16.84 ?  86  THR B C   1 
ATOM   1494 O O   . THR B 1 86  ? -26.342 28.047 29.412  1.00 18.83 ?  86  THR B O   1 
ATOM   1495 C CB  . THR B 1 86  ? -28.477 26.583 31.042  1.00 16.61 ?  86  THR B CB  1 
ATOM   1496 O OG1 . THR B 1 86  ? -29.537 26.593 32.001  1.00 19.35 ?  86  THR B OG1 1 
ATOM   1497 C CG2 . THR B 1 86  ? -27.956 25.162 30.892  1.00 17.46 ?  86  THR B CG2 1 
ATOM   1498 N N   . TYR B 1 87  ? -25.136 26.795 30.842  1.00 15.45 ?  87  TYR B N   1 
ATOM   1499 C CA  . TYR B 1 87  ? -24.048 26.575 29.896  1.00 15.48 ?  87  TYR B CA  1 
ATOM   1500 C C   . TYR B 1 87  ? -23.973 25.099 29.527  1.00 17.74 ?  87  TYR B C   1 
ATOM   1501 O O   . TYR B 1 87  ? -24.452 24.238 30.258  1.00 16.04 ?  87  TYR B O   1 
ATOM   1502 C CB  . TYR B 1 87  ? -22.724 27.063 30.476  1.00 17.42 ?  87  TYR B CB  1 
ATOM   1503 C CG  . TYR B 1 87  ? -22.578 28.565 30.400  1.00 19.92 ?  87  TYR B CG  1 
ATOM   1504 C CD1 . TYR B 1 87  ? -23.419 29.393 31.130  1.00 23.73 ?  87  TYR B CD1 1 
ATOM   1505 C CD2 . TYR B 1 87  ? -21.625 29.153 29.576  1.00 20.23 ?  87  TYR B CD2 1 
ATOM   1506 C CE1 . TYR B 1 87  ? -23.309 30.763 31.061  1.00 22.01 ?  87  TYR B CE1 1 
ATOM   1507 C CE2 . TYR B 1 87  ? -21.506 30.536 29.498  1.00 23.54 ?  87  TYR B CE2 1 
ATOM   1508 C CZ  . TYR B 1 87  ? -22.357 31.330 30.247  1.00 24.72 ?  87  TYR B CZ  1 
ATOM   1509 O OH  . TYR B 1 87  ? -22.268 32.704 30.191  1.00 34.31 ?  87  TYR B OH  1 
ATOM   1510 N N   . ILE B 1 88  ? -23.376 24.812 28.378  1.00 14.40 ?  88  ILE B N   1 
ATOM   1511 C CA  . ILE B 1 88  ? -23.268 23.438 27.916  1.00 14.04 ?  88  ILE B CA  1 
ATOM   1512 C C   . ILE B 1 88  ? -21.957 23.317 27.139  1.00 14.52 ?  88  ILE B C   1 
ATOM   1513 O O   . ILE B 1 88  ? -21.568 24.239 26.414  1.00 14.02 ?  88  ILE B O   1 
ATOM   1514 C CB  . ILE B 1 88  ? -24.510 23.043 27.063  1.00 14.47 ?  88  ILE B CB  1 
ATOM   1515 C CG1 . ILE B 1 88  ? -24.488 21.561 26.675  1.00 13.74 ?  88  ILE B CG1 1 
ATOM   1516 C CG2 . ILE B 1 88  ? -24.664 23.950 25.840  1.00 13.50 ?  88  ILE B CG2 1 
ATOM   1517 C CD1 . ILE B 1 88  ? -25.753 21.134 25.948  1.00 12.99 ?  88  ILE B CD1 1 
ATOM   1518 N N   . PRO B 1 89  ? -21.234 22.205 27.326  1.00 13.55 ?  89  PRO B N   1 
ATOM   1519 C CA  . PRO B 1 89  ? -20.026 22.031 26.514  1.00 11.69 ?  89  PRO B CA  1 
ATOM   1520 C C   . PRO B 1 89  ? -20.391 21.810 25.058  1.00 12.52 ?  89  PRO B C   1 
ATOM   1521 O O   . PRO B 1 89  ? -21.432 21.232 24.750  1.00 12.96 ?  89  PRO B O   1 
ATOM   1522 C CB  . PRO B 1 89  ? -19.365 20.780 27.110  1.00 13.82 ?  89  PRO B CB  1 
ATOM   1523 C CG  . PRO B 1 89  ? -20.507 20.033 27.736  1.00 16.17 ?  89  PRO B CG  1 
ATOM   1524 C CD  . PRO B 1 89  ? -21.430 21.097 28.276  1.00 13.83 ?  89  PRO B CD  1 
ATOM   1525 N N   . THR B 1 90  ? -19.532 22.274 24.165  1.00 13.31 ?  90  THR B N   1 
ATOM   1526 C CA  . THR B 1 90  ? -19.787 22.152 22.745  1.00 14.24 ?  90  THR B CA  1 
ATOM   1527 C C   . THR B 1 90  ? -18.453 22.062 22.005  1.00 12.99 ?  90  THR B C   1 
ATOM   1528 O O   . THR B 1 90  ? -17.440 22.612 22.451  1.00 15.31 ?  90  THR B O   1 
ATOM   1529 C CB  . THR B 1 90  ? -20.642 23.340 22.256  1.00 14.40 ?  90  THR B CB  1 
ATOM   1530 O OG1 . THR B 1 90  ? -20.854 23.248 20.844  1.00 13.75 ?  90  THR B OG1 1 
ATOM   1531 C CG2 . THR B 1 90  ? -19.996 24.668 22.633  1.00 14.25 ?  90  THR B CG2 1 
ATOM   1532 N N   . GLU B 1 91  ? -18.457 21.318 20.902  1.00 12.46 ?  91  GLU B N   1 
ATOM   1533 C CA  . GLU B 1 91  ? -17.282 21.130 20.047  1.00 13.75 ?  91  GLU B CA  1 
ATOM   1534 C C   . GLU B 1 91  ? -17.720 21.281 18.611  1.00 17.43 ?  91  GLU B C   1 
ATOM   1535 O O   . GLU B 1 91  ? -18.812 20.830 18.257  1.00 17.94 ?  91  GLU B O   1 
ATOM   1536 C CB  . GLU B 1 91  ? -16.660 19.738 20.222  1.00 19.52 ?  91  GLU B CB  1 
ATOM   1537 C CG  . GLU B 1 91  ? -15.819 19.512 21.463  1.00 23.00 ?  91  GLU B CG  1 
ATOM   1538 C CD  . GLU B 1 91  ? -15.063 18.180 21.408  1.00 22.57 ?  91  GLU B CD  1 
ATOM   1539 O OE1 . GLU B 1 91  ? -15.259 17.419 20.436  1.00 26.39 ?  91  GLU B OE1 1 
ATOM   1540 O OE2 . GLU B 1 91  ? -14.266 17.903 22.330  1.00 30.82 -1 91  GLU B OE2 1 
ATOM   1541 N N   . ILE B 1 92  ? -16.887 21.882 17.771  1.00 13.03 ?  92  ILE B N   1 
ATOM   1542 C CA  . ILE B 1 92  ? -17.203 21.939 16.345  1.00 14.34 ?  92  ILE B CA  1 
ATOM   1543 C C   . ILE B 1 92  ? -15.963 21.559 15.523  1.00 14.18 ?  92  ILE B C   1 
ATOM   1544 O O   . ILE B 1 92  ? -14.855 21.996 15.828  1.00 13.95 ?  92  ILE B O   1 
ATOM   1545 C CB  . ILE B 1 92  ? -17.740 23.332 15.943  1.00 14.12 ?  92  ILE B CB  1 
ATOM   1546 C CG1 . ILE B 1 92  ? -18.154 23.357 14.471  1.00 13.16 ?  92  ILE B CG1 1 
ATOM   1547 C CG2 . ILE B 1 92  ? -16.747 24.439 16.261  1.00 15.29 ?  92  ILE B CG2 1 
ATOM   1548 C CD1 . ILE B 1 92  ? -18.988 24.574 14.125  1.00 14.67 ?  92  ILE B CD1 1 
ATOM   1549 N N   . GLU B 1 93  ? -16.146 20.708 14.512  1.00 13.48 ?  93  GLU B N   1 
ATOM   1550 C CA  . GLU B 1 93  ? -15.014 20.174 13.746  1.00 13.32 ?  93  GLU B CA  1 
ATOM   1551 C C   . GLU B 1 93  ? -14.566 21.157 12.675  1.00 12.57 ?  93  GLU B C   1 
ATOM   1552 O O   . GLU B 1 93  ? -15.233 21.357 11.663  1.00 13.44 ?  93  GLU B O   1 
ATOM   1553 C CB  . GLU B 1 93  ? -15.373 18.825 13.119  1.00 16.37 ?  93  GLU B CB  1 
ATOM   1554 C CG  . GLU B 1 93  ? -15.680 17.757 14.159  1.00 15.96 ?  93  GLU B CG  1 
ATOM   1555 C CD  . GLU B 1 93  ? -16.138 16.454 13.552  1.00 25.71 ?  93  GLU B CD  1 
ATOM   1556 O OE1 . GLU B 1 93  ? -15.661 16.108 12.456  1.00 26.17 ?  93  GLU B OE1 1 
ATOM   1557 O OE2 . GLU B 1 93  ? -16.989 15.779 14.165  1.00 29.69 -1 93  GLU B OE2 1 
ATOM   1558 N N   . LEU B 1 94  ? -13.412 21.765 12.900  1.00 13.03 ?  94  LEU B N   1 
ATOM   1559 C CA  . LEU B 1 94  ? -12.988 22.885 12.073  1.00 14.08 ?  94  LEU B CA  1 
ATOM   1560 C C   . LEU B 1 94  ? -12.698 22.491 10.616  1.00 12.41 ?  94  LEU B C   1 
ATOM   1561 O O   . LEU B 1 94  ? -12.824 23.313 9.703   1.00 13.04 ?  94  LEU B O   1 
ATOM   1562 C CB  . LEU B 1 94  ? -11.759 23.543 12.704  1.00 12.85 ?  94  LEU B CB  1 
ATOM   1563 C CG  . LEU B 1 94  ? -12.064 24.213 14.052  1.00 12.89 ?  94  LEU B CG  1 
ATOM   1564 C CD1 . LEU B 1 94  ? -10.768 24.628 14.746  1.00 16.85 ?  94  LEU B CD1 1 
ATOM   1565 C CD2 . LEU B 1 94  ? -12.989 25.410 13.885  1.00 14.55 ?  94  LEU B CD2 1 
ATOM   1566 N N   . ASP B 1 95  ? -12.338 21.233 10.392  1.00 13.11 ?  95  ASP B N   1 
ATOM   1567 C CA  . ASP B 1 95  ? -12.021 20.772 9.037   1.00 11.11 ?  95  ASP B CA  1 
ATOM   1568 C C   . ASP B 1 95  ? -13.250 20.687 8.128   1.00 11.67 ?  95  ASP B C   1 
ATOM   1569 O O   . ASP B 1 95  ? -13.122 20.484 6.915   1.00 13.22 ?  95  ASP B O   1 
ATOM   1570 C CB  . ASP B 1 95  ? -11.317 19.408 9.098   1.00 13.43 ?  95  ASP B CB  1 
ATOM   1571 C CG  . ASP B 1 95  ? -9.811  19.528 9.260   1.00 15.07 ?  95  ASP B CG  1 
ATOM   1572 O OD1 . ASP B 1 95  ? -9.194  20.352 8.559   1.00 16.24 ?  95  ASP B OD1 1 
ATOM   1573 O OD2 . ASP B 1 95  ? -9.241  18.802 10.093  1.00 14.75 -1 95  ASP B OD2 1 
ATOM   1574 N N   . GLU B 1 96  ? -14.434 20.835 8.711   1.00 13.21 ?  96  GLU B N   1 
ATOM   1575 C CA  . GLU B 1 96  ? -15.663 20.781 7.934   1.00 13.94 ?  96  GLU B CA  1 
ATOM   1576 C C   . GLU B 1 96  ? -15.740 21.920 6.941   1.00 14.30 ?  96  GLU B C   1 
ATOM   1577 O O   . GLU B 1 96  ? -16.226 21.734 5.826   1.00 16.74 ?  96  GLU B O   1 
ATOM   1578 C CB  . GLU B 1 96  ? -16.885 20.811 8.858   1.00 11.95 ?  96  GLU B CB  1 
ATOM   1579 C CG  . GLU B 1 96  ? -17.035 19.514 9.648   1.00 13.39 ?  96  GLU B CG  1 
ATOM   1580 C CD  . GLU B 1 96  ? -18.221 19.505 10.604  1.00 20.20 ?  96  GLU B CD  1 
ATOM   1581 O OE1 . GLU B 1 96  ? -18.848 20.561 10.822  1.00 18.22 ?  96  GLU B OE1 1 
ATOM   1582 O OE2 . GLU B 1 96  ? -18.513 18.424 11.164  1.00 25.23 -1 96  GLU B OE2 1 
ATOM   1583 N N   . HIS B 1 97  ? -15.281 23.104 7.344   1.00 12.87 ?  97  HIS B N   1 
ATOM   1584 C CA  . HIS B 1 97  ? -15.485 24.283 6.501   1.00 13.95 ?  97  HIS B CA  1 
ATOM   1585 C C   . HIS B 1 97  ? -14.316 25.239 6.436   1.00 14.93 ?  97  HIS B C   1 
ATOM   1586 O O   . HIS B 1 97  ? -14.470 26.381 6.005   1.00 14.53 ?  97  HIS B O   1 
ATOM   1587 C CB  . HIS B 1 97  ? -16.735 25.040 6.966   1.00 15.91 ?  97  HIS B CB  1 
ATOM   1588 C CG  . HIS B 1 97  ? -18.003 24.345 6.603   1.00 14.36 ?  97  HIS B CG  1 
ATOM   1589 N ND1 . HIS B 1 97  ? -18.462 24.277 5.304   1.00 16.38 ?  97  HIS B ND1 1 
ATOM   1590 C CD2 . HIS B 1 97  ? -18.888 23.647 7.354   1.00 16.22 ?  97  HIS B CD2 1 
ATOM   1591 C CE1 . HIS B 1 97  ? -19.586 23.582 5.275   1.00 18.93 ?  97  HIS B CE1 1 
ATOM   1592 N NE2 . HIS B 1 97  ? -19.862 23.182 6.505   1.00 19.35 ?  97  HIS B NE2 1 
ATOM   1593 N N   . ILE B 1 98  ? -13.146 24.778 6.850   1.00 11.04 ?  98  ILE B N   1 
ATOM   1594 C CA  . ILE B 1 98  ? -11.954 25.597 6.701   1.00 12.92 ?  98  ILE B CA  1 
ATOM   1595 C C   . ILE B 1 98  ? -10.973 24.835 5.833   1.00 11.30 ?  98  ILE B C   1 
ATOM   1596 O O   . ILE B 1 98  ? -10.623 23.692 6.123   1.00 13.98 ?  98  ILE B O   1 
ATOM   1597 C CB  . ILE B 1 98  ? -11.333 25.967 8.053   1.00 13.70 ?  98  ILE B CB  1 
ATOM   1598 C CG1 . ILE B 1 98  ? -12.303 26.853 8.824   1.00 14.86 ?  98  ILE B CG1 1 
ATOM   1599 C CG2 . ILE B 1 98  ? -10.003 26.722 7.861   1.00 13.18 ?  98  ILE B CG2 1 
ATOM   1600 C CD1 . ILE B 1 98  ? -11.900 27.086 10.257  1.00 15.07 ?  98  ILE B CD1 1 
ATOM   1601 N N   . ALA B 1 99  ? -10.577 25.465 4.737   1.00 13.80 ?  99  ALA B N   1 
ATOM   1602 C CA  . ALA B 1 99  ? -9.643  24.864 3.799   1.00 13.56 ?  99  ALA B CA  1 
ATOM   1603 C C   . ALA B 1 99  ? -8.337  25.624 3.789   1.00 13.70 ?  99  ALA B C   1 
ATOM   1604 O O   . ALA B 1 99  ? -8.252  26.773 4.223   1.00 13.65 ?  99  ALA B O   1 
ATOM   1605 C CB  . ALA B 1 99  ? -10.228 24.841 2.387   1.00 15.89 ?  99  ALA B CB  1 
ATOM   1606 N N   . ASN B 1 100 ? -7.320  24.956 3.288   1.00 11.87 ?  100 ASN B N   1 
ATOM   1607 C CA  . ASN B 1 100 ? -6.075  25.607 2.942   1.00 12.50 ?  100 ASN B CA  1 
ATOM   1608 C C   . ASN B 1 100 ? -6.052  25.811 1.431   1.00 12.42 ?  100 ASN B C   1 
ATOM   1609 O O   . ASN B 1 100 ? -5.936  24.849 0.663   1.00 15.55 ?  100 ASN B O   1 
ATOM   1610 C CB  . ASN B 1 100 ? -4.891  24.766 3.415   1.00 13.41 ?  100 ASN B CB  1 
ATOM   1611 C CG  . ASN B 1 100 ? -3.579  25.239 2.845   1.00 15.93 ?  100 ASN B CG  1 
ATOM   1612 O OD1 . ASN B 1 100 ? -3.462  26.372 2.400   1.00 15.92 ?  100 ASN B OD1 1 
ATOM   1613 N ND2 . ASN B 1 100 ? -2.581  24.366 2.854   1.00 14.70 ?  100 ASN B ND2 1 
ATOM   1614 N N   . ILE B 1 101 ? -6.226  27.061 1.011   1.00 14.34 ?  101 ILE B N   1 
ATOM   1615 C CA  . ILE B 1 101 ? -6.159  27.402 -0.400  1.00 16.82 ?  101 ILE B CA  1 
ATOM   1616 C C   . ILE B 1 101 ? -4.842  28.115 -0.685  1.00 15.01 ?  101 ILE B C   1 
ATOM   1617 O O   . ILE B 1 101 ? -4.676  29.283 -0.339  1.00 15.89 ?  101 ILE B O   1 
ATOM   1618 C CB  . ILE B 1 101 ? -7.332  28.299 -0.840  1.00 17.80 ?  101 ILE B CB  1 
ATOM   1619 C CG1 . ILE B 1 101 ? -8.672  27.673 -0.439  1.00 20.30 ?  101 ILE B CG1 1 
ATOM   1620 C CG2 . ILE B 1 101 ? -7.267  28.531 -2.352  1.00 19.36 ?  101 ILE B CG2 1 
ATOM   1621 C CD1 . ILE B 1 101 ? -8.952  26.361 -1.121  1.00 24.11 ?  101 ILE B CD1 1 
ATOM   1622 N N   . ASP B 1 102 ? -3.903  27.395 -1.300  1.00 15.90 ?  102 ASP B N   1 
ATOM   1623 C CA  . ASP B 1 102 ? -2.589  27.955 -1.665  1.00 19.09 ?  102 ASP B CA  1 
ATOM   1624 C C   . ASP B 1 102 ? -1.941  28.691 -0.491  1.00 17.84 ?  102 ASP B C   1 
ATOM   1625 O O   . ASP B 1 102 ? -1.350  29.772 -0.650  1.00 18.76 ?  102 ASP B O   1 
ATOM   1626 C CB  . ASP B 1 102 ? -2.722  28.890 -2.866  1.00 22.55 ?  102 ASP B CB  1 
ATOM   1627 C CG  . ASP B 1 102 ? -1.374  29.247 -3.486  1.00 21.33 ?  102 ASP B CG  1 
ATOM   1628 O OD1 . ASP B 1 102 ? -0.412  28.452 -3.360  1.00 22.19 ?  102 ASP B OD1 1 
ATOM   1629 O OD2 . ASP B 1 102 ? -1.282  30.336 -4.093  1.00 27.77 -1 102 ASP B OD2 1 
ATOM   1630 N N   . GLY B 1 103 ? -2.087  28.117 0.698   1.00 15.22 ?  103 GLY B N   1 
ATOM   1631 C CA  . GLY B 1 103 ? -1.409  28.632 1.872   1.00 16.79 ?  103 GLY B CA  1 
ATOM   1632 C C   . GLY B 1 103 ? -2.229  29.536 2.773   1.00 14.99 ?  103 GLY B C   1 
ATOM   1633 O O   . GLY B 1 103 ? -1.744  29.949 3.821   1.00 15.57 ?  103 GLY B O   1 
ATOM   1634 N N   . THR B 1 104 ? -3.465  29.843 2.376   1.00 12.62 ?  104 THR B N   1 
ATOM   1635 C CA  . THR B 1 104 ? -4.321  30.765 3.122   1.00 14.13 ?  104 THR B CA  1 
ATOM   1636 C C   . THR B 1 104 ? -5.562  30.039 3.631   1.00 12.68 ?  104 THR B C   1 
ATOM   1637 O O   . THR B 1 104 ? -6.282  29.406 2.855   1.00 14.82 ?  104 THR B O   1 
ATOM   1638 C CB  . THR B 1 104 ? -4.756  31.964 2.242   1.00 15.37 ?  104 THR B CB  1 
ATOM   1639 O OG1 . THR B 1 104 ? -3.596  32.736 1.897   1.00 19.57 ?  104 THR B OG1 1 
ATOM   1640 C CG2 . THR B 1 104 ? -5.740  32.847 2.976   1.00 16.81 ?  104 THR B CG2 1 
ATOM   1641 N N   . LEU B 1 105 ? -5.784  30.097 4.936   1.00 14.37 ?  105 LEU B N   1 
ATOM   1642 C CA  . LEU B 1 105 ? -6.992  29.529 5.524   1.00 12.76 ?  105 LEU B CA  1 
ATOM   1643 C C   . LEU B 1 105 ? -8.218  30.241 4.971   1.00 12.36 ?  105 LEU B C   1 
ATOM   1644 O O   . LEU B 1 105 ? -8.283  31.473 4.958   1.00 16.65 ?  105 LEU B O   1 
ATOM   1645 C CB  . LEU B 1 105 ? -6.961  29.628 7.050   1.00 12.80 ?  105 LEU B CB  1 
ATOM   1646 C CG  . LEU B 1 105 ? -5.891  28.803 7.771   1.00 12.95 ?  105 LEU B CG  1 
ATOM   1647 C CD1 . LEU B 1 105 ? -5.723  29.266 9.214   1.00 14.46 ?  105 LEU B CD1 1 
ATOM   1648 C CD2 . LEU B 1 105 ? -6.204  27.313 7.710   1.00 13.59 ?  105 LEU B CD2 1 
ATOM   1649 N N   . THR B 1 106 ? -9.194  29.449 4.540   1.00 13.76 ?  106 THR B N   1 
ATOM   1650 C CA  . THR B 1 106 ? -10.311 29.958 3.761   1.00 13.55 ?  106 THR B CA  1 
ATOM   1651 C C   . THR B 1 106 ? -11.572 29.210 4.121   1.00 13.48 ?  106 THR B C   1 
ATOM   1652 O O   . THR B 1 106 ? -11.558 27.990 4.176   1.00 14.22 ?  106 THR B O   1 
ATOM   1653 C CB  . THR B 1 106 ? -10.057 29.793 2.257   1.00 14.27 ?  106 THR B CB  1 
ATOM   1654 O OG1 . THR B 1 106 ? -8.787  30.372 1.916   1.00 16.50 ?  106 THR B OG1 1 
ATOM   1655 C CG2 . THR B 1 106 ? -11.159 30.465 1.450   1.00 18.17 ?  106 THR B CG2 1 
ATOM   1656 N N   . TYR B 1 107 ? -12.659 29.932 4.356   1.00 13.09 ?  107 TYR B N   1 
ATOM   1657 C CA  . TYR B 1 107 ? -13.949 29.279 4.538   1.00 15.67 ?  107 TYR B CA  1 
ATOM   1658 C C   . TYR B 1 107 ? -14.463 28.689 3.224   1.00 15.49 ?  107 TYR B C   1 
ATOM   1659 O O   . TYR B 1 107 ? -14.363 29.319 2.165   1.00 16.61 ?  107 TYR B O   1 
ATOM   1660 C CB  . TYR B 1 107 ? -14.972 30.261 5.094   1.00 13.21 ?  107 TYR B CB  1 
ATOM   1661 C CG  . TYR B 1 107 ? -14.720 30.649 6.528   1.00 12.49 ?  107 TYR B CG  1 
ATOM   1662 C CD1 . TYR B 1 107 ? -14.699 29.684 7.531   1.00 13.02 ?  107 TYR B CD1 1 
ATOM   1663 C CD2 . TYR B 1 107 ? -14.516 31.976 6.882   1.00 14.17 ?  107 TYR B CD2 1 
ATOM   1664 C CE1 . TYR B 1 107 ? -14.464 30.029 8.850   1.00 14.45 ?  107 TYR B CE1 1 
ATOM   1665 C CE2 . TYR B 1 107 ? -14.290 32.333 8.194   1.00 12.93 ?  107 TYR B CE2 1 
ATOM   1666 C CZ  . TYR B 1 107 ? -14.257 31.355 9.171   1.00 15.46 ?  107 TYR B CZ  1 
ATOM   1667 O OH  . TYR B 1 107 ? -14.043 31.691 10.480  1.00 15.44 ?  107 TYR B OH  1 
ATOM   1668 N N   . GLU B 1 108 ? -15.016 27.478 3.312   1.00 16.42 ?  108 GLU B N   1 
ATOM   1669 C CA  . GLU B 1 108 ? -15.525 26.750 2.157   1.00 16.08 ?  108 GLU B CA  1 
ATOM   1670 C C   . GLU B 1 108 ? -16.803 26.048 2.557   1.00 20.80 ?  108 GLU B C   1 
ATOM   1671 O O   . GLU B 1 108 ? -16.928 25.703 3.733   1.00 17.73 ?  108 GLU B O   1 
ATOM   1672 C CB  . GLU B 1 108 ? -14.526 25.700 1.666   1.00 17.98 ?  108 GLU B CB  1 
ATOM   1673 C CG  . GLU B 1 108 ? -13.424 26.193 0.772   1.00 28.19 ?  108 GLU B CG  1 
ATOM   1674 C CD  . GLU B 1 108 ? -12.758 25.048 0.028   1.00 26.90 ?  108 GLU B CD  1 
ATOM   1675 O OE1 . GLU B 1 108 ? -12.744 23.904 0.553   1.00 26.25 ?  108 GLU B OE1 1 
ATOM   1676 O OE2 . GLU B 1 108 ? -12.270 25.285 -1.096  1.00 39.03 -1 108 GLU B OE2 1 
ATOM   1677 O OXT . GLU B 1 108 ? -17.684 25.787 1.730   1.00 23.82 -1 108 GLU B OXT 1 
HETATM 1678 C C1  . PEG C 2 .   ? -16.655 7.324  -18.007 1.00 33.40 ?  201 PEG A C1  1 
HETATM 1679 O O1  . PEG C 2 .   ? -15.958 6.943  -19.214 1.00 43.96 ?  201 PEG A O1  1 
HETATM 1680 C C2  . PEG C 2 .   ? -16.087 6.402  -16.968 1.00 35.59 ?  201 PEG A C2  1 
HETATM 1681 O O2  . PEG C 2 .   ? -16.721 6.335  -15.721 1.00 35.67 ?  201 PEG A O2  1 
HETATM 1682 C C3  . PEG C 2 .   ? -16.570 4.998  -15.243 1.00 31.71 ?  201 PEG A C3  1 
HETATM 1683 C C4  . PEG C 2 .   ? -17.869 4.425  -14.781 1.00 35.69 ?  201 PEG A C4  1 
HETATM 1684 O O4  . PEG C 2 .   ? -18.049 3.013  -14.695 1.00 37.21 ?  201 PEG A O4  1 
HETATM 1685 C C1  . PEG D 2 .   ? -18.048 29.647 0.769   1.00 34.71 ?  202 PEG A C1  1 
HETATM 1686 O O1  . PEG D 2 .   ? -18.397 29.866 -0.580  1.00 37.75 ?  202 PEG A O1  1 
HETATM 1687 C C2  . PEG D 2 .   ? -18.629 30.786 1.560   1.00 31.29 ?  202 PEG A C2  1 
HETATM 1688 O O2  . PEG D 2 .   ? -17.950 31.146 2.730   1.00 35.32 ?  202 PEG A O2  1 
HETATM 1689 C C3  . PEG D 2 .   ? -18.456 32.372 3.211   1.00 39.79 ?  202 PEG A C3  1 
HETATM 1690 C C4  . PEG D 2 .   ? -17.525 33.549 2.978   1.00 40.51 ?  202 PEG A C4  1 
HETATM 1691 O O4  . PEG D 2 .   ? -18.134 34.817 2.649   1.00 39.98 ?  202 PEG A O4  1 
HETATM 1692 C C1  . EDO E 3 .   ? -2.148  38.140 9.221   1.00 34.13 ?  201 EDO B C1  1 
HETATM 1693 O O1  . EDO E 3 .   ? -3.172  38.296 8.255   1.00 34.93 ?  201 EDO B O1  1 
HETATM 1694 C C2  . EDO E 3 .   ? -1.387  36.843 8.997   1.00 24.50 ?  201 EDO B C2  1 
HETATM 1695 O O2  . EDO E 3 .   ? 0.000   37.200 9.153   0.50 28.19 ?  201 EDO B O2  1 
HETATM 1696 O O   . HOH F 4 .   ? -0.517  4.092  12.979  1.00 42.73 ?  301 HOH A O   1 
HETATM 1697 O O   . HOH F 4 .   ? -30.679 24.816 0.151   1.00 32.89 ?  302 HOH A O   1 
HETATM 1698 O O   . HOH F 4 .   ? -29.351 22.208 -3.267  1.00 26.45 ?  303 HOH A O   1 
HETATM 1699 O O   . HOH F 4 .   ? -3.987  12.461 15.086  1.00 24.42 ?  304 HOH A O   1 
HETATM 1700 O O   . HOH F 4 .   ? -37.311 10.302 0.294   1.00 19.94 ?  305 HOH A O   1 
HETATM 1701 O O   . HOH F 4 .   ? -20.204 1.189  -11.663 1.00 25.66 ?  306 HOH A O   1 
HETATM 1702 O O   . HOH F 4 .   ? -24.618 20.077 -6.350  1.00 16.77 ?  307 HOH A O   1 
HETATM 1703 O O   . HOH F 4 .   ? -30.662 4.311  -2.147  1.00 17.96 ?  308 HOH A O   1 
HETATM 1704 O O   . HOH F 4 .   ? -8.176  13.009 -3.140  1.00 28.55 ?  309 HOH A O   1 
HETATM 1705 O O   . HOH F 4 .   ? -33.790 2.390  -7.464  1.00 29.29 ?  310 HOH A O   1 
HETATM 1706 O O   . HOH F 4 .   ? -32.495 19.740 -5.760  1.00 27.76 ?  311 HOH A O   1 
HETATM 1707 O O   . HOH F 4 .   ? -17.318 -1.374 -4.758  1.00 26.58 ?  312 HOH A O   1 
HETATM 1708 O O   . HOH F 4 .   ? -41.997 15.270 -14.216 1.00 26.76 ?  313 HOH A O   1 
HETATM 1709 O O   . HOH F 4 .   ? -33.761 5.473  -17.569 1.00 24.52 ?  314 HOH A O   1 
HETATM 1710 O O   . HOH F 4 .   ? -25.437 21.583 5.383   1.00 33.93 ?  315 HOH A O   1 
HETATM 1711 O O   . HOH F 4 .   ? -32.604 5.512  -0.711  1.00 22.55 ?  316 HOH A O   1 
HETATM 1712 O O   . HOH F 4 .   ? -32.555 3.183  -14.844 1.00 17.46 ?  317 HOH A O   1 
HETATM 1713 O O   . HOH F 4 .   ? -42.205 6.620  -15.612 1.00 20.43 ?  318 HOH A O   1 
HETATM 1714 O O   . HOH F 4 .   ? -26.988 3.513  -12.148 1.00 16.36 ?  319 HOH A O   1 
HETATM 1715 O O   . HOH F 4 .   ? -21.891 21.333 4.863   1.00 23.67 ?  320 HOH A O   1 
HETATM 1716 O O   . HOH F 4 .   ? -19.376 22.232 -1.647  1.00 23.67 ?  321 HOH A O   1 
HETATM 1717 O O   . HOH F 4 .   ? -0.662  10.202 12.999  1.00 33.71 ?  322 HOH A O   1 
HETATM 1718 O O   . HOH F 4 .   ? -29.056 16.913 -15.206 1.00 16.26 ?  323 HOH A O   1 
HETATM 1719 O O   . HOH F 4 .   ? -26.355 19.845 -17.048 1.00 27.28 ?  324 HOH A O   1 
HETATM 1720 O O   . HOH F 4 .   ? -30.535 3.706  -18.879 1.00 19.72 ?  325 HOH A O   1 
HETATM 1721 O O   . HOH F 4 .   ? -13.473 15.252 -1.108  1.00 19.21 ?  326 HOH A O   1 
HETATM 1722 O O   . HOH F 4 .   ? -32.782 13.113 -19.050 1.00 32.32 ?  327 HOH A O   1 
HETATM 1723 O O   . HOH F 4 .   ? -28.944 5.855  -19.691 1.00 15.51 ?  328 HOH A O   1 
HETATM 1724 O O   . HOH F 4 .   ? -25.433 0.450  -0.449  1.00 21.31 ?  329 HOH A O   1 
HETATM 1725 O O   . HOH F 4 .   ? -21.009 -1.160 -1.396  1.00 27.93 ?  330 HOH A O   1 
HETATM 1726 O O   . HOH F 4 .   ? -22.510 18.245 -5.958  1.00 15.00 ?  331 HOH A O   1 
HETATM 1727 O O   . HOH F 4 .   ? -8.331  14.915 12.218  1.00 16.16 ?  332 HOH A O   1 
HETATM 1728 O O   . HOH F 4 .   ? -12.060 2.193  2.247   1.00 18.90 ?  333 HOH A O   1 
HETATM 1729 O O   . HOH F 4 .   ? -24.107 16.915 -17.564 1.00 27.99 ?  334 HOH A O   1 
HETATM 1730 O O   . HOH F 4 .   ? -27.007 15.108 -15.875 1.00 15.15 ?  335 HOH A O   1 
HETATM 1731 O O   . HOH F 4 .   ? -11.212 3.569  -0.103  1.00 17.63 ?  336 HOH A O   1 
HETATM 1732 O O   . HOH F 4 .   ? -26.402 5.634  -18.738 1.00 17.42 ?  337 HOH A O   1 
HETATM 1733 O O   . HOH F 4 .   ? -37.039 2.258  -12.419 1.00 20.26 ?  338 HOH A O   1 
HETATM 1734 O O   . HOH F 4 .   ? -25.525 5.816  4.591   1.00 26.05 ?  339 HOH A O   1 
HETATM 1735 O O   . HOH F 4 .   ? -34.926 8.179  -3.582  1.00 17.85 ?  340 HOH A O   1 
HETATM 1736 O O   . HOH F 4 .   ? -33.798 17.537 -6.382  1.00 32.75 ?  341 HOH A O   1 
HETATM 1737 O O   . HOH F 4 .   ? -13.168 16.605 1.834   1.00 16.97 ?  342 HOH A O   1 
HETATM 1738 O O   . HOH F 4 .   ? -37.107 7.838  -1.886  1.00 23.55 ?  343 HOH A O   1 
HETATM 1739 O O   . HOH F 4 .   ? -28.414 21.506 -7.671  1.00 15.52 ?  344 HOH A O   1 
HETATM 1740 O O   . HOH F 4 .   ? -23.921 1.293  -9.289  1.00 17.86 ?  345 HOH A O   1 
HETATM 1741 O O   . HOH F 4 .   ? -25.091 3.992  -14.841 1.00 19.82 ?  346 HOH A O   1 
HETATM 1742 O O   . HOH F 4 .   ? -31.106 2.742  -12.303 1.00 17.28 ?  347 HOH A O   1 
HETATM 1743 O O   . HOH F 4 .   ? -31.355 5.253  -22.963 1.00 29.13 ?  348 HOH A O   1 
HETATM 1744 O O   . HOH F 4 .   ? -12.846 15.499 -10.430 1.00 26.70 ?  349 HOH A O   1 
HETATM 1745 O O   . HOH F 4 .   ? -20.683 5.115  -16.474 1.00 22.53 ?  350 HOH A O   1 
HETATM 1746 O O   . HOH F 4 .   ? -35.541 5.845  -4.527  1.00 29.65 ?  351 HOH A O   1 
HETATM 1747 O O   . HOH F 4 .   ? -20.074 1.944  6.411   1.00 25.75 ?  352 HOH A O   1 
HETATM 1748 O O   . HOH F 4 .   ? -2.125  16.089 9.107   1.00 31.88 ?  353 HOH A O   1 
HETATM 1749 O O   . HOH F 4 .   ? -15.947 17.478 -4.292  1.00 22.13 ?  354 HOH A O   1 
HETATM 1750 O O   . HOH F 4 .   ? -20.096 3.622  8.439   1.00 26.70 ?  355 HOH A O   1 
HETATM 1751 O O   . HOH F 4 .   ? -39.440 4.237  -12.070 1.00 20.53 ?  356 HOH A O   1 
HETATM 1752 O O   . HOH F 4 .   ? -31.731 0.782  -4.763  1.00 27.23 ?  357 HOH A O   1 
HETATM 1753 O O   . HOH F 4 .   ? -4.495  2.543  7.386   1.00 36.88 ?  358 HOH A O   1 
HETATM 1754 O O   . HOH F 4 .   ? -2.622  9.838  8.269   1.00 22.79 ?  359 HOH A O   1 
HETATM 1755 O O   . HOH F 4 .   ? -3.489  11.457 10.395  1.00 26.53 ?  360 HOH A O   1 
HETATM 1756 O O   . HOH F 4 .   ? -30.749 12.572 -21.043 1.00 28.13 ?  361 HOH A O   1 
HETATM 1757 O O   . HOH F 4 .   ? -5.218  6.178  2.987   1.00 33.18 ?  362 HOH A O   1 
HETATM 1758 O O   . HOH F 4 .   ? -21.439 5.636  11.800  1.00 34.99 ?  363 HOH A O   1 
HETATM 1759 O O   . HOH F 4 .   ? -9.668  2.436  -3.796  1.00 25.37 ?  364 HOH A O   1 
HETATM 1760 O O   . HOH F 4 .   ? -33.771 15.922 -3.664  1.00 23.75 ?  365 HOH A O   1 
HETATM 1761 O O   . HOH F 4 .   ? -28.303 4.362  5.417   1.00 31.40 ?  366 HOH A O   1 
HETATM 1762 O O   . HOH F 4 .   ? -28.510 18.913 4.171   1.00 26.71 ?  367 HOH A O   1 
HETATM 1763 O O   . HOH F 4 .   ? -38.081 10.354 -22.878 1.00 25.99 ?  368 HOH A O   1 
HETATM 1764 O O   . HOH F 4 .   ? -22.395 4.400  -14.352 1.00 16.21 ?  369 HOH A O   1 
HETATM 1765 O O   . HOH F 4 .   ? -37.360 16.402 -4.002  1.00 27.05 ?  370 HOH A O   1 
HETATM 1766 O O   . HOH F 4 .   ? -30.958 10.415 2.339   1.00 18.81 ?  371 HOH A O   1 
HETATM 1767 O O   . HOH F 4 .   ? -28.432 10.563 4.377   1.00 20.34 ?  372 HOH A O   1 
HETATM 1768 O O   . HOH F 4 .   ? -22.282 5.385  8.408   1.00 20.35 ?  373 HOH A O   1 
HETATM 1769 O O   . HOH F 4 .   ? -34.848 13.885 -0.412  1.00 33.14 ?  374 HOH A O   1 
HETATM 1770 O O   . HOH F 4 .   ? -37.810 1.086  -9.839  1.00 26.18 ?  375 HOH A O   1 
HETATM 1771 O O   . HOH F 4 .   ? -11.843 13.598 -5.906  1.00 18.90 ?  376 HOH A O   1 
HETATM 1772 O O   . HOH F 4 .   ? -23.530 -1.460 -1.443  1.00 36.86 ?  377 HOH A O   1 
HETATM 1773 O O   . HOH F 4 .   ? -7.444  5.060  5.310   1.00 29.34 ?  378 HOH A O   1 
HETATM 1774 O O   . HOH F 4 .   ? -40.792 3.716  -9.017  1.00 25.54 ?  379 HOH A O   1 
HETATM 1775 O O   . HOH F 4 .   ? -20.088 -2.681 -3.658  1.00 44.87 ?  380 HOH A O   1 
HETATM 1776 O O   . HOH F 4 .   ? -37.795 0.608  -5.106  1.00 37.31 ?  381 HOH A O   1 
HETATM 1777 O O   . HOH F 4 .   ? 1.759   9.238  13.593  1.00 36.90 ?  382 HOH A O   1 
HETATM 1778 O O   . HOH F 4 .   ? -2.255  13.588 11.239  1.00 28.60 ?  383 HOH A O   1 
HETATM 1779 O O   . HOH F 4 .   ? -32.755 21.964 -15.425 1.00 32.24 ?  384 HOH A O   1 
HETATM 1780 O O   . HOH F 4 .   ? -3.992  15.443 12.037  1.00 27.60 ?  385 HOH A O   1 
HETATM 1781 O O   . HOH F 4 .   ? -27.781 24.276 6.724   1.00 32.66 ?  386 HOH A O   1 
HETATM 1782 O O   . HOH F 4 .   ? -34.592 3.091  -18.413 1.00 31.20 ?  387 HOH A O   1 
HETATM 1783 O O   . HOH F 4 .   ? -1.421  12.391 13.783  1.00 30.41 ?  388 HOH A O   1 
HETATM 1784 O O   . HOH F 4 .   ? -13.471 16.193 -3.803  1.00 30.11 ?  389 HOH A O   1 
HETATM 1785 O O   . HOH F 4 .   ? -31.016 1.584  -2.115  1.00 28.03 ?  390 HOH A O   1 
HETATM 1786 O O   . HOH F 4 .   ? -20.221 -1.769 -12.567 1.00 33.26 ?  391 HOH A O   1 
HETATM 1787 O O   . HOH F 4 .   ? -46.110 10.499 -20.994 1.00 31.83 ?  392 HOH A O   1 
HETATM 1788 O O   . HOH F 4 .   ? -34.919 4.269  -2.076  1.00 31.71 ?  393 HOH A O   1 
HETATM 1789 O O   . HOH F 4 .   ? -22.355 2.053  -13.147 1.00 18.85 ?  394 HOH A O   1 
HETATM 1790 O O   . HOH F 4 .   ? -32.457 3.398  -20.731 1.00 25.85 ?  395 HOH A O   1 
HETATM 1791 O O   . HOH F 4 .   ? -31.082 20.941 -17.236 1.00 27.22 ?  396 HOH A O   1 
HETATM 1792 O O   . HOH F 4 .   ? -23.318 8.192  -21.187 1.00 34.10 ?  397 HOH A O   1 
HETATM 1793 O O   . HOH F 4 .   ? -28.963 19.053 -16.760 1.00 23.76 ?  398 HOH A O   1 
HETATM 1794 O O   . HOH F 4 .   ? -24.083 4.054  6.409   1.00 26.62 ?  399 HOH A O   1 
HETATM 1795 O O   . HOH F 4 .   ? -10.685 -0.152 2.294   1.00 25.89 ?  400 HOH A O   1 
HETATM 1796 O O   . HOH F 4 .   ? -28.962 5.988  -22.456 1.00 22.42 ?  401 HOH A O   1 
HETATM 1797 O O   . HOH F 4 .   ? -29.660 16.814 -18.904 1.00 29.19 ?  402 HOH A O   1 
HETATM 1798 O O   . HOH F 4 .   ? -24.530 6.067  -20.657 1.00 24.26 ?  403 HOH A O   1 
HETATM 1799 O O   . HOH F 4 .   ? -10.852 14.152 -8.796  1.00 32.44 ?  404 HOH A O   1 
HETATM 1800 O O   . HOH F 4 .   ? -28.562 8.307  -23.988 1.00 35.48 ?  405 HOH A O   1 
HETATM 1801 O O   . HOH G 4 .   ? -27.761 28.111 12.963  1.00 25.10 ?  301 HOH B O   1 
HETATM 1802 O O   . HOH G 4 .   ? -30.653 24.725 33.360  1.00 20.90 ?  302 HOH B O   1 
HETATM 1803 O O   . HOH G 4 .   ? -10.058 17.193 11.927  1.00 18.41 ?  303 HOH B O   1 
HETATM 1804 O O   . HOH G 4 .   ? -14.274 29.663 -0.385  1.00 31.01 ?  304 HOH B O   1 
HETATM 1805 O O   . HOH G 4 .   ? -34.221 32.910 31.220  1.00 25.69 ?  305 HOH B O   1 
HETATM 1806 O O   . HOH G 4 .   ? -26.509 24.149 15.154  1.00 26.71 ?  306 HOH B O   1 
HETATM 1807 O O   . HOH G 4 .   ? -2.178  31.657 17.592  1.00 20.72 ?  307 HOH B O   1 
HETATM 1808 O O   . HOH G 4 .   ? -4.165  32.931 16.188  1.00 18.72 ?  308 HOH B O   1 
HETATM 1809 O O   . HOH G 4 .   ? 2.483   26.845 18.677  1.00 17.94 ?  309 HOH B O   1 
HETATM 1810 O O   . HOH G 4 .   ? -15.218 14.898 16.504  1.00 27.46 ?  310 HOH B O   1 
HETATM 1811 O O   . HOH G 4 .   ? -13.360 38.984 11.351  1.00 18.36 ?  311 HOH B O   1 
HETATM 1812 O O   . HOH G 4 .   ? -18.118 38.797 13.146  1.00 21.07 ?  312 HOH B O   1 
HETATM 1813 O O   . HOH G 4 .   ? -12.795 15.790 22.967  1.00 24.58 ?  313 HOH B O   1 
HETATM 1814 O O   . HOH G 4 .   ? -5.740  20.480 3.136   1.00 15.97 ?  314 HOH B O   1 
HETATM 1815 O O   . HOH G 4 .   ? -23.399 33.668 18.257  1.00 17.31 ?  315 HOH B O   1 
HETATM 1816 O O   . HOH G 4 .   ? 1.410   29.223 -5.171  1.00 34.78 ?  316 HOH B O   1 
HETATM 1817 O O   . HOH G 4 .   ? -14.506 38.214 21.607  1.00 29.23 ?  317 HOH B O   1 
HETATM 1818 O O   . HOH G 4 .   ? -22.477 35.052 20.525  1.00 17.06 ?  318 HOH B O   1 
HETATM 1819 O O   . HOH G 4 .   ? 7.238   21.980 4.044   1.00 27.91 ?  319 HOH B O   1 
HETATM 1820 O O   . HOH G 4 .   ? -26.330 22.315 30.481  1.00 14.61 ?  320 HOH B O   1 
HETATM 1821 O O   . HOH G 4 .   ? -33.993 27.095 31.209  1.00 28.55 ?  321 HOH B O   1 
HETATM 1822 O O   . HOH G 4 .   ? -2.149  34.258 3.591   1.00 26.25 ?  322 HOH B O   1 
HETATM 1823 O O   . HOH G 4 .   ? -13.828 38.477 16.637  1.00 20.55 ?  323 HOH B O   1 
HETATM 1824 O O   . HOH G 4 .   ? 7.551   30.772 2.900   1.00 18.57 ?  324 HOH B O   1 
HETATM 1825 O O   . HOH G 4 .   ? -20.207 24.885 2.171   1.00 22.34 ?  325 HOH B O   1 
HETATM 1826 O O   . HOH G 4 .   ? -7.789  33.920 6.243   1.00 20.29 ?  326 HOH B O   1 
HETATM 1827 O O   . HOH G 4 .   ? -24.937 25.240 11.104  1.00 28.49 ?  327 HOH B O   1 
HETATM 1828 O O   . HOH G 4 .   ? 0.926   31.392 14.070  1.00 24.14 ?  328 HOH B O   1 
HETATM 1829 O O   . HOH G 4 .   ? -8.280  17.283 1.063   1.00 31.28 ?  329 HOH B O   1 
HETATM 1830 O O   . HOH G 4 .   ? -10.629 36.197 9.139   1.00 18.07 ?  330 HOH B O   1 
HETATM 1831 O O   . HOH G 4 .   ? -10.558 20.448 0.633   1.00 29.87 ?  331 HOH B O   1 
HETATM 1832 O O   . HOH G 4 .   ? -12.119 18.939 12.252  1.00 15.37 ?  332 HOH B O   1 
HETATM 1833 O O   . HOH G 4 .   ? -8.368  31.808 -0.386  1.00 23.15 ?  333 HOH B O   1 
HETATM 1834 O O   . HOH G 4 .   ? 2.393   29.365 16.332  1.00 19.65 ?  334 HOH B O   1 
HETATM 1835 O O   . HOH G 4 .   ? -14.510 12.436 20.351  1.00 24.29 ?  335 HOH B O   1 
HETATM 1836 O O   . HOH G 4 .   ? -21.811 21.701 7.758   1.00 27.04 ?  336 HOH B O   1 
HETATM 1837 O O   . HOH G 4 .   ? -14.491 35.302 24.556  1.00 21.12 ?  337 HOH B O   1 
HETATM 1838 O O   . HOH G 4 .   ? -21.571 20.696 20.061  1.00 14.28 ?  338 HOH B O   1 
HETATM 1839 O O   . HOH G 4 .   ? -17.313 38.618 17.999  1.00 20.14 ?  339 HOH B O   1 
HETATM 1840 O O   . HOH G 4 .   ? -9.315  31.249 22.813  1.00 24.64 ?  340 HOH B O   1 
HETATM 1841 O O   . HOH G 4 .   ? -21.228 21.869 17.215  1.00 18.13 ?  341 HOH B O   1 
HETATM 1842 O O   . HOH G 4 .   ? -7.741  22.279 2.436   1.00 14.94 ?  342 HOH B O   1 
HETATM 1843 O O   . HOH G 4 .   ? -16.177 35.550 6.377   1.00 30.33 ?  343 HOH B O   1 
HETATM 1844 O O   . HOH G 4 .   ? -5.348  15.106 14.843  1.00 28.99 ?  344 HOH B O   1 
HETATM 1845 O O   . HOH G 4 .   ? -9.413  36.861 17.942  1.00 22.28 ?  345 HOH B O   1 
HETATM 1846 O O   . HOH G 4 .   ? 0.246   29.046 14.750  1.00 19.68 ?  346 HOH B O   1 
HETATM 1847 O O   . HOH G 4 .   ? -9.614  33.344 3.356   1.00 22.68 ?  347 HOH B O   1 
HETATM 1848 O O   . HOH G 4 .   ? 4.688   32.980 6.487   1.00 21.09 ?  348 HOH B O   1 
HETATM 1849 O O   . HOH G 4 .   ? -6.180  15.747 10.472  1.00 17.93 ?  349 HOH B O   1 
HETATM 1850 O O   . HOH G 4 .   ? -5.897  31.624 -1.339  1.00 18.80 ?  350 HOH B O   1 
HETATM 1851 O O   . HOH G 4 .   ? -27.071 31.950 23.693  1.00 26.85 ?  351 HOH B O   1 
HETATM 1852 O O   . HOH G 4 .   ? -29.408 31.035 21.167  1.00 32.58 ?  352 HOH B O   1 
HETATM 1853 O O   . HOH G 4 .   ? -31.179 25.805 28.785  1.00 21.10 ?  353 HOH B O   1 
HETATM 1854 O O   . HOH G 4 .   ? -14.491 33.603 26.694  1.00 23.70 ?  354 HOH B O   1 
HETATM 1855 O O   . HOH G 4 .   ? -18.764 19.620 14.010  1.00 21.33 ?  355 HOH B O   1 
HETATM 1856 O O   . HOH G 4 .   ? -13.146 31.407 30.058  1.00 31.05 ?  356 HOH B O   1 
HETATM 1857 O O   . HOH G 4 .   ? -3.847  34.819 6.296   1.00 20.45 ?  357 HOH B O   1 
HETATM 1858 O O   . HOH G 4 .   ? -32.007 27.453 26.647  1.00 20.62 ?  358 HOH B O   1 
HETATM 1859 O O   . HOH G 4 .   ? -12.410 35.096 5.813   1.00 23.94 ?  359 HOH B O   1 
HETATM 1860 O O   . HOH G 4 .   ? -6.143  18.148 22.320  1.00 26.20 ?  360 HOH B O   1 
HETATM 1861 O O   . HOH G 4 .   ? -32.543 21.100 27.380  1.00 30.28 ?  361 HOH B O   1 
HETATM 1862 O O   . HOH G 4 .   ? -3.932  12.818 0.979   1.00 33.60 ?  362 HOH B O   1 
HETATM 1863 O O   . HOH G 4 .   ? -6.502  32.988 23.756  1.00 28.10 ?  363 HOH B O   1 
HETATM 1864 O O   . HOH G 4 .   ? 2.389   20.767 14.251  1.00 31.29 ?  364 HOH B O   1 
HETATM 1865 O O   . HOH G 4 .   ? 0.135   23.526 17.755  1.00 31.26 ?  365 HOH B O   1 
HETATM 1866 O O   . HOH G 4 .   ? -14.341 32.310 2.059   1.00 31.30 ?  366 HOH B O   1 
HETATM 1867 O O   . HOH G 4 .   ? -25.057 34.853 14.652  1.00 19.15 ?  367 HOH B O   1 
HETATM 1868 O O   . HOH G 4 .   ? -3.731  24.814 -2.809  1.00 24.27 ?  368 HOH B O   1 
HETATM 1869 O O   . HOH G 4 .   ? -14.541 18.425 5.253   1.00 25.92 ?  369 HOH B O   1 
HETATM 1870 O O   . HOH G 4 .   ? -3.140  36.824 13.584  1.00 32.63 ?  370 HOH B O   1 
HETATM 1871 O O   . HOH G 4 .   ? -12.371 32.924 4.068   1.00 18.40 ?  371 HOH B O   1 
HETATM 1872 O O   . HOH G 4 .   ? -3.858  26.773 20.653  1.00 19.08 ?  372 HOH B O   1 
HETATM 1873 O O   . HOH G 4 .   ? -6.275  26.631 22.649  1.00 19.63 ?  373 HOH B O   1 
HETATM 1874 O O   . HOH G 4 .   ? -1.162  21.245 14.534  1.00 20.61 ?  374 HOH B O   1 
HETATM 1875 O O   . HOH G 4 .   ? -12.346 31.770 26.672  1.00 20.45 ?  375 HOH B O   1 
HETATM 1876 O O   . HOH G 4 .   ? 3.412   27.159 -4.669  1.00 28.77 ?  376 HOH B O   1 
HETATM 1877 O O   . HOH G 4 .   ? -22.016 34.717 5.819   1.00 30.08 ?  377 HOH B O   1 
HETATM 1878 O O   . HOH G 4 .   ? -21.430 40.620 17.344  1.00 22.29 ?  378 HOH B O   1 
HETATM 1879 O O   . HOH G 4 .   ? -4.469  33.955 -0.835  1.00 33.49 ?  379 HOH B O   1 
HETATM 1880 O O   . HOH G 4 .   ? -22.859 23.443 12.565  1.00 16.46 ?  380 HOH B O   1 
HETATM 1881 O O   . HOH G 4 .   ? -19.618 37.540 11.188  1.00 25.15 ?  381 HOH B O   1 
HETATM 1882 O O   . HOH G 4 .   ? -1.508  22.744 -0.199  1.00 27.34 ?  382 HOH B O   1 
HETATM 1883 O O   . HOH G 4 .   ? -27.399 31.573 9.610   1.00 37.66 ?  383 HOH B O   1 
HETATM 1884 O O   . HOH G 4 .   ? -23.989 37.554 15.514  1.00 20.08 ?  384 HOH B O   1 
HETATM 1885 O O   . HOH G 4 .   ? -32.398 23.610 29.564  1.00 26.32 ?  385 HOH B O   1 
HETATM 1886 O O   . HOH G 4 .   ? -2.057  15.278 2.815   1.00 30.77 ?  386 HOH B O   1 
HETATM 1887 O O   . HOH G 4 .   ? -22.125 39.036 11.833  1.00 16.07 ?  387 HOH B O   1 
HETATM 1888 O O   . HOH G 4 .   ? 0.173   36.145 4.036   1.00 37.28 ?  388 HOH B O   1 
HETATM 1889 O O   . HOH G 4 .   ? -30.681 21.822 30.492  1.00 24.51 ?  389 HOH B O   1 
HETATM 1890 O O   . HOH G 4 .   ? -17.139 18.136 5.989   1.00 28.71 ?  390 HOH B O   1 
HETATM 1891 O O   . HOH G 4 .   ? -33.276 24.789 32.059  1.00 32.07 ?  391 HOH B O   1 
HETATM 1892 O O   . HOH G 4 .   ? -23.540 38.842 18.032  1.00 28.41 ?  392 HOH B O   1 
HETATM 1893 O O   . HOH G 4 .   ? -9.296  34.039 0.856   1.00 28.69 ?  393 HOH B O   1 
HETATM 1894 O O   . HOH G 4 .   ? -6.110  35.608 5.099   1.00 27.89 ?  394 HOH B O   1 
HETATM 1895 O O   . HOH G 4 .   ? -27.249 25.429 12.839  1.00 34.59 ?  395 HOH B O   1 
HETATM 1896 O O   . HOH G 4 .   ? -3.736  35.571 16.486  1.00 26.39 ?  396 HOH B O   1 
HETATM 1897 O O   . HOH G 4 .   ? 0.062   34.394 0.378   1.00 36.15 ?  397 HOH B O   1 
HETATM 1898 O O   . HOH G 4 .   ? -21.250 20.977 14.462  1.00 29.05 ?  398 HOH B O   1 
HETATM 1899 O O   . HOH G 4 .   ? 0.101   32.941 16.152  1.00 30.97 ?  399 HOH B O   1 
HETATM 1900 O O   . HOH G 4 .   ? -9.828  35.622 6.617   1.00 20.26 ?  400 HOH B O   1 
HETATM 1901 O O   . HOH G 4 .   ? -23.787 37.316 20.431  1.00 22.81 ?  401 HOH B O   1 
HETATM 1902 O O   . HOH G 4 .   ? -12.213 34.829 23.133  1.00 27.38 ?  402 HOH B O   1 
HETATM 1903 O O   . HOH G 4 .   ? 1.136   21.348 16.912  1.00 34.07 ?  403 HOH B O   1 
HETATM 1904 O O   . HOH G 4 .   ? -5.832  18.412 1.363   1.00 26.15 ?  404 HOH B O   1 
HETATM 1905 O O   . HOH G 4 .   ? -32.901 30.225 37.921  1.00 36.87 ?  405 HOH B O   1 
HETATM 1906 O O   . HOH G 4 .   ? -10.536 32.979 24.698  1.00 24.06 ?  406 HOH B O   1 
HETATM 1907 O O   . HOH G 4 .   ? 12.151  21.077 -2.881  1.00 36.12 ?  407 HOH B O   1 
HETATM 1908 O O   . HOH G 4 .   ? -5.795  31.327 -4.209  1.00 30.42 ?  408 HOH B O   1 
HETATM 1909 O O   . HOH G 4 .   ? -5.147  20.572 -0.709  1.00 30.11 ?  409 HOH B O   1 
HETATM 1910 O O   . HOH G 4 .   ? -10.221 31.438 -2.345  1.00 30.78 ?  410 HOH B O   1 
HETATM 1911 O O   . HOH G 4 .   ? -23.811 39.077 22.563  1.00 30.39 ?  411 HOH B O   1 
HETATM 1912 O O   . HOH G 4 .   ? -24.074 22.914 9.328   1.00 27.47 ?  412 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   1   1   THR THR A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  TRP 50  50  50  TRP TRP A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  CYS 59  59  59  CYS CYS A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  CYS 79  79  79  CYS CYS A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  HIS 97  97  97  HIS HIS A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
B 1 1   THR 1   1   1   THR THR B . n 
B 1 2   GLY 2   2   2   GLY GLY B . n 
B 1 3   GLN 3   3   3   GLN GLN B . n 
B 1 4   PHE 4   4   4   PHE PHE B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   CYS 8   8   8   CYS CYS B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  ASP 10  10  10  ASP ASP B . n 
B 1 11  ILE 11  11  11  ILE ILE B . n 
B 1 12  THR 12  12  12  THR THR B . n 
B 1 13  LEU 13  13  13  LEU LEU B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  ALA 20  20  20  ALA ALA B . n 
B 1 21  PHE 21  21  21  PHE PHE B . n 
B 1 22  CYS 22  22  22  CYS CYS B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  LYS 24  24  24  LYS LYS B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  ASP 26  26  26  ASP ASP B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  THR 29  29  29  THR THR B . n 
B 1 30  LEU 30  30  30  LEU LEU B . n 
B 1 31  ASN 31  31  31  ASN ASN B . n 
B 1 32  GLU 32  32  32  GLU GLU B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  SER 34  34  34  SER SER B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  ILE 41  41  41  ILE ILE B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  ASN 43  43  43  ASN ASN B . n 
B 1 44  LEU 44  44  44  LEU LEU B . n 
B 1 45  ASP 45  45  45  ASP ASP B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  THR 47  47  47  THR THR B . n 
B 1 48  LEU 48  48  48  LEU LEU B . n 
B 1 49  SER 49  49  49  SER SER B . n 
B 1 50  TRP 50  50  50  TRP TRP B . n 
B 1 51  GLY 51  51  51  GLY GLY B . n 
B 1 52  ASP 52  52  52  ASP ASP B . n 
B 1 53  HIS 53  53  53  HIS HIS B . n 
B 1 54  ASN 54  54  54  ASN ASN B . n 
B 1 55  PHE 55  55  55  PHE PHE B . n 
B 1 56  SER 56  56  56  SER SER B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  CYS 59  59  59  CYS CYS B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  SER 67  67  67  SER SER B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  PHE 69  69  69  PHE PHE B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  ARG 71  71  71  ARG ARG B . n 
B 1 72  THR 72  72  72  THR THR B . n 
B 1 73  TYR 73  73  73  TYR TYR B . n 
B 1 74  VAL 74  74  74  VAL VAL B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  ALA 77  77  77  ALA ALA B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  CYS 79  79  79  CYS CYS B . n 
B 1 80  GLU 80  80  80  GLU GLU B . n 
B 1 81  ARG 81  81  81  ARG ARG B . n 
B 1 82  ARG 82  82  82  ARG ARG B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  TYR 85  85  85  TYR TYR B . n 
B 1 86  THR 86  86  86  THR THR B . n 
B 1 87  TYR 87  87  87  TYR TYR B . n 
B 1 88  ILE 88  88  88  ILE ILE B . n 
B 1 89  PRO 89  89  89  PRO PRO B . n 
B 1 90  THR 90  90  90  THR THR B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  GLU 96  96  96  GLU GLU B . n 
B 1 97  HIS 97  97  97  HIS HIS B . n 
B 1 98  ILE 98  98  98  ILE ILE B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 ILE 101 101 101 ILE ILE B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 GLY 103 103 103 GLY GLY B . n 
B 1 104 THR 104 104 104 THR THR B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 THR 106 106 106 THR THR B . n 
B 1 107 TYR 107 107 107 TYR TYR B . n 
B 1 108 GLU 108 108 108 GLU GLU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PEG 1   201 109 PEG PEG A . 
D 2 PEG 1   202 110 PEG PEG A . 
E 3 EDO 1   201 111 EDO EDO B . 
F 4 HOH 1   301 274 HOH HOH A . 
F 4 HOH 2   302 310 HOH HOH A . 
F 4 HOH 3   303 189 HOH HOH A . 
F 4 HOH 4   304 287 HOH HOH A . 
F 4 HOH 5   305 229 HOH HOH A . 
F 4 HOH 6   306 239 HOH HOH A . 
F 4 HOH 7   307 275 HOH HOH A . 
F 4 HOH 8   308 168 HOH HOH A . 
F 4 HOH 9   309 260 HOH HOH A . 
F 4 HOH 10  310 195 HOH HOH A . 
F 4 HOH 11  311 240 HOH HOH A . 
F 4 HOH 12  312 172 HOH HOH A . 
F 4 HOH 13  313 289 HOH HOH A . 
F 4 HOH 14  314 255 HOH HOH A . 
F 4 HOH 15  315 294 HOH HOH A . 
F 4 HOH 16  316 167 HOH HOH A . 
F 4 HOH 17  317 170 HOH HOH A . 
F 4 HOH 18  318 217 HOH HOH A . 
F 4 HOH 19  319 179 HOH HOH A . 
F 4 HOH 20  320 271 HOH HOH A . 
F 4 HOH 21  321 242 HOH HOH A . 
F 4 HOH 22  322 317 HOH HOH A . 
F 4 HOH 23  323 113 HOH HOH A . 
F 4 HOH 24  324 164 HOH HOH A . 
F 4 HOH 25  325 218 HOH HOH A . 
F 4 HOH 26  326 173 HOH HOH A . 
F 4 HOH 27  327 270 HOH HOH A . 
F 4 HOH 28  328 177 HOH HOH A . 
F 4 HOH 29  329 115 HOH HOH A . 
F 4 HOH 30  330 284 HOH HOH A . 
F 4 HOH 31  331 273 HOH HOH A . 
F 4 HOH 32  332 152 HOH HOH A . 
F 4 HOH 33  333 279 HOH HOH A . 
F 4 HOH 34  334 219 HOH HOH A . 
F 4 HOH 35  335 112 HOH HOH A . 
F 4 HOH 36  336 278 HOH HOH A . 
F 4 HOH 37  337 200 HOH HOH A . 
F 4 HOH 38  338 121 HOH HOH A . 
F 4 HOH 39  339 169 HOH HOH A . 
F 4 HOH 40  340 117 HOH HOH A . 
F 4 HOH 41  341 129 HOH HOH A . 
F 4 HOH 42  342 175 HOH HOH A . 
F 4 HOH 43  343 222 HOH HOH A . 
F 4 HOH 44  344 157 HOH HOH A . 
F 4 HOH 45  345 116 HOH HOH A . 
F 4 HOH 46  346 178 HOH HOH A . 
F 4 HOH 47  347 171 HOH HOH A . 
F 4 HOH 48  348 205 HOH HOH A . 
F 4 HOH 49  349 176 HOH HOH A . 
F 4 HOH 50  350 254 HOH HOH A . 
F 4 HOH 51  351 312 HOH HOH A . 
F 4 HOH 52  352 225 HOH HOH A . 
F 4 HOH 53  353 131 HOH HOH A . 
F 4 HOH 54  354 266 HOH HOH A . 
F 4 HOH 55  355 226 HOH HOH A . 
F 4 HOH 56  356 120 HOH HOH A . 
F 4 HOH 57  357 215 HOH HOH A . 
F 4 HOH 58  358 321 HOH HOH A . 
F 4 HOH 59  359 122 HOH HOH A . 
F 4 HOH 60  360 123 HOH HOH A . 
F 4 HOH 61  361 118 HOH HOH A . 
F 4 HOH 62  362 235 HOH HOH A . 
F 4 HOH 63  363 127 HOH HOH A . 
F 4 HOH 64  364 125 HOH HOH A . 
F 4 HOH 65  365 198 HOH HOH A . 
F 4 HOH 66  366 234 HOH HOH A . 
F 4 HOH 67  367 174 HOH HOH A . 
F 4 HOH 68  368 119 HOH HOH A . 
F 4 HOH 69  369 130 HOH HOH A . 
F 4 HOH 70  370 166 HOH HOH A . 
F 4 HOH 71  371 114 HOH HOH A . 
F 4 HOH 72  372 128 HOH HOH A . 
F 4 HOH 73  373 126 HOH HOH A . 
F 4 HOH 74  374 292 HOH HOH A . 
F 4 HOH 75  375 190 HOH HOH A . 
F 4 HOH 76  376 277 HOH HOH A . 
F 4 HOH 77  377 328 HOH HOH A . 
F 4 HOH 78  378 303 HOH HOH A . 
F 4 HOH 79  379 297 HOH HOH A . 
F 4 HOH 80  380 295 HOH HOH A . 
F 4 HOH 81  381 315 HOH HOH A . 
F 4 HOH 82  382 298 HOH HOH A . 
F 4 HOH 83  383 244 HOH HOH A . 
F 4 HOH 84  384 221 HOH HOH A . 
F 4 HOH 85  385 307 HOH HOH A . 
F 4 HOH 86  386 264 HOH HOH A . 
F 4 HOH 87  387 314 HOH HOH A . 
F 4 HOH 88  388 257 HOH HOH A . 
F 4 HOH 89  389 290 HOH HOH A . 
F 4 HOH 90  390 223 HOH HOH A . 
F 4 HOH 91  391 281 HOH HOH A . 
F 4 HOH 92  392 300 HOH HOH A . 
F 4 HOH 93  393 241 HOH HOH A . 
F 4 HOH 94  394 203 HOH HOH A . 
F 4 HOH 95  395 204 HOH HOH A . 
F 4 HOH 96  396 220 HOH HOH A . 
F 4 HOH 97  397 324 HOH HOH A . 
F 4 HOH 98  398 165 HOH HOH A . 
F 4 HOH 99  399 227 HOH HOH A . 
F 4 HOH 100 400 224 HOH HOH A . 
F 4 HOH 101 401 202 HOH HOH A . 
F 4 HOH 102 402 206 HOH HOH A . 
F 4 HOH 103 403 238 HOH HOH A . 
F 4 HOH 104 404 304 HOH HOH A . 
F 4 HOH 105 405 201 HOH HOH A . 
G 4 HOH 1   301 283 HOH HOH B . 
G 4 HOH 2   302 207 HOH HOH B . 
G 4 HOH 3   303 153 HOH HOH B . 
G 4 HOH 4   304 261 HOH HOH B . 
G 4 HOH 5   305 280 HOH HOH B . 
G 4 HOH 6   306 253 HOH HOH B . 
G 4 HOH 7   307 245 HOH HOH B . 
G 4 HOH 8   308 135 HOH HOH B . 
G 4 HOH 9   309 180 HOH HOH B . 
G 4 HOH 10  310 237 HOH HOH B . 
G 4 HOH 11  311 251 HOH HOH B . 
G 4 HOH 12  312 144 HOH HOH B . 
G 4 HOH 13  313 149 HOH HOH B . 
G 4 HOH 14  314 160 HOH HOH B . 
G 4 HOH 15  315 141 HOH HOH B . 
G 4 HOH 16  316 320 HOH HOH B . 
G 4 HOH 17  317 199 HOH HOH B . 
G 4 HOH 18  318 142 HOH HOH B . 
G 4 HOH 19  319 258 HOH HOH B . 
G 4 HOH 20  320 276 HOH HOH B . 
G 4 HOH 21  321 267 HOH HOH B . 
G 4 HOH 22  322 196 HOH HOH B . 
G 4 HOH 23  323 140 HOH HOH B . 
G 4 HOH 24  324 137 HOH HOH B . 
G 4 HOH 25  325 233 HOH HOH B . 
G 4 HOH 26  326 191 HOH HOH B . 
G 4 HOH 27  327 265 HOH HOH B . 
G 4 HOH 28  328 246 HOH HOH B . 
G 4 HOH 29  329 236 HOH HOH B . 
G 4 HOH 30  330 138 HOH HOH B . 
G 4 HOH 31  331 209 HOH HOH B . 
G 4 HOH 32  332 154 HOH HOH B . 
G 4 HOH 33  333 249 HOH HOH B . 
G 4 HOH 34  334 216 HOH HOH B . 
G 4 HOH 35  335 150 HOH HOH B . 
G 4 HOH 36  336 158 HOH HOH B . 
G 4 HOH 37  337 211 HOH HOH B . 
G 4 HOH 38  338 186 HOH HOH B . 
G 4 HOH 39  339 145 HOH HOH B . 
G 4 HOH 40  340 247 HOH HOH B . 
G 4 HOH 41  341 187 HOH HOH B . 
G 4 HOH 42  342 159 HOH HOH B . 
G 4 HOH 43  343 259 HOH HOH B . 
G 4 HOH 44  344 151 HOH HOH B . 
G 4 HOH 45  345 134 HOH HOH B . 
G 4 HOH 46  346 136 HOH HOH B . 
G 4 HOH 47  347 311 HOH HOH B . 
G 4 HOH 48  348 262 HOH HOH B . 
G 4 HOH 49  349 124 HOH HOH B . 
G 4 HOH 50  350 197 HOH HOH B . 
G 4 HOH 51  351 252 HOH HOH B . 
G 4 HOH 52  352 306 HOH HOH B . 
G 4 HOH 53  353 156 HOH HOH B . 
G 4 HOH 54  354 184 HOH HOH B . 
G 4 HOH 55  355 188 HOH HOH B . 
G 4 HOH 56  356 288 HOH HOH B . 
G 4 HOH 57  357 139 HOH HOH B . 
G 4 HOH 58  358 155 HOH HOH B . 
G 4 HOH 59  359 194 HOH HOH B . 
G 4 HOH 60  360 148 HOH HOH B . 
G 4 HOH 61  361 268 HOH HOH B . 
G 4 HOH 62  362 302 HOH HOH B . 
G 4 HOH 63  363 133 HOH HOH B . 
G 4 HOH 64  364 322 HOH HOH B . 
G 4 HOH 65  365 299 HOH HOH B . 
G 4 HOH 66  366 291 HOH HOH B . 
G 4 HOH 67  367 143 HOH HOH B . 
G 4 HOH 68  368 162 HOH HOH B . 
G 4 HOH 69  369 305 HOH HOH B . 
G 4 HOH 70  370 282 HOH HOH B . 
G 4 HOH 71  371 163 HOH HOH B . 
G 4 HOH 72  372 132 HOH HOH B . 
G 4 HOH 73  373 147 HOH HOH B . 
G 4 HOH 74  374 319 HOH HOH B . 
G 4 HOH 75  375 146 HOH HOH B . 
G 4 HOH 76  376 181 HOH HOH B . 
G 4 HOH 77  377 250 HOH HOH B . 
G 4 HOH 78  378 183 HOH HOH B . 
G 4 HOH 79  379 301 HOH HOH B . 
G 4 HOH 80  380 272 HOH HOH B . 
G 4 HOH 81  381 213 HOH HOH B . 
G 4 HOH 82  382 212 HOH HOH B . 
G 4 HOH 83  383 323 HOH HOH B . 
G 4 HOH 84  384 182 HOH HOH B . 
G 4 HOH 85  385 243 HOH HOH B . 
G 4 HOH 86  386 318 HOH HOH B . 
G 4 HOH 87  387 214 HOH HOH B . 
G 4 HOH 88  388 327 HOH HOH B . 
G 4 HOH 89  389 208 HOH HOH B . 
G 4 HOH 90  390 286 HOH HOH B . 
G 4 HOH 91  391 316 HOH HOH B . 
G 4 HOH 92  392 231 HOH HOH B . 
G 4 HOH 93  393 296 HOH HOH B . 
G 4 HOH 94  394 193 HOH HOH B . 
G 4 HOH 95  395 326 HOH HOH B . 
G 4 HOH 96  396 248 HOH HOH B . 
G 4 HOH 97  397 263 HOH HOH B . 
G 4 HOH 98  398 285 HOH HOH B . 
G 4 HOH 99  399 256 HOH HOH B . 
G 4 HOH 100 400 192 HOH HOH B . 
G 4 HOH 101 401 230 HOH HOH B . 
G 4 HOH 102 402 185 HOH HOH B . 
G 4 HOH 103 403 325 HOH HOH B . 
G 4 HOH 104 404 161 HOH HOH B . 
G 4 HOH 105 405 308 HOH HOH B . 
G 4 HOH 106 406 210 HOH HOH B . 
G 4 HOH 107 407 309 HOH HOH B . 
G 4 HOH 108 408 313 HOH HOH B . 
G 4 HOH 109 409 269 HOH HOH B . 
G 4 HOH 110 410 293 HOH HOH B . 
G 4 HOH 111 411 232 HOH HOH B . 
G 4 HOH 112 412 228 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,F 
2 1 B,E,G   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    EDO 
_pdbx_struct_special_symmetry.auth_seq_id     201 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   EDO 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-07-20 
2 'Structure model' 1 1 2016-07-27 
3 'Structure model' 1 2 2016-09-14 
4 'Structure model' 1 3 2017-09-20 
5 'Structure model' 1 4 2017-09-27 
6 'Structure model' 1 5 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Data collection'            
7 5 'Structure model' 'Refinement description'     
8 6 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation                    
2 4 'Structure model' pdbx_audit_support          
3 4 'Structure model' pdbx_struct_oper_list       
4 5 'Structure model' diffrn_radiation_wavelength 
5 5 'Structure model' software                    
6 6 'Structure model' pdbx_audit_support          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 6 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .          1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.8.4_1496 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20       3 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .          4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .          5 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 C2 B EDO 201 ? ? 1_555 O2 B EDO 201 ? ? 2_565 1.44 
2 1 O  B HOH 388 ? ? 1_555 O  B HOH 388 ? ? 2_565 2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 28 ? ? -144.25 -26.90 
2 1 TYR A 85 ? ? -140.09 -24.19 
3 1 HIS A 97 ? ? -140.75 15.86  
4 1 TYR B 28 ? ? -144.89 -26.60 
5 1 TYR B 85 ? ? -140.37 -24.25 
6 1 HIS B 97 ? ? -140.28 16.25  
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           RO1GM080642 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DI(HYDROXYETHYL)ETHER' PEG 
3 1,2-ETHANEDIOL          EDO 
4 water                   HOH 
#