data_5K9S
# 
_entry.id   5K9S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5K9S         
WWPDB D_1000218407 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5K9S 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-01 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wiedmann, M.M.' 1 
'Aibara, S.'     2 
'Spring, D.R.'   3 
'Stewart, M.'    4 
'Brenton, J.'    5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Importin-alpha in complex with HNF1-beta peptide' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wiedmann, M.M.' 1 
primary 'Aibara, S.'     2 
primary 'Spring, D.R.'   3 
primary 'Stewart, M.'    4 
primary 'Brenton, J.'    5 
# 
_cell.entry_id           5K9S 
_cell.length_a           81.380 
_cell.length_b           111.394 
_cell.length_c           129.358 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5K9S 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Importin subunit alpha-1'     49644.406 1  ? ? ? ? 
2 polymer man 'HNF1 beta A splice variant 2' 1484.815  2  ? ? ? ? 
3 water   nat water                          18.015    53 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Importin alpha P1,Karyopherin subunit alpha-2,Pendulin,Pore targeting complex 58 kDa subunit,PTAC58,RAG cohort protein 1,SRP1-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGT
SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTW
TLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT
PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADF
KTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD
KIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF
;
;GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGT
SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTW
TLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT
PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADF
KTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD
KIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF
;
A   ? 
2 'polypeptide(L)' no no TNKKMRRNRFK TNKKMRRNRFK B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   THR n 
1 3   VAL n 
1 4   ASN n 
1 5   TRP n 
1 6   SER n 
1 7   VAL n 
1 8   GLU n 
1 9   ASP n 
1 10  ILE n 
1 11  VAL n 
1 12  LYS n 
1 13  GLY n 
1 14  ILE n 
1 15  ASN n 
1 16  SER n 
1 17  ASN n 
1 18  ASN n 
1 19  LEU n 
1 20  GLU n 
1 21  SER n 
1 22  GLN n 
1 23  LEU n 
1 24  GLN n 
1 25  ALA n 
1 26  THR n 
1 27  GLN n 
1 28  ALA n 
1 29  ALA n 
1 30  ARG n 
1 31  LYS n 
1 32  LEU n 
1 33  LEU n 
1 34  SER n 
1 35  ARG n 
1 36  GLU n 
1 37  LYS n 
1 38  GLN n 
1 39  PRO n 
1 40  PRO n 
1 41  ILE n 
1 42  ASP n 
1 43  ASN n 
1 44  ILE n 
1 45  ILE n 
1 46  ARG n 
1 47  ALA n 
1 48  GLY n 
1 49  LEU n 
1 50  ILE n 
1 51  PRO n 
1 52  LYS n 
1 53  PHE n 
1 54  VAL n 
1 55  SER n 
1 56  PHE n 
1 57  LEU n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  ASP n 
1 62  CYS n 
1 63  SER n 
1 64  PRO n 
1 65  ILE n 
1 66  GLN n 
1 67  PHE n 
1 68  GLU n 
1 69  SER n 
1 70  ALA n 
1 71  TRP n 
1 72  ALA n 
1 73  LEU n 
1 74  THR n 
1 75  ASN n 
1 76  ILE n 
1 77  ALA n 
1 78  SER n 
1 79  GLY n 
1 80  THR n 
1 81  SER n 
1 82  GLU n 
1 83  GLN n 
1 84  THR n 
1 85  LYS n 
1 86  ALA n 
1 87  VAL n 
1 88  VAL n 
1 89  ASP n 
1 90  GLY n 
1 91  GLY n 
1 92  ALA n 
1 93  ILE n 
1 94  PRO n 
1 95  ALA n 
1 96  PHE n 
1 97  ILE n 
1 98  SER n 
1 99  LEU n 
1 100 LEU n 
1 101 ALA n 
1 102 SER n 
1 103 PRO n 
1 104 HIS n 
1 105 ALA n 
1 106 HIS n 
1 107 ILE n 
1 108 SER n 
1 109 GLU n 
1 110 GLN n 
1 111 ALA n 
1 112 VAL n 
1 113 TRP n 
1 114 ALA n 
1 115 LEU n 
1 116 GLY n 
1 117 ASN n 
1 118 ILE n 
1 119 ALA n 
1 120 GLY n 
1 121 ASP n 
1 122 GLY n 
1 123 SER n 
1 124 ALA n 
1 125 PHE n 
1 126 ARG n 
1 127 ASP n 
1 128 LEU n 
1 129 VAL n 
1 130 ILE n 
1 131 LYS n 
1 132 HIS n 
1 133 GLY n 
1 134 ALA n 
1 135 ILE n 
1 136 ASP n 
1 137 PRO n 
1 138 LEU n 
1 139 LEU n 
1 140 ALA n 
1 141 LEU n 
1 142 LEU n 
1 143 ALA n 
1 144 VAL n 
1 145 PRO n 
1 146 ASP n 
1 147 LEU n 
1 148 SER n 
1 149 THR n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 GLY n 
1 154 TYR n 
1 155 LEU n 
1 156 ARG n 
1 157 ASN n 
1 158 LEU n 
1 159 THR n 
1 160 TRP n 
1 161 THR n 
1 162 LEU n 
1 163 SER n 
1 164 ASN n 
1 165 LEU n 
1 166 CYS n 
1 167 ARG n 
1 168 ASN n 
1 169 LYS n 
1 170 ASN n 
1 171 PRO n 
1 172 ALA n 
1 173 PRO n 
1 174 PRO n 
1 175 LEU n 
1 176 ASP n 
1 177 ALA n 
1 178 VAL n 
1 179 GLU n 
1 180 GLN n 
1 181 ILE n 
1 182 LEU n 
1 183 PRO n 
1 184 THR n 
1 185 LEU n 
1 186 VAL n 
1 187 ARG n 
1 188 LEU n 
1 189 LEU n 
1 190 HIS n 
1 191 HIS n 
1 192 ASN n 
1 193 ASP n 
1 194 PRO n 
1 195 GLU n 
1 196 VAL n 
1 197 LEU n 
1 198 ALA n 
1 199 ASP n 
1 200 SER n 
1 201 CYS n 
1 202 TRP n 
1 203 ALA n 
1 204 ILE n 
1 205 SER n 
1 206 TYR n 
1 207 LEU n 
1 208 THR n 
1 209 ASP n 
1 210 GLY n 
1 211 PRO n 
1 212 ASN n 
1 213 GLU n 
1 214 ARG n 
1 215 ILE n 
1 216 GLU n 
1 217 MET n 
1 218 VAL n 
1 219 VAL n 
1 220 LYS n 
1 221 LYS n 
1 222 GLY n 
1 223 VAL n 
1 224 VAL n 
1 225 PRO n 
1 226 GLN n 
1 227 LEU n 
1 228 VAL n 
1 229 LYS n 
1 230 LEU n 
1 231 LEU n 
1 232 GLY n 
1 233 ALA n 
1 234 THR n 
1 235 GLU n 
1 236 LEU n 
1 237 PRO n 
1 238 ILE n 
1 239 VAL n 
1 240 THR n 
1 241 PRO n 
1 242 ALA n 
1 243 LEU n 
1 244 ARG n 
1 245 ALA n 
1 246 ILE n 
1 247 GLY n 
1 248 ASN n 
1 249 ILE n 
1 250 VAL n 
1 251 THR n 
1 252 GLY n 
1 253 THR n 
1 254 ASP n 
1 255 GLU n 
1 256 GLN n 
1 257 THR n 
1 258 GLN n 
1 259 LYS n 
1 260 VAL n 
1 261 ILE n 
1 262 ASP n 
1 263 ALA n 
1 264 GLY n 
1 265 ALA n 
1 266 LEU n 
1 267 ALA n 
1 268 VAL n 
1 269 PHE n 
1 270 PRO n 
1 271 SER n 
1 272 LEU n 
1 273 LEU n 
1 274 THR n 
1 275 ASN n 
1 276 PRO n 
1 277 LYS n 
1 278 THR n 
1 279 ASN n 
1 280 ILE n 
1 281 GLN n 
1 282 LYS n 
1 283 GLU n 
1 284 ALA n 
1 285 THR n 
1 286 TRP n 
1 287 THR n 
1 288 MET n 
1 289 SER n 
1 290 ASN n 
1 291 ILE n 
1 292 THR n 
1 293 ALA n 
1 294 GLY n 
1 295 ARG n 
1 296 GLN n 
1 297 ASP n 
1 298 GLN n 
1 299 ILE n 
1 300 GLN n 
1 301 GLN n 
1 302 VAL n 
1 303 VAL n 
1 304 ASN n 
1 305 HIS n 
1 306 GLY n 
1 307 LEU n 
1 308 VAL n 
1 309 PRO n 
1 310 PHE n 
1 311 LEU n 
1 312 VAL n 
1 313 GLY n 
1 314 VAL n 
1 315 LEU n 
1 316 SER n 
1 317 LYS n 
1 318 ALA n 
1 319 ASP n 
1 320 PHE n 
1 321 LYS n 
1 322 THR n 
1 323 GLN n 
1 324 LYS n 
1 325 GLU n 
1 326 ALA n 
1 327 ALA n 
1 328 TRP n 
1 329 ALA n 
1 330 ILE n 
1 331 THR n 
1 332 ASN n 
1 333 TYR n 
1 334 THR n 
1 335 SER n 
1 336 GLY n 
1 337 GLY n 
1 338 THR n 
1 339 VAL n 
1 340 GLU n 
1 341 GLN n 
1 342 ILE n 
1 343 VAL n 
1 344 TYR n 
1 345 LEU n 
1 346 VAL n 
1 347 HIS n 
1 348 CYS n 
1 349 GLY n 
1 350 ILE n 
1 351 ILE n 
1 352 GLU n 
1 353 PRO n 
1 354 LEU n 
1 355 MET n 
1 356 ASN n 
1 357 LEU n 
1 358 LEU n 
1 359 SER n 
1 360 ALA n 
1 361 LYS n 
1 362 ASP n 
1 363 THR n 
1 364 LYS n 
1 365 ILE n 
1 366 ILE n 
1 367 GLN n 
1 368 VAL n 
1 369 ILE n 
1 370 LEU n 
1 371 ASP n 
1 372 ALA n 
1 373 ILE n 
1 374 SER n 
1 375 ASN n 
1 376 ILE n 
1 377 PHE n 
1 378 GLN n 
1 379 ALA n 
1 380 ALA n 
1 381 GLU n 
1 382 LYS n 
1 383 LEU n 
1 384 GLY n 
1 385 GLU n 
1 386 THR n 
1 387 GLU n 
1 388 LYS n 
1 389 LEU n 
1 390 SER n 
1 391 ILE n 
1 392 MET n 
1 393 ILE n 
1 394 GLU n 
1 395 GLU n 
1 396 CYS n 
1 397 GLY n 
1 398 GLY n 
1 399 LEU n 
1 400 ASP n 
1 401 LYS n 
1 402 ILE n 
1 403 GLU n 
1 404 ALA n 
1 405 LEU n 
1 406 GLN n 
1 407 ARG n 
1 408 HIS n 
1 409 GLU n 
1 410 ASN n 
1 411 GLU n 
1 412 SER n 
1 413 VAL n 
1 414 TYR n 
1 415 LYS n 
1 416 ALA n 
1 417 SER n 
1 418 LEU n 
1 419 ASN n 
1 420 LEU n 
1 421 ILE n 
1 422 GLU n 
1 423 LYS n 
1 424 TYR n 
1 425 PHE n 
1 426 SER n 
1 427 VAL n 
1 428 GLU n 
1 429 GLU n 
1 430 GLU n 
1 431 GLU n 
1 432 ASP n 
1 433 GLN n 
1 434 ASN n 
1 435 VAL n 
1 436 VAL n 
1 437 PRO n 
1 438 GLU n 
1 439 THR n 
1 440 THR n 
1 441 SER n 
1 442 GLU n 
1 443 GLY n 
1 444 PHE n 
1 445 ALA n 
1 446 PHE n 
1 447 GLN n 
1 448 VAL n 
1 449 GLN n 
1 450 ASP n 
1 451 GLY n 
1 452 ALA n 
1 453 PRO n 
1 454 GLY n 
1 455 THR n 
1 456 PHE n 
1 457 ASN n 
1 458 PHE n 
2 1   THR n 
2 2   ASN n 
2 3   LYS n 
2 4   LYS n 
2 5   MET n 
2 6   ARG n 
2 7   ARG n 
2 8   ASN n 
2 9   ARG n 
2 10  PHE n 
2 11  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 458 Mouse ? 'Kpna2, Rch1' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 11  Human ? HNF1B         ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 
'synthetic construct'        32630  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP IMA1_MOUSE P52293 ? 1 
;GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGT
SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTW
TLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT
PALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADF
KTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD
KIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF
;
72 
2 PDB 5K9S       5K9S   ? 2 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5K9S A 1 ? 458 ? P52293 72 ? 529 ? 72 529 
2 2 5K9S B 1 ? 11  ? 5K9S   13 ? 23  ? 13 23  
3 2 5K9S C 1 ? 11  ? 5K9S   9  ? 19  ? 9  19  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5K9S 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.79 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.85 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10% PEG 8K, 0.09 M NPS, 20% ethylene glycol, 0.1 M Buffer 1 (Morpheus I)' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-11-10 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97624 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97624 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5K9S 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.4 
_reflns.d_resolution_low                 129.4 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       23388 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.40 
_reflns_shell.d_res_low                   2.49 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5K9S 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     23358 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             65.712 
_refine.ls_d_res_high                            2.400 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.1872 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1852 
_refine.ls_R_factor_R_free                       0.2211 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.15 
_refine.ls_number_reflns_R_free                  1204 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4U54 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.33 
_refine.pdbx_overall_phase_error                 25.77 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3447 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             53 
_refine_hist.number_atoms_total               3500 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        65.712 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 3505 'X-RAY DIFFRACTION' ? 
f_angle_d          0.797  ? ? 4761 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.650 ? ? 1302 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.043  ? ? 568  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 610  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.4000 2.4961  2426 0.2619 100.00 0.3548 . . 117 . . . . 
'X-RAY DIFFRACTION' . 2.4961 2.6097  2419 0.2377 100.00 0.2840 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.6097 2.7473  2454 0.2211 100.00 0.2409 . . 111 . . . . 
'X-RAY DIFFRACTION' . 2.7473 2.9194  2442 0.2203 100.00 0.2697 . . 131 . . . . 
'X-RAY DIFFRACTION' . 2.9194 3.1448  2460 0.2176 100.00 0.2639 . . 131 . . . . 
'X-RAY DIFFRACTION' . 3.1448 3.4613  2434 0.2209 100.00 0.2439 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.4613 3.9621  2444 0.1869 100.00 0.2129 . . 154 . . . . 
'X-RAY DIFFRACTION' . 3.9621 4.9916  2482 0.1481 100.00 0.1916 . . 146 . . . . 
'X-RAY DIFFRACTION' . 4.9916 65.7368 2593 0.1621 100.00 0.1947 . . 139 . . . . 
# 
_struct.entry_id                     5K9S 
_struct.title                        'Importin-alpha in complex with HNF1-beta peptide' 
_struct.pdbx_descriptor              'Importin subunit alpha-1, HNF1 beta A splice variant 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5K9S 
_struct_keywords.text            'Nuclear transport, transport protein' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 6   ? SER A 16  ? SER A 77  SER A 87  1 ? 11 
HELX_P HELX_P2  AA2 ASN A 18  ? SER A 34  ? ASN A 89  SER A 105 1 ? 17 
HELX_P HELX_P3  AA3 PRO A 40  ? ALA A 47  ? PRO A 111 ALA A 118 1 ? 8  
HELX_P HELX_P4  AA4 GLY A 48  ? LEU A 57  ? GLY A 119 LEU A 128 1 ? 10 
HELX_P HELX_P5  AA5 CYS A 62  ? SER A 78  ? CYS A 133 SER A 149 1 ? 17 
HELX_P HELX_P6  AA6 THR A 80  ? GLY A 90  ? THR A 151 GLY A 161 1 ? 11 
HELX_P HELX_P7  AA7 GLY A 91  ? LEU A 100 ? GLY A 162 LEU A 171 1 ? 10 
HELX_P HELX_P8  AA8 HIS A 104 ? GLY A 120 ? HIS A 175 GLY A 191 1 ? 17 
HELX_P HELX_P9  AA9 GLY A 122 ? HIS A 132 ? GLY A 193 HIS A 203 1 ? 11 
HELX_P HELX_P10 AB1 ALA A 134 ? LEU A 142 ? ALA A 205 LEU A 213 1 ? 9  
HELX_P HELX_P11 AB2 ASP A 146 ? LEU A 150 ? ASP A 217 LEU A 221 5 ? 5  
HELX_P HELX_P12 AB3 ALA A 151 ? ARG A 167 ? ALA A 222 ARG A 238 1 ? 17 
HELX_P HELX_P13 AB4 PRO A 174 ? HIS A 190 ? PRO A 245 HIS A 261 1 ? 17 
HELX_P HELX_P14 AB5 ASP A 193 ? THR A 208 ? ASP A 264 THR A 279 1 ? 16 
HELX_P HELX_P15 AB6 PRO A 211 ? LYS A 221 ? PRO A 282 LYS A 292 1 ? 11 
HELX_P HELX_P16 AB7 VAL A 223 ? GLY A 232 ? VAL A 294 GLY A 303 1 ? 10 
HELX_P HELX_P17 AB8 GLU A 235 ? VAL A 250 ? GLU A 306 VAL A 321 1 ? 16 
HELX_P HELX_P18 AB9 THR A 253 ? ALA A 263 ? THR A 324 ALA A 334 1 ? 11 
HELX_P HELX_P19 AC1 GLY A 264 ? ALA A 267 ? GLY A 335 ALA A 338 5 ? 4  
HELX_P HELX_P20 AC2 VAL A 268 ? THR A 274 ? VAL A 339 THR A 345 1 ? 7  
HELX_P HELX_P21 AC3 LYS A 277 ? THR A 292 ? LYS A 348 THR A 363 1 ? 16 
HELX_P HELX_P22 AC4 ARG A 295 ? HIS A 305 ? ARG A 366 HIS A 376 1 ? 11 
HELX_P HELX_P23 AC5 LEU A 307 ? ALA A 318 ? LEU A 378 ALA A 389 1 ? 12 
HELX_P HELX_P24 AC6 ASP A 319 ? GLY A 337 ? ASP A 390 GLY A 408 1 ? 19 
HELX_P HELX_P25 AC7 THR A 338 ? CYS A 348 ? THR A 409 CYS A 419 1 ? 11 
HELX_P HELX_P26 AC8 ILE A 350 ? LEU A 357 ? ILE A 421 LEU A 428 1 ? 8  
HELX_P HELX_P27 AC9 LEU A 358 ? ALA A 360 ? LEU A 429 ALA A 431 5 ? 3  
HELX_P HELX_P28 AD1 ASP A 362 ? GLY A 384 ? ASP A 433 GLY A 455 1 ? 23 
HELX_P HELX_P29 AD2 GLU A 385 ? CYS A 396 ? GLU A 456 CYS A 467 1 ? 12 
HELX_P HELX_P30 AD3 GLY A 397 ? LEU A 405 ? GLY A 468 LEU A 476 1 ? 9  
HELX_P HELX_P31 AD4 GLN A 406 ? HIS A 408 ? GLN A 477 HIS A 479 5 ? 3  
HELX_P HELX_P32 AD5 ASN A 410 ? PHE A 425 ? ASN A 481 PHE A 496 1 ? 16 
HELX_P HELX_P33 AD6 ARG C 6   ? LYS C 11  ? ARG C 14  LYS C 19  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASN 
_struct_mon_prot_cis.label_seq_id           170 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASN 
_struct_mon_prot_cis.auth_seq_id            241 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    171 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     242 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.58 
# 
_atom_sites.entry_id                    5K9S 
_atom_sites.fract_transf_matrix[1][1]   0.012288 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008977 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007730 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . VAL A 1 3   ? -11.778 7.158   14.992  1.00 155.84 ? 74  VAL A N    1 
ATOM   2    C CA   . VAL A 1 3   ? -11.193 5.935   14.451  1.00 151.38 ? 74  VAL A CA   1 
ATOM   3    C C    . VAL A 1 3   ? -10.660 6.254   13.048  1.00 147.97 ? 74  VAL A C    1 
ATOM   4    O O    . VAL A 1 3   ? -10.384 7.420   12.750  1.00 153.90 ? 74  VAL A O    1 
ATOM   5    C CB   . VAL A 1 3   ? -12.224 4.769   14.471  1.00 147.50 ? 74  VAL A CB   1 
ATOM   6    C CG1  . VAL A 1 3   ? -13.252 4.884   13.330  1.00 149.02 ? 74  VAL A CG1  1 
ATOM   7    C CG2  . VAL A 1 3   ? -11.525 3.392   14.520  1.00 141.96 ? 74  VAL A CG2  1 
ATOM   8    H HA   . VAL A 1 3   ? -10.440 5.675   15.004  1.00 181.65 ? 74  VAL A HA   1 
ATOM   9    H HB   . VAL A 1 3   ? -12.727 4.846   15.297  1.00 177.00 ? 74  VAL A HB   1 
ATOM   10   H HG11 . VAL A 1 3   ? -14.064 4.421   13.591  1.00 178.82 ? 74  VAL A HG11 1 
ATOM   11   H HG12 . VAL A 1 3   ? -13.443 5.822   13.172  1.00 178.82 ? 74  VAL A HG12 1 
ATOM   12   H HG13 . VAL A 1 3   ? -12.886 4.482   12.527  1.00 178.82 ? 74  VAL A HG13 1 
ATOM   13   H HG21 . VAL A 1 3   ? -12.080 2.739   14.066  1.00 170.36 ? 74  VAL A HG21 1 
ATOM   14   H HG22 . VAL A 1 3   ? -10.662 3.456   14.083  1.00 170.36 ? 74  VAL A HG22 1 
ATOM   15   H HG23 . VAL A 1 3   ? -11.402 3.136   15.448  1.00 170.36 ? 74  VAL A HG23 1 
ATOM   16   N N    . ASN A 1 4   ? -10.503 5.240   12.191  1.00 136.43 ? 75  ASN A N    1 
ATOM   17   C CA   . ASN A 1 4   ? -9.820  5.401   10.908  1.00 129.71 ? 75  ASN A CA   1 
ATOM   18   C C    . ASN A 1 4   ? -8.392  5.893   11.130  1.00 122.64 ? 75  ASN A C    1 
ATOM   19   O O    . ASN A 1 4   ? -7.959  6.895   10.555  1.00 131.58 ? 75  ASN A O    1 
ATOM   20   C CB   . ASN A 1 4   ? -10.579 6.354   9.984   1.00 133.34 ? 75  ASN A CB   1 
ATOM   21   C CG   . ASN A 1 4   ? -11.889 5.782   9.506   1.00 136.74 ? 75  ASN A CG   1 
ATOM   22   O OD1  . ASN A 1 4   ? -12.844 5.665   10.271  1.00 137.95 ? 75  ASN A OD1  1 
ATOM   23   N ND2  . ASN A 1 4   ? -11.949 5.435   8.225   1.00 138.59 ? 75  ASN A ND2  1 
ATOM   24   H H    . ASN A 1 4   ? -10.789 4.442   12.328  1.00 163.72 ? 75  ASN A H    1 
ATOM   25   H HA   . ASN A 1 4   ? -9.772  4.537   10.469  1.00 155.65 ? 75  ASN A HA   1 
ATOM   26   H HB2  . ASN A 1 4   ? -10.767 7.181   10.453  1.00 160.01 ? 75  ASN A HB2  1 
ATOM   27   H HB3  . ASN A 1 4   ? -10.032 6.536   9.204   1.00 160.01 ? 75  ASN A HB3  1 
ATOM   28   H HD21 . ASN A 1 4   ? -12.675 5.105   7.902   1.00 166.31 ? 75  ASN A HD21 1 
ATOM   29   H HD22 . ASN A 1 4   ? -11.262 5.540   7.718   1.00 166.31 ? 75  ASN A HD22 1 
ATOM   30   N N    . TRP A 1 5   ? -7.658  5.182   11.986  1.00 106.30 ? 76  TRP A N    1 
ATOM   31   C CA   . TRP A 1 5   ? -6.292  5.581   12.306  1.00 88.94  ? 76  TRP A CA   1 
ATOM   32   C C    . TRP A 1 5   ? -5.409  5.513   11.070  1.00 81.31  ? 76  TRP A C    1 
ATOM   33   O O    . TRP A 1 5   ? -5.667  4.751   10.135  1.00 79.34  ? 76  TRP A O    1 
ATOM   34   C CB   . TRP A 1 5   ? -5.697  4.679   13.382  1.00 81.14  ? 76  TRP A CB   1 
ATOM   35   C CG   . TRP A 1 5   ? -6.307  4.813   14.714  1.00 78.34  ? 76  TRP A CG   1 
ATOM   36   C CD1  . TRP A 1 5   ? -7.614  5.071   14.996  1.00 81.48  ? 76  TRP A CD1  1 
ATOM   37   C CD2  . TRP A 1 5   ? -5.635  4.699   15.973  1.00 73.77  ? 76  TRP A CD2  1 
ATOM   38   N NE1  . TRP A 1 5   ? -7.802  5.121   16.355  1.00 81.35  ? 76  TRP A NE1  1 
ATOM   39   C CE2  . TRP A 1 5   ? -6.602  4.897   16.978  1.00 76.78  ? 76  TRP A CE2  1 
ATOM   40   C CE3  . TRP A 1 5   ? -4.308  4.446   16.349  1.00 69.47  ? 76  TRP A CE3  1 
ATOM   41   C CZ2  . TRP A 1 5   ? -6.288  4.853   18.333  1.00 74.84  ? 76  TRP A CZ2  1 
ATOM   42   C CZ3  . TRP A 1 5   ? -3.998  4.399   17.689  1.00 69.53  ? 76  TRP A CZ3  1 
ATOM   43   C CH2  . TRP A 1 5   ? -4.984  4.603   18.670  1.00 72.13  ? 76  TRP A CH2  1 
ATOM   44   H H    . TRP A 1 5   ? -7.926  4.472   12.390  1.00 127.56 ? 76  TRP A H    1 
ATOM   45   H HA   . TRP A 1 5   ? -6.291  6.494   12.635  1.00 106.73 ? 76  TRP A HA   1 
ATOM   46   H HB2  . TRP A 1 5   ? -5.802  3.757   13.102  1.00 97.37  ? 76  TRP A HB2  1 
ATOM   47   H HB3  . TRP A 1 5   ? -4.754  4.886   13.471  1.00 97.37  ? 76  TRP A HB3  1 
ATOM   48   H HD1  . TRP A 1 5   ? -8.283  5.193   14.361  1.00 97.78  ? 76  TRP A HD1  1 
ATOM   49   H HE1  . TRP A 1 5   ? -8.550  5.272   16.751  1.00 97.62  ? 76  TRP A HE1  1 
ATOM   50   H HE3  . TRP A 1 5   ? -3.651  4.310   15.705  1.00 83.36  ? 76  TRP A HE3  1 
ATOM   51   H HZ2  . TRP A 1 5   ? -6.938  4.986   18.984  1.00 89.81  ? 76  TRP A HZ2  1 
ATOM   52   H HZ3  . TRP A 1 5   ? -3.121  4.233   17.950  1.00 83.43  ? 76  TRP A HZ3  1 
ATOM   53   H HH2  . TRP A 1 5   ? -4.746  4.567   19.568  1.00 86.55  ? 76  TRP A HH2  1 
ATOM   54   N N    . SER A 1 6   ? -4.346  6.306   11.082  1.00 76.74  ? 77  SER A N    1 
ATOM   55   C CA   . SER A 1 6   ? -3.320  6.192   10.061  1.00 75.84  ? 77  SER A CA   1 
ATOM   56   C C    . SER A 1 6   ? -2.308  5.130   10.469  1.00 73.65  ? 77  SER A C    1 
ATOM   57   O O    . SER A 1 6   ? -2.149  4.811   11.648  1.00 72.14  ? 77  SER A O    1 
ATOM   58   C CB   . SER A 1 6   ? -2.614  7.527   9.842   1.00 79.20  ? 77  SER A CB   1 
ATOM   59   O OG   . SER A 1 6   ? -1.865  7.892   10.984  1.00 80.80  ? 77  SER A OG   1 
ATOM   60   H H    . SER A 1 6   ? -4.197  6.916   11.669  1.00 92.09  ? 77  SER A H    1 
ATOM   61   H HA   . SER A 1 6   ? -3.726  5.921   9.223   1.00 91.01  ? 77  SER A HA   1 
ATOM   62   H HB2  . SER A 1 6   ? -2.015  7.447   9.084   1.00 95.04  ? 77  SER A HB2  1 
ATOM   63   H HB3  . SER A 1 6   ? -3.279  8.211   9.668   1.00 95.04  ? 77  SER A HB3  1 
ATOM   64   H HG   . SER A 1 6   ? -1.481  8.627   10.853  1.00 96.95  ? 77  SER A HG   1 
ATOM   65   N N    . VAL A 1 7   ? -1.631  4.565   9.469   1.00 74.20  ? 78  VAL A N    1 
ATOM   66   C CA   . VAL A 1 7   ? -0.571  3.605   9.754   1.00 73.04  ? 78  VAL A CA   1 
ATOM   67   C C    . VAL A 1 7   ? 0.483   4.247   10.643  1.00 78.47  ? 78  VAL A C    1 
ATOM   68   O O    . VAL A 1 7   ? 1.012   3.612   11.562  1.00 76.66  ? 78  VAL A O    1 
ATOM   69   C CB   . VAL A 1 7   ? 0.035   3.068   8.442   1.00 68.52  ? 78  VAL A CB   1 
ATOM   70   C CG1  . VAL A 1 7   ? 1.177   2.129   8.730   1.00 64.27  ? 78  VAL A CG1  1 
ATOM   71   C CG2  . VAL A 1 7   ? -1.034  2.349   7.606   1.00 68.05  ? 78  VAL A CG2  1 
ATOM   72   H H    . VAL A 1 7   ? -1.764  4.719   8.633   1.00 89.04  ? 78  VAL A H    1 
ATOM   73   H HA   . VAL A 1 7   ? -0.950  2.853   10.236  1.00 87.64  ? 78  VAL A HA   1 
ATOM   74   H HB   . VAL A 1 7   ? 0.378   3.811   7.921   1.00 82.22  ? 78  VAL A HB   1 
ATOM   75   H HG11 . VAL A 1 7   ? 1.400   1.648   7.918   1.00 77.12  ? 78  VAL A HG11 1 
ATOM   76   H HG12 . VAL A 1 7   ? 1.944   2.642   9.030   1.00 77.12  ? 78  VAL A HG12 1 
ATOM   77   H HG13 . VAL A 1 7   ? 0.905   1.503   9.419   1.00 77.12  ? 78  VAL A HG13 1 
ATOM   78   H HG21 . VAL A 1 7   ? -0.620  1.990   6.806   1.00 81.66  ? 78  VAL A HG21 1 
ATOM   79   H HG22 . VAL A 1 7   ? -1.415  1.629   8.133   1.00 81.66  ? 78  VAL A HG22 1 
ATOM   80   H HG23 . VAL A 1 7   ? -1.726  2.984   7.364   1.00 81.66  ? 78  VAL A HG23 1 
ATOM   81   N N    . GLU A 1 8   ? 0.795   5.521   10.393  1.00 81.80  ? 79  GLU A N    1 
ATOM   82   C CA   . GLU A 1 8   ? 1.752   6.221   11.243  1.00 87.68  ? 79  GLU A CA   1 
ATOM   83   C C    . GLU A 1 8   ? 1.255   6.297   12.680  1.00 81.63  ? 79  GLU A C    1 
ATOM   84   O O    . GLU A 1 8   ? 2.030   6.104   13.625  1.00 83.62  ? 79  GLU A O    1 
ATOM   85   C CB   . GLU A 1 8   ? 2.014   7.619   10.694  1.00 99.55  ? 79  GLU A CB   1 
ATOM   86   C CG   . GLU A 1 8   ? 3.091   8.370   11.450  1.00 111.65 ? 79  GLU A CG   1 
ATOM   87   C CD   . GLU A 1 8   ? 3.290   9.784   10.938  1.00 123.60 ? 79  GLU A CD   1 
ATOM   88   O OE1  . GLU A 1 8   ? 2.409   10.284  10.203  1.00 125.39 ? 79  GLU A OE1  1 
ATOM   89   O OE2  . GLU A 1 8   ? 4.329   10.395  11.270  1.00 130.55 ? 79  GLU A OE2  1 
ATOM   90   H H    . GLU A 1 8   ? 0.472   5.992   9.750   1.00 98.16  ? 79  GLU A H    1 
ATOM   91   H HA   . GLU A 1 8   ? 2.592   5.735   11.241  1.00 105.22 ? 79  GLU A HA   1 
ATOM   92   H HB2  . GLU A 1 8   ? 2.296   7.545   9.769   1.00 119.46 ? 79  GLU A HB2  1 
ATOM   93   H HB3  . GLU A 1 8   ? 1.195   8.136   10.749  1.00 119.46 ? 79  GLU A HB3  1 
ATOM   94   H HG2  . GLU A 1 8   ? 2.845   8.426   12.386  1.00 133.98 ? 79  GLU A HG2  1 
ATOM   95   H HG3  . GLU A 1 8   ? 3.932   7.896   11.356  1.00 133.98 ? 79  GLU A HG3  1 
ATOM   96   N N    . ASP A 1 9   ? -0.037  6.581   12.869  1.00 74.89  ? 80  ASP A N    1 
ATOM   97   C CA   . ASP A 1 9   ? -0.609  6.551   14.212  1.00 71.55  ? 80  ASP A CA   1 
ATOM   98   C C    . ASP A 1 9   ? -0.489  5.163   14.824  1.00 65.23  ? 80  ASP A C    1 
ATOM   99   O O    . ASP A 1 9   ? -0.172  5.025   16.008  1.00 61.57  ? 80  ASP A O    1 
ATOM   100  C CB   . ASP A 1 9   ? -2.076  6.984   14.184  1.00 77.32  ? 80  ASP A CB   1 
ATOM   101  C CG   . ASP A 1 9   ? -2.251  8.493   14.007  1.00 85.15  ? 80  ASP A CG   1 
ATOM   102  O OD1  . ASP A 1 9   ? -1.317  9.254   14.346  1.00 89.50  ? 80  ASP A OD1  1 
ATOM   103  O OD2  . ASP A 1 9   ? -3.337  8.912   13.540  1.00 86.68  ? 80  ASP A OD2  1 
ATOM   104  H H    . ASP A 1 9   ? -0.592  6.790   12.246  1.00 89.87  ? 80  ASP A H    1 
ATOM   105  H HA   . ASP A 1 9   ? -0.122  7.170   14.778  1.00 85.86  ? 80  ASP A HA   1 
ATOM   106  H HB2  . ASP A 1 9   ? -2.521  6.543   13.444  1.00 92.78  ? 80  ASP A HB2  1 
ATOM   107  H HB3  . ASP A 1 9   ? -2.495  6.730   15.021  1.00 92.78  ? 80  ASP A HB3  1 
ATOM   108  N N    . ILE A 1 10  ? -0.738  4.119   14.033  1.00 68.77  ? 81  ILE A N    1 
ATOM   109  C CA   . ILE A 1 10  ? -0.650  2.757   14.554  1.00 65.71  ? 81  ILE A CA   1 
ATOM   110  C C    . ILE A 1 10  ? 0.776   2.446   14.991  1.00 62.45  ? 81  ILE A C    1 
ATOM   111  O O    . ILE A 1 10  ? 1.005   1.909   16.080  1.00 60.15  ? 81  ILE A O    1 
ATOM   112  C CB   . ILE A 1 10  ? -1.157  1.756   13.503  1.00 63.33  ? 81  ILE A CB   1 
ATOM   113  C CG1  . ILE A 1 10  ? -2.659  1.959   13.286  1.00 60.39  ? 81  ILE A CG1  1 
ATOM   114  C CG2  . ILE A 1 10  ? -0.887  0.316   13.939  1.00 62.22  ? 81  ILE A CG2  1 
ATOM   115  C CD1  . ILE A 1 10  ? -3.192  1.258   12.080  1.00 57.60  ? 81  ILE A CD1  1 
ATOM   116  H H    . ILE A 1 10  ? -0.957  4.172   13.203  1.00 82.52  ? 81  ILE A H    1 
ATOM   117  H HA   . ILE A 1 10  ? -1.222  2.683   15.334  1.00 78.85  ? 81  ILE A HA   1 
ATOM   118  H HB   . ILE A 1 10  ? -0.695  1.921   12.666  1.00 76.00  ? 81  ILE A HB   1 
ATOM   119  H HG12 . ILE A 1 10  ? -3.135  1.620   14.060  1.00 72.47  ? 81  ILE A HG12 1 
ATOM   120  H HG13 . ILE A 1 10  ? -2.837  2.906   13.180  1.00 72.47  ? 81  ILE A HG13 1 
ATOM   121  H HG21 . ILE A 1 10  ? -1.335  -0.288  13.329  1.00 74.67  ? 81  ILE A HG21 1 
ATOM   122  H HG22 . ILE A 1 10  ? 0.068   0.148   13.918  1.00 74.67  ? 81  ILE A HG22 1 
ATOM   123  H HG23 . ILE A 1 10  ? -1.227  0.190   14.839  1.00 74.67  ? 81  ILE A HG23 1 
ATOM   124  H HD11 . ILE A 1 10  ? -4.098  1.562   11.914  1.00 69.12  ? 81  ILE A HD11 1 
ATOM   125  H HD12 . ILE A 1 10  ? -2.628  1.468   11.319  1.00 69.12  ? 81  ILE A HD12 1 
ATOM   126  H HD13 . ILE A 1 10  ? -3.188  0.302   12.241  1.00 69.12  ? 81  ILE A HD13 1 
ATOM   127  N N    . VAL A 1 11  ? 1.754   2.777   14.142  1.00 63.88  ? 82  VAL A N    1 
ATOM   128  C CA   . VAL A 1 11  ? 3.159   2.562   14.483  1.00 65.81  ? 82  VAL A CA   1 
ATOM   129  C C    . VAL A 1 11  ? 3.487   3.239   15.803  1.00 70.95  ? 82  VAL A C    1 
ATOM   130  O O    . VAL A 1 11  ? 4.161   2.669   16.671  1.00 71.00  ? 82  VAL A O    1 
ATOM   131  C CB   . VAL A 1 11  ? 4.062   3.077   13.347  1.00 65.08  ? 82  VAL A CB   1 
ATOM   132  C CG1  . VAL A 1 11  ? 5.509   3.198   13.799  1.00 62.20  ? 82  VAL A CG1  1 
ATOM   133  C CG2  . VAL A 1 11  ? 3.941   2.151   12.126  1.00 66.11  ? 82  VAL A CG2  1 
ATOM   134  H H    . VAL A 1 11  ? 1.629   3.126   13.366  1.00 76.65  ? 82  VAL A H    1 
ATOM   135  H HA   . VAL A 1 11  ? 3.318   1.611   14.586  1.00 78.97  ? 82  VAL A HA   1 
ATOM   136  H HB   . VAL A 1 11  ? 3.759   3.959   13.082  1.00 78.09  ? 82  VAL A HB   1 
ATOM   137  H HG11 . VAL A 1 11  ? 6.078   3.251   13.015  1.00 74.65  ? 82  VAL A HG11 1 
ATOM   138  H HG12 . VAL A 1 11  ? 5.610   4.001   14.334  1.00 74.65  ? 82  VAL A HG12 1 
ATOM   139  H HG13 . VAL A 1 11  ? 5.743   2.416   14.323  1.00 74.65  ? 82  VAL A HG13 1 
ATOM   140  H HG21 . VAL A 1 11  ? 4.499   2.496   11.412  1.00 79.33  ? 82  VAL A HG21 1 
ATOM   141  H HG22 . VAL A 1 11  ? 4.235   1.261   12.375  1.00 79.33  ? 82  VAL A HG22 1 
ATOM   142  H HG23 . VAL A 1 11  ? 3.015   2.126   11.839  1.00 79.33  ? 82  VAL A HG23 1 
ATOM   143  N N    . LYS A 1 12  ? 3.016   4.475   15.968  1.00 72.30  ? 83  LYS A N    1 
ATOM   144  C CA   . LYS A 1 12  ? 3.302   5.227   17.181  1.00 75.64  ? 83  LYS A CA   1 
ATOM   145  C C    . LYS A 1 12  ? 2.741   4.508   18.401  1.00 71.72  ? 83  LYS A C    1 
ATOM   146  O O    . LYS A 1 12  ? 3.442   4.321   19.403  1.00 73.62  ? 83  LYS A O    1 
ATOM   147  C CB   . LYS A 1 12  ? 2.730   6.642   17.049  1.00 83.72  ? 83  LYS A CB   1 
ATOM   148  C CG   . LYS A 1 12  ? 2.836   7.503   18.295  1.00 93.13  ? 83  LYS A CG   1 
ATOM   149  C CD   . LYS A 1 12  ? 2.449   8.950   17.995  1.00 102.80 ? 83  LYS A CD   1 
ATOM   150  C CE   . LYS A 1 12  ? 2.313   9.785   19.268  1.00 109.95 ? 83  LYS A CE   1 
ATOM   151  N NZ   . LYS A 1 12  ? 3.561   9.810   20.069  1.00 113.06 ? 83  LYS A NZ   1 
ATOM   152  H H    . LYS A 1 12  ? 2.532   4.895   15.395  1.00 86.76  ? 83  LYS A H    1 
ATOM   153  H HA   . LYS A 1 12  ? 4.263   5.300   17.290  1.00 90.77  ? 83  LYS A HA   1 
ATOM   154  H HB2  . LYS A 1 12  ? 3.204   7.100   16.337  1.00 100.46 ? 83  LYS A HB2  1 
ATOM   155  H HB3  . LYS A 1 12  ? 1.790   6.574   16.821  1.00 100.46 ? 83  LYS A HB3  1 
ATOM   156  H HG2  . LYS A 1 12  ? 2.234   7.162   18.975  1.00 111.76 ? 83  LYS A HG2  1 
ATOM   157  H HG3  . LYS A 1 12  ? 3.751   7.492   18.617  1.00 111.76 ? 83  LYS A HG3  1 
ATOM   158  H HD2  . LYS A 1 12  ? 3.135   9.354   17.440  1.00 123.37 ? 83  LYS A HD2  1 
ATOM   159  H HD3  . LYS A 1 12  ? 1.596   8.962   17.533  1.00 123.37 ? 83  LYS A HD3  1 
ATOM   160  H HE2  . LYS A 1 12  ? 2.093   10.698  19.026  1.00 131.94 ? 83  LYS A HE2  1 
ATOM   161  H HE3  . LYS A 1 12  ? 1.609   9.409   19.820  1.00 131.94 ? 83  LYS A HE3  1 
ATOM   162  H HZ1  . LYS A 1 12  ? 3.445   10.308  20.797  1.00 135.68 ? 83  LYS A HZ1  1 
ATOM   163  H HZ2  . LYS A 1 12  ? 3.780   8.984   20.316  1.00 135.68 ? 83  LYS A HZ2  1 
ATOM   164  H HZ3  . LYS A 1 12  ? 4.225   10.154  19.586  1.00 135.68 ? 83  LYS A HZ3  1 
ATOM   165  N N    . GLY A 1 13  ? 1.484   4.063   18.319  1.00 67.04  ? 84  GLY A N    1 
ATOM   166  C CA   . GLY A 1 13  ? 0.850   3.433   19.465  1.00 64.99  ? 84  GLY A CA   1 
ATOM   167  C C    . GLY A 1 13  ? 1.416   2.065   19.792  1.00 64.98  ? 84  GLY A C    1 
ATOM   168  O O    . GLY A 1 13  ? 1.445   1.667   20.958  1.00 62.89  ? 84  GLY A O    1 
ATOM   169  H H    . GLY A 1 13  ? 0.988   4.115   17.619  1.00 80.45  ? 84  GLY A H    1 
ATOM   170  H HA2  . GLY A 1 13  ? 0.962   4.001   20.243  1.00 77.99  ? 84  GLY A HA2  1 
ATOM   171  H HA3  . GLY A 1 13  ? -0.099  3.338   19.293  1.00 77.99  ? 84  GLY A HA3  1 
ATOM   172  N N    . ILE A 1 14  ? 1.860   1.323   18.774  1.00 68.99  ? 85  ILE A N    1 
ATOM   173  C CA   . ILE A 1 14  ? 2.397   -0.009  19.009  1.00 71.33  ? 85  ILE A CA   1 
ATOM   174  C C    . ILE A 1 14  ? 3.781   0.074   19.640  1.00 77.14  ? 85  ILE A C    1 
ATOM   175  O O    . ILE A 1 14  ? 4.181   -0.820  20.397  1.00 74.06  ? 85  ILE A O    1 
ATOM   176  C CB   . ILE A 1 14  ? 2.400   -0.797  17.684  1.00 68.97  ? 85  ILE A CB   1 
ATOM   177  C CG1  . ILE A 1 14  ? 0.984   -1.265  17.372  1.00 66.05  ? 85  ILE A CG1  1 
ATOM   178  C CG2  . ILE A 1 14  ? 3.310   -2.003  17.753  1.00 68.83  ? 85  ILE A CG2  1 
ATOM   179  C CD1  . ILE A 1 14  ? 0.834   -1.998  16.050  1.00 63.90  ? 85  ILE A CD1  1 
ATOM   180  H H    . ILE A 1 14  ? 1.860   1.568   17.950  1.00 82.79  ? 85  ILE A H    1 
ATOM   181  H HA   . ILE A 1 14  ? 1.816   -0.476  19.630  1.00 85.60  ? 85  ILE A HA   1 
ATOM   182  H HB   . ILE A 1 14  ? 2.703   -0.214  16.971  1.00 82.76  ? 85  ILE A HB   1 
ATOM   183  H HG12 . ILE A 1 14  ? 0.693   -1.865  18.076  1.00 79.26  ? 85  ILE A HG12 1 
ATOM   184  H HG13 . ILE A 1 14  ? 0.404   -0.490  17.342  1.00 79.26  ? 85  ILE A HG13 1 
ATOM   185  H HG21 . ILE A 1 14  ? 3.253   -2.500  16.923  1.00 82.60  ? 85  ILE A HG21 1 
ATOM   186  H HG22 . ILE A 1 14  ? 4.222   -1.706  17.884  1.00 82.60  ? 85  ILE A HG22 1 
ATOM   187  H HG23 . ILE A 1 14  ? 3.034   -2.564  18.494  1.00 82.60  ? 85  ILE A HG23 1 
ATOM   188  H HD11 . ILE A 1 14  ? -0.110  -2.094  15.850  1.00 76.68  ? 85  ILE A HD11 1 
ATOM   189  H HD12 . ILE A 1 14  ? 1.267   -1.480  15.354  1.00 76.68  ? 85  ILE A HD12 1 
ATOM   190  H HD13 . ILE A 1 14  ? 1.246   -2.873  16.120  1.00 76.68  ? 85  ILE A HD13 1 
ATOM   191  N N    . ASN A 1 15  ? 4.526   1.143   19.353  1.00 85.58  ? 86  ASN A N    1 
ATOM   192  C CA   . ASN A 1 15  ? 5.887   1.280   19.853  1.00 92.03  ? 86  ASN A CA   1 
ATOM   193  C C    . ASN A 1 15  ? 5.951   1.795   21.284  1.00 96.24  ? 86  ASN A C    1 
ATOM   194  O O    . ASN A 1 15  ? 6.976   1.612   21.945  1.00 100.55 ? 86  ASN A O    1 
ATOM   195  C CB   . ASN A 1 15  ? 6.685   2.218   18.947  1.00 93.81  ? 86  ASN A CB   1 
ATOM   196  C CG   . ASN A 1 15  ? 7.218   1.519   17.714  1.00 94.32  ? 86  ASN A CG   1 
ATOM   197  O OD1  . ASN A 1 15  ? 7.493   0.321   17.744  1.00 92.00  ? 86  ASN A OD1  1 
ATOM   198  N ND2  . ASN A 1 15  ? 7.368   2.263   16.621  1.00 97.04  ? 86  ASN A ND2  1 
ATOM   199  H H    . ASN A 1 15  ? 4.263   1.803   18.869  1.00 102.69 ? 86  ASN A H    1 
ATOM   200  H HA   . ASN A 1 15  ? 6.315   0.410   19.835  1.00 110.44 ? 86  ASN A HA   1 
ATOM   201  H HB2  . ASN A 1 15  ? 6.110   2.943   18.657  1.00 112.57 ? 86  ASN A HB2  1 
ATOM   202  H HB3  . ASN A 1 15  ? 7.440   2.570   19.443  1.00 112.57 ? 86  ASN A HB3  1 
ATOM   203  H HD21 . ASN A 1 15  ? 7.668   1.908   15.897  1.00 116.45 ? 86  ASN A HD21 1 
ATOM   204  H HD22 . ASN A 1 15  ? 7.165   3.099   16.638  1.00 116.45 ? 86  ASN A HD22 1 
ATOM   205  N N    . SER A 1 16  ? 4.899   2.435   21.780  1.00 94.76  ? 87  SER A N    1 
ATOM   206  C CA   . SER A 1 16  ? 4.958   2.973   23.129  1.00 97.61  ? 87  SER A CA   1 
ATOM   207  C C    . SER A 1 16  ? 5.187   1.856   24.146  1.00 98.46  ? 87  SER A C    1 
ATOM   208  O O    . SER A 1 16  ? 4.935   0.677   23.889  1.00 100.95 ? 87  SER A O    1 
ATOM   209  C CB   . SER A 1 16  ? 3.671   3.716   23.463  1.00 97.66  ? 87  SER A CB   1 
ATOM   210  O OG   . SER A 1 16  ? 2.650   2.797   23.790  1.00 96.96  ? 87  SER A OG   1 
ATOM   211  H H    . SER A 1 16  ? 4.157   2.569   21.367  1.00 113.71 ? 87  SER A H    1 
ATOM   212  H HA   . SER A 1 16  ? 5.696   3.599   23.192  1.00 117.14 ? 87  SER A HA   1 
ATOM   213  H HB2  . SER A 1 16  ? 3.828   4.300   24.222  1.00 117.20 ? 87  SER A HB2  1 
ATOM   214  H HB3  . SER A 1 16  ? 3.395   4.237   22.692  1.00 117.20 ? 87  SER A HB3  1 
ATOM   215  H HG   . SER A 1 16  ? 2.507   2.284   23.141  1.00 116.35 ? 87  SER A HG   1 
ATOM   216  N N    . ASN A 1 17  ? 5.680   2.241   25.321  1.00 96.75  ? 88  ASN A N    1 
ATOM   217  C CA   . ASN A 1 17  ? 5.788   1.314   26.437  1.00 97.84  ? 88  ASN A CA   1 
ATOM   218  C C    . ASN A 1 17  ? 4.454   1.118   27.149  1.00 99.16  ? 88  ASN A C    1 
ATOM   219  O O    . ASN A 1 17  ? 4.348   0.239   28.011  1.00 98.54  ? 88  ASN A O    1 
ATOM   220  C CB   . ASN A 1 17  ? 6.847   1.824   27.426  1.00 103.48 ? 88  ASN A CB   1 
ATOM   221  C CG   . ASN A 1 17  ? 7.394   0.724   28.347  1.00 107.03 ? 88  ASN A CG   1 
ATOM   222  O OD1  . ASN A 1 17  ? 7.587   -0.425  27.934  1.00 103.52 ? 88  ASN A OD1  1 
ATOM   223  N ND2  . ASN A 1 17  ? 7.657   1.087   29.605  1.00 113.42 ? 88  ASN A ND2  1 
ATOM   224  H H    . ASN A 1 17  ? 5.959   3.036   25.495  1.00 116.10 ? 88  ASN A H    1 
ATOM   225  H HA   . ASN A 1 17  ? 6.080   0.451   26.104  1.00 117.41 ? 88  ASN A HA   1 
ATOM   226  H HB2  . ASN A 1 17  ? 7.592   2.193   26.926  1.00 124.18 ? 88  ASN A HB2  1 
ATOM   227  H HB3  . ASN A 1 17  ? 6.451   2.511   27.984  1.00 124.18 ? 88  ASN A HB3  1 
ATOM   228  H HD21 . ASN A 1 17  ? 7.965   0.510   30.163  1.00 136.11 ? 88  ASN A HD21 1 
ATOM   229  H HD22 . ASN A 1 17  ? 7.518   1.898   29.857  1.00 136.11 ? 88  ASN A HD22 1 
ATOM   230  N N    . ASN A 1 18  ? 3.437   1.910   26.811  1.00 98.86  ? 89  ASN A N    1 
ATOM   231  C CA   . ASN A 1 18  ? 2.124   1.789   27.432  1.00 99.60  ? 89  ASN A CA   1 
ATOM   232  C C    . ASN A 1 18  ? 1.396   0.596   26.830  1.00 94.85  ? 89  ASN A C    1 
ATOM   233  O O    . ASN A 1 18  ? 1.222   0.522   25.609  1.00 93.30  ? 89  ASN A O    1 
ATOM   234  C CB   . ASN A 1 18  ? 1.321   3.073   27.225  1.00 104.02 ? 89  ASN A CB   1 
ATOM   235  C CG   . ASN A 1 18  ? -0.032  3.041   27.909  1.00 109.06 ? 89  ASN A CG   1 
ATOM   236  O OD1  . ASN A 1 18  ? -0.584  1.976   28.182  1.00 110.53 ? 89  ASN A OD1  1 
ATOM   237  N ND2  . ASN A 1 18  ? -0.581  4.216   28.180  1.00 111.82 ? 89  ASN A ND2  1 
ATOM   238  H H    . ASN A 1 18  ? 3.484   2.532   26.219  1.00 118.64 ? 89  ASN A H    1 
ATOM   239  H HA   . ASN A 1 18  ? 2.227   1.639   28.385  1.00 119.52 ? 89  ASN A HA   1 
ATOM   240  H HB2  . ASN A 1 18  ? 1.822   3.820   27.588  1.00 124.83 ? 89  ASN A HB2  1 
ATOM   241  H HB3  . ASN A 1 18  ? 1.173   3.203   26.275  1.00 124.83 ? 89  ASN A HB3  1 
ATOM   242  H HD21 . ASN A 1 18  ? -1.348  4.253   28.567  1.00 134.18 ? 89  ASN A HD21 1 
ATOM   243  H HD22 . ASN A 1 18  ? -0.170  4.941   27.969  1.00 134.18 ? 89  ASN A HD22 1 
ATOM   244  N N    . LEU A 1 19  ? 0.967   -0.337  27.679  1.00 96.03  ? 90  LEU A N    1 
ATOM   245  C CA   . LEU A 1 19  ? 0.242   -1.493  27.169  1.00 93.55  ? 90  LEU A CA   1 
ATOM   246  C C    . LEU A 1 19  ? -1.140  -1.103  26.655  1.00 88.90  ? 90  LEU A C    1 
ATOM   247  O O    . LEU A 1 19  ? -1.649  -1.727  25.719  1.00 87.74  ? 90  LEU A O    1 
ATOM   248  C CB   . LEU A 1 19  ? 0.130   -2.564  28.255  1.00 96.96  ? 90  LEU A CB   1 
ATOM   249  C CG   . LEU A 1 19  ? -0.392  -3.927  27.783  1.00 99.50  ? 90  LEU A CG   1 
ATOM   250  C CD1  . LEU A 1 19  ? 0.611   -4.624  26.848  1.00 97.23  ? 90  LEU A CD1  1 
ATOM   251  C CD2  . LEU A 1 19  ? -0.735  -4.816  28.971  1.00 104.50 ? 90  LEU A CD2  1 
ATOM   252  H H    . LEU A 1 19  ? 1.080   -0.324  28.531  1.00 115.24 ? 90  LEU A H    1 
ATOM   253  H HA   . LEU A 1 19  ? 0.739   -1.870  26.427  1.00 112.26 ? 90  LEU A HA   1 
ATOM   254  H HB2  . LEU A 1 19  ? 1.010   -2.706  28.638  1.00 116.36 ? 90  LEU A HB2  1 
ATOM   255  H HB3  . LEU A 1 19  ? -0.475  -2.243  28.942  1.00 116.36 ? 90  LEU A HB3  1 
ATOM   256  H HG   . LEU A 1 19  ? -1.209  -3.787  27.280  1.00 119.39 ? 90  LEU A HG   1 
ATOM   257  H HD11 . LEU A 1 19  ? 0.286   -5.515  26.646  1.00 116.68 ? 90  LEU A HD11 1 
ATOM   258  H HD12 . LEU A 1 19  ? 0.693   -4.109  26.030  1.00 116.68 ? 90  LEU A HD12 1 
ATOM   259  H HD13 . LEU A 1 19  ? 1.471   -4.679  27.293  1.00 116.68 ? 90  LEU A HD13 1 
ATOM   260  H HD21 . LEU A 1 19  ? -1.061  -5.669  28.643  1.00 125.40 ? 90  LEU A HD21 1 
ATOM   261  H HD22 . LEU A 1 19  ? 0.063   -4.950  29.505  1.00 125.40 ? 90  LEU A HD22 1 
ATOM   262  H HD23 . LEU A 1 19  ? -1.420  -4.382  29.502  1.00 125.40 ? 90  LEU A HD23 1 
ATOM   263  N N    . GLU A 1 20  ? -1.756  -0.075  27.237  1.00 86.01  ? 91  GLU A N    1 
ATOM   264  C CA   . GLU A 1 20  ? -3.100  0.304   26.814  1.00 85.63  ? 91  GLU A CA   1 
ATOM   265  C C    . GLU A 1 20  ? -3.087  0.935   25.429  1.00 78.95  ? 91  GLU A C    1 
ATOM   266  O O    . GLU A 1 20  ? -4.030  0.754   24.650  1.00 78.62  ? 91  GLU A O    1 
ATOM   267  C CB   . GLU A 1 20  ? -3.718  1.263   27.826  1.00 95.54  ? 91  GLU A CB   1 
ATOM   268  C CG   . GLU A 1 20  ? -5.131  1.737   27.458  1.00 102.86 ? 91  GLU A CG   1 
ATOM   269  C CD   . GLU A 1 20  ? -6.147  0.601   27.391  1.00 105.74 ? 91  GLU A CD   1 
ATOM   270  O OE1  . GLU A 1 20  ? -5.979  -0.402  28.122  1.00 110.21 ? 91  GLU A OE1  1 
ATOM   271  O OE2  . GLU A 1 20  ? -7.112  0.713   26.604  1.00 102.45 ? 91  GLU A OE2  1 
ATOM   272  H H    . GLU A 1 20  ? -1.425  0.409   27.866  1.00 103.21 ? 91  GLU A H    1 
ATOM   273  H HA   . GLU A 1 20  ? -3.654  -0.491  26.776  1.00 102.76 ? 91  GLU A HA   1 
ATOM   274  H HB2  . GLU A 1 20  ? -3.770  0.817   28.686  1.00 114.64 ? 91  GLU A HB2  1 
ATOM   275  H HB3  . GLU A 1 20  ? -3.152  2.048   27.897  1.00 114.64 ? 91  GLU A HB3  1 
ATOM   276  H HG2  . GLU A 1 20  ? -5.434  2.364   28.133  1.00 123.44 ? 91  GLU A HG2  1 
ATOM   277  H HG3  . GLU A 1 20  ? -5.110  2.173   26.592  1.00 123.44 ? 91  GLU A HG3  1 
ATOM   278  N N    . SER A 1 21  ? -2.038  1.689   25.106  1.00 74.91  ? 92  SER A N    1 
ATOM   279  C CA   . SER A 1 21  ? -1.926  2.281   23.781  1.00 73.90  ? 92  SER A CA   1 
ATOM   280  C C    . SER A 1 21  ? -1.474  1.274   22.737  1.00 68.61  ? 92  SER A C    1 
ATOM   281  O O    . SER A 1 21  ? -1.697  1.492   21.543  1.00 63.55  ? 92  SER A O    1 
ATOM   282  C CB   . SER A 1 21  ? -0.955  3.459   23.822  1.00 82.04  ? 92  SER A CB   1 
ATOM   283  O OG   . SER A 1 21  ? -1.442  4.476   24.683  1.00 89.47  ? 92  SER A OG   1 
ATOM   284  H H    . SER A 1 21  ? -1.384  1.870   25.634  1.00 89.89  ? 92  SER A H    1 
ATOM   285  H HA   . SER A 1 21  ? -2.795  2.619   23.513  1.00 88.68  ? 92  SER A HA   1 
ATOM   286  H HB2  . SER A 1 21  ? -0.096  3.150   24.151  1.00 98.45  ? 92  SER A HB2  1 
ATOM   287  H HB3  . SER A 1 21  ? -0.858  3.821   22.927  1.00 98.45  ? 92  SER A HB3  1 
ATOM   288  H HG   . SER A 1 21  ? -0.903  5.120   24.700  1.00 107.36 ? 92  SER A HG   1 
ATOM   289  N N    . GLN A 1 22  ? -0.829  0.188   23.155  1.00 72.55  ? 93  GLN A N    1 
ATOM   290  C CA   . GLN A 1 22  ? -0.526  -0.887  22.220  1.00 72.85  ? 93  GLN A CA   1 
ATOM   291  C C    . GLN A 1 22  ? -1.796  -1.624  21.835  1.00 68.08  ? 93  GLN A C    1 
ATOM   292  O O    . GLN A 1 22  ? -2.011  -1.934  20.657  1.00 65.41  ? 93  GLN A O    1 
ATOM   293  C CB   . GLN A 1 22  ? 0.489   -1.847  22.841  1.00 75.96  ? 93  GLN A CB   1 
ATOM   294  C CG   . GLN A 1 22  ? 1.892   -1.271  22.967  1.00 77.04  ? 93  GLN A CG   1 
ATOM   295  C CD   . GLN A 1 22  ? 2.841   -2.202  23.684  1.00 76.42  ? 93  GLN A CD   1 
ATOM   296  O OE1  . GLN A 1 22  ? 2.507   -2.774  24.722  1.00 75.05  ? 93  GLN A OE1  1 
ATOM   297  N NE2  . GLN A 1 22  ? 4.032   -2.370  23.123  1.00 77.01  ? 93  GLN A NE2  1 
ATOM   298  H H    . GLN A 1 22  ? -0.560  0.052   23.960  1.00 87.06  ? 93  GLN A H    1 
ATOM   299  H HA   . GLN A 1 22  ? -0.136  -0.511  21.415  1.00 87.41  ? 93  GLN A HA   1 
ATOM   300  H HB2  . GLN A 1 22  ? 0.187   -2.087  23.731  1.00 91.15  ? 93  GLN A HB2  1 
ATOM   301  H HB3  . GLN A 1 22  ? 0.544   -2.642  22.288  1.00 91.15  ? 93  GLN A HB3  1 
ATOM   302  H HG2  . GLN A 1 22  ? 2.247   -1.107  22.079  1.00 92.45  ? 93  GLN A HG2  1 
ATOM   303  H HG3  . GLN A 1 22  ? 1.850   -0.441  23.466  1.00 92.45  ? 93  GLN A HG3  1 
ATOM   304  H HE21 . GLN A 1 22  ? 4.226   -1.958  22.393  1.00 92.41  ? 93  GLN A HE21 1 
ATOM   305  H HE22 . GLN A 1 22  ? 4.610   -2.891  23.489  1.00 92.41  ? 93  GLN A HE22 1 
ATOM   306  N N    . LEU A 1 23  ? -2.660  -1.884  22.816  1.00 65.99  ? 94  LEU A N    1 
ATOM   307  C CA   . LEU A 1 23  ? -3.936  -2.527  22.539  1.00 66.46  ? 94  LEU A CA   1 
ATOM   308  C C    . LEU A 1 23  ? -4.783  -1.684  21.592  1.00 66.30  ? 94  LEU A C    1 
ATOM   309  O O    . LEU A 1 23  ? -5.299  -2.191  20.589  1.00 66.17  ? 94  LEU A O    1 
ATOM   310  C CB   . LEU A 1 23  ? -4.678  -2.787  23.850  1.00 68.94  ? 94  LEU A CB   1 
ATOM   311  C CG   . LEU A 1 23  ? -6.024  -3.507  23.727  1.00 69.12  ? 94  LEU A CG   1 
ATOM   312  C CD1  . LEU A 1 23  ? -5.899  -4.818  22.920  1.00 69.03  ? 94  LEU A CD1  1 
ATOM   313  C CD2  . LEU A 1 23  ? -6.586  -3.790  25.103  1.00 68.92  ? 94  LEU A CD2  1 
ATOM   314  H H    . LEU A 1 23  ? -2.529  -1.698  23.645  1.00 79.18  ? 94  LEU A H    1 
ATOM   315  H HA   . LEU A 1 23  ? -3.768  -3.381  22.111  1.00 79.75  ? 94  LEU A HA   1 
ATOM   316  H HB2  . LEU A 1 23  ? -4.111  -3.330  24.419  1.00 82.73  ? 94  LEU A HB2  1 
ATOM   317  H HB3  . LEU A 1 23  ? -4.845  -1.934  24.281  1.00 82.73  ? 94  LEU A HB3  1 
ATOM   318  H HG   . LEU A 1 23  ? -6.649  -2.929  23.263  1.00 82.94  ? 94  LEU A HG   1 
ATOM   319  H HD11 . LEU A 1 23  ? -6.736  -5.305  22.980  1.00 82.84  ? 94  LEU A HD11 1 
ATOM   320  H HD12 . LEU A 1 23  ? -5.707  -4.603  21.994  1.00 82.84  ? 94  LEU A HD12 1 
ATOM   321  H HD13 . LEU A 1 23  ? -5.180  -5.351  23.293  1.00 82.84  ? 94  LEU A HD13 1 
ATOM   322  H HD21 . LEU A 1 23  ? -7.438  -4.244  25.008  1.00 82.71  ? 94  LEU A HD21 1 
ATOM   323  H HD22 . LEU A 1 23  ? -5.963  -4.353  25.588  1.00 82.71  ? 94  LEU A HD22 1 
ATOM   324  H HD23 . LEU A 1 23  ? -6.709  -2.950  25.572  1.00 82.71  ? 94  LEU A HD23 1 
ATOM   325  N N    . GLN A 1 24  ? -4.933  -0.390  21.883  1.00 66.32  ? 95  GLN A N    1 
ATOM   326  C CA   . GLN A 1 24  ? -5.733  0.458   21.002  1.00 67.66  ? 95  GLN A CA   1 
ATOM   327  C C    . GLN A 1 24  ? -5.141  0.497   19.597  1.00 63.33  ? 95  GLN A C    1 
ATOM   328  O O    . GLN A 1 24  ? -5.877  0.473   18.602  1.00 59.01  ? 95  GLN A O    1 
ATOM   329  C CB   . GLN A 1 24  ? -5.836  1.869   21.574  1.00 76.94  ? 95  GLN A CB   1 
ATOM   330  C CG   . GLN A 1 24  ? -6.577  1.928   22.889  1.00 87.84  ? 95  GLN A CG   1 
ATOM   331  C CD   . GLN A 1 24  ? -6.734  3.346   23.422  1.00 98.85  ? 95  GLN A CD   1 
ATOM   332  O OE1  . GLN A 1 24  ? -6.412  4.324   22.741  1.00 101.44 ? 95  GLN A OE1  1 
ATOM   333  N NE2  . GLN A 1 24  ? -7.233  3.461   24.649  1.00 104.29 ? 95  GLN A NE2  1 
ATOM   334  H H    . GLN A 1 24  ? -4.593  0.010   22.564  1.00 79.58  ? 95  GLN A H    1 
ATOM   335  H HA   . GLN A 1 24  ? -6.629  0.093   20.940  1.00 81.19  ? 95  GLN A HA   1 
ATOM   336  H HB2  . GLN A 1 24  ? -4.942  2.215   21.720  1.00 92.33  ? 95  GLN A HB2  1 
ATOM   337  H HB3  . GLN A 1 24  ? -6.308  2.431   20.940  1.00 92.33  ? 95  GLN A HB3  1 
ATOM   338  H HG2  . GLN A 1 24  ? -7.464  1.555   22.767  1.00 105.41 ? 95  GLN A HG2  1 
ATOM   339  H HG3  . GLN A 1 24  ? -6.090  1.412   23.550  1.00 105.41 ? 95  GLN A HG3  1 
ATOM   340  H HE21 . GLN A 1 24  ? -7.447  2.757   25.094  1.00 125.14 ? 95  GLN A HE21 1 
ATOM   341  H HE22 . GLN A 1 24  ? -7.342  4.240   24.998  1.00 125.14 ? 95  GLN A HE22 1 
ATOM   342  N N    . ALA A 1 25  ? -3.809  0.548   19.495  1.00 66.94  ? 96  ALA A N    1 
ATOM   343  C CA   . ALA A 1 25  ? -3.179  0.598   18.183  1.00 65.54  ? 96  ALA A CA   1 
ATOM   344  C C    . ALA A 1 25  ? -3.380  -0.711  17.427  1.00 59.81  ? 96  ALA A C    1 
ATOM   345  O O    . ALA A 1 25  ? -3.546  -0.703  16.202  1.00 57.16  ? 96  ALA A O    1 
ATOM   346  C CB   . ALA A 1 25  ? -1.693  0.915   18.331  1.00 67.20  ? 96  ALA A CB   1 
ATOM   347  H H    . ALA A 1 25  ? -3.262  0.555   20.159  1.00 80.33  ? 96  ALA A H    1 
ATOM   348  H HA   . ALA A 1 25  ? -3.587  1.309   17.664  1.00 78.65  ? 96  ALA A HA   1 
ATOM   349  H HB1  . ALA A 1 25  ? -1.297  0.990   17.449  1.00 80.64  ? 96  ALA A HB1  1 
ATOM   350  H HB2  . ALA A 1 25  ? -1.599  1.753   18.809  1.00 80.64  ? 96  ALA A HB2  1 
ATOM   351  H HB3  . ALA A 1 25  ? -1.266  0.201   18.829  1.00 80.64  ? 96  ALA A HB3  1 
ATOM   352  N N    . THR A 1 26  ? -3.378  -1.846  18.134  1.00 59.25  ? 97  THR A N    1 
ATOM   353  C CA   . THR A 1 26  ? -3.599  -3.116  17.452  1.00 56.93  ? 97  THR A CA   1 
ATOM   354  C C    . THR A 1 26  ? -5.056  -3.257  17.030  1.00 58.00  ? 97  THR A C    1 
ATOM   355  O O    . THR A 1 26  ? -5.341  -3.800  15.957  1.00 54.81  ? 97  THR A O    1 
ATOM   356  C CB   . THR A 1 26  ? -3.179  -4.296  18.331  1.00 55.45  ? 97  THR A CB   1 
ATOM   357  O OG1  . THR A 1 26  ? -1.807  -4.165  18.703  1.00 55.10  ? 97  THR A OG1  1 
ATOM   358  C CG2  . THR A 1 26  ? -3.293  -5.587  17.555  1.00 53.67  ? 97  THR A CG2  1 
ATOM   359  H H    . THR A 1 26  ? -3.255  -1.904  18.983  1.00 71.10  ? 97  THR A H    1 
ATOM   360  H HA   . THR A 1 26  ? -3.055  -3.137  16.649  1.00 68.32  ? 97  THR A HA   1 
ATOM   361  H HB   . THR A 1 26  ? -3.739  -4.346  19.121  1.00 66.53  ? 97  THR A HB   1 
ATOM   362  H HG1  . THR A 1 26  ? -1.693  -3.453  19.135  1.00 66.12  ? 97  THR A HG1  1 
ATOM   363  H HG21 . THR A 1 26  ? -2.979  -6.327  18.098  1.00 64.41  ? 97  THR A HG21 1 
ATOM   364  H HG22 . THR A 1 26  ? -4.214  -5.751  17.305  1.00 64.41  ? 97  THR A HG22 1 
ATOM   365  H HG23 . THR A 1 26  ? -2.753  -5.537  16.751  1.00 64.41  ? 97  THR A HG23 1 
ATOM   366  N N    . GLN A 1 27  ? -5.992  -2.776  17.859  1.00 60.50  ? 98  GLN A N    1 
ATOM   367  C CA   . GLN A 1 27  ? -7.394  -2.722  17.449  1.00 60.14  ? 98  GLN A CA   1 
ATOM   368  C C    . GLN A 1 27  ? -7.549  -1.931  16.159  1.00 55.24  ? 98  GLN A C    1 
ATOM   369  O O    . GLN A 1 27  ? -8.216  -2.378  15.218  1.00 53.00  ? 98  GLN A O    1 
ATOM   370  C CB   . GLN A 1 27  ? -8.242  -2.096  18.550  1.00 64.06  ? 98  GLN A CB   1 
ATOM   371  C CG   . GLN A 1 27  ? -8.370  -2.937  19.789  1.00 68.30  ? 98  GLN A CG   1 
ATOM   372  C CD   . GLN A 1 27  ? -8.926  -2.148  20.972  1.00 73.53  ? 98  GLN A CD   1 
ATOM   373  O OE1  . GLN A 1 27  ? -9.108  -0.931  20.894  1.00 74.85  ? 98  GLN A OE1  1 
ATOM   374  N NE2  . GLN A 1 27  ? -9.194  -2.843  22.073  1.00 75.92  ? 98  GLN A NE2  1 
ATOM   375  H H    . GLN A 1 27  ? -5.840  -2.480  18.652  1.00 72.60  ? 98  GLN A H    1 
ATOM   376  H HA   . GLN A 1 27  ? -7.716  -3.624  17.293  1.00 72.18  ? 98  GLN A HA   1 
ATOM   377  H HB2  . GLN A 1 27  ? -7.841  -1.251  18.807  1.00 76.87  ? 98  GLN A HB2  1 
ATOM   378  H HB3  . GLN A 1 27  ? -9.135  -1.942  18.205  1.00 76.87  ? 98  GLN A HB3  1 
ATOM   379  H HG2  . GLN A 1 27  ? -8.973  -3.676  19.610  1.00 81.96  ? 98  GLN A HG2  1 
ATOM   380  H HG3  . GLN A 1 27  ? -7.495  -3.274  20.036  1.00 81.96  ? 98  GLN A HG3  1 
ATOM   381  H HE21 . GLN A 1 27  ? -9.052  -3.691  22.091  1.00 91.10  ? 98  GLN A HE21 1 
ATOM   382  H HE22 . GLN A 1 27  ? -9.509  -2.445  22.767  1.00 91.10  ? 98  GLN A HE22 1 
ATOM   383  N N    . ALA A 1 28  ? -6.944  -0.740  16.103  1.00 54.98  ? 99  ALA A N    1 
ATOM   384  C CA   . ALA A 1 28  ? -7.033  0.087   14.900  1.00 55.33  ? 99  ALA A CA   1 
ATOM   385  C C    . ALA A 1 28  ? -6.499  -0.660  13.686  1.00 57.46  ? 99  ALA A C    1 
ATOM   386  O O    . ALA A 1 28  ? -7.125  -0.670  12.619  1.00 55.67  ? 99  ALA A O    1 
ATOM   387  C CB   . ALA A 1 28  ? -6.260  1.390   15.096  1.00 55.54  ? 99  ALA A CB   1 
ATOM   388  H H    . ALA A 1 28  ? -6.482  -0.394  16.740  1.00 65.97  ? 99  ALA A H    1 
ATOM   389  H HA   . ALA A 1 28  ? -7.963  0.309   14.734  1.00 66.39  ? 99  ALA A HA   1 
ATOM   390  H HB1  . ALA A 1 28  ? -6.333  1.922   14.289  1.00 66.65  ? 99  ALA A HB1  1 
ATOM   391  H HB2  . ALA A 1 28  ? -6.640  1.872   15.847  1.00 66.65  ? 99  ALA A HB2  1 
ATOM   392  H HB3  . ALA A 1 28  ? -5.329  1.181   15.273  1.00 66.65  ? 99  ALA A HB3  1 
ATOM   393  N N    . ALA A 1 29  ? -5.338  -1.301  13.840  1.00 62.18  ? 100 ALA A N    1 
ATOM   394  C CA   . ALA A 1 29  ? -4.767  -2.089  12.758  1.00 62.53  ? 100 ALA A CA   1 
ATOM   395  C C    . ALA A 1 29  ? -5.716  -3.196  12.332  1.00 57.51  ? 100 ALA A C    1 
ATOM   396  O O    . ALA A 1 29  ? -5.907  -3.428  11.134  1.00 57.58  ? 100 ALA A O    1 
ATOM   397  C CB   . ALA A 1 29  ? -3.416  -2.670  13.188  1.00 64.56  ? 100 ALA A CB   1 
ATOM   398  H H    . ALA A 1 29  ? -4.867  -1.293  14.559  1.00 74.62  ? 100 ALA A H    1 
ATOM   399  H HA   . ALA A 1 29  ? -4.616  -1.513  11.993  1.00 75.04  ? 100 ALA A HA   1 
ATOM   400  H HB1  . ALA A 1 29  ? -3.039  -3.172  12.449  1.00 77.48  ? 100 ALA A HB1  1 
ATOM   401  H HB2  . ALA A 1 29  ? -2.823  -1.943  13.431  1.00 77.48  ? 100 ALA A HB2  1 
ATOM   402  H HB3  . ALA A 1 29  ? -3.552  -3.254  13.951  1.00 77.48  ? 100 ALA A HB3  1 
ATOM   403  N N    . ARG A 1 30  ? -6.320  -3.896  13.295  1.00 53.41  ? 101 ARG A N    1 
ATOM   404  C CA   . ARG A 1 30  ? -7.268  -4.950  12.949  1.00 52.23  ? 101 ARG A CA   1 
ATOM   405  C C    . ARG A 1 30  ? -8.487  -4.389  12.218  1.00 54.63  ? 101 ARG A C    1 
ATOM   406  O O    . ARG A 1 30  ? -8.956  -4.977  11.237  1.00 54.40  ? 101 ARG A O    1 
ATOM   407  C CB   . ARG A 1 30  ? -7.714  -5.706  14.194  1.00 53.77  ? 101 ARG A CB   1 
ATOM   408  C CG   . ARG A 1 30  ? -8.921  -6.645  13.952  1.00 58.66  ? 101 ARG A CG   1 
ATOM   409  C CD   . ARG A 1 30  ? -9.839  -6.679  15.146  1.00 64.21  ? 101 ARG A CD   1 
ATOM   410  N NE   . ARG A 1 30  ? -11.086 -5.958  14.953  1.00 68.75  ? 101 ARG A NE   1 
ATOM   411  C CZ   . ARG A 1 30  ? -12.017 -5.828  15.894  1.00 73.06  ? 101 ARG A CZ   1 
ATOM   412  N NH1  . ARG A 1 30  ? -11.846 -6.358  17.097  1.00 73.74  ? 101 ARG A NH1  1 
ATOM   413  N NH2  . ARG A 1 30  ? -13.120 -5.157  15.638  1.00 75.97  ? 101 ARG A NH2  1 
ATOM   414  H H    . ARG A 1 30  ? -6.200  -3.782  14.139  1.00 64.10  ? 101 ARG A H    1 
ATOM   415  H HA   . ARG A 1 30  ? -6.831  -5.582  12.357  1.00 62.68  ? 101 ARG A HA   1 
ATOM   416  H HB2  . ARG A 1 30  ? -6.975  -6.248  14.512  1.00 64.52  ? 101 ARG A HB2  1 
ATOM   417  H HB3  . ARG A 1 30  ? -7.960  -5.056  14.870  1.00 64.52  ? 101 ARG A HB3  1 
ATOM   418  H HG2  . ARG A 1 30  ? -9.448  -6.376  13.188  1.00 70.39  ? 101 ARG A HG2  1 
ATOM   419  H HG3  . ARG A 1 30  ? -8.587  -7.545  13.815  1.00 70.39  ? 101 ARG A HG3  1 
ATOM   420  H HD2  . ARG A 1 30  ? -10.025 -7.587  15.400  1.00 77.05  ? 101 ARG A HD2  1 
ATOM   421  H HD3  . ARG A 1 30  ? -9.400  -6.227  15.862  1.00 77.05  ? 101 ARG A HD3  1 
ATOM   422  H HE   . ARG A 1 30  ? -11.181 -5.505  14.228  1.00 82.49  ? 101 ARG A HE   1 
ATOM   423  H HH11 . ARG A 1 30  ? -11.130 -6.798  17.279  1.00 88.49  ? 101 ARG A HH11 1 
ATOM   424  H HH12 . ARG A 1 30  ? -12.456 -6.265  17.696  1.00 88.49  ? 101 ARG A HH12 1 
ATOM   425  H HH21 . ARG A 1 30  ? -13.240 -4.808  14.862  1.00 91.17  ? 101 ARG A HH21 1 
ATOM   426  H HH22 . ARG A 1 30  ? -13.722 -5.070  16.246  1.00 91.17  ? 101 ARG A HH22 1 
ATOM   427  N N    . LYS A 1 31  ? -9.050  -3.283  12.706  1.00 55.46  ? 102 LYS A N    1 
ATOM   428  C CA   . LYS A 1 31  ? -10.175 -2.680  11.998  1.00 58.85  ? 102 LYS A CA   1 
ATOM   429  C C    . LYS A 1 31  ? -9.765  -2.280  10.591  1.00 55.41  ? 102 LYS A C    1 
ATOM   430  O O    . LYS A 1 31  ? -10.511 -2.488  9.626   1.00 54.65  ? 102 LYS A O    1 
ATOM   431  C CB   . LYS A 1 31  ? -10.702 -1.465  12.766  1.00 66.42  ? 102 LYS A CB   1 
ATOM   432  C CG   . LYS A 1 31  ? -11.464 -1.804  14.044  1.00 74.28  ? 102 LYS A CG   1 
ATOM   433  C CD   . LYS A 1 31  ? -11.882 -0.535  14.769  1.00 83.86  ? 102 LYS A CD   1 
ATOM   434  C CE   . LYS A 1 31  ? -12.576 -0.833  16.081  1.00 91.24  ? 102 LYS A CE   1 
ATOM   435  N NZ   . LYS A 1 31  ? -13.035 0.429   16.747  1.00 96.66  ? 102 LYS A NZ   1 
ATOM   436  H H    . LYS A 1 31  ? -8.808  -2.874  13.423  1.00 66.55  ? 102 LYS A H    1 
ATOM   437  H HA   . LYS A 1 31  ? -10.893 -3.329  11.930  1.00 70.62  ? 102 LYS A HA   1 
ATOM   438  H HB2  . LYS A 1 31  ? -9.950  -0.904  13.012  1.00 79.70  ? 102 LYS A HB2  1 
ATOM   439  H HB3  . LYS A 1 31  ? -11.303 -0.970  12.188  1.00 79.70  ? 102 LYS A HB3  1 
ATOM   440  H HG2  . LYS A 1 31  ? -12.263 -2.307  13.820  1.00 89.14  ? 102 LYS A HG2  1 
ATOM   441  H HG3  . LYS A 1 31  ? -10.892 -2.320  14.634  1.00 89.14  ? 102 LYS A HG3  1 
ATOM   442  H HD2  . LYS A 1 31  ? -11.094 -0.002  14.958  1.00 100.63 ? 102 LYS A HD2  1 
ATOM   443  H HD3  . LYS A 1 31  ? -12.496 -0.036  14.209  1.00 100.63 ? 102 LYS A HD3  1 
ATOM   444  H HE2  . LYS A 1 31  ? -13.352 -1.390  15.915  1.00 109.49 ? 102 LYS A HE2  1 
ATOM   445  H HE3  . LYS A 1 31  ? -11.958 -1.285  16.676  1.00 109.49 ? 102 LYS A HE3  1 
ATOM   446  H HZ1  . LYS A 1 31  ? -13.440 0.237   17.516  1.00 115.99 ? 102 LYS A HZ1  1 
ATOM   447  H HZ2  . LYS A 1 31  ? -12.338 0.957   16.912  1.00 115.99 ? 102 LYS A HZ2  1 
ATOM   448  H HZ3  . LYS A 1 31  ? -13.606 0.861   16.219  1.00 115.99 ? 102 LYS A HZ3  1 
ATOM   449  N N    . LEU A 1 32  ? -8.565  -1.726  10.455  1.00 55.33  ? 103 LEU A N    1 
ATOM   450  C CA   . LEU A 1 32  ? -8.081  -1.316  9.148   1.00 58.28  ? 103 LEU A CA   1 
ATOM   451  C C    . LEU A 1 32  ? -7.912  -2.517  8.218   1.00 57.73  ? 103 LEU A C    1 
ATOM   452  O O    . LEU A 1 32  ? -8.070  -2.388  6.997   1.00 57.78  ? 103 LEU A O    1 
ATOM   453  C CB   . LEU A 1 32  ? -6.766  -0.575  9.349   1.00 63.62  ? 103 LEU A CB   1 
ATOM   454  C CG   . LEU A 1 32  ? -6.180  0.270   8.249   1.00 71.47  ? 103 LEU A CG   1 
ATOM   455  C CD1  . LEU A 1 32  ? -7.173  1.319   7.829   1.00 77.89  ? 103 LEU A CD1  1 
ATOM   456  C CD2  . LEU A 1 32  ? -4.909  0.913   8.772   1.00 72.23  ? 103 LEU A CD2  1 
ATOM   457  H H    . LEU A 1 32  ? -8.017  -1.578  11.101  1.00 66.39  ? 103 LEU A H    1 
ATOM   458  H HA   . LEU A 1 32  ? -8.722  -0.708  8.748   1.00 69.93  ? 103 LEU A HA   1 
ATOM   459  H HB2  . LEU A 1 32  ? -6.881  0.013   10.111  1.00 76.34  ? 103 LEU A HB2  1 
ATOM   460  H HB3  . LEU A 1 32  ? -6.093  -1.238  9.570   1.00 76.34  ? 103 LEU A HB3  1 
ATOM   461  H HG   . LEU A 1 32  ? -5.962  -0.285  7.484   1.00 85.77  ? 103 LEU A HG   1 
ATOM   462  H HD11 . LEU A 1 32  ? -6.735  1.944   7.231   1.00 93.47  ? 103 LEU A HD11 1 
ATOM   463  H HD12 . LEU A 1 32  ? -7.913  0.888   7.375   1.00 93.47  ? 103 LEU A HD12 1 
ATOM   464  H HD13 . LEU A 1 32  ? -7.492  1.785   8.618   1.00 93.47  ? 103 LEU A HD13 1 
ATOM   465  H HD21 . LEU A 1 32  ? -4.517  1.454   8.069   1.00 86.67  ? 103 LEU A HD21 1 
ATOM   466  H HD22 . LEU A 1 32  ? -5.128  1.470   9.535   1.00 86.67  ? 103 LEU A HD22 1 
ATOM   467  H HD23 . LEU A 1 32  ? -4.289  0.216   9.038   1.00 86.67  ? 103 LEU A HD23 1 
ATOM   468  N N    . LEU A 1 33  ? -7.615  -3.691  8.780   1.00 58.10  ? 104 LEU A N    1 
ATOM   469  C CA   . LEU A 1 33  ? -7.315  -4.893  8.016   1.00 55.83  ? 104 LEU A CA   1 
ATOM   470  C C    . LEU A 1 33  ? -8.529  -5.768  7.787   1.00 54.98  ? 104 LEU A C    1 
ATOM   471  O O    . LEU A 1 33  ? -8.434  -6.755  7.048   1.00 54.42  ? 104 LEU A O    1 
ATOM   472  C CB   . LEU A 1 33  ? -6.249  -5.732  8.735   1.00 52.97  ? 104 LEU A CB   1 
ATOM   473  C CG   . LEU A 1 33  ? -4.821  -5.189  8.722   1.00 51.40  ? 104 LEU A CG   1 
ATOM   474  C CD1  . LEU A 1 33  ? -3.917  -5.964  9.671   1.00 50.85  ? 104 LEU A CD1  1 
ATOM   475  C CD2  . LEU A 1 33  ? -4.280  -5.270  7.329   1.00 49.66  ? 104 LEU A CD2  1 
ATOM   476  H H    . LEU A 1 33  ? -7.581  -3.815  9.630   1.00 69.72  ? 104 LEU A H    1 
ATOM   477  H HA   . LEU A 1 33  ? -6.964  -4.634  7.151   1.00 66.99  ? 104 LEU A HA   1 
ATOM   478  H HB2  . LEU A 1 33  ? -6.512  -5.822  9.664   1.00 63.57  ? 104 LEU A HB2  1 
ATOM   479  H HB3  . LEU A 1 33  ? -6.226  -6.610  8.323   1.00 63.57  ? 104 LEU A HB3  1 
ATOM   480  H HG   . LEU A 1 33  ? -4.827  -4.258  8.995   1.00 61.68  ? 104 LEU A HG   1 
ATOM   481  H HD11 . LEU A 1 33  ? -3.024  -5.586  9.636   1.00 61.02  ? 104 LEU A HD11 1 
ATOM   482  H HD12 . LEU A 1 33  ? -4.271  -5.894  10.571  1.00 61.02  ? 104 LEU A HD12 1 
ATOM   483  H HD13 . LEU A 1 33  ? -3.894  -6.894  9.396   1.00 61.02  ? 104 LEU A HD13 1 
ATOM   484  H HD21 . LEU A 1 33  ? -3.334  -5.058  7.346   1.00 59.60  ? 104 LEU A HD21 1 
ATOM   485  H HD22 . LEU A 1 33  ? -4.410  -6.170  6.991   1.00 59.60  ? 104 LEU A HD22 1 
ATOM   486  H HD23 . LEU A 1 33  ? -4.751  -4.635  6.768   1.00 59.60  ? 104 LEU A HD23 1 
ATOM   487  N N    . SER A 1 34  ? -9.653  -5.453  8.419   1.00 55.84  ? 105 SER A N    1 
ATOM   488  C CA   . SER A 1 34  ? -10.857 -6.249  8.297   1.00 61.73  ? 105 SER A CA   1 
ATOM   489  C C    . SER A 1 34  ? -11.980 -5.477  7.607   1.00 74.13  ? 105 SER A C    1 
ATOM   490  O O    . SER A 1 34  ? -13.122 -5.953  7.564   1.00 69.82  ? 105 SER A O    1 
ATOM   491  C CB   . SER A 1 34  ? -11.279 -6.747  9.681   1.00 61.79  ? 105 SER A CB   1 
ATOM   492  O OG   . SER A 1 34  ? -11.517 -5.677  10.588  1.00 65.80  ? 105 SER A OG   1 
ATOM   493  H H    . SER A 1 34  ? -9.742  -4.770  8.933   1.00 67.01  ? 105 SER A H    1 
ATOM   494  H HA   . SER A 1 34  ? -10.665 -7.029  7.754   1.00 74.08  ? 105 SER A HA   1 
ATOM   495  H HB2  . SER A 1 34  ? -12.094 -7.265  9.590   1.00 74.15  ? 105 SER A HB2  1 
ATOM   496  H HB3  . SER A 1 34  ? -10.573 -7.307  10.039  1.00 74.15  ? 105 SER A HB3  1 
ATOM   497  H HG   . SER A 1 34  ? -10.819 -5.220  10.682  1.00 78.96  ? 105 SER A HG   1 
ATOM   498  N N    . ARG A 1 35  ? -11.679 -4.305  7.051   1.00 89.98  ? 106 ARG A N    1 
ATOM   499  C CA   . ARG A 1 35  ? -12.651 -3.597  6.238   1.00 107.04 ? 106 ARG A CA   1 
ATOM   500  C C    . ARG A 1 35  ? -12.698 -4.214  4.848   1.00 113.74 ? 106 ARG A C    1 
ATOM   501  O O    . ARG A 1 35  ? -11.666 -4.554  4.262   1.00 113.87 ? 106 ARG A O    1 
ATOM   502  C CB   . ARG A 1 35  ? -12.332 -2.105  6.165   1.00 114.42 ? 106 ARG A CB   1 
ATOM   503  C CG   . ARG A 1 35  ? -10.982 -1.698  5.594   1.00 123.09 ? 106 ARG A CG   1 
ATOM   504  C CD   . ARG A 1 35  ? -10.973 -0.168  5.527   1.00 133.67 ? 106 ARG A CD   1 
ATOM   505  N NE   . ARG A 1 35  ? -9.665  0.464   5.353   1.00 140.12 ? 106 ARG A NE   1 
ATOM   506  C CZ   . ARG A 1 35  ? -9.480  1.785   5.331   1.00 142.97 ? 106 ARG A CZ   1 
ATOM   507  N NH1  . ARG A 1 35  ? -8.267  2.295   5.166   1.00 143.21 ? 106 ARG A NH1  1 
ATOM   508  N NH2  . ARG A 1 35  ? -10.513 2.609   5.468   1.00 144.04 ? 106 ARG A NH2  1 
ATOM   509  H H    . ARG A 1 35  ? -10.923 -3.903  7.130   1.00 107.98 ? 106 ARG A H    1 
ATOM   510  H HA   . ARG A 1 35  ? -13.529 -3.695  6.639   1.00 128.45 ? 106 ARG A HA   1 
ATOM   511  H HB2  . ARG A 1 35  ? -13.011 -1.680  5.618   1.00 137.30 ? 106 ARG A HB2  1 
ATOM   512  H HB3  . ARG A 1 35  ? -12.379 -1.746  7.065   1.00 137.30 ? 106 ARG A HB3  1 
ATOM   513  H HG2  . ARG A 1 35  ? -10.270 -1.995  6.180   1.00 147.70 ? 106 ARG A HG2  1 
ATOM   514  H HG3  . ARG A 1 35  ? -10.874 -2.057  4.699   1.00 147.70 ? 106 ARG A HG3  1 
ATOM   515  H HD2  . ARG A 1 35  ? -11.527 0.107   4.780   1.00 160.41 ? 106 ARG A HD2  1 
ATOM   516  H HD3  . ARG A 1 35  ? -11.351 0.176   6.351   1.00 160.41 ? 106 ARG A HD3  1 
ATOM   517  H HE   . ARG A 1 35  ? -8.968  -0.040  5.378   1.00 168.14 ? 106 ARG A HE   1 
ATOM   518  H HH11 . ARG A 1 35  ? -7.589  1.774   5.077   1.00 171.86 ? 106 ARG A HH11 1 
ATOM   519  H HH12 . ARG A 1 35  ? -8.158  3.148   5.154   1.00 171.86 ? 106 ARG A HH12 1 
ATOM   520  H HH21 . ARG A 1 35  ? -11.307 2.296   5.574   1.00 172.85 ? 106 ARG A HH21 1 
ATOM   521  H HH22 . ARG A 1 35  ? -10.387 3.460   5.452   1.00 172.85 ? 106 ARG A HH22 1 
ATOM   522  N N    . GLU A 1 36  ? -13.916 -4.356  4.331   1.00 124.71 ? 107 GLU A N    1 
ATOM   523  C CA   . GLU A 1 36  ? -14.187 -5.294  3.246   1.00 131.08 ? 107 GLU A CA   1 
ATOM   524  C C    . GLU A 1 36  ? -13.184 -5.150  2.107   1.00 132.68 ? 107 GLU A C    1 
ATOM   525  O O    . GLU A 1 36  ? -12.478 -6.101  1.750   1.00 125.72 ? 107 GLU A O    1 
ATOM   526  C CB   . GLU A 1 36  ? -15.617 -5.079  2.741   1.00 138.00 ? 107 GLU A CB   1 
ATOM   527  C CG   . GLU A 1 36  ? -16.283 -6.329  2.203   1.00 140.26 ? 107 GLU A CG   1 
ATOM   528  C CD   . GLU A 1 36  ? -17.656 -6.051  1.628   1.00 141.73 ? 107 GLU A CD   1 
ATOM   529  O OE1  . GLU A 1 36  ? -17.970 -4.868  1.375   1.00 141.20 ? 107 GLU A OE1  1 
ATOM   530  O OE2  . GLU A 1 36  ? -18.424 -7.015  1.432   1.00 143.01 ? 107 GLU A OE2  1 
ATOM   531  H H    . GLU A 1 36  ? -14.607 -3.916  4.594   1.00 149.66 ? 107 GLU A H    1 
ATOM   532  H HA   . GLU A 1 36  ? -14.123 -6.199  3.588   1.00 157.30 ? 107 GLU A HA   1 
ATOM   533  H HB2  . GLU A 1 36  ? -16.160 -4.750  3.474   1.00 165.60 ? 107 GLU A HB2  1 
ATOM   534  H HB3  . GLU A 1 36  ? -15.601 -4.423  2.027   1.00 165.60 ? 107 GLU A HB3  1 
ATOM   535  H HG2  . GLU A 1 36  ? -15.732 -6.704  1.498   1.00 168.31 ? 107 GLU A HG2  1 
ATOM   536  H HG3  . GLU A 1 36  ? -16.383 -6.970  2.924   1.00 168.31 ? 107 GLU A HG3  1 
ATOM   537  N N    . LYS A 1 37  ? -13.109 -3.958  1.527   1.00 139.63 ? 108 LYS A N    1 
ATOM   538  C CA   . LYS A 1 37  ? -12.332 -3.737  0.319   1.00 146.66 ? 108 LYS A CA   1 
ATOM   539  C C    . LYS A 1 37  ? -10.929 -3.271  0.667   1.00 146.18 ? 108 LYS A C    1 
ATOM   540  O O    . LYS A 1 37  ? -10.754 -2.370  1.492   1.00 149.89 ? 108 LYS A O    1 
ATOM   541  C CB   . LYS A 1 37  ? -13.008 -2.695  -0.569  1.00 151.34 ? 108 LYS A CB   1 
ATOM   542  C CG   . LYS A 1 37  ? -14.330 -3.138  -1.166  1.00 152.24 ? 108 LYS A CG   1 
ATOM   543  C CD   . LYS A 1 37  ? -14.928 -2.038  -2.029  1.00 152.78 ? 108 LYS A CD   1 
ATOM   544  C CE   . LYS A 1 37  ? -16.221 -2.479  -2.682  1.00 152.51 ? 108 LYS A CE   1 
ATOM   545  N NZ   . LYS A 1 37  ? -16.806 -1.404  -3.525  1.00 154.08 ? 108 LYS A NZ   1 
ATOM   546  H H    . LYS A 1 37  ? -13.505 -3.253  1.819   1.00 167.55 ? 108 LYS A H    1 
ATOM   547  H HA   . LYS A 1 37  ? -12.265 -4.567  -0.179  1.00 175.99 ? 108 LYS A HA   1 
ATOM   548  H HB2  . LYS A 1 37  ? -13.176 -1.899  -0.040  1.00 181.61 ? 108 LYS A HB2  1 
ATOM   549  H HB3  . LYS A 1 37  ? -12.412 -2.479  -1.303  1.00 181.61 ? 108 LYS A HB3  1 
ATOM   550  H HG2  . LYS A 1 37  ? -14.187 -3.920  -1.722  1.00 182.69 ? 108 LYS A HG2  1 
ATOM   551  H HG3  . LYS A 1 37  ? -14.954 -3.341  -0.452  1.00 182.69 ? 108 LYS A HG3  1 
ATOM   552  H HD2  . LYS A 1 37  ? -15.116 -1.264  -1.475  1.00 183.33 ? 108 LYS A HD2  1 
ATOM   553  H HD3  . LYS A 1 37  ? -14.299 -1.804  -2.729  1.00 183.33 ? 108 LYS A HD3  1 
ATOM   554  H HE2  . LYS A 1 37  ? -16.047 -3.247  -3.248  1.00 183.01 ? 108 LYS A HE2  1 
ATOM   555  H HE3  . LYS A 1 37  ? -16.865 -2.708  -1.993  1.00 183.01 ? 108 LYS A HE3  1 
ATOM   556  H HZ1  . LYS A 1 37  ? -17.563 -1.687  -3.897  1.00 184.89 ? 108 LYS A HZ1  1 
ATOM   557  H HZ2  . LYS A 1 37  ? -16.979 -0.687  -3.027  1.00 184.89 ? 108 LYS A HZ2  1 
ATOM   558  H HZ3  . LYS A 1 37  ? -16.235 -1.178  -4.169  1.00 184.89 ? 108 LYS A HZ3  1 
ATOM   559  N N    . GLN A 1 38  ? -9.936  -3.885  0.031   1.00 141.73 ? 109 GLN A N    1 
ATOM   560  C CA   . GLN A 1 38  ? -8.577  -3.366  0.059   1.00 135.29 ? 109 GLN A CA   1 
ATOM   561  C C    . GLN A 1 38  ? -8.060  -3.105  1.457   1.00 112.58 ? 109 GLN A C    1 
ATOM   562  O O    . GLN A 1 38  ? -7.844  -1.942  1.811   1.00 120.06 ? 109 GLN A O    1 
ATOM   563  C CB   . GLN A 1 38  ? -8.483  -2.039  -0.673  1.00 148.37 ? 109 GLN A CB   1 
ATOM   564  C CG   . GLN A 1 38  ? -8.492  -2.113  -2.134  1.00 155.17 ? 109 GLN A CG   1 
ATOM   565  C CD   . GLN A 1 38  ? -8.464  -0.736  -2.710  1.00 157.38 ? 109 GLN A CD   1 
ATOM   566  O OE1  . GLN A 1 38  ? -9.469  -0.030  -2.713  1.00 157.89 ? 109 GLN A OE1  1 
ATOM   567  N NE2  . GLN A 1 38  ? -7.305  -0.323  -3.185  1.00 157.40 ? 109 GLN A NE2  1 
ATOM   568  H H    . GLN A 1 38  ? -10.026 -4.608  -0.426  1.00 170.08 ? 109 GLN A H    1 
ATOM   569  H HA   . GLN A 1 38  ? -7.982  -3.998  -0.374  1.00 162.35 ? 109 GLN A HA   1 
ATOM   570  H HB2  . GLN A 1 38  ? -9.228  -1.480  -0.404  1.00 178.04 ? 109 GLN A HB2  1 
ATOM   571  H HB3  . GLN A 1 38  ? -7.650  -1.608  -0.428  1.00 178.04 ? 109 GLN A HB3  1 
ATOM   572  H HG2  . GLN A 1 38  ? -7.707  -2.593  -2.441  1.00 186.20 ? 109 GLN A HG2  1 
ATOM   573  H HG3  . GLN A 1 38  ? -9.301  -2.557  -2.433  1.00 186.20 ? 109 GLN A HG3  1 
ATOM   574  H HE21 . GLN A 1 38  ? -6.757  -0.885  -3.537  1.00 188.88 ? 109 GLN A HE21 1 
ATOM   575  H HE22 . GLN A 1 38  ? -7.099  0.510   -3.139  1.00 188.88 ? 109 GLN A HE22 1 
ATOM   576  N N    . PRO A 1 39  ? -7.838  -4.107  2.281   1.00 81.64  ? 110 PRO A N    1 
ATOM   577  C CA   . PRO A 1 39  ? -7.015  -3.875  3.436   1.00 65.17  ? 110 PRO A CA   1 
ATOM   578  C C    . PRO A 1 39  ? -5.675  -3.321  2.979   1.00 57.16  ? 110 PRO A C    1 
ATOM   579  O O    . PRO A 1 39  ? -5.097  -3.823  2.001   1.00 50.06  ? 110 PRO A O    1 
ATOM   580  C CB   . PRO A 1 39  ? -6.890  -5.267  4.068   1.00 63.62  ? 110 PRO A CB   1 
ATOM   581  C CG   . PRO A 1 39  ? -8.125  -5.974  3.640   1.00 65.53  ? 110 PRO A CG   1 
ATOM   582  C CD   . PRO A 1 39  ? -8.353  -5.483  2.237   1.00 70.66  ? 110 PRO A CD   1 
ATOM   583  H HA   . PRO A 1 39  ? -7.459  -3.272  4.050   1.00 78.21  ? 110 PRO A HA   1 
ATOM   584  H HB2  . PRO A 1 39  ? -6.108  -5.717  3.723   1.00 76.34  ? 110 PRO A HB2  1 
ATOM   585  H HB3  . PRO A 1 39  ? -6.850  -5.191  5.033   1.00 76.34  ? 110 PRO A HB3  1 
ATOM   586  H HG2  . PRO A 1 39  ? -7.978  -6.933  3.652   1.00 78.64  ? 110 PRO A HG2  1 
ATOM   587  H HG3  . PRO A 1 39  ? -8.864  -5.728  4.218   1.00 78.64  ? 110 PRO A HG3  1 
ATOM   588  H HD2  . PRO A 1 39  ? -7.846  -6.015  1.604   1.00 84.79  ? 110 PRO A HD2  1 
ATOM   589  H HD3  . PRO A 1 39  ? -9.300  -5.485  2.027   1.00 84.79  ? 110 PRO A HD3  1 
ATOM   590  N N    . PRO A 1 40  ? -5.206  -2.319  3.562   1.00 63.48  ? 111 PRO A N    1 
ATOM   591  C CA   . PRO A 1 40  ? -3.885  -1.817  3.143   1.00 61.01  ? 111 PRO A CA   1 
ATOM   592  C C    . PRO A 1 40  ? -2.776  -2.699  3.706   1.00 54.29  ? 111 PRO A C    1 
ATOM   593  O O    . PRO A 1 40  ? -1.987  -2.321  4.568   1.00 50.14  ? 111 PRO A O    1 
ATOM   594  C CB   . PRO A 1 40  ? -3.880  -0.399  3.718   1.00 67.24  ? 111 PRO A CB   1 
ATOM   595  C CG   . PRO A 1 40  ? -4.650  -0.540  4.996   1.00 70.43  ? 111 PRO A CG   1 
ATOM   596  C CD   . PRO A 1 40  ? -5.608  -1.721  4.843   1.00 68.87  ? 111 PRO A CD   1 
ATOM   597  H HA   . PRO A 1 40  ? -3.819  -1.778  2.176   1.00 73.21  ? 111 PRO A HA   1 
ATOM   598  H HB2  . PRO A 1 40  ? -2.969  -0.113  3.890   1.00 80.69  ? 111 PRO A HB2  1 
ATOM   599  H HB3  . PRO A 1 40  ? -4.327  0.208   3.108   1.00 80.69  ? 111 PRO A HB3  1 
ATOM   600  H HG2  . PRO A 1 40  ? -4.031  -0.704  5.724   1.00 84.51  ? 111 PRO A HG2  1 
ATOM   601  H HG3  . PRO A 1 40  ? -5.149  0.276   5.159   1.00 84.51  ? 111 PRO A HG3  1 
ATOM   602  H HD2  . PRO A 1 40  ? -5.472  -2.356  5.564   1.00 82.64  ? 111 PRO A HD2  1 
ATOM   603  H HD3  . PRO A 1 40  ? -6.526  -1.415  4.815   1.00 82.64  ? 111 PRO A HD3  1 
ATOM   604  N N    . ILE A 1 41  ? -2.727  -3.934  3.213   1.00 54.52  ? 112 ILE A N    1 
ATOM   605  C CA   . ILE A 1 41  ? -1.831  -4.928  3.786   1.00 54.29  ? 112 ILE A CA   1 
ATOM   606  C C    . ILE A 1 41  ? -0.388  -4.501  3.597   1.00 53.35  ? 112 ILE A C    1 
ATOM   607  O O    . ILE A 1 41  ? 0.417   -4.521  4.534   1.00 53.29  ? 112 ILE A O    1 
ATOM   608  C CB   . ILE A 1 41  ? -2.099  -6.309  3.162   1.00 54.62  ? 112 ILE A CB   1 
ATOM   609  C CG1  . ILE A 1 41  ? -3.489  -6.786  3.575   1.00 55.63  ? 112 ILE A CG1  1 
ATOM   610  C CG2  . ILE A 1 41  ? -1.013  -7.317  3.593   1.00 52.54  ? 112 ILE A CG2  1 
ATOM   611  C CD1  . ILE A 1 41  ? -3.912  -8.109  2.938   1.00 55.74  ? 112 ILE A CD1  1 
ATOM   612  H H    . ILE A 1 41  ? -3.199  -4.218  2.552   1.00 65.43  ? 112 ILE A H    1 
ATOM   613  H HA   . ILE A 1 41  ? -2.001  -4.993  4.739   1.00 65.15  ? 112 ILE A HA   1 
ATOM   614  H HB   . ILE A 1 41  ? -2.075  -6.222  2.196   1.00 65.54  ? 112 ILE A HB   1 
ATOM   615  H HG12 . ILE A 1 41  ? -3.513  -6.895  4.539   1.00 66.75  ? 112 ILE A HG12 1 
ATOM   616  H HG13 . ILE A 1 41  ? -4.127  -6.112  3.302   1.00 66.75  ? 112 ILE A HG13 1 
ATOM   617  H HG21 . ILE A 1 41  ? -1.286  -8.212  3.339   1.00 63.04  ? 112 ILE A HG21 1 
ATOM   618  H HG22 . ILE A 1 41  ? -0.179  -7.096  3.151   1.00 63.04  ? 112 ILE A HG22 1 
ATOM   619  H HG23 . ILE A 1 41  ? -0.902  -7.267  4.555   1.00 63.04  ? 112 ILE A HG23 1 
ATOM   620  H HD11 . ILE A 1 41  ? -4.867  -8.227  3.062   1.00 66.89  ? 112 ILE A HD11 1 
ATOM   621  H HD12 . ILE A 1 41  ? -3.702  -8.084  1.991   1.00 66.89  ? 112 ILE A HD12 1 
ATOM   622  H HD13 . ILE A 1 41  ? -3.431  -8.835  3.365   1.00 66.89  ? 112 ILE A HD13 1 
ATOM   623  N N    . ASP A 1 42  ? -0.035  -4.117  2.381   1.00 52.12  ? 113 ASP A N    1 
ATOM   624  C CA   . ASP A 1 42  ? 1.348   -3.763  2.122   1.00 56.79  ? 113 ASP A CA   1 
ATOM   625  C C    . ASP A 1 42  ? 1.786   -2.574  2.962   1.00 56.28  ? 113 ASP A C    1 
ATOM   626  O O    . ASP A 1 42  ? 2.931   -2.538  3.420   1.00 54.44  ? 113 ASP A O    1 
ATOM   627  C CB   . ASP A 1 42  ? 1.529   -3.514  0.635   1.00 68.13  ? 113 ASP A CB   1 
ATOM   628  C CG   . ASP A 1 42  ? 1.495   -4.820  -0.184  1.00 78.06  ? 113 ASP A CG   1 
ATOM   629  O OD1  . ASP A 1 42  ? 2.129   -5.822  0.247   1.00 79.06  ? 113 ASP A OD1  1 
ATOM   630  O OD2  . ASP A 1 42  ? 0.826   -4.855  -1.250  1.00 85.20  ? 113 ASP A OD2  1 
ATOM   631  H H    . ASP A 1 42  ? -0.562  -4.054  1.704   1.00 62.54  ? 113 ASP A H    1 
ATOM   632  H HA   . ASP A 1 42  ? 1.910   -4.515  2.365   1.00 68.14  ? 113 ASP A HA   1 
ATOM   633  H HB2  . ASP A 1 42  ? 0.890   -2.870  0.292   1.00 81.76  ? 113 ASP A HB2  1 
ATOM   634  H HB3  . ASP A 1 42  ? 2.425   -3.221  0.553   1.00 81.76  ? 113 ASP A HB3  1 
ATOM   635  N N    . ASN A 1 43  ? 0.895   -1.616  3.225   1.00 58.95  ? 114 ASN A N    1 
ATOM   636  C CA   . ASN A 1 43  ? 1.272   -0.505  4.098   1.00 61.89  ? 114 ASN A CA   1 
ATOM   637  C C    . ASN A 1 43  ? 1.638   -1.006  5.489   1.00 59.82  ? 114 ASN A C    1 
ATOM   638  O O    . ASN A 1 43  ? 2.610   -0.540  6.093   1.00 57.76  ? 114 ASN A O    1 
ATOM   639  C CB   . ASN A 1 43  ? 0.137   0.511   4.171   1.00 67.20  ? 114 ASN A CB   1 
ATOM   640  C CG   . ASN A 1 43  ? -0.024  1.293   2.880   1.00 73.71  ? 114 ASN A CG   1 
ATOM   641  O OD1  . ASN A 1 43  ? 0.892   1.354   2.060   1.00 77.46  ? 114 ASN A OD1  1 
ATOM   642  N ND2  . ASN A 1 43  ? -1.185  1.896   2.696   1.00 75.08  ? 114 ASN A ND2  1 
ATOM   643  H H    . ASN A 1 43  ? 0.091   -1.585  2.921   1.00 70.74  ? 114 ASN A H    1 
ATOM   644  H HA   . ASN A 1 43  ? 2.050   -0.061  3.726   1.00 74.27  ? 114 ASN A HA   1 
ATOM   645  H HB2  . ASN A 1 43  ? -0.695  0.045   4.347   1.00 80.64  ? 114 ASN A HB2  1 
ATOM   646  H HB3  . ASN A 1 43  ? 0.323   1.142   4.884   1.00 80.64  ? 114 ASN A HB3  1 
ATOM   647  H HD21 . ASN A 1 43  ? -1.324  2.351   1.980   1.00 90.09  ? 114 ASN A HD21 1 
ATOM   648  H HD22 . ASN A 1 43  ? -1.801  1.833   3.292   1.00 90.09  ? 114 ASN A HD22 1 
ATOM   649  N N    . ILE A 1 44  ? 0.879   -1.977  5.998   1.00 59.92  ? 115 ILE A N    1 
ATOM   650  C CA   . ILE A 1 44  ? 1.139   -2.558  7.312   1.00 56.63  ? 115 ILE A CA   1 
ATOM   651  C C    . ILE A 1 44  ? 2.471   -3.312  7.324   1.00 51.21  ? 115 ILE A C    1 
ATOM   652  O O    . ILE A 1 44  ? 3.250   -3.196  8.274   1.00 49.36  ? 115 ILE A O    1 
ATOM   653  C CB   . ILE A 1 44  ? -0.050  -3.467  7.690   1.00 56.75  ? 115 ILE A CB   1 
ATOM   654  C CG1  . ILE A 1 44  ? -1.336  -2.637  7.854   1.00 61.29  ? 115 ILE A CG1  1 
ATOM   655  C CG2  . ILE A 1 44  ? 0.236   -4.292  8.925   1.00 53.44  ? 115 ILE A CG2  1 
ATOM   656  C CD1  . ILE A 1 44  ? -1.292  -1.610  8.970   1.00 64.87  ? 115 ILE A CD1  1 
ATOM   657  H H    . ILE A 1 44  ? 0.200   -2.319  5.596   1.00 71.91  ? 115 ILE A H    1 
ATOM   658  H HA   . ILE A 1 44  ? 1.199   -1.846  7.967   1.00 67.95  ? 115 ILE A HA   1 
ATOM   659  H HB   . ILE A 1 44  ? -0.192  -4.083  6.954   1.00 68.10  ? 115 ILE A HB   1 
ATOM   660  H HG12 . ILE A 1 44  ? -1.508  -2.163  7.026   1.00 73.55  ? 115 ILE A HG12 1 
ATOM   661  H HG13 . ILE A 1 44  ? -2.071  -3.241  8.042   1.00 73.55  ? 115 ILE A HG13 1 
ATOM   662  H HG21 . ILE A 1 44  ? -0.597  -4.664  9.254   1.00 64.13  ? 115 ILE A HG21 1 
ATOM   663  H HG22 . ILE A 1 44  ? 0.848   -5.008  8.694   1.00 64.13  ? 115 ILE A HG22 1 
ATOM   664  H HG23 . ILE A 1 44  ? 0.632   -3.721  9.602   1.00 64.13  ? 115 ILE A HG23 1 
ATOM   665  H HD11 . ILE A 1 44  ? -2.178  -1.233  9.084   1.00 77.84  ? 115 ILE A HD11 1 
ATOM   666  H HD12 . ILE A 1 44  ? -1.010  -2.043  9.791   1.00 77.84  ? 115 ILE A HD12 1 
ATOM   667  H HD13 . ILE A 1 44  ? -0.664  -0.910  8.733   1.00 77.84  ? 115 ILE A HD13 1 
ATOM   668  N N    . ILE A 1 45  ? 2.739   -4.118  6.288   1.00 48.73  ? 116 ILE A N    1 
ATOM   669  C CA   . ILE A 1 45  ? 3.991   -4.872  6.212   1.00 46.96  ? 116 ILE A CA   1 
ATOM   670  C C    . ILE A 1 45  ? 5.180   -3.925  6.209   1.00 47.92  ? 116 ILE A C    1 
ATOM   671  O O    . ILE A 1 45  ? 6.149   -4.102  6.964   1.00 47.56  ? 116 ILE A O    1 
ATOM   672  C CB   . ILE A 1 45  ? 3.999   -5.760  4.955   1.00 44.60  ? 116 ILE A CB   1 
ATOM   673  C CG1  . ILE A 1 45  ? 2.938   -6.849  5.063   1.00 43.52  ? 116 ILE A CG1  1 
ATOM   674  C CG2  . ILE A 1 45  ? 5.371   -6.391  4.739   1.00 44.09  ? 116 ILE A CG2  1 
ATOM   675  C CD1  . ILE A 1 45  ? 2.690   -7.572  3.786   1.00 43.44  ? 116 ILE A CD1  1 
ATOM   676  H H    . ILE A 1 45  ? 2.212   -4.243  5.620   1.00 58.47  ? 116 ILE A H    1 
ATOM   677  H HA   . ILE A 1 45  ? 4.064   -5.447  6.990   1.00 56.35  ? 116 ILE A HA   1 
ATOM   678  H HB   . ILE A 1 45  ? 3.792   -5.205  4.187   1.00 53.52  ? 116 ILE A HB   1 
ATOM   679  H HG12 . ILE A 1 45  ? 3.227   -7.498  5.718   1.00 52.22  ? 116 ILE A HG12 1 
ATOM   680  H HG13 . ILE A 1 45  ? 2.101   -6.447  5.344   1.00 52.22  ? 116 ILE A HG13 1 
ATOM   681  H HG21 . ILE A 1 45  ? 5.300   -7.097  4.079   1.00 52.91  ? 116 ILE A HG21 1 
ATOM   682  H HG22 . ILE A 1 45  ? 5.988   -5.712  4.423   1.00 52.91  ? 116 ILE A HG22 1 
ATOM   683  H HG23 . ILE A 1 45  ? 5.684   -6.758  5.581   1.00 52.91  ? 116 ILE A HG23 1 
ATOM   684  H HD11 . ILE A 1 45  ? 1.859   -8.067  3.861   1.00 52.12  ? 116 ILE A HD11 1 
ATOM   685  H HD12 . ILE A 1 45  ? 2.626   -6.926  3.065   1.00 52.12  ? 116 ILE A HD12 1 
ATOM   686  H HD13 . ILE A 1 45  ? 3.424   -8.183  3.618   1.00 52.12  ? 116 ILE A HD13 1 
ATOM   687  N N    . ARG A 1 46  ? 5.128   -2.911  5.343   1.00 59.42  ? 117 ARG A N    1 
ATOM   688  C CA   . ARG A 1 46  ? 6.239   -1.974  5.213   1.00 64.90  ? 117 ARG A CA   1 
ATOM   689  C C    . ARG A 1 46  ? 6.465   -1.166  6.477   1.00 65.02  ? 117 ARG A C    1 
ATOM   690  O O    . ARG A 1 46  ? 7.590   -0.714  6.718   1.00 68.63  ? 117 ARG A O    1 
ATOM   691  C CB   . ARG A 1 46  ? 5.998   -1.031  4.032   1.00 69.38  ? 117 ARG A CB   1 
ATOM   692  C CG   . ARG A 1 46  ? 6.077   -1.707  2.673   1.00 69.86  ? 117 ARG A CG   1 
ATOM   693  C CD   . ARG A 1 46  ? 6.150   -0.740  1.502   1.00 73.65  ? 117 ARG A CD   1 
ATOM   694  N NE   . ARG A 1 46  ? 4.951   0.087   1.398   1.00 75.19  ? 117 ARG A NE   1 
ATOM   695  C CZ   . ARG A 1 46  ? 3.849   -0.275  0.759   1.00 74.56  ? 117 ARG A CZ   1 
ATOM   696  N NH1  . ARG A 1 46  ? 3.784   -1.460  0.163   1.00 73.20  ? 117 ARG A NH1  1 
ATOM   697  N NH2  . ARG A 1 46  ? 2.805   0.542   0.715   1.00 75.53  ? 117 ARG A NH2  1 
ATOM   698  H H    . ARG A 1 46  ? 4.463   -2.746  4.823   1.00 71.30  ? 117 ARG A H    1 
ATOM   699  H HA   . ARG A 1 46  ? 7.050   -2.475  5.032   1.00 77.88  ? 117 ARG A HA   1 
ATOM   700  H HB2  . ARG A 1 46  ? 5.113   -0.643  4.118   1.00 83.25  ? 117 ARG A HB2  1 
ATOM   701  H HB3  . ARG A 1 46  ? 6.667   -0.329  4.052   1.00 83.25  ? 117 ARG A HB3  1 
ATOM   702  H HG2  . ARG A 1 46  ? 6.872   -2.263  2.647   1.00 83.83  ? 117 ARG A HG2  1 
ATOM   703  H HG3  . ARG A 1 46  ? 5.288   -2.258  2.553   1.00 83.83  ? 117 ARG A HG3  1 
ATOM   704  H HD2  . ARG A 1 46  ? 6.905   -0.146  1.638   1.00 88.38  ? 117 ARG A HD2  1 
ATOM   705  H HD3  . ARG A 1 46  ? 6.270   -1.234  0.677   1.00 88.38  ? 117 ARG A HD3  1 
ATOM   706  H HE   . ARG A 1 46  ? 4.912   0.791   1.890   1.00 90.22  ? 117 ARG A HE   1 
ATOM   707  H HH11 . ARG A 1 46  ? 4.506   -1.912  0.267   1.00 87.84  ? 117 ARG A HH11 1 
ATOM   708  H HH12 . ARG A 1 46  ? 3.179   -1.961  -0.172  1.00 87.84  ? 117 ARG A HH12 1 
ATOM   709  H HH21 . ARG A 1 46  ? 2.869   1.211   1.268   1.00 90.63  ? 117 ARG A HH21 1 
ATOM   710  H HH22 . ARG A 1 46  ? 1.972   0.427   0.518   1.00 90.63  ? 117 ARG A HH22 1 
ATOM   711  N N    . ALA A 1 47  ? 5.420   -0.943  7.275   1.00 52.54  ? 118 ALA A N    1 
ATOM   712  C CA   . ALA A 1 47  ? 5.605   -0.283  8.557   1.00 54.84  ? 118 ALA A CA   1 
ATOM   713  C C    . ALA A 1 47  ? 6.339   -1.151  9.558   1.00 57.76  ? 118 ALA A C    1 
ATOM   714  O O    . ALA A 1 47  ? 6.621   -0.676  10.663  1.00 61.33  ? 118 ALA A O    1 
ATOM   715  C CB   . ALA A 1 47  ? 4.253   0.126   9.140   1.00 54.54  ? 118 ALA A CB   1 
ATOM   716  H H    . ALA A 1 47  ? 4.608   -1.162  7.097   1.00 63.05  ? 118 ALA A H    1 
ATOM   717  H HA   . ALA A 1 47  ? 6.128   0.523   8.422   1.00 65.80  ? 118 ALA A HA   1 
ATOM   718  H HB1  . ALA A 1 47  ? 4.398   0.550   9.999   1.00 65.45  ? 118 ALA A HB1  1 
ATOM   719  H HB2  . ALA A 1 47  ? 3.821   0.746   8.532   1.00 65.45  ? 118 ALA A HB2  1 
ATOM   720  H HB3  . ALA A 1 47  ? 3.704   -0.666  9.250   1.00 65.45  ? 118 ALA A HB3  1 
ATOM   721  N N    . GLY A 1 48  ? 6.649   -2.398  9.213   1.00 56.74  ? 119 GLY A N    1 
ATOM   722  C CA   . GLY A 1 48  ? 7.380   -3.272  10.114  1.00 55.63  ? 119 GLY A CA   1 
ATOM   723  C C    . GLY A 1 48  ? 6.575   -3.832  11.254  1.00 54.67  ? 119 GLY A C    1 
ATOM   724  O O    . GLY A 1 48  ? 7.153   -4.223  12.272  1.00 56.78  ? 119 GLY A O    1 
ATOM   725  H H    . GLY A 1 48  ? 6.444   -2.763  8.462   1.00 68.09  ? 119 GLY A H    1 
ATOM   726  H HA2  . GLY A 1 48  ? 7.737   -4.018  9.607   1.00 66.75  ? 119 GLY A HA2  1 
ATOM   727  H HA3  . GLY A 1 48  ? 8.127   -2.781  10.490  1.00 66.75  ? 119 GLY A HA3  1 
ATOM   728  N N    . LEU A 1 49  ? 5.252   -3.903  11.122  1.00 52.90  ? 120 LEU A N    1 
ATOM   729  C CA   . LEU A 1 49  ? 4.429   -4.328  12.247  1.00 51.72  ? 120 LEU A CA   1 
ATOM   730  C C    . LEU A 1 49  ? 4.356   -5.842  12.422  1.00 48.95  ? 120 LEU A C    1 
ATOM   731  O O    . LEU A 1 49  ? 3.983   -6.286  13.512  1.00 51.25  ? 120 LEU A O    1 
ATOM   732  C CB   . LEU A 1 49  ? 3.014   -3.752  12.107  1.00 54.30  ? 120 LEU A CB   1 
ATOM   733  C CG   . LEU A 1 49  ? 2.968   -2.218  12.127  1.00 59.80  ? 120 LEU A CG   1 
ATOM   734  C CD1  . LEU A 1 49  ? 1.600   -1.666  11.767  1.00 62.30  ? 120 LEU A CD1  1 
ATOM   735  C CD2  . LEU A 1 49  ? 3.390   -1.691  13.482  1.00 62.82  ? 120 LEU A CD2  1 
ATOM   736  H H    . LEU A 1 49  ? 4.815   -3.714  10.406  1.00 63.49  ? 120 LEU A H    1 
ATOM   737  H HA   . LEU A 1 49  ? 4.813   -3.964  13.060  1.00 62.07  ? 120 LEU A HA   1 
ATOM   738  H HB2  . LEU A 1 49  ? 2.638   -4.049  11.264  1.00 65.15  ? 120 LEU A HB2  1 
ATOM   739  H HB3  . LEU A 1 49  ? 2.470   -4.076  12.842  1.00 65.15  ? 120 LEU A HB3  1 
ATOM   740  H HG   . LEU A 1 49  ? 3.600   -1.881  11.473  1.00 71.76  ? 120 LEU A HG   1 
ATOM   741  H HD11 . LEU A 1 49  ? 1.632   -0.697  11.798  1.00 74.76  ? 120 LEU A HD11 1 
ATOM   742  H HD12 . LEU A 1 49  ? 1.367   -1.960  10.873  1.00 74.76  ? 120 LEU A HD12 1 
ATOM   743  H HD13 . LEU A 1 49  ? 0.949   -1.997  12.405  1.00 74.76  ? 120 LEU A HD13 1 
ATOM   744  H HD21 . LEU A 1 49  ? 3.086   -0.775  13.575  1.00 75.39  ? 120 LEU A HD21 1 
ATOM   745  H HD22 . LEU A 1 49  ? 2.993   -2.245  14.172  1.00 75.39  ? 120 LEU A HD22 1 
ATOM   746  H HD23 . LEU A 1 49  ? 4.357   -1.728  13.547  1.00 75.39  ? 120 LEU A HD23 1 
ATOM   747  N N    . ILE A 1 50  ? 4.721   -6.644  11.421  1.00 47.17  ? 121 ILE A N    1 
ATOM   748  C CA   . ILE A 1 50  ? 4.501   -8.097  11.528  1.00 46.38  ? 121 ILE A CA   1 
ATOM   749  C C    . ILE A 1 50  ? 5.250   -8.661  12.732  1.00 44.83  ? 121 ILE A C    1 
ATOM   750  O O    . ILE A 1 50  ? 4.637   -9.326  13.581  1.00 41.21  ? 121 ILE A O    1 
ATOM   751  C CB   . ILE A 1 50  ? 4.920   -8.845  10.253  1.00 50.65  ? 121 ILE A CB   1 
ATOM   752  C CG1  . ILE A 1 50  ? 3.885   -8.604  9.154   1.00 51.55  ? 121 ILE A CG1  1 
ATOM   753  C CG2  . ILE A 1 50  ? 5.018   -10.352 10.517  1.00 51.54  ? 121 ILE A CG2  1 
ATOM   754  C CD1  . ILE A 1 50  ? 4.208   -9.268  7.825   1.00 52.54  ? 121 ILE A CD1  1 
ATOM   755  H H    . ILE A 1 50  ? 5.088   -6.386  10.687  1.00 56.61  ? 121 ILE A H    1 
ATOM   756  H HA   . ILE A 1 50  ? 3.555   -8.258  11.667  1.00 55.66  ? 121 ILE A HA   1 
ATOM   757  H HB   . ILE A 1 50  ? 5.778   -8.519  9.946   1.00 60.79  ? 121 ILE A HB   1 
ATOM   758  H HG12 . ILE A 1 50  ? 3.029   -8.948  9.454   1.00 61.86  ? 121 ILE A HG12 1 
ATOM   759  H HG13 . ILE A 1 50  ? 3.817   -7.649  8.997   1.00 61.86  ? 121 ILE A HG13 1 
ATOM   760  H HG21 . ILE A 1 50  ? 5.136   -10.827 9.682   1.00 61.85  ? 121 ILE A HG21 1 
ATOM   761  H HG22 . ILE A 1 50  ? 5.782   -10.531 11.087  1.00 61.85  ? 121 ILE A HG22 1 
ATOM   762  H HG23 . ILE A 1 50  ? 4.203   -10.649 10.952  1.00 61.85  ? 121 ILE A HG23 1 
ATOM   763  H HD11 . ILE A 1 50  ? 3.561   -8.977  7.168   1.00 63.04  ? 121 ILE A HD11 1 
ATOM   764  H HD12 . ILE A 1 50  ? 5.101   -9.008  7.552   1.00 63.04  ? 121 ILE A HD12 1 
ATOM   765  H HD13 . ILE A 1 50  ? 4.155   -10.231 7.921   1.00 63.04  ? 121 ILE A HD13 1 
ATOM   766  N N    . PRO A 1 51  ? 6.562   -8.428  12.853  1.00 47.67  ? 122 PRO A N    1 
ATOM   767  C CA   . PRO A 1 51  ? 7.291   -8.957  14.021  1.00 50.62  ? 122 PRO A CA   1 
ATOM   768  C C    . PRO A 1 51  ? 6.680   -8.573  15.358  1.00 53.86  ? 122 PRO A C    1 
ATOM   769  O O    . PRO A 1 51  ? 6.621   -9.404  16.279  1.00 49.98  ? 122 PRO A O    1 
ATOM   770  C CB   . PRO A 1 51  ? 8.687   -8.341  13.873  1.00 51.14  ? 122 PRO A CB   1 
ATOM   771  C CG   . PRO A 1 51  ? 8.785   -7.896  12.469  1.00 49.99  ? 122 PRO A CG   1 
ATOM   772  C CD   . PRO A 1 51  ? 7.408   -7.528  12.051  1.00 48.78  ? 122 PRO A CD   1 
ATOM   773  H HA   . PRO A 1 51  ? 7.360   -9.923  13.965  1.00 60.75  ? 122 PRO A HA   1 
ATOM   774  H HB2  . PRO A 1 51  ? 8.775   -7.587  14.477  1.00 61.36  ? 122 PRO A HB2  1 
ATOM   775  H HB3  . PRO A 1 51  ? 9.360   -9.012  14.066  1.00 61.36  ? 122 PRO A HB3  1 
ATOM   776  H HG2  . PRO A 1 51  ? 9.374   -7.127  12.414  1.00 59.99  ? 122 PRO A HG2  1 
ATOM   777  H HG3  . PRO A 1 51  ? 9.123   -8.622  11.922  1.00 59.99  ? 122 PRO A HG3  1 
ATOM   778  H HD2  . PRO A 1 51  ? 7.224   -6.604  12.276  1.00 58.53  ? 122 PRO A HD2  1 
ATOM   779  H HD3  . PRO A 1 51  ? 7.296   -7.692  11.104  1.00 58.53  ? 122 PRO A HD3  1 
ATOM   780  N N    . LYS A 1 52  ? 6.232   -7.316  15.483  1.00 60.30  ? 123 LYS A N    1 
ATOM   781  C CA   . LYS A 1 52  ? 5.598   -6.855  16.717  1.00 65.56  ? 123 LYS A CA   1 
ATOM   782  C C    . LYS A 1 52  ? 4.290   -7.588  16.980  1.00 60.25  ? 123 LYS A C    1 
ATOM   783  O O    . LYS A 1 52  ? 3.992   -7.953  18.122  1.00 60.67  ? 123 LYS A O    1 
ATOM   784  C CB   . LYS A 1 52  ? 5.359   -5.355  16.631  1.00 75.18  ? 123 LYS A CB   1 
ATOM   785  C CG   . LYS A 1 52  ? 6.638   -4.558  16.398  1.00 84.40  ? 123 LYS A CG   1 
ATOM   786  C CD   . LYS A 1 52  ? 6.325   -3.093  16.251  1.00 92.31  ? 123 LYS A CD   1 
ATOM   787  C CE   . LYS A 1 52  ? 7.572   -2.238  16.133  1.00 98.37  ? 123 LYS A CE   1 
ATOM   788  N NZ   . LYS A 1 52  ? 7.176   -0.841  15.766  1.00 102.00 ? 123 LYS A NZ   1 
ATOM   789  H H    . LYS A 1 52  ? 6.284   -6.717  14.868  1.00 72.37  ? 123 LYS A H    1 
ATOM   790  H HA   . LYS A 1 52  ? 6.194   -7.024  17.463  1.00 78.67  ? 123 LYS A HA   1 
ATOM   791  H HB2  . LYS A 1 52  ? 4.756   -5.174  15.893  1.00 90.21  ? 123 LYS A HB2  1 
ATOM   792  H HB3  . LYS A 1 52  ? 4.965   -5.051  17.463  1.00 90.21  ? 123 LYS A HB3  1 
ATOM   793  H HG2  . LYS A 1 52  ? 7.232   -4.671  17.157  1.00 101.28 ? 123 LYS A HG2  1 
ATOM   794  H HG3  . LYS A 1 52  ? 7.067   -4.862  15.583  1.00 101.28 ? 123 LYS A HG3  1 
ATOM   795  H HD2  . LYS A 1 52  ? 5.788   -2.959  15.454  1.00 110.78 ? 123 LYS A HD2  1 
ATOM   796  H HD3  . LYS A 1 52  ? 5.840   -2.800  17.035  1.00 110.78 ? 123 LYS A HD3  1 
ATOM   797  H HE2  . LYS A 1 52  ? 8.036   -2.217  16.984  1.00 118.05 ? 123 LYS A HE2  1 
ATOM   798  H HE3  . LYS A 1 52  ? 8.147   -2.592  15.437  1.00 118.05 ? 123 LYS A HE3  1 
ATOM   799  H HZ1  . LYS A 1 52  ? 7.884   -0.303  15.808  1.00 122.41 ? 123 LYS A HZ1  1 
ATOM   800  H HZ2  . LYS A 1 52  ? 6.850   -0.825  14.938  1.00 122.41 ? 123 LYS A HZ2  1 
ATOM   801  H HZ3  . LYS A 1 52  ? 6.553   -0.545  16.328  1.00 122.41 ? 123 LYS A HZ3  1 
ATOM   802  N N    . PHE A 1 53  ? 3.494   -7.804  15.936  1.00 56.06  ? 124 PHE A N    1 
ATOM   803  C CA   . PHE A 1 53  ? 2.283   -8.601  16.085  1.00 52.46  ? 124 PHE A CA   1 
ATOM   804  C C    . PHE A 1 53  ? 2.608   -10.017 16.541  1.00 49.09  ? 124 PHE A C    1 
ATOM   805  O O    . PHE A 1 53  ? 1.920   -10.578 17.401  1.00 49.09  ? 124 PHE A O    1 
ATOM   806  C CB   . PHE A 1 53  ? 1.532   -8.660  14.757  1.00 52.46  ? 124 PHE A CB   1 
ATOM   807  C CG   . PHE A 1 53  ? 0.844   -7.391  14.365  1.00 54.71  ? 124 PHE A CG   1 
ATOM   808  C CD1  . PHE A 1 53  ? 0.250   -6.571  15.313  1.00 55.69  ? 124 PHE A CD1  1 
ATOM   809  C CD2  . PHE A 1 53  ? 0.738   -7.046  13.023  1.00 57.04  ? 124 PHE A CD2  1 
ATOM   810  C CE1  . PHE A 1 53  ? -0.419  -5.416  14.929  1.00 58.18  ? 124 PHE A CE1  1 
ATOM   811  C CE2  . PHE A 1 53  ? 0.062   -5.884  12.631  1.00 59.51  ? 124 PHE A CE2  1 
ATOM   812  C CZ   . PHE A 1 53  ? -0.508  -5.068  13.589  1.00 59.93  ? 124 PHE A CZ   1 
ATOM   813  H H    . PHE A 1 53  ? 3.631   -7.504  15.142  1.00 67.28  ? 124 PHE A H    1 
ATOM   814  H HA   . PHE A 1 53  ? 1.713   -8.200  16.758  1.00 62.96  ? 124 PHE A HA   1 
ATOM   815  H HB2  . PHE A 1 53  ? 2.164   -8.880  14.054  1.00 62.96  ? 124 PHE A HB2  1 
ATOM   816  H HB3  . PHE A 1 53  ? 0.856   -9.353  14.815  1.00 62.96  ? 124 PHE A HB3  1 
ATOM   817  H HD1  . PHE A 1 53  ? 0.302   -6.794  16.214  1.00 66.83  ? 124 PHE A HD1  1 
ATOM   818  H HD2  . PHE A 1 53  ? 1.120   -7.595  12.377  1.00 68.45  ? 124 PHE A HD2  1 
ATOM   819  H HE1  . PHE A 1 53  ? -0.802  -4.868  15.575  1.00 69.81  ? 124 PHE A HE1  1 
ATOM   820  H HE2  . PHE A 1 53  ? 0.009   -5.656  11.731  1.00 71.41  ? 124 PHE A HE2  1 
ATOM   821  H HZ   . PHE A 1 53  ? -0.952  -4.291  13.337  1.00 71.92  ? 124 PHE A HZ   1 
ATOM   822  N N    . VAL A 1 54  ? 3.627   -10.629 15.949  1.00 47.24  ? 125 VAL A N    1 
ATOM   823  C CA   . VAL A 1 54  ? 4.004   -11.985 16.348  1.00 45.06  ? 125 VAL A CA   1 
ATOM   824  C C    . VAL A 1 54  ? 4.417   -12.024 17.817  1.00 48.31  ? 125 VAL A C    1 
ATOM   825  O O    . VAL A 1 54  ? 4.191   -13.019 18.520  1.00 46.10  ? 125 VAL A O    1 
ATOM   826  C CB   . VAL A 1 54  ? 5.137   -12.511 15.447  1.00 42.83  ? 125 VAL A CB   1 
ATOM   827  C CG1  . VAL A 1 54  ? 5.759   -13.761 16.066  1.00 42.96  ? 125 VAL A CG1  1 
ATOM   828  C CG2  . VAL A 1 54  ? 4.613   -12.816 14.082  1.00 37.55  ? 125 VAL A CG2  1 
ATOM   829  H H    . VAL A 1 54  ? 4.111   -10.290 15.324  1.00 56.69  ? 125 VAL A H    1 
ATOM   830  H HA   . VAL A 1 54  ? 3.238   -12.570 16.237  1.00 54.07  ? 125 VAL A HA   1 
ATOM   831  H HB   . VAL A 1 54  ? 5.826   -11.833 15.366  1.00 51.39  ? 125 VAL A HB   1 
ATOM   832  H HG11 . VAL A 1 54  ? 6.237   -14.247 15.376  1.00 51.55  ? 125 VAL A HG11 1 
ATOM   833  H HG12 . VAL A 1 54  ? 6.375   -13.498 16.768  1.00 51.55  ? 125 VAL A HG12 1 
ATOM   834  H HG13 . VAL A 1 54  ? 5.054   -14.318 16.431  1.00 51.55  ? 125 VAL A HG13 1 
ATOM   835  H HG21 . VAL A 1 54  ? 5.341   -13.139 13.529  1.00 45.06  ? 125 VAL A HG21 1 
ATOM   836  H HG22 . VAL A 1 54  ? 3.924   -13.495 14.153  1.00 45.06  ? 125 VAL A HG22 1 
ATOM   837  H HG23 . VAL A 1 54  ? 4.241   -12.006 13.699  1.00 45.06  ? 125 VAL A HG23 1 
ATOM   838  N N    . SER A 1 55  ? 5.087   -10.978 18.286  1.00 50.64  ? 126 SER A N    1 
ATOM   839  C CA   . SER A 1 55  ? 5.489   -10.943 19.686  1.00 55.48  ? 126 SER A CA   1 
ATOM   840  C C    . SER A 1 55  ? 4.274   -10.790 20.593  1.00 49.68  ? 126 SER A C    1 
ATOM   841  O O    . SER A 1 55  ? 4.172   -11.455 21.628  1.00 47.53  ? 126 SER A O    1 
ATOM   842  C CB   . SER A 1 55  ? 6.484   -9.814  19.904  1.00 69.33  ? 126 SER A CB   1 
ATOM   843  O OG   . SER A 1 55  ? 6.891   -9.787  21.249  1.00 80.89  ? 126 SER A OG   1 
ATOM   844  H H    . SER A 1 55  ? 5.317   -10.289 17.825  1.00 60.77  ? 126 SER A H    1 
ATOM   845  H HA   . SER A 1 55  ? 5.928   -11.778 19.910  1.00 66.57  ? 126 SER A HA   1 
ATOM   846  H HB2  . SER A 1 55  ? 7.259   -9.959  19.339  1.00 83.20  ? 126 SER A HB2  1 
ATOM   847  H HB3  . SER A 1 55  ? 6.062   -8.970  19.682  1.00 83.20  ? 126 SER A HB3  1 
ATOM   848  H HG   . SER A 1 55  ? 7.441   -9.164  21.370  1.00 97.06  ? 126 SER A HG   1 
ATOM   849  N N    . PHE A 1 56  ? 3.329   -9.938  20.217  1.00 47.44  ? 127 PHE A N    1 
ATOM   850  C CA   . PHE A 1 56  ? 2.086   -9.855  20.978  1.00 49.45  ? 127 PHE A CA   1 
ATOM   851  C C    . PHE A 1 56  ? 1.384   -11.203 21.072  1.00 49.86  ? 127 PHE A C    1 
ATOM   852  O O    . PHE A 1 56  ? 0.678   -11.459 22.049  1.00 54.25  ? 127 PHE A O    1 
ATOM   853  C CB   . PHE A 1 56  ? 1.150   -8.825  20.353  1.00 52.26  ? 127 PHE A CB   1 
ATOM   854  C CG   . PHE A 1 56  ? 1.574   -7.391  20.561  1.00 59.42  ? 127 PHE A CG   1 
ATOM   855  C CD1  . PHE A 1 56  ? 2.317   -7.016  21.656  1.00 62.23  ? 127 PHE A CD1  1 
ATOM   856  C CD2  . PHE A 1 56  ? 1.204   -6.411  19.651  1.00 62.45  ? 127 PHE A CD2  1 
ATOM   857  C CE1  . PHE A 1 56  ? 2.684   -5.697  21.839  1.00 64.37  ? 127 PHE A CE1  1 
ATOM   858  C CE2  . PHE A 1 56  ? 1.581   -5.090  19.833  1.00 64.50  ? 127 PHE A CE2  1 
ATOM   859  C CZ   . PHE A 1 56  ? 2.319   -4.740  20.925  1.00 64.91  ? 127 PHE A CZ   1 
ATOM   860  H H    . PHE A 1 56  ? 3.378   -9.408  19.542  1.00 56.92  ? 127 PHE A H    1 
ATOM   861  H HA   . PHE A 1 56  ? 2.290   -9.588  21.886  1.00 59.34  ? 127 PHE A HA   1 
ATOM   862  H HB2  . PHE A 1 56  ? 1.107   -8.984  19.397  1.00 62.72  ? 127 PHE A HB2  1 
ATOM   863  H HB3  . PHE A 1 56  ? 0.268   -8.931  20.742  1.00 62.72  ? 127 PHE A HB3  1 
ATOM   864  H HD1  . PHE A 1 56  ? 2.572   -7.652  22.284  1.00 74.68  ? 127 PHE A HD1  1 
ATOM   865  H HD2  . PHE A 1 56  ? 0.701   -6.645  18.904  1.00 74.94  ? 127 PHE A HD2  1 
ATOM   866  H HE1  . PHE A 1 56  ? 3.190   -5.457  22.581  1.00 77.24  ? 127 PHE A HE1  1 
ATOM   867  H HE2  . PHE A 1 56  ? 1.329   -4.444  19.214  1.00 77.40  ? 127 PHE A HE2  1 
ATOM   868  H HZ   . PHE A 1 56  ? 2.572   -3.854  21.052  1.00 77.89  ? 127 PHE A HZ   1 
ATOM   869  N N    . LEU A 1 57  ? 1.544   -12.083 20.082  1.00 47.77  ? 128 LEU A N    1 
ATOM   870  C CA   . LEU A 1 57  ? 0.917   -13.400 20.190  1.00 47.30  ? 128 LEU A CA   1 
ATOM   871  C C    . LEU A 1 57  ? 1.411   -14.188 21.386  1.00 48.56  ? 128 LEU A C    1 
ATOM   872  O O    . LEU A 1 57  ? 0.753   -15.150 21.788  1.00 47.75  ? 128 LEU A O    1 
ATOM   873  C CB   . LEU A 1 57  ? 1.169   -14.237 18.942  1.00 48.78  ? 128 LEU A CB   1 
ATOM   874  C CG   . LEU A 1 57  ? 0.570   -13.764 17.639  1.00 48.37  ? 128 LEU A CG   1 
ATOM   875  C CD1  . LEU A 1 57  ? 1.064   -14.709 16.568  1.00 46.29  ? 128 LEU A CD1  1 
ATOM   876  C CD2  . LEU A 1 57  ? -0.956  -13.753 17.707  1.00 48.62  ? 128 LEU A CD2  1 
ATOM   877  H H    . LEU A 1 57  ? 1.994   -11.949 19.362  1.00 57.32  ? 128 LEU A H    1 
ATOM   878  H HA   . LEU A 1 57  ? -0.041  -13.284 20.286  1.00 56.76  ? 128 LEU A HA   1 
ATOM   879  H HB2  . LEU A 1 57  ? 2.128   -14.294 18.809  1.00 58.53  ? 128 LEU A HB2  1 
ATOM   880  H HB3  . LEU A 1 57  ? 0.820   -15.127 19.106  1.00 58.53  ? 128 LEU A HB3  1 
ATOM   881  H HG   . LEU A 1 57  ? 0.883   -12.869 17.437  1.00 58.04  ? 128 LEU A HG   1 
ATOM   882  H HD11 . LEU A 1 57  ? 0.678   -14.450 15.717  1.00 55.54  ? 128 LEU A HD11 1 
ATOM   883  H HD12 . LEU A 1 57  ? 2.031   -14.656 16.522  1.00 55.54  ? 128 LEU A HD12 1 
ATOM   884  H HD13 . LEU A 1 57  ? 0.792   -15.612 16.794  1.00 55.54  ? 128 LEU A HD13 1 
ATOM   885  H HD21 . LEU A 1 57  ? -1.309  -13.525 16.833  1.00 58.34  ? 128 LEU A HD21 1 
ATOM   886  H HD22 . LEU A 1 57  ? -1.266  -14.634 17.969  1.00 58.34  ? 128 LEU A HD22 1 
ATOM   887  H HD23 . LEU A 1 57  ? -1.239  -13.094 18.360  1.00 58.34  ? 128 LEU A HD23 1 
ATOM   888  N N    . GLY A 1 58  ? 2.562   -13.837 21.933  1.00 49.63  ? 129 GLY A N    1 
ATOM   889  C CA   . GLY A 1 58  ? 3.071   -14.499 23.118  1.00 57.85  ? 129 GLY A CA   1 
ATOM   890  C C    . GLY A 1 58  ? 2.638   -13.890 24.433  1.00 64.82  ? 129 GLY A C    1 
ATOM   891  O O    . GLY A 1 58  ? 2.816   -14.527 25.475  1.00 67.19  ? 129 GLY A O    1 
ATOM   892  H H    . GLY A 1 58  ? 3.072   -13.213 21.634  1.00 59.55  ? 129 GLY A H    1 
ATOM   893  H HA2  . GLY A 1 58  ? 2.784   -15.426 23.110  1.00 69.42  ? 129 GLY A HA2  1 
ATOM   894  H HA3  . GLY A 1 58  ? 4.041   -14.487 23.090  1.00 69.42  ? 129 GLY A HA3  1 
ATOM   895  N N    . LYS A 1 59  ? 2.066   -12.679 24.415  1.00 67.05  ? 130 LYS A N    1 
ATOM   896  C CA   . LYS A 1 59  ? 1.689   -11.963 25.639  1.00 71.78  ? 130 LYS A CA   1 
ATOM   897  C C    . LYS A 1 59  ? 0.465   -12.624 26.268  1.00 73.07  ? 130 LYS A C    1 
ATOM   898  O O    . LYS A 1 59  ? -0.664  -12.137 26.179  1.00 74.70  ? 130 LYS A O    1 
ATOM   899  C CB   . LYS A 1 59  ? 1.421   -10.492 25.343  1.00 76.13  ? 130 LYS A CB   1 
ATOM   900  C CG   . LYS A 1 59  ? 2.634   -9.598  25.524  1.00 83.70  ? 130 LYS A CG   1 
ATOM   901  C CD   . LYS A 1 59  ? 2.226   -8.173  25.923  1.00 91.50  ? 130 LYS A CD   1 
ATOM   902  C CE   . LYS A 1 59  ? 3.409   -7.353  26.457  1.00 96.85  ? 130 LYS A CE   1 
ATOM   903  N NZ   . LYS A 1 59  ? 4.231   -6.750  25.364  1.00 98.03  ? 130 LYS A NZ   1 
ATOM   904  H H    . LYS A 1 59  ? 1.884   -12.246 23.694  1.00 80.46  ? 130 LYS A H    1 
ATOM   905  H HA   . LYS A 1 59  ? 2.419   -12.019 26.275  1.00 86.14  ? 130 LYS A HA   1 
ATOM   906  H HB2  . LYS A 1 59  ? 1.125   -10.406 24.423  1.00 91.36  ? 130 LYS A HB2  1 
ATOM   907  H HB3  . LYS A 1 59  ? 0.727   -10.175 25.941  1.00 91.36  ? 130 LYS A HB3  1 
ATOM   908  H HG2  . LYS A 1 59  ? 3.200   -9.958  26.225  1.00 100.44 ? 130 LYS A HG2  1 
ATOM   909  H HG3  . LYS A 1 59  ? 3.124   -9.551  24.688  1.00 100.44 ? 130 LYS A HG3  1 
ATOM   910  H HD2  . LYS A 1 59  ? 1.869   -7.716  25.145  1.00 109.80 ? 130 LYS A HD2  1 
ATOM   911  H HD3  . LYS A 1 59  ? 1.554   -8.217  26.621  1.00 109.80 ? 130 LYS A HD3  1 
ATOM   912  H HE2  . LYS A 1 59  ? 3.070   -6.632  27.010  1.00 116.22 ? 130 LYS A HE2  1 
ATOM   913  H HE3  . LYS A 1 59  ? 3.985   -7.931  26.982  1.00 116.22 ? 130 LYS A HE3  1 
ATOM   914  H HZ1  . LYS A 1 59  ? 4.905   -6.284  25.712  1.00 117.64 ? 130 LYS A HZ1  1 
ATOM   915  H HZ2  . LYS A 1 59  ? 4.562   -7.391  24.843  1.00 117.64 ? 130 LYS A HZ2  1 
ATOM   916  H HZ3  . LYS A 1 59  ? 3.728   -6.207  24.870  1.00 117.64 ? 130 LYS A HZ3  1 
ATOM   917  N N    . THR A 1 60  ? 0.705   -13.753 26.942  1.00 76.55  ? 131 THR A N    1 
ATOM   918  C CA   . THR A 1 60  ? -0.388  -14.524 27.535  1.00 83.26  ? 131 THR A CA   1 
ATOM   919  C C    . THR A 1 60  ? -1.213  -13.705 28.524  1.00 88.91  ? 131 THR A C    1 
ATOM   920  O O    . THR A 1 60  ? -2.412  -13.959 28.694  1.00 90.35  ? 131 THR A O    1 
ATOM   921  C CB   . THR A 1 60  ? 0.162   -15.754 28.243  1.00 89.14  ? 131 THR A CB   1 
ATOM   922  O OG1  . THR A 1 60  ? -0.914  -16.423 28.910  1.00 93.31  ? 131 THR A OG1  1 
ATOM   923  C CG2  . THR A 1 60  ? 1.207   -15.354 29.265  1.00 90.67  ? 131 THR A CG2  1 
ATOM   924  H H    . THR A 1 60  ? 1.486   -14.091 27.060  1.00 91.86  ? 131 THR A H    1 
ATOM   925  H HA   . THR A 1 60  ? -0.981  -14.825 26.829  1.00 99.91  ? 131 THR A HA   1 
ATOM   926  H HB   . THR A 1 60  ? 0.570   -16.351 27.596  1.00 106.97 ? 131 THR A HB   1 
ATOM   927  H HG1  . THR A 1 60  ? -0.626  -17.105 29.306  1.00 111.97 ? 131 THR A HG1  1 
ATOM   928  H HG21 . THR A 1 60  ? 1.530   -16.144 29.726  1.00 108.80 ? 131 THR A HG21 1 
ATOM   929  H HG22 . THR A 1 60  ? 1.958   -14.920 28.832  1.00 108.80 ? 131 THR A HG22 1 
ATOM   930  H HG23 . THR A 1 60  ? 0.825   -14.748 29.919  1.00 108.80 ? 131 THR A HG23 1 
ATOM   931  N N    . ASP A 1 61  ? -0.590  -12.743 29.203  1.00 93.96  ? 132 ASP A N    1 
ATOM   932  C CA   . ASP A 1 61  ? -1.319  -11.905 30.145  1.00 103.97 ? 132 ASP A CA   1 
ATOM   933  C C    . ASP A 1 61  ? -2.457  -11.152 29.454  1.00 100.81 ? 132 ASP A C    1 
ATOM   934  O O    . ASP A 1 61  ? -3.637  -11.330 29.790  1.00 102.54 ? 132 ASP A O    1 
ATOM   935  C CB   . ASP A 1 61  ? -0.337  -10.948 30.823  1.00 119.01 ? 132 ASP A CB   1 
ATOM   936  C CG   . ASP A 1 61  ? 0.526   -10.189 29.847  1.00 133.64 ? 132 ASP A CG   1 
ATOM   937  O OD1  . ASP A 1 61  ? 1.482   -10.798 29.334  1.00 142.76 ? 132 ASP A OD1  1 
ATOM   938  O OD2  . ASP A 1 61  ? 0.266   -8.987  29.608  1.00 135.92 ? 132 ASP A OD2  1 
ATOM   939  H H    . ASP A 1 61  ? 0.248   -12.563 29.136  1.00 112.75 ? 132 ASP A H    1 
ATOM   940  H HA   . ASP A 1 61  ? -1.708  -12.469 30.832  1.00 124.77 ? 132 ASP A HA   1 
ATOM   941  H HB2  . ASP A 1 61  ? -0.818  -10.315 31.379  1.00 142.81 ? 132 ASP A HB2  1 
ATOM   942  H HB3  . ASP A 1 61  ? 0.270   -11.483 31.352  1.00 142.81 ? 132 ASP A HB3  1 
ATOM   943  N N    . CYS A 1 62  ? -2.116  -10.311 28.473  1.00 92.57  ? 133 CYS A N    1 
ATOM   944  C CA   . CYS A 1 62  ? -3.085  -9.474  27.763  1.00 83.78  ? 133 CYS A CA   1 
ATOM   945  C C    . CYS A 1 62  ? -3.680  -10.293 26.622  1.00 73.20  ? 133 CYS A C    1 
ATOM   946  O O    . CYS A 1 62  ? -3.319  -10.156 25.448  1.00 67.50  ? 133 CYS A O    1 
ATOM   947  C CB   . CYS A 1 62  ? -2.410  -8.202  27.261  1.00 83.31  ? 133 CYS A CB   1 
ATOM   948  S SG   . CYS A 1 62  ? -3.531  -6.942  26.595  1.00 83.32  ? 133 CYS A SG   1 
ATOM   949  H H    . CYS A 1 62  ? -1.311  -10.209 28.189  1.00 111.09 ? 133 CYS A H    1 
ATOM   950  H HA   . CYS A 1 62  ? -3.801  -9.224  28.368  1.00 100.54 ? 133 CYS A HA   1 
ATOM   951  H HB2  . CYS A 1 62  ? -1.925  -7.800  27.998  1.00 99.97  ? 133 CYS A HB2  1 
ATOM   952  H HB3  . CYS A 1 62  ? -1.788  -8.441  26.556  1.00 99.97  ? 133 CYS A HB3  1 
ATOM   953  H HG   . CYS A 1 62  ? -2.886  -5.996  26.235  1.00 99.99  ? 133 CYS A HG   1 
ATOM   954  N N    . SER A 1 63  ? -4.607  -11.180 26.976  1.00 70.83  ? 134 SER A N    1 
ATOM   955  C CA   . SER A 1 63  ? -5.236  -11.987 25.941  1.00 69.59  ? 134 SER A CA   1 
ATOM   956  C C    . SER A 1 63  ? -5.954  -11.131 24.896  1.00 65.71  ? 134 SER A C    1 
ATOM   957  O O    . SER A 1 63  ? -5.942  -11.524 23.719  1.00 59.33  ? 134 SER A O    1 
ATOM   958  C CB   . SER A 1 63  ? -6.184  -13.011 26.576  1.00 75.75  ? 134 SER A CB   1 
ATOM   959  O OG   . SER A 1 63  ? -7.255  -12.366 27.215  1.00 81.22  ? 134 SER A OG   1 
ATOM   960  H H    . SER A 1 63  ? -4.880  -11.329 27.778  1.00 84.99  ? 134 SER A H    1 
ATOM   961  H HA   . SER A 1 63  ? -4.543  -12.484 25.479  1.00 83.51  ? 134 SER A HA   1 
ATOM   962  H HB2  . SER A 1 63  ? -6.533  -13.594 25.886  1.00 90.90  ? 134 SER A HB2  1 
ATOM   963  H HB3  . SER A 1 63  ? -5.693  -13.531 27.232  1.00 90.90  ? 134 SER A HB3  1 
ATOM   964  H HG   . SER A 1 63  ? -7.768  -12.935 27.560  1.00 97.46  ? 134 SER A HG   1 
ATOM   965  N N    . PRO A 1 64  ? -6.540  -9.971  25.220  1.00 69.04  ? 135 PRO A N    1 
ATOM   966  C CA   . PRO A 1 64  ? -7.098  -9.136  24.144  1.00 68.95  ? 135 PRO A CA   1 
ATOM   967  C C    . PRO A 1 64  ? -6.087  -8.773  23.066  1.00 62.68  ? 135 PRO A C    1 
ATOM   968  O O    . PRO A 1 64  ? -6.431  -8.771  21.877  1.00 60.99  ? 135 PRO A O    1 
ATOM   969  C CB   . PRO A 1 64  ? -7.602  -7.895  24.895  1.00 72.07  ? 135 PRO A CB   1 
ATOM   970  C CG   . PRO A 1 64  ? -7.854  -8.371  26.276  1.00 73.71  ? 135 PRO A CG   1 
ATOM   971  C CD   . PRO A 1 64  ? -6.793  -9.382  26.546  1.00 72.88  ? 135 PRO A CD   1 
ATOM   972  H HA   . PRO A 1 64  ? -7.853  -9.585  23.732  1.00 82.74  ? 135 PRO A HA   1 
ATOM   973  H HB2  . PRO A 1 64  ? -6.919  -7.206  24.887  1.00 86.49  ? 135 PRO A HB2  1 
ATOM   974  H HB3  . PRO A 1 64  ? -8.421  -7.576  24.486  1.00 86.49  ? 135 PRO A HB3  1 
ATOM   975  H HG2  . PRO A 1 64  ? -7.784  -7.628  26.895  1.00 88.46  ? 135 PRO A HG2  1 
ATOM   976  H HG3  . PRO A 1 64  ? -8.734  -8.777  26.326  1.00 88.46  ? 135 PRO A HG3  1 
ATOM   977  H HD2  . PRO A 1 64  ? -5.995  -8.945  26.882  1.00 87.45  ? 135 PRO A HD2  1 
ATOM   978  H HD3  . PRO A 1 64  ? -7.118  -10.052 27.165  1.00 87.45  ? 135 PRO A HD3  1 
ATOM   979  N N    . ILE A 1 65  ? -4.847  -8.452  23.435  1.00 62.46  ? 136 ILE A N    1 
ATOM   980  C CA   . ILE A 1 65  ? -3.892  -8.111  22.394  1.00 58.15  ? 136 ILE A CA   1 
ATOM   981  C C    . ILE A 1 65  ? -3.462  -9.375  21.657  1.00 51.25  ? 136 ILE A C    1 
ATOM   982  O O    . ILE A 1 65  ? -3.148  -9.324  20.464  1.00 51.74  ? 136 ILE A O    1 
ATOM   983  C CB   . ILE A 1 65  ? -2.695  -7.316  22.969  1.00 62.97  ? 136 ILE A CB   1 
ATOM   984  C CG1  . ILE A 1 65  ? -2.115  -6.388  21.897  1.00 67.40  ? 136 ILE A CG1  1 
ATOM   985  C CG2  . ILE A 1 65  ? -1.588  -8.224  23.500  1.00 61.59  ? 136 ILE A CG2  1 
ATOM   986  C CD1  . ILE A 1 65  ? -1.128  -5.353  22.436  1.00 71.23  ? 136 ILE A CD1  1 
ATOM   987  H H    . ILE A 1 65  ? -4.548  -8.425  24.241  1.00 74.95  ? 136 ILE A H    1 
ATOM   988  H HA   . ILE A 1 65  ? -4.336  -7.539  21.749  1.00 69.79  ? 136 ILE A HA   1 
ATOM   989  H HB   . ILE A 1 65  ? -3.018  -6.769  23.702  1.00 75.56  ? 136 ILE A HB   1 
ATOM   990  H HG12 . ILE A 1 65  ? -1.650  -6.925  21.237  1.00 80.89  ? 136 ILE A HG12 1 
ATOM   991  H HG13 . ILE A 1 65  ? -2.842  -5.906  21.473  1.00 80.89  ? 136 ILE A HG13 1 
ATOM   992  H HG21 . ILE A 1 65  ? -1.017  -7.711  24.093  1.00 73.91  ? 136 ILE A HG21 1 
ATOM   993  H HG22 . ILE A 1 65  ? -1.988  -8.962  23.982  1.00 73.91  ? 136 ILE A HG22 1 
ATOM   994  H HG23 . ILE A 1 65  ? -1.070  -8.562  22.753  1.00 73.91  ? 136 ILE A HG23 1 
ATOM   995  H HD11 . ILE A 1 65  ? -0.837  -4.784  21.706  1.00 85.48  ? 136 ILE A HD11 1 
ATOM   996  H HD12 . ILE A 1 65  ? -1.570  -4.820  23.115  1.00 85.48  ? 136 ILE A HD12 1 
ATOM   997  H HD13 . ILE A 1 65  ? -0.366  -5.813  22.821  1.00 85.48  ? 136 ILE A HD13 1 
ATOM   998  N N    . GLN A 1 66  ? -3.481  -10.529 22.323  1.00 49.51  ? 137 GLN A N    1 
ATOM   999  C CA   . GLN A 1 66  ? -3.237  -11.775 21.606  1.00 48.37  ? 137 GLN A CA   1 
ATOM   1000 C C    . GLN A 1 66  ? -4.284  -11.969 20.521  1.00 48.54  ? 137 GLN A C    1 
ATOM   1001 O O    . GLN A 1 66  ? -3.953  -12.237 19.359  1.00 46.32  ? 137 GLN A O    1 
ATOM   1002 C CB   . GLN A 1 66  ? -3.248  -12.966 22.563  1.00 51.66  ? 137 GLN A CB   1 
ATOM   1003 C CG   . GLN A 1 66  ? -1.977  -13.194 23.315  1.00 55.35  ? 137 GLN A CG   1 
ATOM   1004 C CD   . GLN A 1 66  ? -2.050  -14.442 24.175  1.00 60.80  ? 137 GLN A CD   1 
ATOM   1005 O OE1  . GLN A 1 66  ? -3.089  -14.735 24.772  1.00 63.12  ? 137 GLN A OE1  1 
ATOM   1006 N NE2  . GLN A 1 66  ? -0.948  -15.194 24.232  1.00 63.05  ? 137 GLN A NE2  1 
ATOM   1007 H H    . GLN A 1 66  ? -3.628  -10.616 23.166  1.00 59.41  ? 137 GLN A H    1 
ATOM   1008 H HA   . GLN A 1 66  ? -2.365  -11.734 21.183  1.00 58.05  ? 137 GLN A HA   1 
ATOM   1009 H HB2  . GLN A 1 66  ? -3.952  -12.830 23.216  1.00 62.00  ? 137 GLN A HB2  1 
ATOM   1010 H HB3  . GLN A 1 66  ? -3.432  -13.769 22.051  1.00 62.00  ? 137 GLN A HB3  1 
ATOM   1011 H HG2  . GLN A 1 66  ? -1.248  -13.302 22.685  1.00 66.43  ? 137 GLN A HG2  1 
ATOM   1012 H HG3  . GLN A 1 66  ? -1.809  -12.435 23.895  1.00 66.43  ? 137 GLN A HG3  1 
ATOM   1013 H HE21 . GLN A 1 66  ? -0.245  -14.961 23.794  1.00 75.66  ? 137 GLN A HE21 1 
ATOM   1014 H HE22 . GLN A 1 66  ? -0.941  -15.911 24.706  1.00 75.66  ? 137 GLN A HE22 1 
ATOM   1015 N N    . PHE A 1 67  ? -5.559  -11.809 20.891  1.00 49.75  ? 138 PHE A N    1 
ATOM   1016 C CA   . PHE A 1 67  ? -6.660  -11.984 19.956  1.00 50.15  ? 138 PHE A CA   1 
ATOM   1017 C C    . PHE A 1 67  ? -6.585  -10.976 18.814  1.00 47.69  ? 138 PHE A C    1 
ATOM   1018 O O    . PHE A 1 67  ? -6.774  -11.328 17.648  1.00 44.64  ? 138 PHE A O    1 
ATOM   1019 C CB   . PHE A 1 67  ? -7.979  -11.861 20.725  1.00 54.09  ? 138 PHE A CB   1 
ATOM   1020 C CG   . PHE A 1 67  ? -9.194  -11.837 19.860  1.00 55.14  ? 138 PHE A CG   1 
ATOM   1021 C CD1  . PHE A 1 67  ? -9.682  -13.003 19.305  1.00 54.34  ? 138 PHE A CD1  1 
ATOM   1022 C CD2  . PHE A 1 67  ? -9.857  -10.640 19.606  1.00 55.61  ? 138 PHE A CD2  1 
ATOM   1023 C CE1  . PHE A 1 67  ? -10.816 -12.985 18.491  1.00 54.60  ? 138 PHE A CE1  1 
ATOM   1024 C CE2  . PHE A 1 67  ? -10.996 -10.610 18.804  1.00 55.76  ? 138 PHE A CE2  1 
ATOM   1025 C CZ   . PHE A 1 67  ? -11.476 -11.779 18.254  1.00 55.15  ? 138 PHE A CZ   1 
ATOM   1026 H H    . PHE A 1 67  ? -5.808  -11.597 21.686  1.00 59.70  ? 138 PHE A H    1 
ATOM   1027 H HA   . PHE A 1 67  ? -6.615  -12.875 19.575  1.00 60.17  ? 138 PHE A HA   1 
ATOM   1028 H HB2  . PHE A 1 67  ? -8.060  -12.618 21.326  1.00 64.91  ? 138 PHE A HB2  1 
ATOM   1029 H HB3  . PHE A 1 67  ? -7.965  -11.037 21.236  1.00 64.91  ? 138 PHE A HB3  1 
ATOM   1030 H HD1  . PHE A 1 67  ? -9.244  -13.808 19.466  1.00 65.21  ? 138 PHE A HD1  1 
ATOM   1031 H HD2  . PHE A 1 67  ? -9.538  -9.850  19.980  1.00 66.73  ? 138 PHE A HD2  1 
ATOM   1032 H HE1  . PHE A 1 67  ? -11.140 -13.775 18.123  1.00 65.52  ? 138 PHE A HE1  1 
ATOM   1033 H HE2  . PHE A 1 67  ? -11.431 -9.804  18.641  1.00 66.91  ? 138 PHE A HE2  1 
ATOM   1034 H HZ   . PHE A 1 67  ? -12.232 -11.762 17.713  1.00 66.19  ? 138 PHE A HZ   1 
ATOM   1035 N N    . GLU A 1 68  ? -6.322  -9.709  19.129  1.00 48.89  ? 139 GLU A N    1 
ATOM   1036 C CA   . GLU A 1 68  ? -6.265  -8.691  18.084  1.00 54.51  ? 139 GLU A CA   1 
ATOM   1037 C C    . GLU A 1 68  ? -5.096  -8.938  17.133  1.00 51.22  ? 139 GLU A C    1 
ATOM   1038 O O    . GLU A 1 68  ? -5.219  -8.728  15.922  1.00 51.39  ? 139 GLU A O    1 
ATOM   1039 C CB   . GLU A 1 68  ? -6.165  -7.300  18.712  1.00 63.80  ? 139 GLU A CB   1 
ATOM   1040 C CG   . GLU A 1 68  ? -7.363  -6.906  19.587  1.00 72.85  ? 139 GLU A CG   1 
ATOM   1041 C CD   . GLU A 1 68  ? -8.579  -6.447  18.779  1.00 78.15  ? 139 GLU A CD   1 
ATOM   1042 O OE1  . GLU A 1 68  ? -8.390  -6.105  17.604  1.00 82.67  ? 139 GLU A OE1  1 
ATOM   1043 O OE2  . GLU A 1 68  ? -9.709  -6.409  19.315  1.00 76.81  ? 139 GLU A OE2  1 
ATOM   1044 H H    . GLU A 1 68  ? -6.176  -9.418  19.925  1.00 58.67  ? 139 GLU A H    1 
ATOM   1045 H HA   . GLU A 1 68  ? -7.084  -8.726  17.566  1.00 65.42  ? 139 GLU A HA   1 
ATOM   1046 H HB2  . GLU A 1 68  ? -5.371  -7.267  19.268  1.00 76.56  ? 139 GLU A HB2  1 
ATOM   1047 H HB3  . GLU A 1 68  ? -6.093  -6.645  18.001  1.00 76.56  ? 139 GLU A HB3  1 
ATOM   1048 H HG2  . GLU A 1 68  ? -7.633  -7.672  20.116  1.00 87.42  ? 139 GLU A HG2  1 
ATOM   1049 H HG3  . GLU A 1 68  ? -7.100  -6.177  20.171  1.00 87.42  ? 139 GLU A HG3  1 
ATOM   1050 N N    . SER A 1 69  ? -3.950  -9.374  17.658  1.00 50.38  ? 140 SER A N    1 
ATOM   1051 C CA   . SER A 1 69  ? -2.815  -9.669  16.794  1.00 49.29  ? 140 SER A CA   1 
ATOM   1052 C C    . SER A 1 69  ? -3.100  -10.867 15.891  1.00 42.36  ? 140 SER A C    1 
ATOM   1053 O O    . SER A 1 69  ? -2.829  -10.827 14.688  1.00 40.00  ? 140 SER A O    1 
ATOM   1054 C CB   . SER A 1 69  ? -1.580  -9.925  17.634  1.00 54.57  ? 140 SER A CB   1 
ATOM   1055 O OG   . SER A 1 69  ? -1.264  -8.765  18.362  1.00 61.45  ? 140 SER A OG   1 
ATOM   1056 H H    . SER A 1 69  ? -3.808  -9.504  18.496  1.00 60.46  ? 140 SER A H    1 
ATOM   1057 H HA   . SER A 1 69  ? -2.640  -8.901  16.228  1.00 59.14  ? 140 SER A HA   1 
ATOM   1058 H HB2  . SER A 1 69  ? -1.757  -10.652 18.251  1.00 65.48  ? 140 SER A HB2  1 
ATOM   1059 H HB3  . SER A 1 69  ? -0.837  -10.150 17.052  1.00 65.48  ? 140 SER A HB3  1 
ATOM   1060 H HG   . SER A 1 69  ? -1.901  -8.562  18.871  1.00 73.74  ? 140 SER A HG   1 
ATOM   1061 N N    . ALA A 1 70  ? -3.634  -11.947 16.457  1.00 43.51  ? 141 ALA A N    1 
ATOM   1062 C CA   . ALA A 1 70  ? -3.972  -13.109 15.650  1.00 44.76  ? 141 ALA A CA   1 
ATOM   1063 C C    . ALA A 1 70  ? -4.924  -12.741 14.518  1.00 43.99  ? 141 ALA A C    1 
ATOM   1064 O O    . ALA A 1 70  ? -4.798  -13.247 13.396  1.00 43.50  ? 141 ALA A O    1 
ATOM   1065 C CB   . ALA A 1 70  ? -4.584  -14.179 16.544  1.00 45.90  ? 141 ALA A CB   1 
ATOM   1066 H H    . ALA A 1 70  ? -3.808  -12.029 17.295  1.00 52.21  ? 141 ALA A H    1 
ATOM   1067 H HA   . ALA A 1 70  ? -3.162  -13.470 15.258  1.00 53.71  ? 141 ALA A HA   1 
ATOM   1068 H HB1  . ALA A 1 70  ? -4.808  -14.952 16.003  1.00 55.08  ? 141 ALA A HB1  1 
ATOM   1069 H HB2  . ALA A 1 70  ? -3.940  -14.427 17.225  1.00 55.08  ? 141 ALA A HB2  1 
ATOM   1070 H HB3  . ALA A 1 70  ? -5.385  -13.822 16.960  1.00 55.08  ? 141 ALA A HB3  1 
ATOM   1071 N N    . TRP A 1 71  ? -5.876  -11.845 14.786  1.00 45.16  ? 142 TRP A N    1 
ATOM   1072 C CA   . TRP A 1 71  ? -6.832  -11.470 13.750  1.00 44.73  ? 142 TRP A CA   1 
ATOM   1073 C C    . TRP A 1 71  ? -6.143  -10.636 12.673  1.00 43.36  ? 142 TRP A C    1 
ATOM   1074 O O    . TRP A 1 71  ? -6.291  -10.907 11.472  1.00 43.85  ? 142 TRP A O    1 
ATOM   1075 C CB   . TRP A 1 71  ? -8.016  -10.738 14.393  1.00 48.89  ? 142 TRP A CB   1 
ATOM   1076 C CG   . TRP A 1 71  ? -9.151  -10.344 13.478  1.00 52.71  ? 142 TRP A CG   1 
ATOM   1077 C CD1  . TRP A 1 71  ? -9.139  -10.292 12.116  1.00 54.36  ? 142 TRP A CD1  1 
ATOM   1078 C CD2  . TRP A 1 71  ? -10.475 -9.940  13.881  1.00 56.54  ? 142 TRP A CD2  1 
ATOM   1079 N NE1  . TRP A 1 71  ? -10.366 -9.881  11.645  1.00 55.46  ? 142 TRP A NE1  1 
ATOM   1080 C CE2  . TRP A 1 71  ? -11.199 -9.653  12.708  1.00 56.75  ? 142 TRP A CE2  1 
ATOM   1081 C CE3  . TRP A 1 71  ? -11.109 -9.789  15.119  1.00 60.43  ? 142 TRP A CE3  1 
ATOM   1082 C CZ2  . TRP A 1 71  ? -12.517 -9.222  12.734  1.00 58.88  ? 142 TRP A CZ2  1 
ATOM   1083 C CZ3  . TRP A 1 71  ? -12.425 -9.355  15.144  1.00 63.02  ? 142 TRP A CZ3  1 
ATOM   1084 C CH2  . TRP A 1 71  ? -13.116 -9.084  13.960  1.00 62.17  ? 142 TRP A CH2  1 
ATOM   1085 H H    . TRP A 1 71  ? -5.987  -11.450 15.542  1.00 54.19  ? 142 TRP A H    1 
ATOM   1086 H HA   . TRP A 1 71  ? -7.172  -12.275 13.330  1.00 53.68  ? 142 TRP A HA   1 
ATOM   1087 H HB2  . TRP A 1 71  ? -8.389  -11.312 15.081  1.00 58.67  ? 142 TRP A HB2  1 
ATOM   1088 H HB3  . TRP A 1 71  ? -7.682  -9.924  14.802  1.00 58.67  ? 142 TRP A HB3  1 
ATOM   1089 H HD1  . TRP A 1 71  ? -8.413  -10.504 11.579  1.00 65.24  ? 142 TRP A HD1  1 
ATOM   1090 H HE1  . TRP A 1 71  ? -10.573 -9.776  10.817  1.00 66.55  ? 142 TRP A HE1  1 
ATOM   1091 H HE3  . TRP A 1 71  ? -10.651 -9.961  15.910  1.00 72.51  ? 142 TRP A HE3  1 
ATOM   1092 H HZ2  . TRP A 1 71  ? -12.982 -9.046  11.948  1.00 70.66  ? 142 TRP A HZ2  1 
ATOM   1093 H HZ3  . TRP A 1 71  ? -12.858 -9.251  15.961  1.00 75.62  ? 142 TRP A HZ3  1 
ATOM   1094 H HH2  . TRP A 1 71  ? -14.001 -8.802  14.004  1.00 74.60  ? 142 TRP A HH2  1 
ATOM   1095 N N    . ALA A 1 72  ? -5.346  -9.643  13.080  1.00 42.32  ? 143 ALA A N    1 
ATOM   1096 C CA   . ALA A 1 72  ? -4.599  -8.847  12.108  1.00 43.33  ? 143 ALA A CA   1 
ATOM   1097 C C    . ALA A 1 72  ? -3.734  -9.733  11.218  1.00 44.34  ? 143 ALA A C    1 
ATOM   1098 O O    . ALA A 1 72  ? -3.699  -9.552  9.993   1.00 47.89  ? 143 ALA A O    1 
ATOM   1099 C CB   . ALA A 1 72  ? -3.725  -7.824  12.827  1.00 43.44  ? 143 ALA A CB   1 
ATOM   1100 H H    . ALA A 1 72  ? -5.223  -9.415  13.900  1.00 50.79  ? 143 ALA A H    1 
ATOM   1101 H HA   . ALA A 1 72  ? -5.224  -8.367  11.542  1.00 52.00  ? 143 ALA A HA   1 
ATOM   1102 H HB1  . ALA A 1 72  ? -3.236  -7.308  12.167  1.00 52.12  ? 143 ALA A HB1  1 
ATOM   1103 H HB2  . ALA A 1 72  ? -4.292  -7.238  13.352  1.00 52.12  ? 143 ALA A HB2  1 
ATOM   1104 H HB3  . ALA A 1 72  ? -3.104  -8.292  13.407  1.00 52.12  ? 143 ALA A HB3  1 
ATOM   1105 N N    . LEU A 1 73  ? -3.035  -10.706 11.815  1.00 42.55  ? 144 LEU A N    1 
ATOM   1106 C CA   . LEU A 1 73  ? -2.096  -11.528 11.065  1.00 40.10  ? 144 LEU A CA   1 
ATOM   1107 C C    . LEU A 1 73  ? -2.821  -12.556 10.202  1.00 39.53  ? 144 LEU A C    1 
ATOM   1108 O O    . LEU A 1 73  ? -2.366  -12.876 9.104   1.00 36.10  ? 144 LEU A O    1 
ATOM   1109 C CB   . LEU A 1 73  ? -1.120  -12.220 12.033  1.00 40.93  ? 144 LEU A CB   1 
ATOM   1110 C CG   . LEU A 1 73  ? -0.066  -11.334 12.706  1.00 43.21  ? 144 LEU A CG   1 
ATOM   1111 C CD1  . LEU A 1 73  ? 0.687   -12.112 13.749  1.00 43.71  ? 144 LEU A CD1  1 
ATOM   1112 C CD2  . LEU A 1 73  ? 0.951   -10.777 11.725  1.00 43.49  ? 144 LEU A CD2  1 
ATOM   1113 H H    . LEU A 1 73  ? -3.090  -10.905 12.650  1.00 51.06  ? 144 LEU A H    1 
ATOM   1114 H HA   . LEU A 1 73  ? -1.579  -10.957 10.476  1.00 48.13  ? 144 LEU A HA   1 
ATOM   1115 H HB2  . LEU A 1 73  ? -1.639  -12.634 12.740  1.00 49.12  ? 144 LEU A HB2  1 
ATOM   1116 H HB3  . LEU A 1 73  ? -0.644  -12.908 11.541  1.00 49.12  ? 144 LEU A HB3  1 
ATOM   1117 H HG   . LEU A 1 73  ? -0.507  -10.588 13.143  1.00 51.85  ? 144 LEU A HG   1 
ATOM   1118 H HD11 . LEU A 1 73  ? 1.351   -11.534 14.156  1.00 52.45  ? 144 LEU A HD11 1 
ATOM   1119 H HD12 . LEU A 1 73  ? 0.062   -12.423 14.422  1.00 52.45  ? 144 LEU A HD12 1 
ATOM   1120 H HD13 . LEU A 1 73  ? 1.121   -12.869 13.325  1.00 52.45  ? 144 LEU A HD13 1 
ATOM   1121 H HD21 . LEU A 1 73  ? 1.613   -10.264 12.214  1.00 52.19  ? 144 LEU A HD21 1 
ATOM   1122 H HD22 . LEU A 1 73  ? 1.379   -11.514 11.262  1.00 52.19  ? 144 LEU A HD22 1 
ATOM   1123 H HD23 . LEU A 1 73  ? 0.495   -10.205 11.088  1.00 52.19  ? 144 LEU A HD23 1 
ATOM   1124 N N    . THR A 1 74  ? -3.943  -13.080 10.680  1.00 41.03  ? 145 THR A N    1 
ATOM   1125 C CA   . THR A 1 74  ? -4.805  -13.888 9.825   1.00 42.80  ? 145 THR A CA   1 
ATOM   1126 C C    . THR A 1 74  ? -5.123  -13.156 8.534   1.00 41.89  ? 145 THR A C    1 
ATOM   1127 O O    . THR A 1 74  ? -5.082  -13.743 7.446   1.00 41.23  ? 145 THR A O    1 
ATOM   1128 C CB   . THR A 1 74  ? -6.092  -14.224 10.576  1.00 43.82  ? 145 THR A CB   1 
ATOM   1129 O OG1  . THR A 1 74  ? -5.772  -15.112 11.642  1.00 44.05  ? 145 THR A OG1  1 
ATOM   1130 C CG2  . THR A 1 74  ? -7.166  -14.862 9.654   1.00 44.32  ? 145 THR A CG2  1 
ATOM   1131 H H    . THR A 1 74  ? -4.226  -12.985 11.486  1.00 49.24  ? 145 THR A H    1 
ATOM   1132 H HA   . THR A 1 74  ? -4.354  -14.718 9.604   1.00 51.36  ? 145 THR A HA   1 
ATOM   1133 H HB   . THR A 1 74  ? -6.463  -13.408 10.946  1.00 52.58  ? 145 THR A HB   1 
ATOM   1134 H HG1  . THR A 1 74  ? -5.225  -14.747 12.165  1.00 52.86  ? 145 THR A HG1  1 
ATOM   1135 H HG21 . THR A 1 74  ? -7.858  -15.277 10.192  1.00 53.18  ? 145 THR A HG21 1 
ATOM   1136 H HG22 . THR A 1 74  ? -7.570  -14.183 9.092   1.00 53.18  ? 145 THR A HG22 1 
ATOM   1137 H HG23 . THR A 1 74  ? -6.759  -15.539 9.091   1.00 53.18  ? 145 THR A HG23 1 
ATOM   1138 N N    . ASN A 1 75  ? -5.427  -11.864 8.633   1.00 43.56  ? 146 ASN A N    1 
ATOM   1139 C CA   . ASN A 1 75  ? -5.865  -11.143 7.448   1.00 46.77  ? 146 ASN A CA   1 
ATOM   1140 C C    . ASN A 1 75  ? -4.697  -10.778 6.549   1.00 47.49  ? 146 ASN A C    1 
ATOM   1141 O O    . ASN A 1 75  ? -4.852  -10.752 5.323   1.00 48.56  ? 146 ASN A O    1 
ATOM   1142 C CB   . ASN A 1 75  ? -6.679  -9.923  7.877   1.00 50.79  ? 146 ASN A CB   1 
ATOM   1143 C CG   . ASN A 1 75  ? -8.127  -10.301 8.209   1.00 54.68  ? 146 ASN A CG   1 
ATOM   1144 O OD1  . ASN A 1 75  ? -8.444  -11.476 8.364   1.00 52.50  ? 146 ASN A OD1  1 
ATOM   1145 N ND2  . ASN A 1 75  ? -9.001  -9.319  8.288   1.00 59.81  ? 146 ASN A ND2  1 
ATOM   1146 H H    . ASN A 1 75  ? -5.389  -11.396 9.353   1.00 52.27  ? 146 ASN A H    1 
ATOM   1147 H HA   . ASN A 1 75  ? -6.453  -11.720 6.937   1.00 56.13  ? 146 ASN A HA   1 
ATOM   1148 H HB2  . ASN A 1 75  ? -6.278  -9.532  8.669   1.00 60.95  ? 146 ASN A HB2  1 
ATOM   1149 H HB3  . ASN A 1 75  ? -6.692  -9.277  7.154   1.00 60.95  ? 146 ASN A HB3  1 
ATOM   1150 H HD21 . ASN A 1 75  ? -9.824  -9.489  8.472   1.00 71.77  ? 146 ASN A HD21 1 
ATOM   1151 H HD22 . ASN A 1 75  ? -8.749  -8.507  8.155   1.00 71.77  ? 146 ASN A HD22 1 
ATOM   1152 N N    . ILE A 1 76  ? -3.513  -10.556 7.123   1.00 45.77  ? 147 ILE A N    1 
ATOM   1153 C CA   . ILE A 1 76  ? -2.325  -10.388 6.298   1.00 44.19  ? 147 ILE A CA   1 
ATOM   1154 C C    . ILE A 1 76  ? -1.976  -11.698 5.605   1.00 41.38  ? 147 ILE A C    1 
ATOM   1155 O O    . ILE A 1 76  ? -1.717  -11.726 4.399   1.00 40.69  ? 147 ILE A O    1 
ATOM   1156 C CB   . ILE A 1 76  ? -1.155  -9.856  7.139   1.00 44.92  ? 147 ILE A CB   1 
ATOM   1157 C CG1  . ILE A 1 76  ? -1.500  -8.467  7.675   1.00 46.54  ? 147 ILE A CG1  1 
ATOM   1158 C CG2  . ILE A 1 76  ? 0.100   -9.812  6.310   1.00 44.92  ? 147 ILE A CG2  1 
ATOM   1159 C CD1  . ILE A 1 76  ? -0.681  -8.079  8.871   1.00 47.62  ? 147 ILE A CD1  1 
ATOM   1160 H H    . ILE A 1 76  ? -3.376  -10.500 7.970   1.00 54.92  ? 147 ILE A H    1 
ATOM   1161 H HA   . ILE A 1 76  ? -2.515  -9.732  5.609   1.00 53.03  ? 147 ILE A HA   1 
ATOM   1162 H HB   . ILE A 1 76  ? -1.013  -10.454 7.889   1.00 53.91  ? 147 ILE A HB   1 
ATOM   1163 H HG12 . ILE A 1 76  ? -1.338  -7.812  6.978   1.00 55.84  ? 147 ILE A HG12 1 
ATOM   1164 H HG13 . ILE A 1 76  ? -2.433  -8.446  7.936   1.00 55.84  ? 147 ILE A HG13 1 
ATOM   1165 H HG21 . ILE A 1 76  ? 0.776   -9.307  6.789   1.00 53.90  ? 147 ILE A HG21 1 
ATOM   1166 H HG22 . ILE A 1 76  ? 0.414   -10.715 6.155   1.00 53.90  ? 147 ILE A HG22 1 
ATOM   1167 H HG23 . ILE A 1 76  ? -0.097  -9.379  5.465   1.00 53.90  ? 147 ILE A HG23 1 
ATOM   1168 H HD11 . ILE A 1 76  ? -0.976  -7.211  9.187   1.00 57.15  ? 147 ILE A HD11 1 
ATOM   1169 H HD12 . ILE A 1 76  ? -0.804  -8.744  9.566   1.00 57.15  ? 147 ILE A HD12 1 
ATOM   1170 H HD13 . ILE A 1 76  ? 0.253   -8.037  8.615   1.00 57.15  ? 147 ILE A HD13 1 
ATOM   1171 N N    . ALA A 1 77  ? -2.006  -12.809 6.341   1.00 40.33  ? 148 ALA A N    1 
ATOM   1172 C CA   . ALA A 1 77  ? -1.665  -14.101 5.745   1.00 41.66  ? 148 ALA A CA   1 
ATOM   1173 C C    . ALA A 1 77  ? -2.674  -14.553 4.699   1.00 43.71  ? 148 ALA A C    1 
ATOM   1174 O O    . ALA A 1 77  ? -2.360  -15.437 3.891   1.00 46.25  ? 148 ALA A O    1 
ATOM   1175 C CB   . ALA A 1 77  ? -1.546  -15.176 6.829   1.00 39.98  ? 148 ALA A CB   1 
ATOM   1176 H H    . ALA A 1 77  ? -2.217  -12.843 7.174   1.00 48.40  ? 148 ALA A H    1 
ATOM   1177 H HA   . ALA A 1 77  ? -0.802  -14.024 5.309   1.00 49.99  ? 148 ALA A HA   1 
ATOM   1178 H HB1  . ALA A 1 77  ? -1.320  -16.022 6.411   1.00 47.98  ? 148 ALA A HB1  1 
ATOM   1179 H HB2  . ALA A 1 77  ? -0.850  -14.918 7.453   1.00 47.98  ? 148 ALA A HB2  1 
ATOM   1180 H HB3  . ALA A 1 77  ? -2.395  -15.252 7.292   1.00 47.98  ? 148 ALA A HB3  1 
ATOM   1181 N N    . SER A 1 78  ? -3.864  -13.967 4.689   1.00 45.00  ? 149 SER A N    1 
ATOM   1182 C CA   . SER A 1 78  ? -4.883  -14.307 3.710   1.00 46.97  ? 149 SER A CA   1 
ATOM   1183 C C    . SER A 1 78  ? -4.679  -13.638 2.357   1.00 48.66  ? 149 SER A C    1 
ATOM   1184 O O    . SER A 1 78  ? -5.496  -13.851 1.458   1.00 47.47  ? 149 SER A O    1 
ATOM   1185 C CB   . SER A 1 78  ? -6.266  -13.922 4.250   1.00 49.73  ? 149 SER A CB   1 
ATOM   1186 O OG   . SER A 1 78  ? -6.555  -12.564 3.965   1.00 51.05  ? 149 SER A OG   1 
ATOM   1187 H H    . SER A 1 78  ? -4.109  -13.361 5.248   1.00 54.00  ? 149 SER A H    1 
ATOM   1188 H HA   . SER A 1 78  ? -4.875  -15.267 3.571   1.00 56.37  ? 149 SER A HA   1 
ATOM   1189 H HB2  . SER A 1 78  ? -6.937  -14.483 3.830   1.00 59.68  ? 149 SER A HB2  1 
ATOM   1190 H HB3  . SER A 1 78  ? -6.278  -14.053 5.211   1.00 59.68  ? 149 SER A HB3  1 
ATOM   1191 H HG   . SER A 1 78  ? -5.980  -12.067 4.323   1.00 61.26  ? 149 SER A HG   1 
ATOM   1192 N N    . GLY A 1 79  ? -3.631  -12.845 2.171   1.00 50.94  ? 150 GLY A N    1 
ATOM   1193 C CA   . GLY A 1 79  ? -3.443  -12.179 0.889   1.00 53.02  ? 150 GLY A CA   1 
ATOM   1194 C C    . GLY A 1 79  ? -2.563  -12.969 -0.063  1.00 52.34  ? 150 GLY A C    1 
ATOM   1195 O O    . GLY A 1 79  ? -2.629  -14.205 -0.115  1.00 55.53  ? 150 GLY A O    1 
ATOM   1196 H H    . GLY A 1 79  ? -3.025  -12.678 2.758   1.00 61.13  ? 150 GLY A H    1 
ATOM   1197 H HA2  . GLY A 1 79  ? -4.304  -12.038 0.465   1.00 63.62  ? 150 GLY A HA2  1 
ATOM   1198 H HA3  . GLY A 1 79  ? -3.031  -11.314 1.036   1.00 63.62  ? 150 GLY A HA3  1 
ATOM   1199 N N    . THR A 1 80  ? -1.718  -12.261 -0.808  1.00 47.62  ? 151 THR A N    1 
ATOM   1200 C CA   . THR A 1 80  ? -0.832  -12.883 -1.774  1.00 47.25  ? 151 THR A CA   1 
ATOM   1201 C C    . THR A 1 80  ? 0.187   -13.790 -1.078  1.00 44.53  ? 151 THR A C    1 
ATOM   1202 O O    . THR A 1 80  ? 0.415   -13.712 0.135   1.00 42.48  ? 151 THR A O    1 
ATOM   1203 C CB   . THR A 1 80  ? -0.074  -11.812 -2.553  1.00 50.43  ? 151 THR A CB   1 
ATOM   1204 O OG1  . THR A 1 80  ? 0.716   -11.054 -1.625  1.00 52.37  ? 151 THR A OG1  1 
ATOM   1205 C CG2  . THR A 1 80  ? -1.037  -10.864 -3.283  1.00 51.61  ? 151 THR A CG2  1 
ATOM   1206 H H    . THR A 1 80  ? -1.641  -11.406 -0.767  1.00 57.14  ? 151 THR A H    1 
ATOM   1207 H HA   . THR A 1 80  ? -1.349  -13.416 -2.398  1.00 56.70  ? 151 THR A HA   1 
ATOM   1208 H HB   . THR A 1 80  ? 0.505   -12.232 -3.208  1.00 60.52  ? 151 THR A HB   1 
ATOM   1209 H HG1  . THR A 1 80  ? 1.143   -10.457 -2.032  1.00 62.85  ? 151 THR A HG1  1 
ATOM   1210 H HG21 . THR A 1 80  ? -0.535  -10.233 -3.823  1.00 61.93  ? 151 THR A HG21 1 
ATOM   1211 H HG22 . THR A 1 80  ? -1.628  -11.373 -3.860  1.00 61.93  ? 151 THR A HG22 1 
ATOM   1212 H HG23 . THR A 1 80  ? -1.572  -10.373 -2.640  1.00 61.93  ? 151 THR A HG23 1 
ATOM   1213 N N    . SER A 1 81  ? 0.836   -14.639 -1.879  1.00 47.73  ? 152 SER A N    1 
ATOM   1214 C CA   . SER A 1 81  ? 1.943   -15.440 -1.359  1.00 50.46  ? 152 SER A CA   1 
ATOM   1215 C C    . SER A 1 81  ? 3.034   -14.561 -0.771  1.00 52.80  ? 152 SER A C    1 
ATOM   1216 O O    . SER A 1 81  ? 3.601   -14.888 0.276   1.00 52.14  ? 152 SER A O    1 
ATOM   1217 C CB   . SER A 1 81  ? 2.523   -16.327 -2.459  1.00 53.93  ? 152 SER A CB   1 
ATOM   1218 O OG   . SER A 1 81  ? 1.484   -17.088 -3.052  1.00 55.91  ? 152 SER A OG   1 
ATOM   1219 H H    . SER A 1 81  ? 0.658   -14.767 -2.711  1.00 57.28  ? 152 SER A H    1 
ATOM   1220 H HA   . SER A 1 81  ? 1.611   -16.016 -0.653  1.00 60.55  ? 152 SER A HA   1 
ATOM   1221 H HB2  . SER A 1 81  ? 2.937   -15.768 -3.136  1.00 64.72  ? 152 SER A HB2  1 
ATOM   1222 H HB3  . SER A 1 81  ? 3.179   -16.928 -2.073  1.00 64.72  ? 152 SER A HB3  1 
ATOM   1223 H HG   . SER A 1 81  ? 1.116   -17.572 -2.473  1.00 67.09  ? 152 SER A HG   1 
ATOM   1224 N N    . GLU A 1 82  ? 3.346   -13.447 -1.431  1.00 54.45  ? 153 GLU A N    1 
ATOM   1225 C CA   . GLU A 1 82  ? 4.347   -12.528 -0.900  1.00 60.70  ? 153 GLU A CA   1 
ATOM   1226 C C    . GLU A 1 82  ? 3.960   -12.033 0.491   1.00 55.35  ? 153 GLU A C    1 
ATOM   1227 O O    . GLU A 1 82  ? 4.815   -11.905 1.373   1.00 55.34  ? 153 GLU A O    1 
ATOM   1228 C CB   . GLU A 1 82  ? 4.524   -11.357 -1.861  1.00 73.14  ? 153 GLU A CB   1 
ATOM   1229 C CG   . GLU A 1 82  ? 5.559   -10.342 -1.434  1.00 84.57  ? 153 GLU A CG   1 
ATOM   1230 C CD   . GLU A 1 82  ? 5.662   -9.159  -2.408  1.00 94.82  ? 153 GLU A CD   1 
ATOM   1231 O OE1  . GLU A 1 82  ? 4.781   -9.023  -3.292  1.00 101.51 ? 153 GLU A OE1  1 
ATOM   1232 O OE2  . GLU A 1 82  ? 6.624   -8.363  -2.292  1.00 95.43  ? 153 GLU A OE2  1 
ATOM   1233 H H    . GLU A 1 82  ? 2.997   -13.204 -2.178  1.00 65.34  ? 153 GLU A H    1 
ATOM   1234 H HA   . GLU A 1 82  ? 5.197   -12.991 -0.829  1.00 72.84  ? 153 GLU A HA   1 
ATOM   1235 H HB2  . GLU A 1 82  ? 4.794   -11.704 -2.725  1.00 87.77  ? 153 GLU A HB2  1 
ATOM   1236 H HB3  . GLU A 1 82  ? 3.676   -10.894 -1.946  1.00 87.77  ? 153 GLU A HB3  1 
ATOM   1237 H HG2  . GLU A 1 82  ? 5.321   -9.989  -0.563  1.00 101.49 ? 153 GLU A HG2  1 
ATOM   1238 H HG3  . GLU A 1 82  ? 6.427   -10.773 -1.392  1.00 101.49 ? 153 GLU A HG3  1 
ATOM   1239 N N    . GLN A 1 83  ? 2.672   -11.753 0.704   1.00 52.14  ? 154 GLN A N    1 
ATOM   1240 C CA   . GLN A 1 83  ? 2.208   -11.267 1.995   1.00 48.56  ? 154 GLN A CA   1 
ATOM   1241 C C    . GLN A 1 83  ? 2.158   -12.389 3.024   1.00 46.18  ? 154 GLN A C    1 
ATOM   1242 O O    . GLN A 1 83  ? 2.536   -12.189 4.184   1.00 45.93  ? 154 GLN A O    1 
ATOM   1243 C CB   . GLN A 1 83  ? 0.837   -10.610 1.829   1.00 50.18  ? 154 GLN A CB   1 
ATOM   1244 C CG   . GLN A 1 83  ? 0.911   -9.336  0.973   1.00 53.32  ? 154 GLN A CG   1 
ATOM   1245 C CD   . GLN A 1 83  ? -0.440  -8.876  0.397   1.00 55.08  ? 154 GLN A CD   1 
ATOM   1246 O OE1  . GLN A 1 83  ? -1.368  -9.665  0.201   1.00 56.97  ? 154 GLN A OE1  1 
ATOM   1247 N NE2  . GLN A 1 83  ? -0.536  -7.588  0.117   1.00 54.29  ? 154 GLN A NE2  1 
ATOM   1248 H H    . GLN A 1 83  ? 2.051   -11.837 0.115   1.00 62.57  ? 154 GLN A H    1 
ATOM   1249 H HA   . GLN A 1 83  ? 2.826   -10.593 2.318   1.00 58.28  ? 154 GLN A HA   1 
ATOM   1250 H HB2  . GLN A 1 83  ? 0.236   -11.234 1.393   1.00 60.22  ? 154 GLN A HB2  1 
ATOM   1251 H HB3  . GLN A 1 83  ? 0.492   -10.368 2.703   1.00 60.22  ? 154 GLN A HB3  1 
ATOM   1252 H HG2  . GLN A 1 83  ? 1.258   -8.614  1.521   1.00 63.98  ? 154 GLN A HG2  1 
ATOM   1253 H HG3  . GLN A 1 83  ? 1.509   -9.495  0.226   1.00 63.98  ? 154 GLN A HG3  1 
ATOM   1254 H HE21 . GLN A 1 83  ? 0.132   -7.066  0.262   1.00 65.15  ? 154 GLN A HE21 1 
ATOM   1255 H HE22 . GLN A 1 83  ? -1.266  -7.272  -0.210  1.00 65.15  ? 154 GLN A HE22 1 
ATOM   1256 N N    . THR A 1 84  ? 1.716   -13.580 2.617   1.00 45.35  ? 155 THR A N    1 
ATOM   1257 C CA   . THR A 1 84  ? 1.763   -14.720 3.523   1.00 43.16  ? 155 THR A CA   1 
ATOM   1258 C C    . THR A 1 84  ? 3.195   -15.018 3.919   1.00 42.67  ? 155 THR A C    1 
ATOM   1259 O O    . THR A 1 84  ? 3.473   -15.366 5.074   1.00 40.90  ? 155 THR A O    1 
ATOM   1260 C CB   . THR A 1 84  ? 1.118   -15.945 2.870   1.00 42.03  ? 155 THR A CB   1 
ATOM   1261 O OG1  . THR A 1 84  ? -0.148  -15.570 2.303   1.00 42.33  ? 155 THR A OG1  1 
ATOM   1262 C CG2  . THR A 1 84  ? 0.919   -17.048 3.867   1.00 39.96  ? 155 THR A CG2  1 
ATOM   1263 H H    . THR A 1 84  ? 1.392   -13.749 1.839   1.00 54.42  ? 155 THR A H    1 
ATOM   1264 H HA   . THR A 1 84  ? 1.265   -14.508 4.328   1.00 51.80  ? 155 THR A HA   1 
ATOM   1265 H HB   . THR A 1 84  ? 1.698   -16.274 2.166   1.00 50.44  ? 155 THR A HB   1 
ATOM   1266 H HG1  . THR A 1 84  ? -0.656  -15.276 2.904   1.00 50.80  ? 155 THR A HG1  1 
ATOM   1267 H HG21 . THR A 1 84  ? 0.448   -17.787 3.452   1.00 47.95  ? 155 THR A HG21 1 
ATOM   1268 H HG22 . THR A 1 84  ? 1.777   -17.364 4.190   1.00 47.95  ? 155 THR A HG22 1 
ATOM   1269 H HG23 . THR A 1 84  ? 0.398   -16.725 4.619   1.00 47.95  ? 155 THR A HG23 1 
ATOM   1270 N N    . LYS A 1 85  ? 4.128   -14.838 2.984   1.00 44.47  ? 156 LYS A N    1 
ATOM   1271 C CA   . LYS A 1 85  ? 5.527   -15.098 3.290   1.00 46.63  ? 156 LYS A CA   1 
ATOM   1272 C C    . LYS A 1 85  ? 6.044   -14.131 4.347   1.00 45.19  ? 156 LYS A C    1 
ATOM   1273 O O    . LYS A 1 85  ? 6.792   -14.533 5.247   1.00 45.15  ? 156 LYS A O    1 
ATOM   1274 C CB   . LYS A 1 85  ? 6.382   -15.014 2.032   1.00 52.51  ? 156 LYS A CB   1 
ATOM   1275 C CG   . LYS A 1 85  ? 7.771   -15.577 2.226   1.00 62.07  ? 156 LYS A CG   1 
ATOM   1276 C CD   . LYS A 1 85  ? 8.798   -14.937 1.288   1.00 74.84  ? 156 LYS A CD   1 
ATOM   1277 C CE   . LYS A 1 85  ? 10.188  -15.564 1.468   1.00 85.29  ? 156 LYS A CE   1 
ATOM   1278 N NZ   . LYS A 1 85  ? 11.278  -14.701 0.924   1.00 91.69  ? 156 LYS A NZ   1 
ATOM   1279 H H    . LYS A 1 85  ? 3.978   -14.571 2.180   1.00 53.37  ? 156 LYS A H    1 
ATOM   1280 H HA   . LYS A 1 85  ? 5.608   -15.997 3.645   1.00 55.95  ? 156 LYS A HA   1 
ATOM   1281 H HB2  . LYS A 1 85  ? 5.951   -15.517 1.324   1.00 63.02  ? 156 LYS A HB2  1 
ATOM   1282 H HB3  . LYS A 1 85  ? 6.470   -14.084 1.772   1.00 63.02  ? 156 LYS A HB3  1 
ATOM   1283 H HG2  . LYS A 1 85  ? 8.059   -15.418 3.138   1.00 74.49  ? 156 LYS A HG2  1 
ATOM   1284 H HG3  . LYS A 1 85  ? 7.754   -16.530 2.045   1.00 74.49  ? 156 LYS A HG3  1 
ATOM   1285 H HD2  . LYS A 1 85  ? 8.520   -15.072 0.369   1.00 89.81  ? 156 LYS A HD2  1 
ATOM   1286 H HD3  . LYS A 1 85  ? 8.864   -13.989 1.484   1.00 89.81  ? 156 LYS A HD3  1 
ATOM   1287 H HE2  . LYS A 1 85  ? 10.355  -15.699 2.414   1.00 102.35 ? 156 LYS A HE2  1 
ATOM   1288 H HE3  . LYS A 1 85  ? 10.215  -16.414 1.001   1.00 102.35 ? 156 LYS A HE3  1 
ATOM   1289 H HZ1  . LYS A 1 85  ? 12.067  -15.095 1.045   1.00 110.03 ? 156 LYS A HZ1  1 
ATOM   1290 H HZ2  . LYS A 1 85  ? 11.153  -14.566 0.053   1.00 110.03 ? 156 LYS A HZ2  1 
ATOM   1291 H HZ3  . LYS A 1 85  ? 11.280  -13.915 1.341   1.00 110.03 ? 156 LYS A HZ3  1 
ATOM   1292 N N    . ALA A 1 86  ? 5.649   -12.855 4.278   1.00 44.18  ? 157 ALA A N    1 
ATOM   1293 C CA   . ALA A 1 86  ? 6.103   -11.924 5.306   1.00 44.51  ? 157 ALA A CA   1 
ATOM   1294 C C    . ALA A 1 86  ? 5.656   -12.387 6.691   1.00 46.23  ? 157 ALA A C    1 
ATOM   1295 O O    . ALA A 1 86  ? 6.399   -12.257 7.672   1.00 49.13  ? 157 ALA A O    1 
ATOM   1296 C CB   . ALA A 1 86  ? 5.594   -10.523 5.003   1.00 42.77  ? 157 ALA A CB   1 
ATOM   1297 H H    . ALA A 1 86  ? 5.140   -12.518 3.672   1.00 53.02  ? 157 ALA A H    1 
ATOM   1298 H HA   . ALA A 1 86  ? 7.073   -11.897 5.299   1.00 53.41  ? 157 ALA A HA   1 
ATOM   1299 H HB1  . ALA A 1 86  ? 5.941   -9.910  5.670   1.00 51.33  ? 157 ALA A HB1  1 
ATOM   1300 H HB2  . ALA A 1 86  ? 5.902   -10.261 4.121   1.00 51.33  ? 157 ALA A HB2  1 
ATOM   1301 H HB3  . ALA A 1 86  ? 4.624   -10.527 5.027   1.00 51.33  ? 157 ALA A HB3  1 
ATOM   1302 N N    . VAL A 1 87  ? 4.453   -12.958 6.790   1.00 45.54  ? 158 VAL A N    1 
ATOM   1303 C CA   . VAL A 1 87  ? 3.966   -13.455 8.078   1.00 44.06  ? 158 VAL A CA   1 
ATOM   1304 C C    . VAL A 1 87  ? 4.825   -14.620 8.563   1.00 42.00  ? 158 VAL A C    1 
ATOM   1305 O O    . VAL A 1 87  ? 5.140   -14.723 9.755   1.00 39.91  ? 158 VAL A O    1 
ATOM   1306 C CB   . VAL A 1 87  ? 2.483   -13.848 7.962   1.00 44.42  ? 158 VAL A CB   1 
ATOM   1307 C CG1  . VAL A 1 87  ? 2.008   -14.609 9.175   1.00 42.24  ? 158 VAL A CG1  1 
ATOM   1308 C CG2  . VAL A 1 87  ? 1.634   -12.600 7.744   1.00 46.20  ? 158 VAL A CG2  1 
ATOM   1309 H H    . VAL A 1 87  ? 3.906   -13.068 6.135   1.00 54.64  ? 158 VAL A H    1 
ATOM   1310 H HA   . VAL A 1 87  ? 4.034   -12.744 8.734   1.00 52.87  ? 158 VAL A HA   1 
ATOM   1311 H HB   . VAL A 1 87  ? 2.371   -14.422 7.188   1.00 53.31  ? 158 VAL A HB   1 
ATOM   1312 H HG11 . VAL A 1 87  ? 1.038   -14.615 9.182   1.00 50.69  ? 158 VAL A HG11 1 
ATOM   1313 H HG12 . VAL A 1 87  ? 2.342   -15.519 9.132   1.00 50.69  ? 158 VAL A HG12 1 
ATOM   1314 H HG13 . VAL A 1 87  ? 2.340   -14.169 9.973   1.00 50.69  ? 158 VAL A HG13 1 
ATOM   1315 H HG21 . VAL A 1 87  ? 0.709   -12.865 7.623   1.00 55.44  ? 158 VAL A HG21 1 
ATOM   1316 H HG22 . VAL A 1 87  ? 1.715   -12.023 8.520   1.00 55.44  ? 158 VAL A HG22 1 
ATOM   1317 H HG23 . VAL A 1 87  ? 1.953   -12.138 6.953   1.00 55.44  ? 158 VAL A HG23 1 
ATOM   1318 N N    . VAL A 1 88  ? 5.223   -15.503 7.644   1.00 42.90  ? 159 VAL A N    1 
ATOM   1319 C CA   . VAL A 1 88  ? 6.054   -16.660 7.981   1.00 43.44  ? 159 VAL A CA   1 
ATOM   1320 C C    . VAL A 1 88  ? 7.469   -16.228 8.361   1.00 44.81  ? 159 VAL A C    1 
ATOM   1321 O O    . VAL A 1 88  ? 8.064   -16.750 9.312   1.00 43.83  ? 159 VAL A O    1 
ATOM   1322 C CB   . VAL A 1 88  ? 6.089   -17.642 6.795   1.00 43.80  ? 159 VAL A CB   1 
ATOM   1323 C CG1  . VAL A 1 88  ? 7.048   -18.797 7.078   1.00 42.27  ? 159 VAL A CG1  1 
ATOM   1324 C CG2  . VAL A 1 88  ? 4.693   -18.153 6.468   1.00 45.47  ? 159 VAL A CG2  1 
ATOM   1325 H H    . VAL A 1 88  ? 5.022   -15.453 6.809   1.00 51.48  ? 159 VAL A H    1 
ATOM   1326 H HA   . VAL A 1 88  ? 5.665   -17.119 8.741   1.00 52.13  ? 159 VAL A HA   1 
ATOM   1327 H HB   . VAL A 1 88  ? 6.419   -17.172 6.014   1.00 52.56  ? 159 VAL A HB   1 
ATOM   1328 H HG11 . VAL A 1 88  ? 6.872   -19.511 6.446   1.00 50.72  ? 159 VAL A HG11 1 
ATOM   1329 H HG12 . VAL A 1 88  ? 7.961   -18.486 6.977   1.00 50.72  ? 159 VAL A HG12 1 
ATOM   1330 H HG13 . VAL A 1 88  ? 6.902   -19.114 7.983   1.00 50.72  ? 159 VAL A HG13 1 
ATOM   1331 H HG21 . VAL A 1 88  ? 4.750   -18.766 5.719   1.00 54.56  ? 159 VAL A HG21 1 
ATOM   1332 H HG22 . VAL A 1 88  ? 4.336   -18.611 7.245   1.00 54.56  ? 159 VAL A HG22 1 
ATOM   1333 H HG23 . VAL A 1 88  ? 4.126   -17.401 6.238   1.00 54.56  ? 159 VAL A HG23 1 
ATOM   1334 N N    . ASP A 1 89  ? 8.055   -15.327 7.577   1.00 47.53  ? 160 ASP A N    1 
ATOM   1335 C CA   . ASP A 1 89  ? 9.391   -14.833 7.886   1.00 53.78  ? 160 ASP A CA   1 
ATOM   1336 C C    . ASP A 1 89  ? 9.404   -14.101 9.229   1.00 51.07  ? 160 ASP A C    1 
ATOM   1337 O O    . ASP A 1 89  ? 10.446  -14.048 9.899   1.00 51.22  ? 160 ASP A O    1 
ATOM   1338 C CB   . ASP A 1 89  ? 9.888   -13.927 6.747   1.00 65.09  ? 160 ASP A CB   1 
ATOM   1339 C CG   . ASP A 1 89  ? 10.297  -14.726 5.475   1.00 78.70  ? 160 ASP A CG   1 
ATOM   1340 O OD1  . ASP A 1 89  ? 9.908   -15.911 5.343   1.00 83.40  ? 160 ASP A OD1  1 
ATOM   1341 O OD2  . ASP A 1 89  ? 11.009  -14.176 4.600   1.00 85.84  ? 160 ASP A OD2  1 
ATOM   1342 H H    . ASP A 1 89  ? 7.704   -14.990 6.868   1.00 57.03  ? 160 ASP A H    1 
ATOM   1343 H HA   . ASP A 1 89  ? 9.997   -15.587 7.952   1.00 64.53  ? 160 ASP A HA   1 
ATOM   1344 H HB2  . ASP A 1 89  ? 9.179   -13.313 6.500   1.00 78.11  ? 160 ASP A HB2  1 
ATOM   1345 H HB3  . ASP A 1 89  ? 10.664  -13.432 7.053   1.00 78.11  ? 160 ASP A HB3  1 
ATOM   1346 N N    . GLY A 1 90  ? 8.248   -13.560 9.649   1.00 47.07  ? 161 GLY A N    1 
ATOM   1347 C CA   . GLY A 1 90  ? 8.082   -12.924 10.936  1.00 43.32  ? 161 GLY A CA   1 
ATOM   1348 C C    . GLY A 1 90  ? 7.979   -13.871 12.104  1.00 41.55  ? 161 GLY A C    1 
ATOM   1349 O O    . GLY A 1 90  ? 7.766   -13.405 13.231  1.00 40.28  ? 161 GLY A O    1 
ATOM   1350 H H    . GLY A 1 90  ? 7.529   -13.556 9.178   1.00 56.48  ? 161 GLY A H    1 
ATOM   1351 H HA2  . GLY A 1 90  ? 8.836   -12.335 11.095  1.00 51.98  ? 161 GLY A HA2  1 
ATOM   1352 H HA3  . GLY A 1 90  ? 7.277   -12.383 10.918  1.00 51.98  ? 161 GLY A HA3  1 
ATOM   1353 N N    . GLY A 1 91  ? 8.137   -15.182 11.873  1.00 42.16  ? 162 GLY A N    1 
ATOM   1354 C CA   . GLY A 1 91  ? 8.108   -16.171 12.944  1.00 42.71  ? 162 GLY A CA   1 
ATOM   1355 C C    . GLY A 1 91  ? 6.725   -16.570 13.412  1.00 43.48  ? 162 GLY A C    1 
ATOM   1356 O O    . GLY A 1 91  ? 6.593   -17.151 14.497  1.00 44.25  ? 162 GLY A O    1 
ATOM   1357 H H    . GLY A 1 91  ? 8.263   -15.522 11.093  1.00 50.59  ? 162 GLY A H    1 
ATOM   1358 H HA2  . GLY A 1 91  ? 8.564   -16.973 12.643  1.00 51.25  ? 162 GLY A HA2  1 
ATOM   1359 H HA3  . GLY A 1 91  ? 8.592   -15.820 13.708  1.00 51.25  ? 162 GLY A HA3  1 
ATOM   1360 N N    . ALA A 1 92  ? 5.684   -16.295 12.616  1.00 44.58  ? 163 ALA A N    1 
ATOM   1361 C CA   . ALA A 1 92  ? 4.314   -16.426 13.111  1.00 46.26  ? 163 ALA A CA   1 
ATOM   1362 C C    . ALA A 1 92  ? 3.896   -17.869 13.353  1.00 43.64  ? 163 ALA A C    1 
ATOM   1363 O O    . ALA A 1 92  ? 3.064   -18.118 14.227  1.00 44.36  ? 163 ALA A O    1 
ATOM   1364 C CB   . ALA A 1 92  ? 3.334   -15.764 12.141  1.00 48.70  ? 163 ALA A CB   1 
ATOM   1365 H H    . ALA A 1 92  ? 5.745   -16.035 11.799  1.00 53.50  ? 163 ALA A H    1 
ATOM   1366 H HA   . ALA A 1 92  ? 4.248   -15.958 13.958  1.00 55.51  ? 163 ALA A HA   1 
ATOM   1367 H HB1  . ALA A 1 92  ? 2.434   -15.857 12.490  1.00 58.44  ? 163 ALA A HB1  1 
ATOM   1368 H HB2  . ALA A 1 92  ? 3.561   -14.825 12.056  1.00 58.44  ? 163 ALA A HB2  1 
ATOM   1369 H HB3  . ALA A 1 92  ? 3.402   -16.200 11.277  1.00 58.44  ? 163 ALA A HB3  1 
ATOM   1370 N N    . ILE A 1 93  ? 4.433   -18.844 12.609  1.00 41.64  ? 164 ILE A N    1 
ATOM   1371 C CA   . ILE A 1 93  ? 3.909   -20.211 12.705  1.00 42.84  ? 164 ILE A CA   1 
ATOM   1372 C C    . ILE A 1 93  ? 4.079   -20.791 14.105  1.00 43.76  ? 164 ILE A C    1 
ATOM   1373 O O    . ILE A 1 93  ? 3.077   -21.233 14.691  1.00 41.29  ? 164 ILE A O    1 
ATOM   1374 C CB   . ILE A 1 93  ? 4.537   -21.097 11.614  1.00 42.09  ? 164 ILE A CB   1 
ATOM   1375 C CG1  . ILE A 1 93  ? 4.087   -20.650 10.223  1.00 40.62  ? 164 ILE A CG1  1 
ATOM   1376 C CG2  . ILE A 1 93  ? 4.154   -22.554 11.854  1.00 43.68  ? 164 ILE A CG2  1 
ATOM   1377 C CD1  . ILE A 1 93  ? 4.722   -21.424 9.111   1.00 41.13  ? 164 ILE A CD1  1 
ATOM   1378 H H    . ILE A 1 93  ? 5.084   -18.744 12.056  1.00 49.97  ? 164 ILE A H    1 
ATOM   1379 H HA   . ILE A 1 93  ? 2.956   -20.178 12.528  1.00 51.40  ? 164 ILE A HA   1 
ATOM   1380 H HB   . ILE A 1 93  ? 5.500   -21.019 11.653  1.00 50.51  ? 164 ILE A HB   1 
ATOM   1381 H HG12 . ILE A 1 93  ? 3.126   -20.763 10.153  1.00 48.74  ? 164 ILE A HG12 1 
ATOM   1382 H HG13 . ILE A 1 93  ? 4.318   -19.715 10.104  1.00 48.74  ? 164 ILE A HG13 1 
ATOM   1383 H HG21 . ILE A 1 93  ? 4.398   -23.087 11.083  1.00 52.41  ? 164 ILE A HG21 1 
ATOM   1384 H HG22 . ILE A 1 93  ? 4.627   -22.884 12.634  1.00 52.41  ? 164 ILE A HG22 1 
ATOM   1385 H HG23 . ILE A 1 93  ? 3.197   -22.607 12.000  1.00 52.41  ? 164 ILE A HG23 1 
ATOM   1386 H HD11 . ILE A 1 93  ? 4.645   -20.915 8.289   1.00 49.36  ? 164 ILE A HD11 1 
ATOM   1387 H HD12 . ILE A 1 93  ? 5.657   -21.570 9.323   1.00 49.36  ? 164 ILE A HD12 1 
ATOM   1388 H HD13 . ILE A 1 93  ? 4.267   -22.275 9.016   1.00 49.36  ? 164 ILE A HD13 1 
ATOM   1389 N N    . PRO A 1 94  ? 5.286   -20.851 14.686  1.00 48.41  ? 165 PRO A N    1 
ATOM   1390 C CA   . PRO A 1 94  ? 5.401   -21.342 16.074  1.00 48.27  ? 165 PRO A CA   1 
ATOM   1391 C C    . PRO A 1 94  ? 4.488   -20.611 17.036  1.00 44.50  ? 165 PRO A C    1 
ATOM   1392 O O    . PRO A 1 94  ? 3.944   -21.230 17.960  1.00 44.99  ? 165 PRO A O    1 
ATOM   1393 C CB   . PRO A 1 94  ? 6.873   -21.097 16.422  1.00 52.30  ? 165 PRO A CB   1 
ATOM   1394 C CG   . PRO A 1 94  ? 7.578   -20.875 15.162  1.00 55.19  ? 165 PRO A CG   1 
ATOM   1395 C CD   . PRO A 1 94  ? 6.571   -20.403 14.135  1.00 53.23  ? 165 PRO A CD   1 
ATOM   1396 H HA   . PRO A 1 94  ? 5.215   -22.293 16.113  1.00 57.93  ? 165 PRO A HA   1 
ATOM   1397 H HB2  . PRO A 1 94  ? 6.941   -20.313 16.986  1.00 62.76  ? 165 PRO A HB2  1 
ATOM   1398 H HB3  . PRO A 1 94  ? 7.231   -21.875 16.878  1.00 62.76  ? 165 PRO A HB3  1 
ATOM   1399 H HG2  . PRO A 1 94  ? 8.260   -20.198 15.295  1.00 66.23  ? 165 PRO A HG2  1 
ATOM   1400 H HG3  . PRO A 1 94  ? 7.985   -21.706 14.882  1.00 66.23  ? 165 PRO A HG3  1 
ATOM   1401 H HD2  . PRO A 1 94  ? 6.591   -19.438 14.056  1.00 63.88  ? 165 PRO A HD2  1 
ATOM   1402 H HD3  . PRO A 1 94  ? 6.752   -20.833 13.287  1.00 63.88  ? 165 PRO A HD3  1 
ATOM   1403 N N    . ALA A 1 95  ? 4.326   -19.294 16.865  1.00 42.75  ? 166 ALA A N    1 
ATOM   1404 C CA   . ALA A 1 95  ? 3.521   -18.529 17.813  1.00 44.49  ? 166 ALA A CA   1 
ATOM   1405 C C    . ALA A 1 95  ? 2.055   -18.934 17.725  1.00 47.21  ? 166 ALA A C    1 
ATOM   1406 O O    . ALA A 1 95  ? 1.399   -19.133 18.747  1.00 50.94  ? 166 ALA A O    1 
ATOM   1407 C CB   . ALA A 1 95  ? 3.683   -17.033 17.563  1.00 43.59  ? 166 ALA A CB   1 
ATOM   1408 H H    . ALA A 1 95  ? 4.664   -18.833 16.223  1.00 51.30  ? 166 ALA A H    1 
ATOM   1409 H HA   . ALA A 1 95  ? 3.830   -18.717 18.713  1.00 53.39  ? 166 ALA A HA   1 
ATOM   1410 H HB1  . ALA A 1 95  ? 3.141   -16.546 18.203  1.00 52.31  ? 166 ALA A HB1  1 
ATOM   1411 H HB2  . ALA A 1 95  ? 4.617   -16.795 17.671  1.00 52.31  ? 166 ALA A HB2  1 
ATOM   1412 H HB3  . ALA A 1 95  ? 3.392   -16.831 16.660  1.00 52.31  ? 166 ALA A HB3  1 
ATOM   1413 N N    . PHE A 1 96  ? 1.540   -19.129 16.515  1.00 47.50  ? 167 PHE A N    1 
ATOM   1414 C CA   . PHE A 1 96  ? 0.164   -19.596 16.389  1.00 46.13  ? 167 PHE A CA   1 
ATOM   1415 C C    . PHE A 1 96  ? 0.020   -21.000 16.943  1.00 46.18  ? 167 PHE A C    1 
ATOM   1416 O O    . PHE A 1 96  ? -0.939  -21.295 17.665  1.00 45.63  ? 167 PHE A O    1 
ATOM   1417 C CB   . PHE A 1 96  ? -0.287  -19.546 14.936  1.00 44.90  ? 167 PHE A CB   1 
ATOM   1418 C CG   . PHE A 1 96  ? -0.619  -18.170 14.461  1.00 43.55  ? 167 PHE A CG   1 
ATOM   1419 C CD1  . PHE A 1 96  ? -1.582  -17.425 15.094  1.00 45.46  ? 167 PHE A CD1  1 
ATOM   1420 C CD2  . PHE A 1 96  ? 0.013   -17.632 13.365  1.00 41.85  ? 167 PHE A CD2  1 
ATOM   1421 C CE1  . PHE A 1 96  ? -1.899  -16.156 14.641  1.00 45.77  ? 167 PHE A CE1  1 
ATOM   1422 C CE2  . PHE A 1 96  ? -0.301  -16.374 12.925  1.00 41.85  ? 167 PHE A CE2  1 
ATOM   1423 C CZ   . PHE A 1 96  ? -1.256  -15.642 13.562  1.00 43.78  ? 167 PHE A CZ   1 
ATOM   1424 H H    . PHE A 1 96  ? 1.953   -19.003 15.771  1.00 57.00  ? 167 PHE A H    1 
ATOM   1425 H HA   . PHE A 1 96  ? -0.413  -19.015 16.909  1.00 55.35  ? 167 PHE A HA   1 
ATOM   1426 H HB2  . PHE A 1 96  ? 0.425   -19.890 14.375  1.00 53.88  ? 167 PHE A HB2  1 
ATOM   1427 H HB3  . PHE A 1 96  ? -1.080  -20.095 14.835  1.00 53.88  ? 167 PHE A HB3  1 
ATOM   1428 H HD1  . PHE A 1 96  ? -2.025  -17.775 15.833  1.00 54.55  ? 167 PHE A HD1  1 
ATOM   1429 H HD2  . PHE A 1 96  ? 0.666   -18.125 12.923  1.00 50.21  ? 167 PHE A HD2  1 
ATOM   1430 H HE1  . PHE A 1 96  ? -2.549  -15.655 15.078  1.00 54.93  ? 167 PHE A HE1  1 
ATOM   1431 H HE2  . PHE A 1 96  ? 0.137   -16.020 12.185  1.00 50.22  ? 167 PHE A HE2  1 
ATOM   1432 H HZ   . PHE A 1 96  ? -1.466  -14.788 13.259  1.00 52.54  ? 167 PHE A HZ   1 
ATOM   1433 N N    . ILE A 1 97  ? 0.980   -21.870 16.645  1.00 43.17  ? 168 ILE A N    1 
ATOM   1434 C CA   . ILE A 1 97  ? 0.920   -23.225 17.184  1.00 41.95  ? 168 ILE A CA   1 
ATOM   1435 C C    . ILE A 1 97  ? 0.823   -23.189 18.700  1.00 43.94  ? 168 ILE A C    1 
ATOM   1436 O O    . ILE A 1 97  ? 0.025   -23.918 19.287  1.00 42.35  ? 168 ILE A O    1 
ATOM   1437 C CB   . ILE A 1 97  ? 2.119   -24.058 16.702  1.00 41.67  ? 168 ILE A CB   1 
ATOM   1438 C CG1  . ILE A 1 97  ? 1.927   -24.387 15.217  1.00 42.49  ? 168 ILE A CG1  1 
ATOM   1439 C CG2  . ILE A 1 97  ? 2.231   -25.361 17.505  1.00 40.30  ? 168 ILE A CG2  1 
ATOM   1440 C CD1  . ILE A 1 97  ? 3.144   -25.022 14.579  1.00 43.56  ? 168 ILE A CD1  1 
ATOM   1441 H H    . ILE A 1 97  ? 1.661   -21.707 16.146  1.00 51.80  ? 168 ILE A H    1 
ATOM   1442 H HA   . ILE A 1 97  ? 0.116   -23.653 16.851  1.00 50.34  ? 168 ILE A HA   1 
ATOM   1443 H HB   . ILE A 1 97  ? 2.933   -23.542 16.813  1.00 50.01  ? 168 ILE A HB   1 
ATOM   1444 H HG12 . ILE A 1 97  ? 1.186   -25.006 15.126  1.00 50.98  ? 168 ILE A HG12 1 
ATOM   1445 H HG13 . ILE A 1 97  ? 1.733   -23.567 14.736  1.00 50.98  ? 168 ILE A HG13 1 
ATOM   1446 H HG21 . ILE A 1 97  ? 2.843   -25.963 17.056  1.00 48.36  ? 168 ILE A HG21 1 
ATOM   1447 H HG22 . ILE A 1 97  ? 2.566   -25.160 18.393  1.00 48.36  ? 168 ILE A HG22 1 
ATOM   1448 H HG23 . ILE A 1 97  ? 1.353   -25.770 17.566  1.00 48.36  ? 168 ILE A HG23 1 
ATOM   1449 H HD11 . ILE A 1 97  ? 3.053   -24.979 13.614  1.00 52.27  ? 168 ILE A HD11 1 
ATOM   1450 H HD12 . ILE A 1 97  ? 3.932   -24.532 14.859  1.00 52.27  ? 168 ILE A HD12 1 
ATOM   1451 H HD13 . ILE A 1 97  ? 3.209   -25.946 14.865  1.00 52.27  ? 168 ILE A HD13 1 
ATOM   1452 N N    . SER A 1 98  ? 1.620   -22.333 19.356  1.00 46.68  ? 169 SER A N    1 
ATOM   1453 C CA   . SER A 1 98  ? 1.526   -22.186 20.811  1.00 51.19  ? 169 SER A CA   1 
ATOM   1454 C C    . SER A 1 98  ? 0.122   -21.792 21.260  1.00 53.35  ? 169 SER A C    1 
ATOM   1455 O O    . SER A 1 98  ? -0.357  -22.271 22.290  1.00 59.85  ? 169 SER A O    1 
ATOM   1456 C CB   . SER A 1 98  ? 2.521   -21.148 21.309  1.00 53.55  ? 169 SER A CB   1 
ATOM   1457 O OG   . SER A 1 98  ? 3.822   -21.484 20.897  1.00 56.57  ? 169 SER A OG   1 
ATOM   1458 H H    . SER A 1 98  ? 2.214   -21.834 18.985  1.00 56.01  ? 169 SER A H    1 
ATOM   1459 H HA   . SER A 1 98  ? 1.745   -23.034 21.227  1.00 61.43  ? 169 SER A HA   1 
ATOM   1460 H HB2  . SER A 1 98  ? 2.286   -20.281 20.943  1.00 64.26  ? 169 SER A HB2  1 
ATOM   1461 H HB3  . SER A 1 98  ? 2.492   -21.120 22.278  1.00 64.26  ? 169 SER A HB3  1 
ATOM   1462 H HG   . SER A 1 98  ? 3.865   -21.492 20.058  1.00 67.88  ? 169 SER A HG   1 
ATOM   1463 N N    . LEU A 1 99  ? -0.547  -20.906 20.524  1.00 48.72  ? 170 LEU A N    1 
ATOM   1464 C CA   . LEU A 1 99  ? -1.874  -20.451 20.943  1.00 45.62  ? 170 LEU A CA   1 
ATOM   1465 C C    . LEU A 1 99  ? -2.952  -21.502 20.763  1.00 46.97  ? 170 LEU A C    1 
ATOM   1466 O O    . LEU A 1 99  ? -4.052  -21.330 21.294  1.00 45.43  ? 170 LEU A O    1 
ATOM   1467 C CB   . LEU A 1 99  ? -2.292  -19.201 20.172  1.00 45.09  ? 170 LEU A CB   1 
ATOM   1468 C CG   . LEU A 1 99  ? -1.504  -17.954 20.536  1.00 48.74  ? 170 LEU A CG   1 
ATOM   1469 C CD1  . LEU A 1 99  ? -1.918  -16.835 19.627  1.00 49.93  ? 170 LEU A CD1  1 
ATOM   1470 C CD2  . LEU A 1 99  ? -1.723  -17.548 21.963  1.00 51.10  ? 170 LEU A CD2  1 
ATOM   1471 H H    . LEU A 1 99  ? -0.262  -20.558 19.791  1.00 58.46  ? 170 LEU A H    1 
ATOM   1472 H HA   . LEU A 1 99  ? -1.841  -20.227 21.886  1.00 54.74  ? 170 LEU A HA   1 
ATOM   1473 H HB2  . LEU A 1 99  ? -2.167  -19.364 19.224  1.00 54.11  ? 170 LEU A HB2  1 
ATOM   1474 H HB3  . LEU A 1 99  ? -3.228  -19.022 20.353  1.00 54.11  ? 170 LEU A HB3  1 
ATOM   1475 H HG   . LEU A 1 99  ? -0.557  -18.121 20.406  1.00 58.49  ? 170 LEU A HG   1 
ATOM   1476 H HD11 . LEU A 1 99  ? -1.407  -16.041 19.850  1.00 59.92  ? 170 LEU A HD11 1 
ATOM   1477 H HD12 . LEU A 1 99  ? -1.743  -17.094 18.709  1.00 59.92  ? 170 LEU A HD12 1 
ATOM   1478 H HD13 . LEU A 1 99  ? -2.865  -16.664 19.749  1.00 59.92  ? 170 LEU A HD13 1 
ATOM   1479 H HD21 . LEU A 1 99  ? -1.374  -16.652 22.092  1.00 61.33  ? 170 LEU A HD21 1 
ATOM   1480 H HD22 . LEU A 1 99  ? -2.674  -17.563 22.152  1.00 61.33  ? 170 LEU A HD22 1 
ATOM   1481 H HD23 . LEU A 1 99  ? -1.260  -18.170 22.545  1.00 61.33  ? 170 LEU A HD23 1 
ATOM   1482 N N    . LEU A 1 100 ? -2.688  -22.564 20.011  1.00 48.90  ? 171 LEU A N    1 
ATOM   1483 C CA   . LEU A 1 100 ? -3.692  -23.611 19.880  1.00 52.90  ? 171 LEU A CA   1 
ATOM   1484 C C    . LEU A 1 100 ? -4.112  -24.174 21.229  1.00 58.33  ? 171 LEU A C    1 
ATOM   1485 O O    . LEU A 1 100 ? -5.217  -24.707 21.349  1.00 64.72  ? 171 LEU A O    1 
ATOM   1486 C CB   . LEU A 1 100 ? -3.161  -24.730 18.986  1.00 49.87  ? 171 LEU A CB   1 
ATOM   1487 C CG   . LEU A 1 100 ? -2.968  -24.386 17.516  1.00 45.76  ? 171 LEU A CG   1 
ATOM   1488 C CD1  . LEU A 1 100 ? -2.367  -25.582 16.776  1.00 44.32  ? 171 LEU A CD1  1 
ATOM   1489 C CD2  . LEU A 1 100 ? -4.286  -23.982 16.895  1.00 43.59  ? 171 LEU A CD2  1 
ATOM   1490 H H    . LEU A 1 100 ? -1.958  -22.701 19.578  1.00 58.69  ? 171 LEU A H    1 
ATOM   1491 H HA   . LEU A 1 100 ? -4.482  -23.236 19.461  1.00 63.48  ? 171 LEU A HA   1 
ATOM   1492 H HB2  . LEU A 1 100 ? -2.299  -25.012 19.331  1.00 59.85  ? 171 LEU A HB2  1 
ATOM   1493 H HB3  . LEU A 1 100 ? -3.782  -25.474 19.029  1.00 59.85  ? 171 LEU A HB3  1 
ATOM   1494 H HG   . LEU A 1 100 ? -2.353  -23.640 17.439  1.00 54.91  ? 171 LEU A HG   1 
ATOM   1495 H HD11 . LEU A 1 100 ? -2.247  -25.347 15.842  1.00 53.18  ? 171 LEU A HD11 1 
ATOM   1496 H HD12 . LEU A 1 100 ? -1.511  -25.802 17.175  1.00 53.18  ? 171 LEU A HD12 1 
ATOM   1497 H HD13 . LEU A 1 100 ? -2.972  -26.337 16.853  1.00 53.18  ? 171 LEU A HD13 1 
ATOM   1498 H HD21 . LEU A 1 100 ? -4.187  -23.962 15.930  1.00 52.31  ? 171 LEU A HD21 1 
ATOM   1499 H HD22 . LEU A 1 100 ? -4.964  -24.630 17.145  1.00 52.31  ? 171 LEU A HD22 1 
ATOM   1500 H HD23 . LEU A 1 100 ? -4.533  -23.102 17.220  1.00 52.31  ? 171 LEU A HD23 1 
ATOM   1501 N N    . ALA A 1 101 ? -3.267  -24.062 22.242  1.00 52.77  ? 172 ALA A N    1 
ATOM   1502 C CA   . ALA A 1 101 ? -3.563  -24.575 23.573  1.00 55.28  ? 172 ALA A CA   1 
ATOM   1503 C C    . ALA A 1 101 ? -4.125  -23.504 24.507  1.00 59.92  ? 172 ALA A C    1 
ATOM   1504 O O    . ALA A 1 101 ? -4.297  -23.768 25.700  1.00 62.98  ? 172 ALA A O    1 
ATOM   1505 C CB   . ALA A 1 101 ? -2.302  -25.192 24.180  1.00 55.39  ? 172 ALA A CB   1 
ATOM   1506 H H    . ALA A 1 101 ? -2.496  -23.685 22.184  1.00 63.33  ? 172 ALA A H    1 
ATOM   1507 H HA   . ALA A 1 101 ? -4.227  -25.278 23.497  1.00 66.34  ? 172 ALA A HA   1 
ATOM   1508 H HB1  . ALA A 1 101 ? -2.511  -25.530 25.065  1.00 66.47  ? 172 ALA A HB1  1 
ATOM   1509 H HB2  . ALA A 1 101 ? -2.001  -25.917 23.611  1.00 66.47  ? 172 ALA A HB2  1 
ATOM   1510 H HB3  . ALA A 1 101 ? -1.615  -24.510 24.239  1.00 66.47  ? 172 ALA A HB3  1 
ATOM   1511 N N    . SER A 1 102 ? -4.435  -22.319 23.992  1.00 61.25  ? 173 SER A N    1 
ATOM   1512 C CA   . SER A 1 102 ? -4.935  -21.250 24.841  1.00 61.90  ? 173 SER A CA   1 
ATOM   1513 C C    . SER A 1 102 ? -6.221  -21.689 25.533  1.00 66.66  ? 173 SER A C    1 
ATOM   1514 O O    . SER A 1 102 ? -7.082  -22.312 24.901  1.00 62.48  ? 173 SER A O    1 
ATOM   1515 C CB   . SER A 1 102 ? -5.208  -19.978 24.031  1.00 56.05  ? 173 SER A CB   1 
ATOM   1516 O OG   . SER A 1 102 ? -5.784  -18.957 24.845  1.00 53.85  ? 173 SER A OG   1 
ATOM   1517 H H    . SER A 1 102 ? -4.366  -22.110 23.161  1.00 73.50  ? 173 SER A H    1 
ATOM   1518 H HA   . SER A 1 102 ? -4.262  -21.047 25.507  1.00 74.28  ? 173 SER A HA   1 
ATOM   1519 H HB2  . SER A 1 102 ? -4.371  -19.653 23.665  1.00 67.26  ? 173 SER A HB2  1 
ATOM   1520 H HB3  . SER A 1 102 ? -5.823  -20.190 23.311  1.00 67.26  ? 173 SER A HB3  1 
ATOM   1521 H HG   . SER A 1 102 ? -5.926  -18.269 24.385  1.00 64.62  ? 173 SER A HG   1 
ATOM   1522 N N    . PRO A 1 103 ? -6.393  -21.368 26.820  1.00 75.69  ? 174 PRO A N    1 
ATOM   1523 C CA   . PRO A 1 103 ? -7.688  -21.619 27.474  1.00 81.00  ? 174 PRO A CA   1 
ATOM   1524 C C    . PRO A 1 103 ? -8.825  -20.794 26.891  1.00 80.81  ? 174 PRO A C    1 
ATOM   1525 O O    . PRO A 1 103 ? -9.993  -21.145 27.100  1.00 85.35  ? 174 PRO A O    1 
ATOM   1526 C CB   . PRO A 1 103 ? -7.419  -21.232 28.930  1.00 83.66  ? 174 PRO A CB   1 
ATOM   1527 C CG   . PRO A 1 103 ? -6.357  -20.185 28.829  1.00 81.96  ? 174 PRO A CG   1 
ATOM   1528 C CD   . PRO A 1 103 ? -5.481  -20.602 27.685  1.00 78.59  ? 174 PRO A CD   1 
ATOM   1529 H HA   . PRO A 1 103 ? -7.914  -22.561 27.427  1.00 97.21  ? 174 PRO A HA   1 
ATOM   1530 H HB2  . PRO A 1 103 ? -8.225  -20.871 29.331  1.00 100.40 ? 174 PRO A HB2  1 
ATOM   1531 H HB3  . PRO A 1 103 ? -7.100  -22.003 29.424  1.00 100.40 ? 174 PRO A HB3  1 
ATOM   1532 H HG2  . PRO A 1 103 ? -6.766  -19.324 28.649  1.00 98.35  ? 174 PRO A HG2  1 
ATOM   1533 H HG3  . PRO A 1 103 ? -5.849  -20.157 29.655  1.00 98.35  ? 174 PRO A HG3  1 
ATOM   1534 H HD2  . PRO A 1 103 ? -5.145  -19.821 27.217  1.00 94.31  ? 174 PRO A HD2  1 
ATOM   1535 H HD3  . PRO A 1 103 ? -4.759  -21.167 28.000  1.00 94.31  ? 174 PRO A HD3  1 
ATOM   1536 N N    . HIS A 1 104 ? -8.519  -19.710 26.180  1.00 74.48  ? 175 HIS A N    1 
ATOM   1537 C CA   . HIS A 1 104 ? -9.530  -18.877 25.542  1.00 68.92  ? 175 HIS A CA   1 
ATOM   1538 C C    . HIS A 1 104 ? -9.886  -19.473 24.181  1.00 62.64  ? 175 HIS A C    1 
ATOM   1539 O O    . HIS A 1 104 ? -9.093  -19.398 23.241  1.00 61.52  ? 175 HIS A O    1 
ATOM   1540 C CB   . HIS A 1 104 ? -8.999  -17.453 25.399  1.00 71.14  ? 175 HIS A CB   1 
ATOM   1541 C CG   . HIS A 1 104 ? -8.395  -16.894 26.651  1.00 77.13  ? 175 HIS A CG   1 
ATOM   1542 N ND1  . HIS A 1 104 ? -7.040  -16.930 26.904  1.00 80.49  ? 175 HIS A ND1  1 
ATOM   1543 C CD2  . HIS A 1 104 ? -8.956  -16.267 27.711  1.00 79.65  ? 175 HIS A CD2  1 
ATOM   1544 C CE1  . HIS A 1 104 ? -6.792  -16.352 28.065  1.00 83.31  ? 175 HIS A CE1  1 
ATOM   1545 N NE2  . HIS A 1 104 ? -7.938  -15.941 28.575  1.00 82.77  ? 175 HIS A NE2  1 
ATOM   1546 H H    . HIS A 1 104 ? -7.715  -19.433 26.051  1.00 89.38  ? 175 HIS A H    1 
ATOM   1547 H HA   . HIS A 1 104 ? -10.330 -18.856 26.090  1.00 82.70  ? 175 HIS A HA   1 
ATOM   1548 H HB2  . HIS A 1 104 ? -8.316  -17.443 24.711  1.00 85.37  ? 175 HIS A HB2  1 
ATOM   1549 H HB3  . HIS A 1 104 ? -9.731  -16.874 25.143  1.00 85.37  ? 175 HIS A HB3  1 
ATOM   1550 H HD1  . HIS A 1 104 ? -6.447  -17.272 26.383  1.00 80.49  ? 175 HIS A HD1  1 
ATOM   1551 H HD2  . HIS A 1 104 ? -9.860  -16.089 27.831  1.00 95.58  ? 175 HIS A HD2  1 
ATOM   1552 H HE1  . HIS A 1 104 ? -5.955  -16.256 28.458  1.00 99.98  ? 175 HIS A HE1  1 
ATOM   1553 N N    . ALA A 1 105 ? -11.082 -20.053 24.058  1.00 60.07  ? 176 ALA A N    1 
ATOM   1554 C CA   . ALA A 1 105 ? -11.443 -20.747 22.821  1.00 55.33  ? 176 ALA A CA   1 
ATOM   1555 C C    . ALA A 1 105 ? -11.329 -19.842 21.604  1.00 53.62  ? 176 ALA A C    1 
ATOM   1556 O O    . ALA A 1 105 ? -10.874 -20.280 20.539  1.00 52.10  ? 176 ALA A O    1 
ATOM   1557 C CB   . ALA A 1 105 ? -12.859 -21.304 22.912  1.00 53.57  ? 176 ALA A CB   1 
ATOM   1558 H H    . ALA A 1 105 ? -11.692 -20.059 24.664  1.00 72.09  ? 176 ALA A H    1 
ATOM   1559 H HA   . ALA A 1 105 ? -10.837 -21.494 22.693  1.00 66.39  ? 176 ALA A HA   1 
ATOM   1560 H HB1  . ALA A 1 105 ? -13.073 -21.758 22.082  1.00 64.29  ? 176 ALA A HB1  1 
ATOM   1561 H HB2  . ALA A 1 105 ? -12.905 -21.929 23.653  1.00 64.29  ? 176 ALA A HB2  1 
ATOM   1562 H HB3  . ALA A 1 105 ? -13.477 -20.571 23.058  1.00 64.29  ? 176 ALA A HB3  1 
ATOM   1563 N N    . HIS A 1 106 ? -11.742 -18.580 21.731  1.00 54.74  ? 177 HIS A N    1 
ATOM   1564 C CA   . HIS A 1 106 ? -11.761 -17.701 20.561  1.00 52.58  ? 177 HIS A CA   1 
ATOM   1565 C C    . HIS A 1 106 ? -10.354 -17.336 20.096  1.00 51.21  ? 177 HIS A C    1 
ATOM   1566 O O    . HIS A 1 106 ? -10.151 -17.037 18.915  1.00 48.60  ? 177 HIS A O    1 
ATOM   1567 C CB   . HIS A 1 106 ? -12.567 -16.436 20.861  1.00 54.61  ? 177 HIS A CB   1 
ATOM   1568 C CG   . HIS A 1 106 ? -12.058 -15.661 22.034  1.00 59.74  ? 177 HIS A CG   1 
ATOM   1569 N ND1  . HIS A 1 106 ? -12.113 -16.143 23.325  1.00 62.89  ? 177 HIS A ND1  1 
ATOM   1570 C CD2  . HIS A 1 106 ? -11.478 -14.439 22.112  1.00 63.88  ? 177 HIS A CD2  1 
ATOM   1571 C CE1  . HIS A 1 106 ? -11.583 -15.255 24.147  1.00 65.54  ? 177 HIS A CE1  1 
ATOM   1572 N NE2  . HIS A 1 106 ? -11.187 -14.213 23.436  1.00 66.29  ? 177 HIS A NE2  1 
ATOM   1573 H H    . HIS A 1 106 ? -12.015 -18.225 22.462  1.00 65.68  ? 177 HIS A H    1 
ATOM   1574 H HA   . HIS A 1 106 ? -12.201 -18.165 19.832  1.00 63.10  ? 177 HIS A HA   1 
ATOM   1575 H HB2  . HIS A 1 106 ? -12.536 -15.854 20.085  1.00 65.54  ? 177 HIS A HB2  1 
ATOM   1576 H HB3  . HIS A 1 106 ? -13.485 -16.687 21.047  1.00 65.54  ? 177 HIS A HB3  1 
ATOM   1577 H HD2  . HIS A 1 106 ? -11.300 -13.866 21.402  1.00 76.66  ? 177 HIS A HD2  1 
ATOM   1578 H HE1  . HIS A 1 106 ? -11.505 -15.346 25.069  1.00 78.66  ? 177 HIS A HE1  1 
ATOM   1579 H HE2  . HIS A 1 106 ? -10.818 -13.504 23.752  1.00 79.54  ? 177 HIS A HE2  1 
ATOM   1580 N N    . ILE A 1 107 ? -9.378  -17.323 20.998  1.00 53.81  ? 178 ILE A N    1 
ATOM   1581 C CA   . ILE A 1 107 ? -7.993  -17.154 20.567  1.00 53.08  ? 178 ILE A CA   1 
ATOM   1582 C C    . ILE A 1 107 ? -7.516  -18.407 19.852  1.00 48.49  ? 178 ILE A C    1 
ATOM   1583 O O    . ILE A 1 107 ? -6.904  -18.341 18.784  1.00 47.02  ? 178 ILE A O    1 
ATOM   1584 C CB   . ILE A 1 107 ? -7.089  -16.816 21.766  1.00 58.39  ? 178 ILE A CB   1 
ATOM   1585 C CG1  . ILE A 1 107 ? -7.402  -15.400 22.262  1.00 63.56  ? 178 ILE A CG1  1 
ATOM   1586 C CG2  . ILE A 1 107 ? -5.599  -16.951 21.377  1.00 57.03  ? 178 ILE A CG2  1 
ATOM   1587 C CD1  . ILE A 1 107 ? -6.676  -15.014 23.540  1.00 68.46  ? 178 ILE A CD1  1 
ATOM   1588 H H    . ILE A 1 107 ? -9.486  -17.408 21.847  1.00 64.57  ? 178 ILE A H    1 
ATOM   1589 H HA   . ILE A 1 107 ? -7.946  -16.415 19.940  1.00 63.70  ? 178 ILE A HA   1 
ATOM   1590 H HB   . ILE A 1 107 ? -7.279  -17.443 22.482  1.00 70.07  ? 178 ILE A HB   1 
ATOM   1591 H HG12 . ILE A 1 107 ? -7.146  -14.766 21.574  1.00 76.27  ? 178 ILE A HG12 1 
ATOM   1592 H HG13 . ILE A 1 107 ? -8.355  -15.333 22.432  1.00 76.27  ? 178 ILE A HG13 1 
ATOM   1593 H HG21 . ILE A 1 107 ? -5.050  -16.533 22.057  1.00 68.44  ? 178 ILE A HG21 1 
ATOM   1594 H HG22 . ILE A 1 107 ? -5.371  -17.891 21.310  1.00 68.44  ? 178 ILE A HG22 1 
ATOM   1595 H HG23 . ILE A 1 107 ? -5.456  -16.513 20.523  1.00 68.44  ? 178 ILE A HG23 1 
ATOM   1596 H HD11 . ILE A 1 107 ? -7.059  -14.188 23.873  1.00 82.15  ? 178 ILE A HD11 1 
ATOM   1597 H HD12 . ILE A 1 107 ? -6.790  -15.721 24.195  1.00 82.15  ? 178 ILE A HD12 1 
ATOM   1598 H HD13 . ILE A 1 107 ? -5.734  -14.887 23.347  1.00 82.15  ? 178 ILE A HD13 1 
ATOM   1599 N N    . SER A 1 108 ? -7.786  -19.568 20.430  1.00 47.61  ? 179 SER A N    1 
ATOM   1600 C CA   . SER A 1 108 ? -7.387  -20.802 19.783  1.00 47.87  ? 179 SER A CA   1 
ATOM   1601 C C    . SER A 1 108 ? -7.999  -20.902 18.386  1.00 47.83  ? 179 SER A C    1 
ATOM   1602 O O    . SER A 1 108 ? -7.313  -21.244 17.420  1.00 46.18  ? 179 SER A O    1 
ATOM   1603 C CB   . SER A 1 108 ? -7.793  -21.989 20.660  1.00 52.33  ? 179 SER A CB   1 
ATOM   1604 O OG   . SER A 1 108 ? -7.570  -23.203 19.966  1.00 54.07  ? 179 SER A OG   1 
ATOM   1605 H H    . SER A 1 108 ? -8.191  -19.666 21.182  1.00 57.14  ? 179 SER A H    1 
ATOM   1606 H HA   . SER A 1 108 ? -6.422  -20.813 19.690  1.00 57.44  ? 179 SER A HA   1 
ATOM   1607 H HB2  . SER A 1 108 ? -7.260  -21.983 21.470  1.00 62.80  ? 179 SER A HB2  1 
ATOM   1608 H HB3  . SER A 1 108 ? -8.735  -21.916 20.879  1.00 62.80  ? 179 SER A HB3  1 
ATOM   1609 H HG   . SER A 1 108 ? -8.110  -23.274 19.327  1.00 64.89  ? 179 SER A HG   1 
ATOM   1610 N N    . GLU A 1 109 ? -9.284  -20.579 18.256  1.00 48.99  ? 180 GLU A N    1 
ATOM   1611 C CA   . GLU A 1 109 ? -9.928  -20.621 16.947  1.00 48.63  ? 180 GLU A CA   1 
ATOM   1612 C C    . GLU A 1 109 ? -9.224  -19.707 15.963  1.00 43.87  ? 180 GLU A C    1 
ATOM   1613 O O    . GLU A 1 109 ? -9.035  -20.067 14.801  1.00 44.05  ? 180 GLU A O    1 
ATOM   1614 C CB   . GLU A 1 109 ? -11.405 -20.228 17.065  1.00 55.76  ? 180 GLU A CB   1 
ATOM   1615 C CG   . GLU A 1 109 ? -12.152 -20.211 15.734  1.00 63.72  ? 180 GLU A CG   1 
ATOM   1616 C CD   . GLU A 1 109 ? -13.661 -19.963 15.902  1.00 73.40  ? 180 GLU A CD   1 
ATOM   1617 O OE1  . GLU A 1 109 ? -14.103 -19.789 17.060  1.00 77.68  ? 180 GLU A OE1  1 
ATOM   1618 O OE2  . GLU A 1 109 ? -14.400 -19.939 14.880  1.00 76.01  ? 180 GLU A OE2  1 
ATOM   1619 H H    . GLU A 1 109 ? -9.798  -20.336 18.901  1.00 58.79  ? 180 GLU A H    1 
ATOM   1620 H HA   . GLU A 1 109 ? -9.883  -21.525 16.600  1.00 58.35  ? 180 GLU A HA   1 
ATOM   1621 H HB2  . GLU A 1 109 ? -11.852 -20.857 17.651  1.00 66.91  ? 180 GLU A HB2  1 
ATOM   1622 H HB3  . GLU A 1 109 ? -11.458 -19.336 17.442  1.00 66.91  ? 180 GLU A HB3  1 
ATOM   1623 H HG2  . GLU A 1 109 ? -11.795 -19.501 15.177  1.00 76.46  ? 180 GLU A HG2  1 
ATOM   1624 H HG3  . GLU A 1 109 ? -12.036 -21.068 15.295  1.00 76.46  ? 180 GLU A HG3  1 
ATOM   1625 N N    . GLN A 1 110 ? -8.849  -18.512 16.395  1.00 42.35  ? 181 GLN A N    1 
ATOM   1626 C CA   . GLN A 1 110 ? -8.233  -17.582 15.460  1.00 43.98  ? 181 GLN A CA   1 
ATOM   1627 C C    . GLN A 1 110 ? -6.847  -18.069 15.021  1.00 42.39  ? 181 GLN A C    1 
ATOM   1628 O O    . GLN A 1 110 ? -6.442  -17.839 13.873  1.00 41.77  ? 181 GLN A O    1 
ATOM   1629 C CB   . GLN A 1 110 ? -8.158  -16.185 16.088  1.00 48.01  ? 181 GLN A CB   1 
ATOM   1630 C CG   . GLN A 1 110 ? -7.814  -15.097 15.087  1.00 49.83  ? 181 GLN A CG   1 
ATOM   1631 C CD   . GLN A 1 110 ? -8.876  -14.969 13.997  1.00 51.20  ? 181 GLN A CD   1 
ATOM   1632 O OE1  . GLN A 1 110 ? -10.058 -14.818 14.290  1.00 52.16  ? 181 GLN A OE1  1 
ATOM   1633 N NE2  . GLN A 1 110 ? -8.455  -15.030 12.742  1.00 50.79  ? 181 GLN A NE2  1 
ATOM   1634 H H    . GLN A 1 110 ? -8.936  -18.221 17.199  1.00 50.82  ? 181 GLN A H    1 
ATOM   1635 H HA   . GLN A 1 110 ? -8.790  -17.528 14.669  1.00 52.78  ? 181 GLN A HA   1 
ATOM   1636 H HB2  . GLN A 1 110 ? -9.019  -15.969 16.479  1.00 57.61  ? 181 GLN A HB2  1 
ATOM   1637 H HB3  . GLN A 1 110 ? -7.474  -16.185 16.775  1.00 57.61  ? 181 GLN A HB3  1 
ATOM   1638 H HG2  . GLN A 1 110 ? -7.752  -14.247 15.550  1.00 59.79  ? 181 GLN A HG2  1 
ATOM   1639 H HG3  . GLN A 1 110 ? -6.968  -15.309 14.662  1.00 59.79  ? 181 GLN A HG3  1 
ATOM   1640 H HE21 . GLN A 1 110 ? -7.619  -15.140 12.574  1.00 60.94  ? 181 GLN A HE21 1 
ATOM   1641 H HE22 . GLN A 1 110 ? -9.018  -14.959 12.096  1.00 60.94  ? 181 GLN A HE22 1 
ATOM   1642 N N    . ALA A 1 111 ? -6.136  -18.785 15.895  1.00 42.94  ? 182 ALA A N    1 
ATOM   1643 C CA   . ALA A 1 111 ? -4.855  -19.371 15.503  1.00 43.20  ? 182 ALA A CA   1 
ATOM   1644 C C    . ALA A 1 111 ? -5.046  -20.513 14.508  1.00 42.20  ? 182 ALA A C    1 
ATOM   1645 O O    . ALA A 1 111 ? -4.234  -20.692 13.588  1.00 40.75  ? 182 ALA A O    1 
ATOM   1646 C CB   . ALA A 1 111 ? -4.103  -19.867 16.739  1.00 46.16  ? 182 ALA A CB   1 
ATOM   1647 H H    . ALA A 1 111 ? -6.369  -18.944 16.707  1.00 51.53  ? 182 ALA A H    1 
ATOM   1648 H HA   . ALA A 1 111 ? -4.313  -18.689 15.076  1.00 51.85  ? 182 ALA A HA   1 
ATOM   1649 H HB1  . ALA A 1 111 ? -3.257  -20.252 16.460  1.00 55.39  ? 182 ALA A HB1  1 
ATOM   1650 H HB2  . ALA A 1 111 ? -3.946  -19.117 17.334  1.00 55.39  ? 182 ALA A HB2  1 
ATOM   1651 H HB3  . ALA A 1 111 ? -4.641  -20.539 17.187  1.00 55.39  ? 182 ALA A HB3  1 
ATOM   1652 N N    . VAL A 1 112 ? -6.085  -21.323 14.703  1.00 42.61  ? 183 VAL A N    1 
ATOM   1653 C CA   . VAL A 1 112 ? -6.431  -22.348 13.716  1.00 42.62  ? 183 VAL A CA   1 
ATOM   1654 C C    . VAL A 1 112 ? -6.686  -21.710 12.359  1.00 40.58  ? 183 VAL A C    1 
ATOM   1655 O O    . VAL A 1 112 ? -6.234  -22.202 11.314  1.00 39.62  ? 183 VAL A O    1 
ATOM   1656 C CB   . VAL A 1 112 ? -7.657  -23.138 14.189  1.00 46.78  ? 183 VAL A CB   1 
ATOM   1657 C CG1  . VAL A 1 112 ? -8.127  -24.097 13.099  1.00 47.25  ? 183 VAL A CG1  1 
ATOM   1658 C CG2  . VAL A 1 112 ? -7.320  -23.882 15.471  1.00 47.75  ? 183 VAL A CG2  1 
ATOM   1659 H H    . VAL A 1 112 ? -6.602  -21.301 15.390  1.00 51.13  ? 183 VAL A H    1 
ATOM   1660 H HA   . VAL A 1 112 ? -5.689  -22.966 13.625  1.00 51.15  ? 183 VAL A HA   1 
ATOM   1661 H HB   . VAL A 1 112 ? -8.380  -22.520 14.380  1.00 56.13  ? 183 VAL A HB   1 
ATOM   1662 H HG11 . VAL A 1 112 ? -8.711  -24.761 13.497  1.00 56.70  ? 183 VAL A HG11 1 
ATOM   1663 H HG12 . VAL A 1 112 ? -8.610  -23.598 12.422  1.00 56.70  ? 183 VAL A HG12 1 
ATOM   1664 H HG13 . VAL A 1 112 ? -7.354  -24.531 12.706  1.00 56.70  ? 183 VAL A HG13 1 
ATOM   1665 H HG21 . VAL A 1 112 ? -8.110  -24.353 15.778  1.00 57.30  ? 183 VAL A HG21 1 
ATOM   1666 H HG22 . VAL A 1 112 ? -6.608  -24.515 15.289  1.00 57.30  ? 183 VAL A HG22 1 
ATOM   1667 H HG23 . VAL A 1 112 ? -7.033  -23.246 16.144  1.00 57.30  ? 183 VAL A HG23 1 
ATOM   1668 N N    . TRP A 1 113 ? -7.447  -20.621 12.354  1.00 40.18  ? 184 TRP A N    1 
ATOM   1669 C CA   . TRP A 1 113 ? -7.760  -19.942 11.100  1.00 38.34  ? 184 TRP A CA   1 
ATOM   1670 C C    . TRP A 1 113 ? -6.481  -19.420 10.436  1.00 39.62  ? 184 TRP A C    1 
ATOM   1671 O O    . TRP A 1 113 ? -6.229  -19.693 9.262   1.00 38.10  ? 184 TRP A O    1 
ATOM   1672 C CB   . TRP A 1 113 ? -8.777  -18.831 11.392  1.00 40.38  ? 184 TRP A CB   1 
ATOM   1673 C CG   . TRP A 1 113 ? -9.372  -18.115 10.238  1.00 43.53  ? 184 TRP A CG   1 
ATOM   1674 C CD1  . TRP A 1 113 ? -8.841  -17.936 8.994   1.00 47.37  ? 184 TRP A CD1  1 
ATOM   1675 C CD2  . TRP A 1 113 ? -10.633 -17.429 10.237  1.00 44.90  ? 184 TRP A CD2  1 
ATOM   1676 N NE1  . TRP A 1 113 ? -9.687  -17.174 8.223   1.00 49.22  ? 184 TRP A NE1  1 
ATOM   1677 C CE2  . TRP A 1 113 ? -10.794 -16.851 8.966   1.00 47.50  ? 184 TRP A CE2  1 
ATOM   1678 C CE3  . TRP A 1 113 ? -11.639 -17.251 11.195  1.00 44.64  ? 184 TRP A CE3  1 
ATOM   1679 C CZ2  . TRP A 1 113 ? -11.930 -16.122 8.620   1.00 46.82  ? 184 TRP A CZ2  1 
ATOM   1680 C CZ3  . TRP A 1 113 ? -12.751 -16.519 10.862  1.00 45.49  ? 184 TRP A CZ3  1 
ATOM   1681 C CH2  . TRP A 1 113 ? -12.890 -15.960 9.587   1.00 46.21  ? 184 TRP A CH2  1 
ATOM   1682 H H    . TRP A 1 113 ? -7.791  -20.258 13.053  1.00 48.22  ? 184 TRP A H    1 
ATOM   1683 H HA   . TRP A 1 113 ? -8.175  -20.575 10.493  1.00 46.01  ? 184 TRP A HA   1 
ATOM   1684 H HB2  . TRP A 1 113 ? -9.511  -19.222 11.891  1.00 48.45  ? 184 TRP A HB2  1 
ATOM   1685 H HB3  . TRP A 1 113 ? -8.340  -18.164 11.944  1.00 48.45  ? 184 TRP A HB3  1 
ATOM   1686 H HD1  . TRP A 1 113 ? -8.016  -18.261 8.715   1.00 56.84  ? 184 TRP A HD1  1 
ATOM   1687 H HE1  . TRP A 1 113 ? -9.549  -16.946 7.405   1.00 59.07  ? 184 TRP A HE1  1 
ATOM   1688 H HE3  . TRP A 1 113 ? -11.548 -17.610 12.048  1.00 53.56  ? 184 TRP A HE3  1 
ATOM   1689 H HZ2  . TRP A 1 113 ? -12.028 -15.751 7.773   1.00 56.19  ? 184 TRP A HZ2  1 
ATOM   1690 H HZ3  . TRP A 1 113 ? -13.423 -16.394 11.493  1.00 54.59  ? 184 TRP A HZ3  1 
ATOM   1691 H HH2  . TRP A 1 113 ? -13.659 -15.477 9.386   1.00 55.45  ? 184 TRP A HH2  1 
ATOM   1692 N N    . ALA A 1 114 ? -5.639  -18.706 11.190  1.00 41.32  ? 185 ALA A N    1 
ATOM   1693 C CA   . ALA A 1 114 ? -4.383  -18.191 10.637  1.00 41.49  ? 185 ALA A CA   1 
ATOM   1694 C C    . ALA A 1 114 ? -3.537  -19.301 10.032  1.00 40.58  ? 185 ALA A C    1 
ATOM   1695 O O    . ALA A 1 114 ? -2.958  -19.138 8.952   1.00 39.72  ? 185 ALA A O    1 
ATOM   1696 C CB   . ALA A 1 114 ? -3.581  -17.473 11.719  1.00 42.67  ? 185 ALA A CB   1 
ATOM   1697 H H    . ALA A 1 114 ? -5.770  -18.508 12.016  1.00 49.58  ? 185 ALA A H    1 
ATOM   1698 H HA   . ALA A 1 114 ? -4.584  -17.551 9.937   1.00 49.79  ? 185 ALA A HA   1 
ATOM   1699 H HB1  . ALA A 1 114 ? -2.773  -17.110 11.324  1.00 51.20  ? 185 ALA A HB1  1 
ATOM   1700 H HB2  . ALA A 1 114 ? -4.119  -16.757 12.090  1.00 51.20  ? 185 ALA A HB2  1 
ATOM   1701 H HB3  . ALA A 1 114 ? -3.353  -18.109 12.415  1.00 51.20  ? 185 ALA A HB3  1 
ATOM   1702 N N    . LEU A 1 115 ? -3.432  -20.430 10.724  1.00 39.35  ? 186 LEU A N    1 
ATOM   1703 C CA   . LEU A 1 115 ? -2.630  -21.523 10.196  1.00 39.13  ? 186 LEU A CA   1 
ATOM   1704 C C    . LEU A 1 115 ? -3.259  -22.094 8.939   1.00 41.34  ? 186 LEU A C    1 
ATOM   1705 O O    . LEU A 1 115 ? -2.548  -22.510 8.023   1.00 40.49  ? 186 LEU A O    1 
ATOM   1706 C CB   . LEU A 1 115 ? -2.450  -22.618 11.253  1.00 40.01  ? 186 LEU A CB   1 
ATOM   1707 C CG   . LEU A 1 115 ? -1.582  -22.269 12.469  1.00 42.43  ? 186 LEU A CG   1 
ATOM   1708 C CD1  . LEU A 1 115 ? -1.849  -23.237 13.609  1.00 45.64  ? 186 LEU A CD1  1 
ATOM   1709 C CD2  . LEU A 1 115 ? -0.093  -22.267 12.141  1.00 42.70  ? 186 LEU A CD2  1 
ATOM   1710 H H    . LEU A 1 115 ? -3.806  -20.585 11.483  1.00 47.22  ? 186 LEU A H    1 
ATOM   1711 H HA   . LEU A 1 115 ? -1.751  -21.185 9.963   1.00 46.96  ? 186 LEU A HA   1 
ATOM   1712 H HB2  . LEU A 1 115 ? -3.327  -22.862 11.588  1.00 48.01  ? 186 LEU A HB2  1 
ATOM   1713 H HB3  . LEU A 1 115 ? -2.046  -23.388 10.824  1.00 48.01  ? 186 LEU A HB3  1 
ATOM   1714 H HG   . LEU A 1 115 ? -1.818  -21.379 12.775  1.00 50.92  ? 186 LEU A HG   1 
ATOM   1715 H HD11 . LEU A 1 115 ? -1.284  -23.002 14.361  1.00 54.77  ? 186 LEU A HD11 1 
ATOM   1716 H HD12 . LEU A 1 115 ? -2.783  -23.174 13.864  1.00 54.77  ? 186 LEU A HD12 1 
ATOM   1717 H HD13 . LEU A 1 115 ? -1.647  -24.138 13.312  1.00 54.77  ? 186 LEU A HD13 1 
ATOM   1718 H HD21 . LEU A 1 115 ? 0.406   -22.042 12.942  1.00 51.24  ? 186 LEU A HD21 1 
ATOM   1719 H HD22 . LEU A 1 115 ? 0.162   -23.149 11.829  1.00 51.24  ? 186 LEU A HD22 1 
ATOM   1720 H HD23 . LEU A 1 115 ? 0.077   -21.609 11.449  1.00 51.24  ? 186 LEU A HD23 1 
ATOM   1721 N N    . GLY A 1 116 ? -4.584  -22.096 8.867   1.00 42.94  ? 187 GLY A N    1 
ATOM   1722 C CA   . GLY A 1 116 ? -5.233  -22.488 7.629   1.00 44.07  ? 187 GLY A CA   1 
ATOM   1723 C C    . GLY A 1 116 ? -4.833  -21.615 6.456   1.00 41.28  ? 187 GLY A C    1 
ATOM   1724 O O    . GLY A 1 116 ? -4.605  -22.115 5.350   1.00 40.76  ? 187 GLY A O    1 
ATOM   1725 H H    . GLY A 1 116 ? -5.118  -21.880 9.506   1.00 51.53  ? 187 GLY A H    1 
ATOM   1726 H HA2  . GLY A 1 116 ? -5.000  -23.406 7.420   1.00 52.88  ? 187 GLY A HA2  1 
ATOM   1727 H HA3  . GLY A 1 116 ? -6.195  -22.434 7.739   1.00 52.88  ? 187 GLY A HA3  1 
ATOM   1728 N N    . ASN A 1 117 ? -4.754  -20.291 6.668   1.00 39.94  ? 188 ASN A N    1 
ATOM   1729 C CA   . ASN A 1 117 ? -4.360  -19.422 5.560   1.00 39.29  ? 188 ASN A CA   1 
ATOM   1730 C C    . ASN A 1 117 ? -2.911  -19.656 5.159   1.00 40.21  ? 188 ASN A C    1 
ATOM   1731 O O    . ASN A 1 117 ? -2.565  -19.577 3.973   1.00 38.05  ? 188 ASN A O    1 
ATOM   1732 C CB   . ASN A 1 117 ? -4.568  -17.954 5.932   1.00 41.58  ? 188 ASN A CB   1 
ATOM   1733 C CG   . ASN A 1 117 ? -5.994  -17.552 5.851   1.00 42.97  ? 188 ASN A CG   1 
ATOM   1734 O OD1  . ASN A 1 117 ? -6.791  -18.226 5.191   1.00 46.01  ? 188 ASN A OD1  1 
ATOM   1735 N ND2  . ASN A 1 117 ? -6.348  -16.447 6.519   1.00 41.13  ? 188 ASN A ND2  1 
ATOM   1736 H H    . ASN A 1 117 ? -4.917  -19.891 7.412   1.00 47.93  ? 188 ASN A H    1 
ATOM   1737 H HA   . ASN A 1 117 ? -4.915  -19.621 4.790   1.00 47.15  ? 188 ASN A HA   1 
ATOM   1738 H HB2  . ASN A 1 117 ? -4.265  -17.811 6.842   1.00 49.90  ? 188 ASN A HB2  1 
ATOM   1739 H HB3  . ASN A 1 117 ? -4.062  -17.396 5.320   1.00 49.90  ? 188 ASN A HB3  1 
ATOM   1740 H HD21 . ASN A 1 117 ? -7.164  -16.176 6.501   1.00 49.36  ? 188 ASN A HD21 1 
ATOM   1741 H HD22 . ASN A 1 117 ? -5.759  -16.008 6.967   1.00 49.36  ? 188 ASN A HD22 1 
ATOM   1742 N N    . ILE A 1 118 ? -2.044  -19.901 6.138   1.00 40.21  ? 189 ILE A N    1 
ATOM   1743 C CA   . ILE A 1 118 ? -0.633  -20.125 5.836   1.00 40.21  ? 189 ILE A CA   1 
ATOM   1744 C C    . ILE A 1 118 ? -0.472  -21.412 5.049   1.00 41.12  ? 189 ILE A C    1 
ATOM   1745 O O    . ILE A 1 118 ? 0.171   -21.434 3.997   1.00 39.99  ? 189 ILE A O    1 
ATOM   1746 C CB   . ILE A 1 118 ? 0.194   -20.140 7.132   1.00 39.74  ? 189 ILE A CB   1 
ATOM   1747 C CG1  . ILE A 1 118 ? 0.208   -18.733 7.734   1.00 40.22  ? 189 ILE A CG1  1 
ATOM   1748 C CG2  . ILE A 1 118 ? 1.586   -20.635 6.835   1.00 38.23  ? 189 ILE A CG2  1 
ATOM   1749 C CD1  . ILE A 1 118 ? 0.839   -18.651 9.121   1.00 42.06  ? 189 ILE A CD1  1 
ATOM   1750 H H    . ILE A 1 118 ? -2.243  -19.942 6.974   1.00 48.25  ? 189 ILE A H    1 
ATOM   1751 H HA   . ILE A 1 118 ? -0.310  -19.396 5.284   1.00 48.25  ? 189 ILE A HA   1 
ATOM   1752 H HB   . ILE A 1 118 ? -0.225  -20.746 7.763   1.00 47.69  ? 189 ILE A HB   1 
ATOM   1753 H HG12 . ILE A 1 118 ? 0.711   -18.148 7.146   1.00 48.27  ? 189 ILE A HG12 1 
ATOM   1754 H HG13 . ILE A 1 118 ? -0.706  -18.416 7.807   1.00 48.27  ? 189 ILE A HG13 1 
ATOM   1755 H HG21 . ILE A 1 118 ? 2.175   -20.388 7.564   1.00 45.88  ? 189 ILE A HG21 1 
ATOM   1756 H HG22 . ILE A 1 118 ? 1.568   -21.601 6.744   1.00 45.88  ? 189 ILE A HG22 1 
ATOM   1757 H HG23 . ILE A 1 118 ? 1.896   -20.228 6.011   1.00 45.88  ? 189 ILE A HG23 1 
ATOM   1758 H HD11 . ILE A 1 118 ? 0.635   -17.786 9.509   1.00 50.47  ? 189 ILE A HD11 1 
ATOM   1759 H HD12 . ILE A 1 118 ? 0.472   -19.357 9.676   1.00 50.47  ? 189 ILE A HD12 1 
ATOM   1760 H HD13 . ILE A 1 118 ? 1.799   -18.759 9.040   1.00 50.47  ? 189 ILE A HD13 1 
ATOM   1761 N N    . ALA A 1 119 ? -1.062  -22.502 5.548   1.00 41.97  ? 190 ALA A N    1 
ATOM   1762 C CA   . ALA A 1 119 ? -0.963  -23.776 4.849   1.00 44.00  ? 190 ALA A CA   1 
ATOM   1763 C C    . ALA A 1 119 ? -1.618  -23.706 3.477   1.00 44.89  ? 190 ALA A C    1 
ATOM   1764 O O    . ALA A 1 119 ? -1.159  -24.363 2.532   1.00 46.31  ? 190 ALA A O    1 
ATOM   1765 C CB   . ALA A 1 119 ? -1.584  -24.880 5.707   1.00 44.17  ? 190 ALA A CB   1 
ATOM   1766 H H    . ALA A 1 119 ? -1.517  -22.527 6.277   1.00 50.36  ? 190 ALA A H    1 
ATOM   1767 H HA   . ALA A 1 119 ? -0.026  -23.991 4.720   1.00 52.80  ? 190 ALA A HA   1 
ATOM   1768 H HB1  . ALA A 1 119 ? -1.514  -25.724 5.234   1.00 53.01  ? 190 ALA A HB1  1 
ATOM   1769 H HB2  . ALA A 1 119 ? -1.106  -24.931 6.549   1.00 53.01  ? 190 ALA A HB2  1 
ATOM   1770 H HB3  . ALA A 1 119 ? -2.517  -24.667 5.868   1.00 53.01  ? 190 ALA A HB3  1 
ATOM   1771 N N    . GLY A 1 120 ? -2.663  -22.889 3.334   1.00 43.67  ? 191 GLY A N    1 
ATOM   1772 C CA   . GLY A 1 120 ? -3.381  -22.798 2.070   1.00 46.51  ? 191 GLY A CA   1 
ATOM   1773 C C    . GLY A 1 120 ? -2.601  -22.127 0.961   1.00 49.16  ? 191 GLY A C    1 
ATOM   1774 O O    . GLY A 1 120 ? -3.060  -22.120 -0.192  1.00 49.03  ? 191 GLY A O    1 
ATOM   1775 H H    . GLY A 1 120 ? -2.973  -22.380 3.954   1.00 52.41  ? 191 GLY A H    1 
ATOM   1776 H HA2  . GLY A 1 120 ? -3.617  -23.691 1.774   1.00 55.81  ? 191 GLY A HA2  1 
ATOM   1777 H HA3  . GLY A 1 120 ? -4.201  -22.298 2.206   1.00 55.81  ? 191 GLY A HA3  1 
ATOM   1778 N N    . ASP A 1 121 ? -1.434  -21.564 1.282   1.00 52.37  ? 192 ASP A N    1 
ATOM   1779 C CA   . ASP A 1 121 ? -0.642  -20.916 0.251   1.00 53.68  ? 192 ASP A CA   1 
ATOM   1780 C C    . ASP A 1 121 ? -0.006  -21.916 -0.704  1.00 53.16  ? 192 ASP A C    1 
ATOM   1781 O O    . ASP A 1 121 ? 0.197   -21.592 -1.873  1.00 54.61  ? 192 ASP A O    1 
ATOM   1782 C CB   . ASP A 1 121 ? 0.453   -20.055 0.862   1.00 56.09  ? 192 ASP A CB   1 
ATOM   1783 C CG   . ASP A 1 121 ? 1.207   -19.281 -0.201  1.00 61.68  ? 192 ASP A CG   1 
ATOM   1784 O OD1  . ASP A 1 121 ? 0.650   -18.279 -0.703  1.00 62.19  ? 192 ASP A OD1  1 
ATOM   1785 O OD2  . ASP A 1 121 ? 2.326   -19.702 -0.572  1.00 65.83  ? 192 ASP A OD2  1 
ATOM   1786 H H    . ASP A 1 121 ? -1.090  -21.545 2.070   1.00 62.84  ? 192 ASP A H    1 
ATOM   1787 H HA   . ASP A 1 121 ? -1.220  -20.336 -0.269  1.00 64.42  ? 192 ASP A HA   1 
ATOM   1788 H HB2  . ASP A 1 121 ? 0.055   -19.419 1.477   1.00 67.31  ? 192 ASP A HB2  1 
ATOM   1789 H HB3  . ASP A 1 121 ? 1.084   -20.624 1.329   1.00 67.31  ? 192 ASP A HB3  1 
ATOM   1790 N N    . GLY A 1 122 ? 0.329   -23.108 -0.241  1.00 49.66  ? 193 GLY A N    1 
ATOM   1791 C CA   . GLY A 1 122 ? 0.995   -24.063 -1.100  1.00 48.31  ? 193 GLY A CA   1 
ATOM   1792 C C    . GLY A 1 122 ? 1.728   -25.130 -0.316  1.00 45.49  ? 193 GLY A C    1 
ATOM   1793 O O    . GLY A 1 122 ? 1.778   -25.119 0.920   1.00 44.73  ? 193 GLY A O    1 
ATOM   1794 H H    . GLY A 1 122 ? 0.183   -23.385 0.560   1.00 59.59  ? 193 GLY A H    1 
ATOM   1795 H HA2  . GLY A 1 122 ? 0.341   -24.496 -1.671  1.00 57.98  ? 193 GLY A HA2  1 
ATOM   1796 H HA3  . GLY A 1 122 ? 1.636   -23.601 -1.662  1.00 57.98  ? 193 GLY A HA3  1 
ATOM   1797 N N    . SER A 1 123 ? 2.303   -26.063 -1.084  1.00 46.22  ? 194 SER A N    1 
ATOM   1798 C CA   . SER A 1 123 ? 3.017   -27.187 -0.497  1.00 48.48  ? 194 SER A CA   1 
ATOM   1799 C C    . SER A 1 123 ? 4.111   -26.710 0.439   1.00 46.26  ? 194 SER A C    1 
ATOM   1800 O O    . SER A 1 123 ? 4.278   -27.255 1.538   1.00 44.54  ? 194 SER A O    1 
ATOM   1801 C CB   . SER A 1 123 ? 3.620   -28.069 -1.590  1.00 55.46  ? 194 SER A CB   1 
ATOM   1802 O OG   . SER A 1 123 ? 2.606   -28.611 -2.416  1.00 60.07  ? 194 SER A OG   1 
ATOM   1803 H H    . SER A 1 123 ? 2.291   -26.063 -1.944  1.00 55.46  ? 194 SER A H    1 
ATOM   1804 H HA   . SER A 1 123 ? 2.394   -27.726 0.016   1.00 58.18  ? 194 SER A HA   1 
ATOM   1805 H HB2  . SER A 1 123 ? 4.222   -27.536 -2.133  1.00 66.56  ? 194 SER A HB2  1 
ATOM   1806 H HB3  . SER A 1 123 ? 4.104   -28.796 -1.169  1.00 66.56  ? 194 SER A HB3  1 
ATOM   1807 H HG   . SER A 1 123 ? 2.948   -29.093 -3.012  1.00 72.08  ? 194 SER A HG   1 
ATOM   1808 N N    . ALA A 1 124 ? 4.876   -25.700 0.015   1.00 45.93  ? 195 ALA A N    1 
ATOM   1809 C CA   . ALA A 1 124 ? 6.026   -25.273 0.801   1.00 44.96  ? 195 ALA A CA   1 
ATOM   1810 C C    . ALA A 1 124 ? 5.598   -24.815 2.189   1.00 45.47  ? 195 ALA A C    1 
ATOM   1811 O O    . ALA A 1 124 ? 6.136   -25.279 3.200   1.00 43.09  ? 195 ALA A O    1 
ATOM   1812 C CB   . ALA A 1 124 ? 6.778   -24.167 0.069   1.00 44.39  ? 195 ALA A CB   1 
ATOM   1813 H H    . ALA A 1 124 ? 4.751   -25.256 -0.711  1.00 55.12  ? 195 ALA A H    1 
ATOM   1814 H HA   . ALA A 1 124 ? 6.630   -26.024 0.908   1.00 53.95  ? 195 ALA A HA   1 
ATOM   1815 H HB1  . ALA A 1 124 ? 7.544   -23.901 0.602   1.00 53.27  ? 195 ALA A HB1  1 
ATOM   1816 H HB2  . ALA A 1 124 ? 7.074   -24.503 -0.791  1.00 53.27  ? 195 ALA A HB2  1 
ATOM   1817 H HB3  . ALA A 1 124 ? 6.183   -23.411 -0.058  1.00 53.27  ? 195 ALA A HB3  1 
ATOM   1818 N N    . PHE A 1 125 ? 4.602   -23.928 2.262   1.00 48.81  ? 196 PHE A N    1 
ATOM   1819 C CA   . PHE A 1 125 ? 4.193   -23.415 3.565   1.00 49.00  ? 196 PHE A CA   1 
ATOM   1820 C C    . PHE A 1 125 ? 3.406   -24.458 4.337   1.00 47.11  ? 196 PHE A C    1 
ATOM   1821 O O    . PHE A 1 125 ? 3.412   -24.449 5.572   1.00 45.93  ? 196 PHE A O    1 
ATOM   1822 C CB   . PHE A 1 125 ? 3.366   -22.143 3.400   1.00 51.35  ? 196 PHE A CB   1 
ATOM   1823 C CG   . PHE A 1 125 ? 4.170   -20.914 3.029   1.00 56.49  ? 196 PHE A CG   1 
ATOM   1824 C CD1  . PHE A 1 125 ? 5.550   -20.944 2.966   1.00 61.54  ? 196 PHE A CD1  1 
ATOM   1825 C CD2  . PHE A 1 125 ? 3.528   -19.717 2.756   1.00 57.69  ? 196 PHE A CD2  1 
ATOM   1826 C CE1  . PHE A 1 125 ? 6.271   -19.807 2.617   1.00 64.45  ? 196 PHE A CE1  1 
ATOM   1827 C CE2  . PHE A 1 125 ? 4.240   -18.578 2.404   1.00 60.55  ? 196 PHE A CE2  1 
ATOM   1828 C CZ   . PHE A 1 125 ? 5.610   -18.625 2.333   1.00 63.66  ? 196 PHE A CZ   1 
ATOM   1829 H H    . PHE A 1 125 ? 4.161   -23.617 1.592   1.00 58.57  ? 196 PHE A H    1 
ATOM   1830 H HA   . PHE A 1 125 ? 4.981   -23.212 4.092   1.00 58.80  ? 196 PHE A HA   1 
ATOM   1831 H HB2  . PHE A 1 125 ? 2.710   -22.288 2.700   1.00 61.63  ? 196 PHE A HB2  1 
ATOM   1832 H HB3  . PHE A 1 125 ? 2.913   -21.957 4.237   1.00 61.63  ? 196 PHE A HB3  1 
ATOM   1833 H HD1  . PHE A 1 125 ? 6.006   -21.734 3.145   1.00 73.84  ? 196 PHE A HD1  1 
ATOM   1834 H HD2  . PHE A 1 125 ? 2.599   -19.680 2.792   1.00 69.23  ? 196 PHE A HD2  1 
ATOM   1835 H HE1  . PHE A 1 125 ? 7.199   -19.842 2.573   1.00 77.33  ? 196 PHE A HE1  1 
ATOM   1836 H HE2  . PHE A 1 125 ? 3.790   -17.785 2.220   1.00 72.65  ? 196 PHE A HE2  1 
ATOM   1837 H HZ   . PHE A 1 125 ? 6.092   -17.863 2.107   1.00 76.40  ? 196 PHE A HZ   1 
ATOM   1838 N N    . ARG A 1 126 ? 2.712   -25.351 3.630   1.00 45.95  ? 197 ARG A N    1 
ATOM   1839 C CA   . ARG A 1 126 ? 2.034   -26.454 4.295   1.00 46.41  ? 197 ARG A CA   1 
ATOM   1840 C C    . ARG A 1 126 ? 3.031   -27.313 5.054   1.00 45.73  ? 197 ARG A C    1 
ATOM   1841 O O    . ARG A 1 126 ? 2.783   -27.699 6.201   1.00 44.68  ? 197 ARG A O    1 
ATOM   1842 C CB   . ARG A 1 126 ? 1.269   -27.286 3.268   1.00 48.72  ? 197 ARG A CB   1 
ATOM   1843 C CG   . ARG A 1 126 ? 0.571   -28.517 3.817   1.00 50.79  ? 197 ARG A CG   1 
ATOM   1844 C CD   . ARG A 1 126 ? 1.242   -29.778 3.320   1.00 53.18  ? 197 ARG A CD   1 
ATOM   1845 N NE   . ARG A 1 126 ? 1.027   -29.908 1.895   1.00 54.70  ? 197 ARG A NE   1 
ATOM   1846 C CZ   . ARG A 1 126 ? 1.838   -30.508 1.034   1.00 57.10  ? 197 ARG A CZ   1 
ATOM   1847 N NH1  . ARG A 1 126 ? 2.975   -31.064 1.405   1.00 57.21  ? 197 ARG A NH1  1 
ATOM   1848 N NH2  . ARG A 1 126 ? 1.498   -30.535 -0.230  1.00 57.88  ? 197 ARG A NH2  1 
ATOM   1849 H H    . ARG A 1 126 ? 2.621   -25.338 2.775   1.00 55.14  ? 197 ARG A H    1 
ATOM   1850 H HA   . ARG A 1 126 ? 1.395   -26.098 4.932   1.00 55.70  ? 197 ARG A HA   1 
ATOM   1851 H HB2  . ARG A 1 126 ? 0.591   -26.724 2.862   1.00 58.47  ? 197 ARG A HB2  1 
ATOM   1852 H HB3  . ARG A 1 126 ? 1.894   -27.582 2.588   1.00 58.47  ? 197 ARG A HB3  1 
ATOM   1853 H HG2  . ARG A 1 126 ? 0.610   -28.509 4.786   1.00 60.95  ? 197 ARG A HG2  1 
ATOM   1854 H HG3  . ARG A 1 126 ? -0.351  -28.524 3.517   1.00 60.95  ? 197 ARG A HG3  1 
ATOM   1855 H HD2  . ARG A 1 126 ? 2.195   -29.726 3.490   1.00 63.81  ? 197 ARG A HD2  1 
ATOM   1856 H HD3  . ARG A 1 126 ? 0.857   -30.550 3.764   1.00 63.81  ? 197 ARG A HD3  1 
ATOM   1857 H HE   . ARG A 1 126 ? 0.306   -29.564 1.577   1.00 65.64  ? 197 ARG A HE   1 
ATOM   1858 H HH11 . ARG A 1 126 ? 3.212   -31.052 2.231   1.00 68.65  ? 197 ARG A HH11 1 
ATOM   1859 H HH12 . ARG A 1 126 ? 3.478   -31.444 0.820   1.00 68.65  ? 197 ARG A HH12 1 
ATOM   1860 H HH21 . ARG A 1 126 ? 0.760   -30.175 -0.484  1.00 69.46  ? 197 ARG A HH21 1 
ATOM   1861 H HH22 . ARG A 1 126 ? 2.010   -30.918 -0.805  1.00 69.46  ? 197 ARG A HH22 1 
ATOM   1862 N N    . ASP A 1 127 ? 4.193   -27.589 4.447   1.00 46.22  ? 198 ASP A N    1 
ATOM   1863 C CA   . ASP A 1 127 ? 5.167   -28.450 5.111   1.00 47.91  ? 198 ASP A CA   1 
ATOM   1864 C C    . ASP A 1 127 ? 5.844   -27.722 6.262   1.00 43.36  ? 198 ASP A C    1 
ATOM   1865 O O    . ASP A 1 127 ? 6.102   -28.323 7.310   1.00 42.59  ? 198 ASP A O    1 
ATOM   1866 C CB   . ASP A 1 127 ? 6.173   -28.965 4.099   1.00 56.15  ? 198 ASP A CB   1 
ATOM   1867 C CG   . ASP A 1 127 ? 5.562   -30.016 3.160   1.00 66.42  ? 198 ASP A CG   1 
ATOM   1868 O OD1  . ASP A 1 127 ? 4.542   -30.648 3.541   1.00 65.67  ? 198 ASP A OD1  1 
ATOM   1869 O OD2  . ASP A 1 127 ? 6.092   -30.207 2.041   1.00 76.19  ? 198 ASP A OD2  1 
ATOM   1870 H H    . ASP A 1 127 ? 4.432   -27.298 3.674   1.00 55.46  ? 198 ASP A H    1 
ATOM   1871 H HA   . ASP A 1 127 ? 4.702   -29.216 5.483   1.00 57.49  ? 198 ASP A HA   1 
ATOM   1872 H HB2  . ASP A 1 127 ? 6.488   -28.224 3.558   1.00 67.38  ? 198 ASP A HB2  1 
ATOM   1873 H HB3  . ASP A 1 127 ? 6.916   -29.375 4.569   1.00 67.38  ? 198 ASP A HB3  1 
ATOM   1874 N N    . LEU A 1 128 ? 6.084   -26.417 6.124   1.00 44.57  ? 199 LEU A N    1 
ATOM   1875 C CA   . LEU A 1 128 ? 6.532   -25.657 7.284   1.00 48.12  ? 199 LEU A CA   1 
ATOM   1876 C C    . LEU A 1 128 ? 5.583   -25.866 8.455   1.00 47.25  ? 199 LEU A C    1 
ATOM   1877 O O    . LEU A 1 128 ? 6.015   -26.169 9.575   1.00 48.88  ? 199 LEU A O    1 
ATOM   1878 C CB   . LEU A 1 128 ? 6.641   -24.171 6.950   1.00 54.09  ? 199 LEU A CB   1 
ATOM   1879 C CG   . LEU A 1 128 ? 8.029   -23.634 6.636   1.00 62.01  ? 199 LEU A CG   1 
ATOM   1880 C CD1  . LEU A 1 128 ? 8.694   -24.440 5.534   1.00 68.04  ? 199 LEU A CD1  1 
ATOM   1881 C CD2  . LEU A 1 128 ? 7.919   -22.179 6.217   1.00 61.94  ? 199 LEU A CD2  1 
ATOM   1882 H H    . LEU A 1 128 ? 5.999   -25.966 5.397   1.00 53.48  ? 199 LEU A H    1 
ATOM   1883 H HA   . LEU A 1 128 ? 7.410   -25.972 7.549   1.00 57.74  ? 199 LEU A HA   1 
ATOM   1884 H HB2  . LEU A 1 128 ? 6.084   -23.993 6.176   1.00 64.91  ? 199 LEU A HB2  1 
ATOM   1885 H HB3  . LEU A 1 128 ? 6.305   -23.667 7.707   1.00 64.91  ? 199 LEU A HB3  1 
ATOM   1886 H HG   . LEU A 1 128 ? 8.583   -23.684 7.431   1.00 74.41  ? 199 LEU A HG   1 
ATOM   1887 H HD11 . LEU A 1 128 ? 9.526   -24.008 5.287   1.00 81.65  ? 199 LEU A HD11 1 
ATOM   1888 H HD12 . LEU A 1 128 ? 8.871   -25.336 5.859   1.00 81.65  ? 199 LEU A HD12 1 
ATOM   1889 H HD13 . LEU A 1 128 ? 8.100   -24.476 4.768   1.00 81.65  ? 199 LEU A HD13 1 
ATOM   1890 H HD21 . LEU A 1 128 ? 8.805   -21.842 6.011   1.00 74.33  ? 199 LEU A HD21 1 
ATOM   1891 H HD22 . LEU A 1 128 ? 7.351   -22.119 5.433   1.00 74.33  ? 199 LEU A HD22 1 
ATOM   1892 H HD23 . LEU A 1 128 ? 7.532   -21.670 6.946   1.00 74.33  ? 199 LEU A HD23 1 
ATOM   1893 N N    . VAL A 1 129 ? 4.273   -25.719 8.207   1.00 46.17  ? 200 VAL A N    1 
ATOM   1894 C CA   . VAL A 1 129 ? 3.308   -25.790 9.300   1.00 43.46  ? 200 VAL A CA   1 
ATOM   1895 C C    . VAL A 1 129 ? 3.360   -27.163 9.953   1.00 46.43  ? 200 VAL A C    1 
ATOM   1896 O O    . VAL A 1 129 ? 3.239   -27.294 11.175  1.00 46.89  ? 200 VAL A O    1 
ATOM   1897 C CB   . VAL A 1 129 ? 1.891   -25.462 8.786   1.00 40.75  ? 200 VAL A CB   1 
ATOM   1898 C CG1  . VAL A 1 129 ? 0.857   -25.855 9.794   1.00 37.18  ? 200 VAL A CG1  1 
ATOM   1899 C CG2  . VAL A 1 129 ? 1.775   -24.000 8.491   1.00 39.56  ? 200 VAL A CG2  1 
ATOM   1900 H H    . VAL A 1 129 ? 3.929   -25.581 7.431   1.00 55.40  ? 200 VAL A H    1 
ATOM   1901 H HA   . VAL A 1 129 ? 3.543   -25.130 9.971   1.00 52.15  ? 200 VAL A HA   1 
ATOM   1902 H HB   . VAL A 1 129 ? 1.723   -25.954 7.967   1.00 48.90  ? 200 VAL A HB   1 
ATOM   1903 H HG11 . VAL A 1 129 ? 0.030   -25.389 9.593   1.00 44.61  ? 200 VAL A HG11 1 
ATOM   1904 H HG12 . VAL A 1 129 ? 0.713   -26.813 9.748   1.00 44.61  ? 200 VAL A HG12 1 
ATOM   1905 H HG13 . VAL A 1 129 ? 1.167   -25.606 10.679  1.00 44.61  ? 200 VAL A HG13 1 
ATOM   1906 H HG21 . VAL A 1 129 ? 0.893   -23.819 8.131   1.00 47.48  ? 200 VAL A HG21 1 
ATOM   1907 H HG22 . VAL A 1 129 ? 1.906   -23.501 9.312   1.00 47.48  ? 200 VAL A HG22 1 
ATOM   1908 H HG23 . VAL A 1 129 ? 2.453   -23.755 7.842   1.00 47.48  ? 200 VAL A HG23 1 
ATOM   1909 N N    . ILE A 1 130 ? 3.524   -28.206 9.139   1.00 44.82  ? 201 ILE A N    1 
ATOM   1910 C CA   . ILE A 1 130 ? 3.618   -29.559 9.661   1.00 46.38  ? 201 ILE A CA   1 
ATOM   1911 C C    . ILE A 1 130 ? 4.933   -29.758 10.409  1.00 48.25  ? 201 ILE A C    1 
ATOM   1912 O O    . ILE A 1 130 ? 4.966   -30.427 11.447  1.00 48.52  ? 201 ILE A O    1 
ATOM   1913 C CB   . ILE A 1 130 ? 3.447   -30.561 8.505   1.00 48.72  ? 201 ILE A CB   1 
ATOM   1914 C CG1  . ILE A 1 130 ? 1.996   -30.570 8.028   1.00 50.35  ? 201 ILE A CG1  1 
ATOM   1915 C CG2  . ILE A 1 130 ? 3.849   -31.955 8.927   1.00 49.42  ? 201 ILE A CG2  1 
ATOM   1916 C CD1  . ILE A 1 130 ? 1.817   -31.232 6.661   1.00 52.54  ? 201 ILE A CD1  1 
ATOM   1917 H H    . ILE A 1 130 ? 3.583   -28.152 8.283   1.00 53.79  ? 201 ILE A H    1 
ATOM   1918 H HA   . ILE A 1 130 ? 2.894   -29.704 10.290  1.00 55.65  ? 201 ILE A HA   1 
ATOM   1919 H HB   . ILE A 1 130 ? 4.014   -30.284 7.768   1.00 58.46  ? 201 ILE A HB   1 
ATOM   1920 H HG12 . ILE A 1 130 ? 1.457   -31.059 8.669   1.00 60.42  ? 201 ILE A HG12 1 
ATOM   1921 H HG13 . ILE A 1 130 ? 1.680   -29.655 7.960   1.00 60.42  ? 201 ILE A HG13 1 
ATOM   1922 H HG21 . ILE A 1 130 ? 3.512   -32.594 8.281   1.00 59.30  ? 201 ILE A HG21 1 
ATOM   1923 H HG22 . ILE A 1 130 ? 4.817   -32.009 8.965   1.00 59.30  ? 201 ILE A HG22 1 
ATOM   1924 H HG23 . ILE A 1 130 ? 3.471   -32.141 9.801   1.00 59.30  ? 201 ILE A HG23 1 
ATOM   1925 H HD11 . ILE A 1 130 ? 0.920   -31.051 6.339   1.00 63.05  ? 201 ILE A HD11 1 
ATOM   1926 H HD12 . ILE A 1 130 ? 2.470   -30.864 6.045   1.00 63.05  ? 201 ILE A HD12 1 
ATOM   1927 H HD13 . ILE A 1 130 ? 1.949   -32.188 6.751   1.00 63.05  ? 201 ILE A HD13 1 
ATOM   1928 N N    . LYS A 1 131 ? 6.032   -29.182 9.902   1.00 50.41  ? 202 LYS A N    1 
ATOM   1929 C CA   . LYS A 1 131 ? 7.338   -29.344 10.552  1.00 55.29  ? 202 LYS A CA   1 
ATOM   1930 C C    . LYS A 1 131 ? 7.372   -28.697 11.934  1.00 53.60  ? 202 LYS A C    1 
ATOM   1931 O O    . LYS A 1 131 ? 7.968   -29.240 12.866  1.00 56.35  ? 202 LYS A O    1 
ATOM   1932 C CB   . LYS A 1 131 ? 8.451   -28.747 9.693   1.00 63.55  ? 202 LYS A CB   1 
ATOM   1933 C CG   . LYS A 1 131 ? 8.880   -29.586 8.525   1.00 74.21  ? 202 LYS A CG   1 
ATOM   1934 C CD   . LYS A 1 131 ? 10.230  -29.082 8.003   1.00 85.12  ? 202 LYS A CD   1 
ATOM   1935 C CE   . LYS A 1 131 ? 10.680  -29.817 6.744   1.00 93.17  ? 202 LYS A CE   1 
ATOM   1936 N NZ   . LYS A 1 131 ? 9.811   -29.496 5.570   1.00 96.05  ? 202 LYS A NZ   1 
ATOM   1937 H H    . LYS A 1 131 ? 6.047   -28.698 9.191   1.00 60.49  ? 202 LYS A H    1 
ATOM   1938 H HA   . LYS A 1 131 ? 7.520   -30.291 10.661  1.00 66.35  ? 202 LYS A HA   1 
ATOM   1939 H HB2  . LYS A 1 131 ? 8.146   -27.895 9.343   1.00 76.26  ? 202 LYS A HB2  1 
ATOM   1940 H HB3  . LYS A 1 131 ? 9.230   -28.607 10.253  1.00 76.26  ? 202 LYS A HB3  1 
ATOM   1941 H HG2  . LYS A 1 131 ? 8.981   -30.509 8.806   1.00 89.06  ? 202 LYS A HG2  1 
ATOM   1942 H HG3  . LYS A 1 131 ? 8.226   -29.514 7.813   1.00 89.06  ? 202 LYS A HG3  1 
ATOM   1943 H HD2  . LYS A 1 131 ? 10.155  -28.139 7.790   1.00 102.15 ? 202 LYS A HD2  1 
ATOM   1944 H HD3  . LYS A 1 131 ? 10.905  -29.216 8.687   1.00 102.15 ? 202 LYS A HD3  1 
ATOM   1945 H HE2  . LYS A 1 131 ? 11.589  -29.554 6.529   1.00 111.80 ? 202 LYS A HE2  1 
ATOM   1946 H HE3  . LYS A 1 131 ? 10.636  -30.773 6.900   1.00 111.80 ? 202 LYS A HE3  1 
ATOM   1947 H HZ1  . LYS A 1 131 ? 10.097  -29.935 4.851   1.00 115.25 ? 202 LYS A HZ1  1 
ATOM   1948 H HZ2  . LYS A 1 131 ? 8.971   -29.735 5.740   1.00 115.25 ? 202 LYS A HZ2  1 
ATOM   1949 H HZ3  . LYS A 1 131 ? 9.835   -28.622 5.404   1.00 115.25 ? 202 LYS A HZ3  1 
ATOM   1950 N N    . HIS A 1 132 ? 6.781   -27.524 12.079  1.00 51.35  ? 203 HIS A N    1 
ATOM   1951 C CA   . HIS A 1 132 ? 6.672   -26.926 13.401  1.00 49.77  ? 203 HIS A CA   1 
ATOM   1952 C C    . HIS A 1 132 ? 5.754   -27.706 14.340  1.00 50.34  ? 203 HIS A C    1 
ATOM   1953 O O    . HIS A 1 132 ? 5.560   -27.260 15.468  1.00 49.45  ? 203 HIS A O    1 
ATOM   1954 C CB   . HIS A 1 132 ? 6.168   -25.487 13.282  1.00 49.92  ? 203 HIS A CB   1 
ATOM   1955 C CG   . HIS A 1 132 ? 7.174   -24.536 12.721  1.00 50.84  ? 203 HIS A CG   1 
ATOM   1956 N ND1  . HIS A 1 132 ? 8.059   -23.835 13.515  1.00 50.91  ? 203 HIS A ND1  1 
ATOM   1957 C CD2  . HIS A 1 132 ? 7.432   -24.161 11.446  1.00 50.36  ? 203 HIS A CD2  1 
ATOM   1958 C CE1  . HIS A 1 132 ? 8.815   -23.067 12.753  1.00 49.78  ? 203 HIS A CE1  1 
ATOM   1959 N NE2  . HIS A 1 132 ? 8.458   -23.250 11.494  1.00 49.09  ? 203 HIS A NE2  1 
ATOM   1960 H H    . HIS A 1 132 ? 6.439   -27.059 11.442  1.00 61.62  ? 203 HIS A H    1 
ATOM   1961 H HA   . HIS A 1 132 ? 7.554   -26.899 13.804  1.00 59.72  ? 203 HIS A HA   1 
ATOM   1962 H HB2  . HIS A 1 132 ? 5.390   -25.473 12.703  1.00 59.90  ? 203 HIS A HB2  1 
ATOM   1963 H HB3  . HIS A 1 132 ? 5.928   -25.170 14.166  1.00 59.90  ? 203 HIS A HB3  1 
ATOM   1964 H HD2  . HIS A 1 132 ? 6.997   -24.463 10.682  1.00 60.43  ? 203 HIS A HD2  1 
ATOM   1965 H HE1  . HIS A 1 132 ? 9.491   -22.501 13.051  1.00 59.74  ? 203 HIS A HE1  1 
ATOM   1966 H HE2  . HIS A 1 132 ? 8.811   -22.860 10.814  1.00 58.91  ? 203 HIS A HE2  1 
ATOM   1967 N N    . GLY A 1 133 ? 5.167   -28.821 13.912  1.00 49.20  ? 204 GLY A N    1 
ATOM   1968 C CA   . GLY A 1 133 ? 4.362   -29.646 14.798  1.00 53.21  ? 204 GLY A CA   1 
ATOM   1969 C C    . GLY A 1 133 ? 2.919   -29.211 14.990  1.00 55.00  ? 204 GLY A C    1 
ATOM   1970 O O    . GLY A 1 133 ? 2.385   -29.308 16.104  1.00 60.26  ? 204 GLY A O    1 
ATOM   1971 H H    . GLY A 1 133 ? 5.216   -29.120 13.108  1.00 59.04  ? 204 GLY A H    1 
ATOM   1972 H HA2  . GLY A 1 133 ? 4.353   -30.553 14.454  1.00 63.85  ? 204 GLY A HA2  1 
ATOM   1973 H HA3  . GLY A 1 133 ? 4.783   -29.664 15.672  1.00 63.85  ? 204 GLY A HA3  1 
ATOM   1974 N N    . ALA A 1 134 ? 2.249   -28.753 13.930  1.00 52.81  ? 205 ALA A N    1 
ATOM   1975 C CA   . ALA A 1 134 ? 0.884   -28.260 14.103  1.00 48.12  ? 205 ALA A CA   1 
ATOM   1976 C C    . ALA A 1 134 ? -0.142  -29.378 14.263  1.00 48.57  ? 205 ALA A C    1 
ATOM   1977 O O    . ALA A 1 134 ? -1.169  -29.164 14.915  1.00 49.42  ? 205 ALA A O    1 
ATOM   1978 C CB   . ALA A 1 134 ? 0.483   -27.371 12.930  1.00 45.58  ? 205 ALA A CB   1 
ATOM   1979 H H    . ALA A 1 134 ? 2.551   -28.718 13.126  1.00 63.37  ? 205 ALA A H    1 
ATOM   1980 H HA   . ALA A 1 134 ? 0.852   -27.717 14.906  1.00 57.75  ? 205 ALA A HA   1 
ATOM   1981 H HB1  . ALA A 1 134 ? -0.424  -27.057 13.068  1.00 54.69  ? 205 ALA A HB1  1 
ATOM   1982 H HB2  . ALA A 1 134 ? 1.091   -26.617 12.884  1.00 54.69  ? 205 ALA A HB2  1 
ATOM   1983 H HB3  . ALA A 1 134 ? 0.534   -27.888 12.111  1.00 54.69  ? 205 ALA A HB3  1 
ATOM   1984 N N    . ILE A 1 135 ? 0.110   -30.564 13.702  1.00 46.35  ? 206 ILE A N    1 
ATOM   1985 C CA   . ILE A 1 135 ? -0.936  -31.584 13.627  1.00 49.32  ? 206 ILE A CA   1 
ATOM   1986 C C    . ILE A 1 135 ? -1.348  -32.055 15.017  1.00 52.72  ? 206 ILE A C    1 
ATOM   1987 O O    . ILE A 1 135 ? -2.540  -32.229 15.293  1.00 54.79  ? 206 ILE A O    1 
ATOM   1988 C CB   . ILE A 1 135 ? -0.485  -32.760 12.743  1.00 52.74  ? 206 ILE A CB   1 
ATOM   1989 C CG1  . ILE A 1 135 ? -0.358  -32.287 11.309  1.00 54.55  ? 206 ILE A CG1  1 
ATOM   1990 C CG2  . ILE A 1 135 ? -1.511  -33.901 12.785  1.00 53.97  ? 206 ILE A CG2  1 
ATOM   1991 C CD1  . ILE A 1 135 ? 0.120   -33.357 10.326  1.00 58.01  ? 206 ILE A CD1  1 
ATOM   1992 H H    . ILE A 1 135 ? 0.865   -30.799 13.363  1.00 55.62  ? 206 ILE A H    1 
ATOM   1993 H HA   . ILE A 1 135 ? -1.718  -31.191 13.210  1.00 59.18  ? 206 ILE A HA   1 
ATOM   1994 H HB   . ILE A 1 135 ? 0.374   -33.086 13.053  1.00 63.29  ? 206 ILE A HB   1 
ATOM   1995 H HG12 . ILE A 1 135 ? -1.226  -31.977 11.007  1.00 65.46  ? 206 ILE A HG12 1 
ATOM   1996 H HG13 . ILE A 1 135 ? 0.278   -31.556 11.278  1.00 65.46  ? 206 ILE A HG13 1 
ATOM   1997 H HG21 . ILE A 1 135 ? -1.225  -34.614 12.195  1.00 64.76  ? 206 ILE A HG21 1 
ATOM   1998 H HG22 . ILE A 1 135 ? -1.576  -34.245 13.689  1.00 64.76  ? 206 ILE A HG22 1 
ATOM   1999 H HG23 . ILE A 1 135 ? -2.372  -33.560 12.498  1.00 64.76  ? 206 ILE A HG23 1 
ATOM   2000 H HD11 . ILE A 1 135 ? 0.328   -32.933 9.479   1.00 69.62  ? 206 ILE A HD11 1 
ATOM   2001 H HD12 . ILE A 1 135 ? 0.914   -33.782 10.686  1.00 69.62  ? 206 ILE A HD12 1 
ATOM   2002 H HD13 . ILE A 1 135 ? -0.579  -34.016 10.202  1.00 69.62  ? 206 ILE A HD13 1 
ATOM   2003 N N    . ASP A 1 136 ? -0.386  -32.302 15.905  1.00 53.19  ? 207 ASP A N    1 
ATOM   2004 C CA   . ASP A 1 136 ? -0.739  -32.823 17.226  1.00 57.61  ? 207 ASP A CA   1 
ATOM   2005 C C    . ASP A 1 136 ? -1.702  -31.907 17.961  1.00 50.24  ? 207 ASP A C    1 
ATOM   2006 O O    . ASP A 1 136 ? -2.784  -32.368 18.365  1.00 48.10  ? 207 ASP A O    1 
ATOM   2007 C CB   . ASP A 1 136 ? 0.524   -33.066 18.053  1.00 71.04  ? 207 ASP A CB   1 
ATOM   2008 C CG   . ASP A 1 136 ? 1.165   -34.399 17.750  1.00 87.29  ? 207 ASP A CG   1 
ATOM   2009 O OD1  . ASP A 1 136 ? 0.424   -35.330 17.378  1.00 92.24  ? 207 ASP A OD1  1 
ATOM   2010 O OD2  . ASP A 1 136 ? 2.403   -34.523 17.884  1.00 95.81  ? 207 ASP A OD2  1 
ATOM   2011 H H    . ASP A 1 136 ? 0.455   -32.181 15.774  1.00 63.82  ? 207 ASP A H    1 
ATOM   2012 H HA   . ASP A 1 136 ? -1.188  -33.674 17.110  1.00 69.14  ? 207 ASP A HA   1 
ATOM   2013 H HB2  . ASP A 1 136 ? 1.173   -32.373 17.855  1.00 85.25  ? 207 ASP A HB2  1 
ATOM   2014 H HB3  . ASP A 1 136 ? 0.295   -33.049 18.995  1.00 85.25  ? 207 ASP A HB3  1 
ATOM   2015 N N    . PRO A 1 137 ? -1.379  -30.633 18.194  1.00 50.12  ? 208 PRO A N    1 
ATOM   2016 C CA   . PRO A 1 137 ? -2.312  -29.786 18.949  1.00 50.77  ? 208 PRO A CA   1 
ATOM   2017 C C    . PRO A 1 137 ? -3.636  -29.580 18.235  1.00 54.33  ? 208 PRO A C    1 
ATOM   2018 O O    . PRO A 1 137 ? -4.663  -29.434 18.904  1.00 56.14  ? 208 PRO A O    1 
ATOM   2019 C CB   . PRO A 1 137 ? -1.535  -28.473 19.124  1.00 48.58  ? 208 PRO A CB   1 
ATOM   2020 C CG   . PRO A 1 137 ? -0.403  -28.539 18.156  1.00 46.90  ? 208 PRO A CG   1 
ATOM   2021 C CD   . PRO A 1 137 ? -0.078  -29.982 17.987  1.00 47.36  ? 208 PRO A CD   1 
ATOM   2022 H HA   . PRO A 1 137 ? -2.480  -30.173 19.822  1.00 60.92  ? 208 PRO A HA   1 
ATOM   2023 H HB2  . PRO A 1 137 ? -2.115  -27.723 18.920  1.00 58.29  ? 208 PRO A HB2  1 
ATOM   2024 H HB3  . PRO A 1 137 ? -1.203  -28.411 20.033  1.00 58.29  ? 208 PRO A HB3  1 
ATOM   2025 H HG2  . PRO A 1 137 ? -0.678  -28.152 17.310  1.00 56.27  ? 208 PRO A HG2  1 
ATOM   2026 H HG3  . PRO A 1 137 ? 0.359   -28.060 18.517  1.00 56.27  ? 208 PRO A HG3  1 
ATOM   2027 H HD2  . PRO A 1 137 ? 0.251   -30.151 17.091  1.00 56.83  ? 208 PRO A HD2  1 
ATOM   2028 H HD3  . PRO A 1 137 ? 0.557   -30.268 18.662  1.00 56.83  ? 208 PRO A HD3  1 
ATOM   2029 N N    . LEU A 1 138 ? -3.647  -29.584 16.900  1.00 55.30  ? 209 LEU A N    1 
ATOM   2030 C CA   . LEU A 1 138 ? -4.905  -29.482 16.169  1.00 56.09  ? 209 LEU A CA   1 
ATOM   2031 C C    . LEU A 1 138 ? -5.789  -30.685 16.450  1.00 58.10  ? 209 LEU A C    1 
ATOM   2032 O O    . LEU A 1 138 ? -6.967  -30.540 16.790  1.00 61.00  ? 209 LEU A O    1 
ATOM   2033 C CB   . LEU A 1 138 ? -4.634  -29.362 14.665  1.00 55.72  ? 209 LEU A CB   1 
ATOM   2034 C CG   . LEU A 1 138 ? -4.063  -28.031 14.194  1.00 57.13  ? 209 LEU A CG   1 
ATOM   2035 C CD1  . LEU A 1 138 ? -3.517  -28.165 12.793  1.00 59.24  ? 209 LEU A CD1  1 
ATOM   2036 C CD2  . LEU A 1 138 ? -5.105  -26.908 14.242  1.00 57.03  ? 209 LEU A CD2  1 
ATOM   2037 H H    . LEU A 1 138 ? -2.948  -29.644 16.403  1.00 66.36  ? 209 LEU A H    1 
ATOM   2038 H HA   . LEU A 1 138 ? -5.378  -28.686 16.457  1.00 67.31  ? 209 LEU A HA   1 
ATOM   2039 H HB2  . LEU A 1 138 ? -4.002  -30.053 14.413  1.00 66.86  ? 209 LEU A HB2  1 
ATOM   2040 H HB3  . LEU A 1 138 ? -5.470  -29.502 14.192  1.00 66.86  ? 209 LEU A HB3  1 
ATOM   2041 H HG   . LEU A 1 138 ? -3.329  -27.781 14.777  1.00 68.55  ? 209 LEU A HG   1 
ATOM   2042 H HD11 . LEU A 1 138 ? -3.168  -27.306 12.507  1.00 71.09  ? 209 LEU A HD11 1 
ATOM   2043 H HD12 . LEU A 1 138 ? -2.809  -28.828 12.792  1.00 71.09  ? 209 LEU A HD12 1 
ATOM   2044 H HD13 . LEU A 1 138 ? -4.233  -28.445 12.201  1.00 71.09  ? 209 LEU A HD13 1 
ATOM   2045 H HD21 . LEU A 1 138 ? -4.706  -26.093 13.901  1.00 68.43  ? 209 LEU A HD21 1 
ATOM   2046 H HD22 . LEU A 1 138 ? -5.865  -27.159 13.694  1.00 68.43  ? 209 LEU A HD22 1 
ATOM   2047 H HD23 . LEU A 1 138 ? -5.388  -26.779 15.161  1.00 68.43  ? 209 LEU A HD23 1 
ATOM   2048 N N    . LEU A 1 139 ? -5.232  -31.889 16.322  1.00 54.31  ? 210 LEU A N    1 
ATOM   2049 C CA   . LEU A 1 139 ? -6.032  -33.086 16.554  1.00 53.94  ? 210 LEU A CA   1 
ATOM   2050 C C    . LEU A 1 139 ? -6.475  -33.191 17.997  1.00 56.50  ? 210 LEU A C    1 
ATOM   2051 O O    . LEU A 1 139 ? -7.556  -33.724 18.265  1.00 58.87  ? 210 LEU A O    1 
ATOM   2052 C CB   . LEU A 1 139 ? -5.254  -34.338 16.144  1.00 54.11  ? 210 LEU A CB   1 
ATOM   2053 C CG   . LEU A 1 139 ? -4.908  -34.318 14.649  1.00 52.94  ? 210 LEU A CG   1 
ATOM   2054 C CD1  . LEU A 1 139 ? -4.176  -35.575 14.226  1.00 56.63  ? 210 LEU A CD1  1 
ATOM   2055 C CD2  . LEU A 1 139 ? -6.138  -34.108 13.772  1.00 50.92  ? 210 LEU A CD2  1 
ATOM   2056 H H    . LEU A 1 139 ? -4.412  -32.036 16.107  1.00 65.16  ? 210 LEU A H    1 
ATOM   2057 H HA   . LEU A 1 139 ? -6.835  -33.034 16.014  1.00 64.73  ? 210 LEU A HA   1 
ATOM   2058 H HB2  . LEU A 1 139 ? -4.426  -34.380 16.647  1.00 64.94  ? 210 LEU A HB2  1 
ATOM   2059 H HB3  . LEU A 1 139 ? -5.795  -35.124 16.321  1.00 64.94  ? 210 LEU A HB3  1 
ATOM   2060 H HG   . LEU A 1 139 ? -4.312  -33.572 14.485  1.00 63.53  ? 210 LEU A HG   1 
ATOM   2061 H HD11 . LEU A 1 139 ? -3.946  -35.506 13.286  1.00 67.95  ? 210 LEU A HD11 1 
ATOM   2062 H HD12 . LEU A 1 139 ? -3.370  -35.664 14.758  1.00 67.95  ? 210 LEU A HD12 1 
ATOM   2063 H HD13 . LEU A 1 139 ? -4.754  -36.340 14.370  1.00 67.95  ? 210 LEU A HD13 1 
ATOM   2064 H HD21 . LEU A 1 139 ? -5.934  -34.392 12.867  1.00 61.10  ? 210 LEU A HD21 1 
ATOM   2065 H HD22 . LEU A 1 139 ? -6.871  -34.633 14.126  1.00 61.10  ? 210 LEU A HD22 1 
ATOM   2066 H HD23 . LEU A 1 139 ? -6.374  -33.167 13.779  1.00 61.10  ? 210 LEU A HD23 1 
ATOM   2067 N N    . ALA A 1 140 ? -5.678  -32.674 18.932  1.00 55.64  ? 211 ALA A N    1 
ATOM   2068 C CA   . ALA A 1 140 ? -6.081  -32.704 20.334  1.00 57.35  ? 211 ALA A CA   1 
ATOM   2069 C C    . ALA A 1 140 ? -7.340  -31.879 20.560  1.00 57.65  ? 211 ALA A C    1 
ATOM   2070 O O    . ALA A 1 140 ? -8.161  -32.226 21.414  1.00 62.09  ? 211 ALA A O    1 
ATOM   2071 C CB   . ALA A 1 140 ? -4.949  -32.197 21.222  1.00 57.27  ? 211 ALA A CB   1 
ATOM   2072 H H    . ALA A 1 140 ? -4.914  -32.308 18.784  1.00 66.77  ? 211 ALA A H    1 
ATOM   2073 H HA   . ALA A 1 140 ? -6.274  -33.620 20.588  1.00 68.81  ? 211 ALA A HA   1 
ATOM   2074 H HB1  . ALA A 1 140 ? -5.238  -32.225 22.148  1.00 68.73  ? 211 ALA A HB1  1 
ATOM   2075 H HB2  . ALA A 1 140 ? -4.173  -32.766 21.099  1.00 68.73  ? 211 ALA A HB2  1 
ATOM   2076 H HB3  . ALA A 1 140 ? -4.734  -31.285 20.970  1.00 68.73  ? 211 ALA A HB3  1 
ATOM   2077 N N    . LEU A 1 141 ? -7.517  -30.794 19.801  1.00 53.48  ? 212 LEU A N    1 
ATOM   2078 C CA   . LEU A 1 141 ? -8.747  -30.015 19.895  1.00 53.19  ? 212 LEU A CA   1 
ATOM   2079 C C    . LEU A 1 141 ? -9.968  -30.798 19.428  1.00 55.62  ? 212 LEU A C    1 
ATOM   2080 O O    . LEU A 1 141 ? -11.089 -30.457 19.815  1.00 58.10  ? 212 LEU A O    1 
ATOM   2081 C CB   . LEU A 1 141 ? -8.635  -28.730 19.067  1.00 53.07  ? 212 LEU A CB   1 
ATOM   2082 C CG   . LEU A 1 141 ? -7.537  -27.732 19.449  1.00 54.84  ? 212 LEU A CG   1 
ATOM   2083 C CD1  . LEU A 1 141 ? -7.482  -26.581 18.433  1.00 53.96  ? 212 LEU A CD1  1 
ATOM   2084 C CD2  . LEU A 1 141 ? -7.752  -27.177 20.844  1.00 57.09  ? 212 LEU A CD2  1 
ATOM   2085 H H    . LEU A 1 141 ? -6.946  -30.494 19.232  1.00 64.18  ? 212 LEU A H    1 
ATOM   2086 H HA   . LEU A 1 141 ? -8.890  -29.764 20.821  1.00 63.83  ? 212 LEU A HA   1 
ATOM   2087 H HB2  . LEU A 1 141 ? -8.480  -28.982 18.143  1.00 63.68  ? 212 LEU A HB2  1 
ATOM   2088 H HB3  . LEU A 1 141 ? -9.481  -28.259 19.130  1.00 63.68  ? 212 LEU A HB3  1 
ATOM   2089 H HG   . LEU A 1 141 ? -6.680  -28.185 19.436  1.00 65.80  ? 212 LEU A HG   1 
ATOM   2090 H HD11 . LEU A 1 141 ? -6.876  -25.899 18.762  1.00 64.76  ? 212 LEU A HD11 1 
ATOM   2091 H HD12 . LEU A 1 141 ? -7.162  -26.925 17.584  1.00 64.76  ? 212 LEU A HD12 1 
ATOM   2092 H HD13 . LEU A 1 141 ? -8.372  -26.210 18.328  1.00 64.76  ? 212 LEU A HD13 1 
ATOM   2093 H HD21 . LEU A 1 141 ? -7.066  -26.517 21.030  1.00 68.50  ? 212 LEU A HD21 1 
ATOM   2094 H HD22 . LEU A 1 141 ? -8.629  -26.764 20.887  1.00 68.50  ? 212 LEU A HD22 1 
ATOM   2095 H HD23 . LEU A 1 141 ? -7.696  -27.903 21.485  1.00 68.50  ? 212 LEU A HD23 1 
ATOM   2096 N N    . LEU A 1 142 ? -9.786  -31.822 18.601  1.00 56.49  ? 213 LEU A N    1 
ATOM   2097 C CA   . LEU A 1 142 ? -10.891 -32.626 18.100  1.00 61.59  ? 213 LEU A CA   1 
ATOM   2098 C C    . LEU A 1 142 ? -11.017 -33.959 18.831  1.00 67.20  ? 213 LEU A C    1 
ATOM   2099 O O    . LEU A 1 142 ? -11.800 -34.817 18.410  1.00 72.01  ? 213 LEU A O    1 
ATOM   2100 C CB   . LEU A 1 142 ? -10.718 -32.854 16.599  1.00 60.90  ? 213 LEU A CB   1 
ATOM   2101 C CG   . LEU A 1 142 ? -10.727 -31.560 15.765  1.00 60.06  ? 213 LEU A CG   1 
ATOM   2102 C CD1  . LEU A 1 142 ? -10.115 -31.750 14.386  1.00 60.53  ? 213 LEU A CD1  1 
ATOM   2103 C CD2  . LEU A 1 142 ? -12.144 -31.042 15.637  1.00 59.56  ? 213 LEU A CD2  1 
ATOM   2104 H H    . LEU A 1 142 ? -9.017  -32.074 18.311  1.00 67.79  ? 213 LEU A H    1 
ATOM   2105 H HA   . LEU A 1 142 ? -11.720 -32.139 18.231  1.00 73.91  ? 213 LEU A HA   1 
ATOM   2106 H HB2  . LEU A 1 142 ? -9.869  -33.298 16.447  1.00 73.08  ? 213 LEU A HB2  1 
ATOM   2107 H HB3  . LEU A 1 142 ? -11.443 -33.415 16.283  1.00 73.08  ? 213 LEU A HB3  1 
ATOM   2108 H HG   . LEU A 1 142 ? -10.206 -30.885 16.228  1.00 72.07  ? 213 LEU A HG   1 
ATOM   2109 H HD11 . LEU A 1 142 ? -10.147 -30.906 13.908  1.00 72.64  ? 213 LEU A HD11 1 
ATOM   2110 H HD12 . LEU A 1 142 ? -9.195  -32.040 14.487  1.00 72.64  ? 213 LEU A HD12 1 
ATOM   2111 H HD13 . LEU A 1 142 ? -10.623 -32.422 13.905  1.00 72.64  ? 213 LEU A HD13 1 
ATOM   2112 H HD21 . LEU A 1 142 ? -12.141 -30.253 15.072  1.00 71.47  ? 213 LEU A HD21 1 
ATOM   2113 H HD22 . LEU A 1 142 ? -12.697 -31.732 15.239  1.00 71.47  ? 213 LEU A HD22 1 
ATOM   2114 H HD23 . LEU A 1 142 ? -12.479 -30.816 16.519  1.00 71.47  ? 213 LEU A HD23 1 
ATOM   2115 N N    . ALA A 1 143 ? -10.278 -34.138 19.927  1.00 63.29  ? 214 ALA A N    1 
ATOM   2116 C CA   . ALA A 1 143 ? -10.255 -35.390 20.676  1.00 67.79  ? 214 ALA A CA   1 
ATOM   2117 C C    . ALA A 1 143 ? -11.471 -35.588 21.576  1.00 74.39  ? 214 ALA A C    1 
ATOM   2118 O O    . ALA A 1 143 ? -11.514 -36.581 22.309  1.00 79.88  ? 214 ALA A O    1 
ATOM   2119 C CB   . ALA A 1 143 ? -8.991  -35.456 21.535  1.00 68.03  ? 214 ALA A CB   1 
ATOM   2120 H H    . ALA A 1 143 ? -9.770  -33.532 20.264  1.00 75.95  ? 214 ALA A H    1 
ATOM   2121 H HA   . ALA A 1 143 ? -10.227 -36.129 20.048  1.00 81.35  ? 214 ALA A HA   1 
ATOM   2122 H HB1  . ALA A 1 143 ? -8.987  -36.292 22.027  1.00 81.64  ? 214 ALA A HB1  1 
ATOM   2123 H HB2  . ALA A 1 143 ? -8.214  -35.408 20.957  1.00 81.64  ? 214 ALA A HB2  1 
ATOM   2124 H HB3  . ALA A 1 143 ? -8.990  -34.708 22.153  1.00 81.64  ? 214 ALA A HB3  1 
ATOM   2125 N N    . VAL A 1 144 ? -12.437 -34.678 21.554  1.00 75.45  ? 215 VAL A N    1 
ATOM   2126 C CA   . VAL A 1 144 ? -13.635 -34.815 22.393  1.00 79.23  ? 215 VAL A CA   1 
ATOM   2127 C C    . VAL A 1 144 ? -14.500 -35.956 21.866  1.00 82.38  ? 215 VAL A C    1 
ATOM   2128 O O    . VAL A 1 144 ? -14.659 -36.089 20.638  1.00 78.30  ? 215 VAL A O    1 
ATOM   2129 C CB   . VAL A 1 144 ? -14.421 -33.501 22.417  1.00 79.48  ? 215 VAL A CB   1 
ATOM   2130 C CG1  . VAL A 1 144 ? -13.562 -32.373 22.982  1.00 82.23  ? 215 VAL A CG1  1 
ATOM   2131 C CG2  . VAL A 1 144 ? -14.940 -33.145 21.022  1.00 75.58  ? 215 VAL A CG2  1 
ATOM   2132 H H    . VAL A 1 144 ? -12.427 -33.970 21.067  1.00 90.55  ? 215 VAL A H    1 
ATOM   2133 H HA   . VAL A 1 144 ? -13.357 -35.018 23.298  1.00 95.07  ? 215 VAL A HA   1 
ATOM   2134 H HB   . VAL A 1 144 ? -15.189 -33.608 23.000  1.00 95.37  ? 215 VAL A HB   1 
ATOM   2135 H HG11 . VAL A 1 144 ? -14.099 -31.568 23.042  1.00 98.67  ? 215 VAL A HG11 1 
ATOM   2136 H HG12 . VAL A 1 144 ? -13.248 -32.627 23.864  1.00 98.67  ? 215 VAL A HG12 1 
ATOM   2137 H HG13 . VAL A 1 144 ? -12.807 -32.224 22.392  1.00 98.67  ? 215 VAL A HG13 1 
ATOM   2138 H HG21 . VAL A 1 144 ? -15.300 -32.244 21.042  1.00 90.70  ? 215 VAL A HG21 1 
ATOM   2139 H HG22 . VAL A 1 144 ? -14.209 -33.193 20.387  1.00 90.70  ? 215 VAL A HG22 1 
ATOM   2140 H HG23 . VAL A 1 144 ? -15.637 -33.772 20.772  1.00 90.70  ? 215 VAL A HG23 1 
ATOM   2141 N N    . PRO A 1 145 ? -15.121 -36.768 22.732  1.00 89.90  ? 216 PRO A N    1 
ATOM   2142 C CA   . PRO A 1 145 ? -15.889 -37.918 22.222  1.00 94.70  ? 216 PRO A CA   1 
ATOM   2143 C C    . PRO A 1 145 ? -17.101 -37.525 21.392  1.00 93.38  ? 216 PRO A C    1 
ATOM   2144 O O    . PRO A 1 145 ? -17.499 -38.293 20.506  1.00 94.74  ? 216 PRO A O    1 
ATOM   2145 C CB   . PRO A 1 145 ? -16.309 -38.662 23.498  1.00 99.71  ? 216 PRO A CB   1 
ATOM   2146 C CG   . PRO A 1 145 ? -15.538 -38.030 24.617  1.00 99.23  ? 216 PRO A CG   1 
ATOM   2147 C CD   . PRO A 1 145 ? -15.252 -36.634 24.190  1.00 94.42  ? 216 PRO A CD   1 
ATOM   2148 H HA   . PRO A 1 145 ? -15.315 -38.494 21.693  1.00 113.64 ? 216 PRO A HA   1 
ATOM   2149 H HB2  . PRO A 1 145 ? -17.263 -38.553 23.638  1.00 119.66 ? 216 PRO A HB2  1 
ATOM   2150 H HB3  . PRO A 1 145 ? -16.081 -39.601 23.416  1.00 119.66 ? 216 PRO A HB3  1 
ATOM   2151 H HG2  . PRO A 1 145 ? -16.076 -38.035 25.424  1.00 119.08 ? 216 PRO A HG2  1 
ATOM   2152 H HG3  . PRO A 1 145 ? -14.712 -38.518 24.757  1.00 119.08 ? 216 PRO A HG3  1 
ATOM   2153 H HD2  . PRO A 1 145 ? -15.994 -36.051 24.413  1.00 113.31 ? 216 PRO A HD2  1 
ATOM   2154 H HD3  . PRO A 1 145 ? -14.423 -36.329 24.589  1.00 113.31 ? 216 PRO A HD3  1 
ATOM   2155 N N    . ASP A 1 146 ? -17.706 -36.366 21.655  1.00 89.58  ? 217 ASP A N    1 
ATOM   2156 C CA   . ASP A 1 146 ? -18.862 -35.881 20.905  1.00 87.37  ? 217 ASP A CA   1 
ATOM   2157 C C    . ASP A 1 146 ? -18.491 -34.563 20.234  1.00 79.50  ? 217 ASP A C    1 
ATOM   2158 O O    . ASP A 1 146 ? -18.282 -33.553 20.912  1.00 78.40  ? 217 ASP A O    1 
ATOM   2159 C CB   . ASP A 1 146 ? -20.067 -35.708 21.830  1.00 95.19  ? 217 ASP A CB   1 
ATOM   2160 C CG   . ASP A 1 146 ? -21.273 -35.133 21.119  1.00 100.84 ? 217 ASP A CG   1 
ATOM   2161 O OD1  . ASP A 1 146 ? -21.293 -33.904 20.896  1.00 100.11 ? 217 ASP A OD1  1 
ATOM   2162 O OD2  . ASP A 1 146 ? -22.202 -35.906 20.796  1.00 105.79 ? 217 ASP A OD2  1 
ATOM   2163 H H    . ASP A 1 146 ? -17.457 -35.830 22.280  1.00 107.49 ? 217 ASP A H    1 
ATOM   2164 H HA   . ASP A 1 146 ? -19.096 -36.521 20.215  1.00 104.84 ? 217 ASP A HA   1 
ATOM   2165 H HB2  . ASP A 1 146 ? -20.316 -36.574 22.190  1.00 114.22 ? 217 ASP A HB2  1 
ATOM   2166 H HB3  . ASP A 1 146 ? -19.828 -35.105 22.551  1.00 114.22 ? 217 ASP A HB3  1 
ATOM   2167 N N    . LEU A 1 147 ? -18.420 -34.563 18.903  1.00 78.26  ? 218 LEU A N    1 
ATOM   2168 C CA   . LEU A 1 147 ? -17.993 -33.360 18.202  1.00 74.01  ? 218 LEU A CA   1 
ATOM   2169 C C    . LEU A 1 147 ? -18.995 -32.224 18.320  1.00 78.78  ? 218 LEU A C    1 
ATOM   2170 O O    . LEU A 1 147 ? -18.621 -31.067 18.110  1.00 74.17  ? 218 LEU A O    1 
ATOM   2171 C CB   . LEU A 1 147 ? -17.744 -33.669 16.730  1.00 67.45  ? 218 LEU A CB   1 
ATOM   2172 C CG   . LEU A 1 147 ? -16.582 -34.621 16.440  1.00 64.63  ? 218 LEU A CG   1 
ATOM   2173 C CD1  . LEU A 1 147 ? -16.546 -34.963 14.966  1.00 62.61  ? 218 LEU A CD1  1 
ATOM   2174 C CD2  . LEU A 1 147 ? -15.266 -34.008 16.856  1.00 63.13  ? 218 LEU A CD2  1 
ATOM   2175 H H    . LEU A 1 147 ? -18.609 -35.231 18.396  1.00 93.92  ? 218 LEU A H    1 
ATOM   2176 H HA   . LEU A 1 147 ? -17.158 -33.054 18.589  1.00 88.81  ? 218 LEU A HA   1 
ATOM   2177 H HB2  . LEU A 1 147 ? -18.547 -34.070 16.361  1.00 80.94  ? 218 LEU A HB2  1 
ATOM   2178 H HB3  . LEU A 1 147 ? -17.558 -32.836 16.269  1.00 80.94  ? 218 LEU A HB3  1 
ATOM   2179 H HG   . LEU A 1 147 ? -16.707 -35.442 16.941  1.00 77.56  ? 218 LEU A HG   1 
ATOM   2180 H HD11 . LEU A 1 147 ? -15.751 -35.488 14.782  1.00 75.14  ? 218 LEU A HD11 1 
ATOM   2181 H HD12 . LEU A 1 147 ? -17.339 -35.474 14.741  1.00 75.14  ? 218 LEU A HD12 1 
ATOM   2182 H HD13 . LEU A 1 147 ? -16.526 -34.140 14.454  1.00 75.14  ? 218 LEU A HD13 1 
ATOM   2183 H HD21 . LEU A 1 147 ? -14.542 -34.571 16.540  1.00 75.76  ? 218 LEU A HD21 1 
ATOM   2184 H HD22 . LEU A 1 147 ? -15.193 -33.124 16.465  1.00 75.76  ? 218 LEU A HD22 1 
ATOM   2185 H HD23 . LEU A 1 147 ? -15.237 -33.945 17.823  1.00 75.76  ? 218 LEU A HD23 1 
ATOM   2186 N N    . SER A 1 148 ? -20.251 -32.518 18.658  1.00 91.51  ? 219 SER A N    1 
ATOM   2187 C CA   . SER A 1 148 ? -21.270 -31.478 18.746  1.00 96.87  ? 219 SER A CA   1 
ATOM   2188 C C    . SER A 1 148 ? -21.074 -30.563 19.946  1.00 92.70  ? 219 SER A C    1 
ATOM   2189 O O    . SER A 1 148 ? -21.773 -29.549 20.048  1.00 92.28  ? 219 SER A O    1 
ATOM   2190 C CB   . SER A 1 148 ? -22.661 -32.111 18.798  1.00 105.05 ? 219 SER A CB   1 
ATOM   2191 O OG   . SER A 1 148 ? -22.899 -32.902 17.646  1.00 108.29 ? 219 SER A OG   1 
ATOM   2192 H H    . SER A 1 148 ? -20.536 -33.309 18.840  1.00 109.81 ? 219 SER A H    1 
ATOM   2193 H HA   . SER A 1 148 ? -21.224 -30.930 17.947  1.00 116.25 ? 219 SER A HA   1 
ATOM   2194 H HB2  . SER A 1 148 ? -22.734 -32.668 19.586  1.00 126.06 ? 219 SER A HB2  1 
ATOM   2195 H HB3  . SER A 1 148 ? -23.324 -31.404 18.834  1.00 126.06 ? 219 SER A HB3  1 
ATOM   2196 H HG   . SER A 1 148 ? -23.665 -33.244 17.686  1.00 129.95 ? 219 SER A HG   1 
ATOM   2197 N N    . THR A 1 149 ? -20.147 -30.888 20.848  1.00 85.63  ? 220 THR A N    1 
ATOM   2198 C CA   . THR A 1 149 ? -19.845 -30.004 21.968  1.00 84.87  ? 220 THR A CA   1 
ATOM   2199 C C    . THR A 1 149 ? -18.995 -28.813 21.546  1.00 84.01  ? 220 THR A C    1 
ATOM   2200 O O    . THR A 1 149 ? -19.015 -27.785 22.228  1.00 82.76  ? 220 THR A O    1 
ATOM   2201 C CB   . THR A 1 149 ? -19.133 -30.773 23.089  1.00 87.81  ? 220 THR A CB   1 
ATOM   2202 O OG1  . THR A 1 149 ? -17.807 -31.125 22.676  1.00 87.44  ? 220 THR A OG1  1 
ATOM   2203 C CG2  . THR A 1 149 ? -19.900 -32.042 23.457  1.00 90.87  ? 220 THR A CG2  1 
ATOM   2204 H H    . THR A 1 149 ? -19.682 -31.611 20.833  1.00 102.75 ? 220 THR A H    1 
ATOM   2205 H HA   . THR A 1 149 ? -20.678 -29.661 22.327  1.00 101.85 ? 220 THR A HA   1 
ATOM   2206 H HB   . THR A 1 149 ? -19.082 -30.211 23.878  1.00 105.37 ? 220 THR A HB   1 
ATOM   2207 H HG1  . THR A 1 149 ? -17.839 -31.609 21.991  1.00 104.93 ? 220 THR A HG1  1 
ATOM   2208 H HG21 . THR A 1 149 ? -19.499 -32.456 24.237  1.00 109.05 ? 220 THR A HG21 1 
ATOM   2209 H HG22 . THR A 1 149 ? -20.824 -31.824 23.656  1.00 109.05 ? 220 THR A HG22 1 
ATOM   2210 H HG23 . THR A 1 149 ? -19.877 -32.671 22.719  1.00 109.05 ? 220 THR A HG23 1 
ATOM   2211 N N    . LEU A 1 150 ? -18.259 -28.921 20.440  1.00 86.07  ? 221 LEU A N    1 
ATOM   2212 C CA   . LEU A 1 150 ? -17.516 -27.784 19.919  1.00 83.43  ? 221 LEU A CA   1 
ATOM   2213 C C    . LEU A 1 150 ? -18.470 -26.821 19.224  1.00 80.17  ? 221 LEU A C    1 
ATOM   2214 O O    . LEU A 1 150 ? -19.459 -27.236 18.612  1.00 77.16  ? 221 LEU A O    1 
ATOM   2215 C CB   . LEU A 1 150 ? -16.431 -28.249 18.943  1.00 82.05  ? 221 LEU A CB   1 
ATOM   2216 C CG   . LEU A 1 150 ? -15.273 -29.082 19.513  1.00 81.80  ? 221 LEU A CG   1 
ATOM   2217 C CD1  . LEU A 1 150 ? -14.416 -29.673 18.417  1.00 78.03  ? 221 LEU A CD1  1 
ATOM   2218 C CD2  . LEU A 1 150 ? -14.400 -28.227 20.413  1.00 83.94  ? 221 LEU A CD2  1 
ATOM   2219 H H    . LEU A 1 150 ? -18.175 -29.641 19.977  1.00 103.29 ? 221 LEU A H    1 
ATOM   2220 H HA   . LEU A 1 150 ? -17.089 -27.315 20.652  1.00 100.12 ? 221 LEU A HA   1 
ATOM   2221 H HB2  . LEU A 1 150 ? -16.856 -28.786 18.256  1.00 98.47  ? 221 LEU A HB2  1 
ATOM   2222 H HB3  . LEU A 1 150 ? -16.039 -27.462 18.533  1.00 98.47  ? 221 LEU A HB3  1 
ATOM   2223 H HG   . LEU A 1 150 ? -15.633 -29.810 20.043  1.00 98.16  ? 221 LEU A HG   1 
ATOM   2224 H HD11 . LEU A 1 150 ? -13.668 -30.142 18.820  1.00 93.64  ? 221 LEU A HD11 1 
ATOM   2225 H HD12 . LEU A 1 150 ? -14.953 -30.291 17.896  1.00 93.64  ? 221 LEU A HD12 1 
ATOM   2226 H HD13 . LEU A 1 150 ? -14.091 -28.957 17.850  1.00 93.64  ? 221 LEU A HD13 1 
ATOM   2227 H HD21 . LEU A 1 150 ? -13.654 -28.761 20.729  1.00 100.73 ? 221 LEU A HD21 1 
ATOM   2228 H HD22 . LEU A 1 150 ? -14.072 -27.468 19.906  1.00 100.73 ? 221 LEU A HD22 1 
ATOM   2229 H HD23 . LEU A 1 150 ? -14.928 -27.919 21.166  1.00 100.73 ? 221 LEU A HD23 1 
ATOM   2230 N N    . ALA A 1 151 ? -18.183 -25.527 19.341  1.00 80.14  ? 222 ALA A N    1 
ATOM   2231 C CA   . ALA A 1 151 ? -18.950 -24.526 18.611  1.00 77.49  ? 222 ALA A CA   1 
ATOM   2232 C C    . ALA A 1 151 ? -18.884 -24.802 17.112  1.00 75.12  ? 222 ALA A C    1 
ATOM   2233 O O    . ALA A 1 151 ? -17.838 -25.186 16.577  1.00 77.89  ? 222 ALA A O    1 
ATOM   2234 C CB   . ALA A 1 151 ? -18.417 -23.126 18.911  1.00 75.12  ? 222 ALA A CB   1 
ATOM   2235 H H    . ALA A 1 151 ? -17.554 -25.206 19.832  1.00 96.17  ? 222 ALA A H    1 
ATOM   2236 H HA   . ALA A 1 151 ? -19.878 -24.566 18.889  1.00 92.99  ? 222 ALA A HA   1 
ATOM   2237 H HB1  . ALA A 1 151 ? -18.941 -22.477 18.416  1.00 90.14  ? 222 ALA A HB1  1 
ATOM   2238 H HB2  . ALA A 1 151 ? -18.493 -22.957 19.863  1.00 90.14  ? 222 ALA A HB2  1 
ATOM   2239 H HB3  . ALA A 1 151 ? -17.487 -23.078 18.640  1.00 90.14  ? 222 ALA A HB3  1 
ATOM   2240 N N    . CYS A 1 152 ? -20.011 -24.595 16.435  1.00 71.90  ? 223 CYS A N    1 
ATOM   2241 C CA   . CYS A 1 152 ? -20.091 -24.891 15.011  1.00 71.21  ? 223 CYS A CA   1 
ATOM   2242 C C    . CYS A 1 152 ? -18.995 -24.174 14.229  1.00 65.06  ? 223 CYS A C    1 
ATOM   2243 O O    . CYS A 1 152 ? -18.335 -24.772 13.374  1.00 63.71  ? 223 CYS A O    1 
ATOM   2244 C CB   . CYS A 1 152 ? -21.467 -24.502 14.484  1.00 81.87  ? 223 CYS A CB   1 
ATOM   2245 S SG   . CYS A 1 152 ? -21.992 -25.473 13.061  1.00 91.02  ? 223 CYS A SG   1 
ATOM   2246 H H    . CYS A 1 152 ? -20.737 -24.286 16.776  1.00 86.28  ? 223 CYS A H    1 
ATOM   2247 H HA   . CYS A 1 152 ? -19.978 -25.845 14.880  1.00 85.45  ? 223 CYS A HA   1 
ATOM   2248 H HB2  . CYS A 1 152 ? -22.121 -24.630 15.189  1.00 98.25  ? 223 CYS A HB2  1 
ATOM   2249 H HB3  . CYS A 1 152 ? -21.449 -23.570 14.217  1.00 98.25  ? 223 CYS A HB3  1 
ATOM   2250 H HG   . CYS A 1 152 ? -23.079 -25.102 12.714  1.00 109.22 ? 223 CYS A HG   1 
ATOM   2251 N N    . GLY A 1 153 ? -18.790 -22.887 14.499  1.00 64.07  ? 224 GLY A N    1 
ATOM   2252 C CA   . GLY A 1 153 ? -17.764 -22.152 13.781  1.00 63.77  ? 224 GLY A CA   1 
ATOM   2253 C C    . GLY A 1 153 ? -16.367 -22.663 14.075  1.00 62.68  ? 224 GLY A C    1 
ATOM   2254 O O    . GLY A 1 153 ? -15.529 -22.757 13.174  1.00 65.36  ? 224 GLY A O    1 
ATOM   2255 H H    . GLY A 1 153 ? -19.224 -22.427 15.082  1.00 76.88  ? 224 GLY A H    1 
ATOM   2256 H HA2  . GLY A 1 153 ? -17.923 -22.225 12.827  1.00 76.53  ? 224 GLY A HA2  1 
ATOM   2257 H HA3  . GLY A 1 153 ? -17.806 -21.215 14.028  1.00 76.53  ? 224 GLY A HA3  1 
ATOM   2258 N N    . TYR A 1 154 ? -16.095 -22.987 15.343  1.00 59.72  ? 225 TYR A N    1 
ATOM   2259 C CA   . TYR A 1 154 ? -14.811 -23.565 15.719  1.00 57.98  ? 225 TYR A CA   1 
ATOM   2260 C C    . TYR A 1 154 ? -14.564 -24.847 14.938  1.00 53.44  ? 225 TYR A C    1 
ATOM   2261 O O    . TYR A 1 154 ? -13.525 -25.010 14.290  1.00 52.03  ? 225 TYR A O    1 
ATOM   2262 C CB   . TYR A 1 154 ? -14.804 -23.835 17.234  1.00 64.32  ? 225 TYR A CB   1 
ATOM   2263 C CG   . TYR A 1 154 ? -13.446 -24.023 17.911  1.00 67.49  ? 225 TYR A CG   1 
ATOM   2264 C CD1  . TYR A 1 154 ? -12.285 -23.523 17.358  1.00 68.62  ? 225 TYR A CD1  1 
ATOM   2265 C CD2  . TYR A 1 154 ? -13.347 -24.701 19.126  1.00 68.75  ? 225 TYR A CD2  1 
ATOM   2266 C CE1  . TYR A 1 154 ? -11.066 -23.693 17.988  1.00 70.65  ? 225 TYR A CE1  1 
ATOM   2267 C CE2  . TYR A 1 154 ? -12.143 -24.879 19.753  1.00 70.73  ? 225 TYR A CE2  1 
ATOM   2268 C CZ   . TYR A 1 154 ? -11.005 -24.372 19.186  1.00 73.51  ? 225 TYR A CZ   1 
ATOM   2269 O OH   . TYR A 1 154 ? -9.795  -24.549 19.822  1.00 78.35  ? 225 TYR A OH   1 
ATOM   2270 H H    . TYR A 1 154 ? -16.639 -22.881 16.000  1.00 71.66  ? 225 TYR A H    1 
ATOM   2271 H HA   . TYR A 1 154 ? -14.107 -22.933 15.506  1.00 69.58  ? 225 TYR A HA   1 
ATOM   2272 H HB2  . TYR A 1 154 ? -15.239 -23.088 17.674  1.00 77.17  ? 225 TYR A HB2  1 
ATOM   2273 H HB3  . TYR A 1 154 ? -15.317 -24.642 17.397  1.00 77.17  ? 225 TYR A HB3  1 
ATOM   2274 H HD1  . TYR A 1 154 ? -12.322 -23.063 16.551  1.00 82.35  ? 225 TYR A HD1  1 
ATOM   2275 H HD2  . TYR A 1 154 ? -14.117 -25.046 19.517  1.00 82.49  ? 225 TYR A HD2  1 
ATOM   2276 H HE1  . TYR A 1 154 ? -10.290 -23.353 17.604  1.00 84.78  ? 225 TYR A HE1  1 
ATOM   2277 H HE2  . TYR A 1 154 ? -12.100 -25.335 20.563  1.00 84.88  ? 225 TYR A HE2  1 
ATOM   2278 H HH   . TYR A 1 154 ? -9.906  -24.976 20.537  1.00 94.03  ? 225 TYR A HH   1 
ATOM   2279 N N    . LEU A 1 155 ? -15.529 -25.762 14.973  1.00 53.03  ? 226 LEU A N    1 
ATOM   2280 C CA   . LEU A 1 155 ? -15.356 -27.057 14.331  1.00 54.39  ? 226 LEU A CA   1 
ATOM   2281 C C    . LEU A 1 155 ? -15.172 -26.902 12.827  1.00 54.35  ? 226 LEU A C    1 
ATOM   2282 O O    . LEU A 1 155 ? -14.381 -27.626 12.206  1.00 55.61  ? 226 LEU A O    1 
ATOM   2283 C CB   . LEU A 1 155 ? -16.561 -27.937 14.642  1.00 56.79  ? 226 LEU A CB   1 
ATOM   2284 C CG   . LEU A 1 155 ? -16.507 -29.375 14.146  1.00 59.28  ? 226 LEU A CG   1 
ATOM   2285 C CD1  . LEU A 1 155 ? -15.275 -30.112 14.668  1.00 58.66  ? 226 LEU A CD1  1 
ATOM   2286 C CD2  . LEU A 1 155 ? -17.783 -30.096 14.568  1.00 63.13  ? 226 LEU A CD2  1 
ATOM   2287 H H    . LEU A 1 155 ? -16.289 -25.657 15.361  1.00 63.64  ? 226 LEU A H    1 
ATOM   2288 H HA   . LEU A 1 155 ? -14.563 -27.485 14.691  1.00 65.27  ? 226 LEU A HA   1 
ATOM   2289 H HB2  . LEU A 1 155 ? -16.670 -27.970 15.605  1.00 68.15  ? 226 LEU A HB2  1 
ATOM   2290 H HB3  . LEU A 1 155 ? -17.345 -27.527 14.245  1.00 68.15  ? 226 LEU A HB3  1 
ATOM   2291 H HG   . LEU A 1 155 ? -16.469 -29.375 13.177  1.00 71.13  ? 226 LEU A HG   1 
ATOM   2292 H HD11 . LEU A 1 155 ? -15.347 -31.051 14.434  1.00 70.40  ? 226 LEU A HD11 1 
ATOM   2293 H HD12 . LEU A 1 155 ? -14.481 -29.730 14.261  1.00 70.40  ? 226 LEU A HD12 1 
ATOM   2294 H HD13 . LEU A 1 155 ? -15.234 -30.014 15.632  1.00 70.40  ? 226 LEU A HD13 1 
ATOM   2295 H HD21 . LEU A 1 155 ? -17.747 -31.012 14.251  1.00 75.76  ? 226 LEU A HD21 1 
ATOM   2296 H HD22 . LEU A 1 155 ? -17.847 -30.083 15.536  1.00 75.76  ? 226 LEU A HD22 1 
ATOM   2297 H HD23 . LEU A 1 155 ? -18.546 -29.640 14.179  1.00 75.76  ? 226 LEU A HD23 1 
ATOM   2298 N N    . ARG A 1 156 ? -15.884 -25.950 12.224  1.00 52.92  ? 227 ARG A N    1 
ATOM   2299 C CA   . ARG A 1 156 ? -15.728 -25.703 10.797  1.00 50.99  ? 227 ARG A CA   1 
ATOM   2300 C C    . ARG A 1 156 ? -14.318 -25.237 10.460  1.00 48.06  ? 227 ARG A C    1 
ATOM   2301 O O    . ARG A 1 156 ? -13.714 -25.723 9.498   1.00 49.70  ? 227 ARG A O    1 
ATOM   2302 C CB   . ARG A 1 156 ? -16.754 -24.681 10.333  1.00 54.02  ? 227 ARG A CB   1 
ATOM   2303 C CG   . ARG A 1 156 ? -18.126 -25.265 10.241  1.00 59.03  ? 227 ARG A CG   1 
ATOM   2304 C CD   . ARG A 1 156 ? -19.160 -24.192 10.109  1.00 64.77  ? 227 ARG A CD   1 
ATOM   2305 N NE   . ARG A 1 156 ? -20.488 -24.752 9.949   1.00 72.65  ? 227 ARG A NE   1 
ATOM   2306 C CZ   . ARG A 1 156 ? -21.581 -24.018 9.801   1.00 80.37  ? 227 ARG A CZ   1 
ATOM   2307 N NH1  . ARG A 1 156 ? -21.492 -22.696 9.799   1.00 81.84  ? 227 ARG A NH1  1 
ATOM   2308 N NH2  . ARG A 1 156 ? -22.759 -24.603 9.651   1.00 85.14  ? 227 ARG A NH2  1 
ATOM   2309 H H    . ARG A 1 156 ? -16.456 -25.441 12.615  1.00 63.51  ? 227 ARG A H    1 
ATOM   2310 H HA   . ARG A 1 156 ? -15.892 -26.529 10.316  1.00 61.18  ? 227 ARG A HA   1 
ATOM   2311 H HB2  . ARG A 1 156 ? -16.780 -23.946 10.966  1.00 64.83  ? 227 ARG A HB2  1 
ATOM   2312 H HB3  . ARG A 1 156 ? -16.504 -24.356 9.454   1.00 64.83  ? 227 ARG A HB3  1 
ATOM   2313 H HG2  . ARG A 1 156 ? -18.180 -25.838 9.460   1.00 70.84  ? 227 ARG A HG2  1 
ATOM   2314 H HG3  . ARG A 1 156 ? -18.314 -25.773 11.046  1.00 70.84  ? 227 ARG A HG3  1 
ATOM   2315 H HD2  . ARG A 1 156 ? -19.156 -23.643 10.909  1.00 77.72  ? 227 ARG A HD2  1 
ATOM   2316 H HD3  . ARG A 1 156 ? -18.962 -23.651 9.329   1.00 77.72  ? 227 ARG A HD3  1 
ATOM   2317 H HE   . ARG A 1 156 ? -20.554 -25.601 9.828   1.00 87.18  ? 227 ARG A HE   1 
ATOM   2318 H HH11 . ARG A 1 156 ? -20.729 -22.311 9.893   1.00 98.21  ? 227 ARG A HH11 1 
ATOM   2319 H HH12 . ARG A 1 156 ? -22.202 -22.220 9.703   1.00 98.21  ? 227 ARG A HH12 1 
ATOM   2320 H HH21 . ARG A 1 156 ? -22.817 -25.460 9.653   1.00 102.17 ? 227 ARG A HH21 1 
ATOM   2321 H HH22 . ARG A 1 156 ? -23.467 -24.124 9.558   1.00 102.17 ? 227 ARG A HH22 1 
ATOM   2322 N N    . ASN A 1 157 ? -13.774 -24.292 11.234  1.00 47.37  ? 228 ASN A N    1 
ATOM   2323 C CA   . ASN A 1 157 ? -12.430 -23.794 10.936  1.00 48.37  ? 228 ASN A CA   1 
ATOM   2324 C C    . ASN A 1 157 ? -11.384 -24.891 11.107  1.00 44.71  ? 228 ASN A C    1 
ATOM   2325 O O    . ASN A 1 157 ? -10.449 -24.991 10.308  1.00 40.57  ? 228 ASN A O    1 
ATOM   2326 C CB   . ASN A 1 157 ? -12.097 -22.580 11.809  1.00 57.70  ? 228 ASN A CB   1 
ATOM   2327 C CG   . ASN A 1 157 ? -12.750 -21.298 11.294  1.00 65.90  ? 228 ASN A CG   1 
ATOM   2328 O OD1  . ASN A 1 157 ? -12.731 -21.014 10.088  1.00 68.27  ? 228 ASN A OD1  1 
ATOM   2329 N ND2  . ASN A 1 157 ? -13.346 -20.531 12.205  1.00 69.73  ? 228 ASN A ND2  1 
ATOM   2330 H H    . ASN A 1 157 ? -14.151 -23.933 11.918  1.00 56.84  ? 228 ASN A H    1 
ATOM   2331 H HA   . ASN A 1 157 ? -12.405 -23.506 10.010  1.00 58.04  ? 228 ASN A HA   1 
ATOM   2332 H HB2  . ASN A 1 157 ? -12.417 -22.740 12.711  1.00 69.24  ? 228 ASN A HB2  1 
ATOM   2333 H HB3  . ASN A 1 157 ? -11.136 -22.447 11.815  1.00 69.24  ? 228 ASN A HB3  1 
ATOM   2334 H HD21 . ASN A 1 157 ? -13.729 -19.799 11.967  1.00 83.67  ? 228 ASN A HD21 1 
ATOM   2335 H HD22 . ASN A 1 157 ? -13.348 -20.768 13.032  1.00 83.67  ? 228 ASN A HD22 1 
ATOM   2336 N N    . LEU A 1 158 ? -11.540 -25.743 12.123  1.00 46.73  ? 229 LEU A N    1 
ATOM   2337 C CA   . LEU A 1 158 ? -10.626 -26.870 12.300  1.00 48.80  ? 229 LEU A CA   1 
ATOM   2338 C C    . LEU A 1 158 ? -10.692 -27.809 11.104  1.00 47.05  ? 229 LEU A C    1 
ATOM   2339 O O    . LEU A 1 158 ? -9.663  -28.247 10.582  1.00 48.08  ? 229 LEU A O    1 
ATOM   2340 C CB   . LEU A 1 158 ? -10.964 -27.620 13.590  1.00 52.89  ? 229 LEU A CB   1 
ATOM   2341 C CG   . LEU A 1 158 ? -10.471 -26.985 14.889  1.00 54.75  ? 229 LEU A CG   1 
ATOM   2342 C CD1  . LEU A 1 158 ? -11.340 -27.355 16.065  1.00 55.63  ? 229 LEU A CD1  1 
ATOM   2343 C CD2  . LEU A 1 158 ? -9.040  -27.425 15.132  1.00 55.66  ? 229 LEU A CD2  1 
ATOM   2344 H H    . LEU A 1 158 ? -12.160 -25.691 12.716  1.00 56.08  ? 229 LEU A H    1 
ATOM   2345 H HA   . LEU A 1 158 ? -9.718  -26.536 12.373  1.00 58.56  ? 229 LEU A HA   1 
ATOM   2346 H HB2  . LEU A 1 158 ? -11.929 -27.695 13.654  1.00 63.47  ? 229 LEU A HB2  1 
ATOM   2347 H HB3  . LEU A 1 158 ? -10.576 -28.507 13.537  1.00 63.47  ? 229 LEU A HB3  1 
ATOM   2348 H HG   . LEU A 1 158 ? -10.480 -26.019 14.796  1.00 65.70  ? 229 LEU A HG   1 
ATOM   2349 H HD11 . LEU A 1 158 ? -10.987 -26.932 16.863  1.00 66.76  ? 229 LEU A HD11 1 
ATOM   2350 H HD12 . LEU A 1 158 ? -12.244 -27.045 15.899  1.00 66.76  ? 229 LEU A HD12 1 
ATOM   2351 H HD13 . LEU A 1 158 ? -11.334 -28.319 16.171  1.00 66.76  ? 229 LEU A HD13 1 
ATOM   2352 H HD21 . LEU A 1 158 ? -8.702  -26.972 15.920  1.00 66.79  ? 229 LEU A HD21 1 
ATOM   2353 H HD22 . LEU A 1 158 ? -9.023  -28.385 15.269  1.00 66.79  ? 229 LEU A HD22 1 
ATOM   2354 H HD23 . LEU A 1 158 ? -8.502  -27.191 14.359  1.00 66.79  ? 229 LEU A HD23 1 
ATOM   2355 N N    . THR A 1 159 ? -11.902 -28.124 10.650  1.00 45.69  ? 230 THR A N    1 
ATOM   2356 C CA   . THR A 1 159 ? -12.039 -28.953 9.453   1.00 46.14  ? 230 THR A CA   1 
ATOM   2357 C C    . THR A 1 159 ? -11.404 -28.271 8.240   1.00 44.50  ? 230 THR A C    1 
ATOM   2358 O O    . THR A 1 159 ? -10.674 -28.909 7.475   1.00 43.58  ? 230 THR A O    1 
ATOM   2359 C CB   . THR A 1 159 ? -13.524 -29.284 9.180   1.00 50.26  ? 230 THR A CB   1 
ATOM   2360 O OG1  . THR A 1 159 ? -14.130 -29.844 10.355  1.00 53.22  ? 230 THR A OG1  1 
ATOM   2361 C CG2  . THR A 1 159 ? -13.669 -30.302 8.073   1.00 48.38  ? 230 THR A CG2  1 
ATOM   2362 H H    . THR A 1 159 ? -12.645 -27.877 11.006  1.00 54.82  ? 230 THR A H    1 
ATOM   2363 H HA   . THR A 1 159 ? -11.572 -29.790 9.599   1.00 55.36  ? 230 THR A HA   1 
ATOM   2364 H HB   . THR A 1 159 ? -13.996 -28.477 8.923   1.00 60.32  ? 230 THR A HB   1 
ATOM   2365 H HG1  . THR A 1 159 ? -14.098 -29.291 10.986  1.00 63.87  ? 230 THR A HG1  1 
ATOM   2366 H HG21 . THR A 1 159 ? -14.608 -30.493 7.920   1.00 58.06  ? 230 THR A HG21 1 
ATOM   2367 H HG22 . THR A 1 159 ? -13.279 -29.962 7.253   1.00 58.06  ? 230 THR A HG22 1 
ATOM   2368 H HG23 . THR A 1 159 ? -13.217 -31.124 8.319   1.00 58.06  ? 230 THR A HG23 1 
ATOM   2369 N N    . TRP A 1 160 ? -11.641 -26.973 8.059   1.00 42.88  ? 231 TRP A N    1 
ATOM   2370 C CA   . TRP A 1 160 ? -11.053 -26.300 6.902   1.00 42.30  ? 231 TRP A CA   1 
ATOM   2371 C C    . TRP A 1 160 ? -9.523  -26.268 6.969   1.00 42.79  ? 231 TRP A C    1 
ATOM   2372 O O    . TRP A 1 160 ? -8.854  -26.502 5.957   1.00 45.84  ? 231 TRP A O    1 
ATOM   2373 C CB   . TRP A 1 160 ? -11.610 -24.895 6.792   1.00 42.83  ? 231 TRP A CB   1 
ATOM   2374 C CG   . TRP A 1 160 ? -10.945 -24.099 5.738   1.00 45.58  ? 231 TRP A CG   1 
ATOM   2375 C CD1  . TRP A 1 160 ? -11.102 -24.234 4.397   1.00 47.02  ? 231 TRP A CD1  1 
ATOM   2376 C CD2  . TRP A 1 160 ? -10.029 -23.018 5.930   1.00 47.52  ? 231 TRP A CD2  1 
ATOM   2377 N NE1  . TRP A 1 160 ? -10.336 -23.315 3.738   1.00 48.37  ? 231 TRP A NE1  1 
ATOM   2378 C CE2  . TRP A 1 160 ? -9.673  -22.549 4.657   1.00 49.68  ? 231 TRP A CE2  1 
ATOM   2379 C CE3  . TRP A 1 160 ? -9.488  -22.393 7.058   1.00 48.50  ? 231 TRP A CE3  1 
ATOM   2380 C CZ2  . TRP A 1 160 ? -8.789  -21.501 4.473   1.00 50.53  ? 231 TRP A CZ2  1 
ATOM   2381 C CZ3  . TRP A 1 160 ? -8.608  -21.346 6.876   1.00 48.84  ? 231 TRP A CZ3  1 
ATOM   2382 C CH2  . TRP A 1 160 ? -8.259  -20.916 5.598   1.00 49.86  ? 231 TRP A CH2  1 
ATOM   2383 H H    . TRP A 1 160 ? -12.120 -26.475 8.570   1.00 51.45  ? 231 TRP A H    1 
ATOM   2384 H HA   . TRP A 1 160 ? -11.304 -26.783 6.099   1.00 50.76  ? 231 TRP A HA   1 
ATOM   2385 H HB2  . TRP A 1 160 ? -12.555 -24.945 6.579   1.00 51.39  ? 231 TRP A HB2  1 
ATOM   2386 H HB3  . TRP A 1 160 ? -11.484 -24.438 7.638   1.00 51.39  ? 231 TRP A HB3  1 
ATOM   2387 H HD1  . TRP A 1 160 ? -11.645 -24.867 3.986   1.00 56.42  ? 231 TRP A HD1  1 
ATOM   2388 H HE1  . TRP A 1 160 ? -10.283 -23.229 2.884   1.00 58.04  ? 231 TRP A HE1  1 
ATOM   2389 H HE3  . TRP A 1 160 ? -9.711  -22.682 7.913   1.00 58.20  ? 231 TRP A HE3  1 
ATOM   2390 H HZ2  . TRP A 1 160 ? -8.558  -21.208 3.621   1.00 60.63  ? 231 TRP A HZ2  1 
ATOM   2391 H HZ3  . TRP A 1 160 ? -8.234  -20.928 7.618   1.00 58.61  ? 231 TRP A HZ3  1 
ATOM   2392 H HH2  . TRP A 1 160 ? -7.668  -20.206 5.504   1.00 59.83  ? 231 TRP A HH2  1 
ATOM   2393 N N    . THR A 1 161 ? -8.946  -26.000 8.145   1.00 40.17  ? 232 THR A N    1 
ATOM   2394 C CA   . THR A 1 161 ? -7.488  -25.975 8.267   1.00 39.10  ? 232 THR A CA   1 
ATOM   2395 C C    . THR A 1 161 ? -6.882  -27.362 8.096   1.00 41.35  ? 232 THR A C    1 
ATOM   2396 O O    . THR A 1 161 ? -5.858  -27.506 7.418   1.00 41.00  ? 232 THR A O    1 
ATOM   2397 C CB   . THR A 1 161 ? -7.081  -25.397 9.613   1.00 38.15  ? 232 THR A CB   1 
ATOM   2398 O OG1  . THR A 1 161 ? -7.468  -24.014 9.663   1.00 37.93  ? 232 THR A OG1  1 
ATOM   2399 C CG2  . THR A 1 161 ? -5.581  -25.540 9.840   1.00 37.35  ? 232 THR A CG2  1 
ATOM   2400 H H    . THR A 1 161 ? -9.370  -25.832 8.874   1.00 48.20  ? 232 THR A H    1 
ATOM   2401 H HA   . THR A 1 161 ? -7.124  -25.403 7.574   1.00 46.92  ? 232 THR A HA   1 
ATOM   2402 H HB   . THR A 1 161 ? -7.540  -25.881 10.318  1.00 45.79  ? 232 THR A HB   1 
ATOM   2403 H HG1  . THR A 1 161 ? -7.249  -23.681 10.402  1.00 45.51  ? 232 THR A HG1  1 
ATOM   2404 H HG21 . THR A 1 161 ? -5.291  -24.918 10.525  1.00 44.82  ? 232 THR A HG21 1 
ATOM   2405 H HG22 . THR A 1 161 ? -5.370  -26.442 10.127  1.00 44.82  ? 232 THR A HG22 1 
ATOM   2406 H HG23 . THR A 1 161 ? -5.102  -25.347 9.019   1.00 44.82  ? 232 THR A HG23 1 
ATOM   2407 N N    . LEU A 1 162 ? -7.482  -28.397 8.708   1.00 42.01  ? 233 LEU A N    1 
ATOM   2408 C CA   . LEU A 1 162 ? -7.023  -29.756 8.436   1.00 46.55  ? 233 LEU A CA   1 
ATOM   2409 C C    . LEU A 1 162 ? -7.074  -30.057 6.945   1.00 44.44  ? 233 LEU A C    1 
ATOM   2410 O O    . LEU A 1 162 ? -6.148  -30.675 6.401   1.00 44.54  ? 233 LEU A O    1 
ATOM   2411 C CB   . LEU A 1 162 ? -7.845  -30.786 9.211   1.00 52.90  ? 233 LEU A CB   1 
ATOM   2412 C CG   . LEU A 1 162 ? -7.427  -31.068 10.660  1.00 60.50  ? 233 LEU A CG   1 
ATOM   2413 C CD1  . LEU A 1 162 ? -8.339  -32.102 11.300  1.00 65.26  ? 233 LEU A CD1  1 
ATOM   2414 C CD2  . LEU A 1 162 ? -6.008  -31.558 10.748  1.00 62.76  ? 233 LEU A CD2  1 
ATOM   2415 H H    . LEU A 1 162 ? -8.134  -28.337 9.265   1.00 50.41  ? 233 LEU A H    1 
ATOM   2416 H HA   . LEU A 1 162 ? -6.099  -29.832 8.717   1.00 55.86  ? 233 LEU A HA   1 
ATOM   2417 H HB2  . LEU A 1 162 ? -8.765  -30.481 9.234   1.00 63.48  ? 233 LEU A HB2  1 
ATOM   2418 H HB3  . LEU A 1 162 ? -7.800  -31.628 8.732   1.00 63.48  ? 233 LEU A HB3  1 
ATOM   2419 H HG   . LEU A 1 162 ? -7.494  -30.248 11.174  1.00 72.60  ? 233 LEU A HG   1 
ATOM   2420 H HD11 . LEU A 1 162 ? -8.072  -32.230 12.224  1.00 78.31  ? 233 LEU A HD11 1 
ATOM   2421 H HD12 . LEU A 1 162 ? -9.254  -31.782 11.261  1.00 78.31  ? 233 LEU A HD12 1 
ATOM   2422 H HD13 . LEU A 1 162 ? -8.259  -32.937 10.813  1.00 78.31  ? 233 LEU A HD13 1 
ATOM   2423 H HD21 . LEU A 1 162 ? -5.856  -31.928 11.632  1.00 75.32  ? 233 LEU A HD21 1 
ATOM   2424 H HD22 . LEU A 1 162 ? -5.869  -32.242 10.075  1.00 75.32  ? 233 LEU A HD22 1 
ATOM   2425 H HD23 . LEU A 1 162 ? -5.405  -30.814 10.593  1.00 75.32  ? 233 LEU A HD23 1 
ATOM   2426 N N    . SER A 1 163 ? -8.122  -29.592 6.251   1.00 45.17  ? 234 SER A N    1 
ATOM   2427 C CA   . SER A 1 163 ? -8.215  -29.931 4.835   1.00 46.96  ? 234 SER A CA   1 
ATOM   2428 C C    . SER A 1 163 ? -7.073  -29.279 4.061   1.00 42.57  ? 234 SER A C    1 
ATOM   2429 O O    . SER A 1 163 ? -6.544  -29.884 3.119   1.00 42.98  ? 234 SER A O    1 
ATOM   2430 C CB   . SER A 1 163 ? -9.586  -29.541 4.257   1.00 53.29  ? 234 SER A CB   1 
ATOM   2431 O OG   . SER A 1 163 ? -9.705  -28.147 4.033   1.00 55.79  ? 234 SER A OG   1 
ATOM   2432 H H    . SER A 1 163 ? -8.759  -29.104 6.561   1.00 54.21  ? 234 SER A H    1 
ATOM   2433 H HA   . SER A 1 163 ? -8.121  -30.892 4.741   1.00 56.36  ? 234 SER A HA   1 
ATOM   2434 H HB2  . SER A 1 163 ? -9.709  -30.002 3.413   1.00 63.95  ? 234 SER A HB2  1 
ATOM   2435 H HB3  . SER A 1 163 ? -10.275 -29.815 4.882   1.00 63.95  ? 234 SER A HB3  1 
ATOM   2436 H HG   . SER A 1 163 ? -9.604  -27.730 4.755   1.00 66.94  ? 234 SER A HG   1 
ATOM   2437 N N    . ASN A 1 164 ? -6.645  -28.079 4.476   1.00 40.23  ? 235 ASN A N    1 
ATOM   2438 C CA   . ASN A 1 164 ? -5.536  -27.426 3.805   1.00 39.97  ? 235 ASN A CA   1 
ATOM   2439 C C    . ASN A 1 164 ? -4.209  -28.122 4.100   1.00 39.54  ? 235 ASN A C    1 
ATOM   2440 O O    . ASN A 1 164 ? -3.295  -28.031 3.282   1.00 40.50  ? 235 ASN A O    1 
ATOM   2441 C CB   . ASN A 1 164 ? -5.456  -25.945 4.195   1.00 42.41  ? 235 ASN A CB   1 
ATOM   2442 C CG   . ASN A 1 164 ? -6.243  -25.048 3.251   1.00 44.85  ? 235 ASN A CG   1 
ATOM   2443 O OD1  . ASN A 1 164 ? -6.876  -25.522 2.313   1.00 48.20  ? 235 ASN A OD1  1 
ATOM   2444 N ND2  . ASN A 1 164 ? -6.202  -23.747 3.495   1.00 43.56  ? 235 ASN A ND2  1 
ATOM   2445 H H    . ASN A 1 164 ? -6.979  -27.636 5.133   1.00 48.28  ? 235 ASN A H    1 
ATOM   2446 H HA   . ASN A 1 164 ? -5.681  -27.476 2.848   1.00 47.97  ? 235 ASN A HA   1 
ATOM   2447 H HB2  . ASN A 1 164 ? -5.818  -25.832 5.088   1.00 50.89  ? 235 ASN A HB2  1 
ATOM   2448 H HB3  . ASN A 1 164 ? -4.528  -25.662 4.174   1.00 50.89  ? 235 ASN A HB3  1 
ATOM   2449 H HD21 . ASN A 1 164 ? -6.631  -23.201 2.988   1.00 52.27  ? 235 ASN A HD21 1 
ATOM   2450 H HD22 . ASN A 1 164 ? -5.746  -23.448 4.160   1.00 52.27  ? 235 ASN A HD22 1 
ATOM   2451 N N    . LEU A 1 165 ? -4.091  -28.849 5.218   1.00 39.56  ? 236 LEU A N    1 
ATOM   2452 C CA   . LEU A 1 165 ? -2.884  -29.643 5.436   1.00 44.65  ? 236 LEU A CA   1 
ATOM   2453 C C    . LEU A 1 165 ? -2.819  -30.882 4.552   1.00 49.25  ? 236 LEU A C    1 
ATOM   2454 O O    . LEU A 1 165 ? -1.734  -31.450 4.396   1.00 55.04  ? 236 LEU A O    1 
ATOM   2455 C CB   . LEU A 1 165 ? -2.781  -30.080 6.895   1.00 46.99  ? 236 LEU A CB   1 
ATOM   2456 C CG   . LEU A 1 165 ? -2.719  -28.983 7.960   1.00 47.13  ? 236 LEU A CG   1 
ATOM   2457 C CD1  . LEU A 1 165 ? -2.568  -29.636 9.326   1.00 47.99  ? 236 LEU A CD1  1 
ATOM   2458 C CD2  . LEU A 1 165 ? -1.582  -28.016 7.671   1.00 44.92  ? 236 LEU A CD2  1 
ATOM   2459 H H    . LEU A 1 165 ? -4.677  -28.897 5.845   1.00 47.47  ? 236 LEU A H    1 
ATOM   2460 H HA   . LEU A 1 165 ? -2.110  -29.096 5.232   1.00 53.58  ? 236 LEU A HA   1 
ATOM   2461 H HB2  . LEU A 1 165 ? -3.554  -30.629 7.098   1.00 56.39  ? 236 LEU A HB2  1 
ATOM   2462 H HB3  . LEU A 1 165 ? -1.977  -30.615 6.991   1.00 56.39  ? 236 LEU A HB3  1 
ATOM   2463 H HG   . LEU A 1 165 ? -3.551  -28.484 7.953   1.00 56.56  ? 236 LEU A HG   1 
ATOM   2464 H HD11 . LEU A 1 165 ? -2.529  -28.943 10.004  1.00 57.59  ? 236 LEU A HD11 1 
ATOM   2465 H HD12 . LEU A 1 165 ? -3.331  -30.213 9.485   1.00 57.59  ? 236 LEU A HD12 1 
ATOM   2466 H HD13 . LEU A 1 165 ? -1.750  -30.157 9.338   1.00 57.59  ? 236 LEU A HD13 1 
ATOM   2467 H HD21 . LEU A 1 165 ? -1.486  -27.409 8.422   1.00 53.91  ? 236 LEU A HD21 1 
ATOM   2468 H HD22 . LEU A 1 165 ? -0.763  -28.521 7.546   1.00 53.91  ? 236 LEU A HD22 1 
ATOM   2469 H HD23 . LEU A 1 165 ? -1.788  -27.516 6.866   1.00 53.91  ? 236 LEU A HD23 1 
ATOM   2470 N N    . CYS A 1 166 ? -3.944  -31.326 3.999   1.00 47.83  ? 237 CYS A N    1 
ATOM   2471 C CA   . CYS A 1 166 ? -3.996  -32.431 3.041   1.00 49.00  ? 237 CYS A CA   1 
ATOM   2472 C C    . CYS A 1 166 ? -3.800  -31.989 1.597   1.00 47.01  ? 237 CYS A C    1 
ATOM   2473 O O    . CYS A 1 166 ? -3.542  -32.832 0.735   1.00 52.19  ? 237 CYS A O    1 
ATOM   2474 C CB   . CYS A 1 166 ? -5.349  -33.144 3.152   1.00 52.93  ? 237 CYS A CB   1 
ATOM   2475 S SG   . CYS A 1 166 ? -5.687  -33.812 4.803   1.00 56.00  ? 237 CYS A SG   1 
ATOM   2476 H H    . CYS A 1 166 ? -4.718  -30.992 4.169   1.00 57.40  ? 237 CYS A H    1 
ATOM   2477 H HA   . CYS A 1 166 ? -3.300  -33.071 3.257   1.00 58.80  ? 237 CYS A HA   1 
ATOM   2478 H HB2  . CYS A 1 166 ? -6.054  -32.513 2.937   1.00 63.52  ? 237 CYS A HB2  1 
ATOM   2479 H HB3  . CYS A 1 166 ? -5.366  -33.882 2.523   1.00 63.52  ? 237 CYS A HB3  1 
ATOM   2480 H HG   . CYS A 1 166 ? -5.663  -32.919 5.603   1.00 67.20  ? 237 CYS A HG   1 
ATOM   2481 N N    . ARG A 1 167 ? -3.910  -30.696 1.327   1.00 40.37  ? 238 ARG A N    1 
ATOM   2482 C CA   . ARG A 1 167 ? -3.995  -30.133 -0.007  1.00 42.09  ? 238 ARG A CA   1 
ATOM   2483 C C    . ARG A 1 167 ? -2.640  -30.009 -0.691  1.00 53.60  ? 238 ARG A C    1 
ATOM   2484 O O    . ARG A 1 167 ? -1.590  -29.915 -0.057  1.00 61.62  ? 238 ARG A O    1 
ATOM   2485 C CB   . ARG A 1 167 ? -4.604  -28.739 0.073   1.00 39.68  ? 238 ARG A CB   1 
ATOM   2486 C CG   . ARG A 1 167 ? -5.204  -28.234 -1.218  1.00 40.75  ? 238 ARG A CG   1 
ATOM   2487 C CD   . ARG A 1 167 ? -5.916  -26.925 -0.943  1.00 44.09  ? 238 ARG A CD   1 
ATOM   2488 N NE   . ARG A 1 167 ? -6.728  -26.510 -2.068  1.00 53.41  ? 238 ARG A NE   1 
ATOM   2489 C CZ   . ARG A 1 167 ? -7.723  -25.633 -1.980  1.00 63.35  ? 238 ARG A CZ   1 
ATOM   2490 N NH1  . ARG A 1 167 ? -8.041  -25.080 -0.803  1.00 63.35  ? 238 ARG A NH1  1 
ATOM   2491 N NH2  . ARG A 1 167 ? -8.405  -25.313 -3.075  1.00 71.13  ? 238 ARG A NH2  1 
ATOM   2492 H H    . ARG A 1 167 ? -3.939  -30.093 1.939   1.00 48.44  ? 238 ARG A H    1 
ATOM   2493 H HA   . ARG A 1 167 ? -4.568  -30.689 -0.557  1.00 50.51  ? 238 ARG A HA   1 
ATOM   2494 H HB2  . ARG A 1 167 ? -5.308  -28.748 0.741   1.00 47.61  ? 238 ARG A HB2  1 
ATOM   2495 H HB3  . ARG A 1 167 ? -3.911  -28.114 0.339   1.00 47.61  ? 238 ARG A HB3  1 
ATOM   2496 H HG2  . ARG A 1 167 ? -4.502  -28.076 -1.868  1.00 48.91  ? 238 ARG A HG2  1 
ATOM   2497 H HG3  . ARG A 1 167 ? -5.848  -28.876 -1.555  1.00 48.91  ? 238 ARG A HG3  1 
ATOM   2498 H HD2  . ARG A 1 167 ? -6.495  -27.036 -0.173  1.00 52.90  ? 238 ARG A HD2  1 
ATOM   2499 H HD3  . ARG A 1 167 ? -5.258  -26.233 -0.771  1.00 52.90  ? 238 ARG A HD3  1 
ATOM   2500 H HE   . ARG A 1 167 ? -6.500  -26.783 -2.851  1.00 64.09  ? 238 ARG A HE   1 
ATOM   2501 H HH11 . ARG A 1 167 ? -7.600  -25.284 -0.094  1.00 76.02  ? 238 ARG A HH11 1 
ATOM   2502 H HH12 . ARG A 1 167 ? -8.688  -24.515 -0.757  1.00 76.02  ? 238 ARG A HH12 1 
ATOM   2503 H HH21 . ARG A 1 167 ? -8.200  -25.672 -3.829  1.00 85.36  ? 238 ARG A HH21 1 
ATOM   2504 H HH22 . ARG A 1 167 ? -9.053  -24.750 -3.029  1.00 85.36  ? 238 ARG A HH22 1 
ATOM   2505 N N    . ASN A 1 168 ? -2.703  -29.948 -2.021  1.00 52.98  ? 239 ASN A N    1 
ATOM   2506 C CA   . ASN A 1 168 ? -1.585  -29.569 -2.884  1.00 53.68  ? 239 ASN A CA   1 
ATOM   2507 C C    . ASN A 1 168 ? -0.593  -30.709 -3.069  1.00 53.72  ? 239 ASN A C    1 
ATOM   2508 O O    . ASN A 1 168 ? -0.579  -31.670 -2.298  1.00 53.08  ? 239 ASN A O    1 
ATOM   2509 C CB   . ASN A 1 168 ? -0.870  -28.323 -2.349  1.00 53.02  ? 239 ASN A CB   1 
ATOM   2510 C CG   . ASN A 1 168 ? -1.701  -27.068 -2.521  1.00 52.00  ? 239 ASN A CG   1 
ATOM   2511 O OD1  . ASN A 1 168 ? -2.049  -26.376 -1.548  1.00 52.02  ? 239 ASN A OD1  1 
ATOM   2512 N ND2  . ASN A 1 168 ? -2.057  -26.784 -3.759  1.00 50.59  ? 239 ASN A ND2  1 
ATOM   2513 H H    . ASN A 1 168 ? -3.417  -30.131 -2.464  1.00 63.57  ? 239 ASN A H    1 
ATOM   2514 H HA   . ASN A 1 168 ? -1.938  -29.350 -3.761  1.00 64.41  ? 239 ASN A HA   1 
ATOM   2515 H HB2  . ASN A 1 168 ? -0.658  -28.421 -1.411  1.00 63.63  ? 239 ASN A HB2  1 
ATOM   2516 H HB3  . ASN A 1 168 ? -0.051  -28.200 -2.854  1.00 63.63  ? 239 ASN A HB3  1 
ATOM   2517 H HD21 . ASN A 1 168 ? -2.543  -26.092 -3.919  1.00 60.70  ? 239 ASN A HD21 1 
ATOM   2518 H HD22 . ASN A 1 168 ? -1.804  -27.290 -4.406  1.00 60.70  ? 239 ASN A HD22 1 
ATOM   2519 N N    . LYS A 1 169 ? 0.244   -30.592 -4.090  1.00 55.15  ? 240 LYS A N    1 
ATOM   2520 C CA   . LYS A 1 169 ? 1.128   -31.669 -4.523  1.00 61.25  ? 240 LYS A CA   1 
ATOM   2521 C C    . LYS A 1 169 ? 2.493   -31.076 -4.865  1.00 61.68  ? 240 LYS A C    1 
ATOM   2522 O O    . LYS A 1 169 ? 2.736   -29.875 -4.696  1.00 56.70  ? 240 LYS A O    1 
ATOM   2523 C CB   . LYS A 1 169 ? 0.529   -32.414 -5.720  1.00 68.88  ? 240 LYS A CB   1 
ATOM   2524 C CG   . LYS A 1 169 ? -0.707  -33.234 -5.386  1.00 75.47  ? 240 LYS A CG   1 
ATOM   2525 C CD   . LYS A 1 169 ? -1.103  -34.159 -6.544  1.00 83.05  ? 240 LYS A CD   1 
ATOM   2526 C CE   . LYS A 1 169 ? -1.698  -33.400 -7.723  1.00 88.75  ? 240 LYS A CE   1 
ATOM   2527 N NZ   . LYS A 1 169 ? -1.583  -34.193 -8.995  1.00 93.75  ? 240 LYS A NZ   1 
ATOM   2528 H H    . LYS A 1 169 ? 0.321   -29.878 -4.563  1.00 66.18  ? 240 LYS A H    1 
ATOM   2529 H HA   . LYS A 1 169 ? 1.245   -32.302 -3.798  1.00 73.50  ? 240 LYS A HA   1 
ATOM   2530 H HB2  . LYS A 1 169 ? 0.281   -31.764 -6.395  1.00 82.66  ? 240 LYS A HB2  1 
ATOM   2531 H HB3  . LYS A 1 169 ? 1.195   -33.021 -6.079  1.00 82.66  ? 240 LYS A HB3  1 
ATOM   2532 H HG2  . LYS A 1 169 ? -0.525  -33.783 -4.607  1.00 90.56  ? 240 LYS A HG2  1 
ATOM   2533 H HG3  . LYS A 1 169 ? -1.449  -32.635 -5.208  1.00 90.56  ? 240 LYS A HG3  1 
ATOM   2534 H HD2  . LYS A 1 169 ? -0.315  -34.630 -6.857  1.00 99.66  ? 240 LYS A HD2  1 
ATOM   2535 H HD3  . LYS A 1 169 ? -1.766  -34.793 -6.230  1.00 99.66  ? 240 LYS A HD3  1 
ATOM   2536 H HE2  . LYS A 1 169 ? -2.638  -33.232 -7.554  1.00 106.50 ? 240 LYS A HE2  1 
ATOM   2537 H HE3  . LYS A 1 169 ? -1.223  -32.563 -7.844  1.00 106.50 ? 240 LYS A HE3  1 
ATOM   2538 H HZ1  . LYS A 1 169 ? -1.935  -33.735 -9.672  1.00 112.50 ? 240 LYS A HZ1  1 
ATOM   2539 H HZ2  . LYS A 1 169 ? -0.727  -34.360 -9.173  1.00 112.50 ? 240 LYS A HZ2  1 
ATOM   2540 H HZ3  . LYS A 1 169 ? -2.017  -34.966 -8.912  1.00 112.50 ? 240 LYS A HZ3  1 
ATOM   2541 N N    . ASN A 1 170 ? 3.383   -31.933 -5.354  1.00 68.88  ? 241 ASN A N    1 
ATOM   2542 C CA   . ASN A 1 170 ? 4.735   -31.537 -5.769  1.00 73.90  ? 241 ASN A CA   1 
ATOM   2543 C C    . ASN A 1 170 ? 5.399   -30.640 -4.737  1.00 66.26  ? 241 ASN A C    1 
ATOM   2544 O O    . ASN A 1 170 ? 5.710   -29.479 -5.011  1.00 67.48  ? 241 ASN A O    1 
ATOM   2545 C CB   . ASN A 1 170 ? 4.693   -30.850 -7.127  1.00 84.57  ? 241 ASN A CB   1 
ATOM   2546 C CG   . ASN A 1 170 ? 4.431   -31.835 -8.262  1.00 95.31  ? 241 ASN A CG   1 
ATOM   2547 O OD1  . ASN A 1 170 ? 3.402   -31.771 -8.938  1.00 98.05  ? 241 ASN A OD1  1 
ATOM   2548 N ND2  . ASN A 1 170 ? 5.362   -32.763 -8.464  1.00 100.90 ? 241 ASN A ND2  1 
ATOM   2549 H H    . ASN A 1 170 ? 3.228   -32.772 -5.459  1.00 82.66  ? 241 ASN A H    1 
ATOM   2550 H HA   . ASN A 1 170 ? 5.279   -32.333 -5.867  1.00 88.68  ? 241 ASN A HA   1 
ATOM   2551 H HB2  . ASN A 1 170 ? 3.981   -30.191 -7.128  1.00 101.48 ? 241 ASN A HB2  1 
ATOM   2552 H HB3  . ASN A 1 170 ? 5.546   -30.420 -7.293  1.00 101.48 ? 241 ASN A HB3  1 
ATOM   2553 H HD21 . ASN A 1 170 ? 5.262   -33.343 -9.092  1.00 121.08 ? 241 ASN A HD21 1 
ATOM   2554 H HD22 . ASN A 1 170 ? 6.064   -32.784 -7.967  1.00 121.08 ? 241 ASN A HD22 1 
ATOM   2555 N N    . PRO A 1 171 ? 5.631   -31.187 -3.539  1.00 56.84  ? 242 PRO A N    1 
ATOM   2556 C CA   . PRO A 1 171 ? 5.293   -32.561 -3.133  1.00 53.35  ? 242 PRO A CA   1 
ATOM   2557 C C    . PRO A 1 171 ? 3.924   -32.698 -2.431  1.00 52.79  ? 242 PRO A C    1 
ATOM   2558 O O    . PRO A 1 171 ? 3.332   -31.706 -1.988  1.00 49.81  ? 242 PRO A O    1 
ATOM   2559 C CB   . PRO A 1 171 ? 6.413   -32.901 -2.165  1.00 50.05  ? 242 PRO A CB   1 
ATOM   2560 C CG   . PRO A 1 171 ? 6.715   -31.545 -1.484  1.00 48.76  ? 242 PRO A CG   1 
ATOM   2561 C CD   . PRO A 1 171 ? 6.370   -30.470 -2.483  1.00 51.33  ? 242 PRO A CD   1 
ATOM   2562 H HA   . PRO A 1 171 ? 5.335   -33.176 -3.880  1.00 64.02  ? 242 PRO A HA   1 
ATOM   2563 H HB2  . PRO A 1 171 ? 6.106   -33.555 -1.518  1.00 60.06  ? 242 PRO A HB2  1 
ATOM   2564 H HB3  . PRO A 1 171 ? 7.186   -33.226 -2.652  1.00 60.06  ? 242 PRO A HB3  1 
ATOM   2565 H HG2  . PRO A 1 171 ? 6.168   -31.455 -0.688  1.00 58.51  ? 242 PRO A HG2  1 
ATOM   2566 H HG3  . PRO A 1 171 ? 7.656   -31.503 -1.254  1.00 58.51  ? 242 PRO A HG3  1 
ATOM   2567 H HD2  . PRO A 1 171 ? 5.806   -29.797 -2.073  1.00 61.60  ? 242 PRO A HD2  1 
ATOM   2568 H HD3  . PRO A 1 171 ? 7.179   -30.078 -2.847  1.00 61.60  ? 242 PRO A HD3  1 
ATOM   2569 N N    . ALA A 1 172 ? 3.442   -33.938 -2.340  1.00 55.53  ? 243 ALA A N    1 
ATOM   2570 C CA   . ALA A 1 172 ? 2.253   -34.261 -1.578  1.00 53.46  ? 243 ALA A CA   1 
ATOM   2571 C C    . ALA A 1 172 ? 2.589   -34.191 -0.098  1.00 52.00  ? 243 ALA A C    1 
ATOM   2572 O O    . ALA A 1 172 ? 3.760   -34.168 0.267   1.00 52.09  ? 243 ALA A O    1 
ATOM   2573 C CB   . ALA A 1 172 ? 1.749   -35.656 -1.950  1.00 53.40  ? 243 ALA A CB   1 
ATOM   2574 H H    . ALA A 1 172 ? 3.800   -34.620 -2.723  1.00 66.63  ? 243 ALA A H    1 
ATOM   2575 H HA   . ALA A 1 172 ? 1.558   -33.615 -1.775  1.00 64.15  ? 243 ALA A HA   1 
ATOM   2576 H HB1  . ALA A 1 172 ? 0.945   -35.851 -1.445  1.00 64.07  ? 243 ALA A HB1  1 
ATOM   2577 H HB2  . ALA A 1 172 ? 1.555   -35.677 -2.900  1.00 64.07  ? 243 ALA A HB2  1 
ATOM   2578 H HB3  . ALA A 1 172 ? 2.438   -36.306 -1.739  1.00 64.07  ? 243 ALA A HB3  1 
ATOM   2579 N N    . PRO A 1 173 ? 1.582   -34.157 0.778   1.00 50.59  ? 244 PRO A N    1 
ATOM   2580 C CA   . PRO A 1 173 ? 1.866   -34.144 2.217   1.00 51.14  ? 244 PRO A CA   1 
ATOM   2581 C C    . PRO A 1 173 ? 2.638   -35.379 2.628   1.00 54.11  ? 244 PRO A C    1 
ATOM   2582 O O    . PRO A 1 173 ? 2.497   -36.450 2.012   1.00 52.43  ? 244 PRO A O    1 
ATOM   2583 C CB   . PRO A 1 173 ? 0.467   -34.129 2.850   1.00 50.28  ? 244 PRO A CB   1 
ATOM   2584 C CG   . PRO A 1 173 ? -0.451  -33.629 1.758   1.00 48.99  ? 244 PRO A CG   1 
ATOM   2585 C CD   . PRO A 1 173 ? 0.135   -34.118 0.490   1.00 49.09  ? 244 PRO A CD   1 
ATOM   2586 H HA   . PRO A 1 173 ? 2.347   -33.339 2.457   1.00 61.37  ? 244 PRO A HA   1 
ATOM   2587 H HB2  . PRO A 1 173 ? 0.221   -35.027 3.121   1.00 60.34  ? 244 PRO A HB2  1 
ATOM   2588 H HB3  . PRO A 1 173 ? 0.458   -33.526 3.609   1.00 60.34  ? 244 PRO A HB3  1 
ATOM   2589 H HG2  . PRO A 1 173 ? -1.340  -33.995 1.887   1.00 58.79  ? 244 PRO A HG2  1 
ATOM   2590 H HG3  . PRO A 1 173 ? -0.475  -32.659 1.772   1.00 58.79  ? 244 PRO A HG3  1 
ATOM   2591 H HD2  . PRO A 1 173 ? -0.195  -35.007 0.288   1.00 58.91  ? 244 PRO A HD2  1 
ATOM   2592 H HD3  . PRO A 1 173 ? -0.054  -33.495 -0.229  1.00 58.91  ? 244 PRO A HD3  1 
ATOM   2593 N N    . PRO A 1 174 ? 3.444   -35.293 3.686   1.00 55.24  ? 245 PRO A N    1 
ATOM   2594 C CA   . PRO A 1 174 ? 4.206   -36.473 4.120   1.00 58.19  ? 245 PRO A CA   1 
ATOM   2595 C C    . PRO A 1 174 ? 3.292   -37.595 4.594   1.00 58.72  ? 245 PRO A C    1 
ATOM   2596 O O    . PRO A 1 174 ? 2.281   -37.357 5.255   1.00 59.29  ? 245 PRO A O    1 
ATOM   2597 C CB   . PRO A 1 174 ? 5.062   -35.939 5.269   1.00 58.14  ? 245 PRO A CB   1 
ATOM   2598 C CG   . PRO A 1 174 ? 4.956   -34.479 5.209   1.00 57.75  ? 245 PRO A CG   1 
ATOM   2599 C CD   . PRO A 1 174 ? 3.651   -34.155 4.591   1.00 56.99  ? 245 PRO A CD   1 
ATOM   2600 H HA   . PRO A 1 174 ? 4.779   -36.794 3.406   1.00 69.83  ? 245 PRO A HA   1 
ATOM   2601 H HB2  . PRO A 1 174 ? 4.716   -36.271 6.112   1.00 69.78  ? 245 PRO A HB2  1 
ATOM   2602 H HB3  . PRO A 1 174 ? 5.982   -36.219 5.145   1.00 69.78  ? 245 PRO A HB3  1 
ATOM   2603 H HG2  . PRO A 1 174 ? 5.001   -34.118 6.108   1.00 69.31  ? 245 PRO A HG2  1 
ATOM   2604 H HG3  . PRO A 1 174 ? 5.681   -34.127 4.668   1.00 69.31  ? 245 PRO A HG3  1 
ATOM   2605 H HD2  . PRO A 1 174 ? 2.953   -34.122 5.264   1.00 68.38  ? 245 PRO A HD2  1 
ATOM   2606 H HD3  . PRO A 1 174 ? 3.715   -33.323 4.098   1.00 68.38  ? 245 PRO A HD3  1 
ATOM   2607 N N    . LEU A 1 175 ? 3.668   -38.833 4.270   1.00 60.13  ? 246 LEU A N    1 
ATOM   2608 C CA   . LEU A 1 175 ? 2.822   -39.972 4.614   1.00 62.07  ? 246 LEU A CA   1 
ATOM   2609 C C    . LEU A 1 175 ? 2.557   -40.046 6.111   1.00 61.93  ? 246 LEU A C    1 
ATOM   2610 O O    . LEU A 1 175 ? 1.445   -40.387 6.529   1.00 58.39  ? 246 LEU A O    1 
ATOM   2611 C CB   . LEU A 1 175 ? 3.460   -41.268 4.133   1.00 68.65  ? 246 LEU A CB   1 
ATOM   2612 C CG   . LEU A 1 175 ? 3.459   -41.483 2.622   1.00 75.80  ? 246 LEU A CG   1 
ATOM   2613 C CD1  . LEU A 1 175 ? 4.194   -42.774 2.315   1.00 82.41  ? 246 LEU A CD1  1 
ATOM   2614 C CD2  . LEU A 1 175 ? 2.054   -41.520 2.030   1.00 75.06  ? 246 LEU A CD2  1 
ATOM   2615 H H    . LEU A 1 175 ? 4.395   -39.036 3.858   1.00 72.15  ? 246 LEU A H    1 
ATOM   2616 H HA   . LEU A 1 175 ? 1.966   -39.872 4.170   1.00 74.48  ? 246 LEU A HA   1 
ATOM   2617 H HB2  . LEU A 1 175 ? 4.384   -41.282 4.428   1.00 82.37  ? 246 LEU A HB2  1 
ATOM   2618 H HB3  . LEU A 1 175 ? 2.982   -42.011 4.532   1.00 82.37  ? 246 LEU A HB3  1 
ATOM   2619 H HG   . LEU A 1 175 ? 3.942   -40.756 2.200   1.00 90.96  ? 246 LEU A HG   1 
ATOM   2620 H HD11 . LEU A 1 175 ? 4.196   -42.915 1.355   1.00 98.89  ? 246 LEU A HD11 1 
ATOM   2621 H HD12 . LEU A 1 175 ? 5.105   -42.704 2.642   1.00 98.89  ? 246 LEU A HD12 1 
ATOM   2622 H HD13 . LEU A 1 175 ? 3.739   -43.508 2.757   1.00 98.89  ? 246 LEU A HD13 1 
ATOM   2623 H HD21 . LEU A 1 175 ? 2.113   -41.772 1.095   1.00 90.08  ? 246 LEU A HD21 1 
ATOM   2624 H HD22 . LEU A 1 175 ? 1.527   -42.173 2.516   1.00 90.08  ? 246 LEU A HD22 1 
ATOM   2625 H HD23 . LEU A 1 175 ? 1.651   -40.642 2.111   1.00 90.08  ? 246 LEU A HD23 1 
ATOM   2626 N N    . ASP A 1 176 ? 3.565   -39.751 6.934   1.00 67.91  ? 247 ASP A N    1 
ATOM   2627 C CA   . ASP A 1 176 ? 3.371   -39.734 8.382   1.00 74.53  ? 247 ASP A CA   1 
ATOM   2628 C C    . ASP A 1 176 ? 2.219   -38.822 8.764   1.00 63.80  ? 247 ASP A C    1 
ATOM   2629 O O    . ASP A 1 176 ? 1.375   -39.175 9.591   1.00 64.43  ? 247 ASP A O    1 
ATOM   2630 C CB   . ASP A 1 176 ? 4.642   -39.262 9.085   1.00 90.68  ? 247 ASP A CB   1 
ATOM   2631 C CG   . ASP A 1 176 ? 5.798   -40.200 8.886   1.00 107.81 ? 247 ASP A CG   1 
ATOM   2632 O OD1  . ASP A 1 176 ? 5.552   -41.392 8.609   1.00 116.40 ? 247 ASP A OD1  1 
ATOM   2633 O OD2  . ASP A 1 176 ? 6.953   -39.742 9.018   1.00 112.08 ? 247 ASP A OD2  1 
ATOM   2634 H H    . ASP A 1 176 ? 4.364   -39.559 6.680   1.00 81.48  ? 247 ASP A H    1 
ATOM   2635 H HA   . ASP A 1 176 ? 3.166   -40.631 8.690   1.00 89.43  ? 247 ASP A HA   1 
ATOM   2636 H HB2  . ASP A 1 176 ? 4.895   -38.395 8.732   1.00 108.82 ? 247 ASP A HB2  1 
ATOM   2637 H HB3  . ASP A 1 176 ? 4.470   -39.195 10.037  1.00 108.82 ? 247 ASP A HB3  1 
ATOM   2638 N N    . ALA A 1 177 ? 2.191   -37.622 8.184   1.00 58.37  ? 248 ALA A N    1 
ATOM   2639 C CA   . ALA A 1 177 ? 1.154   -36.659 8.518   1.00 53.49  ? 248 ALA A CA   1 
ATOM   2640 C C    . ALA A 1 177 ? -0.217  -37.149 8.061   1.00 52.11  ? 248 ALA A C    1 
ATOM   2641 O O    . ALA A 1 177 ? -1.210  -37.025 8.791   1.00 49.22  ? 248 ALA A O    1 
ATOM   2642 C CB   . ALA A 1 177 ? 1.493   -35.305 7.894   1.00 52.89  ? 248 ALA A CB   1 
ATOM   2643 H H    . ALA A 1 177 ? 2.758   -37.347 7.599   1.00 70.05  ? 248 ALA A H    1 
ATOM   2644 H HA   . ALA A 1 177 ? 1.126   -36.547 9.481   1.00 64.19  ? 248 ALA A HA   1 
ATOM   2645 H HB1  . ALA A 1 177 ? 0.761   -34.691 8.058   1.00 63.47  ? 248 ALA A HB1  1 
ATOM   2646 H HB2  . ALA A 1 177 ? 2.308   -34.966 8.296   1.00 63.47  ? 248 ALA A HB2  1 
ATOM   2647 H HB3  . ALA A 1 177 ? 1.616   -35.421 6.939   1.00 63.47  ? 248 ALA A HB3  1 
ATOM   2648 N N    . VAL A 1 178 ? -0.294  -37.729 6.864   1.00 55.17  ? 249 VAL A N    1 
ATOM   2649 C CA   . VAL A 1 178 ? -1.577  -38.212 6.376   1.00 56.73  ? 249 VAL A CA   1 
ATOM   2650 C C    . VAL A 1 178 ? -2.110  -39.301 7.299   1.00 57.86  ? 249 VAL A C    1 
ATOM   2651 O O    . VAL A 1 178 ? -3.275  -39.270 7.730   1.00 56.60  ? 249 VAL A O    1 
ATOM   2652 C CB   . VAL A 1 178 ? -1.441  -38.702 4.927   1.00 56.15  ? 249 VAL A CB   1 
ATOM   2653 C CG1  . VAL A 1 178 ? -2.768  -39.275 4.405   1.00 55.11  ? 249 VAL A CG1  1 
ATOM   2654 C CG2  . VAL A 1 178 ? -0.981  -37.556 4.046   1.00 56.83  ? 249 VAL A CG2  1 
ATOM   2655 H H    . VAL A 1 178 ? 0.368   -37.852 6.329   1.00 66.20  ? 249 VAL A H    1 
ATOM   2656 H HA   . VAL A 1 178 ? -2.212  -37.479 6.384   1.00 68.07  ? 249 VAL A HA   1 
ATOM   2657 H HB   . VAL A 1 178 ? -0.770  -39.401 4.888   1.00 67.38  ? 249 VAL A HB   1 
ATOM   2658 H HG11 . VAL A 1 178 ? -2.638  -39.588 3.496   1.00 66.13  ? 249 VAL A HG11 1 
ATOM   2659 H HG12 . VAL A 1 178 ? -3.049  -40.011 4.969   1.00 66.13  ? 249 VAL A HG12 1 
ATOM   2660 H HG13 . VAL A 1 178 ? -3.439  -38.575 4.420   1.00 66.13  ? 249 VAL A HG13 1 
ATOM   2661 H HG21 . VAL A 1 178 ? -0.992  -37.846 3.121   1.00 68.19  ? 249 VAL A HG21 1 
ATOM   2662 H HG22 . VAL A 1 178 ? -1.584  -36.806 4.165   1.00 68.19  ? 249 VAL A HG22 1 
ATOM   2663 H HG23 . VAL A 1 178 ? -0.081  -37.300 4.302   1.00 68.19  ? 249 VAL A HG23 1 
ATOM   2664 N N    . GLU A 1 179 ? -1.261  -40.278 7.633   1.00 62.91  ? 250 GLU A N    1 
ATOM   2665 C CA   . GLU A 1 179 ? -1.707  -41.355 8.503   1.00 65.38  ? 250 GLU A CA   1 
ATOM   2666 C C    . GLU A 1 179 ? -2.110  -40.829 9.875   1.00 61.98  ? 250 GLU A C    1 
ATOM   2667 O O    . GLU A 1 179 ? -3.018  -41.377 10.507  1.00 62.88  ? 250 GLU A O    1 
ATOM   2668 C CB   . GLU A 1 179 ? -0.619  -42.417 8.629   1.00 74.17  ? 250 GLU A CB   1 
ATOM   2669 C CG   . GLU A 1 179 ? -1.098  -43.673 9.333   1.00 85.28  ? 250 GLU A CG   1 
ATOM   2670 C CD   . GLU A 1 179 ? -2.434  -44.194 8.773   1.00 93.92  ? 250 GLU A CD   1 
ATOM   2671 O OE1  . GLU A 1 179 ? -2.496  -44.563 7.575   1.00 98.59  ? 250 GLU A OE1  1 
ATOM   2672 O OE2  . GLU A 1 179 ? -3.430  -44.209 9.532   1.00 95.07  ? 250 GLU A OE2  1 
ATOM   2673 H H    . GLU A 1 179 ? -0.443  -40.336 7.374   1.00 75.49  ? 250 GLU A H    1 
ATOM   2674 H HA   . GLU A 1 179 ? -2.490  -41.757 8.099   1.00 78.46  ? 250 GLU A HA   1 
ATOM   2675 H HB2  . GLU A 1 179 ? -0.318  -42.667 7.741   1.00 89.01  ? 250 GLU A HB2  1 
ATOM   2676 H HB3  . GLU A 1 179 ? 0.121   -42.052 9.139   1.00 89.01  ? 250 GLU A HB3  1 
ATOM   2677 H HG2  . GLU A 1 179 ? -0.433  -44.371 9.222   1.00 102.33 ? 250 GLU A HG2  1 
ATOM   2678 H HG3  . GLU A 1 179 ? -1.222  -43.480 10.275  1.00 102.33 ? 250 GLU A HG3  1 
ATOM   2679 N N    . GLN A 1 180 ? -1.486  -39.748 10.337  1.00 57.95  ? 251 GLN A N    1 
ATOM   2680 C CA   . GLN A 1 180 ? -1.878  -39.171 11.617  1.00 59.23  ? 251 GLN A CA   1 
ATOM   2681 C C    . GLN A 1 180 ? -3.230  -38.465 11.537  1.00 57.07  ? 251 GLN A C    1 
ATOM   2682 O O    . GLN A 1 180 ? -3.988  -38.466 12.511  1.00 56.68  ? 251 GLN A O    1 
ATOM   2683 C CB   . GLN A 1 180 ? -0.802  -38.198 12.074  1.00 63.93  ? 251 GLN A CB   1 
ATOM   2684 C CG   . GLN A 1 180 ? -0.983  -37.675 13.475  1.00 69.29  ? 251 GLN A CG   1 
ATOM   2685 C CD   . GLN A 1 180 ? 0.169   -36.760 13.907  1.00 72.90  ? 251 GLN A CD   1 
ATOM   2686 O OE1  . GLN A 1 180 ? 1.122   -36.540 13.152  1.00 71.01  ? 251 GLN A OE1  1 
ATOM   2687 N NE2  . GLN A 1 180 ? 0.076   -36.222 15.121  1.00 76.89  ? 251 GLN A NE2  1 
ATOM   2688 H H    . GLN A 1 180 ? -0.845  -39.337 9.937   1.00 69.54  ? 251 GLN A H    1 
ATOM   2689 H HA   . GLN A 1 180 ? -1.946  -39.878 12.277  1.00 71.08  ? 251 GLN A HA   1 
ATOM   2690 H HB2  . GLN A 1 180 ? 0.057   -38.646 12.037  1.00 76.72  ? 251 GLN A HB2  1 
ATOM   2691 H HB3  . GLN A 1 180 ? -0.799  -37.436 11.474  1.00 76.72  ? 251 GLN A HB3  1 
ATOM   2692 H HG2  . GLN A 1 180 ? -1.806  -37.164 13.520  1.00 83.15  ? 251 GLN A HG2  1 
ATOM   2693 H HG3  . GLN A 1 180 ? -1.021  -38.423 14.091  1.00 83.15  ? 251 GLN A HG3  1 
ATOM   2694 H HE21 . GLN A 1 180 ? -0.605  -36.395 15.617  1.00 92.27  ? 251 GLN A HE21 1 
ATOM   2695 H HE22 . GLN A 1 180 ? 0.697   -35.702 15.409  1.00 92.27  ? 251 GLN A HE22 1 
ATOM   2696 N N    . ILE A 1 181 ? -3.541  -37.849 10.394  1.00 55.96  ? 252 ILE A N    1 
ATOM   2697 C CA   . ILE A 1 181 ? -4.752  -37.049 10.258  1.00 50.23  ? 252 ILE A CA   1 
ATOM   2698 C C    . ILE A 1 181 ? -5.972  -37.890 9.900   1.00 47.37  ? 252 ILE A C    1 
ATOM   2699 O O    . ILE A 1 181 ? -7.096  -37.494 10.203  1.00 44.29  ? 252 ILE A O    1 
ATOM   2700 C CB   . ILE A 1 181 ? -4.534  -35.956 9.201   1.00 47.68  ? 252 ILE A CB   1 
ATOM   2701 C CG1  . ILE A 1 181 ? -3.552  -34.937 9.722   1.00 48.84  ? 252 ILE A CG1  1 
ATOM   2702 C CG2  . ILE A 1 181 ? -5.869  -35.265 8.832   1.00 46.35  ? 252 ILE A CG2  1 
ATOM   2703 C CD1  . ILE A 1 181 ? -3.090  -33.967 8.635   1.00 50.83  ? 252 ILE A CD1  1 
ATOM   2704 H H    . ILE A 1 181 ? -3.062  -37.881 9.681   1.00 67.15  ? 252 ILE A H    1 
ATOM   2705 H HA   . ILE A 1 181 ? -4.933  -36.611 11.104  1.00 60.27  ? 252 ILE A HA   1 
ATOM   2706 H HB   . ILE A 1 181 ? -4.164  -36.365 8.403   1.00 57.22  ? 252 ILE A HB   1 
ATOM   2707 H HG12 . ILE A 1 181 ? -3.974  -34.421 10.426  1.00 58.61  ? 252 ILE A HG12 1 
ATOM   2708 H HG13 . ILE A 1 181 ? -2.770  -35.395 10.068  1.00 58.61  ? 252 ILE A HG13 1 
ATOM   2709 H HG21 . ILE A 1 181 ? -5.687  -34.443 8.353   1.00 55.62  ? 252 ILE A HG21 1 
ATOM   2710 H HG22 . ILE A 1 181 ? -6.390  -35.858 8.268   1.00 55.62  ? 252 ILE A HG22 1 
ATOM   2711 H HG23 . ILE A 1 181 ? -6.357  -35.069 9.647   1.00 55.62  ? 252 ILE A HG23 1 
ATOM   2712 H HD11 . ILE A 1 181 ? -2.321  -33.473 8.957   1.00 61.00  ? 252 ILE A HD11 1 
ATOM   2713 H HD12 . ILE A 1 181 ? -2.850  -34.473 7.843   1.00 61.00  ? 252 ILE A HD12 1 
ATOM   2714 H HD13 . ILE A 1 181 ? -3.810  -33.352 8.428   1.00 61.00  ? 252 ILE A HD13 1 
ATOM   2715 N N    . LEU A 1 182 ? -5.788  -39.020 9.223   1.00 50.34  ? 253 LEU A N    1 
ATOM   2716 C CA   . LEU A 1 182 ? -6.925  -39.738 8.647   1.00 54.61  ? 253 LEU A CA   1 
ATOM   2717 C C    . LEU A 1 182 ? -7.983  -40.139 9.662   1.00 54.78  ? 253 LEU A C    1 
ATOM   2718 O O    . LEU A 1 182 ? -9.177  -39.980 9.365   1.00 52.90  ? 253 LEU A O    1 
ATOM   2719 C CB   . LEU A 1 182 ? -6.433  -40.979 7.899   1.00 59.37  ? 253 LEU A CB   1 
ATOM   2720 C CG   . LEU A 1 182 ? -6.272  -40.788 6.396   1.00 62.49  ? 253 LEU A CG   1 
ATOM   2721 C CD1  . LEU A 1 182 ? -5.519  -41.977 5.829   1.00 66.05  ? 253 LEU A CD1  1 
ATOM   2722 C CD2  . LEU A 1 182 ? -7.647  -40.615 5.710   1.00 60.95  ? 253 LEU A CD2  1 
ATOM   2723 H H    . LEU A 1 182 ? -5.024  -39.389 9.083   1.00 60.41  ? 253 LEU A H    1 
ATOM   2724 H HA   . LEU A 1 182 ? -7.353  -39.155 8.002   1.00 65.53  ? 253 LEU A HA   1 
ATOM   2725 H HB2  . LEU A 1 182 ? -5.569  -41.237 8.257   1.00 71.24  ? 253 LEU A HB2  1 
ATOM   2726 H HB3  . LEU A 1 182 ? -7.071  -41.697 8.037   1.00 71.24  ? 253 LEU A HB3  1 
ATOM   2727 H HG   . LEU A 1 182 ? -5.747  -39.989 6.230   1.00 74.99  ? 253 LEU A HG   1 
ATOM   2728 H HD11 . LEU A 1 182 ? -5.426  -41.863 4.870   1.00 79.26  ? 253 LEU A HD11 1 
ATOM   2729 H HD12 . LEU A 1 182 ? -4.643  -42.022 6.243   1.00 79.26  ? 253 LEU A HD12 1 
ATOM   2730 H HD13 . LEU A 1 182 ? -6.018  -42.787 6.020   1.00 79.26  ? 253 LEU A HD13 1 
ATOM   2731 H HD21 . LEU A 1 182 ? -7.520  -40.609 4.749   1.00 73.14  ? 253 LEU A HD21 1 
ATOM   2732 H HD22 . LEU A 1 182 ? -8.221  -41.355 5.963   1.00 73.14  ? 253 LEU A HD22 1 
ATOM   2733 H HD23 . LEU A 1 182 ? -8.043  -39.777 5.995   1.00 73.14  ? 253 LEU A HD23 1 
ATOM   2734 N N    . PRO A 1 183 ? -7.647  -40.709 10.819  1.00 57.36  ? 254 PRO A N    1 
ATOM   2735 C CA   . PRO A 1 183 ? -8.708  -41.086 11.772  1.00 54.88  ? 254 PRO A CA   1 
ATOM   2736 C C    . PRO A 1 183 ? -9.629  -39.933 12.142  1.00 53.66  ? 254 PRO A C    1 
ATOM   2737 O O    . PRO A 1 183 ? -10.850 -40.114 12.216  1.00 54.27  ? 254 PRO A O    1 
ATOM   2738 C CB   . PRO A 1 183 ? -7.915  -41.597 12.984  1.00 54.36  ? 254 PRO A CB   1 
ATOM   2739 C CG   . PRO A 1 183 ? -6.662  -42.132 12.391  1.00 55.81  ? 254 PRO A CG   1 
ATOM   2740 C CD   . PRO A 1 183 ? -6.324  -41.197 11.250  1.00 57.89  ? 254 PRO A CD   1 
ATOM   2741 H HA   . PRO A 1 183 ? -9.239  -41.813 11.410  1.00 65.86  ? 254 PRO A HA   1 
ATOM   2742 H HB2  . PRO A 1 183 ? -7.726  -40.863 13.589  1.00 65.23  ? 254 PRO A HB2  1 
ATOM   2743 H HB3  . PRO A 1 183 ? -8.413  -42.298 13.433  1.00 65.23  ? 254 PRO A HB3  1 
ATOM   2744 H HG2  . PRO A 1 183 ? -5.958  -42.126 13.058  1.00 66.98  ? 254 PRO A HG2  1 
ATOM   2745 H HG3  . PRO A 1 183 ? -6.815  -43.032 12.062  1.00 66.98  ? 254 PRO A HG3  1 
ATOM   2746 H HD2  . PRO A 1 183 ? -5.777  -40.461 11.565  1.00 69.47  ? 254 PRO A HD2  1 
ATOM   2747 H HD3  . PRO A 1 183 ? -5.890  -41.683 10.532  1.00 69.47  ? 254 PRO A HD3  1 
ATOM   2748 N N    . THR A 1 184 ? -9.081  -38.748 12.387  1.00 49.41  ? 255 THR A N    1 
ATOM   2749 C CA   . THR A 1 184 ? -9.935  -37.610 12.692  1.00 50.27  ? 255 THR A CA   1 
ATOM   2750 C C    . THR A 1 184 ? -10.781 -37.239 11.485  1.00 52.13  ? 255 THR A C    1 
ATOM   2751 O O    . THR A 1 184 ? -11.954 -36.871 11.621  1.00 51.20  ? 255 THR A O    1 
ATOM   2752 C CB   . THR A 1 184 ? -9.073  -36.441 13.139  1.00 51.52  ? 255 THR A CB   1 
ATOM   2753 O OG1  . THR A 1 184 ? -8.334  -36.850 14.292  1.00 54.26  ? 255 THR A OG1  1 
ATOM   2754 C CG2  . THR A 1 184 ? -9.912  -35.228 13.479  1.00 50.00  ? 255 THR A CG2  1 
ATOM   2755 H H    . THR A 1 184 ? -8.238  -38.580 12.383  1.00 59.29  ? 255 THR A H    1 
ATOM   2756 H HA   . THR A 1 184 ? -10.531 -37.844 13.420  1.00 60.33  ? 255 THR A HA   1 
ATOM   2757 H HB   . THR A 1 184 ? -8.458  -36.201 12.428  1.00 61.83  ? 255 THR A HB   1 
ATOM   2758 H HG1  . THR A 1 184 ? -8.045  -36.178 14.704  1.00 65.11  ? 255 THR A HG1  1 
ATOM   2759 H HG21 . THR A 1 184 ? -9.363  -34.560 13.918  1.00 60.00  ? 255 THR A HG21 1 
ATOM   2760 H HG22 . THR A 1 184 ? -10.288 -34.844 12.671  1.00 60.00  ? 255 THR A HG22 1 
ATOM   2761 H HG23 . THR A 1 184 ? -10.634 -35.481 14.075  1.00 60.00  ? 255 THR A HG23 1 
ATOM   2762 N N    . LEU A 1 185 ? -10.207 -37.359 10.294  1.00 57.51  ? 256 LEU A N    1 
ATOM   2763 C CA   . LEU A 1 185 ? -10.944 -37.060 9.074   1.00 59.78  ? 256 LEU A CA   1 
ATOM   2764 C C    . LEU A 1 185 ? -12.126 -38.006 8.891   1.00 58.34  ? 256 LEU A C    1 
ATOM   2765 O O    . LEU A 1 185 ? -13.184 -37.605 8.385   1.00 58.31  ? 256 LEU A O    1 
ATOM   2766 C CB   . LEU A 1 185 ? -9.987  -37.150 7.888   1.00 61.47  ? 256 LEU A CB   1 
ATOM   2767 C CG   . LEU A 1 185 ? -10.204 -36.180 6.744   1.00 62.45  ? 256 LEU A CG   1 
ATOM   2768 C CD1  . LEU A 1 185 ? -10.183 -34.719 7.226   1.00 63.32  ? 256 LEU A CD1  1 
ATOM   2769 C CD2  . LEU A 1 185 ? -9.106  -36.440 5.707   1.00 62.51  ? 256 LEU A CD2  1 
ATOM   2770 H H    . LEU A 1 185 ? -9.395  -37.612 10.167  1.00 69.01  ? 256 LEU A H    1 
ATOM   2771 H HA   . LEU A 1 185 ? -11.291 -36.157 9.129   1.00 71.73  ? 256 LEU A HA   1 
ATOM   2772 H HB2  . LEU A 1 185 ? -9.086  -37.004 8.215   1.00 73.76  ? 256 LEU A HB2  1 
ATOM   2773 H HB3  . LEU A 1 185 ? -10.050 -38.045 7.518   1.00 73.76  ? 256 LEU A HB3  1 
ATOM   2774 H HG   . LEU A 1 185 ? -11.064 -36.355 6.331   1.00 74.95  ? 256 LEU A HG   1 
ATOM   2775 H HD11 . LEU A 1 185 ? -10.051 -34.138 6.460   1.00 75.98  ? 256 LEU A HD11 1 
ATOM   2776 H HD12 . LEU A 1 185 ? -11.029 -34.513 7.654   1.00 75.98  ? 256 LEU A HD12 1 
ATOM   2777 H HD13 . LEU A 1 185 ? -9.454  -34.605 7.856   1.00 75.98  ? 256 LEU A HD13 1 
ATOM   2778 H HD21 . LEU A 1 185 ? -9.269  -35.885 4.929   1.00 75.02  ? 256 LEU A HD21 1 
ATOM   2779 H HD22 . LEU A 1 185 ? -8.245  -36.220 6.097   1.00 75.02  ? 256 LEU A HD22 1 
ATOM   2780 H HD23 . LEU A 1 185 ? -9.126  -37.376 5.454   1.00 75.02  ? 256 LEU A HD23 1 
ATOM   2781 N N    . VAL A 1 186 ? -11.962 -39.271 9.286   1.00 57.68  ? 257 VAL A N    1 
ATOM   2782 C CA   . VAL A 1 186 ? -13.066 -40.220 9.194   1.00 57.92  ? 257 VAL A CA   1 
ATOM   2783 C C    . VAL A 1 186 ? -14.210 -39.791 10.104  1.00 57.20  ? 257 VAL A C    1 
ATOM   2784 O O    . VAL A 1 186 ? -15.379 -39.811 9.707   1.00 58.55  ? 257 VAL A O    1 
ATOM   2785 C CB   . VAL A 1 186 ? -12.579 -41.642 9.527   1.00 60.93  ? 257 VAL A CB   1 
ATOM   2786 C CG1  . VAL A 1 186 ? -13.761 -42.604 9.629   1.00 62.60  ? 257 VAL A CG1  1 
ATOM   2787 C CG2  . VAL A 1 186 ? -11.608 -42.122 8.455   1.00 60.20  ? 257 VAL A CG2  1 
ATOM   2788 H H    . VAL A 1 186 ? -11.233 -39.598 9.605   1.00 69.21  ? 257 VAL A H    1 
ATOM   2789 H HA   . VAL A 1 186 ? -13.398 -40.226 8.283   1.00 69.51  ? 257 VAL A HA   1 
ATOM   2790 H HB   . VAL A 1 186 ? -12.116 -41.633 10.379  1.00 73.11  ? 257 VAL A HB   1 
ATOM   2791 H HG11 . VAL A 1 186 ? -13.430 -43.514 9.584   1.00 75.13  ? 257 VAL A HG11 1 
ATOM   2792 H HG12 . VAL A 1 186 ? -14.216 -42.461 10.474  1.00 75.13  ? 257 VAL A HG12 1 
ATOM   2793 H HG13 . VAL A 1 186 ? -14.368 -42.437 8.891   1.00 75.13  ? 257 VAL A HG13 1 
ATOM   2794 H HG21 . VAL A 1 186 ? -11.367 -43.044 8.636   1.00 72.24  ? 257 VAL A HG21 1 
ATOM   2795 H HG22 . VAL A 1 186 ? -12.039 -42.056 7.589   1.00 72.24  ? 257 VAL A HG22 1 
ATOM   2796 H HG23 . VAL A 1 186 ? -10.816 -41.563 8.473   1.00 72.24  ? 257 VAL A HG23 1 
ATOM   2797 N N    . ARG A 1 187 ? -13.895 -39.392 11.334  1.00 54.52  ? 258 ARG A N    1 
ATOM   2798 C CA   . ARG A 1 187 ? -14.936 -38.912 12.235  1.00 55.98  ? 258 ARG A CA   1 
ATOM   2799 C C    . ARG A 1 187 ? -15.637 -37.699 11.643  1.00 53.54  ? 258 ARG A C    1 
ATOM   2800 O O    . ARG A 1 187 ? -16.867 -37.606 11.678  1.00 50.60  ? 258 ARG A O    1 
ATOM   2801 C CB   . ARG A 1 187 ? -14.348 -38.566 13.602  1.00 61.63  ? 258 ARG A CB   1 
ATOM   2802 C CG   . ARG A 1 187 ? -13.826 -39.754 14.414  1.00 67.06  ? 258 ARG A CG   1 
ATOM   2803 C CD   . ARG A 1 187 ? -13.239 -39.277 15.736  1.00 71.30  ? 258 ARG A CD   1 
ATOM   2804 N NE   . ARG A 1 187 ? -14.272 -38.693 16.587  1.00 75.45  ? 258 ARG A NE   1 
ATOM   2805 C CZ   . ARG A 1 187 ? -14.066 -37.740 17.493  1.00 79.32  ? 258 ARG A CZ   1 
ATOM   2806 N NH1  . ARG A 1 187 ? -12.851 -37.227 17.676  1.00 79.66  ? 258 ARG A NH1  1 
ATOM   2807 N NH2  . ARG A 1 187 ? -15.088 -37.289 18.217  1.00 81.90  ? 258 ARG A NH2  1 
ATOM   2808 H H    . ARG A 1 187 ? -13.101 -39.389 11.665  1.00 65.42  ? 258 ARG A H    1 
ATOM   2809 H HA   . ARG A 1 187 ? -15.596 -39.612 12.359  1.00 67.17  ? 258 ARG A HA   1 
ATOM   2810 H HB2  . ARG A 1 187 ? -13.606 -37.955 13.471  1.00 73.96  ? 258 ARG A HB2  1 
ATOM   2811 H HB3  . ARG A 1 187 ? -15.036 -38.132 14.130  1.00 73.96  ? 258 ARG A HB3  1 
ATOM   2812 H HG2  . ARG A 1 187 ? -14.557 -40.362 14.604  1.00 80.48  ? 258 ARG A HG2  1 
ATOM   2813 H HG3  . ARG A 1 187 ? -13.129 -40.207 13.914  1.00 80.48  ? 258 ARG A HG3  1 
ATOM   2814 H HD2  . ARG A 1 187 ? -12.846 -40.030 16.204  1.00 85.56  ? 258 ARG A HD2  1 
ATOM   2815 H HD3  . ARG A 1 187 ? -12.566 -38.603 15.555  1.00 85.56  ? 258 ARG A HD3  1 
ATOM   2816 H HE   . ARG A 1 187 ? -15.075 -38.987 16.496  1.00 90.54  ? 258 ARG A HE   1 
ATOM   2817 H HH11 . ARG A 1 187 ? -12.184 -37.512 17.215  1.00 95.59  ? 258 ARG A HH11 1 
ATOM   2818 H HH12 . ARG A 1 187 ? -12.732 -36.610 18.263  1.00 95.59  ? 258 ARG A HH12 1 
ATOM   2819 H HH21 . ARG A 1 187 ? -15.875 -37.615 18.100  1.00 98.28  ? 258 ARG A HH21 1 
ATOM   2820 H HH22 . ARG A 1 187 ? -14.962 -36.670 18.800  1.00 98.28  ? 258 ARG A HH22 1 
ATOM   2821 N N    . LEU A 1 188 ? -14.873 -36.757 11.083  1.00 56.20  ? 259 LEU A N    1 
ATOM   2822 C CA   . LEU A 1 188 ? -15.508 -35.550 10.560  1.00 55.38  ? 259 LEU A CA   1 
ATOM   2823 C C    . LEU A 1 188 ? -16.422 -35.862 9.383   1.00 55.33  ? 259 LEU A C    1 
ATOM   2824 O O    . LEU A 1 188 ? -17.436 -35.186 9.189   1.00 55.77  ? 259 LEU A O    1 
ATOM   2825 C CB   . LEU A 1 188 ? -14.443 -34.532 10.165  1.00 53.97  ? 259 LEU A CB   1 
ATOM   2826 C CG   . LEU A 1 188 ? -13.748 -33.907 11.368  1.00 53.95  ? 259 LEU A CG   1 
ATOM   2827 C CD1  . LEU A 1 188 ? -12.530 -33.120 10.895  1.00 57.32  ? 259 LEU A CD1  1 
ATOM   2828 C CD2  . LEU A 1 188 ? -14.695 -33.014 12.183  1.00 51.97  ? 259 LEU A CD2  1 
ATOM   2829 H H    . LEU A 1 188 ? -14.018 -36.791 10.997  1.00 67.44  ? 259 LEU A H    1 
ATOM   2830 H HA   . LEU A 1 188 ? -16.055 -35.159 11.258  1.00 66.46  ? 259 LEU A HA   1 
ATOM   2831 H HB2  . LEU A 1 188 ? -13.769 -34.973 9.625   1.00 64.76  ? 259 LEU A HB2  1 
ATOM   2832 H HB3  . LEU A 1 188 ? -14.861 -33.819 9.657   1.00 64.76  ? 259 LEU A HB3  1 
ATOM   2833 H HG   . LEU A 1 188 ? -13.435 -34.616 11.951  1.00 64.73  ? 259 LEU A HG   1 
ATOM   2834 H HD11 . LEU A 1 188 ? -12.093 -32.723 11.664  1.00 68.79  ? 259 LEU A HD11 1 
ATOM   2835 H HD12 . LEU A 1 188 ? -11.920 -33.724 10.443  1.00 68.79  ? 259 LEU A HD12 1 
ATOM   2836 H HD13 . LEU A 1 188 ? -12.821 -32.425 10.284  1.00 68.79  ? 259 LEU A HD13 1 
ATOM   2837 H HD21 . LEU A 1 188 ? -14.177 -32.522 12.840  1.00 62.36  ? 259 LEU A HD21 1 
ATOM   2838 H HD22 . LEU A 1 188 ? -15.140 -32.396 11.582  1.00 62.36  ? 259 LEU A HD22 1 
ATOM   2839 H HD23 . LEU A 1 188 ? -15.351 -33.571 12.629  1.00 62.36  ? 259 LEU A HD23 1 
ATOM   2840 N N    . LEU A 1 189 ? -16.082 -36.882 8.603   1.00 54.64  ? 260 LEU A N    1 
ATOM   2841 C CA   . LEU A 1 189 ? -16.875 -37.276 7.453   1.00 54.06  ? 260 LEU A CA   1 
ATOM   2842 C C    . LEU A 1 189 ? -18.238 -37.844 7.843   1.00 56.46  ? 260 LEU A C    1 
ATOM   2843 O O    . LEU A 1 189 ? -19.141 -37.882 7.004   1.00 57.04  ? 260 LEU A O    1 
ATOM   2844 C CB   . LEU A 1 189 ? -16.078 -38.303 6.656   1.00 52.66  ? 260 LEU A CB   1 
ATOM   2845 C CG   . LEU A 1 189 ? -16.374 -38.494 5.190   1.00 53.06  ? 260 LEU A CG   1 
ATOM   2846 C CD1  . LEU A 1 189 ? -16.273 -37.185 4.430   1.00 52.18  ? 260 LEU A CD1  1 
ATOM   2847 C CD2  . LEU A 1 189 ? -15.377 -39.513 4.655   1.00 54.32  ? 260 LEU A CD2  1 
ATOM   2848 H H    . LEU A 1 189 ? -15.383 -37.368 8.725   1.00 65.57  ? 260 LEU A H    1 
ATOM   2849 H HA   . LEU A 1 189 ? -17.024 -36.498 6.894   1.00 64.87  ? 260 LEU A HA   1 
ATOM   2850 H HB2  . LEU A 1 189 ? -15.141 -38.060 6.720   1.00 63.20  ? 260 LEU A HB2  1 
ATOM   2851 H HB3  . LEU A 1 189 ? -16.207 -39.166 7.079   1.00 63.20  ? 260 LEU A HB3  1 
ATOM   2852 H HG   . LEU A 1 189 ? -17.270 -38.849 5.081   1.00 63.67  ? 260 LEU A HG   1 
ATOM   2853 H HD11 . LEU A 1 189 ? -16.282 -37.373 3.478   1.00 62.61  ? 260 LEU A HD11 1 
ATOM   2854 H HD12 . LEU A 1 189 ? -17.029 -36.623 4.662   1.00 62.61  ? 260 LEU A HD12 1 
ATOM   2855 H HD13 . LEU A 1 189 ? -15.444 -36.744 4.671   1.00 62.61  ? 260 LEU A HD13 1 
ATOM   2856 H HD21 . LEU A 1 189 ? -15.556 -39.665 3.714   1.00 65.19  ? 260 LEU A HD21 1 
ATOM   2857 H HD22 . LEU A 1 189 ? -14.479 -39.166 4.769   1.00 65.19  ? 260 LEU A HD22 1 
ATOM   2858 H HD23 . LEU A 1 189 ? -15.477 -40.342 5.149   1.00 65.19  ? 260 LEU A HD23 1 
ATOM   2859 N N    . HIS A 1 190 ? -18.400 -38.293 9.089   1.00 56.51  ? 261 HIS A N    1 
ATOM   2860 C CA   . HIS A 1 190 ? -19.665 -38.796 9.592   1.00 58.51  ? 261 HIS A CA   1 
ATOM   2861 C C    . HIS A 1 190 ? -20.417 -37.760 10.402  1.00 63.84  ? 261 HIS A C    1 
ATOM   2862 O O    . HIS A 1 190 ? -21.528 -38.049 10.866  1.00 69.22  ? 261 HIS A O    1 
ATOM   2863 C CB   . HIS A 1 190 ? -19.446 -40.050 10.446  1.00 56.67  ? 261 HIS A CB   1 
ATOM   2864 C CG   . HIS A 1 190 ? -19.187 -41.280 9.636   1.00 59.19  ? 261 HIS A CG   1 
ATOM   2865 N ND1  . HIS A 1 190 ? -17.949 -41.579 9.109   1.00 62.64  ? 261 HIS A ND1  1 
ATOM   2866 C CD2  . HIS A 1 190 ? -20.021 -42.256 9.211   1.00 59.90  ? 261 HIS A CD2  1 
ATOM   2867 C CE1  . HIS A 1 190 ? -18.026 -42.702 8.415   1.00 64.35  ? 261 HIS A CE1  1 
ATOM   2868 N NE2  . HIS A 1 190 ? -19.275 -43.132 8.462   1.00 62.71  ? 261 HIS A NE2  1 
ATOM   2869 H H    . HIS A 1 190 ? -17.769 -38.314 9.673   1.00 67.82  ? 261 HIS A H    1 
ATOM   2870 H HA   . HIS A 1 190 ? -20.224 -39.046 8.840   1.00 70.22  ? 261 HIS A HA   1 
ATOM   2871 H HB2  . HIS A 1 190 ? -18.680 -39.907 11.024  1.00 68.00  ? 261 HIS A HB2  1 
ATOM   2872 H HB3  . HIS A 1 190 ? -20.239 -40.208 10.982  1.00 68.00  ? 261 HIS A HB3  1 
ATOM   2873 H HD1  . HIS A 1 190 ? -17.235 -41.112 9.221   1.00 75.17  ? 261 HIS A HD1  1 
ATOM   2874 H HD2  . HIS A 1 190 ? -20.929 -42.327 9.400   1.00 71.88  ? 261 HIS A HD2  1 
ATOM   2875 H HE1  . HIS A 1 190 ? -17.322 -43.119 7.973   1.00 77.22  ? 261 HIS A HE1  1 
ATOM   2876 N N    . HIS A 1 191 ? -19.849 -36.567 10.586  1.00 62.82  ? 262 HIS A N    1 
ATOM   2877 C CA   . HIS A 1 191 ? -20.566 -35.504 11.276  1.00 67.27  ? 262 HIS A CA   1 
ATOM   2878 C C    . HIS A 1 191 ? -21.787 -35.086 10.459  1.00 76.86  ? 262 HIS A C    1 
ATOM   2879 O O    . HIS A 1 191 ? -22.056 -35.611 9.379   1.00 79.10  ? 262 HIS A O    1 
ATOM   2880 C CB   . HIS A 1 191 ? -19.641 -34.324 11.535  1.00 64.41  ? 262 HIS A CB   1 
ATOM   2881 C CG   . HIS A 1 191 ? -20.128 -33.407 12.605  1.00 64.48  ? 262 HIS A CG   1 
ATOM   2882 N ND1  . HIS A 1 191 ? -20.566 -32.128 12.342  1.00 64.58  ? 262 HIS A ND1  1 
ATOM   2883 C CD2  . HIS A 1 191 ? -20.276 -33.591 13.937  1.00 65.04  ? 262 HIS A CD2  1 
ATOM   2884 C CE1  . HIS A 1 191 ? -20.950 -31.558 13.468  1.00 65.61  ? 262 HIS A CE1  1 
ATOM   2885 N NE2  . HIS A 1 191 ? -20.779 -32.423 14.452  1.00 65.91  ? 262 HIS A NE2  1 
ATOM   2886 H H    . HIS A 1 191 ? -19.059 -36.352 10.324  1.00 75.38  ? 262 HIS A H    1 
ATOM   2887 H HA   . HIS A 1 191 ? -20.877 -35.836 12.133  1.00 80.73  ? 262 HIS A HA   1 
ATOM   2888 H HB2  . HIS A 1 191 ? -18.772 -34.661 11.805  1.00 77.29  ? 262 HIS A HB2  1 
ATOM   2889 H HB3  . HIS A 1 191 ? -19.555 -33.808 10.718  1.00 77.29  ? 262 HIS A HB3  1 
ATOM   2890 H HD2  . HIS A 1 191 ? -20.064 -34.360 14.415  1.00 78.05  ? 262 HIS A HD2  1 
ATOM   2891 H HE1  . HIS A 1 191 ? -21.279 -30.693 13.555  1.00 78.73  ? 262 HIS A HE1  1 
ATOM   2892 H HE2  . HIS A 1 191 ? -20.960 -32.280 15.280  1.00 79.09  ? 262 HIS A HE2  1 
ATOM   2893 N N    . ASN A 1 192 ? -22.555 -34.140 10.991  1.00 85.74  ? 263 ASN A N    1 
ATOM   2894 C CA   . ASN A 1 192 ? -23.816 -33.763 10.381  1.00 92.85  ? 263 ASN A CA   1 
ATOM   2895 C C    . ASN A 1 192 ? -23.809 -32.383 9.748   1.00 85.62  ? 263 ASN A C    1 
ATOM   2896 O O    . ASN A 1 192 ? -24.651 -32.117 8.886   1.00 93.46  ? 263 ASN A O    1 
ATOM   2897 C CB   . ASN A 1 192 ? -24.940 -33.809 11.421  1.00 107.25 ? 263 ASN A CB   1 
ATOM   2898 C CG   . ASN A 1 192 ? -26.283 -33.495 10.820  1.00 121.43 ? 263 ASN A CG   1 
ATOM   2899 O OD1  . ASN A 1 192 ? -26.682 -32.334 10.750  1.00 126.91 ? 263 ASN A OD1  1 
ATOM   2900 N ND2  . ASN A 1 192 ? -26.978 -34.524 10.347  1.00 126.97 ? 263 ASN A ND2  1 
ATOM   2901 H H    . ASN A 1 192 ? -22.376 -33.706 11.709  1.00 102.89 ? 263 ASN A H    1 
ATOM   2902 H HA   . ASN A 1 192 ? -24.036 -34.403 9.686   1.00 111.42 ? 263 ASN A HA   1 
ATOM   2903 H HB2  . ASN A 1 192 ? -24.982 -34.699 11.805  1.00 128.70 ? 263 ASN A HB2  1 
ATOM   2904 H HB3  . ASN A 1 192 ? -24.759 -33.155 12.114  1.00 128.70 ? 263 ASN A HB3  1 
ATOM   2905 H HD21 . ASN A 1 192 ? -27.751 -34.395 9.994   1.00 152.36 ? 263 ASN A HD21 1 
ATOM   2906 H HD22 . ASN A 1 192 ? -26.654 -35.319 10.394  1.00 152.36 ? 263 ASN A HD22 1 
ATOM   2907 N N    . ASP A 1 193 ? -22.899 -31.518 10.134  1.00 69.94  ? 264 ASP A N    1 
ATOM   2908 C CA   . ASP A 1 193 ? -22.908 -30.162 9.615   1.00 61.89  ? 264 ASP A CA   1 
ATOM   2909 C C    . ASP A 1 193 ? -22.556 -30.164 8.129   1.00 57.50  ? 264 ASP A C    1 
ATOM   2910 O O    . ASP A 1 193 ? -21.556 -30.780 7.733   1.00 52.08  ? 264 ASP A O    1 
ATOM   2911 C CB   . ASP A 1 193 ? -21.927 -29.285 10.391  1.00 63.40  ? 264 ASP A CB   1 
ATOM   2912 C CG   . ASP A 1 193 ? -21.991 -27.834 9.962   1.00 68.96  ? 264 ASP A CG   1 
ATOM   2913 O OD1  . ASP A 1 193 ? -22.891 -27.112 10.425  1.00 72.81  ? 264 ASP A OD1  1 
ATOM   2914 O OD2  . ASP A 1 193 ? -21.158 -27.411 9.145   1.00 69.71  ? 264 ASP A OD2  1 
ATOM   2915 H H    . ASP A 1 193 ? -22.267 -31.684 10.692  1.00 83.93  ? 264 ASP A H    1 
ATOM   2916 H HA   . ASP A 1 193 ? -23.794 -29.792 9.736   1.00 74.27  ? 264 ASP A HA   1 
ATOM   2917 H HB2  . ASP A 1 193 ? -22.140 -29.330 11.336  1.00 76.08  ? 264 ASP A HB2  1 
ATOM   2918 H HB3  . ASP A 1 193 ? -21.024 -29.605 10.237  1.00 76.08  ? 264 ASP A HB3  1 
ATOM   2919 N N    . PRO A 1 194 ? -23.336 -29.490 7.276   1.00 64.51  ? 265 PRO A N    1 
ATOM   2920 C CA   . PRO A 1 194 ? -23.014 -29.509 5.840   1.00 62.79  ? 265 PRO A CA   1 
ATOM   2921 C C    . PRO A 1 194 ? -21.602 -29.045 5.521   1.00 59.11  ? 265 PRO A C    1 
ATOM   2922 O O    . PRO A 1 194 ? -20.939 -29.664 4.681   1.00 60.48  ? 265 PRO A O    1 
ATOM   2923 C CB   . PRO A 1 194 ? -24.069 -28.578 5.230   1.00 66.47  ? 265 PRO A CB   1 
ATOM   2924 C CG   . PRO A 1 194 ? -25.180 -28.603 6.180   1.00 69.69  ? 265 PRO A CG   1 
ATOM   2925 C CD   . PRO A 1 194 ? -24.561 -28.727 7.541   1.00 69.50  ? 265 PRO A CD   1 
ATOM   2926 H HA   . PRO A 1 194 ? -23.139 -30.403 5.485   1.00 75.35  ? 265 PRO A HA   1 
ATOM   2927 H HB2  . PRO A 1 194 ? -23.707 -27.682 5.147   1.00 79.76  ? 265 PRO A HB2  1 
ATOM   2928 H HB3  . PRO A 1 194 ? -24.347 -28.919 4.366   1.00 79.76  ? 265 PRO A HB3  1 
ATOM   2929 H HG2  . PRO A 1 194 ? -25.685 -27.778 6.110   1.00 83.63  ? 265 PRO A HG2  1 
ATOM   2930 H HG3  . PRO A 1 194 ? -25.748 -29.367 5.994   1.00 83.63  ? 265 PRO A HG3  1 
ATOM   2931 H HD2  . PRO A 1 194 ? -24.346 -27.851 7.898   1.00 83.40  ? 265 PRO A HD2  1 
ATOM   2932 H HD3  . PRO A 1 194 ? -25.151 -29.220 8.132   1.00 83.40  ? 265 PRO A HD3  1 
ATOM   2933 N N    . GLU A 1 195 ? -21.132 -27.958 6.135   1.00 54.80  ? 266 GLU A N    1 
ATOM   2934 C CA   . GLU A 1 195 ? -19.828 -27.415 5.764   1.00 55.35  ? 266 GLU A CA   1 
ATOM   2935 C C    . GLU A 1 195 ? -18.700 -28.329 6.217   1.00 49.48  ? 266 GLU A C    1 
ATOM   2936 O O    . GLU A 1 195 ? -17.711 -28.509 5.492   1.00 48.77  ? 266 GLU A O    1 
ATOM   2937 C CB   . GLU A 1 195 ? -19.645 -26.019 6.355   1.00 66.83  ? 266 GLU A CB   1 
ATOM   2938 C CG   . GLU A 1 195 ? -20.545 -24.974 5.717   1.00 78.78  ? 266 GLU A CG   1 
ATOM   2939 C CD   . GLU A 1 195 ? -20.353 -23.593 6.300   1.00 90.17  ? 266 GLU A CD   1 
ATOM   2940 O OE1  . GLU A 1 195 ? -19.215 -23.267 6.704   1.00 94.44  ? 266 GLU A OE1  1 
ATOM   2941 O OE2  . GLU A 1 195 ? -21.345 -22.836 6.354   1.00 94.34  ? 266 GLU A OE2  1 
ATOM   2942 H H    . GLU A 1 195 ? -21.540 -27.525 6.756   1.00 65.77  ? 266 GLU A H    1 
ATOM   2943 H HA   . GLU A 1 195 ? -19.782 -27.339 4.798   1.00 66.42  ? 266 GLU A HA   1 
ATOM   2944 H HB2  . GLU A 1 195 ? -19.849 -26.050 7.303   1.00 80.20  ? 266 GLU A HB2  1 
ATOM   2945 H HB3  . GLU A 1 195 ? -18.725 -25.740 6.224   1.00 80.20  ? 266 GLU A HB3  1 
ATOM   2946 H HG2  . GLU A 1 195 ? -20.350 -24.928 4.768   1.00 94.54  ? 266 GLU A HG2  1 
ATOM   2947 H HG3  . GLU A 1 195 ? -21.471 -25.230 5.853   1.00 94.54  ? 266 GLU A HG3  1 
ATOM   2948 N N    . VAL A 1 196 ? -18.822 -28.903 7.413   1.00 47.20  ? 267 VAL A N    1 
ATOM   2949 C CA   . VAL A 1 196 ? -17.853 -29.889 7.864   1.00 48.27  ? 267 VAL A CA   1 
ATOM   2950 C C    . VAL A 1 196 ? -17.767 -31.028 6.860   1.00 47.69  ? 267 VAL A C    1 
ATOM   2951 O O    . VAL A 1 196 ? -16.670 -31.437 6.443   1.00 45.92  ? 267 VAL A O    1 
ATOM   2952 C CB   . VAL A 1 196 ? -18.228 -30.388 9.268   1.00 50.08  ? 267 VAL A CB   1 
ATOM   2953 C CG1  . VAL A 1 196 ? -17.417 -31.626 9.660   1.00 48.39  ? 267 VAL A CG1  1 
ATOM   2954 C CG2  . VAL A 1 196 ? -18.028 -29.254 10.285  1.00 53.19  ? 267 VAL A CG2  1 
ATOM   2955 H H    . VAL A 1 196 ? -19.452 -28.738 7.975   1.00 56.64  ? 267 VAL A H    1 
ATOM   2956 H HA   . VAL A 1 196 ? -16.979 -29.471 7.918   1.00 57.92  ? 267 VAL A HA   1 
ATOM   2957 H HB   . VAL A 1 196 ? -19.167 -30.632 9.274   1.00 60.10  ? 267 VAL A HB   1 
ATOM   2958 H HG11 . VAL A 1 196 ? -17.493 -31.761 10.618  1.00 58.07  ? 267 VAL A HG11 1 
ATOM   2959 H HG12 . VAL A 1 196 ? -17.767 -32.399 9.190   1.00 58.07  ? 267 VAL A HG12 1 
ATOM   2960 H HG13 . VAL A 1 196 ? -16.488 -31.483 9.421   1.00 58.07  ? 267 VAL A HG13 1 
ATOM   2961 H HG21 . VAL A 1 196 ? -18.259 -29.579 11.169  1.00 63.83  ? 267 VAL A HG21 1 
ATOM   2962 H HG22 . VAL A 1 196 ? -17.099 -28.974 10.267  1.00 63.83  ? 267 VAL A HG22 1 
ATOM   2963 H HG23 . VAL A 1 196 ? -18.603 -28.510 10.046  1.00 63.83  ? 267 VAL A HG23 1 
ATOM   2964 N N    . LEU A 1 197 ? -18.923 -31.546 6.438   1.00 50.91  ? 268 LEU A N    1 
ATOM   2965 C CA   . LEU A 1 197 ? -18.916 -32.637 5.471   1.00 51.93  ? 268 LEU A CA   1 
ATOM   2966 C C    . LEU A 1 197 ? -18.234 -32.225 4.182   1.00 50.74  ? 268 LEU A C    1 
ATOM   2967 O O    . LEU A 1 197 ? -17.468 -33.006 3.600   1.00 51.51  ? 268 LEU A O    1 
ATOM   2968 C CB   . LEU A 1 197 ? -20.334 -33.096 5.172   1.00 54.19  ? 268 LEU A CB   1 
ATOM   2969 C CG   . LEU A 1 197 ? -21.047 -33.782 6.323   1.00 57.70  ? 268 LEU A CG   1 
ATOM   2970 C CD1  . LEU A 1 197 ? -22.525 -33.945 5.971   1.00 58.18  ? 268 LEU A CD1  1 
ATOM   2971 C CD2  . LEU A 1 197 ? -20.377 -35.113 6.582   1.00 59.66  ? 268 LEU A CD2  1 
ATOM   2972 H H    . LEU A 1 197 ? -19.704 -31.289 6.690   1.00 61.09  ? 268 LEU A H    1 
ATOM   2973 H HA   . LEU A 1 197 ? -18.424 -33.385 5.842   1.00 62.31  ? 268 LEU A HA   1 
ATOM   2974 H HB2  . LEU A 1 197 ? -20.861 -32.321 4.923   1.00 65.03  ? 268 LEU A HB2  1 
ATOM   2975 H HB3  . LEU A 1 197 ? -20.306 -33.720 4.430   1.00 65.03  ? 268 LEU A HB3  1 
ATOM   2976 H HG   . LEU A 1 197 ? -20.976 -33.237 7.122   1.00 69.24  ? 268 LEU A HG   1 
ATOM   2977 H HD11 . LEU A 1 197 ? -22.977 -34.391 6.705   1.00 69.82  ? 268 LEU A HD11 1 
ATOM   2978 H HD12 . LEU A 1 197 ? -22.914 -33.068 5.827   1.00 69.82  ? 268 LEU A HD12 1 
ATOM   2979 H HD13 . LEU A 1 197 ? -22.600 -34.477 5.164   1.00 69.82  ? 268 LEU A HD13 1 
ATOM   2980 H HD21 . LEU A 1 197 ? -20.939 -35.639 7.172   1.00 71.59  ? 268 LEU A HD21 1 
ATOM   2981 H HD22 . LEU A 1 197 ? -20.259 -35.577 5.739   1.00 71.59  ? 268 LEU A HD22 1 
ATOM   2982 H HD23 . LEU A 1 197 ? -19.515 -34.959 6.998   1.00 71.59  ? 268 LEU A HD23 1 
ATOM   2983 N N    . ALA A 1 198 ? -18.509 -31.009 3.712   1.00 49.96  ? 269 ALA A N    1 
ATOM   2984 C CA   . ALA A 1 198 ? -17.924 -30.565 2.457   1.00 48.72  ? 269 ALA A CA   1 
ATOM   2985 C C    . ALA A 1 198 ? -16.399 -30.518 2.555   1.00 48.43  ? 269 ALA A C    1 
ATOM   2986 O O    . ALA A 1 198 ? -15.698 -31.100 1.721   1.00 47.79  ? 269 ALA A O    1 
ATOM   2987 C CB   . ALA A 1 198 ? -18.494 -29.208 2.066   1.00 49.08  ? 269 ALA A CB   1 
ATOM   2988 H H    . ALA A 1 198 ? -19.022 -30.434 4.095   1.00 59.96  ? 269 ALA A H    1 
ATOM   2989 H HA   . ALA A 1 198 ? -18.158 -31.198 1.760   1.00 58.47  ? 269 ALA A HA   1 
ATOM   2990 H HB1  . ALA A 1 198 ? -18.094 -28.927 1.228   1.00 58.89  ? 269 ALA A HB1  1 
ATOM   2991 H HB2  . ALA A 1 198 ? -19.455 -29.287 1.964   1.00 58.89  ? 269 ALA A HB2  1 
ATOM   2992 H HB3  . ALA A 1 198 ? -18.287 -28.566 2.763   1.00 58.89  ? 269 ALA A HB3  1 
ATOM   2993 N N    . ASP A 1 199 ? -15.865 -29.849 3.580   1.00 48.93  ? 270 ASP A N    1 
ATOM   2994 C CA   . ASP A 1 199 ? -14.408 -29.757 3.712   1.00 50.43  ? 270 ASP A CA   1 
ATOM   2995 C C    . ASP A 1 199 ? -13.761 -31.117 3.980   1.00 48.31  ? 270 ASP A C    1 
ATOM   2996 O O    . ASP A 1 199 ? -12.661 -31.373 3.491   1.00 48.34  ? 270 ASP A O    1 
ATOM   2997 C CB   . ASP A 1 199 ? -14.037 -28.757 4.806   1.00 55.82  ? 270 ASP A CB   1 
ATOM   2998 C CG   . ASP A 1 199 ? -14.397 -27.324 4.425   1.00 61.72  ? 270 ASP A CG   1 
ATOM   2999 O OD1  . ASP A 1 199 ? -14.666 -27.091 3.229   1.00 64.91  ? 270 ASP A OD1  1 
ATOM   3000 O OD2  . ASP A 1 199 ? -14.420 -26.433 5.307   1.00 63.66  ? 270 ASP A OD2  1 
ATOM   3001 H H    . ASP A 1 199 ? -16.311 -29.449 4.197   1.00 58.71  ? 270 ASP A H    1 
ATOM   3002 H HA   . ASP A 1 199 ? -14.045 -29.424 2.876   1.00 60.51  ? 270 ASP A HA   1 
ATOM   3003 H HB2  . ASP A 1 199 ? -14.519 -28.982 5.617   1.00 66.99  ? 270 ASP A HB2  1 
ATOM   3004 H HB3  . ASP A 1 199 ? -13.081 -28.797 4.963   1.00 66.99  ? 270 ASP A HB3  1 
ATOM   3005 N N    . SER A 1 200 ? -14.422 -32.005 4.725   1.00 46.73  ? 271 SER A N    1 
ATOM   3006 C CA   . SER A 1 200 ? -13.898 -33.356 4.899   1.00 47.90  ? 271 SER A CA   1 
ATOM   3007 C C    . SER A 1 200 ? -13.784 -34.082 3.561   1.00 45.08  ? 271 SER A C    1 
ATOM   3008 O O    . SER A 1 200 ? -12.774 -34.758 3.293   1.00 46.01  ? 271 SER A O    1 
ATOM   3009 C CB   . SER A 1 200 ? -14.796 -34.152 5.850   1.00 51.23  ? 271 SER A CB   1 
ATOM   3010 O OG   . SER A 1 200 ? -14.813 -33.581 7.142   1.00 54.36  ? 271 SER A OG   1 
ATOM   3011 H H    . SER A 1 200 ? -15.163 -31.852 5.133   1.00 56.07  ? 271 SER A H    1 
ATOM   3012 H HA   . SER A 1 200 ? -13.012 -33.305 5.291   1.00 57.48  ? 271 SER A HA   1 
ATOM   3013 H HB2  . SER A 1 200 ? -15.700 -34.158 5.497   1.00 61.48  ? 271 SER A HB2  1 
ATOM   3014 H HB3  . SER A 1 200 ? -14.460 -35.060 5.913   1.00 61.48  ? 271 SER A HB3  1 
ATOM   3015 H HG   . SER A 1 200 ? -15.103 -32.794 7.104   1.00 65.23  ? 271 SER A HG   1 
ATOM   3016 N N    . CYS A 1 201 ? -14.815 -33.953 2.709   1.00 43.73  ? 272 CYS A N    1 
ATOM   3017 C CA   . CYS A 1 201 ? -14.765 -34.528 1.372   1.00 46.00  ? 272 CYS A CA   1 
ATOM   3018 C C    . CYS A 1 201 ? -13.663 -33.897 0.537   1.00 45.97  ? 272 CYS A C    1 
ATOM   3019 O O    . CYS A 1 201 ? -12.981 -34.587 -0.232  1.00 48.12  ? 272 CYS A O    1 
ATOM   3020 C CB   . CYS A 1 201 ? -16.109 -34.356 0.668   1.00 49.76  ? 272 CYS A CB   1 
ATOM   3021 S SG   . CYS A 1 201 ? -17.351 -35.472 1.277   1.00 53.11  ? 272 CYS A SG   1 
ATOM   3022 H H    . CYS A 1 201 ? -15.547 -33.538 2.888   1.00 52.47  ? 272 CYS A H    1 
ATOM   3023 H HA   . CYS A 1 201 ? -14.582 -35.478 1.443   1.00 55.20  ? 272 CYS A HA   1 
ATOM   3024 H HB2  . CYS A 1 201 ? -16.425 -33.448 0.797   1.00 59.71  ? 272 CYS A HB2  1 
ATOM   3025 H HB3  . CYS A 1 201 ? -15.993 -34.540 -0.276  1.00 59.71  ? 272 CYS A HB3  1 
ATOM   3026 H HG   . CYS A 1 201 ? -17.514 -35.274 2.449   1.00 63.73  ? 272 CYS A HG   1 
ATOM   3027 N N    . TRP A 1 202 ? -13.477 -32.586 0.656   1.00 44.63  ? 273 TRP A N    1 
ATOM   3028 C CA   . TRP A 1 202 ? -12.385 -31.973 -0.081  1.00 43.56  ? 273 TRP A CA   1 
ATOM   3029 C C    . TRP A 1 202 ? -11.056 -32.578 0.356   1.00 42.70  ? 273 TRP A C    1 
ATOM   3030 O O    . TRP A 1 202 ? -10.202 -32.895 -0.482  1.00 41.78  ? 273 TRP A O    1 
ATOM   3031 C CB   . TRP A 1 202 ? -12.403 -30.455 0.108   1.00 44.59  ? 273 TRP A CB   1 
ATOM   3032 C CG   . TRP A 1 202 ? -13.374 -29.777 -0.785  1.00 46.51  ? 273 TRP A CG   1 
ATOM   3033 C CD1  . TRP A 1 202 ? -14.495 -29.088 -0.414  1.00 48.87  ? 273 TRP A CD1  1 
ATOM   3034 C CD2  . TRP A 1 202 ? -13.322 -29.716 -2.217  1.00 47.36  ? 273 TRP A CD2  1 
ATOM   3035 N NE1  . TRP A 1 202 ? -15.148 -28.608 -1.533  1.00 49.60  ? 273 TRP A NE1  1 
ATOM   3036 C CE2  . TRP A 1 202 ? -14.449 -28.984 -2.648  1.00 48.80  ? 273 TRP A CE2  1 
ATOM   3037 C CE3  . TRP A 1 202 ? -12.438 -30.222 -3.175  1.00 47.97  ? 273 TRP A CE3  1 
ATOM   3038 C CZ2  . TRP A 1 202 ? -14.705 -28.732 -3.987  1.00 50.05  ? 273 TRP A CZ2  1 
ATOM   3039 C CZ3  . TRP A 1 202 ? -12.695 -29.981 -4.510  1.00 49.98  ? 273 TRP A CZ3  1 
ATOM   3040 C CH2  . TRP A 1 202 ? -13.822 -29.241 -4.907  1.00 50.73  ? 273 TRP A CH2  1 
ATOM   3041 H H    . TRP A 1 202 ? -13.949 -32.051 1.136   1.00 53.56  ? 273 TRP A H    1 
ATOM   3042 H HA   . TRP A 1 202 ? -12.500 -32.158 -1.026  1.00 52.27  ? 273 TRP A HA   1 
ATOM   3043 H HB2  . TRP A 1 202 ? -12.647 -30.254 1.025   1.00 53.50  ? 273 TRP A HB2  1 
ATOM   3044 H HB3  . TRP A 1 202 ? -11.520 -30.102 -0.085  1.00 53.50  ? 273 TRP A HB3  1 
ATOM   3045 H HD1  . TRP A 1 202 ? -14.779 -28.964 0.463   1.00 58.64  ? 273 TRP A HD1  1 
ATOM   3046 H HE1  . TRP A 1 202 ? -15.873 -28.146 -1.529  1.00 59.51  ? 273 TRP A HE1  1 
ATOM   3047 H HE3  . TRP A 1 202 ? -11.692 -30.715 -2.918  1.00 57.56  ? 273 TRP A HE3  1 
ATOM   3048 H HZ2  . TRP A 1 202 ? -15.452 -28.245 -4.252  1.00 60.06  ? 273 TRP A HZ2  1 
ATOM   3049 H HZ3  . TRP A 1 202 ? -12.112 -30.310 -5.156  1.00 59.98  ? 273 TRP A HZ3  1 
ATOM   3050 H HH2  . TRP A 1 202 ? -13.970 -29.089 -5.812  1.00 60.88  ? 273 TRP A HH2  1 
ATOM   3051 N N    . ALA A 1 203 ? -10.883 -32.790 1.664   1.00 41.20  ? 274 ALA A N    1 
ATOM   3052 C CA   . ALA A 1 203 ? -9.642  -33.380 2.150   1.00 41.99  ? 274 ALA A CA   1 
ATOM   3053 C C    . ALA A 1 203 ? -9.435  -34.763 1.551   1.00 44.35  ? 274 ALA A C    1 
ATOM   3054 O O    . ALA A 1 203 ? -8.354  -35.081 1.046   1.00 45.29  ? 274 ALA A O    1 
ATOM   3055 C CB   . ALA A 1 203 ? -9.653  -33.447 3.677   1.00 40.53  ? 274 ALA A CB   1 
ATOM   3056 H H    . ALA A 1 203 ? -11.458 -32.604 2.276   1.00 49.45  ? 274 ALA A H    1 
ATOM   3057 H HA   . ALA A 1 203 ? -8.898  -32.820 1.879   1.00 50.38  ? 274 ALA A HA   1 
ATOM   3058 H HB1  . ALA A 1 203 ? -8.814  -33.827 3.982   1.00 48.63  ? 274 ALA A HB1  1 
ATOM   3059 H HB2  . ALA A 1 203 ? -9.758  -32.550 4.031   1.00 48.63  ? 274 ALA A HB2  1 
ATOM   3060 H HB3  . ALA A 1 203 ? -10.394 -34.004 3.963   1.00 48.63  ? 274 ALA A HB3  1 
ATOM   3061 N N    . ILE A 1 204 ? -10.472 -35.600 1.585   1.00 46.92  ? 275 ILE A N    1 
ATOM   3062 C CA   . ILE A 1 204 ? -10.343 -36.932 1.006   1.00 48.40  ? 275 ILE A CA   1 
ATOM   3063 C C    . ILE A 1 204 ? -10.005 -36.841 -0.473  1.00 46.34  ? 275 ILE A C    1 
ATOM   3064 O O    . ILE A 1 204 ? -9.210  -37.631 -0.992  1.00 44.09  ? 275 ILE A O    1 
ATOM   3065 C CB   . ILE A 1 204 ? -11.627 -37.741 1.215   1.00 49.57  ? 275 ILE A CB   1 
ATOM   3066 C CG1  . ILE A 1 204 ? -12.000 -37.817 2.705   1.00 51.59  ? 275 ILE A CG1  1 
ATOM   3067 C CG2  . ILE A 1 204 ? -11.450 -39.110 0.616   1.00 50.34  ? 275 ILE A CG2  1 
ATOM   3068 C CD1  . ILE A 1 204 ? -11.071 -38.630 3.510   1.00 52.66  ? 275 ILE A CD1  1 
ATOM   3069 H H    . ILE A 1 204 ? -11.241 -35.422 1.925   1.00 56.31  ? 275 ILE A H    1 
ATOM   3070 H HA   . ILE A 1 204 ? -9.616  -37.398 1.447   1.00 58.08  ? 275 ILE A HA   1 
ATOM   3071 H HB   . ILE A 1 204 ? -12.348 -37.294 0.744   1.00 59.49  ? 275 ILE A HB   1 
ATOM   3072 H HG12 . ILE A 1 204 ? -12.008 -36.926 3.081   1.00 61.90  ? 275 ILE A HG12 1 
ATOM   3073 H HG13 . ILE A 1 204 ? -12.882 -38.213 2.784   1.00 61.90  ? 275 ILE A HG13 1 
ATOM   3074 H HG21 . ILE A 1 204 ? -12.068 -39.723 1.043   1.00 60.41  ? 275 ILE A HG21 1 
ATOM   3075 H HG22 . ILE A 1 204 ? -11.631 -39.066 -0.336  1.00 60.41  ? 275 ILE A HG22 1 
ATOM   3076 H HG23 . ILE A 1 204 ? -10.538 -39.400 0.768   1.00 60.41  ? 275 ILE A HG23 1 
ATOM   3077 H HD11 . ILE A 1 204 ? -11.324 -38.559 4.444   1.00 63.19  ? 275 ILE A HD11 1 
ATOM   3078 H HD12 . ILE A 1 204 ? -11.126 -39.556 3.225   1.00 63.19  ? 275 ILE A HD12 1 
ATOM   3079 H HD13 . ILE A 1 204 ? -10.168 -38.298 3.390   1.00 63.19  ? 275 ILE A HD13 1 
ATOM   3080 N N    . SER A 1 205 ? -10.631 -35.905 -1.189  1.00 45.85  ? 276 SER A N    1 
ATOM   3081 C CA   . SER A 1 205 ? -10.346 -35.791 -2.612  1.00 46.91  ? 276 SER A CA   1 
ATOM   3082 C C    . SER A 1 205 ? -8.895  -35.379 -2.853  1.00 47.13  ? 276 SER A C    1 
ATOM   3083 O O    . SER A 1 205 ? -8.281  -35.834 -3.823  1.00 48.58  ? 276 SER A O    1 
ATOM   3084 C CB   . SER A 1 205 ? -11.318 -34.818 -3.277  1.00 46.97  ? 276 SER A CB   1 
ATOM   3085 O OG   . SER A 1 205 ? -10.879 -33.477 -3.174  1.00 47.33  ? 276 SER A OG   1 
ATOM   3086 H H    . SER A 1 205 ? -11.206 -35.343 -0.884  1.00 55.02  ? 276 SER A H    1 
ATOM   3087 H HA   . SER A 1 205 ? -10.475 -36.660 -3.023  1.00 56.29  ? 276 SER A HA   1 
ATOM   3088 H HB2  . SER A 1 205 ? -11.397 -35.049 -4.216  1.00 56.37  ? 276 SER A HB2  1 
ATOM   3089 H HB3  . SER A 1 205 ? -12.183 -34.897 -2.845  1.00 56.37  ? 276 SER A HB3  1 
ATOM   3090 H HG   . SER A 1 205 ? -10.808 -33.259 -2.366  1.00 56.80  ? 276 SER A HG   1 
ATOM   3091 N N    . TYR A 1 206 ? -8.312  -34.566 -1.962  1.00 45.04  ? 277 TYR A N    1 
ATOM   3092 C CA   . TYR A 1 206 ? -6.890  -34.245 -2.068  1.00 44.11  ? 277 TYR A CA   1 
ATOM   3093 C C    . TYR A 1 206 ? -6.030  -35.477 -1.813  1.00 43.46  ? 277 TYR A C    1 
ATOM   3094 O O    . TYR A 1 206 ? -5.098  -35.765 -2.566  1.00 42.21  ? 277 TYR A O    1 
ATOM   3095 C CB   . TYR A 1 206 ? -6.511  -33.151 -1.075  1.00 45.36  ? 277 TYR A CB   1 
ATOM   3096 C CG   . TYR A 1 206 ? -7.320  -31.874 -1.156  1.00 46.63  ? 277 TYR A CG   1 
ATOM   3097 C CD1  . TYR A 1 206 ? -7.788  -31.384 -2.366  1.00 44.84  ? 277 TYR A CD1  1 
ATOM   3098 C CD2  . TYR A 1 206 ? -7.588  -31.145 -0.006  1.00 50.14  ? 277 TYR A CD2  1 
ATOM   3099 C CE1  . TYR A 1 206 ? -8.508  -30.227 -2.422  1.00 46.96  ? 277 TYR A CE1  1 
ATOM   3100 C CE2  . TYR A 1 206 ? -8.303  -29.986 -0.051  1.00 52.04  ? 277 TYR A CE2  1 
ATOM   3101 C CZ   . TYR A 1 206 ? -8.765  -29.523 -1.255  1.00 51.12  ? 277 TYR A CZ   1 
ATOM   3102 O OH   . TYR A 1 206 ? -9.496  -28.356 -1.264  1.00 52.87  ? 277 TYR A OH   1 
ATOM   3103 H H    . TYR A 1 206 ? -8.714  -34.195 -1.298  1.00 54.05  ? 277 TYR A H    1 
ATOM   3104 H HA   . TYR A 1 206 ? -6.700  -33.923 -2.963  1.00 52.94  ? 277 TYR A HA   1 
ATOM   3105 H HB2  . TYR A 1 206 ? -6.616  -33.504 -0.178  1.00 54.43  ? 277 TYR A HB2  1 
ATOM   3106 H HB3  . TYR A 1 206 ? -5.582  -32.914 -1.221  1.00 54.43  ? 277 TYR A HB3  1 
ATOM   3107 H HD1  . TYR A 1 206 ? -7.616  -31.856 -3.149  1.00 53.80  ? 277 TYR A HD1  1 
ATOM   3108 H HD2  . TYR A 1 206 ? -7.276  -31.456 0.813   1.00 60.17  ? 277 TYR A HD2  1 
ATOM   3109 H HE1  . TYR A 1 206 ? -8.824  -29.911 -3.238  1.00 56.35  ? 277 TYR A HE1  1 
ATOM   3110 H HE2  . TYR A 1 206 ? -8.481  -29.515 0.731   1.00 62.45  ? 277 TYR A HE2  1 
ATOM   3111 H HH   . TYR A 1 206 ? -9.563  -28.053 -0.483  1.00 63.45  ? 277 TYR A HH   1 
ATOM   3112 N N    . LEU A 1 207 ? -6.322  -36.214 -0.741  1.00 43.50  ? 278 LEU A N    1 
ATOM   3113 C CA   . LEU A 1 207 ? -5.485  -37.353 -0.386  1.00 46.67  ? 278 LEU A CA   1 
ATOM   3114 C C    . LEU A 1 207 ? -5.561  -38.459 -1.426  1.00 50.57  ? 278 LEU A C    1 
ATOM   3115 O O    . LEU A 1 207 ? -4.594  -39.203 -1.594  1.00 55.80  ? 278 LEU A O    1 
ATOM   3116 C CB   . LEU A 1 207 ? -5.887  -37.896 0.982   1.00 47.11  ? 278 LEU A CB   1 
ATOM   3117 C CG   . LEU A 1 207 ? -5.712  -36.909 2.133   1.00 48.82  ? 278 LEU A CG   1 
ATOM   3118 C CD1  . LEU A 1 207 ? -6.246  -37.566 3.372   1.00 49.22  ? 278 LEU A CD1  1 
ATOM   3119 C CD2  . LEU A 1 207 ? -4.248  -36.448 2.307   1.00 51.07  ? 278 LEU A CD2  1 
ATOM   3120 H H    . LEU A 1 207 ? -6.987  -36.077 -0.213  1.00 52.20  ? 278 LEU A H    1 
ATOM   3121 H HA   . LEU A 1 207 ? -4.562  -37.060 -0.334  1.00 56.01  ? 278 LEU A HA   1 
ATOM   3122 H HB2  . LEU A 1 207 ? -6.823  -38.150 0.952   1.00 56.53  ? 278 LEU A HB2  1 
ATOM   3123 H HB3  . LEU A 1 207 ? -5.344  -38.675 1.178   1.00 56.53  ? 278 LEU A HB3  1 
ATOM   3124 H HG   . LEU A 1 207 ? -6.252  -36.123 1.957   1.00 58.58  ? 278 LEU A HG   1 
ATOM   3125 H HD11 . LEU A 1 207 ? -6.135  -36.961 4.122   1.00 59.06  ? 278 LEU A HD11 1 
ATOM   3126 H HD12 . LEU A 1 207 ? -7.187  -37.765 3.243   1.00 59.06  ? 278 LEU A HD12 1 
ATOM   3127 H HD13 . LEU A 1 207 ? -5.753  -38.386 3.532   1.00 59.06  ? 278 LEU A HD13 1 
ATOM   3128 H HD21 . LEU A 1 207 ? -4.178  -35.923 3.119   1.00 61.28  ? 278 LEU A HD21 1 
ATOM   3129 H HD22 . LEU A 1 207 ? -3.677  -37.230 2.368   1.00 61.28  ? 278 LEU A HD22 1 
ATOM   3130 H HD23 . LEU A 1 207 ? -3.992  -35.910 1.542   1.00 61.28  ? 278 LEU A HD23 1 
ATOM   3131 N N    . THR A 1 208 ? -6.675  -38.586 -2.140  1.00 50.63  ? 279 THR A N    1 
ATOM   3132 C CA   . THR A 1 208 ? -6.785  -39.624 -3.159  1.00 51.69  ? 279 THR A CA   1 
ATOM   3133 C C    . THR A 1 208 ? -6.274  -39.179 -4.522  1.00 54.03  ? 279 THR A C    1 
ATOM   3134 O O    . THR A 1 208 ? -6.289  -39.975 -5.462  1.00 53.48  ? 279 THR A O    1 
ATOM   3135 C CB   . THR A 1 208 ? -8.235  -40.092 -3.293  1.00 52.35  ? 279 THR A CB   1 
ATOM   3136 O OG1  . THR A 1 208 ? -9.087  -38.968 -3.542  1.00 51.85  ? 279 THR A OG1  1 
ATOM   3137 C CG2  . THR A 1 208 ? -8.674  -40.810 -2.029  1.00 53.11  ? 279 THR A CG2  1 
ATOM   3138 H H    . THR A 1 208 ? -7.373  -38.090 -2.056  1.00 60.76  ? 279 THR A H    1 
ATOM   3139 H HA   . THR A 1 208 ? -6.256  -40.389 -2.883  1.00 62.02  ? 279 THR A HA   1 
ATOM   3140 H HB   . THR A 1 208 ? -8.303  -40.714 -4.034  1.00 62.82  ? 279 THR A HB   1 
ATOM   3141 H HG1  . THR A 1 208 ? -9.087  -38.454 -2.878  1.00 62.22  ? 279 THR A HG1  1 
ATOM   3142 H HG21 . THR A 1 208 ? -9.590  -41.115 -2.122  1.00 63.73  ? 279 THR A HG21 1 
ATOM   3143 H HG22 . THR A 1 208 ? -8.102  -41.576 -1.868  1.00 63.73  ? 279 THR A HG22 1 
ATOM   3144 H HG23 . THR A 1 208 ? -8.618  -40.209 -1.270  1.00 63.73  ? 279 THR A HG23 1 
ATOM   3145 N N    . ASP A 1 209 ? -5.827  -37.936 -4.646  1.00 55.06  ? 280 ASP A N    1 
ATOM   3146 C CA   . ASP A 1 209 ? -5.290  -37.414 -5.895  1.00 61.78  ? 280 ASP A CA   1 
ATOM   3147 C C    . ASP A 1 209 ? -3.794  -37.698 -5.889  1.00 65.25  ? 280 ASP A C    1 
ATOM   3148 O O    . ASP A 1 209 ? -2.981  -36.882 -5.451  1.00 70.79  ? 280 ASP A O    1 
ATOM   3149 C CB   . ASP A 1 209 ? -5.597  -35.927 -6.021  1.00 66.14  ? 280 ASP A CB   1 
ATOM   3150 C CG   . ASP A 1 209 ? -5.293  -35.382 -7.396  1.00 74.59  ? 280 ASP A CG   1 
ATOM   3151 O OD1  . ASP A 1 209 ? -5.051  -36.186 -8.314  1.00 74.68  ? 280 ASP A OD1  1 
ATOM   3152 O OD2  . ASP A 1 209 ? -5.311  -34.145 -7.566  1.00 81.41  ? 280 ASP A OD2  1 
ATOM   3153 H H    . ASP A 1 209 ? -5.824  -37.361 -4.007  1.00 66.07  ? 280 ASP A H    1 
ATOM   3154 H HA   . ASP A 1 209 ? -5.693  -37.880 -6.644  1.00 74.14  ? 280 ASP A HA   1 
ATOM   3155 H HB2  . ASP A 1 209 ? -6.540  -35.783 -5.843  1.00 79.37  ? 280 ASP A HB2  1 
ATOM   3156 H HB3  . ASP A 1 209 ? -5.060  -35.438 -5.379  1.00 79.37  ? 280 ASP A HB3  1 
ATOM   3157 N N    . GLY A 1 210 ? -3.426  -38.880 -6.360  1.00 61.73  ? 281 GLY A N    1 
ATOM   3158 C CA   . GLY A 1 210 ? -2.052  -39.300 -6.325  1.00 62.95  ? 281 GLY A CA   1 
ATOM   3159 C C    . GLY A 1 210 ? -1.913  -40.777 -6.630  1.00 63.07  ? 281 GLY A C    1 
ATOM   3160 O O    . GLY A 1 210 ? -2.834  -41.418 -7.150  1.00 61.54  ? 281 GLY A O    1 
ATOM   3161 H H    . GLY A 1 210 ? -3.963  -39.456 -6.706  1.00 74.07  ? 281 GLY A H    1 
ATOM   3162 H HA2  . GLY A 1 210 ? -1.540  -38.798 -6.978  1.00 75.54  ? 281 GLY A HA2  1 
ATOM   3163 H HA3  . GLY A 1 210 ? -1.693  -39.121 -5.443  1.00 75.54  ? 281 GLY A HA3  1 
ATOM   3164 N N    . PRO A 1 211 ? -0.762  -41.350 -6.282  1.00 64.03  ? 282 PRO A N    1 
ATOM   3165 C CA   . PRO A 1 211 ? -0.506  -42.757 -6.601  1.00 63.33  ? 282 PRO A CA   1 
ATOM   3166 C C    . PRO A 1 211 ? -1.470  -43.685 -5.886  1.00 59.87  ? 282 PRO A C    1 
ATOM   3167 O O    . PRO A 1 211 ? -2.077  -43.337 -4.870  1.00 57.16  ? 282 PRO A O    1 
ATOM   3168 C CB   . PRO A 1 211 ? 0.925   -42.980 -6.104  1.00 67.31  ? 282 PRO A CB   1 
ATOM   3169 C CG   . PRO A 1 211 ? 1.448   -41.619 -5.718  1.00 68.65  ? 282 PRO A CG   1 
ATOM   3170 C CD   . PRO A 1 211 ? 0.278   -40.787 -5.410  1.00 66.15  ? 282 PRO A CD   1 
ATOM   3171 H HA   . PRO A 1 211 ? -0.550  -42.908 -7.558  1.00 76.00  ? 282 PRO A HA   1 
ATOM   3172 H HB2  . PRO A 1 211 ? 0.913   -43.571 -5.335  1.00 80.77  ? 282 PRO A HB2  1 
ATOM   3173 H HB3  . PRO A 1 211 ? 1.461   -43.361 -6.818  1.00 80.77  ? 282 PRO A HB3  1 
ATOM   3174 H HG2  . PRO A 1 211 ? 2.018   -41.703 -4.938  1.00 82.38  ? 282 PRO A HG2  1 
ATOM   3175 H HG3  . PRO A 1 211 ? 1.945   -41.242 -6.461  1.00 82.38  ? 282 PRO A HG3  1 
ATOM   3176 H HD2  . PRO A 1 211 ? 0.029   -40.883 -4.478  1.00 79.38  ? 282 PRO A HD2  1 
ATOM   3177 H HD3  . PRO A 1 211 ? 0.457   -39.862 -5.639  1.00 79.38  ? 282 PRO A HD3  1 
ATOM   3178 N N    . ASN A 1 212 ? -1.578  -44.904 -6.413  1.00 64.05  ? 283 ASN A N    1 
ATOM   3179 C CA   . ASN A 1 212 ? -2.461  -45.897 -5.808  1.00 66.84  ? 283 ASN A CA   1 
ATOM   3180 C C    . ASN A 1 212 ? -2.142  -46.131 -4.339  1.00 65.25  ? 283 ASN A C    1 
ATOM   3181 O O    . ASN A 1 212 ? -3.039  -46.466 -3.561  1.00 67.46  ? 283 ASN A O    1 
ATOM   3182 C CB   . ASN A 1 212 ? -2.369  -47.206 -6.576  1.00 73.74  ? 283 ASN A CB   1 
ATOM   3183 C CG   . ASN A 1 212 ? -3.127  -47.155 -7.878  1.00 80.64  ? 283 ASN A CG   1 
ATOM   3184 O OD1  . ASN A 1 212 ? -3.470  -46.079 -8.363  1.00 79.21  ? 283 ASN A OD1  1 
ATOM   3185 N ND2  . ASN A 1 212 ? -3.410  -48.317 -8.447  1.00 87.97  ? 283 ASN A ND2  1 
ATOM   3186 H H    . ASN A 1 212 ? -1.157  -45.177 -7.111  1.00 76.86  ? 283 ASN A H    1 
ATOM   3187 H HA   . ASN A 1 212 ? -3.376  -45.580 -5.867  1.00 80.20  ? 283 ASN A HA   1 
ATOM   3188 H HB2  . ASN A 1 212 ? -1.438  -47.393 -6.776  1.00 88.48  ? 283 ASN A HB2  1 
ATOM   3189 H HB3  . ASN A 1 212 ? -2.744  -47.919 -6.036  1.00 88.48  ? 283 ASN A HB3  1 
ATOM   3190 H HD21 . ASN A 1 212 ? -3.849  -48.338 -9.186  1.00 105.56 ? 283 ASN A HD21 1 
ATOM   3191 H HD22 . ASN A 1 212 ? -3.154  -49.050 -8.077  1.00 105.56 ? 283 ASN A HD22 1 
ATOM   3192 N N    . GLU A 1 213 ? -0.881  -45.965 -3.943  1.00 59.42  ? 284 GLU A N    1 
ATOM   3193 C CA   . GLU A 1 213 ? -0.500  -46.136 -2.540  1.00 61.50  ? 284 GLU A CA   1 
ATOM   3194 C C    . GLU A 1 213 ? -1.299  -45.202 -1.640  1.00 57.10  ? 284 GLU A C    1 
ATOM   3195 O O    . GLU A 1 213 ? -1.815  -45.614 -0.596  1.00 54.42  ? 284 GLU A O    1 
ATOM   3196 C CB   . GLU A 1 213 ? 1.002   -45.883 -2.359  1.00 74.83  ? 284 GLU A CB   1 
ATOM   3197 C CG   . GLU A 1 213 ? 1.907   -46.249 -3.575  1.00 89.61  ? 284 GLU A CG   1 
ATOM   3198 C CD   . GLU A 1 213 ? 1.930   -47.747 -3.912  1.00 101.43 ? 284 GLU A CD   1 
ATOM   3199 O OE1  . GLU A 1 213 ? 3.036   -48.344 -3.889  1.00 103.40 ? 284 GLU A OE1  1 
ATOM   3200 O OE2  . GLU A 1 213 ? 0.853   -48.333 -4.199  1.00 107.24 ? 284 GLU A OE2  1 
ATOM   3201 H H    . GLU A 1 213 ? -0.246  -45.741 -4.471  1.00 71.30  ? 284 GLU A H    1 
ATOM   3202 H HA   . GLU A 1 213 ? -0.687  -47.049 -2.269  1.00 73.79  ? 284 GLU A HA   1 
ATOM   3203 H HB2  . GLU A 1 213 ? 1.133   -44.940 -2.175  1.00 89.80  ? 284 GLU A HB2  1 
ATOM   3204 H HB3  . GLU A 1 213 ? 1.310   -46.405 -1.602  1.00 89.80  ? 284 GLU A HB3  1 
ATOM   3205 H HG2  . GLU A 1 213 ? 1.626   -45.761 -4.363  1.00 107.53 ? 284 GLU A HG2  1 
ATOM   3206 H HG3  . GLU A 1 213 ? 2.817   -45.996 -3.355  1.00 107.53 ? 284 GLU A HG3  1 
ATOM   3207 N N    . ARG A 1 214 ? -1.412  -43.933 -2.031  1.00 61.97  ? 285 ARG A N    1 
ATOM   3208 C CA   . ARG A 1 214 ? -2.218  -42.986 -1.272  1.00 64.80  ? 285 ARG A CA   1 
ATOM   3209 C C    . ARG A 1 214 ? -3.697  -43.357 -1.314  1.00 59.25  ? 285 ARG A C    1 
ATOM   3210 O O    . ARG A 1 214 ? -4.415  -43.185 -0.318  1.00 57.89  ? 285 ARG A O    1 
ATOM   3211 C CB   . ARG A 1 214 ? -2.003  -41.572 -1.812  1.00 72.20  ? 285 ARG A CB   1 
ATOM   3212 C CG   . ARG A 1 214 ? -0.735  -40.906 -1.312  1.00 80.48  ? 285 ARG A CG   1 
ATOM   3213 C CD   . ARG A 1 214 ? -0.835  -39.384 -1.372  1.00 85.59  ? 285 ARG A CD   1 
ATOM   3214 N NE   . ARG A 1 214 ? -0.133  -38.765 -0.247  1.00 86.97  ? 285 ARG A NE   1 
ATOM   3215 C CZ   . ARG A 1 214 ? 1.180   -38.851 -0.050  1.00 85.01  ? 285 ARG A CZ   1 
ATOM   3216 N NH1  . ARG A 1 214 ? 1.939   -39.528 -0.894  1.00 86.39  ? 285 ARG A NH1  1 
ATOM   3217 N NH2  . ARG A 1 214 ? 1.739   -38.268 0.993   1.00 81.26  ? 285 ARG A NH2  1 
ATOM   3218 H H    . ARG A 1 214 ? -1.034  -43.600 -2.728  1.00 74.37  ? 285 ARG A H    1 
ATOM   3219 H HA   . ARG A 1 214 ? -1.933  -43.001 -0.345  1.00 77.76  ? 285 ARG A HA   1 
ATOM   3220 H HB2  . ARG A 1 214 ? -1.954  -41.612 -2.780  1.00 86.64  ? 285 ARG A HB2  1 
ATOM   3221 H HB3  . ARG A 1 214 ? -2.757  -41.024 -1.545  1.00 86.64  ? 285 ARG A HB3  1 
ATOM   3222 H HG2  . ARG A 1 214 ? -0.579  -41.163 -0.390  1.00 96.57  ? 285 ARG A HG2  1 
ATOM   3223 H HG3  . ARG A 1 214 ? 0.009   -41.185 -1.868  1.00 96.57  ? 285 ARG A HG3  1 
ATOM   3224 H HD2  . ARG A 1 214 ? -0.428  -39.069 -2.194  1.00 102.71 ? 285 ARG A HD2  1 
ATOM   3225 H HD3  . ARG A 1 214 ? -1.765  -39.114 -1.333  1.00 102.71 ? 285 ARG A HD3  1 
ATOM   3226 H HE   . ARG A 1 214 ? -0.588  -38.269 0.288   1.00 104.37 ? 285 ARG A HE   1 
ATOM   3227 H HH11 . ARG A 1 214 ? 1.593   -39.914 -1.579  1.00 103.67 ? 285 ARG A HH11 1 
ATOM   3228 H HH12 . ARG A 1 214 ? 2.787   -39.578 -0.760  1.00 103.67 ? 285 ARG A HH12 1 
ATOM   3229 H HH21 . ARG A 1 214 ? 1.255   -37.826 1.549   1.00 97.51  ? 285 ARG A HH21 1 
ATOM   3230 H HH22 . ARG A 1 214 ? 2.588   -38.327 1.115   1.00 97.51  ? 285 ARG A HH22 1 
ATOM   3231 N N    . ILE A 1 215 ? -4.178  -43.876 -2.448  1.00 56.05  ? 286 ILE A N    1 
ATOM   3232 C CA   . ILE A 1 215 ? -5.579  -44.286 -2.516  1.00 53.57  ? 286 ILE A CA   1 
ATOM   3233 C C    . ILE A 1 215 ? -5.850  -45.393 -1.513  1.00 53.40  ? 286 ILE A C    1 
ATOM   3234 O O    . ILE A 1 215 ? -6.907  -45.411 -0.870  1.00 51.72  ? 286 ILE A O    1 
ATOM   3235 C CB   . ILE A 1 215 ? -5.965  -44.704 -3.947  1.00 54.62  ? 286 ILE A CB   1 
ATOM   3236 C CG1  . ILE A 1 215 ? -5.990  -43.471 -4.869  1.00 53.69  ? 286 ILE A CG1  1 
ATOM   3237 C CG2  . ILE A 1 215 ? -7.340  -45.390 -3.958  1.00 55.37  ? 286 ILE A CG2  1 
ATOM   3238 C CD1  . ILE A 1 215 ? -6.176  -43.791 -6.339  1.00 53.79  ? 286 ILE A CD1  1 
ATOM   3239 H H    . ILE A 1 215 ? -3.727  -43.998 -3.170  1.00 67.26  ? 286 ILE A H    1 
ATOM   3240 H HA   . ILE A 1 215 ? -6.134  -43.529 -2.273  1.00 64.28  ? 286 ILE A HA   1 
ATOM   3241 H HB   . ILE A 1 215 ? -5.302  -45.329 -4.279  1.00 65.54  ? 286 ILE A HB   1 
ATOM   3242 H HG12 . ILE A 1 215 ? -6.722  -42.896 -4.598  1.00 64.42  ? 286 ILE A HG12 1 
ATOM   3243 H HG13 . ILE A 1 215 ? -5.149  -42.996 -4.775  1.00 64.42  ? 286 ILE A HG13 1 
ATOM   3244 H HG21 . ILE A 1 215 ? -7.656  -45.460 -4.871  1.00 66.44  ? 286 ILE A HG21 1 
ATOM   3245 H HG22 . ILE A 1 215 ? -7.257  -46.277 -3.575  1.00 66.44  ? 286 ILE A HG22 1 
ATOM   3246 H HG23 . ILE A 1 215 ? -7.961  -44.859 -3.435  1.00 66.44  ? 286 ILE A HG23 1 
ATOM   3247 H HD11 . ILE A 1 215 ? -5.953  -43.006 -6.863  1.00 64.54  ? 286 ILE A HD11 1 
ATOM   3248 H HD12 . ILE A 1 215 ? -5.589  -44.525 -6.578  1.00 64.54  ? 286 ILE A HD12 1 
ATOM   3249 H HD13 . ILE A 1 215 ? -7.100  -44.042 -6.495  1.00 64.54  ? 286 ILE A HD13 1 
ATOM   3250 N N    . GLU A 1 216 ? -4.884  -46.304 -1.322  1.00 56.20  ? 287 GLU A N    1 
ATOM   3251 C CA   . GLU A 1 216 ? -5.092  -47.433 -0.422  1.00 62.12  ? 287 GLU A CA   1 
ATOM   3252 C C    . GLU A 1 216 ? -5.122  -46.985 1.033   1.00 63.83  ? 287 GLU A C    1 
ATOM   3253 O O    . GLU A 1 216 ? -5.863  -47.550 1.844   1.00 63.75  ? 287 GLU A O    1 
ATOM   3254 C CB   . GLU A 1 216 ? -4.006  -48.484 -0.635  1.00 69.97  ? 287 GLU A CB   1 
ATOM   3255 C CG   . GLU A 1 216 ? -4.297  -49.797 0.077   1.00 79.01  ? 287 GLU A CG   1 
ATOM   3256 C CD   . GLU A 1 216 ? -5.592  -50.467 -0.414  1.00 85.67  ? 287 GLU A CD   1 
ATOM   3257 O OE1  . GLU A 1 216 ? -5.809  -50.505 -1.645  1.00 87.26  ? 287 GLU A OE1  1 
ATOM   3258 O OE2  . GLU A 1 216 ? -6.399  -50.944 0.424   1.00 88.51  ? 287 GLU A OE2  1 
ATOM   3259 H H    . GLU A 1 216 ? -4.111  -46.286 -1.699  1.00 67.44  ? 287 GLU A H    1 
ATOM   3260 H HA   . GLU A 1 216 ? -5.949  -47.838 -0.626  1.00 74.54  ? 287 GLU A HA   1 
ATOM   3261 H HB2  . GLU A 1 216 ? -3.929  -48.669 -1.584  1.00 83.97  ? 287 GLU A HB2  1 
ATOM   3262 H HB3  . GLU A 1 216 ? -3.165  -48.140 -0.296  1.00 83.97  ? 287 GLU A HB3  1 
ATOM   3263 H HG2  . GLU A 1 216 ? -3.563  -50.411 -0.083  1.00 94.81  ? 287 GLU A HG2  1 
ATOM   3264 H HG3  . GLU A 1 216 ? -4.387  -49.630 1.028   1.00 94.81  ? 287 GLU A HG3  1 
ATOM   3265 N N    . MET A 1 217 ? -4.322  -45.983 1.391   1.00 66.38  ? 288 MET A N    1 
ATOM   3266 C CA   . MET A 1 217 ? -4.398  -45.433 2.738   1.00 68.75  ? 288 MET A CA   1 
ATOM   3267 C C    . MET A 1 217 ? -5.818  -44.993 3.073   1.00 61.98  ? 288 MET A C    1 
ATOM   3268 O O    . MET A 1 217 ? -6.359  -45.339 4.127   1.00 63.09  ? 288 MET A O    1 
ATOM   3269 C CB   . MET A 1 217 ? -3.454  -44.247 2.872   1.00 75.65  ? 288 MET A CB   1 
ATOM   3270 C CG   . MET A 1 217 ? -2.006  -44.590 3.064   1.00 83.26  ? 288 MET A CG   1 
ATOM   3271 S SD   . MET A 1 217 ? -1.059  -43.055 3.184   1.00 87.74  ? 288 MET A SD   1 
ATOM   3272 C CE   . MET A 1 217 ? -1.685  -42.391 4.723   1.00 88.99  ? 288 MET A CE   1 
ATOM   3273 H H    . MET A 1 217 ? -3.737  -45.611 0.882   1.00 79.66  ? 288 MET A H    1 
ATOM   3274 H HA   . MET A 1 217 ? -4.119  -46.112 3.373   1.00 82.51  ? 288 MET A HA   1 
ATOM   3275 H HB2  . MET A 1 217 ? -3.522  -43.708 2.068   1.00 90.78  ? 288 MET A HB2  1 
ATOM   3276 H HB3  . MET A 1 217 ? -3.739  -43.725 3.637   1.00 90.78  ? 288 MET A HB3  1 
ATOM   3277 H HG2  . MET A 1 217 ? -1.893  -45.092 3.886   1.00 99.91  ? 288 MET A HG2  1 
ATOM   3278 H HG3  . MET A 1 217 ? -1.684  -45.097 2.302   1.00 99.91  ? 288 MET A HG3  1 
ATOM   3279 H HE1  . MET A 1 217 ? -1.153  -41.620 4.972   1.00 106.79 ? 288 MET A HE1  1 
ATOM   3280 H HE2  . MET A 1 217 ? -2.610  -42.130 4.603   1.00 106.79 ? 288 MET A HE2  1 
ATOM   3281 H HE3  . MET A 1 217 ? -1.619  -43.073 5.410   1.00 106.79 ? 288 MET A HE3  1 
ATOM   3282 N N    . VAL A 1 218 ? -6.426  -44.203 2.193   1.00 56.71  ? 289 VAL A N    1 
ATOM   3283 C CA   . VAL A 1 218 ? -7.773  -43.694 2.442   1.00 52.12  ? 289 VAL A CA   1 
ATOM   3284 C C    . VAL A 1 218 ? -8.804  -44.819 2.399   1.00 50.72  ? 289 VAL A C    1 
ATOM   3285 O O    . VAL A 1 218 ? -9.709  -44.880 3.240   1.00 47.56  ? 289 VAL A O    1 
ATOM   3286 C CB   . VAL A 1 218 ? -8.106  -42.597 1.417   1.00 51.61  ? 289 VAL A CB   1 
ATOM   3287 C CG1  . VAL A 1 218 ? -9.570  -42.225 1.468   1.00 50.68  ? 289 VAL A CG1  1 
ATOM   3288 C CG2  . VAL A 1 218 ? -7.218  -41.389 1.660   1.00 51.10  ? 289 VAL A CG2  1 
ATOM   3289 H H    . VAL A 1 218 ? -6.083  -43.947 1.447   1.00 68.05  ? 289 VAL A H    1 
ATOM   3290 H HA   . VAL A 1 218 ? -7.801  -43.296 3.326   1.00 62.55  ? 289 VAL A HA   1 
ATOM   3291 H HB   . VAL A 1 218 ? -7.915  -42.932 0.527   1.00 61.93  ? 289 VAL A HB   1 
ATOM   3292 H HG11 . VAL A 1 218 ? -9.695  -41.393 0.988   1.00 60.82  ? 289 VAL A HG11 1 
ATOM   3293 H HG12 . VAL A 1 218 ? -10.094 -42.926 1.050   1.00 60.82  ? 289 VAL A HG12 1 
ATOM   3294 H HG13 . VAL A 1 218 ? -9.837  -42.116 2.394   1.00 60.82  ? 289 VAL A HG13 1 
ATOM   3295 H HG21 . VAL A 1 218 ? -7.428  -40.707 1.004   1.00 61.32  ? 289 VAL A HG21 1 
ATOM   3296 H HG22 . VAL A 1 218 ? -7.384  -41.051 2.553   1.00 61.32  ? 289 VAL A HG22 1 
ATOM   3297 H HG23 . VAL A 1 218 ? -6.290  -41.656 1.574   1.00 61.32  ? 289 VAL A HG23 1 
ATOM   3298 N N    . VAL A 1 219 ? -8.721  -45.683 1.380   1.00 53.59  ? 290 VAL A N    1 
ATOM   3299 C CA   . VAL A 1 219 ? -9.679  -46.782 1.227   1.00 58.54  ? 290 VAL A CA   1 
ATOM   3300 C C    . VAL A 1 219 ? -9.659  -47.701 2.445   1.00 61.46  ? 290 VAL A C    1 
ATOM   3301 O O    . VAL A 1 219 ? -10.710 -48.136 2.931   1.00 58.78  ? 290 VAL A O    1 
ATOM   3302 C CB   . VAL A 1 219 ? -9.374  -47.577 -0.055  1.00 61.99  ? 290 VAL A CB   1 
ATOM   3303 C CG1  . VAL A 1 219 ? -10.015 -48.977 -0.004  1.00 66.76  ? 290 VAL A CG1  1 
ATOM   3304 C CG2  . VAL A 1 219 ? -9.854  -46.817 -1.270  1.00 59.55  ? 290 VAL A CG2  1 
ATOM   3305 H H    . VAL A 1 219 ? -8.120  -45.653 0.766   1.00 64.31  ? 290 VAL A H    1 
ATOM   3306 H HA   . VAL A 1 219 ? -10.572 -46.413 1.145   1.00 70.25  ? 290 VAL A HA   1 
ATOM   3307 H HB   . VAL A 1 219 ? -8.414  -47.691 -0.134  1.00 74.38  ? 290 VAL A HB   1 
ATOM   3308 H HG11 . VAL A 1 219 ? -10.023 -49.344 -0.901  1.00 80.11  ? 290 VAL A HG11 1 
ATOM   3309 H HG12 . VAL A 1 219 ? -9.491  -49.549 0.578   1.00 80.11  ? 290 VAL A HG12 1 
ATOM   3310 H HG13 . VAL A 1 219 ? -10.923 -48.900 0.328   1.00 80.11  ? 290 VAL A HG13 1 
ATOM   3311 H HG21 . VAL A 1 219 ? -9.640  -47.328 -2.066  1.00 71.46  ? 290 VAL A HG21 1 
ATOM   3312 H HG22 . VAL A 1 219 ? -10.814 -46.692 -1.205  1.00 71.46  ? 290 VAL A HG22 1 
ATOM   3313 H HG23 . VAL A 1 219 ? -9.409  -45.956 -1.299  1.00 71.46  ? 290 VAL A HG23 1 
ATOM   3314 N N    . LYS A 1 220 ? -8.460  -48.057 2.926   1.00 66.15  ? 291 LYS A N    1 
ATOM   3315 C CA   . LYS A 1 220 ? -8.367  -49.003 4.031   1.00 73.21  ? 291 LYS A CA   1 
ATOM   3316 C C    . LYS A 1 220 ? -9.023  -48.469 5.296   1.00 68.08  ? 291 LYS A C    1 
ATOM   3317 O O    . LYS A 1 220 ? -9.304  -49.245 6.210   1.00 70.81  ? 291 LYS A O    1 
ATOM   3318 C CB   . LYS A 1 220 ? -6.903  -49.362 4.309   1.00 86.41  ? 291 LYS A CB   1 
ATOM   3319 C CG   . LYS A 1 220 ? -6.750  -50.453 5.365   1.00 99.35  ? 291 LYS A CG   1 
ATOM   3320 C CD   . LYS A 1 220 ? -5.324  -50.966 5.487   1.00 108.26 ? 291 LYS A CD   1 
ATOM   3321 C CE   . LYS A 1 220 ? -5.212  -52.017 6.589   1.00 112.54 ? 291 LYS A CE   1 
ATOM   3322 N NZ   . LYS A 1 220 ? -3.806  -52.499 6.770   1.00 113.90 ? 291 LYS A NZ   1 
ATOM   3323 H H    . LYS A 1 220 ? -7.704  -47.769 2.633   1.00 79.38  ? 291 LYS A H    1 
ATOM   3324 H HA   . LYS A 1 220 ? -8.829  -49.819 3.781   1.00 87.85  ? 291 LYS A HA   1 
ATOM   3325 H HB2  . LYS A 1 220 ? -6.495  -49.680 3.489   1.00 103.69 ? 291 LYS A HB2  1 
ATOM   3326 H HB3  . LYS A 1 220 ? -6.439  -48.571 4.626   1.00 103.69 ? 291 LYS A HB3  1 
ATOM   3327 H HG2  . LYS A 1 220 ? -7.011  -50.097 6.228   1.00 119.22 ? 291 LYS A HG2  1 
ATOM   3328 H HG3  . LYS A 1 220 ? -7.319  -51.202 5.130   1.00 119.22 ? 291 LYS A HG3  1 
ATOM   3329 H HD2  . LYS A 1 220 ? -5.056  -51.373 4.648   1.00 129.91 ? 291 LYS A HD2  1 
ATOM   3330 H HD3  . LYS A 1 220 ? -4.734  -50.228 5.708   1.00 129.91 ? 291 LYS A HD3  1 
ATOM   3331 H HE2  . LYS A 1 220 ? -5.509  -51.631 7.428   1.00 135.05 ? 291 LYS A HE2  1 
ATOM   3332 H HE3  . LYS A 1 220 ? -5.765  -52.780 6.358   1.00 135.05 ? 291 LYS A HE3  1 
ATOM   3333 H HZ1  . LYS A 1 220 ? -3.775  -53.109 7.417   1.00 136.68 ? 291 LYS A HZ1  1 
ATOM   3334 H HZ2  . LYS A 1 220 ? -3.510  -52.864 6.014   1.00 136.68 ? 291 LYS A HZ2  1 
ATOM   3335 H HZ3  . LYS A 1 220 ? -3.277  -51.818 6.989   1.00 136.68 ? 291 LYS A HZ3  1 
ATOM   3336 N N    . LYS A 1 221 ? -9.284  -47.168 5.371   1.00 62.12  ? 292 LYS A N    1 
ATOM   3337 C CA   . LYS A 1 221 ? -9.958  -46.605 6.531   1.00 59.70  ? 292 LYS A CA   1 
ATOM   3338 C C    . LYS A 1 221 ? -11.473 -46.786 6.509   1.00 59.90  ? 292 LYS A C    1 
ATOM   3339 O O    . LYS A 1 221 ? -12.128 -46.402 7.481   1.00 60.68  ? 292 LYS A O    1 
ATOM   3340 C CB   . LYS A 1 221 ? -9.641  -45.110 6.650   1.00 58.98  ? 292 LYS A CB   1 
ATOM   3341 C CG   . LYS A 1 221 ? -8.214  -44.786 6.959   1.00 62.73  ? 292 LYS A CG   1 
ATOM   3342 C CD   . LYS A 1 221 ? -7.842  -45.318 8.317   1.00 70.23  ? 292 LYS A CD   1 
ATOM   3343 C CE   . LYS A 1 221 ? -6.480  -44.864 8.752   1.00 78.43  ? 292 LYS A CE   1 
ATOM   3344 N NZ   . LYS A 1 221 ? -6.166  -45.494 10.057  1.00 85.18  ? 292 LYS A NZ   1 
ATOM   3345 H H    . LYS A 1 221 ? -9.081  -46.592 4.766   1.00 74.54  ? 292 LYS A H    1 
ATOM   3346 H HA   . LYS A 1 221 ? -9.628  -47.049 7.327   1.00 71.64  ? 292 LYS A HA   1 
ATOM   3347 H HB2  . LYS A 1 221 ? -9.862  -44.680 5.809   1.00 70.78  ? 292 LYS A HB2  1 
ATOM   3348 H HB3  . LYS A 1 221 ? -10.186 -44.735 7.359   1.00 70.78  ? 292 LYS A HB3  1 
ATOM   3349 H HG2  . LYS A 1 221 ? -7.637  -45.199 6.298   1.00 75.28  ? 292 LYS A HG2  1 
ATOM   3350 H HG3  . LYS A 1 221 ? -8.093  -43.824 6.961   1.00 75.28  ? 292 LYS A HG3  1 
ATOM   3351 H HD2  . LYS A 1 221 ? -8.488  -45.006 8.970   1.00 84.28  ? 292 LYS A HD2  1 
ATOM   3352 H HD3  . LYS A 1 221 ? -7.835  -46.287 8.291   1.00 84.28  ? 292 LYS A HD3  1 
ATOM   3353 H HE2  . LYS A 1 221 ? -5.817  -45.143 8.102   1.00 94.11  ? 292 LYS A HE2  1 
ATOM   3354 H HE3  . LYS A 1 221 ? -6.473  -43.900 8.860   1.00 94.11  ? 292 LYS A HE3  1 
ATOM   3355 H HZ1  . LYS A 1 221 ? -5.360  -45.236 10.333  1.00 102.21 ? 292 LYS A HZ1  1 
ATOM   3356 H HZ2  . LYS A 1 221 ? -6.770  -45.253 10.664  1.00 102.21 ? 292 LYS A HZ2  1 
ATOM   3357 H HZ3  . LYS A 1 221 ? -6.175  -46.380 9.977   1.00 102.21 ? 292 LYS A HZ3  1 
ATOM   3358 N N    . GLY A 1 222 ? -12.047 -47.327 5.437   1.00 63.86  ? 293 GLY A N    1 
ATOM   3359 C CA   . GLY A 1 222 ? -13.474 -47.612 5.395   1.00 66.08  ? 293 GLY A CA   1 
ATOM   3360 C C    . GLY A 1 222 ? -14.376 -46.460 5.007   1.00 67.28  ? 293 GLY A C    1 
ATOM   3361 O O    . GLY A 1 222 ? -15.578 -46.508 5.282   1.00 70.91  ? 293 GLY A O    1 
ATOM   3362 H H    . GLY A 1 222 ? -11.627 -47.539 4.717   1.00 76.63  ? 293 GLY A H    1 
ATOM   3363 H HA2  . GLY A 1 222 ? -13.628 -48.331 4.763   1.00 79.30  ? 293 GLY A HA2  1 
ATOM   3364 H HA3  . GLY A 1 222 ? -13.754 -47.923 6.270   1.00 79.30  ? 293 GLY A HA3  1 
ATOM   3365 N N    . VAL A 1 223 ? -13.849 -45.434 4.335   1.00 63.08  ? 294 VAL A N    1 
ATOM   3366 C CA   . VAL A 1 223 ? -14.637 -44.229 4.085   1.00 59.50  ? 294 VAL A CA   1 
ATOM   3367 C C    . VAL A 1 223 ? -15.559 -44.344 2.885   1.00 57.18  ? 294 VAL A C    1 
ATOM   3368 O O    . VAL A 1 223 ? -16.435 -43.486 2.709   1.00 58.13  ? 294 VAL A O    1 
ATOM   3369 C CB   . VAL A 1 223 ? -13.714 -43.014 3.872   1.00 59.06  ? 294 VAL A CB   1 
ATOM   3370 C CG1  . VAL A 1 223 ? -12.805 -42.823 5.081   1.00 63.73  ? 294 VAL A CG1  1 
ATOM   3371 C CG2  . VAL A 1 223 ? -12.884 -43.188 2.617   1.00 54.33  ? 294 VAL A CG2  1 
ATOM   3372 H H    . VAL A 1 223 ? -13.049 -45.413 4.021   1.00 75.70  ? 294 VAL A H    1 
ATOM   3373 H HA   . VAL A 1 223 ? -15.187 -44.050 4.864   1.00 71.40  ? 294 VAL A HA   1 
ATOM   3374 H HB   . VAL A 1 223 ? -14.255 -42.215 3.770   1.00 70.88  ? 294 VAL A HB   1 
ATOM   3375 H HG11 . VAL A 1 223 ? -12.304 -41.999 4.972   1.00 76.48  ? 294 VAL A HG11 1 
ATOM   3376 H HG12 . VAL A 1 223 ? -13.353 -42.775 5.880   1.00 76.48  ? 294 VAL A HG12 1 
ATOM   3377 H HG13 . VAL A 1 223 ? -12.196 -43.576 5.142   1.00 76.48  ? 294 VAL A HG13 1 
ATOM   3378 H HG21 . VAL A 1 223 ? -12.187 -42.514 2.608   1.00 65.19  ? 294 VAL A HG21 1 
ATOM   3379 H HG22 . VAL A 1 223 ? -12.486 -44.072 2.614   1.00 65.19  ? 294 VAL A HG22 1 
ATOM   3380 H HG23 . VAL A 1 223 ? -13.454 -43.080 1.840   1.00 65.19  ? 294 VAL A HG23 1 
ATOM   3381 N N    . VAL A 1 224 ? -15.391 -45.369 2.050   1.00 55.02  ? 295 VAL A N    1 
ATOM   3382 C CA   . VAL A 1 224 ? -16.069 -45.384 0.758   1.00 53.96  ? 295 VAL A CA   1 
ATOM   3383 C C    . VAL A 1 224 ? -17.584 -45.418 0.910   1.00 54.07  ? 295 VAL A C    1 
ATOM   3384 O O    . VAL A 1 224 ? -18.269 -44.673 0.191   1.00 52.13  ? 295 VAL A O    1 
ATOM   3385 C CB   . VAL A 1 224 ? -15.533 -46.536 -0.108  1.00 56.96  ? 295 VAL A CB   1 
ATOM   3386 C CG1  . VAL A 1 224 ? -16.250 -46.563 -1.434  1.00 57.75  ? 295 VAL A CG1  1 
ATOM   3387 C CG2  . VAL A 1 224 ? -14.069 -46.339 -0.364  1.00 56.16  ? 295 VAL A CG2  1 
ATOM   3388 H H    . VAL A 1 224 ? -14.899 -46.057 2.205   1.00 66.03  ? 295 VAL A H    1 
ATOM   3389 H HA   . VAL A 1 224 ? -15.851 -44.559 0.297   1.00 64.75  ? 295 VAL A HA   1 
ATOM   3390 H HB   . VAL A 1 224 ? -15.662 -47.386 0.339   1.00 68.35  ? 295 VAL A HB   1 
ATOM   3391 H HG11 . VAL A 1 224 ? -15.759 -47.136 -2.044  1.00 69.31  ? 295 VAL A HG11 1 
ATOM   3392 H HG12 . VAL A 1 224 ? -17.146 -46.911 -1.305  1.00 69.31  ? 295 VAL A HG12 1 
ATOM   3393 H HG13 . VAL A 1 224 ? -16.290 -45.661 -1.789  1.00 69.31  ? 295 VAL A HG13 1 
ATOM   3394 H HG21 . VAL A 1 224 ? -13.700 -47.162 -0.721  1.00 67.39  ? 295 VAL A HG21 1 
ATOM   3395 H HG22 . VAL A 1 224 ? -13.957 -45.621 -1.007  1.00 67.39  ? 295 VAL A HG22 1 
ATOM   3396 H HG23 . VAL A 1 224 ? -13.622 -46.111 0.464   1.00 67.39  ? 295 VAL A HG23 1 
ATOM   3397 N N    . PRO A 1 225 ? -18.169 -46.244 1.782   1.00 56.62  ? 296 PRO A N    1 
ATOM   3398 C CA   . PRO A 1 225 ? -19.639 -46.213 1.934   1.00 55.18  ? 296 PRO A CA   1 
ATOM   3399 C C    . PRO A 1 225 ? -20.174 -44.844 2.312   1.00 53.54  ? 296 PRO A C    1 
ATOM   3400 O O    . PRO A 1 225 ? -21.241 -44.448 1.835   1.00 53.89  ? 296 PRO A O    1 
ATOM   3401 C CB   . PRO A 1 225 ? -19.899 -47.254 3.031   1.00 56.48  ? 296 PRO A CB   1 
ATOM   3402 C CG   . PRO A 1 225 ? -18.733 -48.185 2.953   1.00 57.55  ? 296 PRO A CG   1 
ATOM   3403 C CD   . PRO A 1 225 ? -17.557 -47.343 2.552   1.00 58.15  ? 296 PRO A CD   1 
ATOM   3404 H HA   . PRO A 1 225 ? -20.065 -46.504 1.113   1.00 66.21  ? 296 PRO A HA   1 
ATOM   3405 H HB2  . PRO A 1 225 ? -19.934 -46.817 3.896   1.00 67.77  ? 296 PRO A HB2  1 
ATOM   3406 H HB3  . PRO A 1 225 ? -20.728 -47.724 2.848   1.00 67.77  ? 296 PRO A HB3  1 
ATOM   3407 H HG2  . PRO A 1 225 ? -18.582 -48.589 3.822   1.00 69.06  ? 296 PRO A HG2  1 
ATOM   3408 H HG3  . PRO A 1 225 ? -18.907 -48.867 2.286   1.00 69.06  ? 296 PRO A HG3  1 
ATOM   3409 H HD2  . PRO A 1 225 ? -17.107 -46.996 3.338   1.00 69.79  ? 296 PRO A HD2  1 
ATOM   3410 H HD3  . PRO A 1 225 ? -16.954 -47.857 1.995   1.00 69.79  ? 296 PRO A HD3  1 
ATOM   3411 N N    . GLN A 1 226 ? -19.453 -44.097 3.144   1.00 50.83  ? 297 GLN A N    1 
ATOM   3412 C CA   . GLN A 1 226 ? -19.907 -42.766 3.517   1.00 50.02  ? 297 GLN A CA   1 
ATOM   3413 C C    . GLN A 1 226 ? -19.686 -41.764 2.387   1.00 48.02  ? 297 GLN A C    1 
ATOM   3414 O O    . GLN A 1 226 ? -20.510 -40.861 2.191   1.00 48.06  ? 297 GLN A O    1 
ATOM   3415 C CB   . GLN A 1 226 ? -19.191 -42.320 4.782   1.00 52.34  ? 297 GLN A CB   1 
ATOM   3416 C CG   . GLN A 1 226 ? -19.521 -40.912 5.233   1.00 55.33  ? 297 GLN A CG   1 
ATOM   3417 C CD   . GLN A 1 226 ? -20.939 -40.761 5.738   1.00 58.56  ? 297 GLN A CD   1 
ATOM   3418 O OE1  . GLN A 1 226 ? -21.683 -41.730 5.855   1.00 59.80  ? 297 GLN A OE1  1 
ATOM   3419 N NE2  . GLN A 1 226 ? -21.318 -39.531 6.045   1.00 58.77  ? 297 GLN A NE2  1 
ATOM   3420 H H    . GLN A 1 226 ? -18.708 -44.335 3.501   1.00 60.99  ? 297 GLN A H    1 
ATOM   3421 H HA   . GLN A 1 226 ? -20.858 -42.798 3.707   1.00 60.03  ? 297 GLN A HA   1 
ATOM   3422 H HB2  . GLN A 1 226 ? -19.431 -42.923 5.503   1.00 62.80  ? 297 GLN A HB2  1 
ATOM   3423 H HB3  . GLN A 1 226 ? -18.234 -42.362 4.627   1.00 62.80  ? 297 GLN A HB3  1 
ATOM   3424 H HG2  . GLN A 1 226 ? -18.925 -40.674 5.960   1.00 66.40  ? 297 GLN A HG2  1 
ATOM   3425 H HG3  . GLN A 1 226 ? -19.397 -40.294 4.497   1.00 66.40  ? 297 GLN A HG3  1 
ATOM   3426 H HE21 . GLN A 1 226 ? -20.768 -38.876 5.952   1.00 70.52  ? 297 GLN A HE21 1 
ATOM   3427 H HE22 . GLN A 1 226 ? -22.114 -39.387 6.337   1.00 70.52  ? 297 GLN A HE22 1 
ATOM   3428 N N    . LEU A 1 227 ? -18.598 -41.902 1.623   1.00 48.57  ? 298 LEU A N    1 
ATOM   3429 C CA   . LEU A 1 227 ? -18.460 -41.068 0.432   1.00 48.23  ? 298 LEU A CA   1 
ATOM   3430 C C    . LEU A 1 227 ? -19.630 -41.285 -0.522  1.00 48.32  ? 298 LEU A C    1 
ATOM   3431 O O    . LEU A 1 227 ? -20.126 -40.336 -1.139  1.00 46.95  ? 298 LEU A O    1 
ATOM   3432 C CB   . LEU A 1 227 ? -17.144 -41.361 -0.292  1.00 49.81  ? 298 LEU A CB   1 
ATOM   3433 C CG   . LEU A 1 227 ? -15.849 -40.806 0.305   1.00 52.09  ? 298 LEU A CG   1 
ATOM   3434 C CD1  . LEU A 1 227 ? -14.676 -41.332 -0.482  1.00 52.47  ? 298 LEU A CD1  1 
ATOM   3435 C CD2  . LEU A 1 227 ? -15.829 -39.261 0.328   1.00 53.34  ? 298 LEU A CD2  1 
ATOM   3436 H H    . LEU A 1 227 ? -17.951 -42.450 1.766   1.00 58.28  ? 298 LEU A H    1 
ATOM   3437 H HA   . LEU A 1 227 ? -18.458 -40.135 0.697   1.00 57.88  ? 298 LEU A HA   1 
ATOM   3438 H HB2  . LEU A 1 227 ? -17.041 -42.324 -0.342  1.00 59.78  ? 298 LEU A HB2  1 
ATOM   3439 H HB3  . LEU A 1 227 ? -17.214 -41.005 -1.191  1.00 59.78  ? 298 LEU A HB3  1 
ATOM   3440 H HG   . LEU A 1 227 ? -15.762 -41.120 1.218   1.00 62.50  ? 298 LEU A HG   1 
ATOM   3441 H HD11 . LEU A 1 227 ? -13.857 -40.975 -0.104  1.00 62.97  ? 298 LEU A HD11 1 
ATOM   3442 H HD12 . LEU A 1 227 ? -14.670 -42.301 -0.429  1.00 62.97  ? 298 LEU A HD12 1 
ATOM   3443 H HD13 . LEU A 1 227 ? -14.765 -41.051 -1.406  1.00 62.97  ? 298 LEU A HD13 1 
ATOM   3444 H HD21 . LEU A 1 227 ? -14.962 -38.962 0.643   1.00 64.01  ? 298 LEU A HD21 1 
ATOM   3445 H HD22 . LEU A 1 227 ? -15.987 -38.930 -0.570  1.00 64.01  ? 298 LEU A HD22 1 
ATOM   3446 H HD23 . LEU A 1 227 ? -16.525 -38.944 0.925   1.00 64.01  ? 298 LEU A HD23 1 
ATOM   3447 N N    . VAL A 1 228 ? -20.071 -42.531 -0.676  1.00 50.00  ? 299 VAL A N    1 
ATOM   3448 C CA   . VAL A 1 228 ? -21.162 -42.797 -1.601  1.00 52.46  ? 299 VAL A CA   1 
ATOM   3449 C C    . VAL A 1 228 ? -22.454 -42.189 -1.082  1.00 54.69  ? 299 VAL A C    1 
ATOM   3450 O O    . VAL A 1 228 ? -23.209 -41.583 -1.840  1.00 53.66  ? 299 VAL A O    1 
ATOM   3451 C CB   . VAL A 1 228 ? -21.285 -44.305 -1.848  1.00 55.79  ? 299 VAL A CB   1 
ATOM   3452 C CG1  . VAL A 1 228 ? -22.545 -44.615 -2.626  1.00 57.21  ? 299 VAL A CG1  1 
ATOM   3453 C CG2  . VAL A 1 228 ? -20.065 -44.773 -2.606  1.00 54.74  ? 299 VAL A CG2  1 
ATOM   3454 H H    . VAL A 1 228 ? -19.763 -43.222 -0.267  1.00 60.00  ? 299 VAL A H    1 
ATOM   3455 H HA   . VAL A 1 228 ? -20.959 -42.375 -2.450  1.00 62.95  ? 299 VAL A HA   1 
ATOM   3456 H HB   . VAL A 1 228 ? -21.321 -44.773 -0.999  1.00 66.95  ? 299 VAL A HB   1 
ATOM   3457 H HG11 . VAL A 1 228 ? -22.475 -45.510 -2.993  1.00 68.65  ? 299 VAL A HG11 1 
ATOM   3458 H HG12 . VAL A 1 228 ? -23.309 -44.563 -2.030  1.00 68.65  ? 299 VAL A HG12 1 
ATOM   3459 H HG13 . VAL A 1 228 ? -22.638 -43.970 -3.345  1.00 68.65  ? 299 VAL A HG13 1 
ATOM   3460 H HG21 . VAL A 1 228 ? -20.168 -45.713 -2.819  1.00 65.69  ? 299 VAL A HG21 1 
ATOM   3461 H HG22 . VAL A 1 228 ? -19.984 -44.256 -3.423  1.00 65.69  ? 299 VAL A HG22 1 
ATOM   3462 H HG23 . VAL A 1 228 ? -19.279 -44.642 -2.053  1.00 65.69  ? 299 VAL A HG23 1 
ATOM   3463 N N    . LYS A 1 229 ? -22.719 -42.315 0.216   1.00 56.83  ? 300 LYS A N    1 
ATOM   3464 C CA   . LYS A 1 229 ? -23.890 -41.660 0.782   1.00 61.16  ? 300 LYS A CA   1 
ATOM   3465 C C    . LYS A 1 229 ? -23.848 -40.152 0.542   1.00 59.98  ? 300 LYS A C    1 
ATOM   3466 O O    . LYS A 1 229 ? -24.871 -39.542 0.200   1.00 63.67  ? 300 LYS A O    1 
ATOM   3467 C CB   . LYS A 1 229 ? -23.984 -41.974 2.271   1.00 66.92  ? 300 LYS A CB   1 
ATOM   3468 C CG   . LYS A 1 229 ? -25.259 -41.484 2.927   1.00 74.50  ? 300 LYS A CG   1 
ATOM   3469 C CD   . LYS A 1 229 ? -25.059 -41.124 4.395   1.00 83.75  ? 300 LYS A CD   1 
ATOM   3470 C CE   . LYS A 1 229 ? -24.692 -42.329 5.227   1.00 92.95  ? 300 LYS A CE   1 
ATOM   3471 N NZ   . LYS A 1 229 ? -24.500 -41.959 6.654   1.00 99.19  ? 300 LYS A NZ   1 
ATOM   3472 H H    . LYS A 1 229 ? -22.247 -42.764 0.778   1.00 68.19  ? 300 LYS A H    1 
ATOM   3473 H HA   . LYS A 1 229 ? -24.686 -42.009 0.351   1.00 73.39  ? 300 LYS A HA   1 
ATOM   3474 H HB2  . LYS A 1 229 ? -23.941 -42.936 2.390   1.00 80.30  ? 300 LYS A HB2  1 
ATOM   3475 H HB3  . LYS A 1 229 ? -23.237 -41.554 2.726   1.00 80.30  ? 300 LYS A HB3  1 
ATOM   3476 H HG2  . LYS A 1 229 ? -25.578 -40.693 2.466   1.00 89.40  ? 300 LYS A HG2  1 
ATOM   3477 H HG3  . LYS A 1 229 ? -25.927 -42.186 2.880   1.00 89.40  ? 300 LYS A HG3  1 
ATOM   3478 H HD2  . LYS A 1 229 ? -24.342 -40.475 4.470   1.00 100.50 ? 300 LYS A HD2  1 
ATOM   3479 H HD3  . LYS A 1 229 ? -25.883 -40.753 4.747   1.00 100.50 ? 300 LYS A HD3  1 
ATOM   3480 H HE2  . LYS A 1 229 ? -25.405 -42.984 5.175   1.00 111.53 ? 300 LYS A HE2  1 
ATOM   3481 H HE3  . LYS A 1 229 ? -23.862 -42.708 4.898   1.00 111.53 ? 300 LYS A HE3  1 
ATOM   3482 H HZ1  . LYS A 1 229 ? -23.847 -41.359 6.727   1.00 119.03 ? 300 LYS A HZ1  1 
ATOM   3483 H HZ2  . LYS A 1 229 ? -25.251 -41.611 6.981   1.00 119.03 ? 300 LYS A HZ2  1 
ATOM   3484 H HZ3  . LYS A 1 229 ? -24.285 -42.680 7.129   1.00 119.03 ? 300 LYS A HZ3  1 
ATOM   3485 N N    . LEU A 1 230 ? -22.676 -39.528 0.709   1.00 55.25  ? 301 LEU A N    1 
ATOM   3486 C CA   . LEU A 1 230 ? -22.569 -38.089 0.457   1.00 52.09  ? 301 LEU A CA   1 
ATOM   3487 C C    . LEU A 1 230 ? -22.666 -37.750 -1.018  1.00 48.07  ? 301 LEU A C    1 
ATOM   3488 O O    . LEU A 1 230 ? -22.966 -36.602 -1.364  1.00 45.85  ? 301 LEU A O    1 
ATOM   3489 C CB   . LEU A 1 230 ? -21.249 -37.541 0.997   1.00 53.86  ? 301 LEU A CB   1 
ATOM   3490 C CG   . LEU A 1 230 ? -21.151 -37.633 2.511   1.00 56.81  ? 301 LEU A CG   1 
ATOM   3491 C CD1  . LEU A 1 230 ? -19.797 -37.169 2.931   1.00 58.44  ? 301 LEU A CD1  1 
ATOM   3492 C CD2  . LEU A 1 230 ? -22.229 -36.807 3.186   1.00 57.26  ? 301 LEU A CD2  1 
ATOM   3493 H H    . LEU A 1 230 ? -21.946 -39.906 0.961   1.00 66.29  ? 301 LEU A H    1 
ATOM   3494 H HA   . LEU A 1 230 ? -23.297 -37.636 0.909   1.00 62.51  ? 301 LEU A HA   1 
ATOM   3495 H HB2  . LEU A 1 230 ? -20.516 -38.051 0.617   1.00 64.63  ? 301 LEU A HB2  1 
ATOM   3496 H HB3  . LEU A 1 230 ? -21.168 -36.607 0.747   1.00 64.63  ? 301 LEU A HB3  1 
ATOM   3497 H HG   . LEU A 1 230 ? -21.257 -38.557 2.786   1.00 68.17  ? 301 LEU A HG   1 
ATOM   3498 H HD11 . LEU A 1 230 ? -19.702 -37.297 3.888   1.00 70.12  ? 301 LEU A HD11 1 
ATOM   3499 H HD12 . LEU A 1 230 ? -19.125 -37.686 2.459   1.00 70.12  ? 301 LEU A HD12 1 
ATOM   3500 H HD13 . LEU A 1 230 ? -19.705 -36.229 2.712   1.00 70.12  ? 301 LEU A HD13 1 
ATOM   3501 H HD21 . LEU A 1 230 ? -22.000 -36.695 4.122   1.00 68.71  ? 301 LEU A HD21 1 
ATOM   3502 H HD22 . LEU A 1 230 ? -22.280 -35.941 2.752   1.00 68.71  ? 301 LEU A HD22 1 
ATOM   3503 H HD23 . LEU A 1 230 ? -23.079 -37.268 3.106   1.00 68.71  ? 301 LEU A HD23 1 
ATOM   3504 N N    . LEU A 1 231 ? -22.376 -38.716 -1.882  1.00 49.95  ? 302 LEU A N    1 
ATOM   3505 C CA   . LEU A 1 231 ? -22.604 -38.536 -3.304  1.00 51.39  ? 302 LEU A CA   1 
ATOM   3506 C C    . LEU A 1 231 ? -24.086 -38.369 -3.601  1.00 55.16  ? 302 LEU A C    1 
ATOM   3507 O O    . LEU A 1 231 ? -24.463 -37.630 -4.522  1.00 55.85  ? 302 LEU A O    1 
ATOM   3508 C CB   . LEU A 1 231 ? -22.042 -39.740 -4.047  1.00 49.08  ? 302 LEU A CB   1 
ATOM   3509 C CG   . LEU A 1 231 ? -21.754 -39.599 -5.518  1.00 49.49  ? 302 LEU A CG   1 
ATOM   3510 C CD1  . LEU A 1 231 ? -20.705 -38.549 -5.706  1.00 46.76  ? 302 LEU A CD1  1 
ATOM   3511 C CD2  . LEU A 1 231 ? -21.271 -40.947 -6.039  1.00 50.86  ? 302 LEU A CD2  1 
ATOM   3512 H H    . LEU A 1 231 ? -22.047 -39.482 -1.669  1.00 59.94  ? 302 LEU A H    1 
ATOM   3513 H HA   . LEU A 1 231 ? -22.141 -37.738 -3.602  1.00 61.67  ? 302 LEU A HA   1 
ATOM   3514 H HB2  . LEU A 1 231 ? -21.209 -39.993 -3.619  1.00 58.90  ? 302 LEU A HB2  1 
ATOM   3515 H HB3  . LEU A 1 231 ? -22.677 -40.467 -3.956  1.00 58.90  ? 302 LEU A HB3  1 
ATOM   3516 H HG   . LEU A 1 231 ? -22.558 -39.339 -5.995  1.00 59.39  ? 302 LEU A HG   1 
ATOM   3517 H HD11 . LEU A 1 231 ? -20.353 -38.616 -6.607  1.00 56.12  ? 302 LEU A HD11 1 
ATOM   3518 H HD12 . LEU A 1 231 ? -21.102 -37.675 -5.572  1.00 56.12  ? 302 LEU A HD12 1 
ATOM   3519 H HD13 . LEU A 1 231 ? -19.993 -38.694 -5.063  1.00 56.12  ? 302 LEU A HD13 1 
ATOM   3520 H HD21 . LEU A 1 231 ? -21.077 -40.868 -6.986  1.00 61.02  ? 302 LEU A HD21 1 
ATOM   3521 H HD22 . LEU A 1 231 ? -20.469 -41.203 -5.557  1.00 61.02  ? 302 LEU A HD22 1 
ATOM   3522 H HD23 . LEU A 1 231 ? -21.967 -41.608 -5.898  1.00 61.02  ? 302 LEU A HD23 1 
ATOM   3523 N N    . GLY A 1 232 ? -24.937 -39.054 -2.838  1.00 55.27  ? 303 GLY A N    1 
ATOM   3524 C CA   . GLY A 1 232 ? -26.361 -38.937 -3.000  1.00 58.79  ? 303 GLY A CA   1 
ATOM   3525 C C    . GLY A 1 232 ? -26.971 -37.751 -2.304  1.00 61.99  ? 303 GLY A C    1 
ATOM   3526 O O    . GLY A 1 232 ? -28.194 -37.628 -2.288  1.00 64.78  ? 303 GLY A O    1 
ATOM   3527 H H    . GLY A 1 232 ? -24.700 -39.597 -2.215  1.00 66.32  ? 303 GLY A H    1 
ATOM   3528 H HA2  . GLY A 1 232 ? -26.568 -38.870 -3.945  1.00 70.55  ? 303 GLY A HA2  1 
ATOM   3529 H HA3  . GLY A 1 232 ? -26.785 -39.738 -2.655  1.00 70.55  ? 303 GLY A HA3  1 
ATOM   3530 N N    . ALA A 1 233 ? -26.167 -36.872 -1.719  1.00 63.07  ? 304 ALA A N    1 
ATOM   3531 C CA   . ALA A 1 233 ? -26.725 -35.729 -1.018  1.00 65.47  ? 304 ALA A CA   1 
ATOM   3532 C C    . ALA A 1 233 ? -27.381 -34.783 -2.018  1.00 70.60  ? 304 ALA A C    1 
ATOM   3533 O O    . ALA A 1 233 ? -27.179 -34.878 -3.235  1.00 71.28  ? 304 ALA A O    1 
ATOM   3534 C CB   . ALA A 1 233 ? -25.639 -35.004 -0.216  1.00 63.81  ? 304 ALA A CB   1 
ATOM   3535 H H    . ALA A 1 233 ? -25.308 -36.914 -1.713  1.00 75.69  ? 304 ALA A H    1 
ATOM   3536 H HA   . ALA A 1 233 ? -27.406 -36.035 -0.399  1.00 78.57  ? 304 ALA A HA   1 
ATOM   3537 H HB1  . ALA A 1 233 ? -26.037 -34.247 0.241   1.00 76.57  ? 304 ALA A HB1  1 
ATOM   3538 H HB2  . ALA A 1 233 ? -25.261 -35.620 0.431   1.00 76.57  ? 304 ALA A HB2  1 
ATOM   3539 H HB3  . ALA A 1 233 ? -24.949 -34.698 -0.825  1.00 76.57  ? 304 ALA A HB3  1 
ATOM   3540 N N    . THR A 1 234 ? -28.185 -33.864 -1.488  1.00 73.88  ? 305 THR A N    1 
ATOM   3541 C CA   . THR A 1 234 ? -28.824 -32.838 -2.307  1.00 77.66  ? 305 THR A CA   1 
ATOM   3542 C C    . THR A 1 234 ? -28.041 -31.531 -2.356  1.00 75.81  ? 305 THR A C    1 
ATOM   3543 O O    . THR A 1 234 ? -28.284 -30.721 -3.256  1.00 79.42  ? 305 THR A O    1 
ATOM   3544 C CB   . THR A 1 234 ? -30.242 -32.534 -1.796  1.00 83.22  ? 305 THR A CB   1 
ATOM   3545 O OG1  . THR A 1 234 ? -30.184 -32.108 -0.425  1.00 85.35  ? 305 THR A OG1  1 
ATOM   3546 C CG2  . THR A 1 234 ? -31.148 -33.764 -1.931  1.00 84.43  ? 305 THR A CG2  1 
ATOM   3547 H H    . THR A 1 234 ? -28.377 -33.813 -0.651  1.00 88.66  ? 305 THR A H    1 
ATOM   3548 H HA   . THR A 1 234 ? -28.903 -33.168 -3.216  1.00 93.19  ? 305 THR A HA   1 
ATOM   3549 H HB   . THR A 1 234 ? -30.624 -31.821 -2.332  1.00 99.87  ? 305 THR A HB   1 
ATOM   3550 H HG1  . THR A 1 234 ? -30.957 -31.941 -0.143  1.00 102.43 ? 305 THR A HG1  1 
ATOM   3551 H HG21 . THR A 1 234 ? -32.042 -33.554 -1.618  1.00 101.32 ? 305 THR A HG21 1 
ATOM   3552 H HG22 . THR A 1 234 ? -31.196 -34.039 -2.860  1.00 101.32 ? 305 THR A HG22 1 
ATOM   3553 H HG23 . THR A 1 234 ? -30.793 -34.496 -1.403  1.00 101.32 ? 305 THR A HG23 1 
ATOM   3554 N N    . GLU A 1 235 ? -27.129 -31.301 -1.411  1.00 70.90  ? 306 GLU A N    1 
ATOM   3555 C CA   . GLU A 1 235 ? -26.328 -30.080 -1.375  1.00 69.46  ? 306 GLU A CA   1 
ATOM   3556 C C    . GLU A 1 235 ? -25.161 -30.206 -2.358  1.00 62.38  ? 306 GLU A C    1 
ATOM   3557 O O    . GLU A 1 235 ? -24.254 -31.029 -2.166  1.00 61.03  ? 306 GLU A O    1 
ATOM   3558 C CB   . GLU A 1 235 ? -25.817 -29.812 0.039   1.00 76.46  ? 306 GLU A CB   1 
ATOM   3559 C CG   . GLU A 1 235 ? -26.901 -29.717 1.116   1.00 85.93  ? 306 GLU A CG   1 
ATOM   3560 C CD   . GLU A 1 235 ? -27.152 -31.037 1.850   1.00 93.83  ? 306 GLU A CD   1 
ATOM   3561 O OE1  . GLU A 1 235 ? -27.290 -32.091 1.189   1.00 94.60  ? 306 GLU A OE1  1 
ATOM   3562 O OE2  . GLU A 1 235 ? -27.211 -31.017 3.099   1.00 98.81  ? 306 GLU A OE2  1 
ATOM   3563 H H    . GLU A 1 235 ? -26.954 -31.847 -0.770  1.00 85.07  ? 306 GLU A H    1 
ATOM   3564 H HA   . GLU A 1 235 ? -26.877 -29.328 -1.648  1.00 83.35  ? 306 GLU A HA   1 
ATOM   3565 H HB2  . GLU A 1 235 ? -25.217 -30.531 0.291   1.00 91.75  ? 306 GLU A HB2  1 
ATOM   3566 H HB3  . GLU A 1 235 ? -25.333 -28.971 0.037   1.00 91.75  ? 306 GLU A HB3  1 
ATOM   3567 H HG2  . GLU A 1 235 ? -26.632 -29.057 1.774   1.00 103.11 ? 306 GLU A HG2  1 
ATOM   3568 H HG3  . GLU A 1 235 ? -27.734 -29.446 0.699   1.00 103.11 ? 306 GLU A HG3  1 
ATOM   3569 N N    . LEU A 1 236 ? -25.176 -29.379 -3.402  1.00 59.23  ? 307 LEU A N    1 
ATOM   3570 C CA   . LEU A 1 236 ? -24.110 -29.408 -4.396  1.00 55.83  ? 307 LEU A CA   1 
ATOM   3571 C C    . LEU A 1 236 ? -22.707 -29.229 -3.810  1.00 52.27  ? 307 LEU A C    1 
ATOM   3572 O O    . LEU A 1 236 ? -21.764 -29.849 -4.338  1.00 48.13  ? 307 LEU A O    1 
ATOM   3573 C CB   . LEU A 1 236 ? -24.419 -28.334 -5.439  1.00 58.68  ? 307 LEU A CB   1 
ATOM   3574 C CG   . LEU A 1 236 ? -23.491 -28.177 -6.628  1.00 62.84  ? 307 LEU A CG   1 
ATOM   3575 C CD1  . LEU A 1 236 ? -23.532 -29.437 -7.480  1.00 63.43  ? 307 LEU A CD1  1 
ATOM   3576 C CD2  . LEU A 1 236 ? -23.894 -26.923 -7.413  1.00 66.40  ? 307 LEU A CD2  1 
ATOM   3577 H H    . LEU A 1 236 ? -25.789 -28.796 -3.556  1.00 71.08  ? 307 LEU A H    1 
ATOM   3578 H HA   . LEU A 1 236 ? -24.131 -30.268 -4.844  1.00 66.99  ? 307 LEU A HA   1 
ATOM   3579 H HB2  . LEU A 1 236 ? -25.301 -28.519 -5.798  1.00 70.42  ? 307 LEU A HB2  1 
ATOM   3580 H HB3  . LEU A 1 236 ? -24.440 -27.478 -4.985  1.00 70.42  ? 307 LEU A HB3  1 
ATOM   3581 H HG   . LEU A 1 236 ? -22.582 -28.056 -6.311  1.00 75.41  ? 307 LEU A HG   1 
ATOM   3582 H HD11 . LEU A 1 236 ? -22.976 -29.305 -8.264  1.00 76.11  ? 307 LEU A HD11 1 
ATOM   3583 H HD12 . LEU A 1 236 ? -23.196 -30.183 -6.958  1.00 76.11  ? 307 LEU A HD12 1 
ATOM   3584 H HD13 . LEU A 1 236 ? -24.449 -29.606 -7.749  1.00 76.11  ? 307 LEU A HD13 1 
ATOM   3585 H HD21 . LEU A 1 236 ? -23.140 -26.632 -7.949  1.00 79.68  ? 307 LEU A HD21 1 
ATOM   3586 H HD22 . LEU A 1 236 ? -24.646 -27.137 -7.987  1.00 79.68  ? 307 LEU A HD22 1 
ATOM   3587 H HD23 . LEU A 1 236 ? -24.140 -26.222 -6.789  1.00 79.68  ? 307 LEU A HD23 1 
ATOM   3588 N N    . PRO A 1 237 ? -22.486 -28.404 -2.778  1.00 55.34  ? 308 PRO A N    1 
ATOM   3589 C CA   . PRO A 1 237 ? -21.133 -28.286 -2.210  1.00 55.07  ? 308 PRO A CA   1 
ATOM   3590 C C    . PRO A 1 237 ? -20.642 -29.543 -1.518  1.00 54.10  ? 308 PRO A C    1 
ATOM   3591 O O    . PRO A 1 237 ? -19.448 -29.631 -1.222  1.00 54.92  ? 308 PRO A O    1 
ATOM   3592 C CB   . PRO A 1 237 ? -21.260 -27.132 -1.203  1.00 56.82  ? 308 PRO A CB   1 
ATOM   3593 C CG   . PRO A 1 237 ? -22.490 -26.405 -1.577  1.00 59.48  ? 308 PRO A CG   1 
ATOM   3594 C CD   . PRO A 1 237 ? -23.409 -27.402 -2.217  1.00 58.93  ? 308 PRO A CD   1 
ATOM   3595 H HA   . PRO A 1 237 ? -20.501 -28.036 -2.902  1.00 66.08  ? 308 PRO A HA   1 
ATOM   3596 H HB2  . PRO A 1 237 ? -21.336 -27.491 -0.305  1.00 68.19  ? 308 PRO A HB2  1 
ATOM   3597 H HB3  . PRO A 1 237 ? -20.486 -26.552 -1.274  1.00 68.19  ? 308 PRO A HB3  1 
ATOM   3598 H HG2  . PRO A 1 237 ? -22.898 -26.033 -0.780  1.00 71.37  ? 308 PRO A HG2  1 
ATOM   3599 H HG3  . PRO A 1 237 ? -22.268 -25.699 -2.204  1.00 71.37  ? 308 PRO A HG3  1 
ATOM   3600 H HD2  . PRO A 1 237 ? -23.984 -27.808 -1.549  1.00 70.71  ? 308 PRO A HD2  1 
ATOM   3601 H HD3  . PRO A 1 237 ? -23.925 -26.980 -2.921  1.00 70.71  ? 308 PRO A HD3  1 
ATOM   3602 N N    . ILE A 1 238 ? -21.514 -30.496 -1.212  1.00 52.66  ? 309 ILE A N    1 
ATOM   3603 C CA   . ILE A 1 238 ? -21.070 -31.803 -0.749  1.00 50.42  ? 309 ILE A CA   1 
ATOM   3604 C C    . ILE A 1 238 ? -20.841 -32.754 -1.916  1.00 50.33  ? 309 ILE A C    1 
ATOM   3605 O O    . ILE A 1 238 ? -19.867 -33.509 -1.926  1.00 50.10  ? 309 ILE A O    1 
ATOM   3606 C CB   . ILE A 1 238 ? -22.093 -32.376 0.246   1.00 49.94  ? 309 ILE A CB   1 
ATOM   3607 C CG1  . ILE A 1 238 ? -22.051 -31.605 1.556   1.00 51.97  ? 309 ILE A CG1  1 
ATOM   3608 C CG2  . ILE A 1 238 ? -21.824 -33.835 0.530   1.00 48.72  ? 309 ILE A CG2  1 
ATOM   3609 C CD1  . ILE A 1 238 ? -23.184 -32.003 2.502   1.00 55.43  ? 309 ILE A CD1  1 
ATOM   3610 H H    . ILE A 1 238 ? -22.368 -30.411 -1.264  1.00 63.19  ? 309 ILE A H    1 
ATOM   3611 H HA   . ILE A 1 238 ? -20.227 -31.702 -0.280  1.00 60.51  ? 309 ILE A HA   1 
ATOM   3612 H HB   . ILE A 1 238 ? -22.980 -32.292 -0.137  1.00 59.93  ? 309 ILE A HB   1 
ATOM   3613 H HG12 . ILE A 1 238 ? -21.209 -31.784 2.003   1.00 62.36  ? 309 ILE A HG12 1 
ATOM   3614 H HG13 . ILE A 1 238 ? -22.134 -30.657 1.369   1.00 62.36  ? 309 ILE A HG13 1 
ATOM   3615 H HG21 . ILE A 1 238 ? -22.362 -34.127 1.281   1.00 58.46  ? 309 ILE A HG21 1 
ATOM   3616 H HG22 . ILE A 1 238 ? -22.055 -34.360 -0.252  1.00 58.46  ? 309 ILE A HG22 1 
ATOM   3617 H HG23 . ILE A 1 238 ? -20.883 -33.946 0.737   1.00 58.46  ? 309 ILE A HG23 1 
ATOM   3618 H HD11 . ILE A 1 238 ? -23.328 -31.286 3.139   1.00 66.52  ? 309 ILE A HD11 1 
ATOM   3619 H HD12 . ILE A 1 238 ? -23.990 -32.151 1.983   1.00 66.52  ? 309 ILE A HD12 1 
ATOM   3620 H HD13 . ILE A 1 238 ? -22.937 -32.816 2.969   1.00 66.52  ? 309 ILE A HD13 1 
ATOM   3621 N N    . VAL A 1 239 ? -21.732 -32.755 -2.907  1.00 51.78  ? 310 VAL A N    1 
ATOM   3622 C CA   . VAL A 1 239 ? -21.626 -33.733 -3.992  1.00 50.48  ? 310 VAL A CA   1 
ATOM   3623 C C    . VAL A 1 239 ? -20.354 -33.512 -4.790  1.00 48.84  ? 310 VAL A C    1 
ATOM   3624 O O    . VAL A 1 239 ? -19.694 -34.466 -5.205  1.00 48.12  ? 310 VAL A O    1 
ATOM   3625 C CB   . VAL A 1 239 ? -22.863 -33.675 -4.908  1.00 50.41  ? 310 VAL A CB   1 
ATOM   3626 C CG1  . VAL A 1 239 ? -22.673 -34.602 -6.134  1.00 48.70  ? 310 VAL A CG1  1 
ATOM   3627 C CG2  . VAL A 1 239 ? -24.125 -34.064 -4.135  1.00 50.72  ? 310 VAL A CG2  1 
ATOM   3628 H H    . VAL A 1 239 ? -22.395 -32.212 -2.975  1.00 62.13  ? 310 VAL A H    1 
ATOM   3629 H HA   . VAL A 1 239 ? -21.584 -34.623 -3.607  1.00 60.57  ? 310 VAL A HA   1 
ATOM   3630 H HB   . VAL A 1 239 ? -22.976 -32.767 -5.231  1.00 60.49  ? 310 VAL A HB   1 
ATOM   3631 H HG11 . VAL A 1 239 ? -23.536 -34.749 -6.552  1.00 58.43  ? 310 VAL A HG11 1 
ATOM   3632 H HG12 . VAL A 1 239 ? -22.070 -34.178 -6.764  1.00 58.43  ? 310 VAL A HG12 1 
ATOM   3633 H HG13 . VAL A 1 239 ? -22.303 -35.448 -5.836  1.00 58.43  ? 310 VAL A HG13 1 
ATOM   3634 H HG21 . VAL A 1 239 ? -24.885 -34.034 -4.737  1.00 60.86  ? 310 VAL A HG21 1 
ATOM   3635 H HG22 . VAL A 1 239 ? -24.016 -34.962 -3.785  1.00 60.86  ? 310 VAL A HG22 1 
ATOM   3636 H HG23 . VAL A 1 239 ? -24.254 -33.437 -3.406  1.00 60.86  ? 310 VAL A HG23 1 
ATOM   3637 N N    . THR A 1 240 ? -20.024 -32.271 -5.063  1.00 47.88  ? 311 THR A N    1 
ATOM   3638 C CA   . THR A 1 240 ? -18.845 -31.962 -5.855  1.00 46.80  ? 311 THR A CA   1 
ATOM   3639 C C    . THR A 1 240 ? -17.579 -32.606 -5.287  1.00 46.59  ? 311 THR A C    1 
ATOM   3640 O O    . THR A 1 240 ? -16.972 -33.443 -5.962  1.00 45.83  ? 311 THR A O    1 
ATOM   3641 C CB   . THR A 1 240 ? -18.724 -30.439 -5.961  1.00 47.97  ? 311 THR A CB   1 
ATOM   3642 O OG1  . THR A 1 240 ? -19.978 -29.937 -6.429  1.00 51.05  ? 311 THR A OG1  1 
ATOM   3643 C CG2  . THR A 1 240 ? -17.557 -30.020 -6.901  1.00 45.20  ? 311 THR A CG2  1 
ATOM   3644 H H    . THR A 1 240 ? -20.465 -31.581 -4.800  1.00 57.46  ? 311 THR A H    1 
ATOM   3645 H HA   . THR A 1 240 ? -18.974 -32.310 -6.751  1.00 56.16  ? 311 THR A HA   1 
ATOM   3646 H HB   . THR A 1 240 ? -18.554 -30.056 -5.091  1.00 57.56  ? 311 THR A HB   1 
ATOM   3647 H HG1  . THR A 1 240 ? -20.556 -29.988 -5.822  1.00 61.26  ? 311 THR A HG1  1 
ATOM   3648 H HG21 . THR A 1 240 ? -17.549 -29.056 -7.009  1.00 54.24  ? 311 THR A HG21 1 
ATOM   3649 H HG22 . THR A 1 240 ? -16.709 -30.301 -6.524  1.00 54.24  ? 311 THR A HG22 1 
ATOM   3650 H HG23 . THR A 1 240 ? -17.668 -30.433 -7.772  1.00 54.24  ? 311 THR A HG23 1 
ATOM   3651 N N    . PRO A 1 241 ? -17.163 -32.304 -4.057  1.00 47.86  ? 312 PRO A N    1 
ATOM   3652 C CA   . PRO A 1 241 ? -15.960 -32.980 -3.522  1.00 48.16  ? 312 PRO A CA   1 
ATOM   3653 C C    . PRO A 1 241 ? -16.121 -34.472 -3.352  1.00 44.81  ? 312 PRO A C    1 
ATOM   3654 O O    . PRO A 1 241 ? -15.129 -35.201 -3.482  1.00 43.60  ? 312 PRO A O    1 
ATOM   3655 C CB   . PRO A 1 241 ? -15.746 -32.296 -2.173  1.00 51.14  ? 312 PRO A CB   1 
ATOM   3656 C CG   . PRO A 1 241 ? -17.142 -31.814 -1.787  1.00 51.69  ? 312 PRO A CG   1 
ATOM   3657 C CD   . PRO A 1 241 ? -17.748 -31.371 -3.079  1.00 50.27  ? 312 PRO A CD   1 
ATOM   3658 H HA   . PRO A 1 241 ? -15.196 -32.805 -4.093  1.00 57.79  ? 312 PRO A HA   1 
ATOM   3659 H HB2  . PRO A 1 241 ? -15.398 -32.929 -1.530  1.00 61.37  ? 312 PRO A HB2  1 
ATOM   3660 H HB3  . PRO A 1 241 ? -15.144 -31.551 -2.281  1.00 61.37  ? 312 PRO A HB3  1 
ATOM   3661 H HG2  . PRO A 1 241 ? -17.647 -32.546 -1.400  1.00 62.03  ? 312 PRO A HG2  1 
ATOM   3662 H HG3  . PRO A 1 241 ? -17.074 -31.073 -1.165  1.00 62.03  ? 312 PRO A HG3  1 
ATOM   3663 H HD2  . PRO A 1 241 ? -18.712 -31.461 -3.050  1.00 60.33  ? 312 PRO A HD2  1 
ATOM   3664 H HD3  . PRO A 1 241 ? -17.478 -30.460 -3.274  1.00 60.33  ? 312 PRO A HD3  1 
ATOM   3665 N N    . ALA A 1 242 ? -17.327 -34.960 -3.037  1.00 43.73  ? 313 ALA A N    1 
ATOM   3666 C CA   . ALA A 1 242 ? -17.495 -36.401 -2.878  1.00 42.29  ? 313 ALA A CA   1 
ATOM   3667 C C    . ALA A 1 242 ? -17.284 -37.106 -4.208  1.00 43.36  ? 313 ALA A C    1 
ATOM   3668 O O    . ALA A 1 242 ? -16.570 -38.114 -4.288  1.00 44.96  ? 313 ALA A O    1 
ATOM   3669 C CB   . ALA A 1 242 ? -18.878 -36.730 -2.316  1.00 41.24  ? 313 ALA A CB   1 
ATOM   3670 H H    . ALA A 1 242 ? -18.038 -34.493 -2.914  1.00 52.47  ? 313 ALA A H    1 
ATOM   3671 H HA   . ALA A 1 242 ? -16.830 -36.731 -2.254  1.00 50.74  ? 313 ALA A HA   1 
ATOM   3672 H HB1  . ALA A 1 242 ? -18.959 -37.692 -2.222  1.00 49.48  ? 313 ALA A HB1  1 
ATOM   3673 H HB2  . ALA A 1 242 ? -18.976 -36.303 -1.451  1.00 49.48  ? 313 ALA A HB2  1 
ATOM   3674 H HB3  . ALA A 1 242 ? -19.554 -36.399 -2.928  1.00 49.48  ? 313 ALA A HB3  1 
ATOM   3675 N N    . LEU A 1 243 ? -17.902 -36.576 -5.260  1.00 43.00  ? 314 LEU A N    1 
ATOM   3676 C CA   . LEU A 1 243 ? -17.719 -37.104 -6.606  1.00 43.80  ? 314 LEU A CA   1 
ATOM   3677 C C    . LEU A 1 243 ? -16.267 -36.990 -7.054  1.00 47.24  ? 314 LEU A C    1 
ATOM   3678 O O    . LEU A 1 243 ? -15.746 -37.878 -7.726  1.00 46.87  ? 314 LEU A O    1 
ATOM   3679 C CB   . LEU A 1 243 ? -18.628 -36.346 -7.575  1.00 43.73  ? 314 LEU A CB   1 
ATOM   3680 C CG   . LEU A 1 243 ? -18.464 -36.724 -9.036  1.00 44.15  ? 314 LEU A CG   1 
ATOM   3681 C CD1  . LEU A 1 243 ? -18.753 -38.180 -9.233  1.00 43.44  ? 314 LEU A CD1  1 
ATOM   3682 C CD2  . LEU A 1 243 ? -19.389 -35.885 -9.897  1.00 45.59  ? 314 LEU A CD2  1 
ATOM   3683 H H    . LEU A 1 243 ? -18.437 -35.904 -5.219  1.00 51.60  ? 314 LEU A H    1 
ATOM   3684 H HA   . LEU A 1 243 ? -17.970 -38.041 -6.618  1.00 52.56  ? 314 LEU A HA   1 
ATOM   3685 H HB2  . LEU A 1 243 ? -19.551 -36.517 -7.330  1.00 52.48  ? 314 LEU A HB2  1 
ATOM   3686 H HB3  . LEU A 1 243 ? -18.441 -35.398 -7.496  1.00 52.48  ? 314 LEU A HB3  1 
ATOM   3687 H HG   . LEU A 1 243 ? -17.553 -36.553 -9.319  1.00 52.98  ? 314 LEU A HG   1 
ATOM   3688 H HD11 . LEU A 1 243 ? -18.785 -38.368 -10.184 1.00 52.12  ? 314 LEU A HD11 1 
ATOM   3689 H HD12 . LEU A 1 243 ? -18.050 -38.703 -8.817  1.00 52.12  ? 314 LEU A HD12 1 
ATOM   3690 H HD13 . LEU A 1 243 ? -19.608 -38.390 -8.826  1.00 52.12  ? 314 LEU A HD13 1 
ATOM   3691 H HD21 . LEU A 1 243 ? -19.319 -36.182 -10.818 1.00 54.71  ? 314 LEU A HD21 1 
ATOM   3692 H HD22 . LEU A 1 243 ? -20.300 -35.996 -9.581  1.00 54.71  ? 314 LEU A HD22 1 
ATOM   3693 H HD23 . LEU A 1 243 ? -19.126 -34.954 -9.828  1.00 54.71  ? 314 LEU A HD23 1 
ATOM   3694 N N    . ARG A 1 244 ? -15.604 -35.889 -6.720  1.00 46.73  ? 315 ARG A N    1 
ATOM   3695 C CA   . ARG A 1 244 ? -14.170 -35.790 -6.997  1.00 48.93  ? 315 ARG A CA   1 
ATOM   3696 C C    . ARG A 1 244 ? -13.398 -36.936 -6.330  1.00 43.54  ? 315 ARG A C    1 
ATOM   3697 O O    . ARG A 1 244 ? -12.542 -37.576 -6.959  1.00 40.95  ? 315 ARG A O    1 
ATOM   3698 C CB   . ARG A 1 244 ? -13.650 -34.432 -6.534  1.00 58.10  ? 315 ARG A CB   1 
ATOM   3699 C CG   . ARG A 1 244 ? -12.213 -34.177 -6.873  1.00 69.66  ? 315 ARG A CG   1 
ATOM   3700 C CD   . ARG A 1 244 ? -12.063 -33.879 -8.342  1.00 80.56  ? 315 ARG A CD   1 
ATOM   3701 N NE   . ARG A 1 244 ? -12.725 -32.623 -8.674  1.00 88.57  ? 315 ARG A NE   1 
ATOM   3702 C CZ   . ARG A 1 244 ? -12.146 -31.433 -8.609  1.00 94.92  ? 315 ARG A CZ   1 
ATOM   3703 N NH1  . ARG A 1 244 ? -10.880 -31.327 -8.226  1.00 95.21  ? 315 ARG A NH1  1 
ATOM   3704 N NH2  . ARG A 1 244 ? -12.837 -30.343 -8.926  1.00 99.13  ? 315 ARG A NH2  1 
ATOM   3705 H H    . ARG A 1 244 ? -15.948 -35.198 -6.341  1.00 56.08  ? 315 ARG A H    1 
ATOM   3706 H HA   . ARG A 1 244 ? -14.033 -35.856 -7.954  1.00 58.72  ? 315 ARG A HA   1 
ATOM   3707 H HB2  . ARG A 1 244 ? -14.185 -33.737 -6.947  1.00 69.72  ? 315 ARG A HB2  1 
ATOM   3708 H HB3  . ARG A 1 244 ? -13.737 -34.380 -5.569  1.00 69.72  ? 315 ARG A HB3  1 
ATOM   3709 H HG2  . ARG A 1 244 ? -11.899 -33.408 -6.373  1.00 83.60  ? 315 ARG A HG2  1 
ATOM   3710 H HG3  . ARG A 1 244 ? -11.678 -34.957 -6.661  1.00 83.60  ? 315 ARG A HG3  1 
ATOM   3711 H HD2  . ARG A 1 244 ? -11.122 -33.814 -8.566  1.00 96.67  ? 315 ARG A HD2  1 
ATOM   3712 H HD3  . ARG A 1 244 ? -12.479 -34.586 -8.859  1.00 96.67  ? 315 ARG A HD3  1 
ATOM   3713 H HE   . ARG A 1 244 ? -13.546 -32.657 -8.929  1.00 106.28 ? 315 ARG A HE   1 
ATOM   3714 H HH11 . ARG A 1 244 ? -10.427 -32.026 -8.016  1.00 114.26 ? 315 ARG A HH11 1 
ATOM   3715 H HH12 . ARG A 1 244 ? -10.510 -30.551 -8.186  1.00 114.26 ? 315 ARG A HH12 1 
ATOM   3716 H HH21 . ARG A 1 244 ? -13.657 -30.411 -9.176  1.00 118.96 ? 315 ARG A HH21 1 
ATOM   3717 H HH22 . ARG A 1 244 ? -12.462 -29.570 -8.887  1.00 118.96 ? 315 ARG A HH22 1 
ATOM   3718 N N    . ALA A 1 245 ? -13.705 -37.227 -5.059  1.00 44.17  ? 316 ALA A N    1 
ATOM   3719 C CA   . ALA A 1 245 ? -12.994 -38.287 -4.343  1.00 45.52  ? 316 ALA A CA   1 
ATOM   3720 C C    . ALA A 1 245 ? -13.273 -39.658 -4.951  1.00 47.22  ? 316 ALA A C    1 
ATOM   3721 O O    . ALA A 1 245 ? -12.358 -40.473 -5.125  1.00 47.97  ? 316 ALA A O    1 
ATOM   3722 C CB   . ALA A 1 245 ? -13.386 -38.278 -2.866  1.00 45.81  ? 316 ALA A CB   1 
ATOM   3723 H H    . ALA A 1 245 ? -14.312 -36.830 -4.597  1.00 53.01  ? 316 ALA A H    1 
ATOM   3724 H HA   . ALA A 1 245 ? -12.040 -38.122 -4.401  1.00 54.63  ? 316 ALA A HA   1 
ATOM   3725 H HB1  . ALA A 1 245 ? -12.906 -38.986 -2.408  1.00 54.97  ? 316 ALA A HB1  1 
ATOM   3726 H HB2  . ALA A 1 245 ? -13.153 -37.418 -2.483  1.00 54.97  ? 316 ALA A HB2  1 
ATOM   3727 H HB3  . ALA A 1 245 ? -14.342 -38.425 -2.793  1.00 54.97  ? 316 ALA A HB3  1 
ATOM   3728 N N    . ILE A 1 246 ? -14.538 -39.943 -5.253  1.00 47.37  ? 317 ILE A N    1 
ATOM   3729 C CA   . ILE A 1 246 ? -14.887 -41.210 -5.888  1.00 47.05  ? 317 ILE A CA   1 
ATOM   3730 C C    . ILE A 1 246 ? -14.193 -41.332 -7.235  1.00 43.50  ? 317 ILE A C    1 
ATOM   3731 O O    . ILE A 1 246 ? -13.672 -42.397 -7.596  1.00 44.00  ? 317 ILE A O    1 
ATOM   3732 C CB   . ILE A 1 246 ? -16.418 -41.321 -6.026  1.00 49.55  ? 317 ILE A CB   1 
ATOM   3733 C CG1  . ILE A 1 246 ? -17.069 -41.424 -4.647  1.00 52.99  ? 317 ILE A CG1  1 
ATOM   3734 C CG2  . ILE A 1 246 ? -16.817 -42.504 -6.924  1.00 48.81  ? 317 ILE A CG2  1 
ATOM   3735 C CD1  . ILE A 1 246 ? -16.680 -42.659 -3.879  1.00 55.96  ? 317 ILE A CD1  1 
ATOM   3736 H H    . ILE A 1 246 ? -15.207 -39.424 -5.102  1.00 56.84  ? 317 ILE A H    1 
ATOM   3737 H HA   . ILE A 1 246 ? -14.574 -41.939 -5.332  1.00 56.46  ? 317 ILE A HA   1 
ATOM   3738 H HB   . ILE A 1 246 ? -16.738 -40.508 -6.446  1.00 59.47  ? 317 ILE A HB   1 
ATOM   3739 H HG12 . ILE A 1 246 ? -16.809 -40.653 -4.119  1.00 63.58  ? 317 ILE A HG12 1 
ATOM   3740 H HG13 . ILE A 1 246 ? -18.033 -41.436 -4.757  1.00 63.58  ? 317 ILE A HG13 1 
ATOM   3741 H HG21 . ILE A 1 246 ? -17.750 -42.718 -6.766  1.00 58.58  ? 317 ILE A HG21 1 
ATOM   3742 H HG22 . ILE A 1 246 ? -16.688 -42.256 -7.853  1.00 58.58  ? 317 ILE A HG22 1 
ATOM   3743 H HG23 . ILE A 1 246 ? -16.261 -43.267 -6.703  1.00 58.58  ? 317 ILE A HG23 1 
ATOM   3744 H HD11 . ILE A 1 246 ? -17.248 -42.731 -3.096  1.00 67.15  ? 317 ILE A HD11 1 
ATOM   3745 H HD12 . ILE A 1 246 ? -16.799 -43.439 -4.442  1.00 67.15  ? 317 ILE A HD12 1 
ATOM   3746 H HD13 . ILE A 1 246 ? -15.753 -42.586 -3.606  1.00 67.15  ? 317 ILE A HD13 1 
ATOM   3747 N N    . GLY A 1 247 ? -14.194 -40.255 -8.009  1.00 39.67  ? 318 GLY A N    1 
ATOM   3748 C CA   . GLY A 1 247 ? -13.491 -40.282 -9.272  1.00 40.22  ? 318 GLY A CA   1 
ATOM   3749 C C    . GLY A 1 247 ? -12.028 -40.657 -9.106  1.00 43.28  ? 318 GLY A C    1 
ATOM   3750 O O    . GLY A 1 247 ? -11.495 -41.472 -9.866  1.00 42.10  ? 318 GLY A O    1 
ATOM   3751 H H    . GLY A 1 247 ? -14.587 -39.512 -7.827  1.00 47.60  ? 318 GLY A H    1 
ATOM   3752 H HA2  . GLY A 1 247 ? -13.910 -40.928 -9.862  1.00 48.26  ? 318 GLY A HA2  1 
ATOM   3753 H HA3  . GLY A 1 247 ? -13.540 -39.407 -9.689  1.00 48.26  ? 318 GLY A HA3  1 
ATOM   3754 N N    . ASN A 1 248 ? -11.359 -40.083 -8.100  1.00 46.48  ? 319 ASN A N    1 
ATOM   3755 C CA   . ASN A 1 248 ? -9.952  -40.421 -7.887  1.00 46.15  ? 319 ASN A CA   1 
ATOM   3756 C C    . ASN A 1 248 ? -9.797  -41.893 -7.540  1.00 44.45  ? 319 ASN A C    1 
ATOM   3757 O O    . ASN A 1 248 ? -8.897  -42.561 -8.056  1.00 43.06  ? 319 ASN A O    1 
ATOM   3758 C CB   . ASN A 1 248 ? -9.347  -39.551 -6.787  1.00 46.51  ? 319 ASN A CB   1 
ATOM   3759 C CG   . ASN A 1 248 ? -9.267  -38.105 -7.181  1.00 47.50  ? 319 ASN A CG   1 
ATOM   3760 O OD1  . ASN A 1 248 ? -9.368  -37.764 -8.358  1.00 47.99  ? 319 ASN A OD1  1 
ATOM   3761 N ND2  . ASN A 1 248 ? -9.098  -37.241 -6.203  1.00 48.63  ? 319 ASN A ND2  1 
ATOM   3762 H H    . ASN A 1 248 ? -11.686 -39.513 -7.545  1.00 55.78  ? 319 ASN A H    1 
ATOM   3763 H HA   . ASN A 1 248 ? -9.460  -40.254 -8.706  1.00 55.37  ? 319 ASN A HA   1 
ATOM   3764 H HB2  . ASN A 1 248 ? -9.898  -39.617 -5.991  1.00 55.80  ? 319 ASN A HB2  1 
ATOM   3765 H HB3  . ASN A 1 248 ? -8.448  -39.861 -6.597  1.00 55.80  ? 319 ASN A HB3  1 
ATOM   3766 H HD21 . ASN A 1 248 ? -9.046  -36.400 -6.376  1.00 58.35  ? 319 ASN A HD21 1 
ATOM   3767 H HD22 . ASN A 1 248 ? -9.040  -37.517 -5.391  1.00 58.35  ? 319 ASN A HD22 1 
ATOM   3768 N N    . ILE A 1 249 ? -10.687 -42.423 -6.696  1.00 41.84  ? 320 ILE A N    1 
ATOM   3769 C CA   . ILE A 1 249 ? -10.508 -43.784 -6.209  1.00 44.45  ? 320 ILE A CA   1 
ATOM   3770 C C    . ILE A 1 249 ? -10.629 -44.780 -7.350  1.00 49.44  ? 320 ILE A C    1 
ATOM   3771 O O    . ILE A 1 249 ? -9.900  -45.775 -7.394  1.00 55.69  ? 320 ILE A O    1 
ATOM   3772 C CB   . ILE A 1 249 ? -11.505 -44.086 -5.076  1.00 41.80  ? 320 ILE A CB   1 
ATOM   3773 C CG1  . ILE A 1 249 ? -11.149 -43.239 -3.847  1.00 46.17  ? 320 ILE A CG1  1 
ATOM   3774 C CG2  . ILE A 1 249 ? -11.509 -45.579 -4.726  1.00 40.21  ? 320 ILE A CG2  1 
ATOM   3775 C CD1  . ILE A 1 249 ? -12.237 -43.211 -2.797  1.00 48.51  ? 320 ILE A CD1  1 
ATOM   3776 H H    . ILE A 1 249 ? -11.387 -42.022 -6.398  1.00 50.20  ? 320 ILE A H    1 
ATOM   3777 H HA   . ILE A 1 249 ? -9.614  -43.866 -5.842  1.00 53.34  ? 320 ILE A HA   1 
ATOM   3778 H HB   . ILE A 1 249 ? -12.394 -43.838 -5.374  1.00 50.16  ? 320 ILE A HB   1 
ATOM   3779 H HG12 . ILE A 1 249 ? -10.350 -43.604 -3.436  1.00 55.40  ? 320 ILE A HG12 1 
ATOM   3780 H HG13 . ILE A 1 249 ? -10.986 -42.326 -4.130  1.00 55.40  ? 320 ILE A HG13 1 
ATOM   3781 H HG21 . ILE A 1 249 ? -11.965 -45.706 -3.880  1.00 48.25  ? 320 ILE A HG21 1 
ATOM   3782 H HG22 . ILE A 1 249 ? -11.973 -46.068 -5.423  1.00 48.25  ? 320 ILE A HG22 1 
ATOM   3783 H HG23 . ILE A 1 249 ? -10.592 -45.888 -4.656  1.00 48.25  ? 320 ILE A HG23 1 
ATOM   3784 H HD11 . ILE A 1 249 ? -12.016 -42.540 -2.133  1.00 58.21  ? 320 ILE A HD11 1 
ATOM   3785 H HD12 . ILE A 1 249 ? -13.080 -42.990 -3.223  1.00 58.21  ? 320 ILE A HD12 1 
ATOM   3786 H HD13 . ILE A 1 249 ? -12.297 -44.084 -2.378  1.00 58.21  ? 320 ILE A HD13 1 
ATOM   3787 N N    . VAL A 1 250 ? -11.534 -44.534 -8.301  1.00 46.82  ? 321 VAL A N    1 
ATOM   3788 C CA   . VAL A 1 250 ? -11.688 -45.472 -9.413  1.00 44.84  ? 321 VAL A CA   1 
ATOM   3789 C C    . VAL A 1 250 ? -10.623 -45.285 -10.478 1.00 45.96  ? 321 VAL A C    1 
ATOM   3790 O O    . VAL A 1 250 ? -10.669 -45.973 -11.504 1.00 46.33  ? 321 VAL A O    1 
ATOM   3791 C CB   . VAL A 1 250 ? -13.085 -45.391 -10.065 1.00 43.07  ? 321 VAL A CB   1 
ATOM   3792 C CG1  . VAL A 1 250 ? -14.180 -45.444 -9.007  1.00 42.26  ? 321 VAL A CG1  1 
ATOM   3793 C CG2  . VAL A 1 250 ? -13.237 -44.133 -10.936 1.00 41.38  ? 321 VAL A CG2  1 
ATOM   3794 H H    . VAL A 1 250 ? -12.056 -43.851 -8.326  1.00 56.18  ? 321 VAL A H    1 
ATOM   3795 H HA   . VAL A 1 250 ? -11.589 -46.372 -9.065  1.00 53.81  ? 321 VAL A HA   1 
ATOM   3796 H HB   . VAL A 1 250 ? -13.200 -46.162 -10.643 1.00 51.68  ? 321 VAL A HB   1 
ATOM   3797 H HG11 . VAL A 1 250 ? -15.043 -45.480 -9.448  1.00 50.70  ? 321 VAL A HG11 1 
ATOM   3798 H HG12 . VAL A 1 250 ? -14.053 -46.237 -8.462  1.00 50.70  ? 321 VAL A HG12 1 
ATOM   3799 H HG13 . VAL A 1 250 ? -14.125 -44.650 -8.453  1.00 50.70  ? 321 VAL A HG13 1 
ATOM   3800 H HG21 . VAL A 1 250 ? -14.163 -44.059 -11.212 1.00 49.66  ? 321 VAL A HG21 1 
ATOM   3801 H HG22 . VAL A 1 250 ? -12.982 -43.355 -10.416 1.00 49.66  ? 321 VAL A HG22 1 
ATOM   3802 H HG23 . VAL A 1 250 ? -12.669 -44.211 -11.718 1.00 49.66  ? 321 VAL A HG23 1 
ATOM   3803 N N    . THR A 1 251 ? -9.667  -44.376 -10.285 1.00 47.49  ? 322 THR A N    1 
ATOM   3804 C CA   . THR A 1 251 ? -8.472  -44.407 -11.125 1.00 53.49  ? 322 THR A CA   1 
ATOM   3805 C C    . THR A 1 251 ? -7.484  -45.475 -10.684 1.00 57.66  ? 322 THR A C    1 
ATOM   3806 O O    . THR A 1 251 ? -6.562  -45.790 -11.443 1.00 61.29  ? 322 THR A O    1 
ATOM   3807 C CB   . THR A 1 251 ? -7.723  -43.069 -11.127 1.00 56.55  ? 322 THR A CB   1 
ATOM   3808 O OG1  . THR A 1 251 ? -7.183  -42.805 -9.825  1.00 56.32  ? 322 THR A OG1  1 
ATOM   3809 C CG2  . THR A 1 251 ? -8.629  -41.952 -11.549 1.00 57.76  ? 322 THR A CG2  1 
ATOM   3810 H H    . THR A 1 251 ? -9.683  -43.750 -9.695  1.00 56.99  ? 322 THR A H    1 
ATOM   3811 H HA   . THR A 1 251 ? -8.734  -44.602 -12.038 1.00 64.18  ? 322 THR A HA   1 
ATOM   3812 H HB   . THR A 1 251 ? -6.994  -43.118 -11.765 1.00 67.86  ? 322 THR A HB   1 
ATOM   3813 H HG1  . THR A 1 251 ? -7.800  -42.791 -9.256  1.00 67.58  ? 322 THR A HG1  1 
ATOM   3814 H HG21 . THR A 1 251 ? -8.123  -41.129 -11.633 1.00 69.32  ? 322 THR A HG21 1 
ATOM   3815 H HG22 . THR A 1 251 ? -9.036  -42.161 -12.404 1.00 69.32  ? 322 THR A HG22 1 
ATOM   3816 H HG23 . THR A 1 251 ? -9.328  -41.826 -10.890 1.00 69.32  ? 322 THR A HG23 1 
ATOM   3817 N N    . GLY A 1 252 ? -7.647  -46.025 -9.479  1.00 55.55  ? 323 GLY A N    1 
ATOM   3818 C CA   . GLY A 1 252 ? -6.725  -47.017 -8.965  1.00 54.01  ? 323 GLY A CA   1 
ATOM   3819 C C    . GLY A 1 252 ? -6.960  -48.393 -9.544  1.00 54.05  ? 323 GLY A C    1 
ATOM   3820 O O    . GLY A 1 252 ? -7.250  -48.541 -10.727 1.00 51.92  ? 323 GLY A O    1 
ATOM   3821 H H    . GLY A 1 252 ? -8.290  -45.834 -8.941  1.00 66.66  ? 323 GLY A H    1 
ATOM   3822 H HA2  . GLY A 1 252 ? -5.816  -46.749 -9.172  1.00 64.81  ? 323 GLY A HA2  1 
ATOM   3823 H HA3  . GLY A 1 252 ? -6.816  -47.071 -8.001  1.00 64.81  ? 323 GLY A HA3  1 
ATOM   3824 N N    . THR A 1 253 ? -6.866  -49.406 -8.701  1.00 56.18  ? 324 THR A N    1 
ATOM   3825 C CA   . THR A 1 253 ? -6.894  -50.788 -9.136  1.00 60.76  ? 324 THR A CA   1 
ATOM   3826 C C    . THR A 1 253 ? -8.328  -51.277 -9.295  1.00 61.19  ? 324 THR A C    1 
ATOM   3827 O O    . THR A 1 253 ? -9.289  -50.647 -8.837  1.00 59.83  ? 324 THR A O    1 
ATOM   3828 C CB   . THR A 1 253 ? -6.185  -51.673 -8.123  1.00 62.62  ? 324 THR A CB   1 
ATOM   3829 O OG1  . THR A 1 253 ? -6.968  -51.710 -6.921  1.00 61.18  ? 324 THR A OG1  1 
ATOM   3830 C CG2  . THR A 1 253 ? -4.795  -51.126 -7.808  1.00 64.10  ? 324 THR A CG2  1 
ATOM   3831 H H    . THR A 1 253 ? -6.783  -49.315 -7.850  1.00 67.41  ? 324 THR A H    1 
ATOM   3832 H HA   . THR A 1 253 ? -6.442  -50.870 -9.990  1.00 72.91  ? 324 THR A HA   1 
ATOM   3833 H HB   . THR A 1 253 ? -6.093  -52.570 -8.481  1.00 75.15  ? 324 THR A HB   1 
ATOM   3834 H HG1  . THR A 1 253 ? -6.592  -52.195 -6.348  1.00 73.41  ? 324 THR A HG1  1 
ATOM   3835 H HG21 . THR A 1 253 ? -4.302  -51.765 -7.270  1.00 76.92  ? 324 THR A HG21 1 
ATOM   3836 H HG22 . THR A 1 253 ? -4.308  -50.965 -8.631  1.00 76.92  ? 324 THR A HG22 1 
ATOM   3837 H HG23 . THR A 1 253 ? -4.868  -50.292 -7.318  1.00 76.92  ? 324 THR A HG23 1 
ATOM   3838 N N    . ASP A 1 254 ? -8.453  -52.448 -9.921  1.00 65.73  ? 325 ASP A N    1 
ATOM   3839 C CA   . ASP A 1 254 ? -9.757  -53.068 -10.072 1.00 68.00  ? 325 ASP A CA   1 
ATOM   3840 C C    . ASP A 1 254 ? -10.370 -53.394 -8.715  1.00 67.96  ? 325 ASP A C    1 
ATOM   3841 O O    . ASP A 1 254 ? -11.600 -53.366 -8.563  1.00 68.27  ? 325 ASP A O    1 
ATOM   3842 C CB   . ASP A 1 254 ? -9.627  -54.317 -10.942 1.00 72.64  ? 325 ASP A CB   1 
ATOM   3843 C CG   . ASP A 1 254 ? -9.326  -53.985 -12.404 1.00 76.33  ? 325 ASP A CG   1 
ATOM   3844 O OD1  . ASP A 1 254 ? -9.618  -52.849 -12.844 1.00 74.35  ? 325 ASP A OD1  1 
ATOM   3845 O OD2  . ASP A 1 254 ? -8.803  -54.864 -13.120 1.00 81.19  ? 325 ASP A OD2  1 
ATOM   3846 H H    . ASP A 1 254 ? -7.802  -52.895 -10.262 1.00 78.88  ? 325 ASP A H    1 
ATOM   3847 H HA   . ASP A 1 254 ? -10.350 -52.448 -10.525 1.00 81.60  ? 325 ASP A HA   1 
ATOM   3848 H HB2  . ASP A 1 254 ? -8.902  -54.865 -10.603 1.00 87.16  ? 325 ASP A HB2  1 
ATOM   3849 H HB3  . ASP A 1 254 ? -10.461 -54.812 -10.912 1.00 87.16  ? 325 ASP A HB3  1 
ATOM   3850 N N    . GLU A 1 255 ? -9.535  -53.660 -7.713  1.00 66.38  ? 326 GLU A N    1 
ATOM   3851 C CA   . GLU A 1 255 ? -10.029 -53.933 -6.372  1.00 68.67  ? 326 GLU A CA   1 
ATOM   3852 C C    . GLU A 1 255 ? -10.514 -52.662 -5.675  1.00 62.43  ? 326 GLU A C    1 
ATOM   3853 O O    . GLU A 1 255 ? -11.511 -52.695 -4.942  1.00 62.10  ? 326 GLU A O    1 
ATOM   3854 C CB   . GLU A 1 255 ? -8.935  -54.611 -5.548  1.00 80.03  ? 326 GLU A CB   1 
ATOM   3855 C CG   . GLU A 1 255 ? -8.608  -56.052 -5.985  1.00 91.95  ? 326 GLU A CG   1 
ATOM   3856 C CD   . GLU A 1 255 ? -7.986  -56.159 -7.386  1.00 99.27  ? 326 GLU A CD   1 
ATOM   3857 O OE1  . GLU A 1 255 ? -7.483  -55.137 -7.910  1.00 98.77  ? 326 GLU A OE1  1 
ATOM   3858 O OE2  . GLU A 1 255 ? -8.009  -57.276 -7.965  1.00 104.21 ? 326 GLU A OE2  1 
ATOM   3859 H H    . GLU A 1 255 ? -8.679  -53.686 -7.786  1.00 79.66  ? 326 GLU A H    1 
ATOM   3860 H HA   . GLU A 1 255 ? -10.779 -54.545 -6.432  1.00 82.40  ? 326 GLU A HA   1 
ATOM   3861 H HB2  . GLU A 1 255 ? -8.121  -54.089 -5.623  1.00 96.03  ? 326 GLU A HB2  1 
ATOM   3862 H HB3  . GLU A 1 255 ? -9.219  -54.642 -4.621  1.00 96.03  ? 326 GLU A HB3  1 
ATOM   3863 H HG2  . GLU A 1 255 ? -7.979  -56.434 -5.353  1.00 110.34 ? 326 GLU A HG2  1 
ATOM   3864 H HG3  . GLU A 1 255 ? -9.428  -56.571 -5.985  1.00 110.34 ? 326 GLU A HG3  1 
ATOM   3865 N N    . GLN A 1 256 ? -9.829  -51.534 -5.876  1.00 61.15  ? 327 GLN A N    1 
ATOM   3866 C CA   . GLN A 1 256 ? -10.314 -50.284 -5.291  1.00 57.91  ? 327 GLN A CA   1 
ATOM   3867 C C    . GLN A 1 256 ? -11.569 -49.788 -6.006  1.00 53.55  ? 327 GLN A C    1 
ATOM   3868 O O    . GLN A 1 256 ? -12.488 -49.259 -5.364  1.00 51.28  ? 327 GLN A O    1 
ATOM   3869 C CB   . GLN A 1 256 ? -9.221  -49.224 -5.327  1.00 58.98  ? 327 GLN A CB   1 
ATOM   3870 C CG   . GLN A 1 256 ? -8.017  -49.561 -4.444  1.00 61.37  ? 327 GLN A CG   1 
ATOM   3871 C CD   . GLN A 1 256 ? -6.755  -48.871 -4.901  1.00 63.92  ? 327 GLN A CD   1 
ATOM   3872 O OE1  . GLN A 1 256 ? -6.561  -48.635 -6.091  1.00 63.29  ? 327 GLN A OE1  1 
ATOM   3873 N NE2  . GLN A 1 256 ? -5.887  -48.533 -3.953  1.00 66.40  ? 327 GLN A NE2  1 
ATOM   3874 H H    . GLN A 1 256 ? -9.103  -51.466 -6.332  1.00 73.38  ? 327 GLN A H    1 
ATOM   3875 H HA   . GLN A 1 256 ? -10.544 -50.442 -4.362  1.00 69.49  ? 327 GLN A HA   1 
ATOM   3876 H HB2  . GLN A 1 256 ? -8.908  -49.131 -6.240  1.00 70.77  ? 327 GLN A HB2  1 
ATOM   3877 H HB3  . GLN A 1 256 ? -9.590  -48.382 -5.018  1.00 70.77  ? 327 GLN A HB3  1 
ATOM   3878 H HG2  . GLN A 1 256 ? -8.202  -49.278 -3.535  1.00 73.64  ? 327 GLN A HG2  1 
ATOM   3879 H HG3  . GLN A 1 256 ? -7.862  -50.518 -4.469  1.00 73.64  ? 327 GLN A HG3  1 
ATOM   3880 H HE21 . GLN A 1 256 ? -6.059  -48.710 -3.129  1.00 79.67  ? 327 GLN A HE21 1 
ATOM   3881 H HE22 . GLN A 1 256 ? -5.153  -48.138 -4.163  1.00 79.67  ? 327 GLN A HE22 1 
ATOM   3882 N N    . THR A 1 257 ? -11.631 -49.946 -7.330  1.00 53.24  ? 328 THR A N    1 
ATOM   3883 C CA   . THR A 1 257 ? -12.856 -49.603 -8.040  1.00 52.66  ? 328 THR A CA   1 
ATOM   3884 C C    . THR A 1 257 ? -14.018 -50.442 -7.526  1.00 55.18  ? 328 THR A C    1 
ATOM   3885 O O    . THR A 1 257 ? -15.121 -49.930 -7.308  1.00 55.19  ? 328 THR A O    1 
ATOM   3886 C CB   . THR A 1 257 ? -12.681 -49.814 -9.544  1.00 51.06  ? 328 THR A CB   1 
ATOM   3887 O OG1  . THR A 1 257 ? -11.539 -49.098 -10.014 1.00 50.19  ? 328 THR A OG1  1 
ATOM   3888 C CG2  . THR A 1 257 ? -13.854 -49.310 -10.272 1.00 49.55  ? 328 THR A CG2  1 
ATOM   3889 H H    . THR A 1 257 ? -10.994 -50.242 -7.826  1.00 63.89  ? 328 THR A H    1 
ATOM   3890 H HA   . THR A 1 257 ? -13.064 -48.668 -7.886  1.00 63.20  ? 328 THR A HA   1 
ATOM   3891 H HB   . THR A 1 257 ? -12.577 -50.760 -9.734  1.00 61.28  ? 328 THR A HB   1 
ATOM   3892 H HG1  . THR A 1 257 ? -10.845 -49.382 -9.635  1.00 60.22  ? 328 THR A HG1  1 
ATOM   3893 H HG21 . THR A 1 257 ? -13.671 -49.298 -11.224 1.00 59.46  ? 328 THR A HG21 1 
ATOM   3894 H HG22 . THR A 1 257 ? -14.621 -49.881 -10.108 1.00 59.46  ? 328 THR A HG22 1 
ATOM   3895 H HG23 . THR A 1 257 ? -14.063 -48.408 -9.981  1.00 59.46  ? 328 THR A HG23 1 
ATOM   3896 N N    . GLN A 1 258 ? -13.776 -51.732 -7.297  1.00 57.87  ? 329 GLN A N    1 
ATOM   3897 C CA   . GLN A 1 258 ? -14.849 -52.611 -6.861  1.00 58.74  ? 329 GLN A CA   1 
ATOM   3898 C C    . GLN A 1 258 ? -15.433 -52.160 -5.536  1.00 56.98  ? 329 GLN A C    1 
ATOM   3899 O O    . GLN A 1 258 ? -16.625 -52.373 -5.286  1.00 54.70  ? 329 GLN A O    1 
ATOM   3900 C CB   . GLN A 1 258 ? -14.346 -54.046 -6.751  1.00 62.27  ? 329 GLN A CB   1 
ATOM   3901 C CG   . GLN A 1 258 ? -15.438 -55.055 -6.495  1.00 64.95  ? 329 GLN A CG   1 
ATOM   3902 C CD   . GLN A 1 258 ? -16.424 -55.118 -7.631  1.00 67.22  ? 329 GLN A CD   1 
ATOM   3903 O OE1  . GLN A 1 258 ? -16.040 -55.197 -8.803  1.00 68.31  ? 329 GLN A OE1  1 
ATOM   3904 N NE2  . GLN A 1 258 ? -17.711 -55.075 -7.296  1.00 68.05  ? 329 GLN A NE2  1 
ATOM   3905 H H    . GLN A 1 258 ? -13.011 -52.114 -7.386  1.00 69.45  ? 329 GLN A H    1 
ATOM   3906 H HA   . GLN A 1 258 ? -15.558 -52.588 -7.522  1.00 70.48  ? 329 GLN A HA   1 
ATOM   3907 H HB2  . GLN A 1 258 ? -13.907 -54.288 -7.581  1.00 74.72  ? 329 GLN A HB2  1 
ATOM   3908 H HB3  . GLN A 1 258 ? -13.714 -54.100 -6.017  1.00 74.72  ? 329 GLN A HB3  1 
ATOM   3909 H HG2  . GLN A 1 258 ? -15.040 -55.934 -6.393  1.00 77.94  ? 329 GLN A HG2  1 
ATOM   3910 H HG3  . GLN A 1 258 ? -15.919 -54.812 -5.689  1.00 77.94  ? 329 GLN A HG3  1 
ATOM   3911 H HE21 . GLN A 1 258 ? -17.938 -55.016 -6.469  1.00 81.65  ? 329 GLN A HE21 1 
ATOM   3912 H HE22 . GLN A 1 258 ? -18.316 -55.106 -7.907  1.00 81.65  ? 329 GLN A HE22 1 
ATOM   3913 N N    . LYS A 1 259 ? -14.624 -51.551 -4.667  1.00 58.29  ? 330 LYS A N    1 
ATOM   3914 C CA   . LYS A 1 259 ? -15.173 -51.077 -3.399  1.00 60.25  ? 330 LYS A CA   1 
ATOM   3915 C C    . LYS A 1 259 ? -16.141 -49.924 -3.620  1.00 57.80  ? 330 LYS A C    1 
ATOM   3916 O O    . LYS A 1 259 ? -17.144 -49.810 -2.907  1.00 57.96  ? 330 LYS A O    1 
ATOM   3917 C CB   . LYS A 1 259 ? -14.053 -50.669 -2.442  1.00 64.85  ? 330 LYS A CB   1 
ATOM   3918 C CG   . LYS A 1 259 ? -13.275 -51.853 -1.870  1.00 72.34  ? 330 LYS A CG   1 
ATOM   3919 C CD   . LYS A 1 259 ? -12.264 -51.405 -0.836  1.00 79.99  ? 330 LYS A CD   1 
ATOM   3920 C CE   . LYS A 1 259 ? -11.494 -52.579 -0.245  1.00 87.98  ? 330 LYS A CE   1 
ATOM   3921 N NZ   . LYS A 1 259 ? -10.540 -52.134 0.826   1.00 91.92  ? 330 LYS A NZ   1 
ATOM   3922 H H    . LYS A 1 259 ? -13.784 -51.405 -4.782  1.00 69.95  ? 330 LYS A H    1 
ATOM   3923 H HA   . LYS A 1 259 ? -15.667 -51.801 -2.984  1.00 72.30  ? 330 LYS A HA   1 
ATOM   3924 H HB2  . LYS A 1 259 ? -13.425 -50.103 -2.918  1.00 77.82  ? 330 LYS A HB2  1 
ATOM   3925 H HB3  . LYS A 1 259 ? -14.439 -50.180 -1.698  1.00 77.82  ? 330 LYS A HB3  1 
ATOM   3926 H HG2  . LYS A 1 259 ? -13.894 -52.467 -1.444  1.00 86.81  ? 330 LYS A HG2  1 
ATOM   3927 H HG3  . LYS A 1 259 ? -12.799 -52.300 -2.587  1.00 86.81  ? 330 LYS A HG3  1 
ATOM   3928 H HD2  . LYS A 1 259 ? -11.628 -50.808 -1.258  1.00 95.99  ? 330 LYS A HD2  1 
ATOM   3929 H HD3  . LYS A 1 259 ? -12.725 -50.949 -0.114  1.00 95.99  ? 330 LYS A HD3  1 
ATOM   3930 H HE2  . LYS A 1 259 ? -12.120 -53.206 0.148   1.00 105.58 ? 330 LYS A HE2  1 
ATOM   3931 H HE3  . LYS A 1 259 ? -10.982 -53.011 -0.947  1.00 105.58 ? 330 LYS A HE3  1 
ATOM   3932 H HZ1  . LYS A 1 259 ? -10.158 -52.843 1.206   1.00 110.31 ? 330 LYS A HZ1  1 
ATOM   3933 H HZ2  . LYS A 1 259 ? -9.906  -51.619 0.473   1.00 110.31 ? 330 LYS A HZ2  1 
ATOM   3934 H HZ3  . LYS A 1 259 ? -10.976 -51.672 1.449   1.00 110.31 ? 330 LYS A HZ3  1 
ATOM   3935 N N    . VAL A 1 260 ? -15.893 -49.091 -4.627  1.00 56.34  ? 331 VAL A N    1 
ATOM   3936 C CA   . VAL A 1 260 ? -16.853 -48.048 -4.967  1.00 53.10  ? 331 VAL A CA   1 
ATOM   3937 C C    . VAL A 1 260 ? -18.163 -48.665 -5.452  1.00 50.69  ? 331 VAL A C    1 
ATOM   3938 O O    . VAL A 1 260 ? -19.252 -48.228 -5.062  1.00 50.55  ? 331 VAL A O    1 
ATOM   3939 C CB   . VAL A 1 260 ? -16.240 -47.097 -6.011  1.00 52.84  ? 331 VAL A CB   1 
ATOM   3940 C CG1  . VAL A 1 260 ? -17.295 -46.137 -6.576  1.00 51.26  ? 331 VAL A CG1  1 
ATOM   3941 C CG2  . VAL A 1 260 ? -15.090 -46.316 -5.384  1.00 53.42  ? 331 VAL A CG2  1 
ATOM   3942 H H    . VAL A 1 260 ? -15.189 -49.108 -5.121  1.00 67.61  ? 331 VAL A H    1 
ATOM   3943 H HA   . VAL A 1 260 ? -17.047 -47.529 -4.171  1.00 63.72  ? 331 VAL A HA   1 
ATOM   3944 H HB   . VAL A 1 260 ? -15.884 -47.619 -6.746  1.00 63.40  ? 331 VAL A HB   1 
ATOM   3945 H HG11 . VAL A 1 260 ? -16.845 -45.431 -7.066  1.00 61.52  ? 331 VAL A HG11 1 
ATOM   3946 H HG12 . VAL A 1 260 ? -17.885 -46.625 -7.171  1.00 61.52  ? 331 VAL A HG12 1 
ATOM   3947 H HG13 . VAL A 1 260 ? -17.802 -45.757 -5.841  1.00 61.52  ? 331 VAL A HG13 1 
ATOM   3948 H HG21 . VAL A 1 260 ? -14.722 -45.710 -6.046  1.00 64.11  ? 331 VAL A HG21 1 
ATOM   3949 H HG22 . VAL A 1 260 ? -15.427 -45.813 -4.626  1.00 64.11  ? 331 VAL A HG22 1 
ATOM   3950 H HG23 . VAL A 1 260 ? -14.407 -46.940 -5.091  1.00 64.11  ? 331 VAL A HG23 1 
ATOM   3951 N N    . ILE A 1 261 ? -18.078 -49.685 -6.312  1.00 48.38  ? 332 ILE A N    1 
ATOM   3952 C CA   . ILE A 1 261 ? -19.271 -50.372 -6.809  1.00 49.72  ? 332 ILE A CA   1 
ATOM   3953 C C    . ILE A 1 261 ? -19.996 -51.102 -5.678  1.00 53.11  ? 332 ILE A C    1 
ATOM   3954 O O    . ILE A 1 261 ? -21.228 -51.055 -5.588  1.00 50.28  ? 332 ILE A O    1 
ATOM   3955 C CB   . ILE A 1 261 ? -18.878 -51.331 -7.949  1.00 51.27  ? 332 ILE A CB   1 
ATOM   3956 C CG1  . ILE A 1 261 ? -18.264 -50.547 -9.128  1.00 51.50  ? 332 ILE A CG1  1 
ATOM   3957 C CG2  . ILE A 1 261 ? -20.083 -52.137 -8.422  1.00 51.92  ? 332 ILE A CG2  1 
ATOM   3958 C CD1  . ILE A 1 261 ? -17.669 -51.431 -10.214 1.00 52.69  ? 332 ILE A CD1  1 
ATOM   3959 H H    . ILE A 1 261 ? -17.339 -49.998 -6.622  1.00 58.05  ? 332 ILE A H    1 
ATOM   3960 H HA   . ILE A 1 261 ? -19.881 -49.713 -7.174  1.00 59.66  ? 332 ILE A HA   1 
ATOM   3961 H HB   . ILE A 1 261 ? -18.210 -51.949 -7.612  1.00 61.53  ? 332 ILE A HB   1 
ATOM   3962 H HG12 . ILE A 1 261 ? -18.957 -50.004 -9.535  1.00 61.80  ? 332 ILE A HG12 1 
ATOM   3963 H HG13 . ILE A 1 261 ? -17.555 -49.977 -8.792  1.00 61.80  ? 332 ILE A HG13 1 
ATOM   3964 H HG21 . ILE A 1 261 ? -19.842 -52.636 -9.218  1.00 62.31  ? 332 ILE A HG21 1 
ATOM   3965 H HG22 . ILE A 1 261 ? -20.350 -52.752 -7.722  1.00 62.31  ? 332 ILE A HG22 1 
ATOM   3966 H HG23 . ILE A 1 261 ? -20.810 -51.527 -8.623  1.00 62.31  ? 332 ILE A HG23 1 
ATOM   3967 H HD11 . ILE A 1 261 ? -17.126 -50.884 -10.803 1.00 63.22  ? 332 ILE A HD11 1 
ATOM   3968 H HD12 . ILE A 1 261 ? -17.121 -52.115 -9.798  1.00 63.22  ? 332 ILE A HD12 1 
ATOM   3969 H HD13 . ILE A 1 261 ? -18.388 -51.844 -10.717 1.00 63.22  ? 332 ILE A HD13 1 
ATOM   3970 N N    . ASP A 1 262 ? -19.248 -51.780 -4.795  1.00 59.48  ? 333 ASP A N    1 
ATOM   3971 C CA   . ASP A 1 262 ? -19.845 -52.486 -3.654  1.00 66.51  ? 333 ASP A CA   1 
ATOM   3972 C C    . ASP A 1 262 ? -20.623 -51.547 -2.736  1.00 61.25  ? 333 ASP A C    1 
ATOM   3973 O O    . ASP A 1 262 ? -21.617 -51.961 -2.127  1.00 59.98  ? 333 ASP A O    1 
ATOM   3974 C CB   . ASP A 1 262 ? -18.764 -53.195 -2.822  1.00 76.79  ? 333 ASP A CB   1 
ATOM   3975 C CG   . ASP A 1 262 ? -18.153 -54.405 -3.523  1.00 85.81  ? 333 ASP A CG   1 
ATOM   3976 O OD1  . ASP A 1 262 ? -18.768 -54.924 -4.481  1.00 90.46  ? 333 ASP A OD1  1 
ATOM   3977 O OD2  . ASP A 1 262 ? -17.054 -54.846 -3.099  1.00 87.70  ? 333 ASP A OD2  1 
ATOM   3978 H H    . ASP A 1 262 ? -18.391 -51.845 -4.836  1.00 71.37  ? 333 ASP A H    1 
ATOM   3979 H HA   . ASP A 1 262 ? -20.460 -53.159 -3.985  1.00 79.81  ? 333 ASP A HA   1 
ATOM   3980 H HB2  . ASP A 1 262 ? -18.049 -52.566 -2.636  1.00 92.14  ? 333 ASP A HB2  1 
ATOM   3981 H HB3  . ASP A 1 262 ? -19.159 -53.501 -1.990  1.00 92.14  ? 333 ASP A HB3  1 
ATOM   3982 N N    . ALA A 1 263 ? -20.166 -50.303 -2.589  1.00 58.33  ? 334 ALA A N    1 
ATOM   3983 C CA   . ALA A 1 263 ? -20.849 -49.327 -1.750  1.00 56.67  ? 334 ALA A CA   1 
ATOM   3984 C C    . ALA A 1 263 ? -22.095 -48.750 -2.405  1.00 56.74  ? 334 ALA A C    1 
ATOM   3985 O O    . ALA A 1 263 ? -22.758 -47.902 -1.794  1.00 56.16  ? 334 ALA A O    1 
ATOM   3986 C CB   . ALA A 1 263 ? -19.899 -48.186 -1.390  1.00 53.88  ? 334 ALA A CB   1 
ATOM   3987 H H    . ALA A 1 263 ? -19.456 -50.000 -2.969  1.00 70.00  ? 334 ALA A H    1 
ATOM   3988 H HA   . ALA A 1 263 ? -21.120 -49.759 -0.925  1.00 68.00  ? 334 ALA A HA   1 
ATOM   3989 H HB1  . ALA A 1 263 ? -20.388 -47.517 -0.887  1.00 64.65  ? 334 ALA A HB1  1 
ATOM   3990 H HB2  . ALA A 1 263 ? -19.171 -48.538 -0.854  1.00 64.65  ? 334 ALA A HB2  1 
ATOM   3991 H HB3  . ALA A 1 263 ? -19.551 -47.797 -2.207  1.00 64.65  ? 334 ALA A HB3  1 
ATOM   3992 N N    . GLY A 1 264 ? -22.421 -49.171 -3.627  1.00 58.69  ? 335 GLY A N    1 
ATOM   3993 C CA   . GLY A 1 264 ? -23.633 -48.730 -4.288  1.00 55.84  ? 335 GLY A CA   1 
ATOM   3994 C C    . GLY A 1 264 ? -23.512 -47.478 -5.127  1.00 54.13  ? 335 GLY A C    1 
ATOM   3995 O O    . GLY A 1 264 ? -24.536 -46.863 -5.430  1.00 53.66  ? 335 GLY A O    1 
ATOM   3996 H H    . GLY A 1 264 ? -21.949 -49.717 -4.095  1.00 70.43  ? 335 GLY A H    1 
ATOM   3997 H HA2  . GLY A 1 264 ? -23.948 -49.442 -4.866  1.00 67.01  ? 335 GLY A HA2  1 
ATOM   3998 H HA3  . GLY A 1 264 ? -24.314 -48.570 -3.616  1.00 67.01  ? 335 GLY A HA3  1 
ATOM   3999 N N    . ALA A 1 265 ? -22.306 -47.079 -5.535  1.00 53.79  ? 336 ALA A N    1 
ATOM   4000 C CA   . ALA A 1 265 ? -22.174 -45.790 -6.211  1.00 53.58  ? 336 ALA A CA   1 
ATOM   4001 C C    . ALA A 1 265 ? -22.960 -45.751 -7.517  1.00 54.54  ? 336 ALA A C    1 
ATOM   4002 O O    . ALA A 1 265 ? -23.467 -44.692 -7.902  1.00 56.24  ? 336 ALA A O    1 
ATOM   4003 C CB   . ALA A 1 265 ? -20.708 -45.468 -6.475  1.00 51.59  ? 336 ALA A CB   1 
ATOM   4004 H H    . ALA A 1 265 ? -21.574 -47.519 -5.437  1.00 64.54  ? 336 ALA A H    1 
ATOM   4005 H HA   . ALA A 1 265 ? -22.529 -45.097 -5.632  1.00 64.30  ? 336 ALA A HA   1 
ATOM   4006 H HB1  . ALA A 1 265 ? -20.649 -44.610 -6.923  1.00 61.91  ? 336 ALA A HB1  1 
ATOM   4007 H HB2  . ALA A 1 265 ? -20.236 -45.433 -5.629  1.00 61.91  ? 336 ALA A HB2  1 
ATOM   4008 H HB3  . ALA A 1 265 ? -20.329 -46.162 -7.037  1.00 61.91  ? 336 ALA A HB3  1 
ATOM   4009 N N    . LEU A 1 266 ? -23.078 -46.885 -8.214  1.00 52.52  ? 337 LEU A N    1 
ATOM   4010 C CA   . LEU A 1 266 ? -23.720 -46.864 -9.521  1.00 51.94  ? 337 LEU A CA   1 
ATOM   4011 C C    . LEU A 1 266 ? -25.213 -46.526 -9.426  1.00 53.92  ? 337 LEU A C    1 
ATOM   4012 O O    . LEU A 1 266 ? -25.804 -46.097 -10.416 1.00 55.18  ? 337 LEU A O    1 
ATOM   4013 C CB   . LEU A 1 266 ? -23.488 -48.209 -10.229 1.00 52.44  ? 337 LEU A CB   1 
ATOM   4014 C CG   . LEU A 1 266 ? -22.009 -48.574 -10.459 1.00 54.50  ? 337 LEU A CG   1 
ATOM   4015 C CD1  . LEU A 1 266 ? -21.856 -49.958 -11.051 1.00 56.85  ? 337 LEU A CD1  1 
ATOM   4016 C CD2  . LEU A 1 266 ? -21.309 -47.556 -11.360 1.00 55.08  ? 337 LEU A CD2  1 
ATOM   4017 H H    . LEU A 1 266 ? -22.801 -47.658 -7.957  1.00 63.02  ? 337 LEU A H    1 
ATOM   4018 H HA   . LEU A 1 266 ? -23.302 -46.173 -10.058 1.00 62.32  ? 337 LEU A HA   1 
ATOM   4019 H HB2  . LEU A 1 266 ? -23.881 -48.913 -9.690  1.00 62.93  ? 337 LEU A HB2  1 
ATOM   4020 H HB3  . LEU A 1 266 ? -23.922 -48.182 -11.096 1.00 62.93  ? 337 LEU A HB3  1 
ATOM   4021 H HG   . LEU A 1 266 ? -21.553 -48.570 -9.603  1.00 65.40  ? 337 LEU A HG   1 
ATOM   4022 H HD11 . LEU A 1 266 ? -20.912 -50.148 -11.169 1.00 68.22  ? 337 LEU A HD11 1 
ATOM   4023 H HD12 . LEU A 1 266 ? -22.251 -50.605 -10.446 1.00 68.22  ? 337 LEU A HD12 1 
ATOM   4024 H HD13 . LEU A 1 266 ? -22.310 -49.986 -11.908 1.00 68.22  ? 337 LEU A HD13 1 
ATOM   4025 H HD21 . LEU A 1 266 ? -20.417 -47.877 -11.564 1.00 66.10  ? 337 LEU A HD21 1 
ATOM   4026 H HD22 . LEU A 1 266 ? -21.820 -47.456 -12.178 1.00 66.10  ? 337 LEU A HD22 1 
ATOM   4027 H HD23 . LEU A 1 266 ? -21.257 -46.706 -10.896 1.00 66.10  ? 337 LEU A HD23 1 
ATOM   4028 N N    . ALA A 1 267 ? -25.833 -46.672 -8.258  1.00 54.27  ? 338 ALA A N    1 
ATOM   4029 C CA   . ALA A 1 267 ? -27.226 -46.277 -8.129  1.00 54.65  ? 338 ALA A CA   1 
ATOM   4030 C C    . ALA A 1 267 ? -27.414 -44.763 -8.175  1.00 58.49  ? 338 ALA A C    1 
ATOM   4031 O O    . ALA A 1 267 ? -28.508 -44.302 -8.506  1.00 59.69  ? 338 ALA A O    1 
ATOM   4032 C CB   . ALA A 1 267 ? -27.803 -46.836 -6.836  1.00 53.26  ? 338 ALA A CB   1 
ATOM   4033 H H    . ALA A 1 267 ? -25.477 -46.990 -7.542  1.00 65.12  ? 338 ALA A H    1 
ATOM   4034 H HA   . ALA A 1 267 ? -27.728 -46.659 -8.866  1.00 65.58  ? 338 ALA A HA   1 
ATOM   4035 H HB1  . ALA A 1 267 ? -28.732 -46.566 -6.762  1.00 63.91  ? 338 ALA A HB1  1 
ATOM   4036 H HB2  . ALA A 1 267 ? -27.740 -47.804 -6.855  1.00 63.91  ? 338 ALA A HB2  1 
ATOM   4037 H HB3  . ALA A 1 267 ? -27.296 -46.486 -6.087  1.00 63.91  ? 338 ALA A HB3  1 
ATOM   4038 N N    . VAL A 1 268 ? -26.379 -43.981 -7.867  1.00 61.40  ? 339 VAL A N    1 
ATOM   4039 C CA   . VAL A 1 268 ? -26.499 -42.525 -7.874  1.00 62.54  ? 339 VAL A CA   1 
ATOM   4040 C C    . VAL A 1 268 ? -26.175 -41.916 -9.232  1.00 53.91  ? 339 VAL A C    1 
ATOM   4041 O O    . VAL A 1 268 ? -26.607 -40.786 -9.515  1.00 53.09  ? 339 VAL A O    1 
ATOM   4042 C CB   . VAL A 1 268 ? -25.579 -41.889 -6.813  1.00 70.72  ? 339 VAL A CB   1 
ATOM   4043 C CG1  . VAL A 1 268 ? -25.694 -40.374 -6.839  1.00 72.21  ? 339 VAL A CG1  1 
ATOM   4044 C CG2  . VAL A 1 268 ? -25.924 -42.402 -5.427  1.00 75.80  ? 339 VAL A CG2  1 
ATOM   4045 H H    . VAL A 1 268 ? -25.598 -44.269 -7.651  1.00 73.68  ? 339 VAL A H    1 
ATOM   4046 H HA   . VAL A 1 268 ? -27.413 -42.286 -7.653  1.00 75.05  ? 339 VAL A HA   1 
ATOM   4047 H HB   . VAL A 1 268 ? -24.658 -42.127 -7.004  1.00 84.86  ? 339 VAL A HB   1 
ATOM   4048 H HG11 . VAL A 1 268 ? -25.338 -40.018 -6.010  1.00 86.65  ? 339 VAL A HG11 1 
ATOM   4049 H HG12 . VAL A 1 268 ? -25.187 -40.028 -7.590  1.00 86.65  ? 339 VAL A HG12 1 
ATOM   4050 H HG13 . VAL A 1 268 ? -26.629 -40.130 -6.927  1.00 86.65  ? 339 VAL A HG13 1 
ATOM   4051 H HG21 . VAL A 1 268 ? -25.349 -41.968 -4.778  1.00 90.96  ? 339 VAL A HG21 1 
ATOM   4052 H HG22 . VAL A 1 268 ? -26.852 -42.196 -5.237  1.00 90.96  ? 339 VAL A HG22 1 
ATOM   4053 H HG23 . VAL A 1 268 ? -25.786 -43.362 -5.401  1.00 90.96  ? 339 VAL A HG23 1 
ATOM   4054 N N    . PHE A 1 269 ? -25.436 -42.627 -10.082 1.00 49.57  ? 340 PHE A N    1 
ATOM   4055 C CA   . PHE A 1 269 ? -24.913 -42.000 -11.288 1.00 49.93  ? 340 PHE A CA   1 
ATOM   4056 C C    . PHE A 1 269 ? -25.967 -41.553 -12.297 1.00 50.78  ? 340 PHE A C    1 
ATOM   4057 O O    . PHE A 1 269 ? -25.682 -40.599 -13.040 1.00 51.52  ? 340 PHE A O    1 
ATOM   4058 C CB   . PHE A 1 269 ? -23.890 -42.938 -11.943 1.00 54.01  ? 340 PHE A CB   1 
ATOM   4059 C CG   . PHE A 1 269 ? -22.495 -42.697 -11.444 1.00 58.30  ? 340 PHE A CG   1 
ATOM   4060 C CD1  . PHE A 1 269 ? -22.125 -43.111 -10.171 1.00 60.64  ? 340 PHE A CD1  1 
ATOM   4061 C CD2  . PHE A 1 269 ? -21.582 -41.985 -12.210 1.00 60.62  ? 340 PHE A CD2  1 
ATOM   4062 C CE1  . PHE A 1 269 ? -20.860 -42.855 -9.689  1.00 62.49  ? 340 PHE A CE1  1 
ATOM   4063 C CE2  . PHE A 1 269 ? -20.319 -41.725 -11.740 1.00 62.43  ? 340 PHE A CE2  1 
ATOM   4064 C CZ   . PHE A 1 269 ? -19.951 -42.161 -10.469 1.00 63.17  ? 340 PHE A CZ   1 
ATOM   4065 H H    . PHE A 1 269 ? -25.228 -43.456 -9.985  1.00 59.49  ? 340 PHE A H    1 
ATOM   4066 H HA   . PHE A 1 269 ? -24.432 -41.202 -11.023 1.00 59.92  ? 340 PHE A HA   1 
ATOM   4067 H HB2  . PHE A 1 269 ? -24.127 -43.857 -11.744 1.00 64.82  ? 340 PHE A HB2  1 
ATOM   4068 H HB3  . PHE A 1 269 ? -23.896 -42.793 -12.902 1.00 64.82  ? 340 PHE A HB3  1 
ATOM   4069 H HD1  . PHE A 1 269 ? -22.734 -43.574 -9.644  1.00 72.77  ? 340 PHE A HD1  1 
ATOM   4070 H HD2  . PHE A 1 269 ? -21.826 -41.690 -13.058 1.00 72.75  ? 340 PHE A HD2  1 
ATOM   4071 H HE1  . PHE A 1 269 ? -20.616 -43.150 -8.841  1.00 74.99  ? 340 PHE A HE1  1 
ATOM   4072 H HE2  . PHE A 1 269 ? -19.711 -41.261 -12.268 1.00 74.92  ? 340 PHE A HE2  1 
ATOM   4073 H HZ   . PHE A 1 269 ? -19.094 -41.994 -10.149 1.00 75.81  ? 340 PHE A HZ   1 
ATOM   4074 N N    . PRO A 1 270 ? -27.153 -42.152 -12.393 1.00 50.58  ? 341 PRO A N    1 
ATOM   4075 C CA   . PRO A 1 270 ? -28.130 -41.600 -13.338 1.00 51.09  ? 341 PRO A CA   1 
ATOM   4076 C C    . PRO A 1 270 ? -28.444 -40.138 -13.072 1.00 47.77  ? 341 PRO A C    1 
ATOM   4077 O O    . PRO A 1 270 ? -28.551 -39.355 -14.026 1.00 49.31  ? 341 PRO A O    1 
ATOM   4078 C CB   . PRO A 1 270 ? -29.344 -42.504 -13.140 1.00 52.66  ? 341 PRO A CB   1 
ATOM   4079 C CG   . PRO A 1 270 ? -28.792 -43.762 -12.626 1.00 53.73  ? 341 PRO A CG   1 
ATOM   4080 C CD   . PRO A 1 270 ? -27.667 -43.374 -11.749 1.00 52.72  ? 341 PRO A CD   1 
ATOM   4081 H HA   . PRO A 1 270 ? -27.807 -41.696 -14.247 1.00 61.31  ? 341 PRO A HA   1 
ATOM   4082 H HB2  . PRO A 1 270 ? -29.948 -42.105 -12.495 1.00 63.19  ? 341 PRO A HB2  1 
ATOM   4083 H HB3  . PRO A 1 270 ? -29.790 -42.645 -13.990 1.00 63.19  ? 341 PRO A HB3  1 
ATOM   4084 H HG2  . PRO A 1 270 ? -29.472 -44.233 -12.120 1.00 64.48  ? 341 PRO A HG2  1 
ATOM   4085 H HG3  . PRO A 1 270 ? -28.478 -44.306 -13.365 1.00 64.48  ? 341 PRO A HG3  1 
ATOM   4086 H HD2  . PRO A 1 270 ? -27.990 -43.176 -10.856 1.00 63.27  ? 341 PRO A HD2  1 
ATOM   4087 H HD3  . PRO A 1 270 ? -26.988 -44.066 -11.737 1.00 63.27  ? 341 PRO A HD3  1 
ATOM   4088 N N    . SER A 1 271 ? -28.580 -39.739 -11.800 1.00 46.07  ? 342 SER A N    1 
ATOM   4089 C CA   . SER A 1 271 ? -28.840 -38.333 -11.510 1.00 47.17  ? 342 SER A CA   1 
ATOM   4090 C C    . SER A 1 271 ? -27.596 -37.471 -11.711 1.00 47.87  ? 342 SER A C    1 
ATOM   4091 O O    . SER A 1 271 ? -27.713 -36.327 -12.156 1.00 51.18  ? 342 SER A O    1 
ATOM   4092 C CB   . SER A 1 271 ? -29.386 -38.156 -10.092 1.00 50.49  ? 342 SER A CB   1 
ATOM   4093 O OG   . SER A 1 271 ? -28.503 -38.678 -9.121  1.00 53.43  ? 342 SER A OG   1 
ATOM   4094 H H    . SER A 1 271 ? -28.527 -40.250 -11.110 1.00 55.28  ? 342 SER A H    1 
ATOM   4095 H HA   . SER A 1 271 ? -29.518 -38.013 -12.125 1.00 56.61  ? 342 SER A HA   1 
ATOM   4096 H HB2  . SER A 1 271 ? -29.514 -37.210 -9.922  1.00 60.58  ? 342 SER A HB2  1 
ATOM   4097 H HB3  . SER A 1 271 ? -30.235 -38.620 -10.024 1.00 60.58  ? 342 SER A HB3  1 
ATOM   4098 H HG   . SER A 1 271 ? -28.389 -39.500 -9.248  1.00 64.12  ? 342 SER A HG   1 
ATOM   4099 N N    . LEU A 1 272 ? -26.407 -37.993 -11.408 1.00 45.12  ? 343 LEU A N    1 
ATOM   4100 C CA   . LEU A 1 272 ? -25.177 -37.259 -11.715 1.00 43.19  ? 343 LEU A CA   1 
ATOM   4101 C C    . LEU A 1 272 ? -25.002 -37.033 -13.217 1.00 43.48  ? 343 LEU A C    1 
ATOM   4102 O O    . LEU A 1 272 ? -24.611 -35.939 -13.642 1.00 43.40  ? 343 LEU A O    1 
ATOM   4103 C CB   . LEU A 1 272 ? -23.973 -38.007 -11.153 1.00 42.41  ? 343 LEU A CB   1 
ATOM   4104 C CG   . LEU A 1 272 ? -24.061 -38.239 -9.654  1.00 43.75  ? 343 LEU A CG   1 
ATOM   4105 C CD1  . LEU A 1 272 ? -23.011 -39.245 -9.243  1.00 47.90  ? 343 LEU A CD1  1 
ATOM   4106 C CD2  . LEU A 1 272 ? -23.877 -36.959 -8.888  1.00 41.27  ? 343 LEU A CD2  1 
ATOM   4107 H H    . LEU A 1 272 ? -26.286 -38.757 -11.033 1.00 54.14  ? 343 LEU A H    1 
ATOM   4108 H HA   . LEU A 1 272 ? -25.216 -36.389 -11.287 1.00 51.83  ? 343 LEU A HA   1 
ATOM   4109 H HB2  . LEU A 1 272 ? -23.910 -38.873 -11.586 1.00 50.89  ? 343 LEU A HB2  1 
ATOM   4110 H HB3  . LEU A 1 272 ? -23.171 -37.490 -11.329 1.00 50.89  ? 343 LEU A HB3  1 
ATOM   4111 H HG   . LEU A 1 272 ? -24.931 -38.604 -9.431  1.00 52.50  ? 343 LEU A HG   1 
ATOM   4112 H HD11 . LEU A 1 272 ? -23.068 -39.386 -8.285  1.00 57.48  ? 343 LEU A HD11 1 
ATOM   4113 H HD12 . LEU A 1 272 ? -23.166 -40.079 -9.709  1.00 57.48  ? 343 LEU A HD12 1 
ATOM   4114 H HD13 . LEU A 1 272 ? -22.135 -38.897 -9.473  1.00 57.48  ? 343 LEU A HD13 1 
ATOM   4115 H HD21 . LEU A 1 272 ? -23.860 -37.159 -7.939  1.00 49.52  ? 343 LEU A HD21 1 
ATOM   4116 H HD22 . LEU A 1 272 ? -23.039 -36.550 -9.155  1.00 49.52  ? 343 LEU A HD22 1 
ATOM   4117 H HD23 . LEU A 1 272 ? -24.615 -36.362 -9.087  1.00 49.52  ? 343 LEU A HD23 1 
ATOM   4118 N N    . LEU A 1 273 ? -25.242 -38.063 -14.040 1.00 43.36  ? 344 LEU A N    1 
ATOM   4119 C CA   . LEU A 1 273 ? -25.092 -37.897 -15.486 1.00 42.67  ? 344 LEU A CA   1 
ATOM   4120 C C    . LEU A 1 273 ? -26.155 -36.984 -16.085 1.00 43.17  ? 344 LEU A C    1 
ATOM   4121 O O    . LEU A 1 273 ? -25.977 -36.522 -17.214 1.00 44.35  ? 344 LEU A O    1 
ATOM   4122 C CB   . LEU A 1 273 ? -25.140 -39.248 -16.194 1.00 42.95  ? 344 LEU A CB   1 
ATOM   4123 C CG   . LEU A 1 273 ? -23.986 -40.185 -15.876 1.00 44.15  ? 344 LEU A CG   1 
ATOM   4124 C CD1  . LEU A 1 273 ? -24.329 -41.608 -16.299 1.00 46.54  ? 344 LEU A CD1  1 
ATOM   4125 C CD2  . LEU A 1 273 ? -22.688 -39.702 -16.561 1.00 45.14  ? 344 LEU A CD2  1 
ATOM   4126 H H    . LEU A 1 273 ? -25.487 -38.849 -13.791 1.00 52.02  ? 344 LEU A H    1 
ATOM   4127 H HA   . LEU A 1 273 ? -24.226 -37.498 -15.665 1.00 51.20  ? 344 LEU A HA   1 
ATOM   4128 H HB2  . LEU A 1 273 ? -25.961 -39.699 -15.941 1.00 51.54  ? 344 LEU A HB2  1 
ATOM   4129 H HB3  . LEU A 1 273 ? -25.136 -39.094 -17.152 1.00 51.54  ? 344 LEU A HB3  1 
ATOM   4130 H HG   . LEU A 1 273 ? -23.836 -40.186 -14.918 1.00 52.98  ? 344 LEU A HG   1 
ATOM   4131 H HD11 . LEU A 1 273 ? -23.578 -42.187 -16.096 1.00 55.85  ? 344 LEU A HD11 1 
ATOM   4132 H HD12 . LEU A 1 273 ? -25.115 -41.901 -15.812 1.00 55.85  ? 344 LEU A HD12 1 
ATOM   4133 H HD13 . LEU A 1 273 ? -24.507 -41.619 -17.252 1.00 55.85  ? 344 LEU A HD13 1 
ATOM   4134 H HD21 . LEU A 1 273 ? -21.981 -40.342 -16.384 1.00 54.17  ? 344 LEU A HD21 1 
ATOM   4135 H HD22 . LEU A 1 273 ? -22.842 -39.635 -17.516 1.00 54.17  ? 344 LEU A HD22 1 
ATOM   4136 H HD23 . LEU A 1 273 ? -22.446 -38.834 -16.203 1.00 54.17  ? 344 LEU A HD23 1 
ATOM   4137 N N    . THR A 1 274 ? -27.260 -36.727 -15.376 1.00 40.76  ? 345 THR A N    1 
ATOM   4138 C CA   . THR A 1 274 ? -28.267 -35.774 -15.835 1.00 43.13  ? 345 THR A CA   1 
ATOM   4139 C C    . THR A 1 274 ? -28.365 -34.552 -14.921 1.00 43.41  ? 345 THR A C    1 
ATOM   4140 O O    . THR A 1 274 ? -29.350 -33.801 -14.986 1.00 44.78  ? 345 THR A O    1 
ATOM   4141 C CB   . THR A 1 274 ? -29.623 -36.467 -15.984 1.00 47.41  ? 345 THR A CB   1 
ATOM   4142 O OG1  . THR A 1 274 ? -30.006 -37.063 -14.745 1.00 46.96  ? 345 THR A OG1  1 
ATOM   4143 C CG2  . THR A 1 274 ? -29.538 -37.565 -17.049 1.00 49.59  ? 345 THR A CG2  1 
ATOM   4144 H H    . THR A 1 274 ? -27.448 -37.096 -14.622 1.00 48.91  ? 345 THR A H    1 
ATOM   4145 H HA   . THR A 1 274 ? -28.012 -35.453 -16.714 1.00 51.76  ? 345 THR A HA   1 
ATOM   4146 H HB   . THR A 1 274 ? -30.293 -35.820 -16.257 1.00 56.89  ? 345 THR A HB   1 
ATOM   4147 H HG1  . THR A 1 274 ? -29.438 -37.638 -14.515 1.00 56.35  ? 345 THR A HG1  1 
ATOM   4148 H HG21 . THR A 1 274 ? -30.406 -37.982 -17.165 1.00 59.51  ? 345 THR A HG21 1 
ATOM   4149 H HG22 . THR A 1 274 ? -29.256 -37.184 -17.895 1.00 59.51  ? 345 THR A HG22 1 
ATOM   4150 H HG23 . THR A 1 274 ? -28.898 -38.241 -16.778 1.00 59.51  ? 345 THR A HG23 1 
ATOM   4151 N N    . ASN A 1 275 ? -27.339 -34.317 -14.105 1.00 44.14  ? 346 ASN A N    1 
ATOM   4152 C CA   . ASN A 1 275 ? -27.318 -33.157 -13.228 1.00 47.21  ? 346 ASN A CA   1 
ATOM   4153 C C    . ASN A 1 275 ? -27.359 -31.876 -14.062 1.00 53.58  ? 346 ASN A C    1 
ATOM   4154 O O    . ASN A 1 275 ? -26.761 -31.815 -15.140 1.00 50.97  ? 346 ASN A O    1 
ATOM   4155 C CB   . ASN A 1 275 ? -26.063 -33.188 -12.360 1.00 46.23  ? 346 ASN A CB   1 
ATOM   4156 C CG   . ASN A 1 275 ? -26.142 -32.248 -11.182 1.00 49.11  ? 346 ASN A CG   1 
ATOM   4157 O OD1  . ASN A 1 275 ? -25.917 -31.038 -11.306 1.00 50.49  ? 346 ASN A OD1  1 
ATOM   4158 N ND2  . ASN A 1 275 ? -26.409 -32.806 -10.021 1.00 49.49  ? 346 ASN A ND2  1 
ATOM   4159 H H    . ASN A 1 275 ? -26.642 -34.816 -14.042 1.00 52.97  ? 346 ASN A H    1 
ATOM   4160 H HA   . ASN A 1 275 ? -28.094 -33.187 -12.648 1.00 56.65  ? 346 ASN A HA   1 
ATOM   4161 H HB2  . ASN A 1 275 ? -25.937 -34.087 -12.018 1.00 55.47  ? 346 ASN A HB2  1 
ATOM   4162 H HB3  . ASN A 1 275 ? -25.300 -32.929 -12.899 1.00 55.47  ? 346 ASN A HB3  1 
ATOM   4163 H HD21 . ASN A 1 275 ? -26.464 -32.321 -9.313  1.00 59.39  ? 346 ASN A HD21 1 
ATOM   4164 H HD22 . ASN A 1 275 ? -26.528 -33.656 -9.970  1.00 59.39  ? 346 ASN A HD22 1 
ATOM   4165 N N    . PRO A 1 276 ? -28.068 -30.839 -13.612 1.00 61.79  ? 347 PRO A N    1 
ATOM   4166 C CA   . PRO A 1 276 ? -28.102 -29.597 -14.400 1.00 66.12  ? 347 PRO A CA   1 
ATOM   4167 C C    . PRO A 1 276 ? -26.765 -28.863 -14.424 1.00 66.87  ? 347 PRO A C    1 
ATOM   4168 O O    . PRO A 1 276 ? -26.512 -28.112 -15.369 1.00 71.29  ? 347 PRO A O    1 
ATOM   4169 C CB   . PRO A 1 276 ? -29.196 -28.774 -13.714 1.00 67.45  ? 347 PRO A CB   1 
ATOM   4170 C CG   . PRO A 1 276 ? -29.251 -29.299 -12.327 1.00 67.48  ? 347 PRO A CG   1 
ATOM   4171 C CD   . PRO A 1 276 ? -28.897 -30.750 -12.397 1.00 66.11  ? 347 PRO A CD   1 
ATOM   4172 H HA   . PRO A 1 276 ? -28.374 -29.789 -15.311 1.00 79.34  ? 347 PRO A HA   1 
ATOM   4173 H HB2  . PRO A 1 276 ? -28.951 -27.835 -13.717 1.00 80.94  ? 347 PRO A HB2  1 
ATOM   4174 H HB3  . PRO A 1 276 ? -30.042 -28.911 -14.168 1.00 80.94  ? 347 PRO A HB3  1 
ATOM   4175 H HG2  . PRO A 1 276 ? -28.611 -28.821 -11.777 1.00 80.98  ? 347 PRO A HG2  1 
ATOM   4176 H HG3  . PRO A 1 276 ? -30.148 -29.187 -11.976 1.00 80.98  ? 347 PRO A HG3  1 
ATOM   4177 H HD2  . PRO A 1 276 ? -28.391 -31.008 -11.613 1.00 79.33  ? 347 PRO A HD2  1 
ATOM   4178 H HD3  . PRO A 1 276 ? -29.694 -31.286 -12.495 1.00 79.33  ? 347 PRO A HD3  1 
ATOM   4179 N N    . LYS A 1 277 ? -25.891 -29.075 -13.444 1.00 61.96  ? 348 LYS A N    1 
ATOM   4180 C CA   . LYS A 1 277 ? -24.566 -28.467 -13.470 1.00 59.09  ? 348 LYS A CA   1 
ATOM   4181 C C    . LYS A 1 277 ? -23.634 -29.250 -14.400 1.00 55.21  ? 348 LYS A C    1 
ATOM   4182 O O    . LYS A 1 277 ? -23.294 -30.406 -14.125 1.00 49.78  ? 348 LYS A O    1 
ATOM   4183 C CB   . LYS A 1 277 ? -23.990 -28.409 -12.061 1.00 64.19  ? 348 LYS A CB   1 
ATOM   4184 C CG   . LYS A 1 277 ? -22.827 -27.445 -11.931 1.00 72.90  ? 348 LYS A CG   1 
ATOM   4185 C CD   . LYS A 1 277 ? -22.064 -27.647 -10.623 1.00 81.73  ? 348 LYS A CD   1 
ATOM   4186 C CE   . LYS A 1 277 ? -20.956 -26.613 -10.421 1.00 89.49  ? 348 LYS A CE   1 
ATOM   4187 N NZ   . LYS A 1 277 ? -21.434 -25.204 -10.578 1.00 94.61  ? 348 LYS A NZ   1 
ATOM   4188 H H    . LYS A 1 277 ? -26.041 -29.566 -12.754 1.00 74.35  ? 348 LYS A H    1 
ATOM   4189 H HA   . LYS A 1 277 ? -24.637 -27.560 -13.806 1.00 70.91  ? 348 LYS A HA   1 
ATOM   4190 H HB2  . LYS A 1 277 ? -24.685 -28.122 -11.448 1.00 77.03  ? 348 LYS A HB2  1 
ATOM   4191 H HB3  . LYS A 1 277 ? -23.675 -29.292 -11.813 1.00 77.03  ? 348 LYS A HB3  1 
ATOM   4192 H HG2  . LYS A 1 277 ? -22.210 -27.587 -12.666 1.00 87.48  ? 348 LYS A HG2  1 
ATOM   4193 H HG3  . LYS A 1 277 ? -23.166 -26.537 -11.949 1.00 87.48  ? 348 LYS A HG3  1 
ATOM   4194 H HD2  . LYS A 1 277 ? -22.684 -27.578 -9.881  1.00 98.08  ? 348 LYS A HD2  1 
ATOM   4195 H HD3  . LYS A 1 277 ? -21.651 -28.522 -10.630 1.00 98.08  ? 348 LYS A HD3  1 
ATOM   4196 H HE2  . LYS A 1 277 ? -20.596 -26.708 -9.526  1.00 107.39 ? 348 LYS A HE2  1 
ATOM   4197 H HE3  . LYS A 1 277 ? -20.258 -26.767 -11.077 1.00 107.39 ? 348 LYS A HE3  1 
ATOM   4198 H HZ1  . LYS A 1 277 ? -21.712 -25.068 -11.412 1.00 113.53 ? 348 LYS A HZ1  1 
ATOM   4199 H HZ2  . LYS A 1 277 ? -22.109 -25.048 -10.019 1.00 113.53 ? 348 LYS A HZ2  1 
ATOM   4200 H HZ3  . LYS A 1 277 ? -20.772 -24.637 -10.399 1.00 113.53 ? 348 LYS A HZ3  1 
ATOM   4201 N N    . THR A 1 278 ? -23.208 -28.603 -15.484 1.00 60.51  ? 349 THR A N    1 
ATOM   4202 C CA   . THR A 1 278 ? -22.313 -29.217 -16.466 1.00 64.94  ? 349 THR A CA   1 
ATOM   4203 C C    . THR A 1 278 ? -21.063 -29.835 -15.848 1.00 59.16  ? 349 THR A C    1 
ATOM   4204 O O    . THR A 1 278 ? -20.581 -30.871 -16.324 1.00 58.52  ? 349 THR A O    1 
ATOM   4205 C CB   . THR A 1 278 ? -21.895 -28.167 -17.488 1.00 75.82  ? 349 THR A CB   1 
ATOM   4206 O OG1  . THR A 1 278 ? -23.046 -27.785 -18.242 1.00 78.46  ? 349 THR A OG1  1 
ATOM   4207 C CG2  . THR A 1 278 ? -20.808 -28.712 -18.427 1.00 80.43  ? 349 THR A CG2  1 
ATOM   4208 H H    . THR A 1 278 ? -23.427 -27.794 -15.676 1.00 72.62  ? 349 THR A H    1 
ATOM   4209 H HA   . THR A 1 278 ? -22.793 -29.918 -16.935 1.00 77.93  ? 349 THR A HA   1 
ATOM   4210 H HB   . THR A 1 278 ? -21.540 -27.391 -17.026 1.00 90.99  ? 349 THR A HB   1 
ATOM   4211 H HG1  . THR A 1 278 ? -22.836 -27.205 -18.813 1.00 94.15  ? 349 THR A HG1  1 
ATOM   4212 H HG21 . THR A 1 278 ? -20.780 -28.183 -19.239 1.00 96.51  ? 349 THR A HG21 1 
ATOM   4213 H HG22 . THR A 1 278 ? -19.940 -28.669 -17.996 1.00 96.51  ? 349 THR A HG22 1 
ATOM   4214 H HG23 . THR A 1 278 ? -21.002 -29.633 -18.660 1.00 96.51  ? 349 THR A HG23 1 
ATOM   4215 N N    . ASN A 1 279 ? -20.479 -29.175 -14.843 1.00 55.78  ? 350 ASN A N    1 
ATOM   4216 C CA   . ASN A 1 279 ? -19.286 -29.706 -14.189 1.00 55.66  ? 350 ASN A CA   1 
ATOM   4217 C C    . ASN A 1 279 ? -19.540 -31.077 -13.558 1.00 46.55  ? 350 ASN A C    1 
ATOM   4218 O O    . ASN A 1 279 ? -18.653 -31.945 -13.549 1.00 42.13  ? 350 ASN A O    1 
ATOM   4219 C CB   . ASN A 1 279 ? -18.804 -28.724 -13.126 1.00 67.94  ? 350 ASN A CB   1 
ATOM   4220 C CG   . ASN A 1 279 ? -17.782 -29.344 -12.194 1.00 80.27  ? 350 ASN A CG   1 
ATOM   4221 O OD1  . ASN A 1 279 ? -16.634 -29.558 -12.582 1.00 87.00  ? 350 ASN A OD1  1 
ATOM   4222 N ND2  . ASN A 1 279 ? -18.198 -29.656 -10.961 1.00 83.04  ? 350 ASN A ND2  1 
ATOM   4223 H H    . ASN A 1 279 ? -20.754 -28.424 -14.526 1.00 66.94  ? 350 ASN A H    1 
ATOM   4224 H HA   . ASN A 1 279 ? -18.581 -29.805 -14.848 1.00 66.79  ? 350 ASN A HA   1 
ATOM   4225 H HB2  . ASN A 1 279 ? -18.392 -27.961 -13.561 1.00 81.53  ? 350 ASN A HB2  1 
ATOM   4226 H HB3  . ASN A 1 279 ? -19.562 -28.435 -12.594 1.00 81.53  ? 350 ASN A HB3  1 
ATOM   4227 H HD21 . ASN A 1 279 ? -17.651 -30.009 -10.399 1.00 99.65  ? 350 ASN A HD21 1 
ATOM   4228 H HD22 . ASN A 1 279 ? -19.012 -29.503 -10.730 1.00 99.65  ? 350 ASN A HD22 1 
ATOM   4229 N N    . ILE A 1 280 ? -20.720 -31.276 -12.970 1.00 47.99  ? 351 ILE A N    1 
ATOM   4230 C CA   . ILE A 1 280 ? -21.023 -32.570 -12.376 1.00 48.62  ? 351 ILE A CA   1 
ATOM   4231 C C    . ILE A 1 280 ? -21.161 -33.632 -13.463 1.00 48.33  ? 351 ILE A C    1 
ATOM   4232 O O    . ILE A 1 280 ? -20.636 -34.748 -13.323 1.00 49.84  ? 351 ILE A O    1 
ATOM   4233 C CB   . ILE A 1 280 ? -22.293 -32.486 -11.507 1.00 50.52  ? 351 ILE A CB   1 
ATOM   4234 C CG1  . ILE A 1 280 ? -22.106 -31.472 -10.376 1.00 53.42  ? 351 ILE A CG1  1 
ATOM   4235 C CG2  . ILE A 1 280 ? -22.661 -33.869 -10.953 1.00 49.50  ? 351 ILE A CG2  1 
ATOM   4236 C CD1  . ILE A 1 280 ? -21.110 -31.904 -9.298  1.00 55.23  ? 351 ILE A CD1  1 
ATOM   4237 H H    . ILE A 1 280 ? -21.347 -30.691 -12.904 1.00 57.59  ? 351 ILE A H    1 
ATOM   4238 H HA   . ILE A 1 280 ? -20.286 -32.831 -11.803 1.00 58.35  ? 351 ILE A HA   1 
ATOM   4239 H HB   . ILE A 1 280 ? -23.023 -32.181 -12.068 1.00 60.62  ? 351 ILE A HB   1 
ATOM   4240 H HG12 . ILE A 1 280 ? -21.785 -30.642 -10.756 1.00 64.10  ? 351 ILE A HG12 1 
ATOM   4241 H HG13 . ILE A 1 280 ? -22.962 -31.325 -9.945  1.00 64.10  ? 351 ILE A HG13 1 
ATOM   4242 H HG21 . ILE A 1 280 ? -23.309 -33.759 -10.240 1.00 59.40  ? 351 ILE A HG21 1 
ATOM   4243 H HG22 . ILE A 1 280 ? -23.042 -34.406 -11.665 1.00 59.40  ? 351 ILE A HG22 1 
ATOM   4244 H HG23 . ILE A 1 280 ? -21.860 -34.294 -10.608 1.00 59.40  ? 351 ILE A HG23 1 
ATOM   4245 H HD11 . ILE A 1 280 ? -21.017 -31.186 -8.653  1.00 66.27  ? 351 ILE A HD11 1 
ATOM   4246 H HD12 . ILE A 1 280 ? -21.443 -32.701 -8.857  1.00 66.27  ? 351 ILE A HD12 1 
ATOM   4247 H HD13 . ILE A 1 280 ? -20.252 -32.087 -9.711  1.00 66.27  ? 351 ILE A HD13 1 
ATOM   4248 N N    . GLN A 1 281 ? -21.863 -33.311 -14.562 1.00 47.72  ? 352 GLN A N    1 
ATOM   4249 C CA   . GLN A 1 281 ? -22.017 -34.299 -15.625 1.00 48.81  ? 352 GLN A CA   1 
ATOM   4250 C C    . GLN A 1 281 ? -20.653 -34.719 -16.149 1.00 47.59  ? 352 GLN A C    1 
ATOM   4251 O O    . GLN A 1 281 ? -20.374 -35.915 -16.307 1.00 48.39  ? 352 GLN A O    1 
ATOM   4252 C CB   . GLN A 1 281 ? -22.867 -33.752 -16.775 1.00 52.56  ? 352 GLN A CB   1 
ATOM   4253 C CG   . GLN A 1 281 ? -24.328 -33.568 -16.471 1.00 55.83  ? 352 GLN A CG   1 
ATOM   4254 C CD   . GLN A 1 281 ? -25.143 -33.174 -17.703 1.00 59.63  ? 352 GLN A CD   1 
ATOM   4255 O OE1  . GLN A 1 281 ? -24.637 -33.127 -18.827 1.00 58.52  ? 352 GLN A OE1  1 
ATOM   4256 N NE2  . GLN A 1 281 ? -26.416 -32.902 -17.486 1.00 62.27  ? 352 GLN A NE2  1 
ATOM   4257 H H    . GLN A 1 281 ? -22.245 -32.554 -14.707 1.00 57.27  ? 352 GLN A H    1 
ATOM   4258 H HA   . GLN A 1 281 ? -22.460 -35.085 -15.268 1.00 58.57  ? 352 GLN A HA   1 
ATOM   4259 H HB2  . GLN A 1 281 ? -22.513 -32.887 -17.033 1.00 63.07  ? 352 GLN A HB2  1 
ATOM   4260 H HB3  . GLN A 1 281 ? -22.801 -34.365 -17.524 1.00 63.07  ? 352 GLN A HB3  1 
ATOM   4261 H HG2  . GLN A 1 281 ? -24.687 -34.401 -16.128 1.00 67.00  ? 352 GLN A HG2  1 
ATOM   4262 H HG3  . GLN A 1 281 ? -24.427 -32.866 -15.809 1.00 67.00  ? 352 GLN A HG3  1 
ATOM   4263 H HE21 . GLN A 1 281 ? -26.737 -32.952 -16.690 1.00 74.73  ? 352 GLN A HE21 1 
ATOM   4264 H HE22 . GLN A 1 281 ? -26.925 -32.674 -18.141 1.00 74.73  ? 352 GLN A HE22 1 
ATOM   4265 N N    . LYS A 1 282 ? -19.796 -33.732 -16.439 1.00 47.53  ? 353 LYS A N    1 
ATOM   4266 C CA   . LYS A 1 282 ? -18.479 -34.024 -16.981 1.00 49.19  ? 353 LYS A CA   1 
ATOM   4267 C C    . LYS A 1 282 ? -17.674 -34.890 -16.018 1.00 47.27  ? 353 LYS A C    1 
ATOM   4268 O O    . LYS A 1 282 ? -17.060 -35.879 -16.434 1.00 46.99  ? 353 LYS A O    1 
ATOM   4269 C CB   . LYS A 1 282 ? -17.743 -32.720 -17.289 1.00 57.51  ? 353 LYS A CB   1 
ATOM   4270 C CG   . LYS A 1 282 ? -16.358 -32.926 -17.881 1.00 65.86  ? 353 LYS A CG   1 
ATOM   4271 C CD   . LYS A 1 282 ? -15.845 -31.684 -18.603 1.00 75.74  ? 353 LYS A CD   1 
ATOM   4272 C CE   . LYS A 1 282 ? -15.383 -30.617 -17.633 1.00 84.40  ? 353 LYS A CE   1 
ATOM   4273 N NZ   . LYS A 1 282 ? -14.133 -31.016 -16.922 1.00 90.06  ? 353 LYS A NZ   1 
ATOM   4274 H H    . LYS A 1 282 ? -19.958 -32.895 -16.330 1.00 57.03  ? 353 LYS A H    1 
ATOM   4275 H HA   . LYS A 1 282 ? -18.581 -34.514 -17.812 1.00 59.03  ? 353 LYS A HA   1 
ATOM   4276 H HB2  . LYS A 1 282 ? -18.267 -32.209 -17.926 1.00 69.01  ? 353 LYS A HB2  1 
ATOM   4277 H HB3  . LYS A 1 282 ? -17.642 -32.216 -16.466 1.00 69.01  ? 353 LYS A HB3  1 
ATOM   4278 H HG2  . LYS A 1 282 ? -15.736 -33.139 -17.168 1.00 79.03  ? 353 LYS A HG2  1 
ATOM   4279 H HG3  . LYS A 1 282 ? -16.392 -33.654 -18.521 1.00 79.03  ? 353 LYS A HG3  1 
ATOM   4280 H HD2  . LYS A 1 282 ? -15.092 -31.930 -19.163 1.00 90.89  ? 353 LYS A HD2  1 
ATOM   4281 H HD3  . LYS A 1 282 ? -16.557 -31.312 -19.146 1.00 90.89  ? 353 LYS A HD3  1 
ATOM   4282 H HE2  . LYS A 1 282 ? -15.205 -29.798 -18.121 1.00 101.28 ? 353 LYS A HE2  1 
ATOM   4283 H HE3  . LYS A 1 282 ? -16.074 -30.468 -16.969 1.00 101.28 ? 353 LYS A HE3  1 
ATOM   4284 H HZ1  . LYS A 1 282 ? -13.871 -30.362 -16.379 1.00 108.07 ? 353 LYS A HZ1  1 
ATOM   4285 H HZ2  . LYS A 1 282 ? -14.278 -31.751 -16.441 1.00 108.07 ? 353 LYS A HZ2  1 
ATOM   4286 H HZ3  . LYS A 1 282 ? -13.487 -31.179 -17.512 1.00 108.07 ? 353 LYS A HZ3  1 
ATOM   4287 N N    . GLU A 1 283 ? -17.697 -34.554 -14.725 1.00 46.38  ? 354 GLU A N    1 
ATOM   4288 C CA   . GLU A 1 283 ? -16.962 -35.332 -13.731 1.00 50.25  ? 354 GLU A CA   1 
ATOM   4289 C C    . GLU A 1 283 ? -17.520 -36.745 -13.615 1.00 47.62  ? 354 GLU A C    1 
ATOM   4290 O O    . GLU A 1 283 ? -16.763 -37.711 -13.444 1.00 45.79  ? 354 GLU A O    1 
ATOM   4291 C CB   . GLU A 1 283 ? -17.032 -34.622 -12.379 1.00 58.77  ? 354 GLU A CB   1 
ATOM   4292 C CG   . GLU A 1 283 ? -15.988 -35.047 -11.378 1.00 70.71  ? 354 GLU A CG   1 
ATOM   4293 C CD   . GLU A 1 283 ? -14.763 -34.161 -11.425 1.00 83.63  ? 354 GLU A CD   1 
ATOM   4294 O OE1  . GLU A 1 283 ? -14.928 -32.927 -11.573 1.00 85.92  ? 354 GLU A OE1  1 
ATOM   4295 O OE2  . GLU A 1 283 ? -13.638 -34.700 -11.327 1.00 90.96  ? 354 GLU A OE2  1 
ATOM   4296 H H    . GLU A 1 283 ? -18.128 -33.884 -14.402 1.00 55.66  ? 354 GLU A H    1 
ATOM   4297 H HA   . GLU A 1 283 ? -16.031 -35.393 -13.996 1.00 60.30  ? 354 GLU A HA   1 
ATOM   4298 H HB2  . GLU A 1 283 ? -16.935 -33.669 -12.527 1.00 70.52  ? 354 GLU A HB2  1 
ATOM   4299 H HB3  . GLU A 1 283 ? -17.900 -34.799 -11.986 1.00 70.52  ? 354 GLU A HB3  1 
ATOM   4300 H HG2  . GLU A 1 283 ? -16.363 -34.994 -10.485 1.00 84.85  ? 354 GLU A HG2  1 
ATOM   4301 H HG3  . GLU A 1 283 ? -15.712 -35.956 -11.572 1.00 84.85  ? 354 GLU A HG3  1 
ATOM   4302 N N    . ALA A 1 284 ? -18.853 -36.882 -13.689 1.00 49.27  ? 355 ALA A N    1 
ATOM   4303 C CA   . ALA A 1 284 ? -19.468 -38.197 -13.525 1.00 47.38  ? 355 ALA A CA   1 
ATOM   4304 C C    . ALA A 1 284 ? -19.232 -39.074 -14.747 1.00 44.08  ? 355 ALA A C    1 
ATOM   4305 O O    . ALA A 1 284 ? -19.041 -40.284 -14.619 1.00 42.50  ? 355 ALA A O    1 
ATOM   4306 C CB   . ALA A 1 284 ? -20.954 -38.041 -13.259 1.00 47.83  ? 355 ALA A CB   1 
ATOM   4307 H H    . ALA A 1 284 ? -19.408 -36.240 -13.830 1.00 59.12  ? 355 ALA A H    1 
ATOM   4308 H HA   . ALA A 1 284 ? -19.071 -38.638 -12.758 1.00 56.86  ? 355 ALA A HA   1 
ATOM   4309 H HB1  . ALA A 1 284 ? -21.349 -38.920 -13.152 1.00 57.40  ? 355 ALA A HB1  1 
ATOM   4310 H HB2  . ALA A 1 284 ? -21.076 -37.522 -12.449 1.00 57.40  ? 355 ALA A HB2  1 
ATOM   4311 H HB3  . ALA A 1 284 ? -21.363 -37.584 -14.011 1.00 57.40  ? 355 ALA A HB3  1 
ATOM   4312 N N    . THR A 1 285 ? -19.231 -38.480 -15.940 1.00 43.53  ? 356 THR A N    1 
ATOM   4313 C CA   . THR A 1 285 ? -18.889 -39.225 -17.149 1.00 45.31  ? 356 THR A CA   1 
ATOM   4314 C C    . THR A 1 285 ? -17.427 -39.670 -17.136 1.00 44.50  ? 356 THR A C    1 
ATOM   4315 O O    . THR A 1 285 ? -17.119 -40.810 -17.497 1.00 43.43  ? 356 THR A O    1 
ATOM   4316 C CB   . THR A 1 285 ? -19.174 -38.363 -18.384 1.00 48.42  ? 356 THR A CB   1 
ATOM   4317 O OG1  . THR A 1 285 ? -20.548 -37.921 -18.381 1.00 48.54  ? 356 THR A OG1  1 
ATOM   4318 C CG2  . THR A 1 285 ? -18.904 -39.135 -19.666 1.00 51.00  ? 356 THR A CG2  1 
ATOM   4319 H H    . THR A 1 285 ? -19.423 -37.653 -16.075 1.00 52.23  ? 356 THR A H    1 
ATOM   4320 H HA   . THR A 1 285 ? -19.445 -40.018 -17.200 1.00 54.37  ? 356 THR A HA   1 
ATOM   4321 H HB   . THR A 1 285 ? -18.591 -37.588 -18.371 1.00 58.11  ? 356 THR A HB   1 
ATOM   4322 H HG1  . THR A 1 285 ? -20.699 -37.457 -17.697 1.00 58.25  ? 356 THR A HG1  1 
ATOM   4323 H HG21 . THR A 1 285 ? -19.220 -38.627 -20.430 1.00 61.20  ? 356 THR A HG21 1 
ATOM   4324 H HG22 . THR A 1 285 ? -17.953 -39.293 -19.766 1.00 61.20  ? 356 THR A HG22 1 
ATOM   4325 H HG23 . THR A 1 285 ? -19.366 -39.988 -19.643 1.00 61.20  ? 356 THR A HG23 1 
ATOM   4326 N N    . TRP A 1 286 ? -16.508 -38.781 -16.747 1.00 45.68  ? 357 TRP A N    1 
ATOM   4327 C CA   . TRP A 1 286 ? -15.108 -39.175 -16.622 1.00 46.69  ? 357 TRP A CA   1 
ATOM   4328 C C    . TRP A 1 286 ? -14.969 -40.365 -15.675 1.00 46.34  ? 357 TRP A C    1 
ATOM   4329 O O    . TRP A 1 286 ? -14.279 -41.349 -15.984 1.00 48.60  ? 357 TRP A O    1 
ATOM   4330 C CB   . TRP A 1 286 ? -14.280 -37.992 -16.130 1.00 47.95  ? 357 TRP A CB   1 
ATOM   4331 C CG   . TRP A 1 286 ? -12.888 -38.373 -15.744 1.00 52.20  ? 357 TRP A CG   1 
ATOM   4332 C CD1  . TRP A 1 286 ? -11.880 -38.744 -16.576 1.00 54.34  ? 357 TRP A CD1  1 
ATOM   4333 C CD2  . TRP A 1 286 ? -12.351 -38.414 -14.424 1.00 57.24  ? 357 TRP A CD2  1 
ATOM   4334 N NE1  . TRP A 1 286 ? -10.747 -39.022 -15.858 1.00 57.00  ? 357 TRP A NE1  1 
ATOM   4335 C CE2  . TRP A 1 286 ? -11.010 -38.825 -14.531 1.00 59.24  ? 357 TRP A CE2  1 
ATOM   4336 C CE3  . TRP A 1 286 ? -12.873 -38.140 -13.160 1.00 59.63  ? 357 TRP A CE3  1 
ATOM   4337 C CZ2  . TRP A 1 286 ? -10.189 -38.973 -13.426 1.00 62.78  ? 357 TRP A CZ2  1 
ATOM   4338 C CZ3  . TRP A 1 286 ? -12.056 -38.287 -12.061 1.00 62.02  ? 357 TRP A CZ3  1 
ATOM   4339 C CH2  . TRP A 1 286 ? -10.731 -38.698 -12.200 1.00 63.40  ? 357 TRP A CH2  1 
ATOM   4340 H H    . TRP A 1 286 ? -16.668 -37.959 -16.553 1.00 54.82  ? 357 TRP A H    1 
ATOM   4341 H HA   . TRP A 1 286 ? -14.772 -39.439 -17.493 1.00 56.02  ? 357 TRP A HA   1 
ATOM   4342 H HB2  . TRP A 1 286 ? -14.224 -37.331 -16.838 1.00 57.54  ? 357 TRP A HB2  1 
ATOM   4343 H HB3  . TRP A 1 286 ? -14.712 -37.607 -15.351 1.00 57.54  ? 357 TRP A HB3  1 
ATOM   4344 H HD1  . TRP A 1 286 ? -11.952 -38.809 -17.501 1.00 65.21  ? 357 TRP A HD1  1 
ATOM   4345 H HE1  . TRP A 1 286 ? -9.995  -39.277 -16.187 1.00 68.40  ? 357 TRP A HE1  1 
ATOM   4346 H HE3  . TRP A 1 286 ? -13.757 -37.869 -13.061 1.00 71.55  ? 357 TRP A HE3  1 
ATOM   4347 H HZ2  . TRP A 1 286 ? -9.304  -39.244 -13.514 1.00 75.34  ? 357 TRP A HZ2  1 
ATOM   4348 H HZ3  . TRP A 1 286 ? -12.394 -38.110 -11.213 1.00 74.42  ? 357 TRP A HZ3  1 
ATOM   4349 H HH2  . TRP A 1 286 ? -10.202 -38.788 -11.440 1.00 76.08  ? 357 TRP A HH2  1 
ATOM   4350 N N    . THR A 1 287 ? -15.643 -40.295 -14.523 1.00 44.87  ? 358 THR A N    1 
ATOM   4351 C CA   . THR A 1 287 ? -15.633 -41.399 -13.569 1.00 45.95  ? 358 THR A CA   1 
ATOM   4352 C C    . THR A 1 287 ? -16.178 -42.684 -14.186 1.00 47.82  ? 358 THR A C    1 
ATOM   4353 O O    . THR A 1 287 ? -15.702 -43.778 -13.861 1.00 47.11  ? 358 THR A O    1 
ATOM   4354 C CB   . THR A 1 287 ? -16.440 -41.006 -12.328 1.00 47.25  ? 358 THR A CB   1 
ATOM   4355 O OG1  . THR A 1 287 ? -15.853 -39.835 -11.733 1.00 47.99  ? 358 THR A OG1  1 
ATOM   4356 C CG2  . THR A 1 287 ? -16.494 -42.143 -11.312 1.00 48.11  ? 358 THR A CG2  1 
ATOM   4357 H H    . THR A 1 287 ? -16.112 -39.619 -14.274 1.00 53.84  ? 358 THR A H    1 
ATOM   4358 H HA   . THR A 1 287 ? -14.722 -41.569 -13.292 1.00 55.14  ? 358 THR A HA   1 
ATOM   4359 H HB   . THR A 1 287 ? -17.350 -40.801 -12.596 1.00 56.70  ? 358 THR A HB   1 
ATOM   4360 H HG1  . THR A 1 287 ? -15.869 -39.197 -12.279 1.00 57.59  ? 358 THR A HG1  1 
ATOM   4361 H HG21 . THR A 1 287 ? -16.938 -41.840 -10.504 1.00 57.73  ? 358 THR A HG21 1 
ATOM   4362 H HG22 . THR A 1 287 ? -16.984 -42.898 -11.673 1.00 57.73  ? 358 THR A HG22 1 
ATOM   4363 H HG23 . THR A 1 287 ? -15.595 -42.425 -11.086 1.00 57.73  ? 358 THR A HG23 1 
ATOM   4364 N N    . MET A 1 288 ? -17.180 -42.578 -15.073 1.00 51.51  ? 359 MET A N    1 
ATOM   4365 C CA   . MET A 1 288 ? -17.735 -43.766 -15.724 1.00 53.10  ? 359 MET A CA   1 
ATOM   4366 C C    . MET A 1 288 ? -16.750 -44.388 -16.704 1.00 51.62  ? 359 MET A C    1 
ATOM   4367 O O    . MET A 1 288 ? -16.733 -45.613 -16.865 1.00 54.42  ? 359 MET A O    1 
ATOM   4368 C CB   . MET A 1 288 ? -19.033 -43.430 -16.467 1.00 56.17  ? 359 MET A CB   1 
ATOM   4369 C CG   . MET A 1 288 ? -20.243 -43.175 -15.578 1.00 61.33  ? 359 MET A CG   1 
ATOM   4370 S SD   . MET A 1 288 ? -20.642 -44.532 -14.434 1.00 64.15  ? 359 MET A SD   1 
ATOM   4371 C CE   . MET A 1 288 ? -20.857 -45.887 -15.594 1.00 64.58  ? 359 MET A CE   1 
ATOM   4372 H H    . MET A 1 288 ? -17.549 -41.838 -15.310 1.00 61.81  ? 359 MET A H    1 
ATOM   4373 H HA   . MET A 1 288 ? -17.943 -44.422 -15.041 1.00 63.71  ? 359 MET A HA   1 
ATOM   4374 H HB2  . MET A 1 288 ? -18.886 -42.629 -16.994 1.00 67.40  ? 359 MET A HB2  1 
ATOM   4375 H HB3  . MET A 1 288 ? -19.252 -44.169 -17.056 1.00 67.40  ? 359 MET A HB3  1 
ATOM   4376 H HG2  . MET A 1 288 ? -20.076 -42.383 -15.045 1.00 73.59  ? 359 MET A HG2  1 
ATOM   4377 H HG3  . MET A 1 288 ? -21.018 -43.030 -16.143 1.00 73.59  ? 359 MET A HG3  1 
ATOM   4378 H HE1  . MET A 1 288 ? -21.162 -46.671 -15.110 1.00 77.50  ? 359 MET A HE1  1 
ATOM   4379 H HE2  . MET A 1 288 ? -21.516 -45.631 -16.259 1.00 77.50  ? 359 MET A HE2  1 
ATOM   4380 H HE3  . MET A 1 288 ? -20.008 -46.073 -16.024 1.00 77.50  ? 359 MET A HE3  1 
ATOM   4381 N N    . SER A 1 289 ? -15.931 -43.568 -17.363 1.00 46.37  ? 360 SER A N    1 
ATOM   4382 C CA   . SER A 1 289 ? -14.970 -44.090 -18.326 1.00 47.17  ? 360 SER A CA   1 
ATOM   4383 C C    . SER A 1 289 ? -13.877 -44.918 -17.650 1.00 48.18  ? 360 SER A C    1 
ATOM   4384 O O    . SER A 1 289 ? -13.384 -45.885 -18.237 1.00 50.65  ? 360 SER A O    1 
ATOM   4385 C CB   . SER A 1 289 ? -14.335 -42.943 -19.101 1.00 48.80  ? 360 SER A CB   1 
ATOM   4386 O OG   . SER A 1 289 ? -13.399 -42.267 -18.282 1.00 50.85  ? 360 SER A OG   1 
ATOM   4387 H H    . SER A 1 289 ? -15.914 -42.713 -17.270 1.00 55.64  ? 360 SER A H    1 
ATOM   4388 H HA   . SER A 1 289 ? -15.434 -44.662 -18.956 1.00 56.60  ? 360 SER A HA   1 
ATOM   4389 H HB2  . SER A 1 289 ? -13.879 -43.299 -19.880 1.00 58.56  ? 360 SER A HB2  1 
ATOM   4390 H HB3  . SER A 1 289 ? -15.027 -42.321 -19.374 1.00 58.56  ? 360 SER A HB3  1 
ATOM   4391 H HG   . SER A 1 289 ? -13.783 -41.957 -17.602 1.00 61.02  ? 360 SER A HG   1 
ATOM   4392 N N    . ASN A 1 290 ? -13.481 -44.560 -16.426 1.00 46.44  ? 361 ASN A N    1 
ATOM   4393 C CA   . ASN A 1 290 ? -12.509 -45.377 -15.706 1.00 48.36  ? 361 ASN A CA   1 
ATOM   4394 C C    . ASN A 1 290 ? -13.134 -46.631 -15.109 1.00 49.21  ? 361 ASN A C    1 
ATOM   4395 O O    . ASN A 1 290 ? -12.426 -47.618 -14.882 1.00 49.38  ? 361 ASN A O    1 
ATOM   4396 C CB   . ASN A 1 290 ? -11.846 -44.552 -14.612 1.00 50.41  ? 361 ASN A CB   1 
ATOM   4397 C CG   . ASN A 1 290 ? -10.733 -43.683 -15.155 1.00 54.12  ? 361 ASN A CG   1 
ATOM   4398 O OD1  . ASN A 1 290 ? -9.964  -44.111 -16.021 1.00 56.79  ? 361 ASN A OD1  1 
ATOM   4399 N ND2  . ASN A 1 290 ? -10.659 -42.457 -14.678 1.00 53.49  ? 361 ASN A ND2  1 
ATOM   4400 H H    . ASN A 1 290 ? -13.754 -43.864 -16.001 1.00 55.72  ? 361 ASN A H    1 
ATOM   4401 H HA   . ASN A 1 290 ? -11.818 -45.659 -16.326 1.00 58.03  ? 361 ASN A HA   1 
ATOM   4402 H HB2  . ASN A 1 290 ? -12.509 -43.974 -14.202 1.00 60.49  ? 361 ASN A HB2  1 
ATOM   4403 H HB3  . ASN A 1 290 ? -11.467 -45.149 -13.948 1.00 60.49  ? 361 ASN A HB3  1 
ATOM   4404 H HD21 . ASN A 1 290 ? -10.044 -41.924 -14.956 1.00 64.19  ? 361 ASN A HD21 1 
ATOM   4405 H HD22 . ASN A 1 290 ? -11.226 -42.190 -14.089 1.00 64.19  ? 361 ASN A HD22 1 
ATOM   4406 N N    . ILE A 1 291 ? -14.441 -46.620 -14.838 1.00 50.43  ? 362 ILE A N    1 
ATOM   4407 C CA   . ILE A 1 291 ? -15.115 -47.849 -14.433 1.00 52.17  ? 362 ILE A CA   1 
ATOM   4408 C C    . ILE A 1 291 ? -15.238 -48.805 -15.619 1.00 54.41  ? 362 ILE A C    1 
ATOM   4409 O O    . ILE A 1 291 ? -14.912 -49.993 -15.514 1.00 55.27  ? 362 ILE A O    1 
ATOM   4410 C CB   . ILE A 1 291 ? -16.481 -47.516 -13.817 1.00 50.21  ? 362 ILE A CB   1 
ATOM   4411 C CG1  . ILE A 1 291 ? -16.257 -46.782 -12.489 1.00 52.47  ? 362 ILE A CG1  1 
ATOM   4412 C CG2  . ILE A 1 291 ? -17.301 -48.775 -13.621 1.00 47.62  ? 362 ILE A CG2  1 
ATOM   4413 C CD1  . ILE A 1 291 ? -17.550 -46.415 -11.756 1.00 53.99  ? 362 ILE A CD1  1 
ATOM   4414 H H    . ILE A 1 291 ? -14.949 -45.927 -14.880 1.00 60.52  ? 362 ILE A H    1 
ATOM   4415 H HA   . ILE A 1 291 ? -14.582 -48.289 -13.752 1.00 62.60  ? 362 ILE A HA   1 
ATOM   4416 H HB   . ILE A 1 291 ? -16.958 -46.926 -14.421 1.00 60.25  ? 362 ILE A HB   1 
ATOM   4417 H HG12 . ILE A 1 291 ? -15.736 -47.352 -11.902 1.00 62.96  ? 362 ILE A HG12 1 
ATOM   4418 H HG13 . ILE A 1 291 ? -15.773 -45.960 -12.663 1.00 62.96  ? 362 ILE A HG13 1 
ATOM   4419 H HG21 . ILE A 1 291 ? -18.097 -48.567 -13.110 1.00 57.14  ? 362 ILE A HG21 1 
ATOM   4420 H HG22 . ILE A 1 291 ? -17.560 -49.127 -14.487 1.00 57.14  ? 362 ILE A HG22 1 
ATOM   4421 H HG23 . ILE A 1 291 ? -16.765 -49.428 -13.145 1.00 57.14  ? 362 ILE A HG23 1 
ATOM   4422 H HD11 . ILE A 1 291 ? -17.350 -45.749 -11.079 1.00 64.79  ? 362 ILE A HD11 1 
ATOM   4423 H HD12 . ILE A 1 291 ? -18.184 -46.056 -12.396 1.00 64.79  ? 362 ILE A HD12 1 
ATOM   4424 H HD13 . ILE A 1 291 ? -17.916 -47.211 -11.340 1.00 64.79  ? 362 ILE A HD13 1 
ATOM   4425 N N    . THR A 1 292 ? -15.717 -48.304 -16.766 1.00 54.78  ? 363 THR A N    1 
ATOM   4426 C CA   . THR A 1 292 ? -15.817 -49.154 -17.944 1.00 54.50  ? 363 THR A CA   1 
ATOM   4427 C C    . THR A 1 292 ? -14.456 -49.586 -18.462 1.00 55.68  ? 363 THR A C    1 
ATOM   4428 O O    . THR A 1 292 ? -14.400 -50.385 -19.398 1.00 57.41  ? 363 THR A O    1 
ATOM   4429 C CB   . THR A 1 292 ? -16.558 -48.454 -19.082 1.00 51.79  ? 363 THR A CB   1 
ATOM   4430 O OG1  . THR A 1 292 ? -15.844 -47.271 -19.463 1.00 50.93  ? 363 THR A OG1  1 
ATOM   4431 C CG2  . THR A 1 292 ? -17.970 -48.113 -18.682 1.00 49.26  ? 363 THR A CG2  1 
ATOM   4432 H H    . THR A 1 292 ? -15.983 -47.494 -16.880 1.00 65.74  ? 363 THR A H    1 
ATOM   4433 H HA   . THR A 1 292 ? -16.315 -49.954 -17.712 1.00 65.40  ? 363 THR A HA   1 
ATOM   4434 H HB   . THR A 1 292 ? -16.601 -49.053 -19.844 1.00 62.15  ? 363 THR A HB   1 
ATOM   4435 H HG1  . THR A 1 292 ? -16.247 -46.881 -20.089 1.00 61.11  ? 363 THR A HG1  1 
ATOM   4436 H HG21 . THR A 1 292 ? -18.427 -47.679 -19.419 1.00 59.11  ? 363 THR A HG21 1 
ATOM   4437 H HG22 . THR A 1 292 ? -18.451 -48.921 -18.445 1.00 59.11  ? 363 THR A HG22 1 
ATOM   4438 H HG23 . THR A 1 292 ? -17.964 -47.514 -17.919 1.00 59.11  ? 363 THR A HG23 1 
ATOM   4439 N N    . ALA A 1 293 ? -13.374 -49.041 -17.913 1.00 54.41  ? 364 ALA A N    1 
ATOM   4440 C CA   . ALA A 1 293 ? -12.028 -49.512 -18.203 1.00 55.92  ? 364 ALA A CA   1 
ATOM   4441 C C    . ALA A 1 293 ? -11.623 -50.701 -17.342 1.00 60.12  ? 364 ALA A C    1 
ATOM   4442 O O    . ALA A 1 293 ? -10.494 -51.172 -17.466 1.00 63.34  ? 364 ALA A O    1 
ATOM   4443 C CB   . ALA A 1 293 ? -11.030 -48.370 -18.000 1.00 55.39  ? 364 ALA A CB   1 
ATOM   4444 H H    . ALA A 1 293 ? -13.394 -48.382 -17.361 1.00 65.29  ? 364 ALA A H    1 
ATOM   4445 H HA   . ALA A 1 293 ? -11.983 -49.787 -19.132 1.00 67.11  ? 364 ALA A HA   1 
ATOM   4446 H HB1  . ALA A 1 293 ? -10.135 -48.700 -18.167 1.00 66.47  ? 364 ALA A HB1  1 
ATOM   4447 H HB2  . ALA A 1 293 ? -11.240 -47.653 -18.619 1.00 66.47  ? 364 ALA A HB2  1 
ATOM   4448 H HB3  . ALA A 1 293 ? -11.098 -48.051 -17.087 1.00 66.47  ? 364 ALA A HB3  1 
ATOM   4449 N N    . GLY A 1 294 ? -12.498 -51.193 -16.477 1.00 60.52  ? 365 GLY A N    1 
ATOM   4450 C CA   . GLY A 1 294 ? -12.162 -52.256 -15.549 1.00 62.76  ? 365 GLY A CA   1 
ATOM   4451 C C    . GLY A 1 294 ? -12.511 -53.641 -16.058 1.00 62.93  ? 365 GLY A C    1 
ATOM   4452 O O    . GLY A 1 294 ? -12.590 -53.891 -17.264 1.00 63.71  ? 365 GLY A O    1 
ATOM   4453 H H    . GLY A 1 294 ? -13.311 -50.921 -16.408 1.00 72.63  ? 365 GLY A H    1 
ATOM   4454 H HA2  . GLY A 1 294 ? -11.210 -52.231 -15.365 1.00 75.31  ? 365 GLY A HA2  1 
ATOM   4455 H HA3  . GLY A 1 294 ? -12.636 -52.112 -14.715 1.00 75.31  ? 365 GLY A HA3  1 
ATOM   4456 N N    . ARG A 1 295 ? -12.726 -54.551 -15.114 1.00 60.33  ? 366 ARG A N    1 
ATOM   4457 C CA   . ARG A 1 295 ? -12.997 -55.945 -15.423 1.00 61.72  ? 366 ARG A CA   1 
ATOM   4458 C C    . ARG A 1 295 ? -14.347 -56.112 -16.128 1.00 59.21  ? 366 ARG A C    1 
ATOM   4459 O O    . ARG A 1 295 ? -15.265 -55.297 -15.992 1.00 57.03  ? 366 ARG A O    1 
ATOM   4460 C CB   . ARG A 1 295 ? -12.986 -56.787 -14.142 1.00 65.78  ? 366 ARG A CB   1 
ATOM   4461 C CG   . ARG A 1 295 ? -11.702 -56.731 -13.332 1.00 70.49  ? 366 ARG A CG   1 
ATOM   4462 C CD   . ARG A 1 295 ? -11.695 -57.794 -12.236 1.00 75.89  ? 366 ARG A CD   1 
ATOM   4463 N NE   . ARG A 1 295 ? -12.746 -57.548 -11.247 1.00 78.76  ? 366 ARG A NE   1 
ATOM   4464 C CZ   . ARG A 1 295 ? -12.555 -57.213 -9.969  1.00 80.51  ? 366 ARG A CZ   1 
ATOM   4465 N NH1  . ARG A 1 295 ? -11.331 -57.088 -9.451  1.00 82.88  ? 366 ARG A NH1  1 
ATOM   4466 N NH2  . ARG A 1 295 ? -13.616 -57.009 -9.191  1.00 79.13  ? 366 ARG A NH2  1 
ATOM   4467 H H    . ARG A 1 295 ? -12.719 -54.380 -14.271 1.00 72.40  ? 366 ARG A H    1 
ATOM   4468 H HA   . ARG A 1 295 ? -12.304 -56.281 -16.013 1.00 74.06  ? 366 ARG A HA   1 
ATOM   4469 H HB2  . ARG A 1 295 ? -13.705 -56.481 -13.568 1.00 78.94  ? 366 ARG A HB2  1 
ATOM   4470 H HB3  . ARG A 1 295 ? -13.137 -57.714 -14.383 1.00 78.94  ? 366 ARG A HB3  1 
ATOM   4471 H HG2  . ARG A 1 295 ? -10.946 -56.892 -13.918 1.00 84.59  ? 366 ARG A HG2  1 
ATOM   4472 H HG3  . ARG A 1 295 ? -11.625 -55.860 -12.913 1.00 84.59  ? 366 ARG A HG3  1 
ATOM   4473 H HD2  . ARG A 1 295 ? -11.860 -58.662 -12.638 1.00 91.07  ? 366 ARG A HD2  1 
ATOM   4474 H HD3  . ARG A 1 295 ? -10.832 -57.792 -11.797 1.00 91.07  ? 366 ARG A HD3  1 
ATOM   4475 H HE   . ARG A 1 295 ? -13.560 -57.626 -11.513 1.00 94.51  ? 366 ARG A HE   1 
ATOM   4476 H HH11 . ARG A 1 295 ? -10.636 -57.213 -9.939  1.00 99.46  ? 366 ARG A HH11 1 
ATOM   4477 H HH12 . ARG A 1 295 ? -11.238 -56.874 -8.623  1.00 99.46  ? 366 ARG A HH12 1 
ATOM   4478 H HH21 . ARG A 1 295 ? -14.409 -57.092 -9.514  1.00 94.96  ? 366 ARG A HH21 1 
ATOM   4479 H HH22 . ARG A 1 295 ? -13.509 -56.800 -8.364  1.00 94.96  ? 366 ARG A HH22 1 
ATOM   4480 N N    . GLN A 1 296 ? -14.470 -57.218 -16.865 1.00 61.43  ? 367 GLN A N    1 
ATOM   4481 C CA   . GLN A 1 296 ? -15.710 -57.486 -17.577 1.00 61.92  ? 367 GLN A CA   1 
ATOM   4482 C C    . GLN A 1 296 ? -16.886 -57.607 -16.621 1.00 58.49  ? 367 GLN A C    1 
ATOM   4483 O O    . GLN A 1 296 ? -18.007 -57.197 -16.959 1.00 57.17  ? 367 GLN A O    1 
ATOM   4484 C CB   . GLN A 1 296 ? -15.560 -58.748 -18.421 1.00 66.37  ? 367 GLN A CB   1 
ATOM   4485 C CG   . GLN A 1 296 ? -14.583 -58.582 -19.567 1.00 69.53  ? 367 GLN A CG   1 
ATOM   4486 C CD   . GLN A 1 296 ? -14.524 -59.796 -20.476 1.00 72.30  ? 367 GLN A CD   1 
ATOM   4487 O OE1  . GLN A 1 296 ? -14.935 -60.894 -20.096 1.00 73.02  ? 367 GLN A OE1  1 
ATOM   4488 N NE2  . GLN A 1 296 ? -14.020 -59.598 -21.693 1.00 73.50  ? 367 GLN A NE2  1 
ATOM   4489 H H    . GLN A 1 296 ? -13.860 -57.816 -16.965 1.00 73.71  ? 367 GLN A H    1 
ATOM   4490 H HA   . GLN A 1 296 ? -15.891 -56.747 -18.178 1.00 74.31  ? 367 GLN A HA   1 
ATOM   4491 H HB2  . GLN A 1 296 ? -15.239 -59.468 -17.856 1.00 79.64  ? 367 GLN A HB2  1 
ATOM   4492 H HB3  . GLN A 1 296 ? -16.424 -58.981 -18.796 1.00 79.64  ? 367 GLN A HB3  1 
ATOM   4493 H HG2  . GLN A 1 296 ? -14.861 -57.823 -20.101 1.00 83.43  ? 367 GLN A HG2  1 
ATOM   4494 H HG3  . GLN A 1 296 ? -13.695 -58.430 -19.208 1.00 83.43  ? 367 GLN A HG3  1 
ATOM   4495 H HE21 . GLN A 1 296 ? -13.750 -58.815 -21.925 1.00 88.20  ? 367 GLN A HE21 1 
ATOM   4496 H HE22 . GLN A 1 296 ? -13.964 -60.253 -22.247 1.00 88.20  ? 367 GLN A HE22 1 
ATOM   4497 N N    . ASP A 1 297 ? -16.653 -58.145 -15.420 1.00 60.87  ? 368 ASP A N    1 
ATOM   4498 C CA   . ASP A 1 297 ? -17.726 -58.224 -14.438 1.00 61.73  ? 368 ASP A CA   1 
ATOM   4499 C C    . ASP A 1 297 ? -18.112 -56.844 -13.923 1.00 59.73  ? 368 ASP A C    1 
ATOM   4500 O O    . ASP A 1 297 ? -19.260 -56.640 -13.516 1.00 60.27  ? 368 ASP A O    1 
ATOM   4501 C CB   . ASP A 1 297 ? -17.325 -59.137 -13.280 1.00 68.95  ? 368 ASP A CB   1 
ATOM   4502 C CG   . ASP A 1 297 ? -16.264 -58.520 -12.374 1.00 77.20  ? 368 ASP A CG   1 
ATOM   4503 O OD1  . ASP A 1 297 ? -15.061 -58.693 -12.676 1.00 80.98  ? 368 ASP A OD1  1 
ATOM   4504 O OD2  . ASP A 1 297 ? -16.625 -57.872 -11.356 1.00 80.81  ? 368 ASP A OD2  1 
ATOM   4505 H H    . ASP A 1 297 ? -15.898 -58.464 -15.158 1.00 73.05  ? 368 ASP A H    1 
ATOM   4506 H HA   . ASP A 1 297 ? -18.508 -58.610 -14.862 1.00 74.07  ? 368 ASP A HA   1 
ATOM   4507 H HB2  . ASP A 1 297 ? -18.109 -59.323 -12.739 1.00 82.73  ? 368 ASP A HB2  1 
ATOM   4508 H HB3  . ASP A 1 297 ? -16.967 -59.964 -13.640 1.00 82.73  ? 368 ASP A HB3  1 
ATOM   4509 N N    . GLN A 1 298 ? -17.183 -55.885 -13.940 1.00 57.49  ? 369 GLN A N    1 
ATOM   4510 C CA   . GLN A 1 298 ? -17.527 -54.526 -13.531 1.00 55.17  ? 369 GLN A CA   1 
ATOM   4511 C C    . GLN A 1 298 ? -18.275 -53.785 -14.633 1.00 55.08  ? 369 GLN A C    1 
ATOM   4512 O O    . GLN A 1 298 ? -19.190 -53.003 -14.345 1.00 55.41  ? 369 GLN A O    1 
ATOM   4513 C CB   . GLN A 1 298 ? -16.265 -53.772 -13.114 1.00 54.62  ? 369 GLN A CB   1 
ATOM   4514 C CG   . GLN A 1 298 ? -15.613 -54.388 -11.886 1.00 56.33  ? 369 GLN A CG   1 
ATOM   4515 C CD   . GLN A 1 298 ? -14.325 -53.715 -11.493 1.00 57.17  ? 369 GLN A CD   1 
ATOM   4516 O OE1  . GLN A 1 298 ? -13.527 -53.334 -12.342 1.00 54.25  ? 369 GLN A OE1  1 
ATOM   4517 N NE2  . GLN A 1 298 ? -14.115 -53.557 -10.189 1.00 60.76  ? 369 GLN A NE2  1 
ATOM   4518 H H    . GLN A 1 298 ? -16.364 -55.994 -14.179 1.00 68.99  ? 369 GLN A H    1 
ATOM   4519 H HA   . GLN A 1 298 ? -18.111 -54.572 -12.758 1.00 66.20  ? 369 GLN A HA   1 
ATOM   4520 H HB2  . GLN A 1 298 ? -15.624 -53.797 -13.842 1.00 65.55  ? 369 GLN A HB2  1 
ATOM   4521 H HB3  . GLN A 1 298 ? -16.497 -52.854 -12.905 1.00 65.55  ? 369 GLN A HB3  1 
ATOM   4522 H HG2  . GLN A 1 298 ? -16.226 -54.319 -11.138 1.00 67.59  ? 369 GLN A HG2  1 
ATOM   4523 H HG3  . GLN A 1 298 ? -15.418 -55.321 -12.068 1.00 67.59  ? 369 GLN A HG3  1 
ATOM   4524 H HE21 . GLN A 1 298 ? -14.700 -53.834 -9.623  1.00 72.91  ? 369 GLN A HE21 1 
ATOM   4525 H HE22 . GLN A 1 298 ? -13.394 -53.178 -9.912  1.00 72.91  ? 369 GLN A HE22 1 
ATOM   4526 N N    . ILE A 1 299 ? -17.918 -54.023 -15.900 1.00 52.80  ? 370 ILE A N    1 
ATOM   4527 C CA   . ILE A 1 299 ? -18.743 -53.531 -17.000 1.00 51.99  ? 370 ILE A CA   1 
ATOM   4528 C C    . ILE A 1 299 ? -20.159 -54.070 -16.868 1.00 52.10  ? 370 ILE A C    1 
ATOM   4529 O O    . ILE A 1 299 ? -21.134 -53.391 -17.204 1.00 49.12  ? 370 ILE A O    1 
ATOM   4530 C CB   . ILE A 1 299 ? -18.116 -53.917 -18.352 1.00 53.97  ? 370 ILE A CB   1 
ATOM   4531 C CG1  . ILE A 1 299 ? -16.888 -53.055 -18.662 1.00 55.26  ? 370 ILE A CG1  1 
ATOM   4532 C CG2  . ILE A 1 299 ? -19.109 -53.758 -19.475 1.00 52.97  ? 370 ILE A CG2  1 
ATOM   4533 C CD1  . ILE A 1 299 ? -16.020 -53.605 -19.812 1.00 57.49  ? 370 ILE A CD1  1 
ATOM   4534 H H    . ILE A 1 299 ? -17.217 -54.458 -16.142 1.00 63.36  ? 370 ILE A H    1 
ATOM   4535 H HA   . ILE A 1 299 ? -18.785 -52.563 -16.955 1.00 62.38  ? 370 ILE A HA   1 
ATOM   4536 H HB   . ILE A 1 299 ? -17.840 -54.846 -18.311 1.00 64.76  ? 370 ILE A HB   1 
ATOM   4537 H HG12 . ILE A 1 299 ? -17.185 -52.166 -18.913 1.00 66.31  ? 370 ILE A HG12 1 
ATOM   4538 H HG13 . ILE A 1 299 ? -16.332 -53.005 -17.868 1.00 66.31  ? 370 ILE A HG13 1 
ATOM   4539 H HG21 . ILE A 1 299 ? -18.639 -53.758 -20.322 1.00 63.56  ? 370 ILE A HG21 1 
ATOM   4540 H HG22 . ILE A 1 299 ? -19.737 -54.497 -19.452 1.00 63.56  ? 370 ILE A HG22 1 
ATOM   4541 H HG23 . ILE A 1 299 ? -19.580 -52.918 -19.361 1.00 63.56  ? 370 ILE A HG23 1 
ATOM   4542 H HD11 . ILE A 1 299 ? -15.163 -53.151 -19.804 1.00 68.99  ? 370 ILE A HD11 1 
ATOM   4543 H HD12 . ILE A 1 299 ? -15.891 -54.557 -19.681 1.00 68.99  ? 370 ILE A HD12 1 
ATOM   4544 H HD13 . ILE A 1 299 ? -16.470 -53.445 -20.656 1.00 68.99  ? 370 ILE A HD13 1 
ATOM   4545 N N    . GLN A 1 300 ? -20.294 -55.304 -16.383 1.00 56.52  ? 371 GLN A N    1 
ATOM   4546 C CA   . GLN A 1 300 ? -21.607 -55.924 -16.301 1.00 56.79  ? 371 GLN A CA   1 
ATOM   4547 C C    . GLN A 1 300 ? -22.469 -55.251 -15.245 1.00 54.84  ? 371 GLN A C    1 
ATOM   4548 O O    . GLN A 1 300 ? -23.692 -55.147 -15.410 1.00 53.44  ? 371 GLN A O    1 
ATOM   4549 C CB   . GLN A 1 300 ? -21.455 -57.412 -16.000 1.00 57.91  ? 371 GLN A CB   1 
ATOM   4550 C CG   . GLN A 1 300 ? -22.748 -58.186 -16.084 1.00 59.87  ? 371 GLN A CG   1 
ATOM   4551 C CD   . GLN A 1 300 ? -23.397 -58.067 -17.444 1.00 62.39  ? 371 GLN A CD   1 
ATOM   4552 O OE1  . GLN A 1 300 ? -22.745 -58.230 -18.481 1.00 63.47  ? 371 GLN A OE1  1 
ATOM   4553 N NE2  . GLN A 1 300 ? -24.685 -57.768 -17.451 1.00 63.74  ? 371 GLN A NE2  1 
ATOM   4554 H H    . GLN A 1 300 ? -19.648 -55.795 -16.099 1.00 67.82  ? 371 GLN A H    1 
ATOM   4555 H HA   . GLN A 1 300 ? -22.051 -55.826 -17.157 1.00 68.15  ? 371 GLN A HA   1 
ATOM   4556 H HB2  . GLN A 1 300 ? -20.836 -57.798 -16.639 1.00 69.50  ? 371 GLN A HB2  1 
ATOM   4557 H HB3  . GLN A 1 300 ? -21.106 -57.515 -15.101 1.00 69.50  ? 371 GLN A HB3  1 
ATOM   4558 H HG2  . GLN A 1 300 ? -22.567 -59.124 -15.918 1.00 71.84  ? 371 GLN A HG2  1 
ATOM   4559 H HG3  . GLN A 1 300 ? -23.369 -57.844 -15.422 1.00 71.84  ? 371 GLN A HG3  1 
ATOM   4560 H HE21 . GLN A 1 300 ? -25.105 -57.655 -16.709 1.00 76.49  ? 371 GLN A HE21 1 
ATOM   4561 H HE22 . GLN A 1 300 ? -25.103 -57.686 -18.198 1.00 76.49  ? 371 GLN A HE22 1 
ATOM   4562 N N    . GLN A 1 301 ? -21.858 -54.778 -14.166 1.00 56.17  ? 372 GLN A N    1 
ATOM   4563 C CA   . GLN A 1 301 ? -22.620 -54.042 -13.170 1.00 56.46  ? 372 GLN A CA   1 
ATOM   4564 C C    . GLN A 1 301 ? -23.052 -52.682 -13.694 1.00 51.50  ? 372 GLN A C    1 
ATOM   4565 O O    . GLN A 1 301 ? -24.081 -52.149 -13.263 1.00 50.69  ? 372 GLN A O    1 
ATOM   4566 C CB   . GLN A 1 301 ? -21.793 -53.890 -11.901 1.00 62.49  ? 372 GLN A CB   1 
ATOM   4567 C CG   . GLN A 1 301 ? -21.246 -55.212 -11.424 1.00 68.86  ? 372 GLN A CG   1 
ATOM   4568 C CD   . GLN A 1 301 ? -20.863 -55.177 -9.989  1.00 74.60  ? 372 GLN A CD   1 
ATOM   4569 O OE1  . GLN A 1 301 ? -19.681 -55.292 -9.638  1.00 75.35  ? 372 GLN A OE1  1 
ATOM   4570 N NE2  . GLN A 1 301 ? -21.862 -55.017 -9.130  1.00 78.31  ? 372 GLN A NE2  1 
ATOM   4571 H H    . GLN A 1 301 ? -21.021 -54.867 -13.991 1.00 67.40  ? 372 GLN A H    1 
ATOM   4572 H HA   . GLN A 1 301 ? -23.419 -54.545 -12.949 1.00 67.76  ? 372 GLN A HA   1 
ATOM   4573 H HB2  . GLN A 1 301 ? -21.044 -53.299 -12.078 1.00 74.99  ? 372 GLN A HB2  1 
ATOM   4574 H HB3  . GLN A 1 301 ? -22.352 -53.521 -11.200 1.00 74.99  ? 372 GLN A HB3  1 
ATOM   4575 H HG2  . GLN A 1 301 ? -21.921 -55.899 -11.542 1.00 82.63  ? 372 GLN A HG2  1 
ATOM   4576 H HG3  . GLN A 1 301 ? -20.454 -55.428 -11.937 1.00 82.63  ? 372 GLN A HG3  1 
ATOM   4577 H HE21 . GLN A 1 301 ? -22.669 -54.941 -9.418  1.00 93.97  ? 372 GLN A HE21 1 
ATOM   4578 H HE22 . GLN A 1 301 ? -21.703 -54.989 -8.285  1.00 93.97  ? 372 GLN A HE22 1 
ATOM   4579 N N    . VAL A 1 302 ? -22.271 -52.093 -14.596 1.00 48.97  ? 373 VAL A N    1 
ATOM   4580 C CA   . VAL A 1 302 ? -22.724 -50.893 -15.294 1.00 46.86  ? 373 VAL A CA   1 
ATOM   4581 C C    . VAL A 1 302 ? -23.971 -51.209 -16.108 1.00 47.95  ? 373 VAL A C    1 
ATOM   4582 O O    . VAL A 1 302 ? -24.937 -50.440 -16.130 1.00 47.37  ? 373 VAL A O    1 
ATOM   4583 C CB   . VAL A 1 302 ? -21.591 -50.344 -16.178 1.00 48.17  ? 373 VAL A CB   1 
ATOM   4584 C CG1  . VAL A 1 302 ? -22.070 -49.219 -17.021 1.00 47.54  ? 373 VAL A CG1  1 
ATOM   4585 C CG2  . VAL A 1 302 ? -20.397 -49.889 -15.306 1.00 49.01  ? 373 VAL A CG2  1 
ATOM   4586 H H    . VAL A 1 302 ? -21.486 -52.363 -14.820 1.00 58.77  ? 373 VAL A H    1 
ATOM   4587 H HA   . VAL A 1 302 ? -22.954 -50.213 -14.641 1.00 56.23  ? 373 VAL A HA   1 
ATOM   4588 H HB   . VAL A 1 302 ? -21.280 -51.047 -16.768 1.00 57.80  ? 373 VAL A HB   1 
ATOM   4589 H HG11 . VAL A 1 302 ? -21.302 -48.753 -17.387 1.00 57.05  ? 373 VAL A HG11 1 
ATOM   4590 H HG12 . VAL A 1 302 ? -22.617 -49.569 -17.742 1.00 57.05  ? 373 VAL A HG12 1 
ATOM   4591 H HG13 . VAL A 1 302 ? -22.591 -48.613 -16.471 1.00 57.05  ? 373 VAL A HG13 1 
ATOM   4592 H HG21 . VAL A 1 302 ? -19.699 -49.541 -15.883 1.00 58.81  ? 373 VAL A HG21 1 
ATOM   4593 H HG22 . VAL A 1 302 ? -20.698 -49.197 -14.696 1.00 58.81  ? 373 VAL A HG22 1 
ATOM   4594 H HG23 . VAL A 1 302 ? -20.064 -50.650 -14.805 1.00 58.81  ? 373 VAL A HG23 1 
ATOM   4595 N N    . VAL A 1 303 ? -23.963 -52.352 -16.787 1.00 48.11  ? 374 VAL A N    1 
ATOM   4596 C CA   . VAL A 1 303 ? -25.115 -52.780 -17.563 1.00 49.94  ? 374 VAL A CA   1 
ATOM   4597 C C    . VAL A 1 303 ? -26.316 -53.001 -16.654 1.00 49.02  ? 374 VAL A C    1 
ATOM   4598 O O    . VAL A 1 303 ? -27.415 -52.507 -16.926 1.00 47.93  ? 374 VAL A O    1 
ATOM   4599 C CB   . VAL A 1 303 ? -24.751 -54.045 -18.358 1.00 54.25  ? 374 VAL A CB   1 
ATOM   4600 C CG1  . VAL A 1 303 ? -25.983 -54.683 -18.966 1.00 56.67  ? 374 VAL A CG1  1 
ATOM   4601 C CG2  . VAL A 1 303 ? -23.746 -53.681 -19.444 1.00 54.55  ? 374 VAL A CG2  1 
ATOM   4602 H H    . VAL A 1 303 ? -23.299 -52.898 -16.813 1.00 57.74  ? 374 VAL A H    1 
ATOM   4603 H HA   . VAL A 1 303 ? -25.344 -52.083 -18.198 1.00 59.93  ? 374 VAL A HA   1 
ATOM   4604 H HB   . VAL A 1 303 ? -24.336 -54.689 -17.764 1.00 65.10  ? 374 VAL A HB   1 
ATOM   4605 H HG11 . VAL A 1 303 ? -25.706 -55.306 -19.656 1.00 68.01  ? 374 VAL A HG11 1 
ATOM   4606 H HG12 . VAL A 1 303 ? -26.472 -55.155 -18.274 1.00 68.01  ? 374 VAL A HG12 1 
ATOM   4607 H HG13 . VAL A 1 303 ? -26.539 -53.989 -19.354 1.00 68.01  ? 374 VAL A HG13 1 
ATOM   4608 H HG21 . VAL A 1 303 ? -23.526 -54.479 -19.950 1.00 65.46  ? 374 VAL A HG21 1 
ATOM   4609 H HG22 . VAL A 1 303 ? -24.141 -53.016 -20.029 1.00 65.46  ? 374 VAL A HG22 1 
ATOM   4610 H HG23 . VAL A 1 303 ? -22.947 -53.322 -19.027 1.00 65.46  ? 374 VAL A HG23 1 
ATOM   4611 N N    . ASN A 1 304 ? -26.115 -53.731 -15.550 1.00 49.77  ? 375 ASN A N    1 
ATOM   4612 C CA   . ASN A 1 304 ? -27.223 -54.137 -14.690 1.00 52.60  ? 375 ASN A CA   1 
ATOM   4613 C C    . ASN A 1 304 ? -27.830 -52.962 -13.942 1.00 48.19  ? 375 ASN A C    1 
ATOM   4614 O O    . ASN A 1 304 ? -29.015 -53.002 -13.609 1.00 48.58  ? 375 ASN A O    1 
ATOM   4615 C CB   . ASN A 1 304 ? -26.763 -55.183 -13.674 1.00 59.47  ? 375 ASN A CB   1 
ATOM   4616 C CG   . ASN A 1 304 ? -26.226 -56.435 -14.322 1.00 64.78  ? 375 ASN A CG   1 
ATOM   4617 O OD1  . ASN A 1 304 ? -26.626 -56.814 -15.426 1.00 63.00  ? 375 ASN A OD1  1 
ATOM   4618 N ND2  . ASN A 1 304 ? -25.307 -57.090 -13.631 1.00 70.35  ? 375 ASN A ND2  1 
ATOM   4619 H H    . ASN A 1 304 ? -25.344 -54.002 -15.281 1.00 59.72  ? 375 ASN A H    1 
ATOM   4620 H HA   . ASN A 1 304 ? -27.918 -54.535 -15.237 1.00 63.13  ? 375 ASN A HA   1 
ATOM   4621 H HB2  . ASN A 1 304 ? -26.058 -54.803 -13.127 1.00 71.36  ? 375 ASN A HB2  1 
ATOM   4622 H HB3  . ASN A 1 304 ? -27.516 -55.434 -13.116 1.00 71.36  ? 375 ASN A HB3  1 
ATOM   4623 H HD21 . ASN A 1 304 ? -24.972 -57.818 -13.943 1.00 84.42  ? 375 ASN A HD21 1 
ATOM   4624 H HD22 . ASN A 1 304 ? -25.045 -56.788 -12.870 1.00 84.42  ? 375 ASN A HD22 1 
ATOM   4625 N N    . HIS A 1 305 ? -27.046 -51.933 -13.640 1.00 46.50  ? 376 HIS A N    1 
ATOM   4626 C CA   . HIS A 1 305 ? -27.597 -50.717 -13.060 1.00 46.55  ? 376 HIS A CA   1 
ATOM   4627 C C    . HIS A 1 305 ? -28.232 -49.805 -14.111 1.00 47.12  ? 376 HIS A C    1 
ATOM   4628 O O    . HIS A 1 305 ? -28.548 -48.655 -13.800 1.00 45.09  ? 376 HIS A O    1 
ATOM   4629 C CB   . HIS A 1 305 ? -26.514 -49.947 -12.296 1.00 49.38  ? 376 HIS A CB   1 
ATOM   4630 C CG   . HIS A 1 305 ? -26.183 -50.539 -10.961 1.00 55.28  ? 376 HIS A CG   1 
ATOM   4631 N ND1  . HIS A 1 305 ? -25.547 -51.756 -10.823 1.00 60.58  ? 376 HIS A ND1  1 
ATOM   4632 C CD2  . HIS A 1 305 ? -26.403 -50.085 -9.705  1.00 56.63  ? 376 HIS A CD2  1 
ATOM   4633 C CE1  . HIS A 1 305 ? -25.390 -52.026 -9.540  1.00 62.44  ? 376 HIS A CE1  1 
ATOM   4634 N NE2  . HIS A 1 305 ? -25.903 -51.029 -8.840  1.00 60.06  ? 376 HIS A NE2  1 
ATOM   4635 H H    . HIS A 1 305 ? -26.195 -51.914 -13.761 1.00 55.80  ? 376 HIS A H    1 
ATOM   4636 H HA   . HIS A 1 305 ? -28.288 -50.961 -12.425 1.00 55.85  ? 376 HIS A HA   1 
ATOM   4637 H HB2  . HIS A 1 305 ? -25.702 -49.940 -12.827 1.00 59.25  ? 376 HIS A HB2  1 
ATOM   4638 H HB3  . HIS A 1 305 ? -26.818 -49.038 -12.148 1.00 59.25  ? 376 HIS A HB3  1 
ATOM   4639 H HD1  . HIS A 1 305 ? -25.293 -52.261 -11.472 1.00 72.70  ? 376 HIS A HD1  1 
ATOM   4640 H HD2  . HIS A 1 305 ? -26.818 -49.286 -9.471  1.00 67.96  ? 376 HIS A HD2  1 
ATOM   4641 H HE1  . HIS A 1 305 ? -24.988 -52.788 -9.189  1.00 74.93  ? 376 HIS A HE1  1 
ATOM   4642 N N    . GLY A 1 306 ? -28.400 -50.278 -15.343 1.00 49.01  ? 377 GLY A N    1 
ATOM   4643 C CA   . GLY A 1 306 ? -29.109 -49.515 -16.354 1.00 49.57  ? 377 GLY A CA   1 
ATOM   4644 C C    . GLY A 1 306 ? -28.435 -48.226 -16.753 1.00 48.26  ? 377 GLY A C    1 
ATOM   4645 O O    . GLY A 1 306 ? -29.121 -47.276 -17.132 1.00 48.35  ? 377 GLY A O    1 
ATOM   4646 H H    . GLY A 1 306 ? -28.110 -51.039 -15.618 1.00 58.81  ? 377 GLY A H    1 
ATOM   4647 H HA2  . GLY A 1 306 ? -29.209 -50.061 -17.150 1.00 59.48  ? 377 GLY A HA2  1 
ATOM   4648 H HA3  . GLY A 1 306 ? -29.995 -49.300 -16.023 1.00 59.48  ? 377 GLY A HA3  1 
ATOM   4649 N N    . LEU A 1 307 ? -27.101 -48.168 -16.707 1.00 46.32  ? 378 LEU A N    1 
ATOM   4650 C CA   . LEU A 1 307 ? -26.409 -46.911 -16.955 1.00 45.61  ? 378 LEU A CA   1 
ATOM   4651 C C    . LEU A 1 307 ? -26.067 -46.680 -18.420 1.00 43.95  ? 378 LEU A C    1 
ATOM   4652 O O    . LEU A 1 307 ? -25.853 -45.523 -18.809 1.00 43.87  ? 378 LEU A O    1 
ATOM   4653 C CB   . LEU A 1 307 ? -25.132 -46.838 -16.105 1.00 48.13  ? 378 LEU A CB   1 
ATOM   4654 C CG   . LEU A 1 307 ? -25.296 -46.632 -14.591 1.00 52.13  ? 378 LEU A CG   1 
ATOM   4655 C CD1  . LEU A 1 307 ? -23.934 -46.731 -13.909 1.00 53.92  ? 378 LEU A CD1  1 
ATOM   4656 C CD2  . LEU A 1 307 ? -25.939 -45.294 -14.283 1.00 52.54  ? 378 LEU A CD2  1 
ATOM   4657 H H    . LEU A 1 307 ? -26.585 -48.834 -16.537 1.00 55.58  ? 378 LEU A H    1 
ATOM   4658 H HA   . LEU A 1 307 ? -26.986 -46.183 -16.677 1.00 54.73  ? 378 LEU A HA   1 
ATOM   4659 H HB2  . LEU A 1 307 ? -24.645 -47.668 -16.227 1.00 57.75  ? 378 LEU A HB2  1 
ATOM   4660 H HB3  . LEU A 1 307 ? -24.594 -46.102 -16.435 1.00 57.75  ? 378 LEU A HB3  1 
ATOM   4661 H HG   . LEU A 1 307 ? -25.865 -47.331 -14.234 1.00 62.55  ? 378 LEU A HG   1 
ATOM   4662 H HD11 . LEU A 1 307 ? -24.050 -46.611 -12.953 1.00 64.70  ? 378 LEU A HD11 1 
ATOM   4663 H HD12 . LEU A 1 307 ? -23.554 -47.605 -14.090 1.00 64.70  ? 378 LEU A HD12 1 
ATOM   4664 H HD13 . LEU A 1 307 ? -23.354 -46.038 -14.261 1.00 64.70  ? 378 LEU A HD13 1 
ATOM   4665 H HD21 . LEU A 1 307 ? -25.906 -45.144 -13.326 1.00 63.04  ? 378 LEU A HD21 1 
ATOM   4666 H HD22 . LEU A 1 307 ? -25.450 -44.595 -14.745 1.00 63.04  ? 378 LEU A HD22 1 
ATOM   4667 H HD23 . LEU A 1 307 ? -26.860 -45.309 -14.586 1.00 63.04  ? 378 LEU A HD23 1 
ATOM   4668 N N    . VAL A 1 308 ? -26.025 -47.729 -19.252 1.00 43.06  ? 379 VAL A N    1 
ATOM   4669 C CA   . VAL A 1 308 ? -25.685 -47.532 -20.663 1.00 44.08  ? 379 VAL A CA   1 
ATOM   4670 C C    . VAL A 1 308 ? -26.621 -46.534 -21.329 1.00 43.20  ? 379 VAL A C    1 
ATOM   4671 O O    . VAL A 1 308 ? -26.129 -45.604 -21.988 1.00 45.12  ? 379 VAL A O    1 
ATOM   4672 C CB   . VAL A 1 308 ? -25.659 -48.879 -21.406 1.00 46.04  ? 379 VAL A CB   1 
ATOM   4673 C CG1  . VAL A 1 308 ? -25.407 -48.629 -22.892 1.00 48.41  ? 379 VAL A CG1  1 
ATOM   4674 C CG2  . VAL A 1 308 ? -24.606 -49.807 -20.845 1.00 45.02  ? 379 VAL A CG2  1 
ATOM   4675 H H    . VAL A 1 308 ? -26.185 -48.544 -19.029 1.00 51.67  ? 379 VAL A H    1 
ATOM   4676 H HA   . VAL A 1 308 ? -24.790 -47.161 -20.710 1.00 52.89  ? 379 VAL A HA   1 
ATOM   4677 H HB   . VAL A 1 308 ? -26.515 -49.320 -21.318 1.00 55.25  ? 379 VAL A HB   1 
ATOM   4678 H HG11 . VAL A 1 308 ? -25.121 -49.459 -23.306 1.00 58.09  ? 379 VAL A HG11 1 
ATOM   4679 H HG12 . VAL A 1 308 ? -26.227 -48.320 -23.307 1.00 58.09  ? 379 VAL A HG12 1 
ATOM   4680 H HG13 . VAL A 1 308 ? -24.713 -47.958 -22.986 1.00 58.09  ? 379 VAL A HG13 1 
ATOM   4681 H HG21 . VAL A 1 308 ? -24.609 -50.632 -21.355 1.00 54.02  ? 379 VAL A HG21 1 
ATOM   4682 H HG22 . VAL A 1 308 ? -23.739 -49.378 -20.914 1.00 54.02  ? 379 VAL A HG22 1 
ATOM   4683 H HG23 . VAL A 1 308 ? -24.811 -49.992 -19.915 1.00 54.02  ? 379 VAL A HG23 1 
ATOM   4684 N N    . PRO A 1 309 ? -27.944 -46.663 -21.229 1.00 43.56  ? 380 PRO A N    1 
ATOM   4685 C CA   . PRO A 1 309 ? -28.808 -45.645 -21.838 1.00 43.46  ? 380 PRO A CA   1 
ATOM   4686 C C    . PRO A 1 309 ? -28.498 -44.241 -21.369 1.00 46.02  ? 380 PRO A C    1 
ATOM   4687 O O    . PRO A 1 309 ? -28.695 -43.296 -22.135 1.00 45.63  ? 380 PRO A O    1 
ATOM   4688 C CB   . PRO A 1 309 ? -30.228 -46.090 -21.426 1.00 44.53  ? 380 PRO A CB   1 
ATOM   4689 C CG   . PRO A 1 309 ? -30.078 -47.575 -21.160 1.00 43.92  ? 380 PRO A CG   1 
ATOM   4690 C CD   . PRO A 1 309 ? -28.728 -47.714 -20.556 1.00 42.10  ? 380 PRO A CD   1 
ATOM   4691 H HA   . PRO A 1 309 ? -28.733 -45.680 -22.804 1.00 52.15  ? 380 PRO A HA   1 
ATOM   4692 H HB2  . PRO A 1 309 ? -30.502 -45.620 -20.623 1.00 53.43  ? 380 PRO A HB2  1 
ATOM   4693 H HB3  . PRO A 1 309 ? -30.849 -45.929 -22.153 1.00 53.43  ? 380 PRO A HB3  1 
ATOM   4694 H HG2  . PRO A 1 309 ? -30.764 -47.869 -20.541 1.00 52.70  ? 380 PRO A HG2  1 
ATOM   4695 H HG3  . PRO A 1 309 ? -30.134 -48.065 -21.995 1.00 52.70  ? 380 PRO A HG3  1 
ATOM   4696 H HD2  . PRO A 1 309 ? -28.767 -47.547 -19.601 1.00 50.52  ? 380 PRO A HD2  1 
ATOM   4697 H HD3  . PRO A 1 309 ? -28.371 -48.592 -20.747 1.00 50.52  ? 380 PRO A HD3  1 
ATOM   4698 N N    . PHE A 1 310 ? -28.000 -44.052 -20.149 1.00 48.27  ? 381 PHE A N    1 
ATOM   4699 C CA   . PHE A 1 310 ? -27.666 -42.686 -19.743 1.00 49.60  ? 381 PHE A CA   1 
ATOM   4700 C C    . PHE A 1 310 ? -26.356 -42.199 -20.355 1.00 50.24  ? 381 PHE A C    1 
ATOM   4701 O O    . PHE A 1 310 ? -26.225 -41.003 -20.638 1.00 50.43  ? 381 PHE A O    1 
ATOM   4702 C CB   . PHE A 1 310 ? -27.619 -42.563 -18.212 1.00 47.73  ? 381 PHE A CB   1 
ATOM   4703 C CG   . PHE A 1 310 ? -28.948 -42.763 -17.555 1.00 44.01  ? 381 PHE A CG   1 
ATOM   4704 C CD1  . PHE A 1 310 ? -29.777 -41.690 -17.310 1.00 43.22  ? 381 PHE A CD1  1 
ATOM   4705 C CD2  . PHE A 1 310 ? -29.369 -44.030 -17.193 1.00 42.43  ? 381 PHE A CD2  1 
ATOM   4706 C CE1  . PHE A 1 310 ? -30.990 -41.877 -16.703 1.00 44.90  ? 381 PHE A CE1  1 
ATOM   4707 C CE2  . PHE A 1 310 ? -30.577 -44.223 -16.594 1.00 44.13  ? 381 PHE A CE2  1 
ATOM   4708 C CZ   . PHE A 1 310 ? -31.396 -43.154 -16.347 1.00 45.70  ? 381 PHE A CZ   1 
ATOM   4709 H H    . PHE A 1 310 ? -27.851 -44.663 -19.563 1.00 57.93  ? 381 PHE A H    1 
ATOM   4710 H HA   . PHE A 1 310 ? -28.368 -42.094 -20.056 1.00 59.52  ? 381 PHE A HA   1 
ATOM   4711 H HB2  . PHE A 1 310 ? -27.011 -43.233 -17.862 1.00 57.27  ? 381 PHE A HB2  1 
ATOM   4712 H HB3  . PHE A 1 310 ? -27.302 -41.676 -17.978 1.00 57.27  ? 381 PHE A HB3  1 
ATOM   4713 H HD1  . PHE A 1 310 ? -29.506 -40.833 -17.547 1.00 51.86  ? 381 PHE A HD1  1 
ATOM   4714 H HD2  . PHE A 1 310 ? -28.817 -44.760 -17.357 1.00 50.92  ? 381 PHE A HD2  1 
ATOM   4715 H HE1  . PHE A 1 310 ? -31.545 -41.149 -16.539 1.00 53.88  ? 381 PHE A HE1  1 
ATOM   4716 H HE2  . PHE A 1 310 ? -30.846 -45.080 -16.354 1.00 52.96  ? 381 PHE A HE2  1 
ATOM   4717 H HZ   . PHE A 1 310 ? -32.221 -43.284 -15.938 1.00 54.84  ? 381 PHE A HZ   1 
ATOM   4718 N N    . LEU A 1 311 ? -25.386 -43.086 -20.584 1.00 48.24  ? 382 LEU A N    1 
ATOM   4719 C CA   . LEU A 1 311 ? -24.174 -42.665 -21.285 1.00 50.12  ? 382 LEU A CA   1 
ATOM   4720 C C    . LEU A 1 311 ? -24.473 -42.321 -22.738 1.00 49.47  ? 382 LEU A C    1 
ATOM   4721 O O    . LEU A 1 311 ? -23.905 -41.369 -23.285 1.00 49.04  ? 382 LEU A O    1 
ATOM   4722 C CB   . LEU A 1 311 ? -23.105 -43.747 -21.194 1.00 54.57  ? 382 LEU A CB   1 
ATOM   4723 C CG   . LEU A 1 311 ? -22.494 -43.903 -19.791 1.00 60.23  ? 382 LEU A CG   1 
ATOM   4724 C CD1  . LEU A 1 311 ? -21.696 -45.210 -19.668 1.00 65.11  ? 382 LEU A CD1  1 
ATOM   4725 C CD2  . LEU A 1 311 ? -21.608 -42.715 -19.442 1.00 60.50  ? 382 LEU A CD2  1 
ATOM   4726 H H    . LEU A 1 311 ? -25.403 -43.914 -20.351 1.00 57.88  ? 382 LEU A H    1 
ATOM   4727 H HA   . LEU A 1 311 ? -23.828 -41.866 -20.858 1.00 60.14  ? 382 LEU A HA   1 
ATOM   4728 H HB2  . LEU A 1 311 ? -23.500 -44.598 -21.441 1.00 65.49  ? 382 LEU A HB2  1 
ATOM   4729 H HB3  . LEU A 1 311 ? -22.386 -43.528 -21.807 1.00 65.49  ? 382 LEU A HB3  1 
ATOM   4730 H HG   . LEU A 1 311 ? -23.213 -43.935 -19.141 1.00 72.28  ? 382 LEU A HG   1 
ATOM   4731 H HD11 . LEU A 1 311 ? -21.330 -45.273 -18.772 1.00 78.13  ? 382 LEU A HD11 1 
ATOM   4732 H HD12 . LEU A 1 311 ? -22.289 -45.959 -19.837 1.00 78.13  ? 382 LEU A HD12 1 
ATOM   4733 H HD13 . LEU A 1 311 ? -20.977 -45.203 -20.320 1.00 78.13  ? 382 LEU A HD13 1 
ATOM   4734 H HD21 . LEU A 1 311 ? -21.148 -42.899 -18.608 1.00 72.60  ? 382 LEU A HD21 1 
ATOM   4735 H HD22 . LEU A 1 311 ? -20.962 -42.584 -20.154 1.00 72.60  ? 382 LEU A HD22 1 
ATOM   4736 H HD23 . LEU A 1 311 ? -22.161 -41.924 -19.347 1.00 72.60  ? 382 LEU A HD23 1 
ATOM   4737 N N    . VAL A 1 312 ? -25.370 -43.075 -23.377 1.00 50.77  ? 383 VAL A N    1 
ATOM   4738 C CA   . VAL A 1 312 ? -25.811 -42.723 -24.722 1.00 53.63  ? 383 VAL A CA   1 
ATOM   4739 C C    . VAL A 1 312 ? -26.477 -41.354 -24.717 1.00 51.71  ? 383 VAL A C    1 
ATOM   4740 O O    . VAL A 1 312 ? -26.225 -40.523 -25.596 1.00 53.75  ? 383 VAL A O    1 
ATOM   4741 C CB   . VAL A 1 312 ? -26.749 -43.816 -25.276 1.00 57.46  ? 383 VAL A CB   1 
ATOM   4742 C CG1  . VAL A 1 312 ? -27.303 -43.409 -26.626 1.00 61.91  ? 383 VAL A CG1  1 
ATOM   4743 C CG2  . VAL A 1 312 ? -26.015 -45.136 -25.396 1.00 56.05  ? 383 VAL A CG2  1 
ATOM   4744 H H    . VAL A 1 312 ? -25.733 -43.786 -23.056 1.00 60.93  ? 383 VAL A H    1 
ATOM   4745 H HA   . VAL A 1 312 ? -25.036 -42.674 -25.303 1.00 64.36  ? 383 VAL A HA   1 
ATOM   4746 H HB   . VAL A 1 312 ? -27.494 -43.937 -24.666 1.00 68.95  ? 383 VAL A HB   1 
ATOM   4747 H HG11 . VAL A 1 312 ? -27.700 -44.186 -27.050 1.00 74.30  ? 383 VAL A HG11 1 
ATOM   4748 H HG12 . VAL A 1 312 ? -27.976 -42.722 -26.500 1.00 74.30  ? 383 VAL A HG12 1 
ATOM   4749 H HG13 . VAL A 1 312 ? -26.579 -43.069 -27.175 1.00 74.30  ? 383 VAL A HG13 1 
ATOM   4750 H HG21 . VAL A 1 312 ? -26.617 -45.799 -25.768 1.00 67.26  ? 383 VAL A HG21 1 
ATOM   4751 H HG22 . VAL A 1 312 ? -25.250 -45.019 -25.980 1.00 67.26  ? 383 VAL A HG22 1 
ATOM   4752 H HG23 . VAL A 1 312 ? -25.719 -45.415 -24.515 1.00 67.26  ? 383 VAL A HG23 1 
ATOM   4753 N N    . GLY A 1 313 ? -27.338 -41.098 -23.727 1.00 46.19  ? 384 GLY A N    1 
ATOM   4754 C CA   . GLY A 1 313 ? -27.923 -39.767 -23.575 1.00 44.55  ? 384 GLY A CA   1 
ATOM   4755 C C    . GLY A 1 313 ? -26.879 -38.665 -23.492 1.00 43.87  ? 384 GLY A C    1 
ATOM   4756 O O    . GLY A 1 313 ? -26.947 -37.671 -24.221 1.00 44.96  ? 384 GLY A O    1 
ATOM   4757 H H    . GLY A 1 313 ? -27.595 -41.671 -23.139 1.00 55.43  ? 384 GLY A H    1 
ATOM   4758 H HA2  . GLY A 1 313 ? -28.502 -39.583 -24.331 1.00 53.46  ? 384 GLY A HA2  1 
ATOM   4759 H HA3  . GLY A 1 313 ? -28.458 -39.742 -22.766 1.00 53.46  ? 384 GLY A HA3  1 
ATOM   4760 N N    . VAL A 1 314 ? -25.892 -38.829 -22.601 1.00 43.83  ? 385 VAL A N    1 
ATOM   4761 C CA   . VAL A 1 314 ? -24.809 -37.849 -22.487 1.00 45.45  ? 385 VAL A CA   1 
ATOM   4762 C C    . VAL A 1 314 ? -24.134 -37.642 -23.840 1.00 47.49  ? 385 VAL A C    1 
ATOM   4763 O O    . VAL A 1 314 ? -23.939 -36.507 -24.294 1.00 47.90  ? 385 VAL A O    1 
ATOM   4764 C CB   . VAL A 1 314 ? -23.797 -38.297 -21.416 1.00 47.48  ? 385 VAL A CB   1 
ATOM   4765 C CG1  . VAL A 1 314 ? -22.545 -37.466 -21.477 1.00 48.90  ? 385 VAL A CG1  1 
ATOM   4766 C CG2  . VAL A 1 314 ? -24.399 -38.172 -20.051 1.00 47.16  ? 385 VAL A CG2  1 
ATOM   4767 H H    . VAL A 1 314 ? -25.829 -39.493 -22.058 1.00 52.59  ? 385 VAL A H    1 
ATOM   4768 H HA   . VAL A 1 314 ? -25.183 -36.999 -22.207 1.00 54.54  ? 385 VAL A HA   1 
ATOM   4769 H HB   . VAL A 1 314 ? -23.558 -39.225 -21.564 1.00 56.97  ? 385 VAL A HB   1 
ATOM   4770 H HG11 . VAL A 1 314 ? -22.021 -37.629 -20.677 1.00 58.67  ? 385 VAL A HG11 1 
ATOM   4771 H HG12 . VAL A 1 314 ? -22.033 -37.713 -22.262 1.00 58.67  ? 385 VAL A HG12 1 
ATOM   4772 H HG13 . VAL A 1 314 ? -22.793 -36.530 -21.523 1.00 58.67  ? 385 VAL A HG13 1 
ATOM   4773 H HG21 . VAL A 1 314 ? -23.756 -38.480 -19.393 1.00 56.59  ? 385 VAL A HG21 1 
ATOM   4774 H HG22 . VAL A 1 314 ? -24.620 -37.242 -19.888 1.00 56.59  ? 385 VAL A HG22 1 
ATOM   4775 H HG23 . VAL A 1 314 ? -25.201 -38.715 -20.009 1.00 56.59  ? 385 VAL A HG23 1 
ATOM   4776 N N    . LEU A 1 315 ? -23.764 -38.741 -24.498 1.00 49.90  ? 386 LEU A N    1 
ATOM   4777 C CA   . LEU A 1 315 ? -23.096 -38.645 -25.791 1.00 53.91  ? 386 LEU A CA   1 
ATOM   4778 C C    . LEU A 1 315 ? -23.951 -37.899 -26.805 1.00 57.14  ? 386 LEU A C    1 
ATOM   4779 O O    . LEU A 1 315 ? -23.416 -37.288 -27.740 1.00 58.75  ? 386 LEU A O    1 
ATOM   4780 C CB   . LEU A 1 315 ? -22.767 -40.046 -26.306 1.00 55.30  ? 386 LEU A CB   1 
ATOM   4781 C CG   . LEU A 1 315 ? -21.805 -40.179 -27.467 1.00 59.25  ? 386 LEU A CG   1 
ATOM   4782 C CD1  . LEU A 1 315 ? -20.399 -39.862 -27.042 1.00 59.40  ? 386 LEU A CD1  1 
ATOM   4783 C CD2  . LEU A 1 315 ? -21.886 -41.595 -28.007 1.00 61.86  ? 386 LEU A CD2  1 
ATOM   4784 H H    . LEU A 1 315 ? -23.888 -39.545 -24.219 1.00 59.88  ? 386 LEU A H    1 
ATOM   4785 H HA   . LEU A 1 315 ? -22.264 -38.159 -25.683 1.00 64.69  ? 386 LEU A HA   1 
ATOM   4786 H HB2  . LEU A 1 315 ? -22.389 -40.551 -25.569 1.00 66.36  ? 386 LEU A HB2  1 
ATOM   4787 H HB3  . LEU A 1 315 ? -23.599 -40.462 -26.579 1.00 66.36  ? 386 LEU A HB3  1 
ATOM   4788 H HG   . LEU A 1 315 ? -22.060 -39.564 -28.173 1.00 71.10  ? 386 LEU A HG   1 
ATOM   4789 H HD11 . LEU A 1 315 ? -19.805 -39.993 -27.797 1.00 71.28  ? 386 LEU A HD11 1 
ATOM   4790 H HD12 . LEU A 1 315 ? -20.359 -38.939 -26.746 1.00 71.28  ? 386 LEU A HD12 1 
ATOM   4791 H HD13 . LEU A 1 315 ? -20.148 -40.455 -26.316 1.00 71.28  ? 386 LEU A HD13 1 
ATOM   4792 H HD21 . LEU A 1 315 ? -21.369 -41.645 -28.826 1.00 74.23  ? 386 LEU A HD21 1 
ATOM   4793 H HD22 . LEU A 1 315 ? -21.524 -42.207 -27.347 1.00 74.23  ? 386 LEU A HD22 1 
ATOM   4794 H HD23 . LEU A 1 315 ? -22.813 -41.813 -28.190 1.00 74.23  ? 386 LEU A HD23 1 
ATOM   4795 N N    . SER A 1 316 ? -25.274 -37.929 -26.638 1.00 58.02  ? 387 SER A N    1 
ATOM   4796 C CA   . SER A 1 316 ? -26.159 -37.333 -27.632 1.00 60.13  ? 387 SER A CA   1 
ATOM   4797 C C    . SER A 1 316 ? -26.449 -35.871 -27.352 1.00 62.78  ? 387 SER A C    1 
ATOM   4798 O O    . SER A 1 316 ? -26.501 -35.070 -28.286 1.00 67.53  ? 387 SER A O    1 
ATOM   4799 C CB   . SER A 1 316 ? -27.487 -38.093 -27.695 1.00 60.65  ? 387 SER A CB   1 
ATOM   4800 O OG   . SER A 1 316 ? -27.279 -39.439 -28.072 1.00 61.12  ? 387 SER A OG   1 
ATOM   4801 H H    . SER A 1 316 ? -25.678 -38.284 -25.967 1.00 69.63  ? 387 SER A H    1 
ATOM   4802 H HA   . SER A 1 316 ? -25.740 -37.393 -28.505 1.00 72.16  ? 387 SER A HA   1 
ATOM   4803 H HB2  . SER A 1 316 ? -27.905 -38.071 -26.820 1.00 72.78  ? 387 SER A HB2  1 
ATOM   4804 H HB3  . SER A 1 316 ? -28.064 -37.668 -28.349 1.00 72.78  ? 387 SER A HB3  1 
ATOM   4805 H HG   . SER A 1 316 ? -26.780 -39.820 -27.514 1.00 73.34  ? 387 SER A HG   1 
ATOM   4806 N N    . LYS A 1 317 ? -26.622 -35.509 -26.083 1.00 58.01  ? 388 LYS A N    1 
ATOM   4807 C CA   . LYS A 1 317 ? -27.252 -34.255 -25.713 1.00 60.90  ? 388 LYS A CA   1 
ATOM   4808 C C    . LYS A 1 317 ? -26.375 -33.325 -24.897 1.00 60.07  ? 388 LYS A C    1 
ATOM   4809 O O    . LYS A 1 317 ? -26.755 -32.167 -24.697 1.00 65.21  ? 388 LYS A O    1 
ATOM   4810 C CB   . LYS A 1 317 ? -28.530 -34.529 -24.906 1.00 64.50  ? 388 LYS A CB   1 
ATOM   4811 C CG   . LYS A 1 317 ? -29.362 -35.684 -25.456 1.00 67.48  ? 388 LYS A CG   1 
ATOM   4812 C CD   . LYS A 1 317 ? -30.737 -35.715 -24.848 1.00 70.13  ? 388 LYS A CD   1 
ATOM   4813 C CE   . LYS A 1 317 ? -30.717 -36.320 -23.460 1.00 72.41  ? 388 LYS A CE   1 
ATOM   4814 N NZ   . LYS A 1 317 ? -32.011 -36.073 -22.757 1.00 74.99  ? 388 LYS A NZ   1 
ATOM   4815 H H    . LYS A 1 317 ? -26.377 -35.984 -25.410 1.00 69.61  ? 388 LYS A H    1 
ATOM   4816 H HA   . LYS A 1 317 ? -27.509 -33.783 -26.520 1.00 73.08  ? 388 LYS A HA   1 
ATOM   4817 H HB2  . LYS A 1 317 ? -28.283 -34.748 -23.994 1.00 77.40  ? 388 LYS A HB2  1 
ATOM   4818 H HB3  . LYS A 1 317 ? -29.082 -33.732 -24.916 1.00 77.40  ? 388 LYS A HB3  1 
ATOM   4819 H HG2  . LYS A 1 317 ? -29.457 -35.581 -26.416 1.00 80.97  ? 388 LYS A HG2  1 
ATOM   4820 H HG3  . LYS A 1 317 ? -28.921 -36.523 -25.250 1.00 80.97  ? 388 LYS A HG3  1 
ATOM   4821 H HD2  . LYS A 1 317 ? -31.080 -34.810 -24.780 1.00 84.16  ? 388 LYS A HD2  1 
ATOM   4822 H HD3  . LYS A 1 317 ? -31.320 -36.254 -25.405 1.00 84.16  ? 388 LYS A HD3  1 
ATOM   4823 H HE2  . LYS A 1 317 ? -30.583 -37.278 -23.528 1.00 86.90  ? 388 LYS A HE2  1 
ATOM   4824 H HE3  . LYS A 1 317 ? -30.005 -35.915 -22.941 1.00 86.90  ? 388 LYS A HE3  1 
ATOM   4825 H HZ1  . LYS A 1 317 ? -31.988 -36.432 -21.943 1.00 89.98  ? 388 LYS A HZ1  1 
ATOM   4826 H HZ2  . LYS A 1 317 ? -32.154 -35.198 -22.683 1.00 89.98  ? 388 LYS A HZ2  1 
ATOM   4827 H HZ3  . LYS A 1 317 ? -32.681 -36.438 -23.216 1.00 89.98  ? 388 LYS A HZ3  1 
ATOM   4828 N N    . ALA A 1 318 ? -25.238 -33.786 -24.403 1.00 55.71  ? 389 ALA A N    1 
ATOM   4829 C CA   . ALA A 1 318 ? -24.443 -32.969 -23.507 1.00 51.05  ? 389 ALA A CA   1 
ATOM   4830 C C    . ALA A 1 318 ? -23.576 -31.978 -24.296 1.00 53.66  ? 389 ALA A C    1 
ATOM   4831 O O    . ALA A 1 318 ? -23.512 -32.001 -25.532 1.00 52.37  ? 389 ALA A O    1 
ATOM   4832 C CB   . ALA A 1 318 ? -23.588 -33.868 -22.618 1.00 47.04  ? 389 ALA A CB   1 
ATOM   4833 H H    . ALA A 1 318 ? -24.907 -34.562 -24.569 1.00 66.86  ? 389 ALA A H    1 
ATOM   4834 H HA   . ALA A 1 318 ? -25.036 -32.458 -22.934 1.00 61.26  ? 389 ALA A HA   1 
ATOM   4835 H HB1  . ALA A 1 318 ? -23.062 -33.313 -22.021 1.00 56.45  ? 389 ALA A HB1  1 
ATOM   4836 H HB2  . ALA A 1 318 ? -24.170 -34.448 -22.104 1.00 56.45  ? 389 ALA A HB2  1 
ATOM   4837 H HB3  . ALA A 1 318 ? -23.001 -34.400 -23.178 1.00 56.45  ? 389 ALA A HB3  1 
ATOM   4838 N N    . ASP A 1 319 ? -22.924 -31.079 -23.560 1.00 61.20  ? 390 ASP A N    1 
ATOM   4839 C CA   . ASP A 1 319 ? -21.951 -30.165 -24.142 1.00 67.95  ? 390 ASP A CA   1 
ATOM   4840 C C    . ASP A 1 319 ? -20.756 -30.954 -24.679 1.00 67.01  ? 390 ASP A C    1 
ATOM   4841 O O    . ASP A 1 319 ? -20.539 -32.117 -24.327 1.00 67.63  ? 390 ASP A O    1 
ATOM   4842 C CB   . ASP A 1 319 ? -21.498 -29.132 -23.103 1.00 75.18  ? 390 ASP A CB   1 
ATOM   4843 C CG   . ASP A 1 319 ? -20.855 -29.774 -21.861 1.00 80.69  ? 390 ASP A CG   1 
ATOM   4844 O OD1  . ASP A 1 319 ? -21.581 -30.430 -21.074 1.00 84.23  ? 390 ASP A OD1  1 
ATOM   4845 O OD2  . ASP A 1 319 ? -19.630 -29.609 -21.656 1.00 81.56  ? 390 ASP A OD2  1 
ATOM   4846 H H    . ASP A 1 319 ? -23.031 -30.980 -22.713 1.00 73.44  ? 390 ASP A H    1 
ATOM   4847 H HA   . ASP A 1 319 ? -22.360 -29.691 -24.883 1.00 81.55  ? 390 ASP A HA   1 
ATOM   4848 H HB2  . ASP A 1 319 ? -20.843 -28.543 -23.509 1.00 90.21  ? 390 ASP A HB2  1 
ATOM   4849 H HB3  . ASP A 1 319 ? -22.268 -28.620 -22.811 1.00 90.21  ? 390 ASP A HB3  1 
ATOM   4850 N N    . PHE A 1 320 ? -19.965 -30.305 -25.535 1.00 64.33  ? 391 PHE A N    1 
ATOM   4851 C CA   . PHE A 1 320 ? -18.931 -31.041 -26.256 1.00 64.20  ? 391 PHE A CA   1 
ATOM   4852 C C    . PHE A 1 320 ? -17.883 -31.627 -25.319 1.00 61.88  ? 391 PHE A C    1 
ATOM   4853 O O    . PHE A 1 320 ? -17.386 -32.731 -25.559 1.00 60.68  ? 391 PHE A O    1 
ATOM   4854 C CB   . PHE A 1 320 ? -18.250 -30.159 -27.293 1.00 70.25  ? 391 PHE A CB   1 
ATOM   4855 C CG   . PHE A 1 320 ? -17.279 -30.915 -28.149 1.00 77.12  ? 391 PHE A CG   1 
ATOM   4856 C CD1  . PHE A 1 320 ? -17.730 -31.862 -29.057 1.00 77.78  ? 391 PHE A CD1  1 
ATOM   4857 C CD2  . PHE A 1 320 ? -15.918 -30.714 -28.018 1.00 84.43  ? 391 PHE A CD2  1 
ATOM   4858 C CE1  . PHE A 1 320 ? -16.842 -32.575 -29.833 1.00 82.79  ? 391 PHE A CE1  1 
ATOM   4859 C CE2  . PHE A 1 320 ? -15.018 -31.425 -28.792 1.00 89.36  ? 391 PHE A CE2  1 
ATOM   4860 C CZ   . PHE A 1 320 ? -15.481 -32.358 -29.703 1.00 88.29  ? 391 PHE A CZ   1 
ATOM   4861 H H    . PHE A 1 320 ? -20.005 -29.464 -25.711 1.00 77.19  ? 391 PHE A H    1 
ATOM   4862 H HA   . PHE A 1 320 ? -19.346 -31.779 -26.726 1.00 77.04  ? 391 PHE A HA   1 
ATOM   4863 H HB2  . PHE A 1 320 ? -18.925 -29.774 -27.873 1.00 84.30  ? 391 PHE A HB2  1 
ATOM   4864 H HB3  . PHE A 1 320 ? -17.763 -29.454 -26.838 1.00 84.30  ? 391 PHE A HB3  1 
ATOM   4865 H HD1  . PHE A 1 320 ? -18.643 -32.012 -29.149 1.00 93.33  ? 391 PHE A HD1  1 
ATOM   4866 H HD2  . PHE A 1 320 ? -15.603 -30.087 -27.407 1.00 101.32 ? 391 PHE A HD2  1 
ATOM   4867 H HE1  . PHE A 1 320 ? -17.157 -33.201 -30.444 1.00 99.35  ? 391 PHE A HE1  1 
ATOM   4868 H HE2  . PHE A 1 320 ? -14.105 -31.275 -28.701 1.00 107.23 ? 391 PHE A HE2  1 
ATOM   4869 H HZ   . PHE A 1 320 ? -14.880 -32.837 -30.227 1.00 105.95 ? 391 PHE A HZ   1 
ATOM   4870 N N    . LYS A 1 321 ? -17.511 -30.909 -24.262 1.00 60.36  ? 392 LYS A N    1 
ATOM   4871 C CA   . LYS A 1 321 ? -16.472 -31.438 -23.385 1.00 63.04  ? 392 LYS A CA   1 
ATOM   4872 C C    . LYS A 1 321 ? -16.948 -32.698 -22.673 1.00 58.75  ? 392 LYS A C    1 
ATOM   4873 O O    . LYS A 1 321 ? -16.195 -33.670 -22.543 1.00 57.70  ? 392 LYS A O    1 
ATOM   4874 C CB   . LYS A 1 321 ? -16.036 -30.377 -22.378 1.00 71.94  ? 392 LYS A CB   1 
ATOM   4875 C CG   . LYS A 1 321 ? -15.323 -29.185 -23.007 1.00 84.81  ? 392 LYS A CG   1 
ATOM   4876 C CD   . LYS A 1 321 ? -15.009 -28.110 -21.974 1.00 97.30  ? 392 LYS A CD   1 
ATOM   4877 C CE   . LYS A 1 321 ? -14.277 -26.917 -22.598 1.00 108.85 ? 392 LYS A CE   1 
ATOM   4878 N NZ   . LYS A 1 321 ? -13.945 -25.850 -21.604 1.00 114.61 ? 392 LYS A NZ   1 
ATOM   4879 H H    . LYS A 1 321 ? -17.830 -30.143 -24.037 1.00 72.43  ? 392 LYS A H    1 
ATOM   4880 H HA   . LYS A 1 321 ? -15.699 -31.674 -23.922 1.00 75.65  ? 392 LYS A HA   1 
ATOM   4881 H HB2  . LYS A 1 321 ? -16.821 -30.043 -21.917 1.00 86.33  ? 392 LYS A HB2  1 
ATOM   4882 H HB3  . LYS A 1 321 ? -15.428 -30.783 -21.740 1.00 86.33  ? 392 LYS A HB3  1 
ATOM   4883 H HG2  . LYS A 1 321 ? -14.487 -29.483 -23.399 1.00 101.77 ? 392 LYS A HG2  1 
ATOM   4884 H HG3  . LYS A 1 321 ? -15.893 -28.795 -23.688 1.00 101.77 ? 392 LYS A HG3  1 
ATOM   4885 H HD2  . LYS A 1 321 ? -15.838 -27.788 -21.587 1.00 116.76 ? 392 LYS A HD2  1 
ATOM   4886 H HD3  . LYS A 1 321 ? -14.441 -28.487 -21.284 1.00 116.76 ? 392 LYS A HD3  1 
ATOM   4887 H HE2  . LYS A 1 321 ? -13.447 -27.228 -22.992 1.00 130.62 ? 392 LYS A HE2  1 
ATOM   4888 H HE3  . LYS A 1 321 ? -14.841 -26.524 -23.282 1.00 130.62 ? 392 LYS A HE3  1 
ATOM   4889 H HZ1  . LYS A 1 321 ? -13.522 -25.179 -22.008 1.00 137.53 ? 392 LYS A HZ1  1 
ATOM   4890 H HZ2  . LYS A 1 321 ? -14.691 -25.539 -21.231 1.00 137.53 ? 392 LYS A HZ2  1 
ATOM   4891 H HZ3  . LYS A 1 321 ? -13.419 -26.181 -20.967 1.00 137.53 ? 392 LYS A HZ3  1 
ATOM   4892 N N    . THR A 1 322 ? -18.192 -32.703 -22.193 1.00 58.91  ? 393 THR A N    1 
ATOM   4893 C CA   . THR A 1 322 ? -18.744 -33.922 -21.610 1.00 52.86  ? 393 THR A CA   1 
ATOM   4894 C C    . THR A 1 322 ? -18.884 -35.007 -22.669 1.00 49.94  ? 393 THR A C    1 
ATOM   4895 O O    . THR A 1 322 ? -18.666 -36.188 -22.383 1.00 47.39  ? 393 THR A O    1 
ATOM   4896 C CB   . THR A 1 322 ? -20.090 -33.622 -20.948 1.00 51.66  ? 393 THR A CB   1 
ATOM   4897 O OG1  . THR A 1 322 ? -19.892 -32.649 -19.922 1.00 54.00  ? 393 THR A OG1  1 
ATOM   4898 C CG2  . THR A 1 322 ? -20.697 -34.866 -20.318 1.00 47.73  ? 393 THR A CG2  1 
ATOM   4899 H H    . THR A 1 322 ? -18.725 -32.028 -22.193 1.00 70.70  ? 393 THR A H    1 
ATOM   4900 H HA   . THR A 1 322 ? -18.139 -34.247 -20.925 1.00 63.43  ? 393 THR A HA   1 
ATOM   4901 H HB   . THR A 1 322 ? -20.709 -33.276 -21.610 1.00 62.00  ? 393 THR A HB   1 
ATOM   4902 H HG1  . THR A 1 322 ? -19.587 -31.940 -20.253 1.00 64.80  ? 393 THR A HG1  1 
ATOM   4903 H HG21 . THR A 1 322 ? -21.558 -34.652 -19.926 1.00 57.28  ? 393 THR A HG21 1 
ATOM   4904 H HG22 . THR A 1 322 ? -20.819 -35.553 -20.989 1.00 57.28  ? 393 THR A HG22 1 
ATOM   4905 H HG23 . THR A 1 322 ? -20.110 -35.205 -19.624 1.00 57.28  ? 393 THR A HG23 1 
ATOM   4906 N N    . GLN A 1 323 ? -19.227 -34.628 -23.903 1.00 50.47  ? 394 GLN A N    1 
ATOM   4907 C CA   . GLN A 1 323 ? -19.336 -35.622 -24.966 1.00 54.57  ? 394 GLN A CA   1 
ATOM   4908 C C    . GLN A 1 323 ? -18.003 -36.319 -25.212 1.00 57.38  ? 394 GLN A C    1 
ATOM   4909 O O    . GLN A 1 323 ? -17.971 -37.516 -25.516 1.00 59.03  ? 394 GLN A O    1 
ATOM   4910 C CB   . GLN A 1 323 ? -19.838 -34.972 -26.246 1.00 57.55  ? 394 GLN A CB   1 
ATOM   4911 C CG   . GLN A 1 323 ? -21.316 -34.746 -26.255 1.00 60.11  ? 394 GLN A CG   1 
ATOM   4912 C CD   . GLN A 1 323 ? -21.756 -33.917 -27.432 1.00 64.49  ? 394 GLN A CD   1 
ATOM   4913 O OE1  . GLN A 1 323 ? -21.157 -32.886 -27.728 1.00 66.36  ? 394 GLN A OE1  1 
ATOM   4914 N NE2  . GLN A 1 323 ? -22.800 -34.368 -28.120 1.00 65.33  ? 394 GLN A NE2  1 
ATOM   4915 H H    . GLN A 1 323 ? -19.398 -33.820 -24.144 1.00 60.57  ? 394 GLN A H    1 
ATOM   4916 H HA   . GLN A 1 323 ? -19.981 -36.296 -24.701 1.00 65.49  ? 394 GLN A HA   1 
ATOM   4917 H HB2  . GLN A 1 323 ? -19.404 -34.111 -26.352 1.00 69.06  ? 394 GLN A HB2  1 
ATOM   4918 H HB3  . GLN A 1 323 ? -19.620 -35.546 -26.996 1.00 69.06  ? 394 GLN A HB3  1 
ATOM   4919 H HG2  . GLN A 1 323 ? -21.768 -35.603 -26.303 1.00 72.13  ? 394 GLN A HG2  1 
ATOM   4920 H HG3  . GLN A 1 323 ? -21.571 -34.279 -25.444 1.00 72.13  ? 394 GLN A HG3  1 
ATOM   4921 H HE21 . GLN A 1 323 ? -23.188 -35.098 -27.884 1.00 78.39  ? 394 GLN A HE21 1 
ATOM   4922 H HE22 . GLN A 1 323 ? -23.088 -33.929 -28.802 1.00 78.39  ? 394 GLN A HE22 1 
ATOM   4923 N N    . LYS A 1 324 ? -16.895 -35.583 -25.107 1.00 58.46  ? 395 LYS A N    1 
ATOM   4924 C CA   . LYS A 1 324 ? -15.588 -36.210 -25.231 1.00 59.88  ? 395 LYS A CA   1 
ATOM   4925 C C    . LYS A 1 324 ? -15.430 -37.297 -24.185 1.00 56.17  ? 395 LYS A C    1 
ATOM   4926 O O    . LYS A 1 324 ? -15.001 -38.415 -24.490 1.00 55.49  ? 395 LYS A O    1 
ATOM   4927 C CB   . LYS A 1 324 ? -14.478 -35.164 -25.091 1.00 67.93  ? 395 LYS A CB   1 
ATOM   4928 C CG   . LYS A 1 324 ? -14.379 -34.191 -26.263 1.00 79.31  ? 395 LYS A CG   1 
ATOM   4929 C CD   . LYS A 1 324 ? -13.504 -32.989 -25.914 1.00 92.03  ? 395 LYS A CD   1 
ATOM   4930 C CE   . LYS A 1 324 ? -12.046 -33.387 -25.687 1.00 103.81 ? 395 LYS A CE   1 
ATOM   4931 N NZ   . LYS A 1 324 ? -11.236 -32.294 -25.075 1.00 111.62 ? 395 LYS A NZ   1 
ATOM   4932 H H    . LYS A 1 324 ? -16.876 -34.735 -24.967 1.00 70.15  ? 395 LYS A H    1 
ATOM   4933 H HA   . LYS A 1 324 ? -15.511 -36.619 -26.107 1.00 71.85  ? 395 LYS A HA   1 
ATOM   4934 H HB2  . LYS A 1 324 ? -14.639 -34.644 -24.288 1.00 81.52  ? 395 LYS A HB2  1 
ATOM   4935 H HB3  . LYS A 1 324 ? -13.629 -35.627 -25.017 1.00 81.52  ? 395 LYS A HB3  1 
ATOM   4936 H HG2  . LYS A 1 324 ? -13.978 -34.643 -27.021 1.00 95.17  ? 395 LYS A HG2  1 
ATOM   4937 H HG3  . LYS A 1 324 ? -15.265 -33.869 -26.491 1.00 95.17  ? 395 LYS A HG3  1 
ATOM   4938 H HD2  . LYS A 1 324 ? -13.532 -32.351 -26.644 1.00 110.43 ? 395 LYS A HD2  1 
ATOM   4939 H HD3  . LYS A 1 324 ? -13.836 -32.579 -25.100 1.00 110.43 ? 395 LYS A HD3  1 
ATOM   4940 H HE2  . LYS A 1 324 ? -12.008 -34.149 -25.090 1.00 124.57 ? 395 LYS A HE2  1 
ATOM   4941 H HE3  . LYS A 1 324 ? -11.645 -33.615 -26.540 1.00 124.57 ? 395 LYS A HE3  1 
ATOM   4942 H HZ1  . LYS A 1 324 ? -10.396 -32.566 -24.960 1.00 133.94 ? 395 LYS A HZ1  1 
ATOM   4943 H HZ2  . LYS A 1 324 ? -11.239 -31.580 -25.606 1.00 133.94 ? 395 LYS A HZ2  1 
ATOM   4944 H HZ3  . LYS A 1 324 ? -11.578 -32.068 -24.285 1.00 133.94 ? 395 LYS A HZ3  1 
ATOM   4945 N N    . GLU A 1 325 ? -15.792 -36.988 -22.940 1.00 54.92  ? 396 GLU A N    1 
ATOM   4946 C CA   . GLU A 1 325 ? -15.647 -37.964 -21.870 1.00 55.02  ? 396 GLU A CA   1 
ATOM   4947 C C    . GLU A 1 325 ? -16.508 -39.190 -22.137 1.00 51.40  ? 396 GLU A C    1 
ATOM   4948 O O    . GLU A 1 325 ? -16.067 -40.326 -21.919 1.00 50.02  ? 396 GLU A O    1 
ATOM   4949 C CB   . GLU A 1 325 ? -16.010 -37.322 -20.536 1.00 58.56  ? 396 GLU A CB   1 
ATOM   4950 C CG   . GLU A 1 325 ? -15.226 -36.061 -20.223 1.00 65.05  ? 396 GLU A CG   1 
ATOM   4951 C CD   . GLU A 1 325 ? -13.710 -36.296 -20.185 1.00 71.55  ? 396 GLU A CD   1 
ATOM   4952 O OE1  . GLU A 1 325 ? -13.283 -37.381 -19.718 1.00 69.86  ? 396 GLU A OE1  1 
ATOM   4953 O OE2  . GLU A 1 325 ? -12.954 -35.396 -20.632 1.00 78.46  ? 396 GLU A OE2  1 
ATOM   4954 H H    . GLU A 1 325 ? -16.121 -36.232 -22.696 1.00 65.90  ? 396 GLU A H    1 
ATOM   4955 H HA   . GLU A 1 325 ? -14.722 -38.251 -21.826 1.00 66.02  ? 396 GLU A HA   1 
ATOM   4956 H HB2  . GLU A 1 325 ? -16.952 -37.089 -20.548 1.00 70.28  ? 396 GLU A HB2  1 
ATOM   4957 H HB3  . GLU A 1 325 ? -15.839 -37.960 -19.826 1.00 70.28  ? 396 GLU A HB3  1 
ATOM   4958 H HG2  . GLU A 1 325 ? -15.410 -35.394 -20.903 1.00 78.06  ? 396 GLU A HG2  1 
ATOM   4959 H HG3  . GLU A 1 325 ? -15.498 -35.729 -19.353 1.00 78.06  ? 396 GLU A HG3  1 
ATOM   4960 N N    . ALA A 1 326 ? -17.732 -38.985 -22.638 1.00 51.53  ? 397 ALA A N    1 
ATOM   4961 C CA   . ALA A 1 326 ? -18.619 -40.119 -22.877 1.00 51.26  ? 397 ALA A CA   1 
ATOM   4962 C C    . ALA A 1 326 ? -18.042 -41.037 -23.952 1.00 52.34  ? 397 ALA A C    1 
ATOM   4963 O O    . ALA A 1 326 ? -18.107 -42.265 -23.835 1.00 53.18  ? 397 ALA A O    1 
ATOM   4964 C CB   . ALA A 1 326 ? -20.011 -39.626 -23.269 1.00 49.80  ? 397 ALA A CB   1 
ATOM   4965 H H    . ALA A 1 326 ? -18.062 -38.218 -22.842 1.00 61.83  ? 397 ALA A H    1 
ATOM   4966 H HA   . ALA A 1 326 ? -18.703 -40.632 -22.058 1.00 61.51  ? 397 ALA A HA   1 
ATOM   4967 H HB1  . ALA A 1 326 ? -20.579 -40.392 -23.444 1.00 59.77  ? 397 ALA A HB1  1 
ATOM   4968 H HB2  . ALA A 1 326 ? -20.374 -39.105 -22.537 1.00 59.77  ? 397 ALA A HB2  1 
ATOM   4969 H HB3  . ALA A 1 326 ? -19.940 -39.077 -24.065 1.00 59.77  ? 397 ALA A HB3  1 
ATOM   4970 N N    . ALA A 1 327 ? -17.456 -40.453 -24.995 1.00 51.40  ? 398 ALA A N    1 
ATOM   4971 C CA   . ALA A 1 327 ? -16.793 -41.230 -26.033 1.00 49.97  ? 398 ALA A CA   1 
ATOM   4972 C C    . ALA A 1 327 ? -15.686 -42.107 -25.455 1.00 50.36  ? 398 ALA A C    1 
ATOM   4973 O O    . ALA A 1 327 ? -15.567 -43.287 -25.797 1.00 51.54  ? 398 ALA A O    1 
ATOM   4974 C CB   . ALA A 1 327 ? -16.238 -40.274 -27.086 1.00 49.76  ? 398 ALA A CB   1 
ATOM   4975 H H    . ALA A 1 327 ? -17.430 -39.603 -25.123 1.00 61.68  ? 398 ALA A H    1 
ATOM   4976 H HA   . ALA A 1 327 ? -17.443 -41.808 -26.462 1.00 59.97  ? 398 ALA A HA   1 
ATOM   4977 H HB1  . ALA A 1 327 ? -15.796 -40.790 -27.778 1.00 59.72  ? 398 ALA A HB1  1 
ATOM   4978 H HB2  . ALA A 1 327 ? -16.971 -39.766 -27.468 1.00 59.72  ? 398 ALA A HB2  1 
ATOM   4979 H HB3  . ALA A 1 327 ? -15.603 -39.674 -26.664 1.00 59.72  ? 398 ALA A HB3  1 
ATOM   4980 N N    . TRP A 1 328 ? -14.850 -41.545 -24.591 1.00 51.07  ? 399 TRP A N    1 
ATOM   4981 C CA   . TRP A 1 328 ? -13.846 -42.362 -23.929 1.00 56.80  ? 399 TRP A CA   1 
ATOM   4982 C C    . TRP A 1 328 ? -14.492 -43.531 -23.191 1.00 51.64  ? 399 TRP A C    1 
ATOM   4983 O O    . TRP A 1 328 ? -13.996 -44.664 -23.247 1.00 54.11  ? 399 TRP A O    1 
ATOM   4984 C CB   . TRP A 1 328 ? -13.021 -41.499 -22.968 1.00 68.97  ? 399 TRP A CB   1 
ATOM   4985 C CG   . TRP A 1 328 ? -11.819 -40.859 -23.620 1.00 82.92  ? 399 TRP A CG   1 
ATOM   4986 C CD1  . TRP A 1 328 ? -11.609 -39.519 -23.862 1.00 88.11  ? 399 TRP A CD1  1 
ATOM   4987 C CD2  . TRP A 1 328 ? -10.667 -41.542 -24.124 1.00 90.63  ? 399 TRP A CD2  1 
ATOM   4988 N NE1  . TRP A 1 328 ? -10.396 -39.339 -24.480 1.00 93.49  ? 399 TRP A NE1  1 
ATOM   4989 C CE2  . TRP A 1 328 ? -9.799  -40.563 -24.654 1.00 97.48  ? 399 TRP A CE2  1 
ATOM   4990 C CE3  . TRP A 1 328 ? -10.285 -42.888 -24.178 1.00 90.65  ? 399 TRP A CE3  1 
ATOM   4991 C CZ2  . TRP A 1 328 ? -8.568  -40.894 -25.227 1.00 104.52 ? 399 TRP A CZ2  1 
ATOM   4992 C CZ3  . TRP A 1 328 ? -9.071  -43.213 -24.745 1.00 95.44  ? 399 TRP A CZ3  1 
ATOM   4993 C CH2  . TRP A 1 328 ? -8.224  -42.222 -25.262 1.00 102.49 ? 399 TRP A CH2  1 
ATOM   4994 H H    . TRP A 1 328 ? -14.843 -40.713 -24.375 1.00 61.28  ? 399 TRP A H    1 
ATOM   4995 H HA   . TRP A 1 328 ? -13.244 -42.726 -24.597 1.00 68.16  ? 399 TRP A HA   1 
ATOM   4996 H HB2  . TRP A 1 328 ? -13.584 -40.790 -22.620 1.00 82.76  ? 399 TRP A HB2  1 
ATOM   4997 H HB3  . TRP A 1 328 ? -12.704 -42.056 -22.240 1.00 82.76  ? 399 TRP A HB3  1 
ATOM   4998 H HD1  . TRP A 1 328 ? -12.201 -38.837 -23.639 1.00 105.73 ? 399 TRP A HD1  1 
ATOM   4999 H HE1  . TRP A 1 328 ? -10.065 -38.583 -24.720 1.00 112.18 ? 399 TRP A HE1  1 
ATOM   5000 H HE3  . TRP A 1 328 ? -10.840 -43.551 -23.836 1.00 108.78 ? 399 TRP A HE3  1 
ATOM   5001 H HZ2  . TRP A 1 328 ? -8.004  -40.240 -25.571 1.00 125.42 ? 399 TRP A HZ2  1 
ATOM   5002 H HZ3  . TRP A 1 328 ? -8.809  -44.104 -24.784 1.00 114.53 ? 399 TRP A HZ3  1 
ATOM   5003 H HH2  . TRP A 1 328 ? -7.411  -42.471 -25.639 1.00 122.99 ? 399 TRP A HH2  1 
ATOM   5004 N N    . ALA A 1 329 ? -15.595 -43.278 -22.484 1.00 47.66  ? 400 ALA A N    1 
ATOM   5005 C CA   . ALA A 1 329 ? -16.253 -44.359 -21.765 1.00 47.70  ? 400 ALA A CA   1 
ATOM   5006 C C    . ALA A 1 329 ? -16.762 -45.435 -22.711 1.00 52.54  ? 400 ALA A C    1 
ATOM   5007 O O    . ALA A 1 329 ? -16.825 -46.607 -22.335 1.00 51.69  ? 400 ALA A O    1 
ATOM   5008 C CB   . ALA A 1 329 ? -17.412 -43.815 -20.920 1.00 46.14  ? 400 ALA A CB   1 
ATOM   5009 H H    . ALA A 1 329 ? -15.971 -42.508 -22.408 1.00 57.19  ? 400 ALA A H    1 
ATOM   5010 H HA   . ALA A 1 329 ? -15.612 -44.771 -21.166 1.00 57.24  ? 400 ALA A HA   1 
ATOM   5011 H HB1  . ALA A 1 329 ? -17.834 -44.552 -20.451 1.00 55.37  ? 400 ALA A HB1  1 
ATOM   5012 H HB2  . ALA A 1 329 ? -17.063 -43.173 -20.282 1.00 55.37  ? 400 ALA A HB2  1 
ATOM   5013 H HB3  . ALA A 1 329 ? -18.054 -43.384 -21.506 1.00 55.37  ? 400 ALA A HB3  1 
ATOM   5014 N N    . ILE A 1 330 ? -17.139 -45.061 -23.934 1.00 57.28  ? 401 ILE A N    1 
ATOM   5015 C CA   . ILE A 1 330 ? -17.586 -46.048 -24.911 1.00 58.75  ? 401 ILE A CA   1 
ATOM   5016 C C    . ILE A 1 330 ? -16.401 -46.840 -25.440 1.00 56.66  ? 401 ILE A C    1 
ATOM   5017 O O    . ILE A 1 330 ? -16.433 -48.075 -25.486 1.00 56.95  ? 401 ILE A O    1 
ATOM   5018 C CB   . ILE A 1 330 ? -18.354 -45.359 -26.052 1.00 59.39  ? 401 ILE A CB   1 
ATOM   5019 C CG1  . ILE A 1 330 ? -19.532 -44.551 -25.500 1.00 54.69  ? 401 ILE A CG1  1 
ATOM   5020 C CG2  . ILE A 1 330 ? -18.837 -46.393 -27.078 1.00 63.11  ? 401 ILE A CG2  1 
ATOM   5021 C CD1  . ILE A 1 330 ? -20.507 -45.348 -24.738 1.00 51.46  ? 401 ILE A CD1  1 
ATOM   5022 H H    . ILE A 1 330 ? -17.145 -44.250 -24.219 1.00 68.73  ? 401 ILE A H    1 
ATOM   5023 H HA   . ILE A 1 330 ? -18.185 -46.674 -24.476 1.00 70.50  ? 401 ILE A HA   1 
ATOM   5024 H HB   . ILE A 1 330 ? -17.749 -44.747 -26.499 1.00 71.27  ? 401 ILE A HB   1 
ATOM   5025 H HG12 . ILE A 1 330 ? -19.195 -43.865 -24.911 1.00 65.62  ? 401 ILE A HG12 1 
ATOM   5026 H HG13 . ILE A 1 330 ? -20.002 -44.141 -26.243 1.00 65.62  ? 401 ILE A HG13 1 
ATOM   5027 H HG21 . ILE A 1 330 ? -19.492 -45.976 -27.659 1.00 75.73  ? 401 ILE A HG21 1 
ATOM   5028 H HG22 . ILE A 1 330 ? -18.079 -46.699 -27.601 1.00 75.73  ? 401 ILE A HG22 1 
ATOM   5029 H HG23 . ILE A 1 330 ? -19.240 -47.140 -26.608 1.00 75.73  ? 401 ILE A HG23 1 
ATOM   5030 H HD11 . ILE A 1 330 ? -21.273 -44.790 -24.532 1.00 61.76  ? 401 ILE A HD11 1 
ATOM   5031 H HD12 . ILE A 1 330 ? -20.789 -46.107 -25.272 1.00 61.76  ? 401 ILE A HD12 1 
ATOM   5032 H HD13 . ILE A 1 330 ? -20.095 -45.656 -23.916 1.00 61.76  ? 401 ILE A HD13 1 
ATOM   5033 N N    . THR A 1 331 ? -15.332 -46.146 -25.842 1.00 53.79  ? 402 THR A N    1 
ATOM   5034 C CA   . THR A 1 331 ? -14.141 -46.849 -26.297 1.00 56.77  ? 402 THR A CA   1 
ATOM   5035 C C    . THR A 1 331 ? -13.680 -47.872 -25.267 1.00 53.69  ? 402 THR A C    1 
ATOM   5036 O O    . THR A 1 331 ? -13.443 -49.036 -25.606 1.00 53.65  ? 402 THR A O    1 
ATOM   5037 C CB   . THR A 1 331 ? -13.025 -45.860 -26.603 1.00 65.18  ? 402 THR A CB   1 
ATOM   5038 O OG1  . THR A 1 331 ? -13.444 -45.006 -27.669 1.00 68.10  ? 402 THR A OG1  1 
ATOM   5039 C CG2  . THR A 1 331 ? -11.761 -46.592 -27.043 1.00 69.75  ? 402 THR A CG2  1 
ATOM   5040 H H    . THR A 1 331 ? -15.275 -45.288 -25.859 1.00 64.55  ? 402 THR A H    1 
ATOM   5041 H HA   . THR A 1 331 ? -14.351 -47.325 -27.116 1.00 68.13  ? 402 THR A HA   1 
ATOM   5042 H HB   . THR A 1 331 ? -12.825 -45.332 -25.815 1.00 78.21  ? 402 THR A HB   1 
ATOM   5043 H HG1  . THR A 1 331 ? -13.603 -45.462 -28.356 1.00 81.72  ? 402 THR A HG1  1 
ATOM   5044 H HG21 . THR A 1 331 ? -11.145 -45.966 -27.455 1.00 83.70  ? 402 THR A HG21 1 
ATOM   5045 H HG22 . THR A 1 331 ? -11.328 -47.001 -26.278 1.00 83.70  ? 402 THR A HG22 1 
ATOM   5046 H HG23 . THR A 1 331 ? -11.985 -47.282 -27.687 1.00 83.70  ? 402 THR A HG23 1 
ATOM   5047 N N    . ASN A 1 332 ? -13.555 -47.457 -23.996 1.00 51.81  ? 403 ASN A N    1 
ATOM   5048 C CA   . ASN A 1 332 ? -13.115 -48.384 -22.952 1.00 51.81  ? 403 ASN A CA   1 
ATOM   5049 C C    . ASN A 1 332 ? -14.082 -49.543 -22.819 1.00 49.56  ? 403 ASN A C    1 
ATOM   5050 O O    . ASN A 1 332 ? -13.669 -50.699 -22.662 1.00 47.66  ? 403 ASN A O    1 
ATOM   5051 C CB   . ASN A 1 332 ? -12.988 -47.662 -21.612 1.00 53.22  ? 403 ASN A CB   1 
ATOM   5052 C CG   . ASN A 1 332 ? -11.888 -46.617 -21.611 1.00 56.74  ? 403 ASN A CG   1 
ATOM   5053 O OD1  . ASN A 1 332 ? -11.071 -46.548 -22.529 1.00 60.33  ? 403 ASN A OD1  1 
ATOM   5054 N ND2  . ASN A 1 332 ? -11.854 -45.809 -20.566 1.00 55.44  ? 403 ASN A ND2  1 
ATOM   5055 H H    . ASN A 1 332 ? -13.717 -46.658 -23.721 1.00 62.17  ? 403 ASN A H    1 
ATOM   5056 H HA   . ASN A 1 332 ? -12.244 -48.741 -23.188 1.00 62.17  ? 403 ASN A HA   1 
ATOM   5057 H HB2  . ASN A 1 332 ? -13.826 -47.216 -21.413 1.00 63.87  ? 403 ASN A HB2  1 
ATOM   5058 H HB3  . ASN A 1 332 ? -12.785 -48.312 -20.921 1.00 63.87  ? 403 ASN A HB3  1 
ATOM   5059 H HD21 . ASN A 1 332 ? -11.251 -45.198 -20.514 1.00 66.53  ? 403 ASN A HD21 1 
ATOM   5060 H HD22 . ASN A 1 332 ? -12.435 -45.894 -19.938 1.00 66.53  ? 403 ASN A HD22 1 
ATOM   5061 N N    . TYR A 1 333 ? -15.380 -49.252 -22.894 1.00 51.02  ? 404 TYR A N    1 
ATOM   5062 C CA   . TYR A 1 333 ? -16.378 -50.306 -22.837 1.00 52.53  ? 404 TYR A CA   1 
ATOM   5063 C C    . TYR A 1 333 ? -16.177 -51.298 -23.973 1.00 52.47  ? 404 TYR A C    1 
ATOM   5064 O O    . TYR A 1 333 ? -16.188 -52.517 -23.757 1.00 56.50  ? 404 TYR A O    1 
ATOM   5065 C CB   . TYR A 1 333 ? -17.771 -49.679 -22.893 1.00 51.07  ? 404 TYR A CB   1 
ATOM   5066 C CG   . TYR A 1 333 ? -18.957 -50.602 -22.799 1.00 50.37  ? 404 TYR A CG   1 
ATOM   5067 C CD1  . TYR A 1 333 ? -19.276 -51.493 -23.817 1.00 51.54  ? 404 TYR A CD1  1 
ATOM   5068 C CD2  . TYR A 1 333 ? -19.804 -50.522 -21.721 1.00 48.21  ? 404 TYR A CD2  1 
ATOM   5069 C CE1  . TYR A 1 333 ? -20.412 -52.302 -23.732 1.00 52.84  ? 404 TYR A CE1  1 
ATOM   5070 C CE2  . TYR A 1 333 ? -20.918 -51.309 -21.616 1.00 49.52  ? 404 TYR A CE2  1 
ATOM   5071 C CZ   . TYR A 1 333 ? -21.226 -52.203 -22.619 1.00 51.82  ? 404 TYR A CZ   1 
ATOM   5072 O OH   . TYR A 1 333 ? -22.364 -52.972 -22.492 1.00 52.96  ? 404 TYR A OH   1 
ATOM   5073 H H    . TYR A 1 333 ? -15.702 -48.459 -22.977 1.00 61.22  ? 404 TYR A H    1 
ATOM   5074 H HA   . TYR A 1 333 ? -16.292 -50.784 -21.997 1.00 63.04  ? 404 TYR A HA   1 
ATOM   5075 H HB2  . TYR A 1 333 ? -17.845 -49.048 -22.160 1.00 61.28  ? 404 TYR A HB2  1 
ATOM   5076 H HB3  . TYR A 1 333 ? -17.850 -49.201 -23.733 1.00 61.28  ? 404 TYR A HB3  1 
ATOM   5077 H HD1  . TYR A 1 333 ? -18.726 -51.552 -24.565 1.00 61.84  ? 404 TYR A HD1  1 
ATOM   5078 H HD2  . TYR A 1 333 ? -19.611 -49.920 -21.039 1.00 57.84  ? 404 TYR A HD2  1 
ATOM   5079 H HE1  . TYR A 1 333 ? -20.614 -52.903 -24.412 1.00 63.41  ? 404 TYR A HE1  1 
ATOM   5080 H HE2  . TYR A 1 333 ? -21.469 -51.238 -20.870 1.00 59.43  ? 404 TYR A HE2  1 
ATOM   5081 H HH   . TYR A 1 333 ? -22.453 -53.466 -23.165 1.00 63.55  ? 404 TYR A HH   1 
ATOM   5082 N N    . THR A 1 334 ? -15.971 -50.796 -25.189 1.00 49.34  ? 405 THR A N    1 
ATOM   5083 C CA   . THR A 1 334 ? -15.921 -51.695 -26.336 1.00 51.97  ? 405 THR A CA   1 
ATOM   5084 C C    . THR A 1 334 ? -14.608 -52.457 -26.438 1.00 57.55  ? 405 THR A C    1 
ATOM   5085 O O    . THR A 1 334 ? -14.590 -53.521 -27.060 1.00 60.55  ? 405 THR A O    1 
ATOM   5086 C CB   . THR A 1 334 ? -16.163 -50.945 -27.656 1.00 54.48  ? 405 THR A CB   1 
ATOM   5087 O OG1  . THR A 1 334 ? -15.160 -49.946 -27.845 1.00 55.12  ? 405 THR A OG1  1 
ATOM   5088 C CG2  . THR A 1 334 ? -17.540 -50.299 -27.673 1.00 54.01  ? 405 THR A CG2  1 
ATOM   5089 H H    . THR A 1 334 ? -15.860 -49.963 -25.372 1.00 59.21  ? 405 THR A H    1 
ATOM   5090 H HA   . THR A 1 334 ? -16.630 -52.350 -26.241 1.00 62.36  ? 405 THR A HA   1 
ATOM   5091 H HB   . THR A 1 334 ? -16.120 -51.577 -28.390 1.00 65.37  ? 405 THR A HB   1 
ATOM   5092 H HG1  . THR A 1 334 ? -15.182 -49.394 -27.212 1.00 66.14  ? 405 THR A HG1  1 
ATOM   5093 H HG21 . THR A 1 334 ? -17.671 -49.822 -28.507 1.00 64.81  ? 405 THR A HG21 1 
ATOM   5094 H HG22 . THR A 1 334 ? -18.226 -50.980 -27.588 1.00 64.81  ? 405 THR A HG22 1 
ATOM   5095 H HG23 . THR A 1 334 ? -17.623 -49.674 -26.936 1.00 64.81  ? 405 THR A HG23 1 
ATOM   5096 N N    . SER A 1 335 ? -13.522 -51.946 -25.849 1.00 58.84  ? 406 SER A N    1 
ATOM   5097 C CA   . SER A 1 335 ? -12.249 -52.654 -25.890 1.00 61.84  ? 406 SER A CA   1 
ATOM   5098 C C    . SER A 1 335 ? -12.140 -53.706 -24.790 1.00 64.33  ? 406 SER A C    1 
ATOM   5099 O O    . SER A 1 335 ? -11.389 -54.675 -24.943 1.00 67.52  ? 406 SER A O    1 
ATOM   5100 C CB   . SER A 1 335 ? -11.087 -51.663 -25.777 1.00 61.42  ? 406 SER A CB   1 
ATOM   5101 O OG   . SER A 1 335 ? -10.875 -51.283 -24.435 1.00 60.27  ? 406 SER A OG   1 
ATOM   5102 H H    . SER A 1 335 ? -13.500 -51.198 -25.425 1.00 70.60  ? 406 SER A H    1 
ATOM   5103 H HA   . SER A 1 335 ? -12.170 -53.108 -26.744 1.00 74.20  ? 406 SER A HA   1 
ATOM   5104 H HB2  . SER A 1 335 ? -10.281 -52.082 -26.117 1.00 73.70  ? 406 SER A HB2  1 
ATOM   5105 H HB3  . SER A 1 335 ? -11.295 -50.873 -26.299 1.00 73.70  ? 406 SER A HB3  1 
ATOM   5106 H HG   . SER A 1 335 ? -10.236 -50.740 -24.388 1.00 72.33  ? 406 SER A HG   1 
ATOM   5107 N N    . GLY A 1 336 ? -12.870 -53.543 -23.688 1.00 62.76  ? 407 GLY A N    1 
ATOM   5108 C CA   . GLY A 1 336 ? -12.814 -54.500 -22.600 1.00 60.73  ? 407 GLY A CA   1 
ATOM   5109 C C    . GLY A 1 336 ? -14.045 -55.378 -22.452 1.00 58.43  ? 407 GLY A C    1 
ATOM   5110 O O    . GLY A 1 336 ? -14.031 -56.344 -21.682 1.00 59.75  ? 407 GLY A O    1 
ATOM   5111 H H    . GLY A 1 336 ? -13.405 -52.884 -23.550 1.00 75.31  ? 407 GLY A H    1 
ATOM   5112 H HA2  . GLY A 1 336 ? -12.047 -55.080 -22.721 1.00 72.87  ? 407 GLY A HA2  1 
ATOM   5113 H HA3  . GLY A 1 336 ? -12.693 -54.018 -21.767 1.00 72.87  ? 407 GLY A HA3  1 
ATOM   5114 N N    . GLY A 1 337 ? -15.112 -55.075 -23.194 1.00 54.85  ? 408 GLY A N    1 
ATOM   5115 C CA   . GLY A 1 337 ? -16.363 -55.779 -23.005 1.00 55.52  ? 408 GLY A CA   1 
ATOM   5116 C C    . GLY A 1 337 ? -16.457 -57.098 -23.764 1.00 59.37  ? 408 GLY A C    1 
ATOM   5117 O O    . GLY A 1 337 ? -15.744 -57.368 -24.730 1.00 59.27  ? 408 GLY A O    1 
ATOM   5118 H H    . GLY A 1 337 ? -15.131 -54.471 -23.806 1.00 65.83  ? 408 GLY A H    1 
ATOM   5119 H HA2  . GLY A 1 337 ? -16.483 -55.965 -22.061 1.00 66.62  ? 408 GLY A HA2  1 
ATOM   5120 H HA3  . GLY A 1 337 ? -17.093 -55.211 -23.296 1.00 66.62  ? 408 GLY A HA3  1 
ATOM   5121 N N    . THR A 1 338 ? -17.377 -57.939 -23.300 1.00 60.89  ? 409 THR A N    1 
ATOM   5122 C CA   . THR A 1 338 ? -17.661 -59.182 -23.988 1.00 64.53  ? 409 THR A CA   1 
ATOM   5123 C C    . THR A 1 338 ? -18.467 -58.895 -25.247 1.00 63.37  ? 409 THR A C    1 
ATOM   5124 O O    . THR A 1 338 ? -18.947 -57.776 -25.475 1.00 62.49  ? 409 THR A O    1 
ATOM   5125 C CB   . THR A 1 338 ? -18.449 -60.131 -23.095 1.00 67.69  ? 409 THR A CB   1 
ATOM   5126 O OG1  . THR A 1 338 ? -19.716 -59.531 -22.793 1.00 65.99  ? 409 THR A OG1  1 
ATOM   5127 C CG2  . THR A 1 338 ? -17.698 -60.423 -21.804 1.00 70.76  ? 409 THR A CG2  1 
ATOM   5128 H H    . THR A 1 338 ? -17.846 -57.809 -22.591 1.00 73.06  ? 409 THR A H    1 
ATOM   5129 H HA   . THR A 1 338 ? -16.830 -59.613 -24.242 1.00 77.44  ? 409 THR A HA   1 
ATOM   5130 H HB   . THR A 1 338 ? -18.592 -60.969 -23.562 1.00 81.23  ? 409 THR A HB   1 
ATOM   5131 H HG1  . THR A 1 338 ? -20.165 -60.042 -22.300 1.00 79.20  ? 409 THR A HG1  1 
ATOM   5132 H HG21 . THR A 1 338 ? -18.189 -61.070 -21.274 1.00 84.91  ? 409 THR A HG21 1 
ATOM   5133 H HG22 . THR A 1 338 ? -16.820 -60.783 -22.006 1.00 84.91  ? 409 THR A HG22 1 
ATOM   5134 H HG23 . THR A 1 338 ? -17.594 -59.608 -21.289 1.00 84.91  ? 409 THR A HG23 1 
ATOM   5135 N N    . VAL A 1 339 ? -18.621 -59.933 -26.073 1.00 59.97  ? 410 VAL A N    1 
ATOM   5136 C CA   . VAL A 1 339 ? -19.407 -59.785 -27.288 1.00 59.03  ? 410 VAL A CA   1 
ATOM   5137 C C    . VAL A 1 339 ? -20.851 -59.472 -26.942 1.00 57.05  ? 410 VAL A C    1 
ATOM   5138 O O    . VAL A 1 339 ? -21.488 -58.631 -27.588 1.00 54.74  ? 410 VAL A O    1 
ATOM   5139 C CB   . VAL A 1 339 ? -19.298 -61.046 -28.158 1.00 63.04  ? 410 VAL A CB   1 
ATOM   5140 C CG1  . VAL A 1 339 ? -20.240 -60.936 -29.348 1.00 64.06  ? 410 VAL A CG1  1 
ATOM   5141 C CG2  . VAL A 1 339 ? -17.878 -61.216 -28.642 1.00 64.75  ? 410 VAL A CG2  1 
ATOM   5142 H H    . VAL A 1 339 ? -18.286 -60.716 -25.952 1.00 71.96  ? 410 VAL A H    1 
ATOM   5143 H HA   . VAL A 1 339 ? -19.056 -59.040 -27.800 1.00 70.83  ? 410 VAL A HA   1 
ATOM   5144 H HB   . VAL A 1 339 ? -19.545 -61.826 -27.637 1.00 75.64  ? 410 VAL A HB   1 
ATOM   5145 H HG11 . VAL A 1 339 ? -19.975 -61.585 -30.018 1.00 76.87  ? 410 VAL A HG11 1 
ATOM   5146 H HG12 . VAL A 1 339 ? -21.147 -61.117 -29.055 1.00 76.87  ? 410 VAL A HG12 1 
ATOM   5147 H HG13 . VAL A 1 339 ? -20.181 -60.040 -29.716 1.00 76.87  ? 410 VAL A HG13 1 
ATOM   5148 H HG21 . VAL A 1 339 ? -17.828 -62.005 -29.203 1.00 77.70  ? 410 VAL A HG21 1 
ATOM   5149 H HG22 . VAL A 1 339 ? -17.622 -60.431 -29.151 1.00 77.70  ? 410 VAL A HG22 1 
ATOM   5150 H HG23 . VAL A 1 339 ? -17.293 -61.318 -27.875 1.00 77.70  ? 410 VAL A HG23 1 
ATOM   5151 N N    . GLU A 1 340 ? -21.394 -60.139 -25.922 1.00 63.39  ? 411 GLU A N    1 
ATOM   5152 C CA   . GLU A 1 340 ? -22.784 -59.893 -25.561 1.00 69.86  ? 411 GLU A CA   1 
ATOM   5153 C C    . GLU A 1 340 ? -22.971 -58.491 -24.993 1.00 63.82  ? 411 GLU A C    1 
ATOM   5154 O O    . GLU A 1 340 ? -24.037 -57.891 -25.180 1.00 63.92  ? 411 GLU A O    1 
ATOM   5155 C CB   . GLU A 1 340 ? -23.266 -60.950 -24.568 1.00 85.33  ? 411 GLU A CB   1 
ATOM   5156 C CG   . GLU A 1 340 ? -24.782 -61.221 -24.630 1.00 100.68 ? 411 GLU A CG   1 
ATOM   5157 C CD   . GLU A 1 340 ? -25.244 -61.846 -25.959 1.00 113.95 ? 411 GLU A CD   1 
ATOM   5158 O OE1  . GLU A 1 340 ? -24.589 -62.802 -26.440 1.00 119.14 ? 411 GLU A OE1  1 
ATOM   5159 O OE2  . GLU A 1 340 ? -26.268 -61.381 -26.521 1.00 117.96 ? 411 GLU A OE2  1 
ATOM   5160 H H    . GLU A 1 340 ? -20.989 -60.723 -25.437 1.00 76.06  ? 411 GLU A H    1 
ATOM   5161 H HA   . GLU A 1 340 ? -23.329 -59.963 -26.360 1.00 83.83  ? 411 GLU A HA   1 
ATOM   5162 H HB2  . GLU A 1 340 ? -22.809 -61.785 -24.754 1.00 102.40 ? 411 GLU A HB2  1 
ATOM   5163 H HB3  . GLU A 1 340 ? -23.055 -60.653 -23.669 1.00 102.40 ? 411 GLU A HB3  1 
ATOM   5164 H HG2  . GLU A 1 340 ? -25.020 -61.832 -23.916 1.00 120.82 ? 411 GLU A HG2  1 
ATOM   5165 H HG3  . GLU A 1 340 ? -25.255 -60.382 -24.516 1.00 120.82 ? 411 GLU A HG3  1 
ATOM   5166 N N    . GLN A 1 341 ? -21.952 -57.943 -24.315 1.00 61.64  ? 412 GLN A N    1 
ATOM   5167 C CA   . GLN A 1 341 ? -22.051 -56.576 -23.803 1.00 56.88  ? 412 GLN A CA   1 
ATOM   5168 C C    . GLN A 1 341 ? -22.048 -55.564 -24.939 1.00 53.20  ? 412 GLN A C    1 
ATOM   5169 O O    . GLN A 1 341 ? -22.737 -54.536 -24.871 1.00 50.51  ? 412 GLN A O    1 
ATOM   5170 C CB   . GLN A 1 341 ? -20.902 -56.279 -22.839 1.00 56.80  ? 412 GLN A CB   1 
ATOM   5171 C CG   . GLN A 1 341 ? -21.145 -56.757 -21.417 1.00 56.62  ? 412 GLN A CG   1 
ATOM   5172 C CD   . GLN A 1 341 ? -19.868 -57.034 -20.632 1.00 55.80  ? 412 GLN A CD   1 
ATOM   5173 O OE1  . GLN A 1 341 ? -18.758 -56.967 -21.164 1.00 55.74  ? 412 GLN A OE1  1 
ATOM   5174 N NE2  . GLN A 1 341 ? -20.030 -57.362 -19.358 1.00 54.80  ? 412 GLN A NE2  1 
ATOM   5175 H H    . GLN A 1 341 ? -21.207 -58.337 -24.143 1.00 73.97  ? 412 GLN A H    1 
ATOM   5176 H HA   . GLN A 1 341 ? -22.885 -56.480 -23.316 1.00 68.25  ? 412 GLN A HA   1 
ATOM   5177 H HB2  . GLN A 1 341 ? -20.102 -56.717 -23.167 1.00 68.16  ? 412 GLN A HB2  1 
ATOM   5178 H HB3  . GLN A 1 341 ? -20.761 -55.320 -22.808 1.00 68.16  ? 412 GLN A HB3  1 
ATOM   5179 H HG2  . GLN A 1 341 ? -21.644 -56.076 -20.940 1.00 67.95  ? 412 GLN A HG2  1 
ATOM   5180 H HG3  . GLN A 1 341 ? -21.658 -57.580 -21.448 1.00 67.95  ? 412 GLN A HG3  1 
ATOM   5181 H HE21 . GLN A 1 341 ? -20.821 -57.408 -19.023 1.00 65.76  ? 412 GLN A HE21 1 
ATOM   5182 H HE22 . GLN A 1 341 ? -19.344 -57.529 -18.866 1.00 65.76  ? 412 GLN A HE22 1 
ATOM   5183 N N    . ILE A 1 342 ? -21.285 -55.843 -25.993 1.00 54.33  ? 413 ILE A N    1 
ATOM   5184 C CA   . ILE A 1 342 ? -21.225 -54.930 -27.125 1.00 56.17  ? 413 ILE A CA   1 
ATOM   5185 C C    . ILE A 1 342 ? -22.535 -54.960 -27.900 1.00 56.20  ? 413 ILE A C    1 
ATOM   5186 O O    . ILE A 1 342 ? -23.020 -53.923 -28.362 1.00 54.11  ? 413 ILE A O    1 
ATOM   5187 C CB   . ILE A 1 342 ? -20.014 -55.291 -28.005 1.00 59.89  ? 413 ILE A CB   1 
ATOM   5188 C CG1  . ILE A 1 342 ? -18.719 -55.030 -27.214 1.00 62.10  ? 413 ILE A CG1  1 
ATOM   5189 C CG2  . ILE A 1 342 ? -20.047 -54.524 -29.325 1.00 59.81  ? 413 ILE A CG2  1 
ATOM   5190 C CD1  . ILE A 1 342 ? -17.445 -55.334 -27.970 1.00 64.60  ? 413 ILE A CD1  1 
ATOM   5191 H H    . ILE A 1 342 ? -20.798 -56.547 -26.075 1.00 65.19  ? 413 ILE A H    1 
ATOM   5192 H HA   . ILE A 1 342 ? -21.095 -54.027 -26.795 1.00 67.40  ? 413 ILE A HA   1 
ATOM   5193 H HB   . ILE A 1 342 ? -20.059 -56.239 -28.206 1.00 71.86  ? 413 ILE A HB   1 
ATOM   5194 H HG12 . ILE A 1 342 ? -18.694 -54.093 -26.964 1.00 74.52  ? 413 ILE A HG12 1 
ATOM   5195 H HG13 . ILE A 1 342 ? -18.725 -55.579 -26.415 1.00 74.52  ? 413 ILE A HG13 1 
ATOM   5196 H HG21 . ILE A 1 342 ? -19.233 -54.700 -29.820 1.00 71.77  ? 413 ILE A HG21 1 
ATOM   5197 H HG22 . ILE A 1 342 ? -20.810 -54.817 -29.848 1.00 71.77  ? 413 ILE A HG22 1 
ATOM   5198 H HG23 . ILE A 1 342 ? -20.119 -53.575 -29.136 1.00 71.77  ? 413 ILE A HG23 1 
ATOM   5199 H HD11 . ILE A 1 342 ? -16.693 -55.252 -27.363 1.00 77.52  ? 413 ILE A HD11 1 
ATOM   5200 H HD12 . ILE A 1 342 ? -17.493 -56.239 -28.313 1.00 77.52  ? 413 ILE A HD12 1 
ATOM   5201 H HD13 . ILE A 1 342 ? -17.348 -54.705 -28.701 1.00 77.52  ? 413 ILE A HD13 1 
ATOM   5202 N N    . VAL A 1 343 ? -23.122 -56.147 -28.061 1.00 59.02  ? 414 VAL A N    1 
ATOM   5203 C CA   . VAL A 1 343 ? -24.420 -56.256 -28.719 1.00 58.66  ? 414 VAL A CA   1 
ATOM   5204 C C    . VAL A 1 343 ? -25.432 -55.378 -28.001 1.00 55.94  ? 414 VAL A C    1 
ATOM   5205 O O    . VAL A 1 343 ? -26.169 -54.602 -28.622 1.00 55.88  ? 414 VAL A O    1 
ATOM   5206 C CB   . VAL A 1 343 ? -24.872 -57.729 -28.754 1.00 60.85  ? 414 VAL A CB   1 
ATOM   5207 C CG1  . VAL A 1 343 ? -26.287 -57.855 -29.248 1.00 58.20  ? 414 VAL A CG1  1 
ATOM   5208 C CG2  . VAL A 1 343 ? -23.927 -58.553 -29.621 1.00 65.45  ? 414 VAL A CG2  1 
ATOM   5209 H H    . VAL A 1 343 ? -22.791 -56.897 -27.799 1.00 70.82  ? 414 VAL A H    1 
ATOM   5210 H HA   . VAL A 1 343 ? -24.341 -55.942 -29.633 1.00 70.39  ? 414 VAL A HA   1 
ATOM   5211 H HB   . VAL A 1 343 ? -24.839 -58.088 -27.854 1.00 73.01  ? 414 VAL A HB   1 
ATOM   5212 H HG11 . VAL A 1 343 ? -26.453 -58.780 -29.489 1.00 69.84  ? 414 VAL A HG11 1 
ATOM   5213 H HG12 . VAL A 1 343 ? -26.896 -57.584 -28.543 1.00 69.84  ? 414 VAL A HG12 1 
ATOM   5214 H HG13 . VAL A 1 343 ? -26.402 -57.286 -30.025 1.00 69.84  ? 414 VAL A HG13 1 
ATOM   5215 H HG21 . VAL A 1 343 ? -24.097 -59.495 -29.464 1.00 78.54  ? 414 VAL A HG21 1 
ATOM   5216 H HG22 . VAL A 1 343 ? -24.089 -58.339 -30.553 1.00 78.54  ? 414 VAL A HG22 1 
ATOM   5217 H HG23 . VAL A 1 343 ? -23.011 -58.340 -29.388 1.00 78.54  ? 414 VAL A HG23 1 
ATOM   5218 N N    . TYR A 1 344 ? -25.467 -55.483 -26.675 1.00 53.75  ? 415 TYR A N    1 
ATOM   5219 C CA   . TYR A 1 344 ? -26.366 -54.656 -25.882 1.00 52.71  ? 415 TYR A CA   1 
ATOM   5220 C C    . TYR A 1 344 ? -26.070 -53.175 -26.088 1.00 50.73  ? 415 TYR A C    1 
ATOM   5221 O O    . TYR A 1 344 ? -26.992 -52.352 -26.187 1.00 49.76  ? 415 TYR A O    1 
ATOM   5222 C CB   . TYR A 1 344 ? -26.238 -55.043 -24.405 1.00 53.91  ? 415 TYR A CB   1 
ATOM   5223 C CG   . TYR A 1 344 ? -26.979 -54.139 -23.473 1.00 53.58  ? 415 TYR A CG   1 
ATOM   5224 C CD1  . TYR A 1 344 ? -28.356 -54.205 -23.360 1.00 52.45  ? 415 TYR A CD1  1 
ATOM   5225 C CD2  . TYR A 1 344 ? -26.298 -53.204 -22.706 1.00 53.49  ? 415 TYR A CD2  1 
ATOM   5226 C CE1  . TYR A 1 344 ? -29.032 -53.369 -22.504 1.00 51.91  ? 415 TYR A CE1  1 
ATOM   5227 C CE2  . TYR A 1 344 ? -26.964 -52.364 -21.854 1.00 52.92  ? 415 TYR A CE2  1 
ATOM   5228 C CZ   . TYR A 1 344 ? -28.329 -52.446 -21.751 1.00 53.27  ? 415 TYR A CZ   1 
ATOM   5229 O OH   . TYR A 1 344 ? -28.987 -51.595 -20.887 1.00 56.16  ? 415 TYR A OH   1 
ATOM   5230 H H    . TYR A 1 344 ? -24.982 -56.023 -26.214 1.00 64.50  ? 415 TYR A H    1 
ATOM   5231 H HA   . TYR A 1 344 ? -27.280 -54.823 -26.160 1.00 63.25  ? 415 TYR A HA   1 
ATOM   5232 H HB2  . TYR A 1 344 ? -26.587 -55.940 -24.286 1.00 64.69  ? 415 TYR A HB2  1 
ATOM   5233 H HB3  . TYR A 1 344 ? -25.301 -55.020 -24.157 1.00 64.69  ? 415 TYR A HB3  1 
ATOM   5234 H HD1  . TYR A 1 344 ? -28.829 -54.825 -23.866 1.00 62.94  ? 415 TYR A HD1  1 
ATOM   5235 H HD2  . TYR A 1 344 ? -25.372 -53.145 -22.774 1.00 64.19  ? 415 TYR A HD2  1 
ATOM   5236 H HE1  . TYR A 1 344 ? -29.958 -53.421 -22.434 1.00 62.29  ? 415 TYR A HE1  1 
ATOM   5237 H HE2  . TYR A 1 344 ? -26.493 -51.744 -21.345 1.00 63.50  ? 415 TYR A HE2  1 
ATOM   5238 H HH   . TYR A 1 344 ? -28.434 -51.094 -20.501 1.00 67.39  ? 415 TYR A HH   1 
ATOM   5239 N N    . LEU A 1 345 ? -24.790 -52.817 -26.166 1.00 50.16  ? 416 LEU A N    1 
ATOM   5240 C CA   . LEU A 1 345 ? -24.443 -51.436 -26.466 1.00 50.86  ? 416 LEU A CA   1 
ATOM   5241 C C    . LEU A 1 345 ? -25.041 -51.004 -27.797 1.00 50.19  ? 416 LEU A C    1 
ATOM   5242 O O    . LEU A 1 345 ? -25.550 -49.887 -27.926 1.00 50.71  ? 416 LEU A O    1 
ATOM   5243 C CB   . LEU A 1 345 ? -22.930 -51.267 -26.477 1.00 53.92  ? 416 LEU A CB   1 
ATOM   5244 C CG   . LEU A 1 345 ? -22.416 -49.867 -26.812 1.00 56.01  ? 416 LEU A CG   1 
ATOM   5245 C CD1  . LEU A 1 345 ? -22.799 -48.822 -25.743 1.00 55.20  ? 416 LEU A CD1  1 
ATOM   5246 C CD2  . LEU A 1 345 ? -20.907 -49.923 -26.978 1.00 58.66  ? 416 LEU A CD2  1 
ATOM   5247 H H    . LEU A 1 345 ? -24.119 -53.343 -26.052 1.00 60.19  ? 416 LEU A H    1 
ATOM   5248 H HA   . LEU A 1 345 ? -24.805 -50.861 -25.773 1.00 61.03  ? 416 LEU A HA   1 
ATOM   5249 H HB2  . LEU A 1 345 ? -22.591 -51.497 -25.598 1.00 64.70  ? 416 LEU A HB2  1 
ATOM   5250 H HB3  . LEU A 1 345 ? -22.559 -51.875 -27.134 1.00 64.70  ? 416 LEU A HB3  1 
ATOM   5251 H HG   . LEU A 1 345 ? -22.797 -49.582 -27.655 1.00 67.21  ? 416 LEU A HG   1 
ATOM   5252 H HD11 . LEU A 1 345 ? -22.430 -47.962 -25.997 1.00 66.24  ? 416 LEU A HD11 1 
ATOM   5253 H HD12 . LEU A 1 345 ? -23.766 -48.765 -25.690 1.00 66.24  ? 416 LEU A HD12 1 
ATOM   5254 H HD13 . LEU A 1 345 ? -22.436 -49.099 -24.887 1.00 66.24  ? 416 LEU A HD13 1 
ATOM   5255 H HD21 . LEU A 1 345 ? -20.580 -49.034 -27.186 1.00 70.39  ? 416 LEU A HD21 1 
ATOM   5256 H HD22 . LEU A 1 345 ? -20.510 -50.237 -26.150 1.00 70.39  ? 416 LEU A HD22 1 
ATOM   5257 H HD23 . LEU A 1 345 ? -20.692 -50.533 -27.701 1.00 70.39  ? 416 LEU A HD23 1 
ATOM   5258 N N    . VAL A 1 346 ? -25.011 -51.884 -28.792 1.00 50.10  ? 417 VAL A N    1 
ATOM   5259 C CA   . VAL A 1 346 ? -25.560 -51.537 -30.097 1.00 50.41  ? 417 VAL A CA   1 
ATOM   5260 C C    . VAL A 1 346 ? -27.080 -51.415 -30.019 1.00 51.02  ? 417 VAL A C    1 
ATOM   5261 O O    . VAL A 1 346 ? -27.678 -50.524 -30.635 1.00 47.78  ? 417 VAL A O    1 
ATOM   5262 C CB   . VAL A 1 346 ? -25.119 -52.578 -31.145 1.00 51.82  ? 417 VAL A CB   1 
ATOM   5263 C CG1  . VAL A 1 346 ? -25.918 -52.425 -32.413 1.00 50.14  ? 417 VAL A CG1  1 
ATOM   5264 C CG2  . VAL A 1 346 ? -23.647 -52.428 -31.442 1.00 53.96  ? 417 VAL A CG2  1 
ATOM   5265 H H    . VAL A 1 346 ? -24.683 -52.677 -28.739 1.00 60.12  ? 417 VAL A H    1 
ATOM   5266 H HA   . VAL A 1 346 ? -25.207 -50.676 -30.367 1.00 60.49  ? 417 VAL A HA   1 
ATOM   5267 H HB   . VAL A 1 346 ? -25.270 -53.470 -30.795 1.00 62.19  ? 417 VAL A HB   1 
ATOM   5268 H HG11 . VAL A 1 346 ? -25.452 -52.878 -33.134 1.00 60.17  ? 417 VAL A HG11 1 
ATOM   5269 H HG12 . VAL A 1 346 ? -26.795 -52.821 -32.288 1.00 60.17  ? 417 VAL A HG12 1 
ATOM   5270 H HG13 . VAL A 1 346 ? -26.004 -51.481 -32.618 1.00 60.17  ? 417 VAL A HG13 1 
ATOM   5271 H HG21 . VAL A 1 346 ? -23.385 -53.104 -32.087 1.00 64.75  ? 417 VAL A HG21 1 
ATOM   5272 H HG22 . VAL A 1 346 ? -23.487 -51.543 -31.806 1.00 64.75  ? 417 VAL A HG22 1 
ATOM   5273 H HG23 . VAL A 1 346 ? -23.146 -52.543 -30.619 1.00 64.75  ? 417 VAL A HG23 1 
ATOM   5274 N N    . HIS A 1 347 ? -27.727 -52.315 -29.270 1.00 53.79  ? 418 HIS A N    1 
ATOM   5275 C CA   . HIS A 1 347 ? -29.174 -52.262 -29.104 1.00 56.74  ? 418 HIS A CA   1 
ATOM   5276 C C    . HIS A 1 347 ? -29.610 -51.013 -28.356 1.00 55.35  ? 418 HIS A C    1 
ATOM   5277 O O    . HIS A 1 347 ? -30.778 -50.626 -28.455 1.00 58.67  ? 418 HIS A O    1 
ATOM   5278 C CB   . HIS A 1 347 ? -29.678 -53.514 -28.375 1.00 63.29  ? 418 HIS A CB   1 
ATOM   5279 C CG   . HIS A 1 347 ? -29.596 -54.772 -29.192 1.00 73.55  ? 418 HIS A CG   1 
ATOM   5280 N ND1  . HIS A 1 347 ? -29.678 -54.777 -30.570 1.00 79.84  ? 418 HIS A ND1  1 
ATOM   5281 C CD2  . HIS A 1 347 ? -29.442 -56.068 -28.822 1.00 77.93  ? 418 HIS A CD2  1 
ATOM   5282 C CE1  . HIS A 1 347 ? -29.569 -56.019 -31.011 1.00 82.47  ? 418 HIS A CE1  1 
ATOM   5283 N NE2  . HIS A 1 347 ? -29.425 -56.821 -29.971 1.00 81.34  ? 418 HIS A NE2  1 
ATOM   5284 H H    . HIS A 1 347 ? -27.348 -52.963 -28.850 1.00 64.54  ? 418 HIS A H    1 
ATOM   5285 H HA   . HIS A 1 347 ? -29.588 -52.241 -29.981 1.00 68.09  ? 418 HIS A HA   1 
ATOM   5286 H HB2  . HIS A 1 347 ? -29.145 -53.645 -27.576 1.00 75.94  ? 418 HIS A HB2  1 
ATOM   5287 H HB3  . HIS A 1 347 ? -30.607 -53.380 -28.131 1.00 75.94  ? 418 HIS A HB3  1 
ATOM   5288 H HD2  . HIS A 1 347 ? -29.356 -56.387 -27.953 1.00 93.51  ? 418 HIS A HD2  1 
ATOM   5289 H HE1  . HIS A 1 347 ? -29.594 -56.284 -31.902 1.00 98.96  ? 418 HIS A HE1  1 
ATOM   5290 H HE2  . HIS A 1 347 ? -29.340 -57.676 -30.007 1.00 97.61  ? 418 HIS A HE2  1 
ATOM   5291 N N    . CYS A 1 348 ? -28.705 -50.365 -27.624 1.00 52.34  ? 419 CYS A N    1 
ATOM   5292 C CA   . CYS A 1 348 ? -29.047 -49.109 -26.967 1.00 52.07  ? 419 CYS A CA   1 
ATOM   5293 C C    . CYS A 1 348 ? -28.927 -47.909 -27.896 1.00 51.58  ? 419 CYS A C    1 
ATOM   5294 O O    . CYS A 1 348 ? -29.200 -46.788 -27.458 1.00 53.29  ? 419 CYS A O    1 
ATOM   5295 C CB   . CYS A 1 348 ? -28.163 -48.873 -25.729 1.00 54.51  ? 419 CYS A CB   1 
ATOM   5296 S SG   . CYS A 1 348 ? -28.458 -50.030 -24.358 1.00 57.21  ? 419 CYS A SG   1 
ATOM   5297 H H    . CYS A 1 348 ? -27.897 -50.628 -27.494 1.00 62.81  ? 419 CYS A H    1 
ATOM   5298 H HA   . CYS A 1 348 ? -29.968 -49.157 -26.665 1.00 62.49  ? 419 CYS A HA   1 
ATOM   5299 H HB2  . CYS A 1 348 ? -27.233 -48.959 -25.991 1.00 65.41  ? 419 CYS A HB2  1 
ATOM   5300 H HB3  . CYS A 1 348 ? -28.327 -47.976 -25.397 1.00 65.41  ? 419 CYS A HB3  1 
ATOM   5301 H HG   . CYS A 1 348 ? -28.382 -51.162 -24.745 1.00 68.65  ? 419 CYS A HG   1 
ATOM   5302 N N    . GLY A 1 349 ? -28.516 -48.103 -29.146 1.00 51.07  ? 420 GLY A N    1 
ATOM   5303 C CA   . GLY A 1 349 ? -28.474 -47.002 -30.085 1.00 52.84  ? 420 GLY A CA   1 
ATOM   5304 C C    . GLY A 1 349 ? -27.185 -46.217 -30.061 1.00 54.41  ? 420 GLY A C    1 
ATOM   5305 O O    . GLY A 1 349 ? -27.200 -45.000 -30.289 1.00 56.94  ? 420 GLY A O    1 
ATOM   5306 H H    . GLY A 1 349 ? -28.259 -48.857 -29.469 1.00 61.29  ? 420 GLY A H    1 
ATOM   5307 H HA2  . GLY A 1 349 ? -28.599 -47.347 -30.983 1.00 63.41  ? 420 GLY A HA2  1 
ATOM   5308 H HA3  . GLY A 1 349 ? -29.203 -46.391 -29.892 1.00 63.41  ? 420 GLY A HA3  1 
ATOM   5309 N N    . ILE A 1 350 ? -26.060 -46.882 -29.799 1.00 53.97  ? 421 ILE A N    1 
ATOM   5310 C CA   . ILE A 1 350 ? -24.790 -46.176 -29.712 1.00 53.32  ? 421 ILE A CA   1 
ATOM   5311 C C    . ILE A 1 350 ? -24.377 -45.608 -31.068 1.00 54.96  ? 421 ILE A C    1 
ATOM   5312 O O    . ILE A 1 350 ? -23.804 -44.519 -31.137 1.00 54.95  ? 421 ILE A O    1 
ATOM   5313 C CB   . ILE A 1 350 ? -23.707 -47.107 -29.132 1.00 54.50  ? 421 ILE A CB   1 
ATOM   5314 C CG1  . ILE A 1 350 ? -22.461 -46.302 -28.784 1.00 58.24  ? 421 ILE A CG1  1 
ATOM   5315 C CG2  . ILE A 1 350 ? -23.346 -48.231 -30.115 1.00 53.52  ? 421 ILE A CG2  1 
ATOM   5316 C CD1  . ILE A 1 350 ? -22.694 -45.257 -27.701 1.00 60.51  ? 421 ILE A CD1  1 
ATOM   5317 H H    . ILE A 1 350 ? -26.008 -47.731 -29.670 1.00 64.77  ? 421 ILE A H    1 
ATOM   5318 H HA   . ILE A 1 350 ? -24.903 -45.429 -29.105 1.00 63.99  ? 421 ILE A HA   1 
ATOM   5319 H HB   . ILE A 1 350 ? -24.051 -47.509 -28.319 1.00 65.40  ? 421 ILE A HB   1 
ATOM   5320 H HG12 . ILE A 1 350 ? -21.774 -46.910 -28.467 1.00 69.89  ? 421 ILE A HG12 1 
ATOM   5321 H HG13 . ILE A 1 350 ? -22.151 -45.842 -29.579 1.00 69.89  ? 421 ILE A HG13 1 
ATOM   5322 H HG21 . ILE A 1 350 ? -22.737 -48.849 -29.684 1.00 64.22  ? 421 ILE A HG21 1 
ATOM   5323 H HG22 . ILE A 1 350 ? -24.157 -48.693 -30.376 1.00 64.22  ? 421 ILE A HG22 1 
ATOM   5324 H HG23 . ILE A 1 350 ? -22.920 -47.845 -30.896 1.00 64.22  ? 421 ILE A HG23 1 
ATOM   5325 H HD11 . ILE A 1 350 ? -21.836 -44.974 -27.349 1.00 72.61  ? 421 ILE A HD11 1 
ATOM   5326 H HD12 . ILE A 1 350 ? -23.159 -44.498 -28.086 1.00 72.61  ? 421 ILE A HD12 1 
ATOM   5327 H HD13 . ILE A 1 350 ? -23.227 -45.651 -26.992 1.00 72.61  ? 421 ILE A HD13 1 
ATOM   5328 N N    . ILE A 1 351 ? -24.656 -46.322 -32.162 1.00 55.64  ? 422 ILE A N    1 
ATOM   5329 C CA   . ILE A 1 351 ? -23.994 -46.018 -33.435 1.00 60.52  ? 422 ILE A CA   1 
ATOM   5330 C C    . ILE A 1 351 ? -24.228 -44.564 -33.844 1.00 58.91  ? 422 ILE A C    1 
ATOM   5331 O O    . ILE A 1 351 ? -23.283 -43.814 -34.121 1.00 58.07  ? 422 ILE A O    1 
ATOM   5332 C CB   . ILE A 1 351 ? -24.468 -46.979 -34.542 1.00 63.77  ? 422 ILE A CB   1 
ATOM   5333 C CG1  . ILE A 1 351 ? -24.148 -48.445 -34.215 1.00 63.51  ? 422 ILE A CG1  1 
ATOM   5334 C CG2  . ILE A 1 351 ? -23.829 -46.601 -35.854 1.00 67.08  ? 422 ILE A CG2  1 
ATOM   5335 C CD1  . ILE A 1 351 ? -22.700 -48.716 -33.991 1.00 63.20  ? 422 ILE A CD1  1 
ATOM   5336 H H    . ILE A 1 351 ? -25.214 -46.975 -32.195 1.00 66.76  ? 422 ILE A H    1 
ATOM   5337 H HA   . ILE A 1 351 ? -23.038 -46.135 -33.325 1.00 72.62  ? 422 ILE A HA   1 
ATOM   5338 H HB   . ILE A 1 351 ? -25.430 -46.889 -34.633 1.00 76.52  ? 422 ILE A HB   1 
ATOM   5339 H HG12 . ILE A 1 351 ? -24.622 -48.695 -33.407 1.00 76.21  ? 422 ILE A HG12 1 
ATOM   5340 H HG13 . ILE A 1 351 ? -24.442 -49.001 -34.953 1.00 76.21  ? 422 ILE A HG13 1 
ATOM   5341 H HG21 . ILE A 1 351 ? -23.938 -47.335 -36.479 1.00 80.50  ? 422 ILE A HG21 1 
ATOM   5342 H HG22 . ILE A 1 351 ? -24.260 -45.806 -36.204 1.00 80.50  ? 422 ILE A HG22 1 
ATOM   5343 H HG23 . ILE A 1 351 ? -22.887 -46.433 -35.707 1.00 80.50  ? 422 ILE A HG23 1 
ATOM   5344 H HD11 . ILE A 1 351 ? -22.574 -49.672 -33.887 1.00 75.84  ? 422 ILE A HD11 1 
ATOM   5345 H HD12 . ILE A 1 351 ? -22.192 -48.399 -34.754 1.00 75.84  ? 422 ILE A HD12 1 
ATOM   5346 H HD13 . ILE A 1 351 ? -22.411 -48.259 -33.186 1.00 75.84  ? 422 ILE A HD13 1 
ATOM   5347 N N    . GLU A 1 352 ? -25.492 -44.156 -33.928 1.00 60.62  ? 423 GLU A N    1 
ATOM   5348 C CA   . GLU A 1 352 ? -25.806 -42.840 -34.486 1.00 61.71  ? 423 GLU A CA   1 
ATOM   5349 C C    . GLU A 1 352 ? -25.150 -41.703 -33.709 1.00 54.80  ? 423 GLU A C    1 
ATOM   5350 O O    . GLU A 1 352 ? -24.409 -40.909 -34.312 1.00 49.49  ? 423 GLU A O    1 
ATOM   5351 C CB   . GLU A 1 352 ? -27.330 -42.680 -34.572 1.00 72.23  ? 423 GLU A CB   1 
ATOM   5352 C CG   . GLU A 1 352 ? -27.790 -41.571 -35.519 1.00 82.21  ? 423 GLU A CG   1 
ATOM   5353 C CD   . GLU A 1 352 ? -29.238 -41.761 -36.000 1.00 89.87  ? 423 GLU A CD   1 
ATOM   5354 O OE1  . GLU A 1 352 ? -30.070 -42.300 -35.227 1.00 95.16  ? 423 GLU A OE1  1 
ATOM   5355 O OE2  . GLU A 1 352 ? -29.542 -41.376 -37.153 1.00 89.96  ? 423 GLU A OE2  1 
ATOM   5356 H H    . GLU A 1 352 ? -26.176 -44.612 -33.674 1.00 72.75  ? 423 GLU A H    1 
ATOM   5357 H HA   . GLU A 1 352 ? -25.461 -42.805 -35.392 1.00 74.05  ? 423 GLU A HA   1 
ATOM   5358 H HB2  . GLU A 1 352 ? -27.711 -43.514 -34.890 1.00 86.67  ? 423 GLU A HB2  1 
ATOM   5359 H HB3  . GLU A 1 352 ? -27.681 -42.477 -33.692 1.00 86.67  ? 423 GLU A HB3  1 
ATOM   5360 H HG2  . GLU A 1 352 ? -27.737 -40.719 -35.058 1.00 98.66  ? 423 GLU A HG2  1 
ATOM   5361 H HG3  . GLU A 1 352 ? -27.214 -41.562 -36.299 1.00 98.66  ? 423 GLU A HG3  1 
ATOM   5362 N N    . PRO A 1 353 ? -25.376 -41.546 -32.405 1.00 54.27  ? 424 PRO A N    1 
ATOM   5363 C CA   . PRO A 1 353 ? -24.691 -40.453 -31.684 1.00 54.87  ? 424 PRO A CA   1 
ATOM   5364 C C    . PRO A 1 353 ? -23.170 -40.529 -31.783 1.00 57.09  ? 424 PRO A C    1 
ATOM   5365 O O    . PRO A 1 353 ? -22.487 -39.495 -31.717 1.00 59.57  ? 424 PRO A O    1 
ATOM   5366 C CB   . PRO A 1 353 ? -25.182 -40.626 -30.241 1.00 52.11  ? 424 PRO A CB   1 
ATOM   5367 C CG   . PRO A 1 353 ? -25.668 -42.027 -30.154 1.00 51.92  ? 424 PRO A CG   1 
ATOM   5368 C CD   . PRO A 1 353 ? -26.202 -42.368 -31.506 1.00 53.34  ? 424 PRO A CD   1 
ATOM   5369 H HA   . PRO A 1 353 ? -24.989 -39.593 -32.020 1.00 65.85  ? 424 PRO A HA   1 
ATOM   5370 H HB2  . PRO A 1 353 ? -24.446 -40.480 -29.626 1.00 62.53  ? 424 PRO A HB2  1 
ATOM   5371 H HB3  . PRO A 1 353 ? -25.904 -40.002 -30.066 1.00 62.53  ? 424 PRO A HB3  1 
ATOM   5372 H HG2  . PRO A 1 353 ? -24.930 -42.612 -29.923 1.00 62.31  ? 424 PRO A HG2  1 
ATOM   5373 H HG3  . PRO A 1 353 ? -26.370 -42.085 -29.487 1.00 62.31  ? 424 PRO A HG3  1 
ATOM   5374 H HD2  . PRO A 1 353 ? -26.076 -43.311 -31.686 1.00 64.01  ? 424 PRO A HD2  1 
ATOM   5375 H HD3  . PRO A 1 353 ? -27.135 -42.113 -31.572 1.00 64.01  ? 424 PRO A HD3  1 
ATOM   5376 N N    . LEU A 1 354 ? -22.627 -41.735 -31.947 1.00 56.70  ? 425 LEU A N    1 
ATOM   5377 C CA   . LEU A 1 354 ? -21.197 -41.901 -32.145 1.00 58.48  ? 425 LEU A CA   1 
ATOM   5378 C C    . LEU A 1 354 ? -20.772 -41.376 -33.517 1.00 62.27  ? 425 LEU A C    1 
ATOM   5379 O O    . LEU A 1 354 ? -19.803 -40.616 -33.628 1.00 63.29  ? 425 LEU A O    1 
ATOM   5380 C CB   . LEU A 1 354 ? -20.845 -43.383 -31.976 1.00 58.05  ? 425 LEU A CB   1 
ATOM   5381 C CG   . LEU A 1 354 ? -19.515 -43.793 -31.372 1.00 58.04  ? 425 LEU A CG   1 
ATOM   5382 C CD1  . LEU A 1 354 ? -19.235 -43.090 -30.067 1.00 55.45  ? 425 LEU A CD1  1 
ATOM   5383 C CD2  . LEU A 1 354 ? -19.513 -45.289 -31.144 1.00 59.83  ? 425 LEU A CD2  1 
ATOM   5384 H H    . LEU A 1 354 ? -23.071 -42.471 -31.948 1.00 68.05  ? 425 LEU A H    1 
ATOM   5385 H HA   . LEU A 1 354 ? -20.727 -41.389 -31.471 1.00 70.17  ? 425 LEU A HA   1 
ATOM   5386 H HB2  . LEU A 1 354 ? -21.529 -43.782 -31.417 1.00 69.65  ? 425 LEU A HB2  1 
ATOM   5387 H HB3  . LEU A 1 354 ? -20.885 -43.792 -32.854 1.00 69.65  ? 425 LEU A HB3  1 
ATOM   5388 H HG   . LEU A 1 354 ? -18.802 -43.579 -31.993 1.00 69.65  ? 425 LEU A HG   1 
ATOM   5389 H HD11 . LEU A 1 354 ? -18.430 -43.465 -29.677 1.00 66.54  ? 425 LEU A HD11 1 
ATOM   5390 H HD12 . LEU A 1 354 ? -19.108 -42.143 -30.232 1.00 66.54  ? 425 LEU A HD12 1 
ATOM   5391 H HD13 . LEU A 1 354 ? -19.985 -43.229 -29.469 1.00 66.54  ? 425 LEU A HD13 1 
ATOM   5392 H HD21 . LEU A 1 354 ? -18.616 -45.569 -30.904 1.00 71.79  ? 425 LEU A HD21 1 
ATOM   5393 H HD22 . LEU A 1 354 ? -20.128 -45.500 -30.425 1.00 71.79  ? 425 LEU A HD22 1 
ATOM   5394 H HD23 . LEU A 1 354 ? -19.790 -45.733 -31.961 1.00 71.79  ? 425 LEU A HD23 1 
ATOM   5395 N N    . MET A 1 355 ? -21.494 -41.765 -34.579 1.00 63.46  ? 426 MET A N    1 
ATOM   5396 C CA   . MET A 1 355 ? -21.201 -41.236 -35.911 1.00 67.65  ? 426 MET A CA   1 
ATOM   5397 C C    . MET A 1 355 ? -21.332 -39.720 -35.943 1.00 65.74  ? 426 MET A C    1 
ATOM   5398 O O    . MET A 1 355 ? -20.591 -39.038 -36.654 1.00 67.48  ? 426 MET A O    1 
ATOM   5399 C CB   . MET A 1 355 ? -22.141 -41.836 -36.958 1.00 74.11  ? 426 MET A CB   1 
ATOM   5400 C CG   . MET A 1 355 ? -22.084 -43.339 -37.131 1.00 79.47  ? 426 MET A CG   1 
ATOM   5401 S SD   . MET A 1 355 ? -20.441 -44.000 -37.451 1.00 83.92  ? 426 MET A SD   1 
ATOM   5402 C CE   . MET A 1 355 ? -20.204 -44.875 -35.917 1.00 84.48  ? 426 MET A CE   1 
ATOM   5403 H H    . MET A 1 355 ? -22.147 -42.324 -34.552 1.00 76.15  ? 426 MET A H    1 
ATOM   5404 H HA   . MET A 1 355 ? -20.293 -41.476 -36.151 1.00 81.18  ? 426 MET A HA   1 
ATOM   5405 H HB2  . MET A 1 355 ? -23.052 -41.609 -36.714 1.00 88.93  ? 426 MET A HB2  1 
ATOM   5406 H HB3  . MET A 1 355 ? -21.931 -41.439 -37.818 1.00 88.93  ? 426 MET A HB3  1 
ATOM   5407 H HG2  . MET A 1 355 ? -22.420 -43.756 -36.324 1.00 95.37  ? 426 MET A HG2  1 
ATOM   5408 H HG3  . MET A 1 355 ? -22.648 -43.584 -37.881 1.00 95.37  ? 426 MET A HG3  1 
ATOM   5409 H HE1  . MET A 1 355 ? -19.492 -45.521 -36.034 1.00 101.38 ? 426 MET A HE1  1 
ATOM   5410 H HE2  . MET A 1 355 ? -19.967 -44.240 -35.223 1.00 101.38 ? 426 MET A HE2  1 
ATOM   5411 H HE3  . MET A 1 355 ? -21.023 -45.334 -35.681 1.00 101.38 ? 426 MET A HE3  1 
ATOM   5412 N N    . ASN A 1 356 ? -22.299 -39.173 -35.216 1.00 64.40  ? 427 ASN A N    1 
ATOM   5413 C CA   . ASN A 1 356 ? -22.513 -37.734 -35.275 1.00 64.95  ? 427 ASN A CA   1 
ATOM   5414 C C    . ASN A 1 356 ? -21.315 -36.955 -34.758 1.00 68.84  ? 427 ASN A C    1 
ATOM   5415 O O    . ASN A 1 356 ? -21.074 -35.828 -35.206 1.00 73.22  ? 427 ASN A O    1 
ATOM   5416 C CB   . ASN A 1 356 ? -23.760 -37.368 -34.492 1.00 63.41  ? 427 ASN A CB   1 
ATOM   5417 C CG   . ASN A 1 356 ? -25.011 -37.777 -35.212 1.00 67.24  ? 427 ASN A CG   1 
ATOM   5418 O OD1  . ASN A 1 356 ? -24.945 -38.324 -36.317 1.00 72.83  ? 427 ASN A OD1  1 
ATOM   5419 N ND2  . ASN A 1 356 ? -26.161 -37.523 -34.604 1.00 66.14  ? 427 ASN A ND2  1 
ATOM   5420 H H    . ASN A 1 356 ? -22.832 -39.600 -34.694 1.00 77.28  ? 427 ASN A H    1 
ATOM   5421 H HA   . ASN A 1 356 ? -22.655 -37.477 -36.199 1.00 77.94  ? 427 ASN A HA   1 
ATOM   5422 H HB2  . ASN A 1 356 ? -23.742 -37.821 -33.634 1.00 76.09  ? 427 ASN A HB2  1 
ATOM   5423 H HB3  . ASN A 1 356 ? -23.785 -36.407 -34.363 1.00 76.09  ? 427 ASN A HB3  1 
ATOM   5424 H HD21 . ASN A 1 356 ? -26.903 -37.740 -34.980 1.00 79.37  ? 427 ASN A HD21 1 
ATOM   5425 H HD22 . ASN A 1 356 ? -26.165 -37.141 -33.834 1.00 79.37  ? 427 ASN A HD22 1 
ATOM   5426 N N    . LEU A 1 357 ? -20.558 -37.526 -33.819 1.00 68.51  ? 428 LEU A N    1 
ATOM   5427 C CA   . LEU A 1 357 ? -19.381 -36.856 -33.280 1.00 69.84  ? 428 LEU A CA   1 
ATOM   5428 C C    . LEU A 1 357 ? -18.173 -36.912 -34.208 1.00 69.26  ? 428 LEU A C    1 
ATOM   5429 O O    . LEU A 1 357 ? -17.172 -36.244 -33.924 1.00 72.42  ? 428 LEU A O    1 
ATOM   5430 C CB   . LEU A 1 357 ? -18.986 -37.462 -31.930 1.00 70.44  ? 428 LEU A CB   1 
ATOM   5431 C CG   . LEU A 1 357 ? -19.762 -36.995 -30.704 1.00 69.56  ? 428 LEU A CG   1 
ATOM   5432 C CD1  . LEU A 1 357 ? -19.178 -37.691 -29.523 1.00 68.47  ? 428 LEU A CD1  1 
ATOM   5433 C CD2  . LEU A 1 357 ? -19.707 -35.485 -30.508 1.00 69.76  ? 428 LEU A CD2  1 
ATOM   5434 H H    . LEU A 1 357 ? -20.707 -38.302 -33.479 1.00 82.21  ? 428 LEU A H    1 
ATOM   5435 H HA   . LEU A 1 357 ? -19.596 -35.921 -33.140 1.00 83.81  ? 428 LEU A HA   1 
ATOM   5436 H HB2  . LEU A 1 357 ? -19.095 -38.424 -31.988 1.00 84.53  ? 428 LEU A HB2  1 
ATOM   5437 H HB3  . LEU A 1 357 ? -18.052 -37.256 -31.771 1.00 84.53  ? 428 LEU A HB3  1 
ATOM   5438 H HG   . LEU A 1 357 ? -20.691 -37.261 -30.789 1.00 83.47  ? 428 LEU A HG   1 
ATOM   5439 H HD11 . LEU A 1 357 ? -19.663 -37.423 -28.727 1.00 82.16  ? 428 LEU A HD11 1 
ATOM   5440 H HD12 . LEU A 1 357 ? -19.256 -38.649 -29.651 1.00 82.16  ? 428 LEU A HD12 1 
ATOM   5441 H HD13 . LEU A 1 357 ? -18.244 -37.443 -29.441 1.00 82.16  ? 428 LEU A HD13 1 
ATOM   5442 H HD21 . LEU A 1 357 ? -20.042 -35.270 -29.623 1.00 83.71  ? 428 LEU A HD21 1 
ATOM   5443 H HD22 . LEU A 1 357 ? -18.787 -35.189 -30.595 1.00 83.71  ? 428 LEU A HD22 1 
ATOM   5444 H HD23 . LEU A 1 357 ? -20.257 -35.057 -31.183 1.00 83.71  ? 428 LEU A HD23 1 
ATOM   5445 N N    . LEU A 1 358 ? -18.225 -37.700 -35.285 1.00 64.71  ? 429 LEU A N    1 
ATOM   5446 C CA   . LEU A 1 358 ? -17.151 -37.679 -36.268 1.00 66.63  ? 429 LEU A CA   1 
ATOM   5447 C C    . LEU A 1 358 ? -17.091 -36.361 -37.027 1.00 74.74  ? 429 LEU A C    1 
ATOM   5448 O O    . LEU A 1 358 ? -16.099 -36.097 -37.712 1.00 77.76  ? 429 LEU A O    1 
ATOM   5449 C CB   . LEU A 1 358 ? -17.310 -38.840 -37.250 1.00 63.87  ? 429 LEU A CB   1 
ATOM   5450 C CG   . LEU A 1 358 ? -16.863 -40.213 -36.748 1.00 61.90  ? 429 LEU A CG   1 
ATOM   5451 C CD1  . LEU A 1 358 ? -17.141 -41.278 -37.785 1.00 59.96  ? 429 LEU A CD1  1 
ATOM   5452 C CD2  . LEU A 1 358 ? -15.379 -40.213 -36.410 1.00 63.89  ? 429 LEU A CD2  1 
ATOM   5453 H H    . LEU A 1 358 ? -18.864 -38.247 -35.464 1.00 77.65  ? 429 LEU A H    1 
ATOM   5454 H HA   . LEU A 1 358 ? -16.306 -37.786 -35.805 1.00 79.96  ? 429 LEU A HA   1 
ATOM   5455 H HB2  . LEU A 1 358 ? -18.247 -38.911 -37.489 1.00 76.64  ? 429 LEU A HB2  1 
ATOM   5456 H HB3  . LEU A 1 358 ? -16.790 -38.640 -38.044 1.00 76.64  ? 429 LEU A HB3  1 
ATOM   5457 H HG   . LEU A 1 358 ? -17.358 -40.436 -35.944 1.00 74.28  ? 429 LEU A HG   1 
ATOM   5458 H HD11 . LEU A 1 358 ? -16.866 -42.140 -37.434 1.00 71.95  ? 429 LEU A HD11 1 
ATOM   5459 H HD12 . LEU A 1 358 ? -18.091 -41.288 -37.980 1.00 71.95  ? 429 LEU A HD12 1 
ATOM   5460 H HD13 . LEU A 1 358 ? -16.640 -41.073 -38.590 1.00 71.95  ? 429 LEU A HD13 1 
ATOM   5461 H HD21 . LEU A 1 358 ? -15.077 -41.130 -36.315 1.00 76.67  ? 429 LEU A HD21 1 
ATOM   5462 H HD22 . LEU A 1 358 ? -14.893 -39.777 -37.127 1.00 76.67  ? 429 LEU A HD22 1 
ATOM   5463 H HD23 . LEU A 1 358 ? -15.243 -39.733 -35.579 1.00 76.67  ? 429 LEU A HD23 1 
ATOM   5464 N N    . SER A 1 359 ? -18.124 -35.532 -36.914 1.00 80.88  ? 430 SER A N    1 
ATOM   5465 C CA   . SER A 1 359 ? -18.076 -34.178 -37.438 1.00 87.36  ? 430 SER A CA   1 
ATOM   5466 C C    . SER A 1 359 ? -17.213 -33.259 -36.590 1.00 96.71  ? 430 SER A C    1 
ATOM   5467 O O    . SER A 1 359 ? -16.890 -32.156 -37.036 1.00 96.02  ? 430 SER A O    1 
ATOM   5468 C CB   . SER A 1 359 ? -19.493 -33.606 -37.525 1.00 85.24  ? 430 SER A CB   1 
ATOM   5469 O OG   . SER A 1 359 ? -20.357 -34.475 -38.237 1.00 84.18  ? 430 SER A OG   1 
ATOM   5470 H H    . SER A 1 359 ? -18.869 -35.734 -36.536 1.00 97.05  ? 430 SER A H    1 
ATOM   5471 H HA   . SER A 1 359 ? -17.704 -34.198 -38.334 1.00 104.83 ? 430 SER A HA   1 
ATOM   5472 H HB2  . SER A 1 359 ? -19.839 -33.486 -36.627 1.00 102.29 ? 430 SER A HB2  1 
ATOM   5473 H HB3  . SER A 1 359 ? -19.459 -32.752 -37.983 1.00 102.29 ? 430 SER A HB3  1 
ATOM   5474 H HG   . SER A 1 359 ? -20.085 -34.565 -39.027 1.00 101.01 ? 430 SER A HG   1 
ATOM   5475 N N    . ALA A 1 360 ? -16.844 -33.674 -35.384 1.00 104.25 ? 431 ALA A N    1 
ATOM   5476 C CA   . ALA A 1 360 ? -16.089 -32.801 -34.500 1.00 112.93 ? 431 ALA A CA   1 
ATOM   5477 C C    . ALA A 1 360 ? -14.712 -32.514 -35.086 1.00 114.74 ? 431 ALA A C    1 
ATOM   5478 O O    . ALA A 1 360 ? -14.028 -33.411 -35.590 1.00 120.39 ? 431 ALA A O    1 
ATOM   5479 C CB   . ALA A 1 360 ? -15.957 -33.433 -33.115 1.00 113.13 ? 431 ALA A CB   1 
ATOM   5480 H H    . ALA A 1 360 ? -17.017 -34.450 -35.056 1.00 125.10 ? 431 ALA A H    1 
ATOM   5481 H HA   . ALA A 1 360 ? -16.560 -31.958 -34.405 1.00 135.52 ? 431 ALA A HA   1 
ATOM   5482 H HB1  . ALA A 1 360 ? -15.449 -32.836 -32.543 1.00 135.76 ? 431 ALA A HB1  1 
ATOM   5483 H HB2  . ALA A 1 360 ? -16.843 -33.571 -32.746 1.00 135.76 ? 431 ALA A HB2  1 
ATOM   5484 H HB3  . ALA A 1 360 ? -15.497 -34.283 -33.199 1.00 135.76 ? 431 ALA A HB3  1 
ATOM   5485 N N    . LYS A 1 361 ? -14.317 -31.240 -35.035 1.00 112.62 ? 432 LYS A N    1 
ATOM   5486 C CA   . LYS A 1 361 ? -12.986 -30.855 -35.488 1.00 111.54 ? 432 LYS A CA   1 
ATOM   5487 C C    . LYS A 1 361 ? -11.902 -31.529 -34.653 1.00 114.30 ? 432 LYS A C    1 
ATOM   5488 O O    . LYS A 1 361 ? -10.834 -31.865 -35.178 1.00 113.04 ? 432 LYS A O    1 
ATOM   5489 C CB   . LYS A 1 361 ? -12.842 -29.328 -35.436 1.00 115.31 ? 432 LYS A CB   1 
ATOM   5490 C CG   . LYS A 1 361 ? -13.020 -28.726 -34.036 1.00 118.70 ? 432 LYS A CG   1 
ATOM   5491 C CD   . LYS A 1 361 ? -12.848 -27.206 -34.017 1.00 125.40 ? 432 LYS A CD   1 
ATOM   5492 C CE   . LYS A 1 361 ? -12.929 -26.661 -32.589 1.00 129.19 ? 432 LYS A CE   1 
ATOM   5493 N NZ   . LYS A 1 361 ? -12.732 -25.184 -32.509 1.00 133.64 ? 432 LYS A NZ   1 
ATOM   5494 H H    . LYS A 1 361 ? -14.798 -30.589 -34.746 1.00 135.15 ? 432 LYS A H    1 
ATOM   5495 H HA   . LYS A 1 361 ? -12.872 -31.136 -36.409 1.00 133.84 ? 432 LYS A HA   1 
ATOM   5496 H HB2  . LYS A 1 361 ? -11.956 -29.088 -35.750 1.00 138.37 ? 432 LYS A HB2  1 
ATOM   5497 H HB3  . LYS A 1 361 ? -13.512 -28.932 -36.015 1.00 138.37 ? 432 LYS A HB3  1 
ATOM   5498 H HG2  . LYS A 1 361 ? -13.912 -28.930 -33.715 1.00 142.44 ? 432 LYS A HG2  1 
ATOM   5499 H HG3  . LYS A 1 361 ? -12.357 -29.108 -33.440 1.00 142.44 ? 432 LYS A HG3  1 
ATOM   5500 H HD2  . LYS A 1 361 ? -11.980 -26.976 -34.383 1.00 150.48 ? 432 LYS A HD2  1 
ATOM   5501 H HD3  . LYS A 1 361 ? -13.554 -26.796 -34.541 1.00 150.48 ? 432 LYS A HD3  1 
ATOM   5502 H HE2  . LYS A 1 361 ? -13.804 -26.865 -32.224 1.00 155.03 ? 432 LYS A HE2  1 
ATOM   5503 H HE3  . LYS A 1 361 ? -12.240 -27.083 -32.052 1.00 155.03 ? 432 LYS A HE3  1 
ATOM   5504 H HZ1  . LYS A 1 361 ? -12.788 -24.915 -31.662 1.00 160.36 ? 432 LYS A HZ1  1 
ATOM   5505 H HZ2  . LYS A 1 361 ? -11.931 -24.966 -32.830 1.00 160.36 ? 432 LYS A HZ2  1 
ATOM   5506 H HZ3  . LYS A 1 361 ? -13.357 -24.768 -32.986 1.00 160.36 ? 432 LYS A HZ3  1 
ATOM   5507 N N    . ASP A 1 362 ? -12.169 -31.753 -33.365 1.00 115.99 ? 433 ASP A N    1 
ATOM   5508 C CA   . ASP A 1 362 ? -11.174 -32.311 -32.455 1.00 115.43 ? 433 ASP A CA   1 
ATOM   5509 C C    . ASP A 1 362 ? -10.633 -33.635 -32.985 1.00 105.78 ? 433 ASP A C    1 
ATOM   5510 O O    . ASP A 1 362 ? -11.391 -34.571 -33.252 1.00 109.97 ? 433 ASP A O    1 
ATOM   5511 C CB   . ASP A 1 362 ? -11.793 -32.507 -31.070 1.00 115.51 ? 433 ASP A CB   1 
ATOM   5512 C CG   . ASP A 1 362 ? -10.769 -32.902 -30.020 1.00 118.11 ? 433 ASP A CG   1 
ATOM   5513 O OD1  . ASP A 1 362 ? -10.376 -34.087 -29.979 1.00 116.94 ? 433 ASP A OD1  1 
ATOM   5514 O OD2  . ASP A 1 362 ? -10.365 -32.029 -29.224 1.00 121.63 ? 433 ASP A OD2  1 
ATOM   5515 H H    . ASP A 1 362 ? -12.927 -31.588 -32.993 1.00 139.18 ? 433 ASP A H    1 
ATOM   5516 H HA   . ASP A 1 362 ? -10.433 -31.691 -32.372 1.00 138.52 ? 433 ASP A HA   1 
ATOM   5517 H HB2  . ASP A 1 362 ? -12.207 -31.676 -30.788 1.00 138.61 ? 433 ASP A HB2  1 
ATOM   5518 H HB3  . ASP A 1 362 ? -12.460 -33.210 -31.118 1.00 138.61 ? 433 ASP A HB3  1 
ATOM   5519 N N    . THR A 1 363 ? -9.309  -33.711 -33.128 1.00 92.37  ? 434 THR A N    1 
ATOM   5520 C CA   . THR A 1 363 ? -8.679  -34.898 -33.696 1.00 84.49  ? 434 THR A CA   1 
ATOM   5521 C C    . THR A 1 363 ? -8.624  -36.044 -32.698 1.00 82.67  ? 434 THR A C    1 
ATOM   5522 O O    . THR A 1 363 ? -8.725  -37.214 -33.086 1.00 75.18  ? 434 THR A O    1 
ATOM   5523 C CB   . THR A 1 363 ? -7.267  -34.563 -34.167 1.00 87.39  ? 434 THR A CB   1 
ATOM   5524 O OG1  . THR A 1 363 ? -7.337  -33.622 -35.244 1.00 91.28  ? 434 THR A OG1  1 
ATOM   5525 C CG2  . THR A 1 363 ? -6.542  -35.822 -34.639 1.00 87.04  ? 434 THR A CG2  1 
ATOM   5526 H H    . THR A 1 363 ? -8.757  -33.090 -32.904 1.00 110.85 ? 434 THR A H    1 
ATOM   5527 H HA   . THR A 1 363 ? -9.192  -35.192 -34.465 1.00 101.39 ? 434 THR A HA   1 
ATOM   5528 H HB   . THR A 1 363 ? -6.765  -34.177 -33.433 1.00 104.87 ? 434 THR A HB   1 
ATOM   5529 H HG1  . THR A 1 363 ? -6.563  -33.432 -35.510 1.00 109.53 ? 434 THR A HG1  1 
ATOM   5530 H HG21 . THR A 1 363 ? -5.795  -35.578 -35.208 1.00 104.45 ? 434 THR A HG21 1 
ATOM   5531 H HG22 . THR A 1 363 ? -6.206  -36.319 -33.877 1.00 104.45 ? 434 THR A HG22 1 
ATOM   5532 H HG23 . THR A 1 363 ? -7.150  -36.385 -35.144 1.00 104.45 ? 434 THR A HG23 1 
ATOM   5533 N N    . LYS A 1 364 ? -8.422  -35.734 -31.417 1.00 90.63  ? 435 LYS A N    1 
ATOM   5534 C CA   . LYS A 1 364 ? -8.279  -36.790 -30.426 1.00 94.10  ? 435 LYS A CA   1 
ATOM   5535 C C    . LYS A 1 364 ? -9.554  -37.615 -30.326 1.00 84.92  ? 435 LYS A C    1 
ATOM   5536 O O    . LYS A 1 364 ? -9.498  -38.848 -30.232 1.00 83.98  ? 435 LYS A O    1 
ATOM   5537 C CB   . LYS A 1 364 ? -7.913  -36.185 -29.073 1.00 101.58 ? 435 LYS A CB   1 
ATOM   5538 C CG   . LYS A 1 364 ? -7.540  -37.212 -28.022 1.00 107.28 ? 435 LYS A CG   1 
ATOM   5539 C CD   . LYS A 1 364 ? -6.165  -37.831 -28.289 1.00 111.76 ? 435 LYS A CD   1 
ATOM   5540 C CE   . LYS A 1 364 ? -5.891  -39.011 -27.351 1.00 109.79 ? 435 LYS A CE   1 
ATOM   5541 N NZ   . LYS A 1 364 ? -6.128  -38.663 -25.912 1.00 106.02 ? 435 LYS A NZ   1 
ATOM   5542 H H    . LYS A 1 364 ? -8.365  -34.935 -31.104 1.00 108.75 ? 435 LYS A H    1 
ATOM   5543 H HA   . LYS A 1 364 ? -7.561  -37.381 -30.699 1.00 112.92 ? 435 LYS A HA   1 
ATOM   5544 H HB2  . LYS A 1 364 ? -7.154  -35.593 -29.191 1.00 121.89 ? 435 LYS A HB2  1 
ATOM   5545 H HB3  . LYS A 1 364 ? -8.673  -35.683 -28.740 1.00 121.89 ? 435 LYS A HB3  1 
ATOM   5546 H HG2  . LYS A 1 364 ? -7.513  -36.781 -27.154 1.00 128.74 ? 435 LYS A HG2  1 
ATOM   5547 H HG3  . LYS A 1 364 ? -8.197  -37.925 -28.019 1.00 128.74 ? 435 LYS A HG3  1 
ATOM   5548 H HD2  . LYS A 1 364 ? -6.128  -38.156 -29.202 1.00 134.11 ? 435 LYS A HD2  1 
ATOM   5549 H HD3  . LYS A 1 364 ? -5.479  -37.161 -28.143 1.00 134.11 ? 435 LYS A HD3  1 
ATOM   5550 H HE2  . LYS A 1 364 ? -6.480  -39.745 -27.584 1.00 131.75 ? 435 LYS A HE2  1 
ATOM   5551 H HE3  . LYS A 1 364 ? -4.965  -39.284 -27.446 1.00 131.75 ? 435 LYS A HE3  1 
ATOM   5552 H HZ1  . LYS A 1 364 ? -5.629  -37.963 -25.682 1.00 127.22 ? 435 LYS A HZ1  1 
ATOM   5553 H HZ2  . LYS A 1 364 ? -6.985  -38.462 -25.785 1.00 127.22 ? 435 LYS A HZ2  1 
ATOM   5554 H HZ3  . LYS A 1 364 ? -5.914  -39.354 -25.393 1.00 127.22 ? 435 LYS A HZ3  1 
ATOM   5555 N N    . ILE A 1 365 ? -10.714 -36.954 -30.365 1.00 78.62  ? 436 ILE A N    1 
ATOM   5556 C CA   . ILE A 1 365 ? -11.978 -37.667 -30.224 1.00 72.40  ? 436 ILE A CA   1 
ATOM   5557 C C    . ILE A 1 365 ? -12.278 -38.497 -31.467 1.00 70.66  ? 436 ILE A C    1 
ATOM   5558 O O    . ILE A 1 365 ? -12.900 -39.561 -31.370 1.00 66.77  ? 436 ILE A O    1 
ATOM   5559 C CB   . ILE A 1 365 ? -13.125 -36.684 -29.907 1.00 71.52  ? 436 ILE A CB   1 
ATOM   5560 C CG1  . ILE A 1 365 ? -14.332 -37.449 -29.360 1.00 69.46  ? 436 ILE A CG1  1 
ATOM   5561 C CG2  . ILE A 1 365 ? -13.543 -35.894 -31.148 1.00 73.06  ? 436 ILE A CG2  1 
ATOM   5562 C CD1  . ILE A 1 365 ? -15.524 -36.569 -28.955 1.00 68.71  ? 436 ILE A CD1  1 
ATOM   5563 H H    . ILE A 1 365 ? -10.792 -36.104 -30.471 1.00 94.34  ? 436 ILE A H    1 
ATOM   5564 H HA   . ILE A 1 365 ? -11.904 -38.280 -29.476 1.00 86.88  ? 436 ILE A HA   1 
ATOM   5565 H HB   . ILE A 1 365 ? -12.820 -36.060 -29.230 1.00 85.82  ? 436 ILE A HB   1 
ATOM   5566 H HG12 . ILE A 1 365 ? -14.642 -38.066 -30.041 1.00 83.36  ? 436 ILE A HG12 1 
ATOM   5567 H HG13 . ILE A 1 365 ? -14.054 -37.945 -28.574 1.00 83.36  ? 436 ILE A HG13 1 
ATOM   5568 H HG21 . ILE A 1 365 ? -14.075 -35.131 -30.872 1.00 87.67  ? 436 ILE A HG21 1 
ATOM   5569 H HG22 . ILE A 1 365 ? -12.746 -35.592 -31.608 1.00 87.67  ? 436 ILE A HG22 1 
ATOM   5570 H HG23 . ILE A 1 365 ? -14.064 -36.469 -31.730 1.00 87.67  ? 436 ILE A HG23 1 
ATOM   5571 H HD11 . ILE A 1 365 ? -16.169 -37.113 -28.477 1.00 82.45  ? 436 ILE A HD11 1 
ATOM   5572 H HD12 . ILE A 1 365 ? -15.208 -35.853 -28.384 1.00 82.45  ? 436 ILE A HD12 1 
ATOM   5573 H HD13 . ILE A 1 365 ? -15.930 -36.199 -29.755 1.00 82.45  ? 436 ILE A HD13 1 
ATOM   5574 N N    . ILE A 1 366 ? -11.864 -38.037 -32.651 1.00 71.37  ? 437 ILE A N    1 
ATOM   5575 C CA   . ILE A 1 366 ? -12.093 -38.831 -33.854 1.00 73.40  ? 437 ILE A CA   1 
ATOM   5576 C C    . ILE A 1 366 ? -11.368 -40.162 -33.741 1.00 72.36  ? 437 ILE A C    1 
ATOM   5577 O O    . ILE A 1 366 ? -11.903 -41.212 -34.123 1.00 71.32  ? 437 ILE A O    1 
ATOM   5578 C CB   . ILE A 1 366 ? -11.658 -38.053 -35.111 1.00 76.99  ? 437 ILE A CB   1 
ATOM   5579 C CG1  . ILE A 1 366 ? -12.566 -36.840 -35.335 1.00 79.20  ? 437 ILE A CG1  1 
ATOM   5580 C CG2  . ILE A 1 366 ? -11.710 -38.949 -36.324 1.00 76.62  ? 437 ILE A CG2  1 
ATOM   5581 C CD1  . ILE A 1 366 ? -12.108 -35.901 -36.442 1.00 82.65  ? 437 ILE A CD1  1 
ATOM   5582 H H    . ILE A 1 366 ? -11.460 -37.289 -32.780 1.00 85.65  ? 437 ILE A H    1 
ATOM   5583 H HA   . ILE A 1 366 ? -13.042 -39.015 -33.932 1.00 88.08  ? 437 ILE A HA   1 
ATOM   5584 H HB   . ILE A 1 366 ? -10.747 -37.744 -34.989 1.00 92.39  ? 437 ILE A HB   1 
ATOM   5585 H HG12 . ILE A 1 366 ? -13.453 -37.156 -35.567 1.00 95.04  ? 437 ILE A HG12 1 
ATOM   5586 H HG13 . ILE A 1 366 ? -12.608 -36.327 -34.513 1.00 95.04  ? 437 ILE A HG13 1 
ATOM   5587 H HG21 . ILE A 1 366 ? -11.636 -38.410 -37.126 1.00 91.95  ? 437 ILE A HG21 1 
ATOM   5588 H HG22 . ILE A 1 366 ? -10.972 -39.578 -36.288 1.00 91.95  ? 437 ILE A HG22 1 
ATOM   5589 H HG23 . ILE A 1 366 ? -12.554 -39.427 -36.326 1.00 91.95  ? 437 ILE A HG23 1 
ATOM   5590 H HD11 . ILE A 1 366 ? -12.560 -35.050 -36.344 1.00 99.18  ? 437 ILE A HD11 1 
ATOM   5591 H HD12 . ILE A 1 366 ? -11.149 -35.775 -36.370 1.00 99.18  ? 437 ILE A HD12 1 
ATOM   5592 H HD13 . ILE A 1 366 ? -12.326 -36.294 -37.301 1.00 99.18  ? 437 ILE A HD13 1 
ATOM   5593 N N    . GLN A 1 367 ? -10.135 -40.139 -33.225 1.00 75.28  ? 438 GLN A N    1 
ATOM   5594 C CA   . GLN A 1 367 ? -9.390  -41.379 -33.043 1.00 77.80  ? 438 GLN A CA   1 
ATOM   5595 C C    . GLN A 1 367 ? -10.081 -42.283 -32.031 1.00 69.72  ? 438 GLN A C    1 
ATOM   5596 O O    . GLN A 1 367 ? -10.141 -43.502 -32.210 1.00 65.04  ? 438 GLN A O    1 
ATOM   5597 C CB   . GLN A 1 367 ? -7.957  -41.078 -32.595 1.00 91.11  ? 438 GLN A CB   1 
ATOM   5598 C CG   . GLN A 1 367 ? -7.237  -40.044 -33.441 1.00 105.18 ? 438 GLN A CG   1 
ATOM   5599 C CD   . GLN A 1 367 ? -5.729  -40.035 -33.213 1.00 118.31 ? 438 GLN A CD   1 
ATOM   5600 O OE1  . GLN A 1 367 ? -5.084  -41.085 -33.212 1.00 127.30 ? 438 GLN A OE1  1 
ATOM   5601 N NE2  . GLN A 1 367 ? -5.165  -38.845 -33.012 1.00 119.09 ? 438 GLN A NE2  1 
ATOM   5602 H H    . GLN A 1 367 ? -9.718  -39.429 -32.977 1.00 90.33  ? 438 GLN A H    1 
ATOM   5603 H HA   . GLN A 1 367 ? -9.348  -41.851 -33.889 1.00 93.36  ? 438 GLN A HA   1 
ATOM   5604 H HB2  . GLN A 1 367 ? -7.980  -40.748 -31.683 1.00 109.33 ? 438 GLN A HB2  1 
ATOM   5605 H HB3  . GLN A 1 367 ? -7.442  -41.899 -32.632 1.00 109.33 ? 438 GLN A HB3  1 
ATOM   5606 H HG2  . GLN A 1 367 ? -7.398  -40.235 -34.378 1.00 126.22 ? 438 GLN A HG2  1 
ATOM   5607 H HG3  . GLN A 1 367 ? -7.574  -39.166 -33.218 1.00 126.22 ? 438 GLN A HG3  1 
ATOM   5608 H HE21 . GLN A 1 367 ? -5.654  -38.139 -32.969 1.00 142.91 ? 438 GLN A HE21 1 
ATOM   5609 H HE22 . GLN A 1 367 ? -4.312  -38.783 -32.923 1.00 142.91 ? 438 GLN A HE22 1 
ATOM   5610 N N    . VAL A 1 368 ? -10.599 -41.704 -30.955 1.00 69.61  ? 439 VAL A N    1 
ATOM   5611 C CA   . VAL A 1 368 ? -11.330 -42.484 -29.961 1.00 69.09  ? 439 VAL A CA   1 
ATOM   5612 C C    . VAL A 1 368 ? -12.531 -43.176 -30.605 1.00 65.63  ? 439 VAL A C    1 
ATOM   5613 O O    . VAL A 1 368 ? -12.756 -44.379 -30.413 1.00 63.85  ? 439 VAL A O    1 
ATOM   5614 C CB   . VAL A 1 368 ? -11.744 -41.566 -28.796 1.00 70.36  ? 439 VAL A CB   1 
ATOM   5615 C CG1  . VAL A 1 368 ? -12.660 -42.272 -27.826 1.00 67.59  ? 439 VAL A CG1  1 
ATOM   5616 C CG2  . VAL A 1 368 ? -10.486 -41.055 -28.066 1.00 73.93  ? 439 VAL A CG2  1 
ATOM   5617 H H    . VAL A 1 368 ? -10.543 -40.865 -30.776 1.00 83.52  ? 439 VAL A H    1 
ATOM   5618 H HA   . VAL A 1 368 ? -10.744 -43.171 -29.606 1.00 82.90  ? 439 VAL A HA   1 
ATOM   5619 H HB   . VAL A 1 368 ? -12.218 -40.798 -29.152 1.00 84.43  ? 439 VAL A HB   1 
ATOM   5620 H HG11 . VAL A 1 368 ? -12.864 -41.667 -27.096 1.00 81.11  ? 439 VAL A HG11 1 
ATOM   5621 H HG12 . VAL A 1 368 ? -13.479 -42.530 -28.276 1.00 81.11  ? 439 VAL A HG12 1 
ATOM   5622 H HG13 . VAL A 1 368 ? -12.203 -43.055 -27.483 1.00 81.11  ? 439 VAL A HG13 1 
ATOM   5623 H HG21 . VAL A 1 368 ? -10.751 -40.395 -27.407 1.00 88.72  ? 439 VAL A HG21 1 
ATOM   5624 H HG22 . VAL A 1 368 ? -10.051 -41.803 -27.628 1.00 88.72  ? 439 VAL A HG22 1 
ATOM   5625 H HG23 . VAL A 1 368 ? -9.884  -40.654 -28.711 1.00 88.72  ? 439 VAL A HG23 1 
ATOM   5626 N N    . ILE A 1 369 ? -13.309 -42.424 -31.392 1.00 64.89  ? 440 ILE A N    1 
ATOM   5627 C CA   . ILE A 1 369 ? -14.524 -42.956 -32.012 1.00 63.04  ? 440 ILE A CA   1 
ATOM   5628 C C    . ILE A 1 369 ? -14.183 -44.083 -32.986 1.00 62.70  ? 440 ILE A C    1 
ATOM   5629 O O    . ILE A 1 369 ? -14.781 -45.167 -32.947 1.00 60.98  ? 440 ILE A O    1 
ATOM   5630 C CB   . ILE A 1 369 ? -15.296 -41.818 -32.705 1.00 63.75  ? 440 ILE A CB   1 
ATOM   5631 C CG1  . ILE A 1 369 ? -15.830 -40.839 -31.657 1.00 64.90  ? 440 ILE A CG1  1 
ATOM   5632 C CG2  . ILE A 1 369 ? -16.435 -42.360 -33.579 1.00 62.08  ? 440 ILE A CG2  1 
ATOM   5633 C CD1  . ILE A 1 369 ? -16.320 -39.508 -32.236 1.00 67.39  ? 440 ILE A CD1  1 
ATOM   5634 H H    . ILE A 1 369 ? -13.153 -41.600 -31.582 1.00 77.87  ? 440 ILE A H    1 
ATOM   5635 H HA   . ILE A 1 369 ? -15.095 -43.324 -31.319 1.00 75.65  ? 440 ILE A HA   1 
ATOM   5636 H HB   . ILE A 1 369 ? -14.677 -41.339 -33.278 1.00 76.50  ? 440 ILE A HB   1 
ATOM   5637 H HG12 . ILE A 1 369 ? -16.577 -41.253 -31.197 1.00 77.88  ? 440 ILE A HG12 1 
ATOM   5638 H HG13 . ILE A 1 369 ? -15.124 -40.642 -31.022 1.00 77.88  ? 440 ILE A HG13 1 
ATOM   5639 H HG21 . ILE A 1 369 ? -17.046 -41.638 -33.789 1.00 74.49  ? 440 ILE A HG21 1 
ATOM   5640 H HG22 . ILE A 1 369 ? -16.061 -42.723 -34.397 1.00 74.49  ? 440 ILE A HG22 1 
ATOM   5641 H HG23 . ILE A 1 369 ? -16.902 -43.055 -33.091 1.00 74.49  ? 440 ILE A HG23 1 
ATOM   5642 H HD11 . ILE A 1 369 ? -16.472 -38.886 -31.508 1.00 80.87  ? 440 ILE A HD11 1 
ATOM   5643 H HD12 . ILE A 1 369 ? -15.643 -39.157 -32.835 1.00 80.87  ? 440 ILE A HD12 1 
ATOM   5644 H HD13 . ILE A 1 369 ? -17.146 -39.658 -32.722 1.00 80.87  ? 440 ILE A HD13 1 
ATOM   5645 N N    . LEU A 1 370 ? -13.224 -43.842 -33.882 1.00 61.82  ? 441 LEU A N    1 
ATOM   5646 C CA   . LEU A 1 370 ? -12.822 -44.885 -34.822 1.00 64.77  ? 441 LEU A CA   1 
ATOM   5647 C C    . LEU A 1 370 ? -12.378 -46.148 -34.096 1.00 67.51  ? 441 LEU A C    1 
ATOM   5648 O O    . LEU A 1 370 ? -12.649 -47.263 -34.557 1.00 61.68  ? 441 LEU A O    1 
ATOM   5649 C CB   . LEU A 1 370 ? -11.703 -44.371 -35.727 1.00 69.21  ? 441 LEU A CB   1 
ATOM   5650 C CG   . LEU A 1 370 ? -12.096 -43.260 -36.694 1.00 73.75  ? 441 LEU A CG   1 
ATOM   5651 C CD1  . LEU A 1 370 ? -10.905 -42.892 -37.564 1.00 80.15  ? 441 LEU A CD1  1 
ATOM   5652 C CD2  . LEU A 1 370 ? -13.272 -43.687 -37.555 1.00 72.70  ? 441 LEU A CD2  1 
ATOM   5653 H H    . LEU A 1 370 ? -12.800 -43.099 -33.964 1.00 74.18  ? 441 LEU A H    1 
ATOM   5654 H HA   . LEU A 1 370 ? -13.582 -45.120 -35.376 1.00 77.73  ? 441 LEU A HA   1 
ATOM   5655 H HB2  . LEU A 1 370 ? -10.989 -44.029 -35.166 1.00 83.05  ? 441 LEU A HB2  1 
ATOM   5656 H HB3  . LEU A 1 370 ? -11.372 -45.113 -36.256 1.00 83.05  ? 441 LEU A HB3  1 
ATOM   5657 H HG   . LEU A 1 370 ? -12.359 -42.474 -36.190 1.00 88.50  ? 441 LEU A HG   1 
ATOM   5658 H HD11 . LEU A 1 370 ? -10.977 -41.961 -37.822 1.00 96.19  ? 441 LEU A HD11 1 
ATOM   5659 H HD12 . LEU A 1 370 ? -10.090 -43.031 -37.056 1.00 96.19  ? 441 LEU A HD12 1 
ATOM   5660 H HD13 . LEU A 1 370 ? -10.902 -43.458 -38.352 1.00 96.19  ? 441 LEU A HD13 1 
ATOM   5661 H HD21 . LEU A 1 370 ? -13.345 -43.089 -38.313 1.00 87.24  ? 441 LEU A HD21 1 
ATOM   5662 H HD22 . LEU A 1 370 ? -13.122 -44.594 -37.864 1.00 87.24  ? 441 LEU A HD22 1 
ATOM   5663 H HD23 . LEU A 1 370 ? -14.083 -43.649 -37.024 1.00 87.24  ? 441 LEU A HD23 1 
ATOM   5664 N N    . ASP A 1 371 ? -11.695 -45.995 -32.956 1.00 79.38  ? 442 ASP A N    1 
ATOM   5665 C CA   . ASP A 1 371 ? -11.293 -47.158 -32.172 1.00 85.02  ? 442 ASP A CA   1 
ATOM   5666 C C    . ASP A 1 371 ? -12.515 -47.940 -31.713 1.00 73.19  ? 442 ASP A C    1 
ATOM   5667 O O    . ASP A 1 371 ? -12.575 -49.166 -31.857 1.00 72.20  ? 442 ASP A O    1 
ATOM   5668 C CB   . ASP A 1 371 ? -10.441 -46.719 -30.975 1.00 99.47  ? 442 ASP A CB   1 
ATOM   5669 C CG   . ASP A 1 371 ? -8.967  -46.528 -31.338 1.00 116.35 ? 442 ASP A CG   1 
ATOM   5670 O OD1  . ASP A 1 371 ? -8.653  -46.391 -32.542 1.00 125.89 ? 442 ASP A OD1  1 
ATOM   5671 O OD2  . ASP A 1 371 ? -8.119  -46.514 -30.416 1.00 120.03 ? 442 ASP A OD2  1 
ATOM   5672 H H    . ASP A 1 371 ? -11.457 -45.239 -32.623 1.00 95.26  ? 442 ASP A H    1 
ATOM   5673 H HA   . ASP A 1 371 ? -10.754 -47.743 -32.727 1.00 102.03 ? 442 ASP A HA   1 
ATOM   5674 H HB2  . ASP A 1 371 ? -10.779 -45.874 -30.639 1.00 119.37 ? 442 ASP A HB2  1 
ATOM   5675 H HB3  . ASP A 1 371 ? -10.494 -47.397 -30.283 1.00 119.37 ? 442 ASP A HB3  1 
ATOM   5676 N N    . ALA A 1 372 ? -13.518 -47.237 -31.182 1.00 65.04  ? 443 ALA A N    1 
ATOM   5677 C CA   . ALA A 1 372 ? -14.734 -47.912 -30.749 1.00 58.48  ? 443 ALA A CA   1 
ATOM   5678 C C    . ALA A 1 372 ? -15.408 -48.635 -31.911 1.00 55.11  ? 443 ALA A C    1 
ATOM   5679 O O    . ALA A 1 372 ? -15.868 -49.776 -31.757 1.00 53.23  ? 443 ALA A O    1 
ATOM   5680 C CB   . ALA A 1 372 ? -15.692 -46.909 -30.111 1.00 56.81  ? 443 ALA A CB   1 
ATOM   5681 H H    . ALA A 1 372 ? -13.517 -46.385 -31.065 1.00 78.05  ? 443 ALA A H    1 
ATOM   5682 H HA   . ALA A 1 372 ? -14.504 -48.574 -30.078 1.00 70.18  ? 443 ALA A HA   1 
ATOM   5683 H HB1  . ALA A 1 372 ? -16.495 -47.375 -29.830 1.00 68.17  ? 443 ALA A HB1  1 
ATOM   5684 H HB2  . ALA A 1 372 ? -15.259 -46.504 -29.344 1.00 68.17  ? 443 ALA A HB2  1 
ATOM   5685 H HB3  . ALA A 1 372 ? -15.915 -46.227 -30.764 1.00 68.17  ? 443 ALA A HB3  1 
ATOM   5686 N N    . ILE A 1 373 ? -15.471 -47.994 -33.085 1.00 56.84  ? 444 ILE A N    1 
ATOM   5687 C CA   . ILE A 1 373 ? -16.104 -48.628 -34.240 1.00 60.24  ? 444 ILE A CA   1 
ATOM   5688 C C    . ILE A 1 373 ? -15.389 -49.927 -34.582 1.00 65.20  ? 444 ILE A C    1 
ATOM   5689 O O    . ILE A 1 373 ? -16.018 -50.961 -34.841 1.00 65.05  ? 444 ILE A O    1 
ATOM   5690 C CB   . ILE A 1 373 ? -16.125 -47.667 -35.442 1.00 63.38  ? 444 ILE A CB   1 
ATOM   5691 C CG1  . ILE A 1 373 ? -16.940 -46.413 -35.109 1.00 65.52  ? 444 ILE A CG1  1 
ATOM   5692 C CG2  . ILE A 1 373 ? -16.732 -48.347 -36.653 1.00 62.74  ? 444 ILE A CG2  1 
ATOM   5693 C CD1  . ILE A 1 373 ? -16.821 -45.297 -36.166 1.00 69.01  ? 444 ILE A CD1  1 
ATOM   5694 H H    . ILE A 1 373 ? -15.159 -47.207 -33.234 1.00 68.21  ? 444 ILE A H    1 
ATOM   5695 H HA   . ILE A 1 373 ? -17.023 -48.844 -34.015 1.00 72.29  ? 444 ILE A HA   1 
ATOM   5696 H HB   . ILE A 1 373 ? -15.215 -47.405 -35.651 1.00 76.05  ? 444 ILE A HB   1 
ATOM   5697 H HG12 . ILE A 1 373 ? -17.875 -46.660 -35.039 1.00 78.63  ? 444 ILE A HG12 1 
ATOM   5698 H HG13 . ILE A 1 373 ? -16.633 -46.051 -34.264 1.00 78.63  ? 444 ILE A HG13 1 
ATOM   5699 H HG21 . ILE A 1 373 ? -16.859 -47.693 -37.357 1.00 75.28  ? 444 ILE A HG21 1 
ATOM   5700 H HG22 . ILE A 1 373 ? -16.133 -49.044 -36.962 1.00 75.28  ? 444 ILE A HG22 1 
ATOM   5701 H HG23 . ILE A 1 373 ? -17.587 -48.731 -36.402 1.00 75.28  ? 444 ILE A HG23 1 
ATOM   5702 H HD11 . ILE A 1 373 ? -17.183 -44.476 -35.799 1.00 82.81  ? 444 ILE A HD11 1 
ATOM   5703 H HD12 . ILE A 1 373 ? -15.885 -45.175 -36.390 1.00 82.81  ? 444 ILE A HD12 1 
ATOM   5704 H HD13 . ILE A 1 373 ? -17.320 -45.554 -36.957 1.00 82.81  ? 444 ILE A HD13 1 
ATOM   5705 N N    . SER A 1 374 ? -14.058 -49.894 -34.585 1.00 66.80  ? 445 SER A N    1 
ATOM   5706 C CA   . SER A 1 374 ? -13.303 -51.092 -34.922 1.00 71.17  ? 445 SER A CA   1 
ATOM   5707 C C    . SER A 1 374 ? -13.550 -52.195 -33.904 1.00 66.07  ? 445 SER A C    1 
ATOM   5708 O O    . SER A 1 374 ? -13.717 -53.366 -34.270 1.00 64.51  ? 445 SER A O    1 
ATOM   5709 C CB   . SER A 1 374 ? -11.818 -50.763 -35.005 1.00 80.81  ? 445 SER A CB   1 
ATOM   5710 O OG   . SER A 1 374 ? -11.084 -51.948 -35.217 1.00 88.08  ? 445 SER A OG   1 
ATOM   5711 H H    . SER A 1 374 ? -13.579 -49.204 -34.399 1.00 80.16  ? 445 SER A H    1 
ATOM   5712 H HA   . SER A 1 374 ? -13.590 -51.414 -35.791 1.00 85.41  ? 445 SER A HA   1 
ATOM   5713 H HB2  . SER A 1 374 ? -11.666 -50.155 -35.746 1.00 96.97  ? 445 SER A HB2  1 
ATOM   5714 H HB3  . SER A 1 374 ? -11.534 -50.355 -34.172 1.00 96.97  ? 445 SER A HB3  1 
ATOM   5715 H HG   . SER A 1 374 ? -10.264 -51.773 -35.264 1.00 105.70 ? 445 SER A HG   1 
ATOM   5716 N N    . ASN A 1 375 ? -13.601 -51.839 -32.619 1.00 65.55  ? 446 ASN A N    1 
ATOM   5717 C CA   . ASN A 1 375 ? -13.844 -52.853 -31.601 1.00 65.09  ? 446 ASN A CA   1 
ATOM   5718 C C    . ASN A 1 375 ? -15.207 -53.505 -31.797 1.00 62.54  ? 446 ASN A C    1 
ATOM   5719 O O    . ASN A 1 375 ? -15.342 -54.725 -31.661 1.00 63.52  ? 446 ASN A O    1 
ATOM   5720 C CB   . ASN A 1 375 ? -13.731 -52.240 -30.204 1.00 66.86  ? 446 ASN A CB   1 
ATOM   5721 C CG   . ASN A 1 375 ? -12.326 -51.740 -29.887 1.00 69.25  ? 446 ASN A CG   1 
ATOM   5722 O OD1  . ASN A 1 375 ? -11.343 -52.165 -30.495 1.00 69.06  ? 446 ASN A OD1  1 
ATOM   5723 N ND2  . ASN A 1 375 ? -12.233 -50.829 -28.922 1.00 70.86  ? 446 ASN A ND2  1 
ATOM   5724 H H    . ASN A 1 375 ? -13.501 -51.039 -32.320 1.00 78.66  ? 446 ASN A H    1 
ATOM   5725 H HA   . ASN A 1 375 ? -13.169 -53.545 -31.679 1.00 78.11  ? 446 ASN A HA   1 
ATOM   5726 H HB2  . ASN A 1 375 ? -14.339 -51.487 -30.140 1.00 80.24  ? 446 ASN A HB2  1 
ATOM   5727 H HB3  . ASN A 1 375 ? -13.966 -52.912 -29.545 1.00 80.24  ? 446 ASN A HB3  1 
ATOM   5728 H HD21 . ASN A 1 375 ? -11.464 -50.512 -28.702 1.00 85.04  ? 446 ASN A HD21 1 
ATOM   5729 H HD22 . ASN A 1 375 ? -12.942 -50.557 -28.518 1.00 85.04  ? 446 ASN A HD22 1 
ATOM   5730 N N    . ILE A 1 376 ? -16.227 -52.713 -32.125 1.00 59.57  ? 447 ILE A N    1 
ATOM   5731 C CA   . ILE A 1 376 ? -17.559 -53.273 -32.342 1.00 57.47  ? 447 ILE A CA   1 
ATOM   5732 C C    . ILE A 1 376 ? -17.552 -54.175 -33.567 1.00 60.86  ? 447 ILE A C    1 
ATOM   5733 O O    . ILE A 1 376 ? -18.187 -55.235 -33.577 1.00 59.99  ? 447 ILE A O    1 
ATOM   5734 C CB   . ILE A 1 376 ? -18.605 -52.143 -32.473 1.00 54.88  ? 447 ILE A CB   1 
ATOM   5735 C CG1  . ILE A 1 376 ? -18.657 -51.307 -31.193 1.00 53.74  ? 447 ILE A CG1  1 
ATOM   5736 C CG2  . ILE A 1 376 ? -19.988 -52.714 -32.764 1.00 52.21  ? 447 ILE A CG2  1 
ATOM   5737 C CD1  . ILE A 1 376 ? -19.545 -50.058 -31.302 1.00 53.51  ? 447 ILE A CD1  1 
ATOM   5738 H H    . ILE A 1 376 ? -16.176 -51.861 -32.227 1.00 71.48  ? 447 ILE A H    1 
ATOM   5739 H HA   . ILE A 1 376 ? -17.801 -53.815 -31.575 1.00 68.96  ? 447 ILE A HA   1 
ATOM   5740 H HB   . ILE A 1 376 ? -18.347 -51.566 -33.209 1.00 65.86  ? 447 ILE A HB   1 
ATOM   5741 H HG12 . ILE A 1 376 ? -19.010 -51.858 -30.476 1.00 64.49  ? 447 ILE A HG12 1 
ATOM   5742 H HG13 . ILE A 1 376 ? -17.761 -51.014 -30.969 1.00 64.49  ? 447 ILE A HG13 1 
ATOM   5743 H HG21 . ILE A 1 376 ? -20.621 -51.985 -32.850 1.00 62.65  ? 447 ILE A HG21 1 
ATOM   5744 H HG22 . ILE A 1 376 ? -19.962 -53.220 -33.589 1.00 62.65  ? 447 ILE A HG22 1 
ATOM   5745 H HG23 . ILE A 1 376 ? -20.249 -53.292 -32.030 1.00 62.65  ? 447 ILE A HG23 1 
ATOM   5746 H HD11 . ILE A 1 376 ? -19.390 -49.493 -30.529 1.00 64.21  ? 447 ILE A HD11 1 
ATOM   5747 H HD12 . ILE A 1 376 ? -19.316 -49.578 -32.113 1.00 64.21  ? 447 ILE A HD12 1 
ATOM   5748 H HD13 . ILE A 1 376 ? -20.475 -50.331 -31.331 1.00 64.21  ? 447 ILE A HD13 1 
ATOM   5749 N N    . PHE A 1 377 ? -16.836 -53.771 -34.619 1.00 63.01  ? 448 PHE A N    1 
ATOM   5750 C CA   . PHE A 1 377 ? -16.716 -54.615 -35.802 1.00 69.09  ? 448 PHE A CA   1 
ATOM   5751 C C    . PHE A 1 377 ? -16.021 -55.928 -35.472 1.00 75.10  ? 448 PHE A C    1 
ATOM   5752 O O    . PHE A 1 377 ? -16.368 -56.977 -36.027 1.00 78.41  ? 448 PHE A O    1 
ATOM   5753 C CB   . PHE A 1 377 ? -15.960 -53.881 -36.904 1.00 69.87  ? 448 PHE A CB   1 
ATOM   5754 C CG   . PHE A 1 377 ? -16.858 -53.162 -37.888 1.00 68.97  ? 448 PHE A CG   1 
ATOM   5755 C CD1  . PHE A 1 377 ? -17.649 -53.874 -38.777 1.00 69.47  ? 448 PHE A CD1  1 
ATOM   5756 C CD2  . PHE A 1 377 ? -16.888 -51.779 -37.940 1.00 67.06  ? 448 PHE A CD2  1 
ATOM   5757 C CE1  . PHE A 1 377 ? -18.462 -53.218 -39.682 1.00 68.10  ? 448 PHE A CE1  1 
ATOM   5758 C CE2  . PHE A 1 377 ? -17.689 -51.126 -38.844 1.00 65.73  ? 448 PHE A CE2  1 
ATOM   5759 C CZ   . PHE A 1 377 ? -18.477 -51.843 -39.715 1.00 66.19  ? 448 PHE A CZ   1 
ATOM   5760 H H    . PHE A 1 377 ? -16.417 -53.022 -34.669 1.00 75.61  ? 448 PHE A H    1 
ATOM   5761 H HA   . PHE A 1 377 ? -17.604 -54.822 -36.133 1.00 82.90  ? 448 PHE A HA   1 
ATOM   5762 H HB2  . PHE A 1 377 ? -15.375 -53.222 -36.499 1.00 83.84  ? 448 PHE A HB2  1 
ATOM   5763 H HB3  . PHE A 1 377 ? -15.434 -54.527 -37.398 1.00 83.84  ? 448 PHE A HB3  1 
ATOM   5764 H HD1  . PHE A 1 377 ? -17.640 -54.804 -38.757 1.00 83.36  ? 448 PHE A HD1  1 
ATOM   5765 H HD2  . PHE A 1 377 ? -16.358 -51.286 -37.356 1.00 80.48  ? 448 PHE A HD2  1 
ATOM   5766 H HE1  . PHE A 1 377 ? -18.992 -53.705 -40.271 1.00 81.71  ? 448 PHE A HE1  1 
ATOM   5767 H HE2  . PHE A 1 377 ? -17.703 -50.196 -38.864 1.00 78.87  ? 448 PHE A HE2  1 
ATOM   5768 H HZ   . PHE A 1 377 ? -19.023 -51.398 -40.323 1.00 79.43  ? 448 PHE A HZ   1 
ATOM   5769 N N    . GLN A 1 378 ? -15.039 -55.896 -34.569 1.00 77.47  ? 449 GLN A N    1 
ATOM   5770 C CA   . GLN A 1 378 ? -14.378 -57.134 -34.174 1.00 81.68  ? 449 GLN A CA   1 
ATOM   5771 C C    . GLN A 1 378 ? -15.342 -58.070 -33.463 1.00 81.71  ? 449 GLN A C    1 
ATOM   5772 O O    . GLN A 1 378 ? -15.313 -59.284 -33.687 1.00 82.47  ? 449 GLN A O    1 
ATOM   5773 C CB   . GLN A 1 378 ? -13.179 -56.830 -33.288 1.00 87.49  ? 449 GLN A CB   1 
ATOM   5774 C CG   . GLN A 1 378 ? -12.049 -56.153 -34.023 1.00 95.10  ? 449 GLN A CG   1 
ATOM   5775 C CD   . GLN A 1 378 ? -10.860 -55.886 -33.120 1.00 102.25 ? 449 GLN A CD   1 
ATOM   5776 O OE1  . GLN A 1 378 ? -10.407 -56.772 -32.388 1.00 107.20 ? 449 GLN A OE1  1 
ATOM   5777 N NE2  . GLN A 1 378 ? -10.355 -54.655 -33.154 1.00 102.71 ? 449 GLN A NE2  1 
ATOM   5778 H H    . GLN A 1 378 ? -14.745 -55.187 -34.180 1.00 92.96  ? 449 GLN A H    1 
ATOM   5779 H HA   . GLN A 1 378 ? -14.055 -57.586 -34.969 1.00 98.02  ? 449 GLN A HA   1 
ATOM   5780 H HB2  . GLN A 1 378 ? -13.461 -56.243 -32.569 1.00 104.99 ? 449 GLN A HB2  1 
ATOM   5781 H HB3  . GLN A 1 378 ? -12.840 -57.662 -32.922 1.00 104.99 ? 449 GLN A HB3  1 
ATOM   5782 H HG2  . GLN A 1 378 ? -11.754 -56.727 -34.747 1.00 114.12 ? 449 GLN A HG2  1 
ATOM   5783 H HG3  . GLN A 1 378 ? -12.358 -55.305 -34.375 1.00 114.12 ? 449 GLN A HG3  1 
ATOM   5784 H HE21 . GLN A 1 378 ? -10.703 -54.062 -33.670 1.00 123.26 ? 449 GLN A HE21 1 
ATOM   5785 H HE22 . GLN A 1 378 ? -9.681  -54.453 -32.660 1.00 123.26 ? 449 GLN A HE22 1 
ATOM   5786 N N    . ALA A 1 379 ? -16.198 -57.530 -32.592 1.00 79.14  ? 450 ALA A N    1 
ATOM   5787 C CA   . ALA A 1 379 ? -17.236 -58.351 -31.976 1.00 78.75  ? 450 ALA A CA   1 
ATOM   5788 C C    . ALA A 1 379 ? -18.215 -58.867 -33.021 1.00 78.85  ? 450 ALA A C    1 
ATOM   5789 O O    . ALA A 1 379 ? -18.695 -60.004 -32.929 1.00 79.31  ? 450 ALA A O    1 
ATOM   5790 C CB   . ALA A 1 379 ? -17.978 -57.554 -30.903 1.00 76.36  ? 450 ALA A CB   1 
ATOM   5791 H H    . ALA A 1 379 ? -16.198 -56.706 -32.346 1.00 94.96  ? 450 ALA A H    1 
ATOM   5792 H HA   . ALA A 1 379 ? -16.822 -59.117 -31.549 1.00 94.50  ? 450 ALA A HA   1 
ATOM   5793 H HB1  . ALA A 1 379 ? -18.654 -58.120 -30.499 1.00 91.63  ? 450 ALA A HB1  1 
ATOM   5794 H HB2  . ALA A 1 379 ? -17.340 -57.269 -30.232 1.00 91.63  ? 450 ALA A HB2  1 
ATOM   5795 H HB3  . ALA A 1 379 ? -18.394 -56.781 -31.315 1.00 91.63  ? 450 ALA A HB3  1 
ATOM   5796 N N    . ALA A 1 380 ? -18.531 -58.038 -34.018 1.00 78.05  ? 451 ALA A N    1 
ATOM   5797 C CA   . ALA A 1 380 ? -19.448 -58.465 -35.063 1.00 77.93  ? 451 ALA A CA   1 
ATOM   5798 C C    . ALA A 1 380 ? -18.862 -59.610 -35.879 1.00 78.19  ? 451 ALA A C    1 
ATOM   5799 O O    . ALA A 1 380 ? -19.609 -60.483 -36.333 1.00 78.04  ? 451 ALA A O    1 
ATOM   5800 C CB   . ALA A 1 380 ? -19.796 -57.280 -35.962 1.00 77.10  ? 451 ALA A CB   1 
ATOM   5801 H H    . ALA A 1 380 ? -18.231 -57.237 -34.108 1.00 93.66  ? 451 ALA A H    1 
ATOM   5802 H HA   . ALA A 1 380 ? -20.268 -58.780 -34.653 1.00 93.52  ? 451 ALA A HA   1 
ATOM   5803 H HB1  . ALA A 1 380 ? -20.407 -57.578 -36.654 1.00 92.51  ? 451 ALA A HB1  1 
ATOM   5804 H HB2  . ALA A 1 380 ? -20.215 -56.589 -35.425 1.00 92.51  ? 451 ALA A HB2  1 
ATOM   5805 H HB3  . ALA A 1 380 ? -18.982 -56.939 -36.364 1.00 92.51  ? 451 ALA A HB3  1 
ATOM   5806 N N    . GLU A 1 381 ? -17.535 -59.631 -36.066 1.00 81.33  ? 452 GLU A N    1 
ATOM   5807 C CA   . GLU A 1 381 ? -16.899 -60.735 -36.786 1.00 82.75  ? 452 GLU A CA   1 
ATOM   5808 C C    . GLU A 1 381 ? -17.069 -62.050 -36.042 1.00 81.43  ? 452 GLU A C    1 
ATOM   5809 O O    . GLU A 1 381 ? -17.281 -63.097 -36.662 1.00 81.09  ? 452 GLU A O    1 
ATOM   5810 C CB   . GLU A 1 381 ? -15.412 -60.455 -37.004 1.00 89.04  ? 452 GLU A CB   1 
ATOM   5811 C CG   . GLU A 1 381 ? -15.124 -59.448 -38.090 1.00 97.76  ? 452 GLU A CG   1 
ATOM   5812 C CD   . GLU A 1 381 ? -13.655 -59.096 -38.182 1.00 109.48 ? 452 GLU A CD   1 
ATOM   5813 O OE1  . GLU A 1 381 ? -12.823 -59.791 -37.550 1.00 114.97 ? 452 GLU A OE1  1 
ATOM   5814 O OE2  . GLU A 1 381 ? -13.332 -58.116 -38.885 1.00 113.20 ? 452 GLU A OE2  1 
ATOM   5815 H H    . GLU A 1 381 ? -16.991 -59.026 -35.789 1.00 97.60  ? 452 GLU A H    1 
ATOM   5816 H HA   . GLU A 1 381 ? -17.318 -60.827 -37.656 1.00 99.30  ? 452 GLU A HA   1 
ATOM   5817 H HB2  . GLU A 1 381 ? -15.035 -60.114 -36.178 1.00 106.85 ? 452 GLU A HB2  1 
ATOM   5818 H HB3  . GLU A 1 381 ? -14.972 -61.285 -37.247 1.00 106.85 ? 452 GLU A HB3  1 
ATOM   5819 H HG2  . GLU A 1 381 ? -15.399 -59.816 -38.944 1.00 117.31 ? 452 GLU A HG2  1 
ATOM   5820 H HG3  . GLU A 1 381 ? -15.617 -58.633 -37.904 1.00 117.31 ? 452 GLU A HG3  1 
ATOM   5821 N N    . LYS A 1 382 ? -16.970 -62.020 -34.711 1.00 80.56  ? 453 LYS A N    1 
ATOM   5822 C CA   . LYS A 1 382 ? -17.173 -63.236 -33.928 1.00 84.19  ? 453 LYS A CA   1 
ATOM   5823 C C    . LYS A 1 382 ? -18.544 -63.838 -34.214 1.00 86.52  ? 453 LYS A C    1 
ATOM   5824 O O    . LYS A 1 382 ? -18.692 -65.062 -34.282 1.00 91.75  ? 453 LYS A O    1 
ATOM   5825 C CB   . LYS A 1 382 ? -17.032 -62.943 -32.432 1.00 85.28  ? 453 LYS A CB   1 
ATOM   5826 C CG   . LYS A 1 382 ? -15.828 -62.092 -32.011 1.00 88.09  ? 453 LYS A CG   1 
ATOM   5827 C CD   . LYS A 1 382 ? -14.533 -62.864 -31.989 1.00 92.64  ? 453 LYS A CD   1 
ATOM   5828 C CE   . LYS A 1 382 ? -13.693 -62.490 -30.768 1.00 94.75  ? 453 LYS A CE   1 
ATOM   5829 N NZ   . LYS A 1 382 ? -13.501 -61.020 -30.613 1.00 94.77  ? 453 LYS A NZ   1 
ATOM   5830 H H    . LYS A 1 382 ? -16.799 -61.316 -34.251 1.00 96.67  ? 453 LYS A H    1 
ATOM   5831 H HA   . LYS A 1 382 ? -16.499 -63.889 -34.173 1.00 101.03 ? 453 LYS A HA   1 
ATOM   5832 H HB2  . LYS A 1 382 ? -17.829 -62.474 -32.140 1.00 102.33 ? 453 LYS A HB2  1 
ATOM   5833 H HB3  . LYS A 1 382 ? -16.968 -63.789 -31.961 1.00 102.33 ? 453 LYS A HB3  1 
ATOM   5834 H HG2  . LYS A 1 382 ? -15.721 -61.349 -32.621 1.00 105.71 ? 453 LYS A HG2  1 
ATOM   5835 H HG3  . LYS A 1 382 ? -15.986 -61.757 -31.115 1.00 105.71 ? 453 LYS A HG3  1 
ATOM   5836 H HD2  . LYS A 1 382 ? -14.722 -63.814 -31.949 1.00 111.17 ? 453 LYS A HD2  1 
ATOM   5837 H HD3  . LYS A 1 382 ? -14.021 -62.656 -32.786 1.00 111.17 ? 453 LYS A HD3  1 
ATOM   5838 H HE2  . LYS A 1 382 ? -14.135 -62.819 -29.970 1.00 113.70 ? 453 LYS A HE2  1 
ATOM   5839 H HE3  . LYS A 1 382 ? -12.817 -62.898 -30.852 1.00 113.70 ? 453 LYS A HE3  1 
ATOM   5840 H HZ1  . LYS A 1 382 ? -13.130 -60.683 -31.348 1.00 113.72 ? 453 LYS A HZ1  1 
ATOM   5841 H HZ2  . LYS A 1 382 ? -14.286 -60.623 -30.476 1.00 113.72 ? 453 LYS A HZ2  1 
ATOM   5842 H HZ3  . LYS A 1 382 ? -12.969 -60.855 -29.919 1.00 113.72 ? 453 LYS A HZ3  1 
ATOM   5843 N N    . LEU A 1 383 ? -19.556 -62.990 -34.394 1.00 81.60  ? 454 LEU A N    1 
ATOM   5844 C CA   . LEU A 1 383 ? -20.925 -63.431 -34.629 1.00 82.59  ? 454 LEU A CA   1 
ATOM   5845 C C    . LEU A 1 383 ? -21.247 -63.651 -36.108 1.00 87.06  ? 454 LEU A C    1 
ATOM   5846 O O    . LEU A 1 383 ? -22.349 -64.116 -36.423 1.00 82.48  ? 454 LEU A O    1 
ATOM   5847 C CB   . LEU A 1 383 ? -21.918 -62.403 -34.052 1.00 79.38  ? 454 LEU A CB   1 
ATOM   5848 C CG   . LEU A 1 383 ? -21.859 -62.117 -32.546 1.00 76.70  ? 454 LEU A CG   1 
ATOM   5849 C CD1  . LEU A 1 383 ? -22.704 -60.915 -32.208 1.00 73.77  ? 454 LEU A CD1  1 
ATOM   5850 C CD2  . LEU A 1 383 ? -22.328 -63.318 -31.740 1.00 77.05  ? 454 LEU A CD2  1 
ATOM   5851 H H    . LEU A 1 383 ? -19.470 -62.134 -34.384 1.00 97.92  ? 454 LEU A H    1 
ATOM   5852 H HA   . LEU A 1 383 ? -21.066 -64.272 -34.167 1.00 99.11  ? 454 LEU A HA   1 
ATOM   5853 H HB2  . LEU A 1 383 ? -21.771 -61.559 -34.506 1.00 95.25  ? 454 LEU A HB2  1 
ATOM   5854 H HB3  . LEU A 1 383 ? -22.816 -62.714 -34.246 1.00 95.25  ? 454 LEU A HB3  1 
ATOM   5855 H HG   . LEU A 1 383 ? -20.943 -61.923 -32.294 1.00 92.05  ? 454 LEU A HG   1 
ATOM   5856 H HD11 . LEU A 1 383 ? -22.656 -60.755 -31.253 1.00 88.53  ? 454 LEU A HD11 1 
ATOM   5857 H HD12 . LEU A 1 383 ? -22.364 -60.145 -32.690 1.00 88.53  ? 454 LEU A HD12 1 
ATOM   5858 H HD13 . LEU A 1 383 ? -23.622 -61.091 -32.469 1.00 88.53  ? 454 LEU A HD13 1 
ATOM   5859 H HD21 . LEU A 1 383 ? -22.291 -63.098 -30.796 1.00 92.46  ? 454 LEU A HD21 1 
ATOM   5860 H HD22 . LEU A 1 383 ? -23.239 -63.532 -31.995 1.00 92.46  ? 454 LEU A HD22 1 
ATOM   5861 H HD23 . LEU A 1 383 ? -21.746 -64.071 -31.928 1.00 92.46  ? 454 LEU A HD23 1 
ATOM   5862 N N    . GLY A 1 384 ? -20.327 -63.325 -37.014 1.00 93.63  ? 455 GLY A N    1 
ATOM   5863 C CA   . GLY A 1 384 ? -20.624 -63.370 -38.439 1.00 97.80  ? 455 GLY A CA   1 
ATOM   5864 C C    . GLY A 1 384 ? -21.702 -62.398 -38.865 1.00 95.27  ? 455 GLY A C    1 
ATOM   5865 O O    . GLY A 1 384 ? -22.522 -62.724 -39.733 1.00 98.18  ? 455 GLY A O    1 
ATOM   5866 H H    . GLY A 1 384 ? -19.525 -63.075 -36.828 1.00 112.35 ? 455 GLY A H    1 
ATOM   5867 H HA2  . GLY A 1 384 ? -19.818 -63.167 -38.939 1.00 117.36 ? 455 GLY A HA2  1 
ATOM   5868 H HA3  . GLY A 1 384 ? -20.912 -64.265 -38.677 1.00 117.36 ? 455 GLY A HA3  1 
ATOM   5869 N N    . GLU A 1 385 ? -21.717 -61.196 -38.276 1.00 92.41  ? 456 GLU A N    1 
ATOM   5870 C CA   . GLU A 1 385 ? -22.754 -60.205 -38.543 1.00 87.13  ? 456 GLU A CA   1 
ATOM   5871 C C    . GLU A 1 385 ? -22.162 -58.851 -38.938 1.00 82.92  ? 456 GLU A C    1 
ATOM   5872 O O    . GLU A 1 385 ? -22.768 -57.808 -38.685 1.00 82.15  ? 456 GLU A O    1 
ATOM   5873 C CB   . GLU A 1 385 ? -23.676 -60.057 -37.330 1.00 89.03  ? 456 GLU A CB   1 
ATOM   5874 C CG   . GLU A 1 385 ? -24.542 -61.297 -37.050 1.00 94.74  ? 456 GLU A CG   1 
ATOM   5875 C CD   . GLU A 1 385 ? -25.384 -61.189 -35.773 1.00 99.79  ? 456 GLU A CD   1 
ATOM   5876 O OE1  . GLU A 1 385 ? -25.092 -60.325 -34.914 1.00 102.86 ? 456 GLU A OE1  1 
ATOM   5877 O OE2  . GLU A 1 385 ? -26.347 -61.976 -35.629 1.00 100.77 ? 456 GLU A OE2  1 
ATOM   5878 H H    . GLU A 1 385 ? -21.126 -60.932 -37.710 1.00 110.89 ? 456 GLU A H    1 
ATOM   5879 H HA   . GLU A 1 385 ? -23.298 -60.512 -39.283 1.00 104.56 ? 456 GLU A HA   1 
ATOM   5880 H HB2  . GLU A 1 385 ? -23.133 -59.891 -36.543 1.00 106.84 ? 456 GLU A HB2  1 
ATOM   5881 H HB3  . GLU A 1 385 ? -24.274 -59.308 -37.480 1.00 106.84 ? 456 GLU A HB3  1 
ATOM   5882 H HG2  . GLU A 1 385 ? -25.149 -61.429 -37.795 1.00 113.69 ? 456 GLU A HG2  1 
ATOM   5883 H HG3  . GLU A 1 385 ? -23.962 -62.069 -36.958 1.00 113.69 ? 456 GLU A HG3  1 
ATOM   5884 N N    . THR A 1 386 ? -20.984 -58.843 -39.569 1.00 80.82  ? 457 THR A N    1 
ATOM   5885 C CA   . THR A 1 386 ? -20.364 -57.585 -39.980 1.00 81.94  ? 457 THR A CA   1 
ATOM   5886 C C    . THR A 1 386 ? -21.171 -56.880 -41.061 1.00 83.22  ? 457 THR A C    1 
ATOM   5887 O O    . THR A 1 386 ? -21.099 -55.653 -41.195 1.00 79.05  ? 457 THR A O    1 
ATOM   5888 C CB   . THR A 1 386 ? -18.947 -57.838 -40.483 1.00 85.81  ? 457 THR A CB   1 
ATOM   5889 O OG1  . THR A 1 386 ? -18.966 -58.900 -41.448 1.00 88.48  ? 457 THR A OG1  1 
ATOM   5890 C CG2  . THR A 1 386 ? -18.032 -58.206 -39.326 1.00 86.53  ? 457 THR A CG2  1 
ATOM   5891 H H    . THR A 1 386 ? -20.530 -59.545 -39.768 1.00 96.99  ? 457 THR A H    1 
ATOM   5892 H HA   . THR A 1 386 ? -20.309 -56.994 -39.213 1.00 98.33  ? 457 THR A HA   1 
ATOM   5893 H HB   . THR A 1 386 ? -18.604 -57.031 -40.899 1.00 102.97 ? 457 THR A HB   1 
ATOM   5894 H HG1  . THR A 1 386 ? -18.188 -59.046 -41.730 1.00 106.17 ? 457 THR A HG1  1 
ATOM   5895 H HG21 . THR A 1 386 ? -17.130 -58.351 -39.652 1.00 103.84 ? 457 THR A HG21 1 
ATOM   5896 H HG22 . THR A 1 386 ? -18.020 -57.489 -38.672 1.00 103.84 ? 457 THR A HG22 1 
ATOM   5897 H HG23 . THR A 1 386 ? -18.348 -59.018 -38.899 1.00 103.84 ? 457 THR A HG23 1 
ATOM   5898 N N    . GLU A 1 387 ? -21.914 -57.638 -41.860 1.00 87.50  ? 458 GLU A N    1 
ATOM   5899 C CA   . GLU A 1 387 ? -22.804 -57.044 -42.849 1.00 91.33  ? 458 GLU A CA   1 
ATOM   5900 C C    . GLU A 1 387 ? -23.939 -56.287 -42.173 1.00 83.99  ? 458 GLU A C    1 
ATOM   5901 O O    . GLU A 1 387 ? -24.240 -55.144 -42.538 1.00 80.39  ? 458 GLU A O    1 
ATOM   5902 C CB   . GLU A 1 387 ? -23.350 -58.131 -43.779 1.00 101.57 ? 458 GLU A CB   1 
ATOM   5903 C CG   . GLU A 1 387 ? -24.104 -59.295 -43.086 1.00 109.18 ? 458 GLU A CG   1 
ATOM   5904 C CD   . GLU A 1 387 ? -23.180 -60.298 -42.364 1.00 114.68 ? 458 GLU A CD   1 
ATOM   5905 O OE1  . GLU A 1 387 ? -21.948 -60.280 -42.607 1.00 117.58 ? 458 GLU A OE1  1 
ATOM   5906 O OE2  . GLU A 1 387 ? -23.685 -61.102 -41.542 1.00 115.19 ? 458 GLU A OE2  1 
ATOM   5907 H H    . GLU A 1 387 ? -21.901 -58.491 -41.852 1.00 105.00 ? 458 GLU A H    1 
ATOM   5908 H HA   . GLU A 1 387 ? -22.302 -56.413 -43.388 1.00 109.60 ? 458 GLU A HA   1 
ATOM   5909 H HB2  . GLU A 1 387 ? -23.967 -57.718 -44.403 1.00 121.88 ? 458 GLU A HB2  1 
ATOM   5910 H HB3  . GLU A 1 387 ? -22.607 -58.517 -44.268 1.00 121.88 ? 458 GLU A HB3  1 
ATOM   5911 H HG2  . GLU A 1 387 ? -24.733 -58.945 -42.441 1.00 131.01 ? 458 GLU A HG2  1 
ATOM   5912 H HG3  . GLU A 1 387 ? -24.587 -59.789 -43.766 1.00 131.01 ? 458 GLU A HG3  1 
ATOM   5913 N N    . LYS A 1 388 ? -24.575 -56.903 -41.175 1.00 85.44  ? 459 LYS A N    1 
ATOM   5914 C CA   . LYS A 1 388 ? -25.649 -56.231 -40.456 1.00 83.50  ? 459 LYS A CA   1 
ATOM   5915 C C    . LYS A 1 388 ? -25.149 -54.948 -39.818 1.00 75.90  ? 459 LYS A C    1 
ATOM   5916 O O    . LYS A 1 388 ? -25.827 -53.914 -39.871 1.00 74.93  ? 459 LYS A O    1 
ATOM   5917 C CB   . LYS A 1 388 ? -26.237 -57.164 -39.402 1.00 90.37  ? 459 LYS A CB   1 
ATOM   5918 C CG   . LYS A 1 388 ? -27.159 -58.225 -39.989 1.00 99.98  ? 459 LYS A CG   1 
ATOM   5919 C CD   . LYS A 1 388 ? -27.048 -59.570 -39.262 1.00 108.56 ? 459 LYS A CD   1 
ATOM   5920 C CE   . LYS A 1 388 ? -28.074 -60.589 -39.776 1.00 113.56 ? 459 LYS A CE   1 
ATOM   5921 N NZ   . LYS A 1 388 ? -29.486 -60.174 -39.487 1.00 114.41 ? 459 LYS A NZ   1 
ATOM   5922 H H    . LYS A 1 388 ? -24.400 -57.696 -40.894 1.00 102.53 ? 459 LYS A H    1 
ATOM   5923 H HA   . LYS A 1 388 ? -26.354 -56.001 -41.081 1.00 100.20 ? 459 LYS A HA   1 
ATOM   5924 H HB2  . LYS A 1 388 ? -25.512 -57.618 -38.944 1.00 108.45 ? 459 LYS A HB2  1 
ATOM   5925 H HB3  . LYS A 1 388 ? -26.751 -56.639 -38.769 1.00 108.45 ? 459 LYS A HB3  1 
ATOM   5926 H HG2  . LYS A 1 388 ? -28.077 -57.920 -39.919 1.00 119.98 ? 459 LYS A HG2  1 
ATOM   5927 H HG3  . LYS A 1 388 ? -26.926 -58.367 -40.920 1.00 119.98 ? 459 LYS A HG3  1 
ATOM   5928 H HD2  . LYS A 1 388 ? -26.161 -59.936 -39.404 1.00 130.27 ? 459 LYS A HD2  1 
ATOM   5929 H HD3  . LYS A 1 388 ? -27.206 -59.434 -38.315 1.00 130.27 ? 459 LYS A HD3  1 
ATOM   5930 H HE2  . LYS A 1 388 ? -27.977 -60.679 -40.737 1.00 136.28 ? 459 LYS A HE2  1 
ATOM   5931 H HE3  . LYS A 1 388 ? -27.917 -61.443 -39.344 1.00 136.28 ? 459 LYS A HE3  1 
ATOM   5932 H HZ1  . LYS A 1 388 ? -30.052 -60.793 -39.785 1.00 137.29 ? 459 LYS A HZ1  1 
ATOM   5933 H HZ2  . LYS A 1 388 ? -29.601 -60.076 -38.610 1.00 137.29 ? 459 LYS A HZ2  1 
ATOM   5934 H HZ3  . LYS A 1 388 ? -29.664 -59.401 -39.890 1.00 137.29 ? 459 LYS A HZ3  1 
ATOM   5935 N N    . LEU A 1 389 ? -23.960 -54.988 -39.218 1.00 71.87  ? 460 LEU A N    1 
ATOM   5936 C CA   . LEU A 1 389 ? -23.430 -53.786 -38.591 1.00 68.17  ? 460 LEU A CA   1 
ATOM   5937 C C    . LEU A 1 389 ? -23.088 -52.736 -39.633 1.00 69.80  ? 460 LEU A C    1 
ATOM   5938 O O    . LEU A 1 389 ? -23.258 -51.536 -39.390 1.00 68.69  ? 460 LEU A O    1 
ATOM   5939 C CB   . LEU A 1 389 ? -22.199 -54.129 -37.752 1.00 66.25  ? 460 LEU A CB   1 
ATOM   5940 C CG   . LEU A 1 389 ? -21.587 -52.947 -37.008 1.00 64.37  ? 460 LEU A CG   1 
ATOM   5941 C CD1  . LEU A 1 389 ? -22.596 -52.305 -36.063 1.00 60.40  ? 460 LEU A CD1  1 
ATOM   5942 C CD2  . LEU A 1 389 ? -20.362 -53.401 -36.245 1.00 66.81  ? 460 LEU A CD2  1 
ATOM   5943 H H    . LEU A 1 389 ? -23.454 -55.681 -39.162 1.00 86.25  ? 460 LEU A H    1 
ATOM   5944 H HA   . LEU A 1 389 ? -24.106 -53.417 -38.003 1.00 81.80  ? 460 LEU A HA   1 
ATOM   5945 H HB2  . LEU A 1 389 ? -22.450 -54.794 -37.092 1.00 79.50  ? 460 LEU A HB2  1 
ATOM   5946 H HB3  . LEU A 1 389 ? -21.517 -54.493 -38.338 1.00 79.50  ? 460 LEU A HB3  1 
ATOM   5947 H HG   . LEU A 1 389 ? -21.307 -52.276 -37.650 1.00 77.25  ? 460 LEU A HG   1 
ATOM   5948 H HD11 . LEU A 1 389 ? -22.134 -51.670 -35.494 1.00 72.48  ? 460 LEU A HD11 1 
ATOM   5949 H HD12 . LEU A 1 389 ? -23.273 -51.848 -36.585 1.00 72.48  ? 460 LEU A HD12 1 
ATOM   5950 H HD13 . LEU A 1 389 ? -23.005 -52.997 -35.521 1.00 72.48  ? 460 LEU A HD13 1 
ATOM   5951 H HD21 . LEU A 1 389 ? -19.969 -52.636 -35.797 1.00 80.17  ? 460 LEU A HD21 1 
ATOM   5952 H HD22 . LEU A 1 389 ? -20.627 -54.069 -35.593 1.00 80.17  ? 460 LEU A HD22 1 
ATOM   5953 H HD23 . LEU A 1 389 ? -19.725 -53.782 -36.869 1.00 80.17  ? 460 LEU A HD23 1 
ATOM   5954 N N    . SER A 1 390 ? -22.650 -53.174 -40.808 1.00 70.39  ? 461 SER A N    1 
ATOM   5955 C CA   . SER A 1 390 ? -22.249 -52.248 -41.860 1.00 72.53  ? 461 SER A CA   1 
ATOM   5956 C C    . SER A 1 390 ? -23.445 -51.502 -42.446 1.00 67.45  ? 461 SER A C    1 
ATOM   5957 O O    . SER A 1 390 ? -23.364 -50.298 -42.723 1.00 64.26  ? 461 SER A O    1 
ATOM   5958 C CB   . SER A 1 390 ? -21.508 -53.015 -42.951 1.00 79.43  ? 461 SER A CB   1 
ATOM   5959 O OG   . SER A 1 390 ? -20.947 -52.110 -43.861 1.00 83.69  ? 461 SER A OG   1 
ATOM   5960 H H    . SER A 1 390 ? -22.575 -54.004 -41.022 1.00 84.47  ? 461 SER A H    1 
ATOM   5961 H HA   . SER A 1 390 ? -21.640 -51.592 -41.488 1.00 87.03  ? 461 SER A HA   1 
ATOM   5962 H HB2  . SER A 1 390 ? -20.801 -53.542 -42.547 1.00 95.32  ? 461 SER A HB2  1 
ATOM   5963 H HB3  . SER A 1 390 ? -22.133 -53.592 -43.417 1.00 95.32  ? 461 SER A HB3  1 
ATOM   5964 H HG   . SER A 1 390 ? -20.241 -51.788 -43.542 1.00 100.43 ? 461 SER A HG   1 
ATOM   5965 N N    . ILE A 1 391 ? -24.559 -52.194 -42.665 1.00 68.61  ? 462 ILE A N    1 
ATOM   5966 C CA   . ILE A 1 391 ? -25.756 -51.500 -43.128 1.00 69.48  ? 462 ILE A CA   1 
ATOM   5967 C C    . ILE A 1 391 ? -26.267 -50.545 -42.053 1.00 67.94  ? 462 ILE A C    1 
ATOM   5968 O O    . ILE A 1 391 ? -26.763 -49.455 -42.361 1.00 63.26  ? 462 ILE A O    1 
ATOM   5969 C CB   . ILE A 1 391 ? -26.832 -52.514 -43.561 1.00 74.45  ? 462 ILE A CB   1 
ATOM   5970 C CG1  . ILE A 1 391 ? -26.305 -53.407 -44.694 1.00 81.41  ? 462 ILE A CG1  1 
ATOM   5971 C CG2  . ILE A 1 391 ? -28.089 -51.804 -44.016 1.00 73.13  ? 462 ILE A CG2  1 
ATOM   5972 C CD1  . ILE A 1 391 ? -25.838 -52.654 -45.967 1.00 86.61  ? 462 ILE A CD1  1 
ATOM   5973 H H    . ILE A 1 391 ? -24.648 -53.042 -42.557 1.00 82.33  ? 462 ILE A H    1 
ATOM   5974 H HA   . ILE A 1 391 ? -25.524 -50.964 -43.902 1.00 83.38  ? 462 ILE A HA   1 
ATOM   5975 H HB   . ILE A 1 391 ? -27.052 -53.075 -42.801 1.00 89.34  ? 462 ILE A HB   1 
ATOM   5976 H HG12 . ILE A 1 391 ? -25.549 -53.915 -44.361 1.00 97.69  ? 462 ILE A HG12 1 
ATOM   5977 H HG13 . ILE A 1 391 ? -27.012 -54.016 -44.959 1.00 97.69  ? 462 ILE A HG13 1 
ATOM   5978 H HG21 . ILE A 1 391 ? -28.661 -52.440 -44.473 1.00 87.76  ? 462 ILE A HG21 1 
ATOM   5979 H HG22 . ILE A 1 391 ? -28.549 -51.444 -43.241 1.00 87.76  ? 462 ILE A HG22 1 
ATOM   5980 H HG23 . ILE A 1 391 ? -27.845 -51.086 -44.621 1.00 87.76  ? 462 ILE A HG23 1 
ATOM   5981 H HD11 . ILE A 1 391 ? -25.632 -53.303 -46.658 1.00 103.93 ? 462 ILE A HD11 1 
ATOM   5982 H HD12 . ILE A 1 391 ? -26.549 -52.067 -46.268 1.00 103.93 ? 462 ILE A HD12 1 
ATOM   5983 H HD13 . ILE A 1 391 ? -25.046 -52.135 -45.756 1.00 103.93 ? 462 ILE A HD13 1 
ATOM   5984 N N    . MET A 1 392 ? -26.140 -50.922 -40.776 1.00 72.57  ? 463 MET A N    1 
ATOM   5985 C CA   . MET A 1 392 ? -26.542 -50.018 -39.701 1.00 73.08  ? 463 MET A CA   1 
ATOM   5986 C C    . MET A 1 392 ? -25.735 -48.726 -39.736 1.00 68.50  ? 463 MET A C    1 
ATOM   5987 O O    . MET A 1 392 ? -26.274 -47.642 -39.494 1.00 70.24  ? 463 MET A O    1 
ATOM   5988 C CB   . MET A 1 392 ? -26.371 -50.686 -38.341 1.00 74.55  ? 463 MET A CB   1 
ATOM   5989 C CG   . MET A 1 392 ? -27.391 -51.756 -37.980 1.00 78.05  ? 463 MET A CG   1 
ATOM   5990 S SD   . MET A 1 392 ? -27.020 -52.417 -36.330 1.00 80.70  ? 463 MET A SD   1 
ATOM   5991 C CE   . MET A 1 392 ? -27.253 -50.945 -35.328 1.00 81.49  ? 463 MET A CE   1 
ATOM   5992 H H    . MET A 1 392 ? -25.830 -51.680 -40.513 1.00 87.09  ? 463 MET A H    1 
ATOM   5993 H HA   . MET A 1 392 ? -27.482 -49.802 -39.809 1.00 87.69  ? 463 MET A HA   1 
ATOM   5994 H HB2  . MET A 1 392 ? -25.495 -51.103 -38.315 1.00 89.46  ? 463 MET A HB2  1 
ATOM   5995 H HB3  . MET A 1 392 ? -26.418 -49.996 -37.662 1.00 89.46  ? 463 MET A HB3  1 
ATOM   5996 H HG2  . MET A 1 392 ? -28.279 -51.367 -37.965 1.00 93.66  ? 463 MET A HG2  1 
ATOM   5997 H HG3  . MET A 1 392 ? -27.347 -52.481 -38.622 1.00 93.66  ? 463 MET A HG3  1 
ATOM   5998 H HE1  . MET A 1 392 ? -27.389 -51.211 -34.406 1.00 97.79  ? 463 MET A HE1  1 
ATOM   5999 H HE2  . MET A 1 392 ? -26.464 -50.385 -35.399 1.00 97.79  ? 463 MET A HE2  1 
ATOM   6000 H HE3  . MET A 1 392 ? -28.032 -50.465 -35.650 1.00 97.79  ? 463 MET A HE3  1 
ATOM   6001 N N    . ILE A 1 393 ? -24.432 -48.820 -40.009 1.00 63.70  ? 464 ILE A N    1 
ATOM   6002 C CA   . ILE A 1 393 ? -23.616 -47.613 -40.039 1.00 61.57  ? 464 ILE A CA   1 
ATOM   6003 C C    . ILE A 1 393 ? -23.984 -46.749 -41.242 1.00 68.41  ? 464 ILE A C    1 
ATOM   6004 O O    . ILE A 1 393 ? -23.969 -45.511 -41.157 1.00 66.97  ? 464 ILE A O    1 
ATOM   6005 C CB   . ILE A 1 393 ? -22.123 -47.987 -40.020 1.00 59.97  ? 464 ILE A CB   1 
ATOM   6006 C CG1  . ILE A 1 393 ? -21.754 -48.517 -38.635 1.00 60.03  ? 464 ILE A CG1  1 
ATOM   6007 C CG2  . ILE A 1 393 ? -21.257 -46.789 -40.347 1.00 57.68  ? 464 ILE A CG2  1 
ATOM   6008 C CD1  . ILE A 1 393 ? -20.423 -49.194 -38.582 1.00 62.06  ? 464 ILE A CD1  1 
ATOM   6009 H H    . ILE A 1 393 ? -24.009 -49.550 -40.175 1.00 76.44  ? 464 ILE A H    1 
ATOM   6010 H HA   . ILE A 1 393 ? -23.799 -47.095 -39.239 1.00 73.88  ? 464 ILE A HA   1 
ATOM   6011 H HB   . ILE A 1 393 ? -21.963 -48.682 -40.678 1.00 71.96  ? 464 ILE A HB   1 
ATOM   6012 H HG12 . ILE A 1 393 ? -21.733 -47.774 -38.012 1.00 72.04  ? 464 ILE A HG12 1 
ATOM   6013 H HG13 . ILE A 1 393 ? -22.424 -49.160 -38.357 1.00 72.04  ? 464 ILE A HG13 1 
ATOM   6014 H HG21 . ILE A 1 393 ? -20.336 -46.988 -40.119 1.00 69.21  ? 464 ILE A HG21 1 
ATOM   6015 H HG22 . ILE A 1 393 ? -21.324 -46.597 -41.296 1.00 69.21  ? 464 ILE A HG22 1 
ATOM   6016 H HG23 . ILE A 1 393 ? -21.566 -46.027 -39.832 1.00 69.21  ? 464 ILE A HG23 1 
ATOM   6017 H HD11 . ILE A 1 393 ? -20.357 -49.695 -37.754 1.00 74.47  ? 464 ILE A HD11 1 
ATOM   6018 H HD12 . ILE A 1 393 ? -20.347 -49.795 -39.339 1.00 74.47  ? 464 ILE A HD12 1 
ATOM   6019 H HD13 . ILE A 1 393 ? -19.723 -48.524 -38.621 1.00 74.47  ? 464 ILE A HD13 1 
ATOM   6020 N N    . GLU A 1 394 ? -24.339 -47.371 -42.368 1.00 72.14  ? 465 GLU A N    1 
ATOM   6021 C CA   . GLU A 1 394 ? -24.817 -46.602 -43.515 1.00 78.00  ? 465 GLU A CA   1 
ATOM   6022 C C    . GLU A 1 394 ? -26.139 -45.903 -43.203 1.00 73.05  ? 465 GLU A C    1 
ATOM   6023 O O    . GLU A 1 394 ? -26.315 -44.726 -43.533 1.00 70.01  ? 465 GLU A O    1 
ATOM   6024 C CB   . GLU A 1 394 ? -24.954 -47.519 -44.733 1.00 86.81  ? 465 GLU A CB   1 
ATOM   6025 C CG   . GLU A 1 394 ? -25.072 -46.787 -46.073 1.00 92.59  ? 465 GLU A CG   1 
ATOM   6026 C CD   . GLU A 1 394 ? -25.066 -47.738 -47.279 1.00 94.97  ? 465 GLU A CD   1 
ATOM   6027 O OE1  . GLU A 1 394 ? -25.429 -48.927 -47.115 1.00 96.47  ? 465 GLU A OE1  1 
ATOM   6028 O OE2  . GLU A 1 394 ? -24.688 -47.294 -48.389 1.00 94.61  ? 465 GLU A OE2  1 
ATOM   6029 H H    . GLU A 1 394 ? -24.313 -48.222 -42.491 1.00 86.57  ? 465 GLU A H    1 
ATOM   6030 H HA   . GLU A 1 394 ? -24.163 -45.919 -43.729 1.00 93.60  ? 465 GLU A HA   1 
ATOM   6031 H HB2  . GLU A 1 394 ? -24.172 -48.092 -44.779 1.00 104.17 ? 465 GLU A HB2  1 
ATOM   6032 H HB3  . GLU A 1 394 ? -25.750 -48.062 -44.624 1.00 104.17 ? 465 GLU A HB3  1 
ATOM   6033 H HG2  . GLU A 1 394 ? -25.905 -46.290 -46.088 1.00 111.10 ? 465 GLU A HG2  1 
ATOM   6034 H HG3  . GLU A 1 394 ? -24.322 -46.179 -46.167 1.00 111.10 ? 465 GLU A HG3  1 
ATOM   6035 N N    . GLU A 1 395 ? -27.068 -46.595 -42.541 1.00 74.20  ? 466 GLU A N    1 
ATOM   6036 C CA   . GLU A 1 395 ? -28.385 -46.022 -42.254 1.00 73.93  ? 466 GLU A CA   1 
ATOM   6037 C C    . GLU A 1 395 ? -28.363 -44.879 -41.238 1.00 74.71  ? 466 GLU A C    1 
ATOM   6038 O O    . GLU A 1 395 ? -29.386 -44.204 -41.087 1.00 76.13  ? 466 GLU A O    1 
ATOM   6039 C CB   . GLU A 1 395 ? -29.326 -47.108 -41.741 1.00 73.52  ? 466 GLU A CB   1 
ATOM   6040 C CG   . GLU A 1 395 ? -29.613 -48.201 -42.736 1.00 78.53  ? 466 GLU A CG   1 
ATOM   6041 C CD   . GLU A 1 395 ? -30.390 -49.351 -42.115 1.00 85.37  ? 466 GLU A CD   1 
ATOM   6042 O OE1  . GLU A 1 395 ? -30.405 -49.462 -40.864 1.00 86.83  ? 466 GLU A OE1  1 
ATOM   6043 O OE2  . GLU A 1 395 ? -30.988 -50.142 -42.880 1.00 89.83  ? 466 GLU A OE2  1 
ATOM   6044 H H    . GLU A 1 395 ? -26.961 -47.396 -42.248 1.00 89.03  ? 466 GLU A H    1 
ATOM   6045 H HA   . GLU A 1 395 ? -28.758 -45.674 -43.079 1.00 88.71  ? 466 GLU A HA   1 
ATOM   6046 H HB2  . GLU A 1 395 ? -28.927 -47.518 -40.958 1.00 88.23  ? 466 GLU A HB2  1 
ATOM   6047 H HB3  . GLU A 1 395 ? -30.172 -46.698 -41.500 1.00 88.23  ? 466 GLU A HB3  1 
ATOM   6048 H HG2  . GLU A 1 395 ? -30.147 -47.836 -43.459 1.00 94.23  ? 466 GLU A HG2  1 
ATOM   6049 H HG3  . GLU A 1 395 ? -28.779 -48.549 -43.084 1.00 94.23  ? 466 GLU A HG3  1 
ATOM   6050 N N    . CYS A 1 396 ? -27.258 -44.655 -40.530 1.00 76.74  ? 467 CYS A N    1 
ATOM   6051 C CA   . CYS A 1 396 ? -27.146 -43.564 -39.569 1.00 78.01  ? 467 CYS A CA   1 
ATOM   6052 C C    . CYS A 1 396 ? -26.407 -42.367 -40.134 1.00 72.63  ? 467 CYS A C    1 
ATOM   6053 O O    . CYS A 1 396 ? -26.094 -41.434 -39.385 1.00 74.72  ? 467 CYS A O    1 
ATOM   6054 C CB   . CYS A 1 396 ? -26.431 -44.035 -38.299 1.00 85.44  ? 467 CYS A CB   1 
ATOM   6055 S SG   . CYS A 1 396 ? -27.409 -45.179 -37.319 1.00 90.74  ? 467 CYS A SG   1 
ATOM   6056 H H    . CYS A 1 396 ? -26.545 -45.133 -40.591 1.00 92.08  ? 467 CYS A H    1 
ATOM   6057 H HA   . CYS A 1 396 ? -28.036 -43.272 -39.317 1.00 93.61  ? 467 CYS A HA   1 
ATOM   6058 H HB2  . CYS A 1 396 ? -25.609 -44.484 -38.549 1.00 102.53 ? 467 CYS A HB2  1 
ATOM   6059 H HB3  . CYS A 1 396 ? -26.231 -43.264 -37.745 1.00 102.53 ? 467 CYS A HB3  1 
ATOM   6060 H HG   . CYS A 1 396 ? -27.660 -46.147 -37.982 1.00 108.89 ? 467 CYS A HG   1 
ATOM   6061 N N    . GLY A 1 397 ? -26.116 -42.375 -41.434 1.00 66.16  ? 468 GLY A N    1 
ATOM   6062 C CA   . GLY A 1 397 ? -25.282 -41.356 -42.028 1.00 65.54  ? 468 GLY A CA   1 
ATOM   6063 C C    . GLY A 1 397 ? -23.804 -41.530 -41.766 1.00 69.27  ? 468 GLY A C    1 
ATOM   6064 O O    . GLY A 1 397 ? -23.023 -40.626 -42.091 1.00 72.54  ? 468 GLY A O    1 
ATOM   6065 H H    . GLY A 1 397 ? -26.396 -42.967 -41.992 1.00 79.39  ? 468 GLY A H    1 
ATOM   6066 H HA2  . GLY A 1 397 ? -25.419 -41.355 -42.988 1.00 78.65  ? 468 GLY A HA2  1 
ATOM   6067 H HA3  . GLY A 1 397 ? -25.548 -40.489 -41.684 1.00 78.65  ? 468 GLY A HA3  1 
ATOM   6068 N N    . GLY A 1 398 ? -23.394 -42.676 -41.216 1.00 68.53  ? 469 GLY A N    1 
ATOM   6069 C CA   . GLY A 1 398 ? -22.028 -42.874 -40.777 1.00 68.88  ? 469 GLY A CA   1 
ATOM   6070 C C    . GLY A 1 398 ? -21.028 -43.112 -41.892 1.00 69.08  ? 469 GLY A C    1 
ATOM   6071 O O    . GLY A 1 398 ? -19.887 -42.655 -41.814 1.00 71.10  ? 469 GLY A O    1 
ATOM   6072 H H    . GLY A 1 398 ? -23.901 -43.359 -41.088 1.00 82.24  ? 469 GLY A H    1 
ATOM   6073 H HA2  . GLY A 1 398 ? -21.741 -42.092 -40.280 1.00 82.66  ? 469 GLY A HA2  1 
ATOM   6074 H HA3  . GLY A 1 398 ? -21.997 -43.638 -40.180 1.00 82.66  ? 469 GLY A HA3  1 
ATOM   6075 N N    . LEU A 1 399 ? -21.432 -43.834 -42.933 1.00 67.46  ? 470 LEU A N    1 
ATOM   6076 C CA   . LEU A 1 399 ? -20.474 -44.224 -43.962 1.00 71.92  ? 470 LEU A CA   1 
ATOM   6077 C C    . LEU A 1 399 ? -19.861 -43.016 -44.657 1.00 78.72  ? 470 LEU A C    1 
ATOM   6078 O O    . LEU A 1 399 ? -18.661 -43.014 -44.964 1.00 80.14  ? 470 LEU A O    1 
ATOM   6079 C CB   . LEU A 1 399 ? -21.142 -45.138 -44.985 1.00 75.65  ? 470 LEU A CB   1 
ATOM   6080 C CG   . LEU A 1 399 ? -20.242 -45.663 -46.104 1.00 83.12  ? 470 LEU A CG   1 
ATOM   6081 C CD1  . LEU A 1 399 ? -18.853 -46.061 -45.608 1.00 85.89  ? 470 LEU A CD1  1 
ATOM   6082 C CD2  . LEU A 1 399 ? -20.924 -46.851 -46.740 1.00 85.81  ? 470 LEU A CD2  1 
ATOM   6083 H H    . LEU A 1 399 ? -22.237 -44.106 -43.066 1.00 80.95  ? 470 LEU A H    1 
ATOM   6084 H HA   . LEU A 1 399 ? -19.756 -44.718 -43.538 1.00 86.30  ? 470 LEU A HA   1 
ATOM   6085 H HB2  . LEU A 1 399 ? -21.501 -45.908 -44.517 1.00 90.78  ? 470 LEU A HB2  1 
ATOM   6086 H HB3  . LEU A 1 399 ? -21.867 -44.648 -45.403 1.00 90.78  ? 470 LEU A HB3  1 
ATOM   6087 H HG   . LEU A 1 399 ? -20.138 -44.975 -46.780 1.00 99.75  ? 470 LEU A HG   1 
ATOM   6088 H HD11 . LEU A 1 399 ? -18.430 -46.621 -46.278 1.00 103.07 ? 470 LEU A HD11 1 
ATOM   6089 H HD12 . LEU A 1 399 ? -18.322 -45.264 -45.464 1.00 103.07 ? 470 LEU A HD12 1 
ATOM   6090 H HD13 . LEU A 1 399 ? -18.945 -46.554 -44.778 1.00 103.07 ? 470 LEU A HD13 1 
ATOM   6091 H HD21 . LEU A 1 399 ? -20.372 -47.180 -47.466 1.00 102.97 ? 470 LEU A HD21 1 
ATOM   6092 H HD22 . LEU A 1 399 ? -21.040 -47.544 -46.072 1.00 102.97 ? 470 LEU A HD22 1 
ATOM   6093 H HD23 . LEU A 1 399 ? -21.788 -46.573 -47.081 1.00 102.97 ? 470 LEU A HD23 1 
ATOM   6094 N N    . ASP A 1 400 ? -20.661 -41.984 -44.929 1.00 87.39  ? 471 ASP A N    1 
ATOM   6095 C CA   . ASP A 1 400 ? -20.123 -40.805 -45.599 1.00 98.16  ? 471 ASP A CA   1 
ATOM   6096 C C    . ASP A 1 400 ? -19.062 -40.124 -44.744 1.00 98.50  ? 471 ASP A C    1 
ATOM   6097 O O    . ASP A 1 400 ? -18.052 -39.639 -45.267 1.00 104.54 ? 471 ASP A O    1 
ATOM   6098 C CB   . ASP A 1 400 ? -21.251 -39.830 -45.937 1.00 106.69 ? 471 ASP A CB   1 
ATOM   6099 C CG   . ASP A 1 400 ? -22.205 -40.375 -47.001 1.00 115.00 ? 471 ASP A CG   1 
ATOM   6100 O OD1  . ASP A 1 400 ? -21.790 -41.250 -47.794 1.00 118.25 ? 471 ASP A OD1  1 
ATOM   6101 O OD2  . ASP A 1 400 ? -23.369 -39.922 -47.053 1.00 117.69 ? 471 ASP A OD2  1 
ATOM   6102 H H    . ASP A 1 400 ? -21.499 -41.943 -44.740 1.00 104.87 ? 471 ASP A H    1 
ATOM   6103 H HA   . ASP A 1 400 ? -19.705 -41.079 -46.430 1.00 117.79 ? 471 ASP A HA   1 
ATOM   6104 H HB2  . ASP A 1 400 ? -21.766 -39.653 -45.135 1.00 128.03 ? 471 ASP A HB2  1 
ATOM   6105 H HB3  . ASP A 1 400 ? -20.866 -39.006 -46.273 1.00 128.03 ? 471 ASP A HB3  1 
ATOM   6106 N N    . LYS A 1 401 ? -19.267 -40.089 -43.424 1.00 92.91  ? 472 LYS A N    1 
ATOM   6107 C CA   . LYS A 1 401 ? -18.300 -39.455 -42.533 1.00 87.39  ? 472 LYS A CA   1 
ATOM   6108 C C    . LYS A 1 401 ? -16.997 -40.239 -42.467 1.00 87.37  ? 472 LYS A C    1 
ATOM   6109 O O    . LYS A 1 401 ? -15.917 -39.647 -42.373 1.00 90.01  ? 472 LYS A O    1 
ATOM   6110 C CB   . LYS A 1 401 ? -18.896 -39.316 -41.141 1.00 81.84  ? 472 LYS A CB   1 
ATOM   6111 C CG   . LYS A 1 401 ? -20.009 -38.298 -41.051 1.00 79.50  ? 472 LYS A CG   1 
ATOM   6112 C CD   . LYS A 1 401 ? -21.026 -38.701 -40.008 1.00 77.27  ? 472 LYS A CD   1 
ATOM   6113 C CE   . LYS A 1 401 ? -22.183 -37.710 -39.929 1.00 77.06  ? 472 LYS A CE   1 
ATOM   6114 N NZ   . LYS A 1 401 ? -21.915 -36.592 -38.976 1.00 77.20  ? 472 LYS A NZ   1 
ATOM   6115 H H    . LYS A 1 401 ? -19.952 -40.423 -43.026 1.00 111.49 ? 472 LYS A H    1 
ATOM   6116 H HA   . LYS A 1 401 ? -18.099 -38.566 -42.865 1.00 104.87 ? 472 LYS A HA   1 
ATOM   6117 H HB2  . LYS A 1 401 ? -19.256 -40.175 -40.869 1.00 98.20  ? 472 LYS A HB2  1 
ATOM   6118 H HB3  . LYS A 1 401 ? -18.196 -39.044 -40.527 1.00 98.20  ? 472 LYS A HB3  1 
ATOM   6119 H HG2  . LYS A 1 401 ? -19.639 -37.437 -40.800 1.00 95.40  ? 472 LYS A HG2  1 
ATOM   6120 H HG3  . LYS A 1 401 ? -20.458 -38.235 -41.908 1.00 95.40  ? 472 LYS A HG3  1 
ATOM   6121 H HD2  . LYS A 1 401 ? -21.389 -39.571 -40.235 1.00 92.73  ? 472 LYS A HD2  1 
ATOM   6122 H HD3  . LYS A 1 401 ? -20.596 -38.734 -39.139 1.00 92.73  ? 472 LYS A HD3  1 
ATOM   6123 H HE2  . LYS A 1 401 ? -22.333 -37.327 -40.807 1.00 92.47  ? 472 LYS A HE2  1 
ATOM   6124 H HE3  . LYS A 1 401 ? -22.979 -38.176 -39.629 1.00 92.47  ? 472 LYS A HE3  1 
ATOM   6125 H HZ1  . LYS A 1 401 ? -21.791 -36.915 -38.156 1.00 92.64  ? 472 LYS A HZ1  1 
ATOM   6126 H HZ2  . LYS A 1 401 ? -21.185 -36.149 -39.226 1.00 92.64  ? 472 LYS A HZ2  1 
ATOM   6127 H HZ3  . LYS A 1 401 ? -22.605 -36.030 -38.964 1.00 92.64  ? 472 LYS A HZ3  1 
ATOM   6128 N N    . ILE A 1 402 ? -17.072 -41.569 -42.504 1.00 83.97  ? 473 ILE A N    1 
ATOM   6129 C CA   . ILE A 1 402 ? -15.854 -42.370 -42.484 1.00 87.11  ? 473 ILE A CA   1 
ATOM   6130 C C    . ILE A 1 402 ? -15.063 -42.165 -43.767 1.00 97.89  ? 473 ILE A C    1 
ATOM   6131 O O    . ILE A 1 402 ? -13.829 -42.087 -43.748 1.00 102.65 ? 473 ILE A O    1 
ATOM   6132 C CB   . ILE A 1 402 ? -16.196 -43.852 -42.265 1.00 81.48  ? 473 ILE A CB   1 
ATOM   6133 C CG1  . ILE A 1 402 ? -16.964 -44.009 -40.957 1.00 76.72  ? 473 ILE A CG1  1 
ATOM   6134 C CG2  . ILE A 1 402 ? -14.920 -44.700 -42.267 1.00 82.11  ? 473 ILE A CG2  1 
ATOM   6135 C CD1  . ILE A 1 402 ? -17.224 -45.446 -40.552 1.00 75.04  ? 473 ILE A CD1  1 
ATOM   6136 H H    . ILE A 1 402 ? -17.802 -42.022 -42.541 1.00 100.76 ? 473 ILE A H    1 
ATOM   6137 H HA   . ILE A 1 402 ? -15.300 -42.080 -41.743 1.00 104.54 ? 473 ILE A HA   1 
ATOM   6138 H HB   . ILE A 1 402 ? -16.764 -44.148 -42.993 1.00 97.77  ? 473 ILE A HB   1 
ATOM   6139 H HG12 . ILE A 1 402 ? -16.454 -43.591 -40.246 1.00 92.06  ? 473 ILE A HG12 1 
ATOM   6140 H HG13 . ILE A 1 402 ? -17.823 -43.570 -41.044 1.00 92.06  ? 473 ILE A HG13 1 
ATOM   6141 H HG21 . ILE A 1 402 ? -15.155 -45.633 -42.147 1.00 98.54  ? 473 ILE A HG21 1 
ATOM   6142 H HG22 . ILE A 1 402 ? -14.460 -44.592 -43.113 1.00 98.54  ? 473 ILE A HG22 1 
ATOM   6143 H HG23 . ILE A 1 402 ? -14.347 -44.407 -41.541 1.00 98.54  ? 473 ILE A HG23 1 
ATOM   6144 H HD11 . ILE A 1 402 ? -17.885 -45.458 -39.842 1.00 90.05  ? 473 ILE A HD11 1 
ATOM   6145 H HD12 . ILE A 1 402 ? -17.556 -45.935 -41.321 1.00 90.05  ? 473 ILE A HD12 1 
ATOM   6146 H HD13 . ILE A 1 402 ? -16.396 -45.843 -40.240 1.00 90.05  ? 473 ILE A HD13 1 
ATOM   6147 N N    . GLU A 1 403 ? -15.754 -42.095 -44.904 1.00 96.67  ? 474 GLU A N    1 
ATOM   6148 C CA   . GLU A 1 403 ? -15.071 -41.829 -46.163 1.00 103.82 ? 474 GLU A CA   1 
ATOM   6149 C C    . GLU A 1 403 ? -14.404 -40.462 -46.130 1.00 100.28 ? 474 GLU A C    1 
ATOM   6150 O O    . GLU A 1 403 ? -13.235 -40.322 -46.507 1.00 112.65 ? 474 GLU A O    1 
ATOM   6151 C CB   . GLU A 1 403 ? -16.066 -41.934 -47.321 1.00 113.39 ? 474 GLU A CB   1 
ATOM   6152 C CG   . GLU A 1 403 ? -15.425 -41.980 -48.701 1.00 127.56 ? 474 GLU A CG   1 
ATOM   6153 C CD   . GLU A 1 403 ? -15.340 -40.611 -49.354 1.00 141.19 ? 474 GLU A CD   1 
ATOM   6154 O OE1  . GLU A 1 403 ? -16.390 -39.944 -49.476 1.00 148.74 ? 474 GLU A OE1  1 
ATOM   6155 O OE2  . GLU A 1 403 ? -14.223 -40.198 -49.736 1.00 143.97 ? 474 GLU A OE2  1 
ATOM   6156 H H    . GLU A 1 403 ? -16.605 -42.196 -44.971 1.00 116.01 ? 474 GLU A H    1 
ATOM   6157 H HA   . GLU A 1 403 ? -14.379 -42.492 -46.301 1.00 124.58 ? 474 GLU A HA   1 
ATOM   6158 H HB2  . GLU A 1 403 ? -16.586 -42.746 -47.211 1.00 136.07 ? 474 GLU A HB2  1 
ATOM   6159 H HB3  . GLU A 1 403 ? -16.655 -41.163 -47.295 1.00 136.07 ? 474 GLU A HB3  1 
ATOM   6160 H HG2  . GLU A 1 403 ? -14.524 -42.330 -48.620 1.00 153.07 ? 474 GLU A HG2  1 
ATOM   6161 H HG3  . GLU A 1 403 ? -15.954 -42.554 -49.276 1.00 153.07 ? 474 GLU A HG3  1 
ATOM   6162 N N    . ALA A 1 404 ? -15.119 -39.449 -45.636 1.00 94.12  ? 475 ALA A N    1 
ATOM   6163 C CA   . ALA A 1 404 ? -14.558 -38.105 -45.536 1.00 91.64  ? 475 ALA A CA   1 
ATOM   6164 C C    . ALA A 1 404 ? -13.283 -38.064 -44.705 1.00 106.66 ? 475 ALA A C    1 
ATOM   6165 O O    . ALA A 1 404 ? -12.468 -37.155 -44.885 1.00 104.12 ? 475 ALA A O    1 
ATOM   6166 C CB   . ALA A 1 404 ? -15.589 -37.147 -44.927 1.00 84.43  ? 475 ALA A CB   1 
ATOM   6167 H H    . ALA A 1 404 ? -15.928 -39.516 -45.353 1.00 112.94 ? 475 ALA A H    1 
ATOM   6168 H HA   . ALA A 1 404 ? -14.344 -37.787 -46.427 1.00 109.97 ? 475 ALA A HA   1 
ATOM   6169 H HB1  . ALA A 1 404 ? -15.200 -36.261 -44.868 1.00 101.31 ? 475 ALA A HB1  1 
ATOM   6170 H HB2  . ALA A 1 404 ? -16.375 -37.127 -45.495 1.00 101.31 ? 475 ALA A HB2  1 
ATOM   6171 H HB3  . ALA A 1 404 ? -15.829 -37.463 -44.042 1.00 101.31 ? 475 ALA A HB3  1 
ATOM   6172 N N    . LEU A 1 405 ? -13.093 -39.018 -43.793 1.00 121.40 ? 476 LEU A N    1 
ATOM   6173 C CA   . LEU A 1 405 ? -11.939 -38.955 -42.905 1.00 138.75 ? 476 LEU A CA   1 
ATOM   6174 C C    . LEU A 1 405 ? -10.631 -39.130 -43.656 1.00 159.24 ? 476 LEU A C    1 
ATOM   6175 O O    . LEU A 1 405 ? -9.587  -38.665 -43.187 1.00 165.43 ? 476 LEU A O    1 
ATOM   6176 C CB   . LEU A 1 405 ? -12.052 -40.020 -41.822 1.00 130.53 ? 476 LEU A CB   1 
ATOM   6177 C CG   . LEU A 1 405 ? -13.124 -39.812 -40.751 1.00 120.39 ? 476 LEU A CG   1 
ATOM   6178 C CD1  . LEU A 1 405 ? -12.929 -40.868 -39.697 1.00 118.16 ? 476 LEU A CD1  1 
ATOM   6179 C CD2  . LEU A 1 405 ? -13.057 -38.432 -40.126 1.00 115.20 ? 476 LEU A CD2  1 
ATOM   6180 H H    . LEU A 1 405 ? -13.607 -39.697 -43.671 1.00 145.68 ? 476 LEU A H    1 
ATOM   6181 H HA   . LEU A 1 405 ? -11.917 -38.085 -42.479 1.00 166.51 ? 476 LEU A HA   1 
ATOM   6182 H HB2  . LEU A 1 405 ? -12.239 -40.869 -42.252 1.00 156.64 ? 476 LEU A HB2  1 
ATOM   6183 H HB3  . LEU A 1 405 ? -11.198 -40.076 -41.364 1.00 156.64 ? 476 LEU A HB3  1 
ATOM   6184 H HG   . LEU A 1 405 ? -14.001 -39.932 -41.142 1.00 144.46 ? 476 LEU A HG   1 
ATOM   6185 H HD11 . LEU A 1 405 ? -13.628 -40.782 -39.030 1.00 141.79 ? 476 LEU A HD11 1 
ATOM   6186 H HD12 . LEU A 1 405 ? -12.974 -41.742 -40.115 1.00 141.79 ? 476 LEU A HD12 1 
ATOM   6187 H HD13 . LEU A 1 405 ? -12.060 -40.741 -39.286 1.00 141.79 ? 476 LEU A HD13 1 
ATOM   6188 H HD21 . LEU A 1 405 ? -13.625 -38.414 -39.340 1.00 138.24 ? 476 LEU A HD21 1 
ATOM   6189 H HD22 . LEU A 1 405 ? -12.139 -38.244 -39.875 1.00 138.24 ? 476 LEU A HD22 1 
ATOM   6190 H HD23 . LEU A 1 405 ? -13.364 -37.777 -40.772 1.00 138.24 ? 476 LEU A HD23 1 
ATOM   6191 N N    . GLN A 1 406 ? -10.653 -39.805 -44.804 1.00 168.64 ? 477 GLN A N    1 
ATOM   6192 C CA   . GLN A 1 406 ? -9.414  -40.016 -45.541 1.00 176.46 ? 477 GLN A CA   1 
ATOM   6193 C C    . GLN A 1 406 ? -8.678  -38.702 -45.768 1.00 176.22 ? 477 GLN A C    1 
ATOM   6194 O O    . GLN A 1 406 ? -7.457  -38.624 -45.589 1.00 183.93 ? 477 GLN A O    1 
ATOM   6195 C CB   . GLN A 1 406 ? -9.705  -40.699 -46.872 1.00 179.41 ? 477 GLN A CB   1 
ATOM   6196 C CG   . GLN A 1 406 ? -8.450  -41.223 -47.536 1.00 180.92 ? 477 GLN A CG   1 
ATOM   6197 C CD   . GLN A 1 406 ? -8.721  -41.980 -48.817 1.00 179.10 ? 477 GLN A CD   1 
ATOM   6198 O OE1  . GLN A 1 406 ? -9.871  -42.258 -49.157 1.00 178.45 ? 477 GLN A OE1  1 
ATOM   6199 N NE2  . GLN A 1 406 ? -7.655  -42.322 -49.538 1.00 178.41 ? 477 GLN A NE2  1 
ATOM   6200 H H    . GLN A 1 406 ? -11.355 -40.143 -45.169 1.00 202.36 ? 477 GLN A H    1 
ATOM   6201 H HA   . GLN A 1 406 ? -8.835  -40.599 -45.025 1.00 211.75 ? 477 GLN A HA   1 
ATOM   6202 H HB2  . GLN A 1 406 ? -10.301 -41.449 -46.720 1.00 215.29 ? 477 GLN A HB2  1 
ATOM   6203 H HB3  . GLN A 1 406 ? -10.119 -40.060 -47.473 1.00 215.29 ? 477 GLN A HB3  1 
ATOM   6204 H HG2  . GLN A 1 406 ? -7.859  -40.481 -47.740 1.00 217.11 ? 477 GLN A HG2  1 
ATOM   6205 H HG3  . GLN A 1 406 ? -8.021  -41.835 -46.921 1.00 217.11 ? 477 GLN A HG3  1 
ATOM   6206 H HE21 . GLN A 1 406 ? -6.867  -42.111 -49.267 1.00 214.09 ? 477 GLN A HE21 1 
ATOM   6207 H HE22 . GLN A 1 406 ? -7.755  -42.754 -50.275 1.00 214.09 ? 477 GLN A HE22 1 
ATOM   6208 N N    . ARG A 1 407 ? -9.410  -37.652 -46.149 1.00 160.24 ? 478 ARG A N    1 
ATOM   6209 C CA   . ARG A 1 407 ? -8.815  -36.340 -46.375 1.00 154.36 ? 478 ARG A CA   1 
ATOM   6210 C C    . ARG A 1 407 ? -8.194  -35.746 -45.120 1.00 146.41 ? 478 ARG A C    1 
ATOM   6211 O O    . ARG A 1 407 ? -7.493  -34.734 -45.218 1.00 154.67 ? 478 ARG A O    1 
ATOM   6212 C CB   . ARG A 1 407 ? -9.871  -35.369 -46.901 1.00 155.59 ? 478 ARG A CB   1 
ATOM   6213 C CG   . ARG A 1 407 ? -10.561 -35.814 -48.177 1.00 157.68 ? 478 ARG A CG   1 
ATOM   6214 C CD   . ARG A 1 407 ? -9.625  -35.734 -49.371 1.00 162.57 ? 478 ARG A CD   1 
ATOM   6215 N NE   . ARG A 1 407 ? -10.292 -36.122 -50.613 1.00 165.92 ? 478 ARG A NE   1 
ATOM   6216 C CZ   . ARG A 1 407 ? -11.026 -35.307 -51.367 1.00 169.90 ? 478 ARG A CZ   1 
ATOM   6217 N NH1  . ARG A 1 407 ? -11.205 -34.039 -51.016 1.00 169.41 ? 478 ARG A NH1  1 
ATOM   6218 N NH2  . ARG A 1 407 ? -11.590 -35.762 -52.478 1.00 173.72 ? 478 ARG A NH2  1 
ATOM   6219 H H    . ARG A 1 407 ? -10.259 -37.678 -46.282 1.00 192.29 ? 478 ARG A H    1 
ATOM   6220 H HA   . ARG A 1 407 ? -8.118  -36.420 -47.045 1.00 185.23 ? 478 ARG A HA   1 
ATOM   6221 H HB2  . ARG A 1 407 ? -10.554 -35.257 -46.222 1.00 186.72 ? 478 ARG A HB2  1 
ATOM   6222 H HB3  . ARG A 1 407 ? -9.445  -34.516 -47.080 1.00 186.72 ? 478 ARG A HB3  1 
ATOM   6223 H HG2  . ARG A 1 407 ? -10.856 -36.733 -48.082 1.00 189.22 ? 478 ARG A HG2  1 
ATOM   6224 H HG3  . ARG A 1 407 ? -11.320 -35.235 -48.348 1.00 189.22 ? 478 ARG A HG3  1 
ATOM   6225 H HD2  . ARG A 1 407 ? -9.301  -34.825 -49.466 1.00 195.08 ? 478 ARG A HD2  1 
ATOM   6226 H HD3  . ARG A 1 407 ? -8.880  -36.339 -49.230 1.00 195.08 ? 478 ARG A HD3  1 
ATOM   6227 H HE   . ARG A 1 407 ? -10.204 -36.936 -50.875 1.00 199.11 ? 478 ARG A HE   1 
ATOM   6228 H HH11 . ARG A 1 407 ? -10.846 -33.732 -50.298 1.00 203.29 ? 478 ARG A HH11 1 
ATOM   6229 H HH12 . ARG A 1 407 ? -11.682 -33.522 -51.510 1.00 203.29 ? 478 ARG A HH12 1 
ATOM   6230 H HH21 . ARG A 1 407 ? -11.479 -36.582 -52.712 1.00 208.47 ? 478 ARG A HH21 1 
ATOM   6231 H HH22 . ARG A 1 407 ? -12.065 -35.236 -52.966 1.00 208.47 ? 478 ARG A HH22 1 
ATOM   6232 N N    . HIS A 1 408 ? -8.432  -36.337 -43.955 1.00 140.97 ? 479 HIS A N    1 
ATOM   6233 C CA   . HIS A 1 408 ? -7.995  -35.730 -42.709 1.00 128.23 ? 479 HIS A CA   1 
ATOM   6234 C C    . HIS A 1 408 ? -6.480  -35.569 -42.683 1.00 128.80 ? 479 HIS A C    1 
ATOM   6235 O O    . HIS A 1 408 ? -5.732  -36.371 -43.250 1.00 129.24 ? 479 HIS A O    1 
ATOM   6236 C CB   . HIS A 1 408 ? -8.455  -36.575 -41.523 1.00 115.20 ? 479 HIS A CB   1 
ATOM   6237 C CG   . HIS A 1 408 ? -8.323  -35.882 -40.206 1.00 104.60 ? 479 HIS A CG   1 
ATOM   6238 N ND1  . HIS A 1 408 ? -7.515  -36.353 -39.195 1.00 100.15 ? 479 HIS A ND1  1 
ATOM   6239 C CD2  . HIS A 1 408 ? -8.898  -34.750 -39.735 1.00 100.02 ? 479 HIS A CD2  1 
ATOM   6240 C CE1  . HIS A 1 408 ? -7.602  -35.543 -38.153 1.00 97.27  ? 479 HIS A CE1  1 
ATOM   6241 N NE2  . HIS A 1 408 ? -8.434  -34.562 -38.456 1.00 97.26  ? 479 HIS A NE2  1 
ATOM   6242 H H    . HIS A 1 408 ? -8.845  -37.084 -43.857 1.00 169.17 ? 479 HIS A H    1 
ATOM   6243 H HA   . HIS A 1 408 ? -8.394  -34.850 -42.626 1.00 153.88 ? 479 HIS A HA   1 
ATOM   6244 H HB2  . HIS A 1 408 ? -9.390  -36.801 -41.644 1.00 138.24 ? 479 HIS A HB2  1 
ATOM   6245 H HB3  . HIS A 1 408 ? -7.922  -37.385 -41.489 1.00 138.24 ? 479 HIS A HB3  1 
ATOM   6246 H HD2  . HIS A 1 408 ? -9.498  -34.204 -40.191 1.00 120.03 ? 479 HIS A HD2  1 
ATOM   6247 H HE1  . HIS A 1 408 ? -7.151  -35.644 -37.346 1.00 116.72 ? 479 HIS A HE1  1 
ATOM   6248 H HE2  . HIS A 1 408 ? -8.649  -33.911 -37.937 1.00 116.72 ? 479 HIS A HE2  1 
ATOM   6249 N N    . GLU A 1 409 ? -6.032  -34.514 -41.998 1.00 130.08 ? 480 GLU A N    1 
ATOM   6250 C CA   . GLU A 1 409 ? -4.606  -34.227 -41.905 1.00 132.57 ? 480 GLU A CA   1 
ATOM   6251 C C    . GLU A 1 409 ? -3.886  -35.287 -41.082 1.00 128.62 ? 480 GLU A C    1 
ATOM   6252 O O    . GLU A 1 409 ? -2.843  -35.807 -41.495 1.00 130.87 ? 480 GLU A O    1 
ATOM   6253 C CB   . GLU A 1 409 ? -4.394  -32.836 -41.300 1.00 138.37 ? 480 GLU A CB   1 
ATOM   6254 C CG   . GLU A 1 409 ? -5.220  -31.727 -41.958 1.00 143.66 ? 480 GLU A CG   1 
ATOM   6255 C CD   . GLU A 1 409 ? -4.840  -30.328 -41.475 1.00 148.77 ? 480 GLU A CD   1 
ATOM   6256 O OE1  . GLU A 1 409 ? -5.371  -29.338 -42.027 1.00 148.66 ? 480 GLU A OE1  1 
ATOM   6257 O OE2  . GLU A 1 409 ? -4.008  -30.215 -40.548 1.00 152.63 ? 480 GLU A OE2  1 
ATOM   6258 H H    . GLU A 1 409 ? -6.534  -33.955 -41.580 1.00 156.10 ? 480 GLU A H    1 
ATOM   6259 H HA   . GLU A 1 409 ? -4.224  -34.228 -42.797 1.00 159.08 ? 480 GLU A HA   1 
ATOM   6260 H HB2  . GLU A 1 409 ? -4.636  -32.866 -40.361 1.00 166.04 ? 480 GLU A HB2  1 
ATOM   6261 H HB3  . GLU A 1 409 ? -3.458  -32.598 -41.389 1.00 166.04 ? 480 GLU A HB3  1 
ATOM   6262 H HG2  . GLU A 1 409 ? -5.083  -31.759 -42.918 1.00 172.39 ? 480 GLU A HG2  1 
ATOM   6263 H HG3  . GLU A 1 409 ? -6.158  -31.868 -41.753 1.00 172.39 ? 480 GLU A HG3  1 
ATOM   6264 N N    . ASN A 1 410 ? -4.429  -35.623 -39.915 1.00 126.02 ? 481 ASN A N    1 
ATOM   6265 C CA   . ASN A 1 410 ? -3.780  -36.577 -39.027 1.00 123.09 ? 481 ASN A CA   1 
ATOM   6266 C C    . ASN A 1 410 ? -3.552  -37.910 -39.732 1.00 126.13 ? 481 ASN A C    1 
ATOM   6267 O O    . ASN A 1 410 ? -4.290  -38.294 -40.644 1.00 126.44 ? 481 ASN A O    1 
ATOM   6268 C CB   . ASN A 1 410 ? -4.627  -36.784 -37.774 1.00 116.39 ? 481 ASN A CB   1 
ATOM   6269 C CG   . ASN A 1 410 ? -3.939  -37.633 -36.740 1.00 113.28 ? 481 ASN A CG   1 
ATOM   6270 O OD1  . ASN A 1 410 ? -3.960  -38.861 -36.819 1.00 113.74 ? 481 ASN A OD1  1 
ATOM   6271 N ND2  . ASN A 1 410 ? -3.334  -36.986 -35.750 1.00 110.68 ? 481 ASN A ND2  1 
ATOM   6272 H H    . ASN A 1 410 ? -5.173  -35.312 -39.616 1.00 151.23 ? 481 ASN A H    1 
ATOM   6273 H HA   . ASN A 1 410 ? -2.918  -36.226 -38.756 1.00 147.70 ? 481 ASN A HA   1 
ATOM   6274 H HB2  . ASN A 1 410 ? -4.825  -35.922 -37.376 1.00 139.66 ? 481 ASN A HB2  1 
ATOM   6275 H HB3  . ASN A 1 410 ? -5.448  -37.235 -38.022 1.00 139.66 ? 481 ASN A HB3  1 
ATOM   6276 H HD21 . ASN A 1 410 ? -2.927  -37.427 -35.134 1.00 132.81 ? 481 ASN A HD21 1 
ATOM   6277 H HD22 . ASN A 1 410 ? -3.349  -36.126 -35.725 1.00 132.81 ? 481 ASN A HD22 1 
ATOM   6278 N N    . GLU A 1 411 ? -2.512  -38.621 -39.298 1.00 124.50 ? 482 GLU A N    1 
ATOM   6279 C CA   . GLU A 1 411 ? -2.109  -39.862 -39.946 1.00 130.00 ? 482 GLU A CA   1 
ATOM   6280 C C    . GLU A 1 411 ? -2.879  -41.060 -39.407 1.00 122.83 ? 482 GLU A C    1 
ATOM   6281 O O    . GLU A 1 411 ? -3.433  -41.841 -40.185 1.00 123.43 ? 482 GLU A O    1 
ATOM   6282 C CB   . GLU A 1 411 ? -0.604  -40.086 -39.768 1.00 143.20 ? 482 GLU A CB   1 
ATOM   6283 C CG   . GLU A 1 411 ? -0.022  -41.142 -40.701 1.00 154.26 ? 482 GLU A CG   1 
ATOM   6284 C CD   . GLU A 1 411 ? 0.030   -40.685 -42.149 1.00 162.27 ? 482 GLU A CD   1 
ATOM   6285 O OE1  . GLU A 1 411 ? 0.913   -39.864 -42.484 1.00 168.04 ? 482 GLU A OE1  1 
ATOM   6286 O OE2  . GLU A 1 411 ? -0.818  -41.138 -42.950 1.00 161.71 ? 482 GLU A OE2  1 
ATOM   6287 H H    . GLU A 1 411 ? -2.022  -38.402 -38.626 1.00 149.40 ? 482 GLU A H    1 
ATOM   6288 H HA   . GLU A 1 411 ? -2.291  -39.794 -40.896 1.00 156.00 ? 482 GLU A HA   1 
ATOM   6289 H HB2  . GLU A 1 411 ? -0.142  -39.251 -39.941 1.00 171.84 ? 482 GLU A HB2  1 
ATOM   6290 H HB3  . GLU A 1 411 ? -0.437  -40.372 -38.856 1.00 171.84 ? 482 GLU A HB3  1 
ATOM   6291 H HG2  . GLU A 1 411 ? 0.883   -41.349 -40.419 1.00 185.11 ? 482 GLU A HG2  1 
ATOM   6292 H HG3  . GLU A 1 411 ? -0.573  -41.938 -40.661 1.00 185.11 ? 482 GLU A HG3  1 
ATOM   6293 N N    . SER A 1 412 ? -2.914  -41.223 -38.081 1.00 116.24 ? 483 SER A N    1 
ATOM   6294 C CA   . SER A 1 412 ? -3.603  -42.367 -37.489 1.00 108.65 ? 483 SER A CA   1 
ATOM   6295 C C    . SER A 1 412 ? -5.075  -42.392 -37.890 1.00 108.16 ? 483 SER A C    1 
ATOM   6296 O O    . SER A 1 412 ? -5.645  -43.464 -38.129 1.00 100.16 ? 483 SER A O    1 
ATOM   6297 C CB   . SER A 1 412 ? -3.461  -42.329 -35.972 1.00 103.77 ? 483 SER A CB   1 
ATOM   6298 O OG   . SER A 1 412 ? -3.683  -41.017 -35.494 1.00 101.90 ? 483 SER A OG   1 
ATOM   6299 H H    . SER A 1 412 ? -2.551  -40.691 -37.511 1.00 139.49 ? 483 SER A H    1 
ATOM   6300 H HA   . SER A 1 412 ? -3.189  -43.184 -37.807 1.00 130.38 ? 483 SER A HA   1 
ATOM   6301 H HB2  . SER A 1 412 ? -4.115  -42.926 -35.576 1.00 124.52 ? 483 SER A HB2  1 
ATOM   6302 H HB3  . SER A 1 412 ? -2.564  -42.608 -35.730 1.00 124.52 ? 483 SER A HB3  1 
ATOM   6303 H HG   . SER A 1 412 ? -4.457  -40.763 -35.701 1.00 122.27 ? 483 SER A HG   1 
ATOM   6304 N N    . VAL A 1 413 ? -5.707  -41.218 -37.963 1.00 116.24 ? 484 VAL A N    1 
ATOM   6305 C CA   . VAL A 1 413 ? -7.074  -41.127 -38.471 1.00 118.36 ? 484 VAL A CA   1 
ATOM   6306 C C    . VAL A 1 413 ? -7.138  -41.641 -39.905 1.00 119.65 ? 484 VAL A C    1 
ATOM   6307 O O    . VAL A 1 413 ? -8.011  -42.442 -40.263 1.00 122.70 ? 484 VAL A O    1 
ATOM   6308 C CB   . VAL A 1 413 ? -7.581  -39.677 -38.371 1.00 112.99 ? 484 VAL A CB   1 
ATOM   6309 C CG1  . VAL A 1 413 ? -8.928  -39.513 -39.078 1.00 112.42 ? 484 VAL A CG1  1 
ATOM   6310 C CG2  . VAL A 1 413 ? -7.686  -39.257 -36.915 1.00 106.84 ? 484 VAL A CG2  1 
ATOM   6311 H H    . VAL A 1 413 ? -5.367  -40.465 -37.726 1.00 139.49 ? 484 VAL A H    1 
ATOM   6312 H HA   . VAL A 1 413 ? -7.651  -41.685 -37.926 1.00 142.03 ? 484 VAL A HA   1 
ATOM   6313 H HB   . VAL A 1 413 ? -6.943  -39.090 -38.806 1.00 135.59 ? 484 VAL A HB   1 
ATOM   6314 H HG11 . VAL A 1 413 ? -9.330  -38.676 -38.797 1.00 134.90 ? 484 VAL A HG11 1 
ATOM   6315 H HG12 . VAL A 1 413 ? -8.785  -39.503 -40.037 1.00 134.90 ? 484 VAL A HG12 1 
ATOM   6316 H HG13 . VAL A 1 413 ? -9.505  -40.254 -38.834 1.00 134.90 ? 484 VAL A HG13 1 
ATOM   6317 H HG21 . VAL A 1 413 ? -8.000  -38.340 -36.873 1.00 128.21 ? 484 VAL A HG21 1 
ATOM   6318 H HG22 . VAL A 1 413 ? -8.314  -39.842 -36.463 1.00 128.21 ? 484 VAL A HG22 1 
ATOM   6319 H HG23 . VAL A 1 413 ? -6.811  -39.327 -36.502 1.00 128.21 ? 484 VAL A HG23 1 
ATOM   6320 N N    . TYR A 1 414 ? -6.214  -41.176 -40.749 1.00 110.97 ? 485 TYR A N    1 
ATOM   6321 C CA   . TYR A 1 414 ? -6.203  -41.573 -42.152 1.00 113.87 ? 485 TYR A CA   1 
ATOM   6322 C C    . TYR A 1 414 ? -6.145  -43.089 -42.297 1.00 112.81 ? 485 TYR A C    1 
ATOM   6323 O O    . TYR A 1 414 ? -6.990  -43.691 -42.969 1.00 105.41 ? 485 TYR A O    1 
ATOM   6324 C CB   . TYR A 1 414 ? -5.020  -40.904 -42.860 1.00 127.63 ? 485 TYR A CB   1 
ATOM   6325 C CG   . TYR A 1 414 ? -4.714  -41.455 -44.229 1.00 142.75 ? 485 TYR A CG   1 
ATOM   6326 C CD1  . TYR A 1 414 ? -5.668  -41.430 -45.237 1.00 149.80 ? 485 TYR A CD1  1 
ATOM   6327 C CD2  . TYR A 1 414 ? -3.462  -41.987 -44.521 1.00 151.67 ? 485 TYR A CD2  1 
ATOM   6328 C CE1  . TYR A 1 414 ? -5.387  -41.931 -46.499 1.00 158.03 ? 485 TYR A CE1  1 
ATOM   6329 C CE2  . TYR A 1 414 ? -3.172  -42.489 -45.781 1.00 159.94 ? 485 TYR A CE2  1 
ATOM   6330 C CZ   . TYR A 1 414 ? -4.139  -42.457 -46.766 1.00 163.54 ? 485 TYR A CZ   1 
ATOM   6331 O OH   . TYR A 1 414 ? -3.865  -42.953 -48.023 1.00 169.24 ? 485 TYR A OH   1 
ATOM   6332 H H    . TYR A 1 414 ? -5.585  -40.631 -40.532 1.00 133.16 ? 485 TYR A H    1 
ATOM   6333 H HA   . TYR A 1 414 ? -7.019  -41.263 -42.574 1.00 136.64 ? 485 TYR A HA   1 
ATOM   6334 H HB2  . TYR A 1 414 ? -5.214  -39.959 -42.961 1.00 153.16 ? 485 TYR A HB2  1 
ATOM   6335 H HB3  . TYR A 1 414 ? -4.226  -41.017 -42.315 1.00 153.16 ? 485 TYR A HB3  1 
ATOM   6336 H HD1  . TYR A 1 414 ? -6.510  -41.076 -45.062 1.00 179.77 ? 485 TYR A HD1  1 
ATOM   6337 H HD2  . TYR A 1 414 ? -2.809  -42.009 -43.859 1.00 182.00 ? 485 TYR A HD2  1 
ATOM   6338 H HE1  . TYR A 1 414 ? -6.032  -41.912 -47.166 1.00 189.64 ? 485 TYR A HE1  1 
ATOM   6339 H HE2  . TYR A 1 414 ? -2.332  -42.844 -45.961 1.00 191.93 ? 485 TYR A HE2  1 
ATOM   6340 H HH   . TYR A 1 414 ? -3.077  -43.241 -48.053 1.00 203.09 ? 485 TYR A HH   1 
ATOM   6341 N N    . LYS A 1 415 ? -5.156  -43.728 -41.666 1.00 127.02 ? 486 LYS A N    1 
ATOM   6342 C CA   . LYS A 1 415 ? -4.991  -45.172 -41.817 1.00 130.57 ? 486 LYS A CA   1 
ATOM   6343 C C    . LYS A 1 415 ? -6.146  -45.939 -41.183 1.00 118.67 ? 486 LYS A C    1 
ATOM   6344 O O    . LYS A 1 415 ? -6.554  -46.986 -41.702 1.00 116.23 ? 486 LYS A O    1 
ATOM   6345 C CB   . LYS A 1 415 ? -3.650  -45.617 -41.216 1.00 140.26 ? 486 LYS A CB   1 
ATOM   6346 C CG   . LYS A 1 415 ? -3.507  -45.372 -39.717 1.00 142.55 ? 486 LYS A CG   1 
ATOM   6347 C CD   . LYS A 1 415 ? -2.064  -45.545 -39.227 1.00 145.70 ? 486 LYS A CD   1 
ATOM   6348 C CE   . LYS A 1 415 ? -1.165  -44.409 -39.697 1.00 148.81 ? 486 LYS A CE   1 
ATOM   6349 N NZ   . LYS A 1 415 ? 0.161   -44.398 -39.014 1.00 151.07 ? 486 LYS A NZ   1 
ATOM   6350 H H    . LYS A 1 415 ? -4.576  -43.353 -41.153 1.00 152.43 ? 486 LYS A H    1 
ATOM   6351 H HA   . LYS A 1 415 ? -4.977  -45.387 -42.763 1.00 156.68 ? 486 LYS A HA   1 
ATOM   6352 H HB2  . LYS A 1 415 ? -3.544  -46.569 -41.368 1.00 168.31 ? 486 LYS A HB2  1 
ATOM   6353 H HB3  . LYS A 1 415 ? -2.938  -45.135 -41.664 1.00 168.31 ? 486 LYS A HB3  1 
ATOM   6354 H HG2  . LYS A 1 415 ? -3.787  -44.466 -39.518 1.00 171.07 ? 486 LYS A HG2  1 
ATOM   6355 H HG3  . LYS A 1 415 ? -4.065  -46.005 -39.238 1.00 171.07 ? 486 LYS A HG3  1 
ATOM   6356 H HD2  . LYS A 1 415 ? -2.056  -45.556 -38.257 1.00 174.84 ? 486 LYS A HD2  1 
ATOM   6357 H HD3  . LYS A 1 415 ? -1.707  -46.377 -39.574 1.00 174.84 ? 486 LYS A HD3  1 
ATOM   6358 H HE2  . LYS A 1 415 ? -1.010  -44.501 -40.650 1.00 178.57 ? 486 LYS A HE2  1 
ATOM   6359 H HE3  . LYS A 1 415 ? -1.604  -43.565 -39.511 1.00 178.57 ? 486 LYS A HE3  1 
ATOM   6360 H HZ1  . LYS A 1 415 ? 0.653   -43.721 -39.317 1.00 181.28 ? 486 LYS A HZ1  1 
ATOM   6361 H HZ2  . LYS A 1 415 ? 0.050   -44.305 -38.136 1.00 181.28 ? 486 LYS A HZ2  1 
ATOM   6362 H HZ3  . LYS A 1 415 ? 0.591   -45.161 -39.172 1.00 181.28 ? 486 LYS A HZ3  1 
ATOM   6363 N N    . ALA A 1 416 ? -6.699  -45.428 -40.081 1.00 107.15 ? 487 ALA A N    1 
ATOM   6364 C CA   . ALA A 1 416 ? -7.767  -46.142 -39.386 1.00 94.35  ? 487 ALA A CA   1 
ATOM   6365 C C    . ALA A 1 416 ? -9.036  -46.193 -40.226 1.00 84.03  ? 487 ALA A C    1 
ATOM   6366 O O    . ALA A 1 416 ? -9.642  -47.258 -40.385 1.00 77.96  ? 487 ALA A O    1 
ATOM   6367 C CB   . ALA A 1 416 ? -8.042  -45.483 -38.037 1.00 91.85  ? 487 ALA A CB   1 
ATOM   6368 H H    . ALA A 1 416 ? -6.476  -44.680 -39.721 1.00 128.58 ? 487 ALA A H    1 
ATOM   6369 H HA   . ALA A 1 416 ? -7.481  -47.054 -39.221 1.00 113.22 ? 487 ALA A HA   1 
ATOM   6370 H HB1  . ALA A 1 416 ? -8.752  -45.968 -37.588 1.00 110.22 ? 487 ALA A HB1  1 
ATOM   6371 H HB2  . ALA A 1 416 ? -7.233  -45.510 -37.502 1.00 110.22 ? 487 ALA A HB2  1 
ATOM   6372 H HB3  . ALA A 1 416 ? -8.311  -44.563 -38.185 1.00 110.22 ? 487 ALA A HB3  1 
ATOM   6373 N N    . SER A 1 417 ? -9.458  -45.053 -40.773 1.00 84.77  ? 488 SER A N    1 
ATOM   6374 C CA   . SER A 1 417 ? -10.695 -45.034 -41.548 1.00 88.69  ? 488 SER A CA   1 
ATOM   6375 C C    . SER A 1 417 ? -10.559 -45.835 -42.836 1.00 92.31  ? 488 SER A C    1 
ATOM   6376 O O    . SER A 1 417 ? -11.533 -46.438 -43.303 1.00 88.92  ? 488 SER A O    1 
ATOM   6377 C CB   . SER A 1 417 ? -11.112 -43.587 -41.850 1.00 92.86  ? 488 SER A CB   1 
ATOM   6378 O OG   . SER A 1 417 ? -10.046 -42.825 -42.398 1.00 98.79  ? 488 SER A OG   1 
ATOM   6379 H H    . SER A 1 417 ? -9.056  -44.295 -40.711 1.00 101.72 ? 488 SER A H    1 
ATOM   6380 H HA   . SER A 1 417 ? -11.400 -45.441 -41.020 1.00 106.42 ? 488 SER A HA   1 
ATOM   6381 H HB2  . SER A 1 417 ? -11.845 -43.600 -42.486 1.00 111.44 ? 488 SER A HB2  1 
ATOM   6382 H HB3  . SER A 1 417 ? -11.402 -43.168 -41.025 1.00 111.44 ? 488 SER A HB3  1 
ATOM   6383 H HG   . SER A 1 417 ? -9.424  -42.755 -41.838 1.00 118.55 ? 488 SER A HG   1 
ATOM   6384 N N    . LEU A 1 418 ? -9.363  -45.857 -43.419 1.00 94.94  ? 489 LEU A N    1 
ATOM   6385 C CA   . LEU A 1 418 ? -9.152  -46.618 -44.643 1.00 99.70  ? 489 LEU A CA   1 
ATOM   6386 C C    . LEU A 1 418 ? -9.210  -48.114 -44.367 1.00 94.68  ? 489 LEU A C    1 
ATOM   6387 O O    . LEU A 1 418 ? -9.707  -48.887 -45.195 1.00 91.00  ? 489 LEU A O    1 
ATOM   6388 C CB   . LEU A 1 418 ? -7.815  -46.218 -45.257 1.00 108.99 ? 489 LEU A CB   1 
ATOM   6389 C CG   . LEU A 1 418 ? -7.545  -46.751 -46.655 1.00 116.90 ? 489 LEU A CG   1 
ATOM   6390 C CD1  . LEU A 1 418 ? -6.781  -45.704 -47.434 1.00 122.48 ? 489 LEU A CD1  1 
ATOM   6391 C CD2  . LEU A 1 418 ? -6.771  -48.072 -46.587 1.00 118.82 ? 489 LEU A CD2  1 
ATOM   6392 H H    . LEU A 1 418 ? -8.666  -45.445 -43.129 1.00 113.92 ? 489 LEU A H    1 
ATOM   6393 H HA   . LEU A 1 418 ? -9.853  -46.401 -45.277 1.00 119.64 ? 489 LEU A HA   1 
ATOM   6394 H HB2  . LEU A 1 418 ? -7.778  -45.250 -45.303 1.00 130.79 ? 489 LEU A HB2  1 
ATOM   6395 H HB3  . LEU A 1 418 ? -7.105  -46.541 -44.680 1.00 130.79 ? 489 LEU A HB3  1 
ATOM   6396 H HG   . LEU A 1 418 ? -8.388  -46.913 -47.106 1.00 140.28 ? 489 LEU A HG   1 
ATOM   6397 H HD11 . LEU A 1 418 ? -6.554  -46.064 -48.306 1.00 146.97 ? 489 LEU A HD11 1 
ATOM   6398 H HD12 . LEU A 1 418 ? -7.338  -44.917 -47.536 1.00 146.97 ? 489 LEU A HD12 1 
ATOM   6399 H HD13 . LEU A 1 418 ? -5.972  -45.477 -46.948 1.00 146.97 ? 489 LEU A HD13 1 
ATOM   6400 H HD21 . LEU A 1 418 ? -6.537  -48.345 -47.488 1.00 142.59 ? 489 LEU A HD21 1 
ATOM   6401 H HD22 . LEU A 1 418 ? -5.965  -47.940 -46.063 1.00 142.59 ? 489 LEU A HD22 1 
ATOM   6402 H HD23 . LEU A 1 418 ? -7.329  -48.748 -46.172 1.00 142.59 ? 489 LEU A HD23 1 
ATOM   6403 N N    . ASN A 1 419 ? -8.714  -48.539 -43.203 1.00 99.69  ? 490 ASN A N    1 
ATOM   6404 C CA   . ASN A 1 419 ? -8.848  -49.934 -42.805 1.00 102.41 ? 490 ASN A CA   1 
ATOM   6405 C C    . ASN A 1 419 ? -10.318 -50.340 -42.703 1.00 101.68 ? 490 ASN A C    1 
ATOM   6406 O O    . ASN A 1 419 ? -10.708 -51.411 -43.185 1.00 101.98 ? 490 ASN A O    1 
ATOM   6407 C CB   . ASN A 1 419 ? -8.124  -50.162 -41.475 1.00 105.69 ? 490 ASN A CB   1 
ATOM   6408 C CG   . ASN A 1 419 ? -8.418  -51.527 -40.875 1.00 108.76 ? 490 ASN A CG   1 
ATOM   6409 O OD1  . ASN A 1 419 ? -7.756  -52.512 -41.193 1.00 113.12 ? 490 ASN A OD1  1 
ATOM   6410 N ND2  . ASN A 1 419 ? -9.419  -51.589 -40.002 1.00 106.64 ? 490 ASN A ND2  1 
ATOM   6411 H H    . ASN A 1 419 ? -8.301  -48.043 -42.634 1.00 119.63 ? 490 ASN A H    1 
ATOM   6412 H HA   . ASN A 1 419 ? -8.428  -50.495 -43.475 1.00 122.89 ? 490 ASN A HA   1 
ATOM   6413 H HB2  . ASN A 1 419 ? -7.167  -50.098 -41.621 1.00 126.83 ? 490 ASN A HB2  1 
ATOM   6414 H HB3  . ASN A 1 419 ? -8.409  -49.487 -40.840 1.00 126.83 ? 490 ASN A HB3  1 
ATOM   6415 H HD21 . ASN A 1 419 ? -9.624  -52.339 -39.635 1.00 127.97 ? 490 ASN A HD21 1 
ATOM   6416 H HD22 . ASN A 1 419 ? -9.862  -50.879 -39.804 1.00 127.97 ? 490 ASN A HD22 1 
ATOM   6417 N N    . LEU A 1 420 ? -11.152 -49.493 -42.085 1.00 97.45  ? 491 LEU A N    1 
ATOM   6418 C CA   . LEU A 1 420 ? -12.567 -49.832 -41.922 1.00 90.81  ? 491 LEU A CA   1 
ATOM   6419 C C    . LEU A 1 420 ? -13.273 -49.911 -43.266 1.00 86.63  ? 491 LEU A C    1 
ATOM   6420 O O    . LEU A 1 420 ? -14.092 -50.811 -43.493 1.00 86.74  ? 491 LEU A O    1 
ATOM   6421 C CB   . LEU A 1 420 ? -13.280 -48.803 -41.040 1.00 83.72  ? 491 LEU A CB   1 
ATOM   6422 C CG   . LEU A 1 420 ? -12.961 -48.777 -39.549 1.00 76.53  ? 491 LEU A CG   1 
ATOM   6423 C CD1  . LEU A 1 420 ? -13.646 -47.574 -38.895 1.00 73.06  ? 491 LEU A CD1  1 
ATOM   6424 C CD2  . LEU A 1 420 ? -13.386 -50.073 -38.871 1.00 72.84  ? 491 LEU A CD2  1 
ATOM   6425 H H    . LEU A 1 420 ? -10.926 -48.730 -41.758 1.00 116.94 ? 491 LEU A H    1 
ATOM   6426 H HA   . LEU A 1 420 ? -12.638 -50.699 -41.494 1.00 108.97 ? 491 LEU A HA   1 
ATOM   6427 H HB2  . LEU A 1 420 ? -13.072 -47.921 -41.387 1.00 100.46 ? 491 LEU A HB2  1 
ATOM   6428 H HB3  . LEU A 1 420 ? -14.235 -48.955 -41.120 1.00 100.46 ? 491 LEU A HB3  1 
ATOM   6429 H HG   . LEU A 1 420 ? -12.003 -48.677 -39.432 1.00 91.84  ? 491 LEU A HG   1 
ATOM   6430 H HD11 . LEU A 1 420 ? -13.438 -47.569 -37.948 1.00 87.67  ? 491 LEU A HD11 1 
ATOM   6431 H HD12 . LEU A 1 420 ? -13.319 -46.761 -39.310 1.00 87.67  ? 491 LEU A HD12 1 
ATOM   6432 H HD13 . LEU A 1 420 ? -14.605 -47.649 -39.023 1.00 87.67  ? 491 LEU A HD13 1 
ATOM   6433 H HD21 . LEU A 1 420 ? -13.242 -49.990 -37.915 1.00 87.41  ? 491 LEU A HD21 1 
ATOM   6434 H HD22 . LEU A 1 420 ? -14.326 -50.230 -39.052 1.00 87.41  ? 491 LEU A HD22 1 
ATOM   6435 H HD23 . LEU A 1 420 ? -12.855 -50.804 -39.224 1.00 87.41  ? 491 LEU A HD23 1 
ATOM   6436 N N    . ILE A 1 421 ? -12.989 -48.958 -44.154 1.00 83.07  ? 492 ILE A N    1 
ATOM   6437 C CA   . ILE A 1 421 ? -13.660 -48.916 -45.447 1.00 81.46  ? 492 ILE A CA   1 
ATOM   6438 C C    . ILE A 1 421 ? -13.262 -50.117 -46.291 1.00 86.85  ? 492 ILE A C    1 
ATOM   6439 O O    . ILE A 1 421 ? -14.111 -50.769 -46.909 1.00 82.64  ? 492 ILE A O    1 
ATOM   6440 C CB   . ILE A 1 421 ? -13.346 -47.589 -46.157 1.00 80.83  ? 492 ILE A CB   1 
ATOM   6441 C CG1  . ILE A 1 421 ? -14.191 -46.473 -45.541 1.00 83.01  ? 492 ILE A CG1  1 
ATOM   6442 C CG2  . ILE A 1 421 ? -13.588 -47.697 -47.665 1.00 78.01  ? 492 ILE A CG2  1 
ATOM   6443 C CD1  . ILE A 1 421 ? -13.782 -45.087 -45.946 1.00 86.72  ? 492 ILE A CD1  1 
ATOM   6444 H H    . ILE A 1 421 ? -12.415 -48.329 -44.031 1.00 99.69  ? 492 ILE A H    1 
ATOM   6445 H HA   . ILE A 1 421 ? -14.619 -48.957 -45.305 1.00 97.75  ? 492 ILE A HA   1 
ATOM   6446 H HB   . ILE A 1 421 ? -12.410 -47.379 -46.012 1.00 97.00  ? 492 ILE A HB   1 
ATOM   6447 H HG12 . ILE A 1 421 ? -15.114 -46.598 -45.811 1.00 99.61  ? 492 ILE A HG12 1 
ATOM   6448 H HG13 . ILE A 1 421 ? -14.123 -46.529 -44.575 1.00 99.61  ? 492 ILE A HG13 1 
ATOM   6449 H HG21 . ILE A 1 421 ? -13.629 -46.805 -48.044 1.00 93.61  ? 492 ILE A HG21 1 
ATOM   6450 H HG22 . ILE A 1 421 ? -12.858 -48.190 -48.071 1.00 93.61  ? 492 ILE A HG22 1 
ATOM   6451 H HG23 . ILE A 1 421 ? -14.428 -48.157 -47.818 1.00 93.61  ? 492 ILE A HG23 1 
ATOM   6452 H HD11 . ILE A 1 421 ? -14.207 -44.451 -45.350 1.00 104.06 ? 492 ILE A HD11 1 
ATOM   6453 H HD12 . ILE A 1 421 ? -12.817 -45.011 -45.879 1.00 104.06 ? 492 ILE A HD12 1 
ATOM   6454 H HD13 . ILE A 1 421 ? -14.064 -44.926 -46.860 1.00 104.06 ? 492 ILE A HD13 1 
ATOM   6455 N N    . GLU A 1 422 ? -11.965 -50.426 -46.339 1.00 98.59  ? 493 GLU A N    1 
ATOM   6456 C CA   . GLU A 1 422 ? -11.535 -51.564 -47.140 1.00 110.73 ? 493 GLU A CA   1 
ATOM   6457 C C    . GLU A 1 422 ? -12.023 -52.874 -46.540 1.00 105.74 ? 493 GLU A C    1 
ATOM   6458 O O    . GLU A 1 422 ? -12.342 -53.816 -47.276 1.00 104.74 ? 493 GLU A O    1 
ATOM   6459 C CB   . GLU A 1 422 ? -10.010 -51.575 -47.282 1.00 127.27 ? 493 GLU A CB   1 
ATOM   6460 C CG   . GLU A 1 422 ? -9.458  -50.491 -48.215 1.00 141.32 ? 493 GLU A CG   1 
ATOM   6461 C CD   . GLU A 1 422 ? -8.050  -50.798 -48.737 1.00 153.87 ? 493 GLU A CD   1 
ATOM   6462 O OE1  . GLU A 1 422 ? -7.533  -51.906 -48.477 1.00 159.66 ? 493 GLU A OE1  1 
ATOM   6463 O OE2  . GLU A 1 422 ? -7.460  -49.929 -49.417 1.00 157.01 ? 493 GLU A OE2  1 
ATOM   6464 H H    . GLU A 1 422 ? -11.335 -50.006 -45.930 1.00 118.31 ? 493 GLU A H    1 
ATOM   6465 H HA   . GLU A 1 422 ? -11.916 -51.484 -48.028 1.00 132.87 ? 493 GLU A HA   1 
ATOM   6466 H HB2  . GLU A 1 422 ? -9.615  -51.441 -46.406 1.00 152.72 ? 493 GLU A HB2  1 
ATOM   6467 H HB3  . GLU A 1 422 ? -9.739  -52.437 -47.635 1.00 152.72 ? 493 GLU A HB3  1 
ATOM   6468 H HG2  . GLU A 1 422 ? -10.047 -50.405 -48.981 1.00 169.58 ? 493 GLU A HG2  1 
ATOM   6469 H HG3  . GLU A 1 422 ? -9.420  -49.651 -47.732 1.00 169.58 ? 493 GLU A HG3  1 
ATOM   6470 N N    . LYS A 1 423 ? -12.122 -52.939 -45.218 1.00 102.67 ? 494 LYS A N    1 
ATOM   6471 C CA   . LYS A 1 423 ? -12.393 -54.207 -44.558 1.00 100.44 ? 494 LYS A CA   1 
ATOM   6472 C C    . LYS A 1 423 ? -13.888 -54.528 -44.513 1.00 95.52  ? 494 LYS A C    1 
ATOM   6473 O O    . LYS A 1 423 ? -14.273 -55.698 -44.622 1.00 93.95  ? 494 LYS A O    1 
ATOM   6474 C CB   . LYS A 1 423 ? -11.787 -54.172 -43.153 1.00 103.01 ? 494 LYS A CB   1 
ATOM   6475 C CG   . LYS A 1 423 ? -11.633 -55.521 -42.482 1.00 106.90 ? 494 LYS A CG   1 
ATOM   6476 C CD   . LYS A 1 423 ? -10.757 -55.400 -41.233 1.00 111.05 ? 494 LYS A CD   1 
ATOM   6477 C CE   . LYS A 1 423 ? -10.822 -56.652 -40.368 1.00 114.93 ? 494 LYS A CE   1 
ATOM   6478 N NZ   . LYS A 1 423 ? -10.395 -57.877 -41.102 1.00 119.30 ? 494 LYS A NZ   1 
ATOM   6479 H H    . LYS A 1 423 ? -12.037 -52.270 -44.685 1.00 123.20 ? 494 LYS A H    1 
ATOM   6480 H HA   . LYS A 1 423 ? -11.953 -54.916 -45.052 1.00 120.52 ? 494 LYS A HA   1 
ATOM   6481 H HB2  . LYS A 1 423 ? -10.903 -53.779 -43.211 1.00 123.62 ? 494 LYS A HB2  1 
ATOM   6482 H HB3  . LYS A 1 423 ? -12.351 -53.624 -42.586 1.00 123.62 ? 494 LYS A HB3  1 
ATOM   6483 H HG2  . LYS A 1 423 ? -12.505 -55.851 -42.215 1.00 128.29 ? 494 LYS A HG2  1 
ATOM   6484 H HG3  . LYS A 1 423 ? -11.209 -56.141 -43.096 1.00 128.29 ? 494 LYS A HG3  1 
ATOM   6485 H HD2  . LYS A 1 423 ? -9.835  -55.266 -41.502 1.00 133.26 ? 494 LYS A HD2  1 
ATOM   6486 H HD3  . LYS A 1 423 ? -11.063 -54.649 -40.701 1.00 133.26 ? 494 LYS A HD3  1 
ATOM   6487 H HE2  . LYS A 1 423 ? -10.236 -56.540 -39.603 1.00 137.92 ? 494 LYS A HE2  1 
ATOM   6488 H HE3  . LYS A 1 423 ? -11.736 -56.782 -40.072 1.00 137.92 ? 494 LYS A HE3  1 
ATOM   6489 H HZ1  . LYS A 1 423 ? -10.441 -58.585 -40.565 1.00 143.17 ? 494 LYS A HZ1  1 
ATOM   6490 H HZ2  . LYS A 1 423 ? -10.926 -58.012 -41.804 1.00 143.17 ? 494 LYS A HZ2  1 
ATOM   6491 H HZ3  . LYS A 1 423 ? -9.557  -57.784 -41.387 1.00 143.17 ? 494 LYS A HZ3  1 
ATOM   6492 N N    . TYR A 1 424 ? -14.751 -53.520 -44.374 1.00 95.43  ? 495 TYR A N    1 
ATOM   6493 C CA   . TYR A 1 424 ? -16.175 -53.775 -44.173 1.00 91.60  ? 495 TYR A CA   1 
ATOM   6494 C C    . TYR A 1 424 ? -17.101 -53.081 -45.164 1.00 94.89  ? 495 TYR A C    1 
ATOM   6495 O O    . TYR A 1 424 ? -18.309 -53.343 -45.125 1.00 88.83  ? 495 TYR A O    1 
ATOM   6496 C CB   . TYR A 1 424 ? -16.594 -53.364 -42.753 1.00 85.22  ? 495 TYR A CB   1 
ATOM   6497 C CG   . TYR A 1 424 ? -15.674 -53.871 -41.665 1.00 82.56  ? 495 TYR A CG   1 
ATOM   6498 C CD1  . TYR A 1 424 ? -15.781 -55.173 -41.181 1.00 80.96  ? 495 TYR A CD1  1 
ATOM   6499 C CD2  . TYR A 1 424 ? -14.700 -53.053 -41.122 1.00 82.69  ? 495 TYR A CD2  1 
ATOM   6500 C CE1  . TYR A 1 424 ? -14.940 -55.643 -40.183 1.00 80.61  ? 495 TYR A CE1  1 
ATOM   6501 C CE2  . TYR A 1 424 ? -13.855 -53.513 -40.122 1.00 82.64  ? 495 TYR A CE2  1 
ATOM   6502 C CZ   . TYR A 1 424 ? -13.980 -54.807 -39.658 1.00 81.39  ? 495 TYR A CZ   1 
ATOM   6503 O OH   . TYR A 1 424 ? -13.140 -55.254 -38.662 1.00 81.19  ? 495 TYR A OH   1 
ATOM   6504 H H    . TYR A 1 424 ? -14.538 -52.687 -44.392 1.00 114.51 ? 495 TYR A H    1 
ATOM   6505 H HA   . TYR A 1 424 ? -16.336 -54.727 -44.254 1.00 109.92 ? 495 TYR A HA   1 
ATOM   6506 H HB2  . TYR A 1 424 ? -16.608 -52.396 -42.701 1.00 102.26 ? 495 TYR A HB2  1 
ATOM   6507 H HB3  . TYR A 1 424 ? -17.481 -53.714 -42.577 1.00 102.26 ? 495 TYR A HB3  1 
ATOM   6508 H HD1  . TYR A 1 424 ? -16.429 -55.738 -41.534 1.00 97.16  ? 495 TYR A HD1  1 
ATOM   6509 H HD2  . TYR A 1 424 ? -14.612 -52.180 -41.430 1.00 99.22  ? 495 TYR A HD2  1 
ATOM   6510 H HE1  . TYR A 1 424 ? -15.026 -56.514 -39.869 1.00 96.73  ? 495 TYR A HE1  1 
ATOM   6511 H HE2  . TYR A 1 424 ? -13.206 -52.951 -39.765 1.00 99.17  ? 495 TYR A HE2  1 
ATOM   6512 H HH   . TYR A 1 424 ? -13.321 -56.051 -38.470 1.00 97.43  ? 495 TYR A HH   1 
ATOM   6513 N N    . PHE A 1 425 ? -16.591 -52.231 -46.049 1.00 97.68  ? 496 PHE A N    1 
ATOM   6514 C CA   . PHE A 1 425 ? -17.424 -51.462 -46.974 1.00 105.67 ? 496 PHE A CA   1 
ATOM   6515 C C    . PHE A 1 425 ? -16.923 -51.609 -48.407 1.00 113.78 ? 496 PHE A C    1 
ATOM   6516 O O    . PHE A 1 425 ? -16.772 -50.632 -49.143 1.00 118.65 ? 496 PHE A O    1 
ATOM   6517 C CB   . PHE A 1 425 ? -17.452 -49.991 -46.565 1.00 103.09 ? 496 PHE A CB   1 
ATOM   6518 C CG   . PHE A 1 425 ? -17.961 -49.760 -45.171 1.00 98.04  ? 496 PHE A CG   1 
ATOM   6519 C CD1  . PHE A 1 425 ? -17.101 -49.808 -44.083 1.00 95.52  ? 496 PHE A CD1  1 
ATOM   6520 C CD2  . PHE A 1 425 ? -19.300 -49.495 -44.946 1.00 94.69  ? 496 PHE A CD2  1 
ATOM   6521 C CE1  . PHE A 1 425 ? -17.572 -49.596 -42.789 1.00 91.15  ? 496 PHE A CE1  1 
ATOM   6522 C CE2  . PHE A 1 425 ? -19.773 -49.282 -43.657 1.00 90.53  ? 496 PHE A CE2  1 
ATOM   6523 C CZ   . PHE A 1 425 ? -18.905 -49.335 -42.578 1.00 88.83  ? 496 PHE A CZ   1 
ATOM   6524 H H    . PHE A 1 425 ? -15.749 -52.078 -46.136 1.00 117.22 ? 496 PHE A H    1 
ATOM   6525 H HA   . PHE A 1 425 ? -18.333 -51.798 -46.941 1.00 126.80 ? 496 PHE A HA   1 
ATOM   6526 H HB2  . PHE A 1 425 ? -16.551 -49.636 -46.614 1.00 123.71 ? 496 PHE A HB2  1 
ATOM   6527 H HB3  . PHE A 1 425 ? -18.030 -49.508 -47.176 1.00 123.71 ? 496 PHE A HB3  1 
ATOM   6528 H HD1  . PHE A 1 425 ? -16.198 -49.986 -44.219 1.00 114.63 ? 496 PHE A HD1  1 
ATOM   6529 H HD2  . PHE A 1 425 ? -19.889 -49.459 -45.664 1.00 113.63 ? 496 PHE A HD2  1 
ATOM   6530 H HE1  . PHE A 1 425 ? -16.985 -49.631 -42.069 1.00 109.38 ? 496 PHE A HE1  1 
ATOM   6531 H HE2  . PHE A 1 425 ? -20.675 -49.105 -43.518 1.00 108.63 ? 496 PHE A HE2  1 
ATOM   6532 H HZ   . PHE A 1 425 ? -19.222 -49.191 -41.716 1.00 106.59 ? 496 PHE A HZ   1 
ATOM   6533 N N    . SER A 1 426 ? -16.683 -52.847 -48.828 1.00 120.06 ? 497 SER A N    1 
ATOM   6534 C CA   . SER A 1 426 ? -16.118 -53.137 -50.138 1.00 125.97 ? 497 SER A CA   1 
ATOM   6535 C C    . SER A 1 426 ? -17.047 -54.046 -50.936 1.00 134.92 ? 497 SER A C    1 
ATOM   6536 O O    . SER A 1 426 ? -18.014 -54.606 -50.414 1.00 132.29 ? 497 SER A O    1 
ATOM   6537 C CB   . SER A 1 426 ? -14.736 -53.783 -50.000 1.00 125.69 ? 497 SER A CB   1 
ATOM   6538 O OG   . SER A 1 426 ? -13.812 -52.870 -49.435 1.00 124.88 ? 497 SER A OG   1 
ATOM   6539 H H    . SER A 1 426 ? -16.843 -53.551 -48.360 1.00 144.07 ? 497 SER A H    1 
ATOM   6540 H HA   . SER A 1 426 ? -16.013 -52.310 -50.633 1.00 151.16 ? 497 SER A HA   1 
ATOM   6541 H HB2  . SER A 1 426 ? -14.806 -54.560 -49.423 1.00 150.82 ? 497 SER A HB2  1 
ATOM   6542 H HB3  . SER A 1 426 ? -14.421 -54.048 -50.878 1.00 150.82 ? 497 SER A HB3  1 
ATOM   6543 H HG   . SER A 1 426 ? -13.058 -53.232 -49.363 1.00 149.85 ? 497 SER A HG   1 
ATOM   6544 N N    . VAL A 1 427 ? -16.725 -54.193 -52.221 1.00 148.00 ? 498 VAL A N    1 
ATOM   6545 C CA   . VAL A 1 427 ? -17.511 -54.998 -53.159 1.00 150.57 ? 498 VAL A CA   1 
ATOM   6546 C C    . VAL A 1 427 ? -18.868 -54.326 -53.350 1.00 149.54 ? 498 VAL A C    1 
ATOM   6547 O O    . VAL A 1 427 ? -18.992 -53.123 -53.118 1.00 147.10 ? 498 VAL A O    1 
ATOM   6548 C CB   . VAL A 1 427 ? -17.669 -56.464 -52.682 1.00 147.63 ? 498 VAL A CB   1 
ATOM   6549 C CG1  . VAL A 1 427 ? -18.161 -57.352 -53.823 1.00 145.83 ? 498 VAL A CG1  1 
ATOM   6550 C CG2  . VAL A 1 427 ? -16.351 -57.004 -52.127 1.00 148.75 ? 498 VAL A CG2  1 
ATOM   6551 H H    . VAL A 1 427 ? -16.037 -53.826 -52.583 1.00 177.61 ? 498 VAL A H    1 
ATOM   6552 H HA   . VAL A 1 427 ? -17.060 -55.010 -54.018 1.00 180.69 ? 498 VAL A HA   1 
ATOM   6553 H HB   . VAL A 1 427 ? -18.329 -56.497 -51.972 1.00 177.15 ? 498 VAL A HB   1 
ATOM   6554 H HG11 . VAL A 1 427 ? -18.057 -58.281 -53.565 1.00 174.99 ? 498 VAL A HG11 1 
ATOM   6555 H HG12 . VAL A 1 427 ? -19.096 -57.162 -53.996 1.00 174.99 ? 498 VAL A HG12 1 
ATOM   6556 H HG13 . VAL A 1 427 ? -17.632 -57.170 -54.615 1.00 174.99 ? 498 VAL A HG13 1 
ATOM   6557 H HG21 . VAL A 1 427 ? -16.431 -57.962 -52.000 1.00 178.50 ? 498 VAL A HG21 1 
ATOM   6558 H HG22 . VAL A 1 427 ? -15.641 -56.813 -52.760 1.00 178.50 ? 498 VAL A HG22 1 
ATOM   6559 H HG23 . VAL A 1 427 ? -16.162 -56.574 -51.279 1.00 178.50 ? 498 VAL A HG23 1 
ATOM   6560 N N    . THR B 2 1   ? -13.315 -24.975 0.064   1.00 96.16  ? 13  THR B N    1 
ATOM   6561 C CA   . THR B 2 1   ? -12.334 -25.308 -0.964  1.00 98.37  ? 13  THR B CA   1 
ATOM   6562 C C    . THR B 2 1   ? -11.463 -24.101 -1.303  1.00 102.69 ? 13  THR B C    1 
ATOM   6563 O O    . THR B 2 1   ? -10.534 -24.218 -2.105  1.00 105.67 ? 13  THR B O    1 
ATOM   6564 C CB   . THR B 2 1   ? -13.008 -25.827 -2.276  1.00 93.92  ? 13  THR B CB   1 
ATOM   6565 O OG1  . THR B 2 1   ? -12.013 -26.380 -3.150  1.00 89.57  ? 13  THR B OG1  1 
ATOM   6566 C CG2  . THR B 2 1   ? -13.757 -24.713 -3.017  1.00 93.86  ? 13  THR B CG2  1 
ATOM   6567 H HA   . THR B 2 1   ? -11.754 -26.010 -0.629  1.00 118.04 ? 13  THR B HA   1 
ATOM   6568 H HB   . THR B 2 1   ? -13.650 -26.514 -2.046  1.00 112.70 ? 13  THR B HB   1 
ATOM   6569 H HG1  . THR B 2 1   ? -11.450 -25.791 -3.354  1.00 107.49 ? 13  THR B HG1  1 
ATOM   6570 H HG21 . THR B 2 1   ? -14.332 -25.097 -3.698  1.00 112.64 ? 13  THR B HG21 1 
ATOM   6571 H HG22 . THR B 2 1   ? -14.302 -24.209 -2.393  1.00 112.64 ? 13  THR B HG22 1 
ATOM   6572 H HG23 . THR B 2 1   ? -13.126 -24.111 -3.441  1.00 112.64 ? 13  THR B HG23 1 
ATOM   6573 N N    . ASN B 2 2   ? -11.769 -22.941 -0.719  1.00 107.18 ? 14  ASN B N    1 
ATOM   6574 C CA   . ASN B 2 2   ? -10.948 -21.759 -0.957  1.00 99.11  ? 14  ASN B CA   1 
ATOM   6575 C C    . ASN B 2 2   ? -9.620  -21.908 -0.235  1.00 87.76  ? 14  ASN B C    1 
ATOM   6576 O O    . ASN B 2 2   ? -9.558  -22.421 0.885   1.00 82.10  ? 14  ASN B O    1 
ATOM   6577 C CB   . ASN B 2 2   ? -11.660 -20.486 -0.494  1.00 107.80 ? 14  ASN B CB   1 
ATOM   6578 C CG   . ASN B 2 2   ? -11.509 -19.333 -1.488  1.00 112.16 ? 14  ASN B CG   1 
ATOM   6579 O OD1  . ASN B 2 2   ? -10.412 -19.063 -1.997  1.00 110.36 ? 14  ASN B OD1  1 
ATOM   6580 N ND2  . ASN B 2 2   ? -12.622 -18.657 -1.778  1.00 116.61 ? 14  ASN B ND2  1 
ATOM   6581 H H    . ASN B 2 2   ? -12.435 -22.813 -0.190  1.00 128.62 ? 14  ASN B H    1 
ATOM   6582 H HA   . ASN B 2 2   ? -10.770 -21.679 -1.907  1.00 118.93 ? 14  ASN B HA   1 
ATOM   6583 H HB2  . ASN B 2 2   ? -12.606 -20.672 -0.391  1.00 129.36 ? 14  ASN B HB2  1 
ATOM   6584 H HB3  . ASN B 2 2   ? -11.283 -20.203 0.354   1.00 129.36 ? 14  ASN B HB3  1 
ATOM   6585 H HD21 . ASN B 2 2   ? -12.594 -18.000 -2.332  1.00 139.92 ? 14  ASN B HD21 1 
ATOM   6586 H HD22 . ASN B 2 2   ? -13.368 -18.879 -1.411  1.00 139.92 ? 14  ASN B HD22 1 
ATOM   6587 N N    . LYS B 2 3   ? -8.544  -21.488 -0.898  1.00 80.28  ? 15  LYS B N    1 
ATOM   6588 C CA   . LYS B 2 3   ? -7.232  -21.616 -0.285  1.00 70.02  ? 15  LYS B CA   1 
ATOM   6589 C C    . LYS B 2 3   ? -7.131  -20.740 0.957   1.00 57.46  ? 15  LYS B C    1 
ATOM   6590 O O    . LYS B 2 3   ? -6.663  -21.199 2.003   1.00 52.07  ? 15  LYS B O    1 
ATOM   6591 C CB   . LYS B 2 3   ? -6.138  -21.279 -1.302  1.00 70.75  ? 15  LYS B CB   1 
ATOM   6592 C CG   . LYS B 2 3   ? -6.330  -19.958 -2.027  1.00 73.74  ? 15  LYS B CG   1 
ATOM   6593 C CD   . LYS B 2 3   ? -4.982  -19.350 -2.454  1.00 73.61  ? 15  LYS B CD   1 
ATOM   6594 C CE   . LYS B 2 3   ? -5.179  -17.971 -3.076  1.00 73.60  ? 15  LYS B CE   1 
ATOM   6595 N NZ   . LYS B 2 3   ? -4.038  -17.022 -2.802  1.00 70.73  ? 15  LYS B NZ   1 
ATOM   6596 H H    . LYS B 2 3   ? -8.549  -21.137 -1.683  1.00 96.34  ? 15  LYS B H    1 
ATOM   6597 H HA   . LYS B 2 3   ? -7.105  -22.537 -0.008  1.00 84.03  ? 15  LYS B HA   1 
ATOM   6598 H HB2  . LYS B 2 3   ? -5.287  -21.238 -0.838  1.00 84.90  ? 15  LYS B HB2  1 
ATOM   6599 H HB3  . LYS B 2 3   ? -6.111  -21.980 -1.972  1.00 84.90  ? 15  LYS B HB3  1 
ATOM   6600 H HG2  . LYS B 2 3   ? -6.861  -20.107 -2.825  1.00 88.49  ? 15  LYS B HG2  1 
ATOM   6601 H HG3  . LYS B 2 3   ? -6.775  -19.326 -1.443  1.00 88.49  ? 15  LYS B HG3  1 
ATOM   6602 H HD2  . LYS B 2 3   ? -4.410  -19.255 -1.676  1.00 88.34  ? 15  LYS B HD2  1 
ATOM   6603 H HD3  . LYS B 2 3   ? -4.563  -19.926 -3.113  1.00 88.34  ? 15  LYS B HD3  1 
ATOM   6604 H HE2  . LYS B 2 3   ? -5.260  -18.069 -4.038  1.00 88.32  ? 15  LYS B HE2  1 
ATOM   6605 H HE3  . LYS B 2 3   ? -5.988  -17.576 -2.715  1.00 88.32  ? 15  LYS B HE3  1 
ATOM   6606 H HZ1  . LYS B 2 3   ? -4.204  -16.232 -3.176  1.00 84.88  ? 15  LYS B HZ1  1 
ATOM   6607 H HZ2  . LYS B 2 3   ? -3.938  -16.912 -1.925  1.00 84.88  ? 15  LYS B HZ2  1 
ATOM   6608 H HZ3  . LYS B 2 3   ? -3.283  -17.349 -3.140  1.00 84.88  ? 15  LYS B HZ3  1 
ATOM   6609 N N    . LYS B 2 4   ? -7.625  -19.504 0.883   1.00 57.95  ? 16  LYS B N    1 
ATOM   6610 C CA   . LYS B 2 4   ? -7.458  -18.522 1.943   1.00 56.20  ? 16  LYS B CA   1 
ATOM   6611 C C    . LYS B 2 4   ? -8.773  -17.802 2.233   1.00 61.09  ? 16  LYS B C    1 
ATOM   6612 O O    . LYS B 2 4   ? -9.661  -17.711 1.384   1.00 62.94  ? 16  LYS B O    1 
ATOM   6613 C CB   . LYS B 2 4   ? -6.371  -17.517 1.573   1.00 50.16  ? 16  LYS B CB   1 
ATOM   6614 C CG   . LYS B 2 4   ? -4.969  -18.120 1.618   1.00 46.35  ? 16  LYS B CG   1 
ATOM   6615 C CD   . LYS B 2 4   ? -3.952  -17.175 1.015   1.00 43.69  ? 16  LYS B CD   1 
ATOM   6616 C CE   . LYS B 2 4   ? -2.618  -17.818 0.780   1.00 43.69  ? 16  LYS B CE   1 
ATOM   6617 N NZ   . LYS B 2 4   ? -1.712  -16.871 0.026   1.00 45.03  ? 16  LYS B NZ   1 
ATOM   6618 H H    . LYS B 2 4   ? -8.073  -19.208 0.211   1.00 69.54  ? 16  LYS B H    1 
ATOM   6619 H HA   . LYS B 2 4   ? -7.182  -18.974 2.755   1.00 67.44  ? 16  LYS B HA   1 
ATOM   6620 H HB2  . LYS B 2 4   ? -6.531  -17.196 0.672   1.00 60.20  ? 16  LYS B HB2  1 
ATOM   6621 H HB3  . LYS B 2 4   ? -6.399  -16.776 2.199   1.00 60.20  ? 16  LYS B HB3  1 
ATOM   6622 H HG2  . LYS B 2 4   ? -4.721  -18.288 2.540   1.00 55.62  ? 16  LYS B HG2  1 
ATOM   6623 H HG3  . LYS B 2 4   ? -4.957  -18.946 1.110   1.00 55.62  ? 16  LYS B HG3  1 
ATOM   6624 H HD2  . LYS B 2 4   ? -4.285  -16.856 0.162   1.00 52.42  ? 16  LYS B HD2  1 
ATOM   6625 H HD3  . LYS B 2 4   ? -3.821  -16.427 1.619   1.00 52.42  ? 16  LYS B HD3  1 
ATOM   6626 H HE2  . LYS B 2 4   ? -2.204  -18.029 1.632   1.00 52.42  ? 16  LYS B HE2  1 
ATOM   6627 H HE3  . LYS B 2 4   ? -2.734  -18.622 0.250   1.00 52.42  ? 16  LYS B HE3  1 
ATOM   6628 H HZ1  . LYS B 2 4   ? -0.921  -17.254 -0.113  1.00 54.03  ? 16  LYS B HZ1  1 
ATOM   6629 H HZ2  . LYS B 2 4   ? -2.075  -16.664 -0.760  1.00 54.03  ? 16  LYS B HZ2  1 
ATOM   6630 H HZ3  . LYS B 2 4   ? -1.594  -16.124 0.496   1.00 54.03  ? 16  LYS B HZ3  1 
ATOM   6631 N N    . MET B 2 5   ? -8.859  -17.268 3.457   1.00 59.09  ? 17  MET B N    1 
ATOM   6632 C CA   . MET B 2 5   ? -10.075 -16.697 4.031   1.00 63.45  ? 17  MET B CA   1 
ATOM   6633 C C    . MET B 2 5   ? -9.686  -15.504 4.889   1.00 53.59  ? 17  MET B C    1 
ATOM   6634 O O    . MET B 2 5   ? -9.020  -15.674 5.911   1.00 50.26  ? 17  MET B O    1 
ATOM   6635 C CB   . MET B 2 5   ? -10.793 -17.717 4.921   1.00 76.47  ? 17  MET B CB   1 
ATOM   6636 C CG   . MET B 2 5   ? -11.936 -18.460 4.336   1.00 95.55  ? 17  MET B CG   1 
ATOM   6637 S SD   . MET B 2 5   ? -12.279 -19.965 5.295   1.00 111.29 ? 17  MET B SD   1 
ATOM   6638 C CE   . MET B 2 5   ? -12.415 -19.383 6.987   1.00 106.00 ? 17  MET B CE   1 
ATOM   6639 H H    . MET B 2 5   ? -8.190  -17.226 3.995   1.00 70.90  ? 17  MET B H    1 
ATOM   6640 H HA   . MET B 2 5   ? -10.676 -16.416 3.324   1.00 76.14  ? 17  MET B HA   1 
ATOM   6641 H HB2  . MET B 2 5   ? -10.142 -18.377 5.205   1.00 91.76  ? 17  MET B HB2  1 
ATOM   6642 H HB3  . MET B 2 5   ? -11.129 -17.248 5.701   1.00 91.76  ? 17  MET B HB3  1 
ATOM   6643 H HG2  . MET B 2 5   ? -12.727 -17.899 4.351   1.00 114.66 ? 17  MET B HG2  1 
ATOM   6644 H HG3  . MET B 2 5   ? -11.721 -18.718 3.426   1.00 114.66 ? 17  MET B HG3  1 
ATOM   6645 H HE1  . MET B 2 5   ? -12.661 -20.128 7.557   1.00 127.21 ? 17  MET B HE1  1 
ATOM   6646 H HE2  . MET B 2 5   ? -11.560 -19.021 7.266   1.00 127.21 ? 17  MET B HE2  1 
ATOM   6647 H HE3  . MET B 2 5   ? -13.097 -18.695 7.030   1.00 127.21 ? 17  MET B HE3  1 
ATOM   6648 N N    . ARG B 2 6   ? -10.131 -14.319 4.523   1.00 52.56  ? 18  ARG B N    1 
ATOM   6649 C CA   . ARG B 2 6   ? -10.015 -13.163 5.402   1.00 52.45  ? 18  ARG B CA   1 
ATOM   6650 C C    . ARG B 2 6   ? -11.124 -13.198 6.448   1.00 51.71  ? 18  ARG B C    1 
ATOM   6651 O O    . ARG B 2 6   ? -12.180 -13.788 6.229   1.00 52.98  ? 18  ARG B O    1 
ATOM   6652 C CB   . ARG B 2 6   ? -10.073 -11.895 4.552   1.00 59.29  ? 18  ARG B CB   1 
ATOM   6653 C CG   . ARG B 2 6   ? -10.634 -10.617 5.204   1.00 68.78  ? 18  ARG B CG   1 
ATOM   6654 C CD   . ARG B 2 6   ? -10.781 -9.483  4.174   1.00 82.44  ? 18  ARG B CD   1 
ATOM   6655 N NE   . ARG B 2 6   ? -9.668  -9.507  3.228   1.00 97.97  ? 18  ARG B NE   1 
ATOM   6656 C CZ   . ARG B 2 6   ? -9.651  -10.178 2.072   1.00 116.48 ? 18  ARG B CZ   1 
ATOM   6657 N NH1  . ARG B 2 6   ? -10.706 -10.885 1.673   1.00 125.14 ? 18  ARG B NH1  1 
ATOM   6658 N NH2  . ARG B 2 6   ? -8.567  -10.146 1.300   1.00 121.60 ? 18  ARG B NH2  1 
ATOM   6659 H H    . ARG B 2 6   ? -10.507 -14.153 3.768   1.00 63.08  ? 18  ARG B H    1 
ATOM   6660 H HA   . ARG B 2 6   ? -9.160  -13.187 5.859   1.00 62.94  ? 18  ARG B HA   1 
ATOM   6661 H HB2  . ARG B 2 6   ? -9.170  -11.700 4.258   1.00 71.15  ? 18  ARG B HB2  1 
ATOM   6662 H HB3  . ARG B 2 6   ? -10.630 -12.088 3.784   1.00 71.15  ? 18  ARG B HB3  1 
ATOM   6663 H HG2  . ARG B 2 6   ? -11.513 -10.794 5.572   1.00 82.54  ? 18  ARG B HG2  1 
ATOM   6664 H HG3  . ARG B 2 6   ? -10.029 -10.320 5.902   1.00 82.54  ? 18  ARG B HG3  1 
ATOM   6665 H HD2  . ARG B 2 6   ? -11.612 -9.591  3.686   1.00 98.93  ? 18  ARG B HD2  1 
ATOM   6666 H HD3  . ARG B 2 6   ? -10.770 -8.629  4.634   1.00 98.93  ? 18  ARG B HD3  1 
ATOM   6667 H HE   . ARG B 2 6   ? -8.967  -9.053  3.431   1.00 117.56 ? 18  ARG B HE   1 
ATOM   6668 H HH11 . ARG B 2 6   ? -11.412 -10.924 2.161   1.00 150.17 ? 18  ARG B HH11 1 
ATOM   6669 H HH12 . ARG B 2 6   ? -10.679 -11.308 0.925   1.00 150.17 ? 18  ARG B HH12 1 
ATOM   6670 H HH21 . ARG B 2 6   ? -7.880  -9.689  1.542   1.00 145.91 ? 18  ARG B HH21 1 
ATOM   6671 H HH22 . ARG B 2 6   ? -8.560  -10.569 0.551   1.00 145.91 ? 18  ARG B HH22 1 
ATOM   6672 N N    . ARG B 2 7   ? -10.877 -12.587 7.606   1.00 50.06  ? 19  ARG B N    1 
ATOM   6673 C CA   . ARG B 2 7   ? -11.927 -12.422 8.607   1.00 52.73  ? 19  ARG B CA   1 
ATOM   6674 C C    . ARG B 2 7   ? -12.460 -10.988 8.609   1.00 53.80  ? 19  ARG B C    1 
ATOM   6675 O O    . ARG B 2 7   ? -11.719 -10.046 8.906   1.00 53.48  ? 19  ARG B O    1 
ATOM   6676 C CB   . ARG B 2 7   ? -11.441 -12.780 10.003  1.00 50.47  ? 19  ARG B CB   1 
ATOM   6677 C CG   . ARG B 2 7   ? -12.572 -12.620 11.019  1.00 52.34  ? 19  ARG B CG   1 
ATOM   6678 C CD   . ARG B 2 7   ? -12.207 -13.115 12.409  1.00 52.08  ? 19  ARG B CD   1 
ATOM   6679 N NE   . ARG B 2 7   ? -13.251 -12.722 13.354  1.00 54.37  ? 19  ARG B NE   1 
ATOM   6680 C CZ   . ARG B 2 7   ? -13.303 -13.096 14.623  1.00 56.45  ? 19  ARG B CZ   1 
ATOM   6681 N NH1  . ARG B 2 7   ? -14.300 -12.693 15.380  1.00 59.60  ? 19  ARG B NH1  1 
ATOM   6682 N NH2  . ARG B 2 7   ? -12.358 -13.865 15.138  1.00 54.65  ? 19  ARG B NH2  1 
ATOM   6683 H H    . ARG B 2 7   ? -10.115 -12.261 7.834   1.00 60.07  ? 19  ARG B H    1 
ATOM   6684 H HA   . ARG B 2 7   ? -12.666 -13.012 8.394   1.00 63.28  ? 19  ARG B HA   1 
ATOM   6685 H HB2  . ARG B 2 7   ? -11.144 -13.703 10.016  1.00 60.56  ? 19  ARG B HB2  1 
ATOM   6686 H HB3  . ARG B 2 7   ? -10.716 -12.187 10.255  1.00 60.56  ? 19  ARG B HB3  1 
ATOM   6687 H HG2  . ARG B 2 7   ? -12.802 -11.681 11.098  1.00 62.81  ? 19  ARG B HG2  1 
ATOM   6688 H HG3  . ARG B 2 7   ? -13.342 -13.125 10.715  1.00 62.81  ? 19  ARG B HG3  1 
ATOM   6689 H HD2  . ARG B 2 7   ? -12.141 -14.083 12.404  1.00 62.50  ? 19  ARG B HD2  1 
ATOM   6690 H HD3  . ARG B 2 7   ? -11.369 -12.715 12.689  1.00 62.50  ? 19  ARG B HD3  1 
ATOM   6691 H HE   . ARG B 2 7   ? -13.878 -12.210 13.064  1.00 65.25  ? 19  ARG B HE   1 
ATOM   6692 H HH11 . ARG B 2 7   ? -14.914 -12.189 15.050  1.00 71.52  ? 19  ARG B HH11 1 
ATOM   6693 H HH12 . ARG B 2 7   ? -14.334 -12.927 16.207  1.00 71.52  ? 19  ARG B HH12 1 
ATOM   6694 H HH21 . ARG B 2 7   ? -11.705 -14.135 14.648  1.00 65.58  ? 19  ARG B HH21 1 
ATOM   6695 H HH22 . ARG B 2 7   ? -12.400 -14.100 15.964  1.00 65.58  ? 19  ARG B HH22 1 
ATOM   6696 N N    . ASN B 2 8   ? -13.754 -10.837 8.341   1.00 58.10  ? 20  ASN B N    1 
ATOM   6697 C CA   . ASN B 2 8   ? -14.372 -9.532  8.163   1.00 65.80  ? 20  ASN B CA   1 
ATOM   6698 C C    . ASN B 2 8   ? -14.993 -9.032  9.463   1.00 69.24  ? 20  ASN B C    1 
ATOM   6699 O O    . ASN B 2 8   ? -15.272 -9.797  10.392  1.00 63.15  ? 20  ASN B O    1 
ATOM   6700 C CB   . ASN B 2 8   ? -15.442 -9.604  7.070   1.00 79.20  ? 20  ASN B CB   1 
ATOM   6701 C CG   . ASN B 2 8   ? -14.860 -9.491  5.661   1.00 90.76  ? 20  ASN B CG   1 
ATOM   6702 O OD1  . ASN B 2 8   ? -14.074 -8.584  5.366   1.00 94.09  ? 20  ASN B OD1  1 
ATOM   6703 N ND2  . ASN B 2 8   ? -15.252 -10.410 4.783   1.00 96.69  ? 20  ASN B ND2  1 
ATOM   6704 H H    . ASN B 2 8   ? -14.305 -11.492 8.256   1.00 69.72  ? 20  ASN B H    1 
ATOM   6705 H HA   . ASN B 2 8   ? -13.697 -8.894  7.884   1.00 78.96  ? 20  ASN B HA   1 
ATOM   6706 H HB2  . ASN B 2 8   ? -15.904 -10.454 7.136   1.00 95.04  ? 20  ASN B HB2  1 
ATOM   6707 H HB3  . ASN B 2 8   ? -16.069 -8.875  7.194   1.00 95.04  ? 20  ASN B HB3  1 
ATOM   6708 H HD21 . ASN B 2 8   ? -14.976 -10.372 3.970   1.00 116.02 ? 20  ASN B HD21 1 
ATOM   6709 H HD22 . ASN B 2 8   ? -15.782 -11.041 5.029   1.00 116.02 ? 20  ASN B HD22 1 
ATOM   6710 N N    . ARG B 2 9   ? -15.217 -7.724  9.518   1.00 81.87  ? 21  ARG B N    1 
ATOM   6711 C CA   . ARG B 2 9   ? -15.887 -7.146  10.674  1.00 96.70  ? 21  ARG B CA   1 
ATOM   6712 C C    . ARG B 2 9   ? -17.296 -7.708  10.819  1.00 107.64 ? 21  ARG B C    1 
ATOM   6713 O O    . ARG B 2 9   ? -17.945 -8.085  9.841   1.00 113.53 ? 21  ARG B O    1 
ATOM   6714 C CB   . ARG B 2 9   ? -15.942 -5.621  10.557  1.00 101.06 ? 21  ARG B CB   1 
ATOM   6715 C CG   . ARG B 2 9   ? -14.597 -4.936  10.775  1.00 103.12 ? 21  ARG B CG   1 
ATOM   6716 C CD   . ARG B 2 9   ? -14.079 -5.091  12.221  1.00 106.72 ? 21  ARG B CD   1 
ATOM   6717 N NE   . ARG B 2 9   ? -14.979 -4.456  13.197  1.00 111.25 ? 21  ARG B NE   1 
ATOM   6718 C CZ   . ARG B 2 9   ? -15.785 -5.094  14.050  1.00 113.09 ? 21  ARG B CZ   1 
ATOM   6719 N NH1  . ARG B 2 9   ? -16.546 -4.391  14.885  1.00 116.52 ? 21  ARG B NH1  1 
ATOM   6720 N NH2  . ARG B 2 9   ? -15.833 -6.424  14.092  1.00 110.77 ? 21  ARG B NH2  1 
ATOM   6721 H H    . ARG B 2 9   ? -14.995 -7.158  8.910   1.00 98.24  ? 21  ARG B H    1 
ATOM   6722 H HA   . ARG B 2 9   ? -15.392 -7.377  11.474  1.00 116.04 ? 21  ARG B HA   1 
ATOM   6723 H HB2  . ARG B 2 9   ? -16.253 -5.387  9.668   1.00 121.27 ? 21  ARG B HB2  1 
ATOM   6724 H HB3  . ARG B 2 9   ? -16.560 -5.279  11.221  1.00 121.27 ? 21  ARG B HB3  1 
ATOM   6725 H HG2  . ARG B 2 9   ? -13.942 -5.328  10.177  1.00 123.74 ? 21  ARG B HG2  1 
ATOM   6726 H HG3  . ARG B 2 9   ? -14.691 -3.989  10.589  1.00 123.74 ? 21  ARG B HG3  1 
ATOM   6727 H HD2  . ARG B 2 9   ? -13.985 -6.030  12.435  1.00 128.07 ? 21  ARG B HD2  1 
ATOM   6728 H HD3  . ARG B 2 9   ? -13.216 -4.653  12.289  1.00 128.07 ? 21  ARG B HD3  1 
ATOM   6729 H HE   . ARG B 2 9   ? -14.987 -3.596  13.220  1.00 133.50 ? 21  ARG B HE   1 
ATOM   6730 H HH11 . ARG B 2 9   ? -16.522 -3.531  14.868  1.00 139.82 ? 21  ARG B HH11 1 
ATOM   6731 H HH12 . ARG B 2 9   ? -17.066 -4.796  15.437  1.00 139.82 ? 21  ARG B HH12 1 
ATOM   6732 H HH21 . ARG B 2 9   ? -15.348 -6.895  13.562  1.00 132.92 ? 21  ARG B HH21 1 
ATOM   6733 H HH22 . ARG B 2 9   ? -16.358 -6.815  14.650  1.00 132.92 ? 21  ARG B HH22 1 
ATOM   6734 N N    . PHE B 2 10  ? -17.754 -7.781  12.068  1.00 103.15 ? 22  PHE B N    1 
ATOM   6735 C CA   . PHE B 2 10  ? -19.139 -8.130  12.353  1.00 112.47 ? 22  PHE B CA   1 
ATOM   6736 C C    . PHE B 2 10  ? -20.055 -7.072  11.758  1.00 122.30 ? 22  PHE B C    1 
ATOM   6737 O O    . PHE B 2 10  ? -19.949 -5.888  12.094  1.00 118.80 ? 22  PHE B O    1 
ATOM   6738 C CB   . PHE B 2 10  ? -19.357 -8.239  13.865  1.00 114.43 ? 22  PHE B CB   1 
ATOM   6739 C CG   . PHE B 2 10  ? -20.685 -8.847  14.254  1.00 120.12 ? 22  PHE B CG   1 
ATOM   6740 C CD1  . PHE B 2 10  ? -20.815 -10.220 14.401  1.00 120.57 ? 22  PHE B CD1  1 
ATOM   6741 C CD2  . PHE B 2 10  ? -21.799 -8.045  14.482  1.00 124.23 ? 22  PHE B CD2  1 
ATOM   6742 C CE1  . PHE B 2 10  ? -22.031 -10.784 14.762  1.00 122.68 ? 22  PHE B CE1  1 
ATOM   6743 C CE2  . PHE B 2 10  ? -23.021 -8.603  14.840  1.00 126.35 ? 22  PHE B CE2  1 
ATOM   6744 C CZ   . PHE B 2 10  ? -23.136 -9.973  14.981  1.00 125.25 ? 22  PHE B CZ   1 
ATOM   6745 H H    . PHE B 2 10  ? -17.279 -7.637  12.768  1.00 123.78 ? 22  PHE B H    1 
ATOM   6746 H HA   . PHE B 2 10  ? -19.349 -8.986  11.947  1.00 134.96 ? 22  PHE B HA   1 
ATOM   6747 H HB2  . PHE B 2 10  ? -18.656 -8.794  14.242  1.00 137.32 ? 22  PHE B HB2  1 
ATOM   6748 H HB3  . PHE B 2 10  ? -19.314 -7.350  14.251  1.00 137.32 ? 22  PHE B HB3  1 
ATOM   6749 H HD1  . PHE B 2 10  ? -20.079 -10.769 14.255  1.00 144.68 ? 22  PHE B HD1  1 
ATOM   6750 H HD2  . PHE B 2 10  ? -21.727 -7.123  14.387  1.00 149.07 ? 22  PHE B HD2  1 
ATOM   6751 H HE1  . PHE B 2 10  ? -22.106 -11.706 14.855  1.00 147.22 ? 22  PHE B HE1  1 
ATOM   6752 H HE2  . PHE B 2 10  ? -23.758 -8.056  14.988  1.00 151.62 ? 22  PHE B HE2  1 
ATOM   6753 H HZ   . PHE B 2 10  ? -23.951 -10.350 15.223  1.00 150.30 ? 22  PHE B HZ   1 
ATOM   6754 N N    . LYS B 2 11  ? -20.937 -7.497  10.862  1.00 136.62 ? 23  LYS B N    1 
ATOM   6755 C CA   . LYS B 2 11  ? -21.873 -6.584  10.218  1.00 146.88 ? 23  LYS B CA   1 
ATOM   6756 C C    . LYS B 2 11  ? -23.231 -6.650  10.914  1.00 158.84 ? 23  LYS B C    1 
ATOM   6757 O O    . LYS B 2 11  ? -23.829 -5.624  11.243  1.00 160.44 ? 23  LYS B O    1 
ATOM   6758 C CB   . LYS B 2 11  ? -22.006 -6.916  8.727   1.00 142.22 ? 23  LYS B CB   1 
ATOM   6759 C CG   . LYS B 2 11  ? -20.747 -6.618  7.924   1.00 131.50 ? 23  LYS B CG   1 
ATOM   6760 C CD   . LYS B 2 11  ? -20.182 -7.866  7.251   1.00 121.65 ? 23  LYS B CD   1 
ATOM   6761 C CE   . LYS B 2 11  ? -18.843 -7.576  6.575   1.00 111.66 ? 23  LYS B CE   1 
ATOM   6762 N NZ   . LYS B 2 11  ? -18.350 -8.721  5.767   1.00 106.77 ? 23  LYS B NZ   1 
ATOM   6763 O OXT  . LYS B 2 11  ? -23.751 -7.733  11.183  1.00 165.04 ? 23  LYS B OXT  1 
ATOM   6764 H H    . LYS B 2 11  ? -21.014 -8.315  10.608  1.00 163.94 ? 23  LYS B H    1 
ATOM   6765 H HA   . LYS B 2 11  ? -21.539 -5.677  10.294  1.00 176.26 ? 23  LYS B HA   1 
ATOM   6766 H HB2  . LYS B 2 11  ? -22.202 -7.861  8.633   1.00 170.66 ? 23  LYS B HB2  1 
ATOM   6767 H HB3  . LYS B 2 11  ? -22.730 -6.390  8.352   1.00 170.66 ? 23  LYS B HB3  1 
ATOM   6768 H HG2  . LYS B 2 11  ? -20.957 -5.971  7.232   1.00 157.80 ? 23  LYS B HG2  1 
ATOM   6769 H HG3  . LYS B 2 11  ? -20.068 -6.262  8.518   1.00 157.80 ? 23  LYS B HG3  1 
ATOM   6770 H HD2  . LYS B 2 11  ? -20.043 -8.555  7.919   1.00 145.98 ? 23  LYS B HD2  1 
ATOM   6771 H HD3  . LYS B 2 11  ? -20.804 -8.175  6.574   1.00 145.98 ? 23  LYS B HD3  1 
ATOM   6772 H HE2  . LYS B 2 11  ? -18.946 -6.814  5.984   1.00 133.99 ? 23  LYS B HE2  1 
ATOM   6773 H HE3  . LYS B 2 11  ? -18.180 -7.382  7.256   1.00 133.99 ? 23  LYS B HE3  1 
ATOM   6774 H HZ1  . LYS B 2 11  ? -17.571 -8.514  5.391   1.00 128.12 ? 23  LYS B HZ1  1 
ATOM   6775 H HZ2  . LYS B 2 11  ? -18.240 -9.435  6.287   1.00 128.12 ? 23  LYS B HZ2  1 
ATOM   6776 H HZ3  . LYS B 2 11  ? -18.937 -8.917  5.128   1.00 128.12 ? 23  LYS B HZ3  1 
ATOM   6777 N N    . THR C 2 1   ? -1.714  -49.186 -18.980 1.00 129.84 ? 9   THR C N    1 
ATOM   6778 C CA   . THR C 2 1   ? -3.012  -49.403 -18.353 1.00 131.18 ? 9   THR C CA   1 
ATOM   6779 C C    . THR C 2 1   ? -4.126  -48.825 -19.227 1.00 139.26 ? 9   THR C C    1 
ATOM   6780 O O    . THR C 2 1   ? -3.865  -48.237 -20.276 1.00 138.64 ? 9   THR C O    1 
ATOM   6781 C CB   . THR C 2 1   ? -3.071  -48.773 -16.929 1.00 125.81 ? 9   THR C CB   1 
ATOM   6782 O OG1  . THR C 2 1   ? -4.371  -48.973 -16.354 1.00 123.26 ? 9   THR C OG1  1 
ATOM   6783 C CG2  . THR C 2 1   ? -2.758  -47.277 -16.968 1.00 124.80 ? 9   THR C CG2  1 
ATOM   6784 H HA   . THR C 2 1   ? -3.164  -50.357 -18.265 1.00 157.42 ? 9   THR C HA   1 
ATOM   6785 H HB   . THR C 2 1   ? -2.408  -49.203 -16.366 1.00 150.97 ? 9   THR C HB   1 
ATOM   6786 H HG1  . THR C 2 1   ? -4.401  -48.633 -15.587 1.00 147.91 ? 9   THR C HG1  1 
ATOM   6787 H HG21 . THR C 2 1   ? -2.768  -46.914 -16.069 1.00 149.77 ? 9   THR C HG21 1 
ATOM   6788 H HG22 . THR C 2 1   ? -1.881  -47.131 -17.356 1.00 149.77 ? 9   THR C HG22 1 
ATOM   6789 H HG23 . THR C 2 1   ? -3.421  -46.812 -17.502 1.00 149.77 ? 9   THR C HG23 1 
ATOM   6790 N N    . ASN C 2 2   ? -5.369  -49.016 -18.786 1.00 149.98 ? 10  ASN C N    1 
ATOM   6791 C CA   . ASN C 2 2   ? -6.542  -48.495 -19.475 1.00 143.89 ? 10  ASN C CA   1 
ATOM   6792 C C    . ASN C 2 2   ? -7.130  -47.274 -18.785 1.00 147.53 ? 10  ASN C C    1 
ATOM   6793 O O    . ASN C 2 2   ? -7.801  -46.472 -19.442 1.00 153.76 ? 10  ASN C O    1 
ATOM   6794 C CB   . ASN C 2 2   ? -7.616  -49.586 -19.567 1.00 127.90 ? 10  ASN C CB   1 
ATOM   6795 C CG   . ASN C 2 2   ? -8.378  -49.555 -20.876 1.00 111.16 ? 10  ASN C CG   1 
ATOM   6796 O OD1  . ASN C 2 2   ? -8.705  -48.486 -21.396 1.00 106.72 ? 10  ASN C OD1  1 
ATOM   6797 N ND2  . ASN C 2 2   ? -8.671  -50.738 -21.416 1.00 103.10 ? 10  ASN C ND2  1 
ATOM   6798 H H    . ASN C 2 2   ? -5.560  -49.456 -18.072 1.00 179.98 ? 10  ASN C H    1 
ATOM   6799 H HA   . ASN C 2 2   ? -6.295  -48.240 -20.378 1.00 172.67 ? 10  ASN C HA   1 
ATOM   6800 H HB2  . ASN C 2 2   ? -7.188  -50.453 -19.492 1.00 153.48 ? 10  ASN C HB2  1 
ATOM   6801 H HB3  . ASN C 2 2   ? -8.249  -49.468 -18.844 1.00 153.48 ? 10  ASN C HB3  1 
ATOM   6802 H HD21 . ASN C 2 2   ? -9.102  -50.777 -22.159 1.00 123.72 ? 10  ASN C HD21 1 
ATOM   6803 H HD22 . ASN C 2 2   ? -8.429  -51.463 -21.021 1.00 123.72 ? 10  ASN C HD22 1 
ATOM   6804 N N    . LYS C 2 3   ? -6.882  -47.115 -17.489 1.00 132.57 ? 11  LYS C N    1 
ATOM   6805 C CA   . LYS C 2 3   ? -7.423  -45.999 -16.735 1.00 117.59 ? 11  LYS C CA   1 
ATOM   6806 C C    . LYS C 2 3   ? -6.541  -44.770 -16.869 1.00 118.52 ? 11  LYS C C    1 
ATOM   6807 O O    . LYS C 2 3   ? -5.315  -44.860 -16.948 1.00 128.91 ? 11  LYS C O    1 
ATOM   6808 C CB   . LYS C 2 3   ? -7.568  -46.371 -15.262 1.00 96.92  ? 11  LYS C CB   1 
ATOM   6809 C CG   . LYS C 2 3   ? -8.313  -47.671 -15.061 1.00 75.74  ? 11  LYS C CG   1 
ATOM   6810 C CD   . LYS C 2 3   ? -8.848  -47.807 -13.683 1.00 62.04  ? 11  LYS C CD   1 
ATOM   6811 C CE   . LYS C 2 3   ? -9.781  -48.961 -13.618 1.00 56.65  ? 11  LYS C CE   1 
ATOM   6812 N NZ   . LYS C 2 3   ? -10.579 -48.905 -12.370 1.00 57.42  ? 11  LYS C NZ   1 
ATOM   6813 H H    . LYS C 2 3   ? -6.397  -47.649 -17.020 1.00 159.08 ? 11  LYS C H    1 
ATOM   6814 H HA   . LYS C 2 3   ? -8.303  -45.779 -17.079 1.00 141.10 ? 11  LYS C HA   1 
ATOM   6815 H HB2  . LYS C 2 3   ? -6.685  -46.467 -14.872 1.00 116.30 ? 11  LYS C HB2  1 
ATOM   6816 H HB3  . LYS C 2 3   ? -8.058  -45.669 -14.806 1.00 116.30 ? 11  LYS C HB3  1 
ATOM   6817 H HG2  . LYS C 2 3   ? -9.058  -47.706 -15.681 1.00 90.88  ? 11  LYS C HG2  1 
ATOM   6818 H HG3  . LYS C 2 3   ? -7.708  -48.412 -15.224 1.00 90.88  ? 11  LYS C HG3  1 
ATOM   6819 H HD2  . LYS C 2 3   ? -8.118  -47.964 -13.064 1.00 74.45  ? 11  LYS C HD2  1 
ATOM   6820 H HD3  . LYS C 2 3   ? -9.334  -47.003 -13.441 1.00 74.45  ? 11  LYS C HD3  1 
ATOM   6821 H HE2  . LYS C 2 3   ? -10.390 -48.933 -14.373 1.00 67.98  ? 11  LYS C HE2  1 
ATOM   6822 H HE3  . LYS C 2 3   ? -9.274  -49.788 -13.622 1.00 67.98  ? 11  LYS C HE3  1 
ATOM   6823 H HZ1  . LYS C 2 3   ? -10.039 -48.931 -11.663 1.00 68.90  ? 11  LYS C HZ1  1 
ATOM   6824 H HZ2  . LYS C 2 3   ? -11.052 -48.151 -12.345 1.00 68.90  ? 11  LYS C HZ2  1 
ATOM   6825 H HZ3  . LYS C 2 3   ? -11.137 -49.598 -12.334 1.00 68.90  ? 11  LYS C HZ3  1 
ATOM   6826 N N    . LYS C 2 4   ? -7.187  -43.615 -16.890 1.00 109.53 ? 12  LYS C N    1 
ATOM   6827 C CA   . LYS C 2 4   ? -6.519  -42.332 -17.005 1.00 99.53  ? 12  LYS C CA   1 
ATOM   6828 C C    . LYS C 2 4   ? -6.718  -41.569 -15.708 1.00 106.56 ? 12  LYS C C    1 
ATOM   6829 O O    . LYS C 2 4   ? -7.856  -41.287 -15.316 1.00 102.45 ? 12  LYS C O    1 
ATOM   6830 C CB   . LYS C 2 4   ? -7.067  -41.529 -18.179 1.00 87.94  ? 12  LYS C CB   1 
ATOM   6831 C CG   . LYS C 2 4   ? -6.466  -40.136 -18.311 1.00 81.95  ? 12  LYS C CG   1 
ATOM   6832 C CD   . LYS C 2 4   ? -7.194  -39.288 -19.346 1.00 77.15  ? 12  LYS C CD   1 
ATOM   6833 C CE   . LYS C 2 4   ? -8.530  -38.784 -18.799 1.00 74.37  ? 12  LYS C CE   1 
ATOM   6834 N NZ   . LYS C 2 4   ? -9.597  -38.713 -19.871 1.00 72.30  ? 12  LYS C NZ   1 
ATOM   6835 H H    . LYS C 2 4   ? -8.043  -43.548 -16.837 1.00 131.43 ? 12  LYS C H    1 
ATOM   6836 H HA   . LYS C 2 4   ? -5.568  -42.467 -17.141 1.00 119.43 ? 12  LYS C HA   1 
ATOM   6837 H HB2  . LYS C 2 4   ? -6.878  -42.010 -19.000 1.00 105.53 ? 12  LYS C HB2  1 
ATOM   6838 H HB3  . LYS C 2 4   ? -8.026  -41.434 -18.069 1.00 105.53 ? 12  LYS C HB3  1 
ATOM   6839 H HG2  . LYS C 2 4   ? -6.522  -39.673 -17.461 1.00 98.34  ? 12  LYS C HG2  1 
ATOM   6840 H HG3  . LYS C 2 4   ? -5.539  -40.216 -18.586 1.00 98.34  ? 12  LYS C HG3  1 
ATOM   6841 H HD2  . LYS C 2 4   ? -6.648  -38.520 -19.574 1.00 92.58  ? 12  LYS C HD2  1 
ATOM   6842 H HD3  . LYS C 2 4   ? -7.369  -39.824 -20.135 1.00 92.58  ? 12  LYS C HD3  1 
ATOM   6843 H HE2  . LYS C 2 4   ? -8.841  -39.383 -18.103 1.00 89.24  ? 12  LYS C HE2  1 
ATOM   6844 H HE3  . LYS C 2 4   ? -8.409  -37.895 -18.440 1.00 89.24  ? 12  LYS C HE3  1 
ATOM   6845 H HZ1  . LYS C 2 4   ? -10.360 -38.417 -19.521 1.00 86.76  ? 12  LYS C HZ1  1 
ATOM   6846 H HZ2  . LYS C 2 4   ? -9.341  -38.158 -20.518 1.00 86.76  ? 12  LYS C HZ2  1 
ATOM   6847 H HZ3  . LYS C 2 4   ? -9.732  -39.521 -20.219 1.00 86.76  ? 12  LYS C HZ3  1 
ATOM   6848 N N    . MET C 2 5   ? -5.612  -41.252 -15.044 1.00 123.39 ? 13  MET C N    1 
ATOM   6849 C CA   . MET C 2 5   ? -5.640  -40.412 -13.856 1.00 133.73 ? 13  MET C CA   1 
ATOM   6850 C C    . MET C 2 5   ? -5.603  -38.929 -14.207 1.00 143.12 ? 13  MET C C    1 
ATOM   6851 O O    . MET C 2 5   ? -6.130  -38.103 -13.451 1.00 137.31 ? 13  MET C O    1 
ATOM   6852 C CB   . MET C 2 5   ? -4.446  -40.761 -12.965 1.00 137.59 ? 13  MET C CB   1 
ATOM   6853 C CG   . MET C 2 5   ? -3.119  -40.365 -13.588 1.00 145.06 ? 13  MET C CG   1 
ATOM   6854 S SD   . MET C 2 5   ? -1.633  -41.021 -12.814 1.00 152.68 ? 13  MET C SD   1 
ATOM   6855 C CE   . MET C 2 5   ? -1.536  -42.662 -13.511 1.00 149.19 ? 13  MET C CE   1 
ATOM   6856 H H    . MET C 2 5   ? -4.825  -41.517 -15.266 1.00 148.07 ? 13  MET C H    1 
ATOM   6857 H HA   . MET C 2 5   ? -6.451  -40.598 -13.357 1.00 160.47 ? 13  MET C HA   1 
ATOM   6858 H HB2  . MET C 2 5   ? -4.533  -40.292 -12.120 1.00 165.10 ? 13  MET C HB2  1 
ATOM   6859 H HB3  . MET C 2 5   ? -4.433  -41.719 -12.814 1.00 165.10 ? 13  MET C HB3  1 
ATOM   6860 H HG2  . MET C 2 5   ? -3.112  -40.639 -14.518 1.00 174.07 ? 13  MET C HG2  1 
ATOM   6861 H HG3  . MET C 2 5   ? -3.055  -39.402 -13.530 1.00 174.07 ? 13  MET C HG3  1 
ATOM   6862 H HE1  . MET C 2 5   ? -0.754  -43.111 -13.153 1.00 179.03 ? 13  MET C HE1  1 
ATOM   6863 H HE2  . MET C 2 5   ? -2.338  -43.153 -13.274 1.00 179.03 ? 13  MET C HE2  1 
ATOM   6864 H HE3  . MET C 2 5   ? -1.464  -42.591 -14.476 1.00 179.03 ? 13  MET C HE3  1 
ATOM   6865 N N    . ARG C 2 6   ? -4.994  -38.581 -15.344 1.00 147.71 ? 14  ARG C N    1 
ATOM   6866 C CA   . ARG C 2 6   ? -4.654  -37.194 -15.667 1.00 153.76 ? 14  ARG C CA   1 
ATOM   6867 C C    . ARG C 2 6   ? -5.687  -36.589 -16.616 1.00 153.13 ? 14  ARG C C    1 
ATOM   6868 O O    . ARG C 2 6   ? -5.407  -36.247 -17.766 1.00 153.62 ? 14  ARG C O    1 
ATOM   6869 C CB   . ARG C 2 6   ? -3.252  -37.120 -16.266 1.00 152.04 ? 14  ARG C CB   1 
ATOM   6870 C CG   . ARG C 2 6   ? -2.130  -37.196 -15.261 1.00 151.19 ? 14  ARG C CG   1 
ATOM   6871 C CD   . ARG C 2 6   ? -2.148  -36.024 -14.287 1.00 153.28 ? 14  ARG C CD   1 
ATOM   6872 N NE   . ARG C 2 6   ? -1.310  -36.286 -13.123 1.00 156.82 ? 14  ARG C NE   1 
ATOM   6873 C CZ   . ARG C 2 6   ? 0.017   -36.337 -13.149 1.00 160.99 ? 14  ARG C CZ   1 
ATOM   6874 N NH1  . ARG C 2 6   ? 0.674   -36.152 -14.290 1.00 162.29 ? 14  ARG C NH1  1 
ATOM   6875 N NH2  . ARG C 2 6   ? 0.692   -36.582 -12.032 1.00 162.99 ? 14  ARG C NH2  1 
ATOM   6876 H H    . ARG C 2 6   ? -4.764  -39.141 -15.955 1.00 177.25 ? 14  ARG C H    1 
ATOM   6877 H HA   . ARG C 2 6   ? -4.680  -36.675 -14.852 1.00 184.52 ? 14  ARG C HA   1 
ATOM   6878 H HB2  . ARG C 2 6   ? -3.141  -37.858 -16.886 1.00 182.44 ? 14  ARG C HB2  1 
ATOM   6879 H HB3  . ARG C 2 6   ? -3.163  -36.280 -16.741 1.00 182.44 ? 14  ARG C HB3  1 
ATOM   6880 H HG2  . ARG C 2 6   ? -2.202  -38.015 -14.757 1.00 181.43 ? 14  ARG C HG2  1 
ATOM   6881 H HG3  . ARG C 2 6   ? -1.285  -37.177 -15.737 1.00 181.43 ? 14  ARG C HG3  1 
ATOM   6882 H HD2  . ARG C 2 6   ? -1.804  -35.235 -14.734 1.00 183.94 ? 14  ARG C HD2  1 
ATOM   6883 H HD3  . ARG C 2 6   ? -3.045  -35.858 -13.967 1.00 183.94 ? 14  ARG C HD3  1 
ATOM   6884 H HE   . ARG C 2 6   ? -1.701  -36.416 -12.368 1.00 188.19 ? 14  ARG C HE   1 
ATOM   6885 H HH11 . ARG C 2 6   ? 0.245   -35.992 -15.017 1.00 194.74 ? 14  ARG C HH11 1 
ATOM   6886 H HH12 . ARG C 2 6   ? 1.533   -36.187 -14.299 1.00 194.74 ? 14  ARG C HH12 1 
ATOM   6887 H HH21 . ARG C 2 6   ? 0.270   -36.704 -11.293 1.00 195.59 ? 14  ARG C HH21 1 
ATOM   6888 H HH22 . ARG C 2 6   ? 1.551   -36.618 -12.048 1.00 195.59 ? 14  ARG C HH22 1 
ATOM   6889 N N    . ARG C 2 7   ? -6.904  -36.445 -16.093 1.00 142.29 ? 15  ARG C N    1 
ATOM   6890 C CA   . ARG C 2 7   ? -7.912  -35.654 -16.786 1.00 133.53 ? 15  ARG C CA   1 
ATOM   6891 C C    . ARG C 2 7   ? -7.487  -34.194 -16.876 1.00 139.74 ? 15  ARG C C    1 
ATOM   6892 O O    . ARG C 2 7   ? -7.742  -33.527 -17.884 1.00 148.66 ? 15  ARG C O    1 
ATOM   6893 C CB   . ARG C 2 7   ? -9.256  -35.784 -16.071 1.00 116.08 ? 15  ARG C CB   1 
ATOM   6894 C CG   . ARG C 2 7   ? -9.224  -35.352 -14.620 1.00 103.04 ? 15  ARG C CG   1 
ATOM   6895 C CD   . ARG C 2 7   ? -10.599 -35.447 -13.965 1.00 96.23  ? 15  ARG C CD   1 
ATOM   6896 N NE   . ARG C 2 7   ? -10.915 -34.253 -13.176 1.00 96.52  ? 15  ARG C NE   1 
ATOM   6897 C CZ   . ARG C 2 7   ? -10.698 -34.106 -11.867 1.00 99.25  ? 15  ARG C CZ   1 
ATOM   6898 N NH1  . ARG C 2 7   ? -10.159 -35.085 -11.146 1.00 100.46 ? 15  ARG C NH1  1 
ATOM   6899 N NH2  . ARG C 2 7   ? -11.031 -32.961 -11.269 1.00 101.00 ? 15  ARG C NH2  1 
ATOM   6900 H H    . ARG C 2 7   ? -7.165  -36.792 -15.351 1.00 170.75 ? 15  ARG C H    1 
ATOM   6901 H HA   . ARG C 2 7   ? -8.015  -35.983 -17.690 1.00 160.24 ? 15  ARG C HA   1 
ATOM   6902 H HB2  . ARG C 2 7   ? -9.908  -35.232 -16.530 1.00 139.29 ? 15  ARG C HB2  1 
ATOM   6903 H HB3  . ARG C 2 7   ? -9.535  -36.712 -16.097 1.00 139.29 ? 15  ARG C HB3  1 
ATOM   6904 H HG2  . ARG C 2 7   ? -8.616  -35.925 -14.128 1.00 123.64 ? 15  ARG C HG2  1 
ATOM   6905 H HG3  . ARG C 2 7   ? -8.931  -34.429 -14.566 1.00 123.64 ? 15  ARG C HG3  1 
ATOM   6906 H HD2  . ARG C 2 7   ? -11.273 -35.535 -14.657 1.00 115.47 ? 15  ARG C HD2  1 
ATOM   6907 H HD3  . ARG C 2 7   ? -10.623 -36.218 -13.381 1.00 115.47 ? 15  ARG C HD3  1 
ATOM   6908 H HE   . ARG C 2 7   ? -11.271 -33.590 -13.592 1.00 115.83 ? 15  ARG C HE   1 
ATOM   6909 H HH11 . ARG C 2 7   ? -9.939  -35.828 -11.518 1.00 120.56 ? 15  ARG C HH11 1 
ATOM   6910 H HH12 . ARG C 2 7   ? -10.027 -34.973 -10.304 1.00 120.56 ? 15  ARG C HH12 1 
ATOM   6911 H HH21 . ARG C 2 7   ? -11.381 -32.323 -11.727 1.00 121.21 ? 15  ARG C HH21 1 
ATOM   6912 H HH22 . ARG C 2 7   ? -10.895 -32.861 -10.426 1.00 121.21 ? 15  ARG C HH22 1 
ATOM   6913 N N    . ASN C 2 8   ? -6.812  -33.686 -15.839 1.00 136.89 ? 16  ASN C N    1 
ATOM   6914 C CA   . ASN C 2 8   ? -6.429  -32.277 -15.816 1.00 131.55 ? 16  ASN C CA   1 
ATOM   6915 C C    . ASN C 2 8   ? -5.412  -31.972 -16.909 1.00 136.17 ? 16  ASN C C    1 
ATOM   6916 O O    . ASN C 2 8   ? -5.576  -31.011 -17.670 1.00 134.72 ? 16  ASN C O    1 
ATOM   6917 C CB   . ASN C 2 8   ? -5.880  -31.899 -14.437 1.00 124.60 ? 16  ASN C CB   1 
ATOM   6918 C CG   . ASN C 2 8   ? -5.577  -30.409 -14.311 1.00 120.63 ? 16  ASN C CG   1 
ATOM   6919 O OD1  . ASN C 2 8   ? -5.770  -29.644 -15.254 1.00 124.21 ? 16  ASN C OD1  1 
ATOM   6920 N ND2  . ASN C 2 8   ? -5.118  -29.992 -13.138 1.00 115.01 ? 16  ASN C ND2  1 
ATOM   6921 H H    . ASN C 2 8   ? -6.568  -34.133 -15.146 1.00 164.27 ? 16  ASN C H    1 
ATOM   6922 H HA   . ASN C 2 8   ? -7.216  -31.735 -15.982 1.00 157.86 ? 16  ASN C HA   1 
ATOM   6923 H HB2  . ASN C 2 8   ? -6.537  -32.130 -13.761 1.00 149.52 ? 16  ASN C HB2  1 
ATOM   6924 H HB3  . ASN C 2 8   ? -5.056  -32.387 -14.280 1.00 149.52 ? 16  ASN C HB3  1 
ATOM   6925 H HD21 . ASN C 2 8   ? -4.933  -29.161 -13.020 1.00 138.01 ? 16  ASN C HD21 1 
ATOM   6926 H HD22 . ASN C 2 8   ? -5.005  -30.553 -12.496 1.00 138.01 ? 16  ASN C HD22 1 
ATOM   6927 N N    . ARG C 2 9   ? -4.350  -32.777 -17.005 1.00 146.95 ? 17  ARG C N    1 
ATOM   6928 C CA   . ARG C 2 9   ? -3.394  -32.590 -18.093 1.00 149.86 ? 17  ARG C CA   1 
ATOM   6929 C C    . ARG C 2 9   ? -4.065  -32.780 -19.448 1.00 159.28 ? 17  ARG C C    1 
ATOM   6930 O O    . ARG C 2 9   ? -3.772  -32.047 -20.400 1.00 150.18 ? 17  ARG C O    1 
ATOM   6931 C CB   . ARG C 2 9   ? -2.214  -33.556 -17.937 1.00 148.82 ? 17  ARG C CB   1 
ATOM   6932 C CG   . ARG C 2 9   ? -1.186  -33.180 -16.863 1.00 149.08 ? 17  ARG C CG   1 
ATOM   6933 C CD   . ARG C 2 9   ? -0.700  -31.749 -17.039 1.00 150.01 ? 17  ARG C CD   1 
ATOM   6934 N NE   . ARG C 2 9   ? 0.638   -31.515 -16.483 1.00 150.60 ? 17  ARG C NE   1 
ATOM   6935 C CZ   . ARG C 2 9   ? 0.962   -30.545 -15.627 1.00 150.82 ? 17  ARG C CZ   1 
ATOM   6936 N NH1  . ARG C 2 9   ? 0.055   -29.675 -15.192 1.00 154.61 ? 17  ARG C NH1  1 
ATOM   6937 N NH2  . ARG C 2 9   ? 2.218   -30.432 -15.204 1.00 147.14 ? 17  ARG C NH2  1 
ATOM   6938 H H    . ARG C 2 9   ? -4.166  -33.422 -16.467 1.00 176.35 ? 17  ARG C H    1 
ATOM   6939 H HA   . ARG C 2 9   ? -3.059  -31.681 -18.061 1.00 179.83 ? 17  ARG C HA   1 
ATOM   6940 H HB2  . ARG C 2 9   ? -2.563  -34.431 -17.713 1.00 178.58 ? 17  ARG C HB2  1 
ATOM   6941 H HB3  . ARG C 2 9   ? -1.744  -33.603 -18.784 1.00 178.58 ? 17  ARG C HB3  1 
ATOM   6942 H HG2  . ARG C 2 9   ? -1.595  -33.257 -15.987 1.00 178.90 ? 17  ARG C HG2  1 
ATOM   6943 H HG3  . ARG C 2 9   ? -0.421  -33.772 -16.930 1.00 178.90 ? 17  ARG C HG3  1 
ATOM   6944 H HD2  . ARG C 2 9   ? -0.663  -31.549 -17.987 1.00 180.01 ? 17  ARG C HD2  1 
ATOM   6945 H HD3  . ARG C 2 9   ? -1.332  -31.158 -16.606 1.00 180.01 ? 17  ARG C HD3  1 
ATOM   6946 H HE   . ARG C 2 9   ? 1.266   -32.048 -16.730 1.00 180.72 ? 17  ARG C HE   1 
ATOM   6947 H HH11 . ARG C 2 9   ? -0.761  -29.725 -15.453 1.00 185.54 ? 17  ARG C HH11 1 
ATOM   6948 H HH12 . ARG C 2 9   ? 0.288   -29.058 -14.641 1.00 185.54 ? 17  ARG C HH12 1 
ATOM   6949 H HH21 . ARG C 2 9   ? 2.815   -30.988 -15.476 1.00 176.57 ? 17  ARG C HH21 1 
ATOM   6950 H HH22 . ARG C 2 9   ? 2.431   -29.809 -14.650 1.00 176.57 ? 17  ARG C HH22 1 
ATOM   6951 N N    . PHE C 2 10  ? -4.974  -33.755 -19.554 1.00 174.00 ? 18  PHE C N    1 
ATOM   6952 C CA   . PHE C 2 10  ? -5.712  -33.945 -20.800 1.00 172.58 ? 18  PHE C CA   1 
ATOM   6953 C C    . PHE C 2 10  ? -6.439  -32.669 -21.206 1.00 169.72 ? 18  PHE C C    1 
ATOM   6954 O O    . PHE C 2 10  ? -6.421  -32.286 -22.381 1.00 174.12 ? 18  PHE C O    1 
ATOM   6955 C CB   . PHE C 2 10  ? -6.693  -35.108 -20.652 1.00 164.17 ? 18  PHE C CB   1 
ATOM   6956 C CG   . PHE C 2 10  ? -7.496  -35.386 -21.889 1.00 153.32 ? 18  PHE C CG   1 
ATOM   6957 C CD1  . PHE C 2 10  ? -6.920  -36.028 -22.969 1.00 147.91 ? 18  PHE C CD1  1 
ATOM   6958 C CD2  . PHE C 2 10  ? -8.830  -35.014 -21.969 1.00 147.10 ? 18  PHE C CD2  1 
ATOM   6959 C CE1  . PHE C 2 10  ? -7.656  -36.287 -24.113 1.00 142.53 ? 18  PHE C CE1  1 
ATOM   6960 C CE2  . PHE C 2 10  ? -9.573  -35.270 -23.110 1.00 141.58 ? 18  PHE C CE2  1 
ATOM   6961 C CZ   . PHE C 2 10  ? -8.985  -35.907 -24.182 1.00 139.73 ? 18  PHE C CZ   1 
ATOM   6962 H H    . PHE C 2 10  ? -5.177  -34.309 -18.929 1.00 208.80 ? 18  PHE C H    1 
ATOM   6963 H HA   . PHE C 2 10  ? -5.086  -34.170 -21.506 1.00 207.10 ? 18  PHE C HA   1 
ATOM   6964 H HB2  . PHE C 2 10  ? -6.194  -35.911 -20.436 1.00 197.00 ? 18  PHE C HB2  1 
ATOM   6965 H HB3  . PHE C 2 10  ? -7.314  -34.904 -19.936 1.00 197.00 ? 18  PHE C HB3  1 
ATOM   6966 H HD1  . PHE C 2 10  ? -6.027  -36.284 -22.929 1.00 177.49 ? 18  PHE C HD1  1 
ATOM   6967 H HD2  . PHE C 2 10  ? -9.230  -34.582 -21.249 1.00 176.51 ? 18  PHE C HD2  1 
ATOM   6968 H HE1  . PHE C 2 10  ? -7.258  -36.717 -24.835 1.00 171.03 ? 18  PHE C HE1  1 
ATOM   6969 H HE2  . PHE C 2 10  ? -10.466 -35.014 -23.152 1.00 169.90 ? 18  PHE C HE2  1 
ATOM   6970 H HZ   . PHE C 2 10  ? -9.481  -36.082 -24.949 1.00 167.67 ? 18  PHE C HZ   1 
ATOM   6971 N N    . LYS C 2 11  ? -7.074  -31.995 -20.249 1.00 157.16 ? 19  LYS C N    1 
ATOM   6972 C CA   . LYS C 2 11  ? -7.651  -30.665 -20.470 1.00 142.90 ? 19  LYS C CA   1 
ATOM   6973 C C    . LYS C 2 11  ? -8.699  -30.661 -21.587 1.00 142.28 ? 19  LYS C C    1 
ATOM   6974 O O    . LYS C 2 11  ? -9.488  -29.720 -21.694 1.00 139.89 ? 19  LYS C O    1 
ATOM   6975 C CB   . LYS C 2 11  ? -6.525  -29.660 -20.775 1.00 134.97 ? 19  LYS C CB   1 
ATOM   6976 C CG   . LYS C 2 11  ? -6.933  -28.390 -21.531 1.00 124.70 ? 19  LYS C CG   1 
ATOM   6977 C CD   . LYS C 2 11  ? -5.712  -27.598 -21.974 1.00 114.16 ? 19  LYS C CD   1 
ATOM   6978 C CE   . LYS C 2 11  ? -4.980  -28.280 -23.134 1.00 104.56 ? 19  LYS C CE   1 
ATOM   6979 N NZ   . LYS C 2 11  ? -5.728  -28.170 -24.422 1.00 99.37  ? 19  LYS C NZ   1 
ATOM   6980 O OXT  . LYS C 2 11  ? -8.801  -31.582 -22.407 1.00 143.50 ? 19  LYS C OXT  1 
ATOM   6981 H H    . LYS C 2 11  ? -7.187  -32.290 -19.449 1.00 188.59 ? 19  LYS C H    1 
ATOM   6982 H HA   . LYS C 2 11  ? -8.090  -30.378 -19.654 1.00 171.48 ? 19  LYS C HA   1 
ATOM   6983 H HB2  . LYS C 2 11  ? -6.138  -29.377 -19.932 1.00 161.96 ? 19  LYS C HB2  1 
ATOM   6984 H HB3  . LYS C 2 11  ? -5.848  -30.110 -21.299 1.00 161.96 ? 19  LYS C HB3  1 
ATOM   6985 H HG2  . LYS C 2 11  ? -7.427  -28.619 -22.332 1.00 149.64 ? 19  LYS C HG2  1 
ATOM   6986 H HG3  . LYS C 2 11  ? -7.470  -27.827 -20.951 1.00 149.64 ? 19  LYS C HG3  1 
ATOM   6987 H HD2  . LYS C 2 11  ? -5.993  -26.718 -22.269 1.00 136.98 ? 19  LYS C HD2  1 
ATOM   6988 H HD3  . LYS C 2 11  ? -5.095  -27.521 -21.230 1.00 136.98 ? 19  LYS C HD3  1 
ATOM   6989 H HE2  . LYS C 2 11  ? -4.118  -27.852 -23.254 1.00 125.47 ? 19  LYS C HE2  1 
ATOM   6990 H HE3  . LYS C 2 11  ? -4.856  -29.220 -22.939 1.00 125.47 ? 19  LYS C HE3  1 
ATOM   6991 H HZ1  . LYS C 2 11  ? -5.274  -28.573 -25.073 1.00 119.24 ? 19  LYS C HZ1  1 
ATOM   6992 H HZ2  . LYS C 2 11  ? -6.526  -28.556 -24.344 1.00 119.24 ? 19  LYS C HZ2  1 
ATOM   6993 H HZ3  . LYS C 2 11  ? -5.841  -27.313 -24.636 1.00 119.24 ? 19  LYS C HZ3  1 
HETATM 6994 O O    . HOH D 3 .   ? -16.259 -62.007 -18.736 1.00 61.79  ? 601 HOH A O    1 
HETATM 6995 O O    . HOH D 3 .   ? -9.867  -32.691 -5.205  1.00 56.54  ? 602 HOH A O    1 
HETATM 6996 O O    . HOH D 3 .   ? -17.844 -27.834 -1.556  1.00 58.06  ? 603 HOH A O    1 
HETATM 6997 O O    . HOH D 3 .   ? -4.055  -17.232 25.558  1.00 55.45  ? 604 HOH A O    1 
HETATM 6998 O O    . HOH D 3 .   ? -18.941 -36.625 17.491  1.00 69.78  ? 605 HOH A O    1 
HETATM 6999 O O    . HOH D 3 .   ? -6.570  -38.503 13.467  1.00 56.63  ? 606 HOH A O    1 
HETATM 7000 O O    . HOH D 3 .   ? -2.281  -33.420 -1.507  1.00 52.96  ? 607 HOH A O    1 
HETATM 7001 O O    . HOH D 3 .   ? -13.159 -47.569 2.265   1.00 56.21  ? 608 HOH A O    1 
HETATM 7002 O O    . HOH D 3 .   ? -23.723 -37.465 -30.657 1.00 51.71  ? 609 HOH A O    1 
HETATM 7003 O O    . HOH D 3 .   ? 2.896   -31.535 12.663  1.00 50.74  ? 610 HOH A O    1 
HETATM 7004 O O    . HOH D 3 .   ? -9.769  -27.015 1.642   1.00 53.96  ? 611 HOH A O    1 
HETATM 7005 O O    . HOH D 3 .   ? -0.371  -28.513 -5.626  1.00 64.04  ? 612 HOH A O    1 
HETATM 7006 O O    . HOH D 3 .   ? 1.721   -8.862  -2.796  1.00 70.01  ? 613 HOH A O    1 
HETATM 7007 O O    . HOH D 3 .   ? 5.786   -19.744 20.327  1.00 47.08  ? 614 HOH A O    1 
HETATM 7008 O O    . HOH D 3 .   ? -26.752 -48.595 -32.258 1.00 49.11  ? 615 HOH A O    1 
HETATM 7009 O O    . HOH D 3 .   ? -1.621  -26.713 1.315   1.00 40.61  ? 616 HOH A O    1 
HETATM 7010 O O    . HOH D 3 .   ? -27.268 -50.456 -18.666 1.00 48.16  ? 617 HOH A O    1 
HETATM 7011 O O    . HOH D 3 .   ? -29.353 -43.400 -30.031 1.00 55.05  ? 618 HOH A O    1 
HETATM 7012 O O    . HOH D 3 .   ? -10.383 -37.812 16.757  1.00 71.03  ? 619 HOH A O    1 
HETATM 7013 O O    . HOH D 3 .   ? -30.369 -32.851 -17.298 1.00 49.85  ? 620 HOH A O    1 
HETATM 7014 O O    . HOH D 3 .   ? 6.048   -25.020 16.908  1.00 53.04  ? 621 HOH A O    1 
HETATM 7015 O O    . HOH D 3 .   ? 6.357   -6.019  8.898   1.00 51.70  ? 622 HOH A O    1 
HETATM 7016 O O    . HOH D 3 .   ? -28.157 -39.150 -19.947 1.00 45.69  ? 623 HOH A O    1 
HETATM 7017 O O    . HOH D 3 .   ? -30.416 -45.909 -25.133 1.00 47.39  ? 624 HOH A O    1 
HETATM 7018 O O    . HOH D 3 .   ? 8.544   -24.735 16.093  1.00 60.74  ? 625 HOH A O    1 
HETATM 7019 O O    . HOH D 3 .   ? 7.635   -16.952 17.060  1.00 51.64  ? 626 HOH A O    1 
HETATM 7020 O O    . HOH D 3 .   ? -2.671  -34.947 19.425  1.00 64.33  ? 627 HOH A O    1 
HETATM 7021 O O    . HOH D 3 .   ? 7.054   -18.838 10.891  1.00 44.28  ? 628 HOH A O    1 
HETATM 7022 O O    . HOH D 3 .   ? 5.659   -14.747 20.173  1.00 51.28  ? 629 HOH A O    1 
HETATM 7023 O O    . HOH D 3 .   ? -22.985 -49.716 -7.341  1.00 52.58  ? 630 HOH A O    1 
HETATM 7024 O O    . HOH D 3 .   ? -26.621 -36.456 -5.944  1.00 53.49  ? 631 HOH A O    1 
HETATM 7025 O O    . HOH D 3 .   ? 5.100   -23.690 18.896  1.00 44.65  ? 632 HOH A O    1 
HETATM 7026 O O    . HOH D 3 .   ? -26.489 -58.108 -33.727 1.00 61.20  ? 633 HOH A O    1 
HETATM 7027 O O    . HOH D 3 .   ? -4.306  -27.855 21.320  1.00 61.28  ? 634 HOH A O    1 
HETATM 7028 O O    . HOH D 3 .   ? -24.625 -55.202 -10.105 1.00 58.22  ? 635 HOH A O    1 
HETATM 7029 O O    . HOH D 3 .   ? -12.541 -41.363 -12.614 1.00 45.94  ? 636 HOH A O    1 
HETATM 7030 O O    . HOH D 3 .   ? 3.568   -22.344 -0.013  1.00 49.15  ? 637 HOH A O    1 
HETATM 7031 O O    . HOH D 3 .   ? -5.226  -14.586 -1.489  1.00 67.37  ? 638 HOH A O    1 
HETATM 7032 O O    . HOH D 3 .   ? 3.036   -12.534 -4.239  1.00 63.77  ? 639 HOH A O    1 
HETATM 7033 O O    . HOH D 3 .   ? -20.540 -62.809 -24.883 1.00 56.58  ? 640 HOH A O    1 
HETATM 7034 O O    . HOH D 3 .   ? -25.937 -42.779 -2.319  1.00 67.19  ? 641 HOH A O    1 
HETATM 7035 O O    . HOH D 3 .   ? -27.661 -36.428 -19.721 1.00 52.87  ? 642 HOH A O    1 
HETATM 7036 O O    . HOH D 3 .   ? -28.130 -45.528 -33.365 1.00 51.20  ? 643 HOH A O    1 
HETATM 7037 O O    . HOH D 3 .   ? -1.946  -4.092  -0.254  1.00 61.45  ? 644 HOH A O    1 
HETATM 7038 O O    . HOH D 3 .   ? -8.689  -34.273 -7.070  1.00 64.41  ? 645 HOH A O    1 
HETATM 7039 O O    . HOH D 3 .   ? -1.992  -36.170 -2.040  1.00 66.88  ? 646 HOH A O    1 
HETATM 7040 O O    . HOH D 3 .   ? -27.481 -59.391 -32.629 1.00 59.20  ? 647 HOH A O    1 
HETATM 7041 O O    . HOH D 3 .   ? 7.365   -18.997 18.877  1.00 49.15  ? 648 HOH A O    1 
HETATM 7042 O O    . HOH D 3 .   ? -24.900 -56.642 -34.612 1.00 65.27  ? 649 HOH A O    1 
HETATM 7043 O O    . HOH D 3 .   ? -7.676  -15.477 -1.520  1.00 57.23  ? 650 HOH A O    1 
HETATM 7044 O O    . HOH D 3 .   ? -22.821 -56.166 -33.242 1.00 64.87  ? 651 HOH A O    1 
HETATM 7045 O O    . HOH E 3 .   ? -14.339 -11.124 2.596   1.00 69.26  ? 101 HOH B O    1 
HETATM 7046 O O    . HOH E 3 .   ? -15.772 -10.960 12.820  1.00 52.76  ? 102 HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 3   ? 1.9352 1.8595 2.1264 0.1584  -0.1144 -0.1288 74  VAL A N   
2    C CA  . VAL A 3   ? 1.8878 1.8133 2.0505 0.1487  -0.1073 -0.1115 74  VAL A CA  
3    C C   . VAL A 3   ? 1.8532 1.7533 2.0155 0.1457  -0.1102 -0.0886 74  VAL A C   
4    O O   . VAL A 3   ? 1.9279 1.8081 2.1115 0.1489  -0.1166 -0.0869 74  VAL A O   
5    C CB  . VAL A 3   ? 1.8374 1.7854 1.9816 0.1487  -0.1020 -0.1112 74  VAL A CB  
6    C CG1 . VAL A 3   ? 1.8569 1.8004 2.0046 0.1539  -0.1070 -0.1004 74  VAL A CG1 
7    C CG2 . VAL A 3   ? 1.7740 1.7296 1.8904 0.1386  -0.0933 -0.1019 74  VAL A CG2 
16   N N   . ASN A 4   ? 1.7150 1.6153 1.8536 0.1396  -0.1054 -0.0713 75  ASN A N   
17   C CA  . ASN A 4   ? 1.6390 1.5174 1.7718 0.1351  -0.1058 -0.0494 75  ASN A CA  
18   C C   . ASN A 4   ? 1.5515 1.4152 1.6932 0.1288  -0.1038 -0.0480 75  ASN A C   
19   O O   . ASN A 4   ? 1.6668 1.5087 1.8239 0.1292  -0.1076 -0.0394 75  ASN A O   
20   C CB  . ASN A 4   ? 1.6857 1.5488 1.8317 0.1430  -0.1146 -0.0407 75  ASN A CB  
21   C CG  . ASN A 4   ? 1.7276 1.6043 1.8637 0.1483  -0.1171 -0.0388 75  ASN A CG  
22   O OD1 . ASN A 4   ? 1.7341 1.6295 1.8778 0.1539  -0.1182 -0.0552 75  ASN A OD1 
23   N ND2 . ASN A 4   ? 1.7594 1.6275 1.8790 0.1466  -0.1179 -0.0194 75  ASN A ND2 
30   N N   . TRP A 5   ? 1.3433 1.2193 1.4764 0.1230  -0.0981 -0.0563 76  TRP A N   
31   C CA  . TRP A 5   ? 1.1235 0.9891 1.2669 0.1171  -0.0968 -0.0576 76  TRP A CA  
32   C C   . TRP A 5   ? 1.0350 0.8824 1.1720 0.1098  -0.0928 -0.0357 76  TRP A C   
33   O O   . TRP A 5   ? 1.0166 0.8649 1.1330 0.1076  -0.0891 -0.0209 76  TRP A O   
34   C CB  . TRP A 5   ? 1.0226 0.9061 1.1543 0.1127  -0.0922 -0.0689 76  TRP A CB  
35   C CG  . TRP A 5   ? 0.9794 0.8807 1.1166 0.1187  -0.0949 -0.0911 76  TRP A CG  
36   C CD1 . TRP A 5   ? 1.0143 0.9256 1.1560 0.1268  -0.0977 -0.1008 76  TRP A CD1 
37   C CD2 . TRP A 5   ? 0.9173 0.8301 1.0556 0.1173  -0.0948 -0.1071 76  TRP A CD2 
38   N NE1 . TRP A 5   ? 1.0058 0.9346 1.1505 0.1302  -0.0982 -0.1221 76  TRP A NE1 
39   C CE2 . TRP A 5   ? 0.9488 0.8786 1.0900 0.1246  -0.0969 -0.1261 76  TRP A CE2 
40   C CE3 . TRP A 5   ? 0.8636 0.7750 1.0008 0.1109  -0.0936 -0.1078 76  TRP A CE3 
41   C CZ2 . TRP A 5   ? 0.9195 0.8646 1.0596 0.1258  -0.0977 -0.1450 76  TRP A CZ2 
42   C CZ3 . TRP A 5   ? 0.8594 0.7856 0.9967 0.1124  -0.0958 -0.1264 76  TRP A CZ3 
43   C CH2 . TRP A 5   ? 0.8869 0.8296 1.0240 0.1197  -0.0977 -0.1446 76  TRP A CH2 
54   N N   . SER A 6   ? 0.9761 0.8081 1.1316 0.1057  -0.0932 -0.0346 77  SER A N   
55   C CA  . SER A 6   ? 0.9713 0.7887 1.1217 0.0972  -0.0872 -0.0155 77  SER A CA  
56   C C   . SER A 6   ? 0.9436 0.7733 1.0816 0.0895  -0.0802 -0.0179 77  SER A C   
57   O O   . SER A 6   ? 0.9188 0.7634 1.0587 0.0903  -0.0816 -0.0347 77  SER A O   
58   C CB  . SER A 6   ? 1.0119 0.8067 1.1906 0.0954  -0.0898 -0.0121 77  SER A CB  
59   O OG  . SER A 6   ? 1.0240 0.8230 1.2229 0.0937  -0.0918 -0.0304 77  SER A OG  
65   N N   . VAL A 7   ? 0.9569 0.7809 1.0814 0.0823  -0.0727 -0.0007 78  VAL A N   
66   C CA  . VAL A 7   ? 0.9416 0.7754 1.0580 0.0751  -0.0663 -0.0021 78  VAL A CA  
67   C C   . VAL A 7   ? 1.0029 0.8344 1.1443 0.0722  -0.0685 -0.0145 78  VAL A C   
68   O O   . VAL A 7   ? 0.9760 0.8216 1.1153 0.0707  -0.0686 -0.0261 78  VAL A O   
69   C CB  . VAL A 7   ? 0.8916 0.7181 0.9936 0.0680  -0.0574 0.0177  78  VAL A CB  
70   C CG1 . VAL A 7   ? 0.8359 0.6721 0.9339 0.0611  -0.0511 0.0153  78  VAL A CG1 
71   C CG2 . VAL A 7   ? 0.8927 0.7239 0.9689 0.0712  -0.0564 0.0276  78  VAL A CG2 
81   N N   . GLU A 8   ? 1.0428 0.8562 1.2091 0.0716  -0.0711 -0.0124 79  GLU A N   
82   C CA  . GLU A 8   ? 1.1088 0.9197 1.3029 0.0690  -0.0744 -0.0261 79  GLU A CA  
83   C C   . GLU A 8   ? 1.0254 0.8517 1.2244 0.0761  -0.0826 -0.0499 79  GLU A C   
84   O O   . GLU A 8   ? 1.0447 0.8814 1.2509 0.0742  -0.0846 -0.0639 79  GLU A O   
85   C CB  . GLU A 8   ? 1.2578 1.0450 1.4796 0.0673  -0.0760 -0.0193 79  GLU A CB  
86   C CG  . GLU A 8   ? 1.4015 1.1849 1.6559 0.0633  -0.0790 -0.0331 79  GLU A CG  
87   C CD  . GLU A 8   ? 1.5511 1.3094 1.8359 0.0614  -0.0806 -0.0264 79  GLU A CD  
88   O OE1 . GLU A 8   ? 1.5795 1.3242 1.8605 0.0659  -0.0821 -0.0141 79  GLU A OE1 
89   O OE2 . GLU A 8   ? 1.6315 1.3836 1.9453 0.0556  -0.0809 -0.0333 79  GLU A OE2 
96   N N   . ASP A 9   ? 0.9405 0.7695 1.1355 0.0846  -0.0876 -0.0553 80  ASP A N   
97   C CA  . ASP A 9   ? 0.8922 0.7386 1.0876 0.0914  -0.0936 -0.0778 80  ASP A CA  
98   C C   . ASP A 9   ? 0.8138 0.6817 0.9831 0.0898  -0.0899 -0.0814 80  ASP A C   
99   O O   . ASP A 9   ? 0.7623 0.6439 0.9332 0.0912  -0.0934 -0.0985 80  ASP A O   
100  C CB  . ASP A 9   ? 0.9651 0.8124 1.1602 0.1007  -0.0978 -0.0816 80  ASP A CB  
101  C CG  . ASP A 9   ? 1.0604 0.8883 1.2868 0.1048  -0.1045 -0.0851 80  ASP A CG  
102  O OD1 . ASP A 9   ? 1.1104 0.9288 1.3614 0.1015  -0.1071 -0.0924 80  ASP A OD1 
103  O OD2 . ASP A 9   ? 1.0810 0.9033 1.3091 0.1115  -0.1076 -0.0809 80  ASP A OD2 
108  N N   . ILE A 10  ? 0.8656 0.7366 1.0107 0.0870  -0.0833 -0.0655 81  ILE A N   
109  C CA  . ILE A 10  ? 0.8286 0.7179 0.9500 0.0852  -0.0797 -0.0672 81  ILE A CA  
110  C C   . ILE A 10  ? 0.7847 0.6763 0.9117 0.0793  -0.0791 -0.0704 81  ILE A C   
111  O O   . ILE A 10  ? 0.7529 0.6597 0.8728 0.0806  -0.0816 -0.0822 81  ILE A O   
112  C CB  . ILE A 10  ? 0.8061 0.6960 0.9043 0.0830  -0.0731 -0.0498 81  ILE A CB  
113  C CG1 . ILE A 10  ? 0.7697 0.6623 0.8625 0.0899  -0.0753 -0.0502 81  ILE A CG1 
114  C CG2 . ILE A 10  ? 0.7939 0.6994 0.8708 0.0800  -0.0689 -0.0496 81  ILE A CG2 
115  C CD1 . ILE A 10  ? 0.7412 0.6313 0.8161 0.0883  -0.0707 -0.0335 81  ILE A CD1 
127  N N   . VAL A 11  ? 0.8033 0.6804 0.9433 0.0729  -0.0757 -0.0595 82  VAL A N   
128  C CA  . VAL A 11  ? 0.8235 0.7028 0.9740 0.0672  -0.0752 -0.0629 82  VAL A CA  
129  C C   . VAL A 11  ? 0.8804 0.7664 1.0489 0.0706  -0.0842 -0.0844 82  VAL A C   
130  O O   . VAL A 11  ? 0.8778 0.7768 1.0430 0.0700  -0.0872 -0.0938 82  VAL A O   
131  C CB  . VAL A 11  ? 0.8146 0.6764 0.9816 0.0597  -0.0695 -0.0489 82  VAL A CB  
132  C CG1 . VAL A 11  ? 0.7706 0.6342 0.9587 0.0542  -0.0705 -0.0563 82  VAL A CG1 
133  C CG2 . VAL A 11  ? 0.8358 0.6955 0.9805 0.0559  -0.0601 -0.0294 82  VAL A CG2 
143  N N   . LYS A 12  ? 0.8940 0.7711 1.0821 0.0746  -0.0895 -0.0930 83  LYS A N   
144  C CA  . LYS A 12  ? 0.9279 0.8108 1.1354 0.0781  -0.0985 -0.1156 83  LYS A CA  
145  C C   . LYS A 12  ? 0.8781 0.7834 1.0637 0.0842  -0.1022 -0.1298 83  LYS A C   
146  O O   . LYS A 12  ? 0.8976 0.8149 1.0847 0.0845  -0.1074 -0.1435 83  LYS A O   
147  C CB  . LYS A 12  ? 1.0267 0.8951 1.2591 0.0822  -0.1031 -0.1217 83  LYS A CB  
148  C CG  . LYS A 12  ? 1.1369 1.0114 1.3902 0.0871  -0.1129 -0.1478 83  LYS A CG  
149  C CD  . LYS A 12  ? 1.2554 1.1113 1.5394 0.0900  -0.1171 -0.1520 83  LYS A CD  
150  C CE  . LYS A 12  ? 1.3368 1.2007 1.6402 0.0966  -0.1271 -0.1809 83  LYS A CE  
151  N NZ  . LYS A 12  ? 1.3691 1.2407 1.6860 0.0927  -0.1321 -0.1956 83  LYS A NZ  
165  N N   . GLY A 13  ? 0.8237 0.7355 0.9880 0.0889  -0.0992 -0.1260 84  GLY A N   
166  C CA  . GLY A 13  ? 0.7976 0.7306 0.9411 0.0942  -0.1011 -0.1385 84  GLY A CA  
167  C C   . GLY A 13  ? 0.8012 0.7466 0.9212 0.0907  -0.0983 -0.1325 84  GLY A C   
168  O O   . GLY A 13  ? 0.7733 0.7353 0.8811 0.0938  -0.1020 -0.1447 84  GLY A O   
172  N N   . ILE A 14  ? 0.8568 0.7946 0.9698 0.0846  -0.0918 -0.1136 85  ILE A N   
173  C CA  . ILE A 14  ? 0.8898 0.8377 0.9829 0.0816  -0.0892 -0.1072 85  ILE A CA  
174  C C   . ILE A 14  ? 0.9579 0.9087 1.0643 0.0795  -0.0952 -0.1158 85  ILE A C   
175  O O   . ILE A 14  ? 0.9197 0.8832 1.0111 0.0801  -0.0976 -0.1182 85  ILE A O   
176  C CB  . ILE A 14  ? 0.8660 0.8052 0.9493 0.0763  -0.0805 -0.0863 85  ILE A CB  
177  C CG1 . ILE A 14  ? 0.8340 0.7774 0.8981 0.0792  -0.0760 -0.0802 85  ILE A CG1 
178  C CG2 . ILE A 14  ? 0.8659 0.8110 0.9384 0.0723  -0.0784 -0.0798 85  ILE A CG2 
179  C CD1 . ILE A 14  ? 0.8128 0.7486 0.8664 0.0748  -0.0683 -0.0617 85  ILE A CD1 
191  N N   . ASN A 15  ? 1.0589 0.9981 1.1945 0.0770  -0.0983 -0.1204 86  ASN A N   
192  C CA  . ASN A 15  ? 1.1340 1.0758 1.2871 0.0743  -0.1042 -0.1290 86  ASN A CA  
193  C C   . ASN A 15  ? 1.1814 1.1360 1.3393 0.0801  -0.1151 -0.1521 86  ASN A C   
194  O O   . ASN A 15  ? 1.2311 1.1937 1.3956 0.0795  -0.1219 -0.1607 86  ASN A O   
195  C CB  . ASN A 15  ? 1.1516 1.0760 1.3367 0.0681  -0.1020 -0.1245 86  ASN A CB  
196  C CG  . ASN A 15  ? 1.1619 1.0784 1.3436 0.0610  -0.0920 -0.1041 86  ASN A CG  
197  O OD1 . ASN A 15  ? 1.1355 1.0611 1.2990 0.0601  -0.0895 -0.0978 86  ASN A OD1 
198  N ND2 . ASN A 15  ? 1.1962 1.0956 1.3953 0.0561  -0.0861 -0.0937 86  ASN A ND2 
205  N N   . SER A 16  ? 1.1626 1.1203 1.3176 0.0862  -0.1175 -0.1633 87  SER A N   
206  C CA  . SER A 16  ? 1.1929 1.1637 1.3522 0.0920  -0.1277 -0.1871 87  SER A CA  
207  C C   . SER A 16  ? 1.2065 1.1969 1.3376 0.0945  -0.1311 -0.1902 87  SER A C   
208  O O   . SER A 16  ? 1.2452 1.2394 1.3511 0.0931  -0.1248 -0.1746 87  SER A O   
209  C CB  . SER A 16  ? 1.1932 1.1661 1.3515 0.0986  -0.1281 -0.1983 87  SER A CB  
210  O OG  . SER A 16  ? 1.1908 1.1770 1.3161 0.1020  -0.1229 -0.1934 87  SER A OG  
216  N N   . ASN A 17  ? 1.1793 1.1818 1.3150 0.0986  -0.1418 -0.2108 88  ASN A N   
217  C CA  . ASN A 17  ? 1.1963 1.2183 1.3030 0.1025  -0.1465 -0.2153 88  ASN A CA  
218  C C   . ASN A 17  ? 1.2179 1.2532 1.2965 0.1086  -0.1432 -0.2207 88  ASN A C   
219  O O   . ASN A 17  ? 1.2148 1.2657 1.2637 0.1115  -0.1446 -0.2204 88  ASN A O   
220  C CB  . ASN A 17  ? 1.2597 1.2910 1.3812 0.1050  -0.1604 -0.2362 88  ASN A CB  
221  C CG  . ASN A 17  ? 1.3080 1.3560 1.4025 0.1076  -0.1668 -0.2354 88  ASN A CG  
222  O OD1 . ASN A 17  ? 1.2696 1.3161 1.3477 0.1047  -0.1616 -0.2160 88  ASN A OD1 
223  N ND2 . ASN A 17  ? 1.3852 1.4489 1.4754 0.1136  -0.1787 -0.2570 88  ASN A ND2 
230  N N   . ASN A 18  ? 1.2129 1.2426 1.3008 0.1106  -0.1387 -0.2251 89  ASN A N   
231  C CA  . ASN A 18  ? 1.2251 1.2685 1.2906 0.1162  -0.1344 -0.2313 89  ASN A CA  
232  C C   . ASN A 18  ? 1.1734 1.2167 1.2138 0.1132  -0.1231 -0.2087 89  ASN A C   
233  O O   . ASN A 18  ? 1.1558 1.1837 1.2056 0.1088  -0.1168 -0.1927 89  ASN A O   
234  C CB  . ASN A 18  ? 1.2755 1.3125 1.3644 0.1199  -0.1342 -0.2445 89  ASN A CB  
235  C CG  . ASN A 18  ? 1.3402 1.3936 1.4101 0.1262  -0.1296 -0.2541 89  ASN A CG  
236  O OD1 . ASN A 18  ? 1.3650 1.4304 1.4042 0.1259  -0.1228 -0.2441 89  ASN A OD1 
237  N ND2 . ASN A 18  ? 1.3682 1.4219 1.4584 0.1317  -0.1327 -0.2737 89  ASN A ND2 
244  N N   . LEU A 19  ? 1.1934 1.2537 1.2016 0.1153  -0.1207 -0.2073 90  LEU A N   
245  C CA  . LEU A 19  ? 1.1692 1.2299 1.1555 0.1120  -0.1100 -0.1870 90  LEU A CA  
246  C C   . LEU A 19  ? 1.1094 1.1688 1.0997 0.1135  -0.1019 -0.1867 90  LEU A C   
247  O O   . LEU A 19  ? 1.0986 1.1507 1.0846 0.1097  -0.0940 -0.1694 90  LEU A O   
248  C CB  . LEU A 19  ? 1.2179 1.2964 1.1699 0.1135  -0.1092 -0.1848 90  LEU A CB  
249  C CG  . LEU A 19  ? 1.2574 1.3350 1.1880 0.1090  -0.0991 -0.1625 90  LEU A CG  
250  C CD1 . LEU A 19  ? 1.2314 1.2938 1.1692 0.1033  -0.0998 -0.1450 90  LEU A CD1 
251  C CD2 . LEU A 19  ? 1.3259 1.4216 1.2229 0.1110  -0.0971 -0.1616 90  LEU A CD2 
263  N N   . GLU A 20  ? 1.0669 1.1339 1.0671 0.1194  -0.1044 -0.2067 91  GLU A N   
264  C CA  . GLU A 20  ? 1.0600 1.1276 1.0659 0.1219  -0.0976 -0.2079 91  GLU A CA  
265  C C   . GLU A 20  ? 0.9739 1.0194 1.0064 0.1196  -0.0975 -0.1985 91  GLU A C   
266  O O   . GLU A 20  ? 0.9710 1.0129 1.0034 0.1191  -0.0910 -0.1884 91  GLU A O   
267  C CB  . GLU A 20  ? 1.1787 1.2608 1.1905 0.1296  -0.1005 -0.2335 91  GLU A CB  
268  C CG  . GLU A 20  ? 1.2674 1.3520 1.2890 0.1333  -0.0943 -0.2376 91  GLU A CG  
269  C CD  . GLU A 20  ? 1.3079 1.4044 1.3052 0.1310  -0.0829 -0.2242 91  GLU A CD  
270  O OE1 . GLU A 20  ? 1.3697 1.4792 1.3387 0.1287  -0.0793 -0.2192 91  GLU A OE1 
271  O OE2 . GLU A 20  ? 1.2642 1.3567 1.2716 0.1315  -0.0779 -0.2185 91  GLU A OE2 
278  N N   . SER A 21  ? 0.9198 0.9508 0.9756 0.1181  -0.1049 -0.2016 92  SER A N   
279  C CA  . SER A 21  ? 0.9066 0.9155 0.9858 0.1152  -0.1043 -0.1904 92  SER A CA  
280  C C   . SER A 21  ? 0.8464 0.8453 0.9151 0.1080  -0.0986 -0.1662 92  SER A C   
281  O O   . SER A 21  ? 0.7841 0.7678 0.8629 0.1056  -0.0955 -0.1532 92  SER A O   
282  C CB  . SER A 21  ? 1.0036 1.0005 1.1132 0.1153  -0.1130 -0.2021 92  SER A CB  
283  O OG  . SER A 21  ? 1.0907 1.0951 1.2135 0.1225  -0.1185 -0.2260 92  SER A OG  
289  N N   . GLN A 22  ? 0.9002 0.9073 0.9491 0.1047  -0.0978 -0.1601 93  GLN A N   
290  C CA  . GLN A 22  ? 0.9100 0.9099 0.9479 0.0985  -0.0917 -0.1386 93  GLN A CA  
291  C C   . GLN A 22  ? 0.8538 0.8589 0.8739 0.0987  -0.0835 -0.1287 93  GLN A C   
292  O O   . GLN A 22  ? 0.8233 0.8177 0.8444 0.0952  -0.0786 -0.1136 93  GLN A O   
293  C CB  . GLN A 22  ? 0.9517 0.9589 0.9754 0.0960  -0.0940 -0.1359 93  GLN A CB  
294  C CG  . GLN A 22  ? 0.9607 0.9615 1.0050 0.0944  -0.1019 -0.1427 93  GLN A CG  
295  C CD  . GLN A 22  ? 0.9542 0.9642 0.9851 0.0935  -0.1060 -0.1416 93  GLN A CD  
296  O OE1 . GLN A 22  ? 0.9393 0.9645 0.9476 0.0970  -0.1076 -0.1464 93  GLN A OE1 
297  N NE2 . GLN A 22  ? 0.9599 0.9611 1.0049 0.0889  -0.1076 -0.1348 93  GLN A NE2 
306  N N   . LEU A 23  ? 0.8267 0.8492 0.8313 0.1027  -0.0817 -0.1378 94  LEU A N   
307  C CA  . LEU A 23  ? 0.8348 0.8644 0.8260 0.1027  -0.0737 -0.1306 94  LEU A CA  
308  C C   . LEU A 23  ? 0.8298 0.8502 0.8391 0.1050  -0.0730 -0.1302 94  LEU A C   
309  O O   . LEU A 23  ? 0.8311 0.8458 0.8372 0.1023  -0.0683 -0.1163 94  LEU A O   
310  C CB  . LEU A 23  ? 0.8647 0.9159 0.8388 0.1064  -0.0714 -0.1424 94  LEU A CB  
311  C CG  . LEU A 23  ? 0.8676 0.9295 0.8291 0.1058  -0.0621 -0.1363 94  LEU A CG  
312  C CD1 . LEU A 23  ? 0.8729 0.9282 0.8219 0.0990  -0.0565 -0.1153 94  LEU A CD1 
313  C CD2 . LEU A 23  ? 0.8639 0.9478 0.8071 0.1086  -0.0585 -0.1473 94  LEU A CD2 
325  N N   . GLN A 24  ? 0.8241 0.8423 0.8533 0.1105  -0.0786 -0.1456 95  GLN A N   
326  C CA  . GLN A 24  ? 0.8382 0.8464 0.8860 0.1137  -0.0793 -0.1447 95  GLN A CA  
327  C C   . GLN A 24  ? 0.7878 0.7747 0.8436 0.1089  -0.0795 -0.1267 95  GLN A C   
328  O O   . GLN A 24  ? 0.7348 0.7153 0.7922 0.1092  -0.0772 -0.1163 95  GLN A O   
329  C CB  . GLN A 24  ? 0.9484 0.9556 1.0193 0.1204  -0.0862 -0.1647 95  GLN A CB  
330  C CG  . GLN A 24  ? 1.0815 1.1113 1.1448 0.1260  -0.0852 -0.1842 95  GLN A CG  
331  C CD  . GLN A 24  ? 1.2128 1.2419 1.3012 0.1333  -0.0921 -0.2062 95  GLN A CD  
332  O OE1 . GLN A 24  ? 1.2435 1.2535 1.3572 0.1343  -0.0978 -0.2056 95  GLN A OE1 
333  N NE2 . GLN A 24  ? 1.2769 1.3269 1.3586 0.1384  -0.0913 -0.2259 95  GLN A NE2 
342  N N   . ALA A 25  ? 0.8352 0.8121 0.8961 0.1044  -0.0820 -0.1230 96  ALA A N   
343  C CA  . ALA A 25  ? 0.8214 0.7794 0.8896 0.0993  -0.0807 -0.1062 96  ALA A CA  
344  C C   . ALA A 25  ? 0.7552 0.7149 0.8023 0.0947  -0.0736 -0.0891 96  ALA A C   
345  O O   . ALA A 25  ? 0.7251 0.6731 0.7735 0.0926  -0.0713 -0.0756 96  ALA A O   
346  C CB  . ALA A 25  ? 0.8410 0.7906 0.9216 0.0953  -0.0841 -0.1079 96  ALA A CB  
352  N N   . THR A 26  ? 0.7499 0.7241 0.7773 0.0930  -0.0705 -0.0895 97  THR A N   
353  C CA  . THR A 26  ? 0.7259 0.7015 0.7357 0.0886  -0.0640 -0.0746 97  THR A CA  
354  C C   . THR A 26  ? 0.7393 0.7203 0.7443 0.0913  -0.0610 -0.0726 97  THR A C   
355  O O   . THR A 26  ? 0.7025 0.6781 0.7019 0.0885  -0.0576 -0.0600 97  THR A O   
356  C CB  . THR A 26  ? 0.7091 0.6967 0.7010 0.0861  -0.0619 -0.0744 97  THR A CB  
357  O OG1 . THR A 26  ? 0.7040 0.6874 0.7021 0.0842  -0.0660 -0.0769 97  THR A OG1 
358  C CG2 . THR A 26  ? 0.6917 0.6782 0.6695 0.0811  -0.0556 -0.0594 97  THR A CG2 
366  N N   . GLN A 27  ? 0.7659 0.7589 0.7740 0.0968  -0.0623 -0.0860 98  GLN A N   
367  C CA  . GLN A 27  ? 0.7590 0.7577 0.7685 0.1002  -0.0604 -0.0861 98  GLN A CA  
368  C C   . GLN A 27  ? 0.6978 0.6798 0.7212 0.1019  -0.0640 -0.0783 98  GLN A C   
369  O O   . GLN A 27  ? 0.6716 0.6522 0.6899 0.1011  -0.0620 -0.0685 98  GLN A O   
370  C CB  . GLN A 27  ? 0.8015 0.8152 0.8173 0.1067  -0.0616 -0.1041 98  GLN A CB  
371  C CG  . GLN A 27  ? 0.8548 0.8875 0.8529 0.1054  -0.0566 -0.1104 98  GLN A CG  
372  C CD  . GLN A 27  ? 0.9141 0.9614 0.9184 0.1119  -0.0580 -0.1306 98  GLN A CD  
373  O OE1 . GLN A 27  ? 0.9258 0.9676 0.9505 0.1176  -0.0636 -0.1412 98  GLN A OE1 
374  N NE2 . GLN A 27  ? 0.9440 1.0098 0.9308 0.1111  -0.0527 -0.1360 98  GLN A NE2 
383  N N   . ALA A 28  ? 0.6930 0.6619 0.7341 0.1042  -0.0696 -0.0826 99  ALA A N   
384  C CA  . ALA A 28  ? 0.6990 0.6501 0.7530 0.1057  -0.0732 -0.0734 99  ALA A CA  
385  C C   . ALA A 28  ? 0.7336 0.6746 0.7751 0.0993  -0.0692 -0.0546 99  ALA A C   
386  O O   . ALA A 28  ? 0.7136 0.6490 0.7525 0.1004  -0.0696 -0.0445 99  ALA A O   
387  C CB  . ALA A 28  ? 0.6991 0.6363 0.7750 0.1075  -0.0789 -0.0798 99  ALA A CB  
393  N N   . ALA A 29  ? 0.7963 0.7361 0.8303 0.0930  -0.0658 -0.0505 100 ALA A N   
394  C CA  . ALA A 29  ? 0.8070 0.7394 0.8294 0.0869  -0.0610 -0.0347 100 ALA A CA  
395  C C   . ALA A 29  ? 0.7458 0.6882 0.7513 0.0863  -0.0573 -0.0293 100 ALA A C   
396  O O   . ALA A 29  ? 0.7510 0.6866 0.7503 0.0849  -0.0559 -0.0177 100 ALA A O   
397  C CB  . ALA A 29  ? 0.8336 0.7664 0.8531 0.0812  -0.0583 -0.0342 100 ALA A CB  
403  N N   . ARG A 30  ? 0.6909 0.6499 0.6887 0.0873  -0.0555 -0.0376 101 ARG A N   
404  C CA  . ARG A 30  ? 0.6767 0.6458 0.6620 0.0861  -0.0517 -0.0334 101 ARG A CA  
405  C C   . ARG A 30  ? 0.7052 0.6739 0.6967 0.0912  -0.0553 -0.0330 101 ARG A C   
406  O O   . ARG A 30  ? 0.7049 0.6733 0.6888 0.0898  -0.0542 -0.0246 101 ARG A O   
407  C CB  . ARG A 30  ? 0.6929 0.6795 0.6705 0.0858  -0.0484 -0.0419 101 ARG A CB  
408  C CG  . ARG A 30  ? 0.7534 0.7520 0.7233 0.0848  -0.0444 -0.0399 101 ARG A CG  
409  C CD  . ARG A 30  ? 0.8176 0.8339 0.7882 0.0876  -0.0422 -0.0516 101 ARG A CD  
410  N NE  . ARG A 30  ? 0.8689 0.8915 0.8516 0.0935  -0.0449 -0.0586 101 ARG A NE  
411  C CZ  . ARG A 30  ? 0.9165 0.9560 0.9033 0.0967  -0.0425 -0.0704 101 ARG A CZ  
412  N NH1 . ARG A 30  ? 0.9246 0.9758 0.9014 0.0943  -0.0372 -0.0754 101 ARG A NH1 
413  N NH2 . ARG A 30  ? 0.9469 0.9920 0.9477 0.1025  -0.0455 -0.0772 101 ARG A NH2 
427  N N   . LYS A 31  ? 0.7103 0.6804 0.7165 0.0978  -0.0601 -0.0431 102 LYS A N   
428  C CA  . LYS A 31  ? 0.7507 0.7197 0.7655 0.1037  -0.0650 -0.0426 102 LYS A CA  
429  C C   . LYS A 31  ? 0.7137 0.6641 0.7275 0.1031  -0.0680 -0.0281 102 LYS A C   
430  O O   . LYS A 31  ? 0.7057 0.6561 0.7148 0.1048  -0.0702 -0.0212 102 LYS A O   
431  C CB  . LYS A 31  ? 0.8394 0.8109 0.8733 0.1114  -0.0702 -0.0567 102 LYS A CB  
432  C CG  . LYS A 31  ? 0.9316 0.9249 0.9659 0.1135  -0.0667 -0.0719 102 LYS A CG  
433  C CD  . LYS A 31  ? 1.0455 1.0409 1.0999 0.1215  -0.0718 -0.0875 102 LYS A CD  
434  C CE  . LYS A 31  ? 1.1317 1.1502 1.1849 0.1234  -0.0670 -0.1035 102 LYS A CE  
435  N NZ  . LYS A 31  ? 1.1921 1.2138 1.2666 0.1320  -0.0720 -0.1210 102 LYS A NZ  
449  N N   . LEU A 32  ? 0.7163 0.6517 0.7341 0.1003  -0.0681 -0.0232 103 LEU A N   
450  C CA  . LEU A 32  ? 0.7603 0.6779 0.7760 0.0989  -0.0694 -0.0082 103 LEU A CA  
451  C C   . LEU A 32  ? 0.7594 0.6791 0.7549 0.0933  -0.0641 0.0030  103 LEU A C   
452  O O   . LEU A 32  ? 0.7653 0.6762 0.7539 0.0938  -0.0657 0.0147  103 LEU A O   
453  C CB  . LEU A 32  ? 0.8291 0.7326 0.8555 0.0956  -0.0687 -0.0067 103 LEU A CB  
454  C CG  . LEU A 32  ? 0.9339 0.8167 0.9651 0.0944  -0.0698 0.0072  103 LEU A CG  
455  C CD1 . LEU A 32  ? 1.0142 0.8891 1.0563 0.1025  -0.0779 0.0087  103 LEU A CD1 
456  C CD2 . LEU A 32  ? 0.9416 0.8148 0.9879 0.0905  -0.0684 0.0043  103 LEU A CD2 
468  N N   . LEU A 33  ? 0.7636 0.6948 0.7492 0.0883  -0.0583 -0.0006 104 LEU A N   
469  C CA  . LEU A 33  ? 0.7396 0.6728 0.7087 0.0827  -0.0529 0.0079  104 LEU A CA  
470  C C   . LEU A 33  ? 0.7272 0.6736 0.6883 0.0839  -0.0532 0.0058  104 LEU A C   
471  O O   . LEU A 33  ? 0.7237 0.6718 0.6721 0.0798  -0.0498 0.0117  104 LEU A O   
472  C CB  . LEU A 33  ? 0.7036 0.6404 0.6688 0.0767  -0.0470 0.0057  104 LEU A CB  
473  C CG  . LEU A 33  ? 0.6854 0.6101 0.6575 0.0733  -0.0454 0.0092  104 LEU A CG  
474  C CD1 . LEU A 33  ? 0.6766 0.6077 0.6477 0.0693  -0.0420 0.0042  104 LEU A CD1 
475  C CD2 . LEU A 33  ? 0.6695 0.5834 0.6341 0.0698  -0.0420 0.0221  104 LEU A CD2 
487  N N   . SER A 34  ? 0.7317 0.6885 0.7014 0.0891  -0.0569 -0.0036 105 SER A N   
488  C CA  . SER A 34  ? 0.8026 0.7739 0.7689 0.0899  -0.0569 -0.0070 105 SER A CA  
489  C C   . SER A 34  ? 0.9571 0.9284 0.9310 0.0973  -0.0649 -0.0072 105 SER A C   
490  O O   . SER A 34  ? 0.8972 0.8823 0.8733 0.0991  -0.0662 -0.0122 105 SER A O   
491  C CB  . SER A 34  ? 0.7968 0.7841 0.7668 0.0890  -0.0528 -0.0183 105 SER A CB  
492  O OG  . SER A 34  ? 0.8424 0.8319 0.8259 0.0946  -0.0558 -0.0280 105 SER A OG  
498  N N   . ARG A 35  ? 1.1612 1.1172 1.1405 0.1015  -0.0705 -0.0013 106 ARG A N   
499  C CA  . ARG A 35  ? 1.3762 1.3297 1.3610 0.1090  -0.0794 0.0014  106 ARG A CA  
500  C C   . ARG A 35  ? 1.4679 1.4181 1.4355 0.1070  -0.0805 0.0128  106 ARG A C   
501  O O   . ARG A 35  ? 1.4773 1.4179 1.4314 0.1013  -0.0757 0.0224  106 ARG A O   
502  C CB  . ARG A 35  ? 1.4710 1.4077 1.4687 0.1144  -0.0853 0.0046  106 ARG A CB  
503  C CG  . ARG A 35  ? 1.5896 1.5065 1.5807 0.1098  -0.0825 0.0174  106 ARG A CG  
504  C CD  . ARG A 35  ? 1.7233 1.6241 1.7315 0.1161  -0.0897 0.0198  106 ARG A CD  
505  N NE  . ARG A 35  ? 1.8103 1.6926 1.8209 0.1115  -0.0864 0.0286  106 ARG A NE  
506  C CZ  . ARG A 35  ? 1.8463 1.7121 1.8738 0.1155  -0.0916 0.0314  106 ARG A CZ  
507  N NH1 . ARG A 35  ? 1.8535 1.7032 1.8848 0.1101  -0.0876 0.0393  106 ARG A NH1 
508  N NH2 . ARG A 35  ? 1.8549 1.7201 1.8979 0.1249  -0.1008 0.0259  106 ARG A NH2 
522  N N   . GLU A 36  ? 1.6032 1.5630 1.5723 0.1120  -0.0872 0.0106  107 GLU A N   
523  C CA  . GLU A 36  ? 1.6876 1.6521 1.6407 0.1095  -0.0879 0.0160  107 GLU A CA  
524  C C   . GLU A 36  ? 1.7194 1.6673 1.6545 0.1068  -0.0868 0.0309  107 GLU A C   
525  O O   . GLU A 36  ? 1.6359 1.5842 1.5565 0.0998  -0.0797 0.0341  107 GLU A O   
526  C CB  . GLU A 36  ? 1.7696 1.7439 1.7300 0.1175  -0.0984 0.0122  107 GLU A CB  
527  C CG  . GLU A 36  ? 1.7959 1.7852 1.7483 0.1145  -0.0984 0.0086  107 GLU A CG  
528  C CD  . GLU A 36  ? 1.8082 1.8075 1.7693 0.1228  -0.1104 0.0047  107 GLU A CD  
529  O OE1 . GLU A 36  ? 1.8019 1.7926 1.7705 0.1314  -0.1197 0.0085  107 GLU A OE1 
530  O OE2 . GLU A 36  ? 1.8187 1.8341 1.7808 0.1209  -0.1111 -0.0025 107 GLU A OE2 
537  N N   . LYS A 37  ? 1.8120 1.7449 1.7484 0.1124  -0.0935 0.0403  108 LYS A N   
538  C CA  . LYS A 37  ? 1.9121 1.8301 1.8302 0.1105  -0.0927 0.0561  108 LYS A CA  
539  C C   . LYS A 37  ? 1.9102 1.8135 1.8304 0.1048  -0.0845 0.0619  108 LYS A C   
540  O O   . LYS A 37  ? 1.9534 1.8500 1.8917 0.1070  -0.0856 0.0585  108 LYS A O   
541  C CB  . LYS A 37  ? 1.9749 1.8832 1.8921 0.1194  -0.1046 0.0656  108 LYS A CB  
542  C CG  . LYS A 37  ? 1.9829 1.9053 1.8962 0.1255  -0.1144 0.0614  108 LYS A CG  
543  C CD  . LYS A 37  ? 1.9937 1.9051 1.9061 0.1353  -0.1275 0.0723  108 LYS A CD  
544  C CE  . LYS A 37  ? 1.9865 1.9130 1.8952 0.1419  -0.1389 0.0677  108 LYS A CE  
545  N NZ  . LYS A 37  ? 2.0105 1.9259 1.9179 0.1525  -0.1532 0.0791  108 LYS A NZ  
559  N N   . GLN A 38  ? 1.8608 1.7601 1.7642 0.0977  -0.0762 0.0696  109 GLN A N   
560  C CA  . GLN A 38  ? 1.7836 1.6683 1.6885 0.0923  -0.0687 0.0776  109 GLN A CA  
561  C C   . GLN A 38  ? 1.4891 1.3741 1.4143 0.0902  -0.0654 0.0676  109 GLN A C   
562  O O   . GLN A 38  ? 1.5827 1.4559 1.5231 0.0928  -0.0684 0.0693  109 GLN A O   
563  C CB  . GLN A 38  ? 1.9553 1.8213 1.8607 0.0963  -0.0736 0.0919  109 GLN A CB  
564  C CG  . GLN A 38  ? 2.0511 1.9118 1.9327 0.0966  -0.0743 0.1064  109 GLN A CG  
565  C CD  . GLN A 38  ? 2.0848 1.9259 1.9689 0.1009  -0.0798 0.1215  109 GLN A CD  
566  O OE1 . GLN A 38  ? 2.0894 1.9278 1.9819 0.1098  -0.0915 0.1217  109 GLN A OE1 
567  N NE2 . GLN A 38  ? 2.0915 1.9184 1.9704 0.0947  -0.0712 0.1345  109 GLN A NE2 
576  N N   . PRO A 39  ? 1.0926 0.9902 1.0191 0.0859  -0.0599 0.0571  110 PRO A N   
577  C CA  . PRO A 39  ? 0.8798 0.7758 0.8207 0.0828  -0.0560 0.0503  110 PRO A CA  
578  C C   . PRO A 39  ? 0.7831 0.6638 0.7250 0.0779  -0.0505 0.0605  110 PRO A C   
579  O O   . PRO A 39  ? 0.6991 0.5771 0.6260 0.0733  -0.0447 0.0697  110 PRO A O   
580  C CB  . PRO A 39  ? 0.8569 0.7678 0.7924 0.0782  -0.0503 0.0418  110 PRO A CB  
581  C CG  . PRO A 39  ? 0.8803 0.8027 0.8070 0.0810  -0.0539 0.0392  110 PRO A CG  
582  C CD  . PRO A 39  ? 0.9518 0.8652 0.8677 0.0838  -0.0578 0.0508  110 PRO A CD  
590  N N   . PRO A 40  ? 0.8605 0.7320 0.8195 0.0785  -0.0519 0.0590  111 PRO A N   
591  C CA  . PRO A 40  ? 0.8325 0.6902 0.7954 0.0726  -0.0457 0.0684  111 PRO A CA  
592  C C   . PRO A 40  ? 0.7446 0.6096 0.7087 0.0656  -0.0377 0.0626  111 PRO A C   
593  O O   . PRO A 40  ? 0.6872 0.5502 0.6677 0.0634  -0.0368 0.0563  111 PRO A O   
594  C CB  . PRO A 40  ? 0.9078 0.7536 0.8935 0.0762  -0.0514 0.0661  111 PRO A CB  
595  C CG  . PRO A 40  ? 0.9405 0.7995 0.9360 0.0812  -0.0570 0.0490  111 PRO A CG  
596  C CD  . PRO A 40  ? 0.9212 0.7963 0.8992 0.0829  -0.0572 0.0458  111 PRO A CD  
604  N N   . ILE A 41  ? 0.7502 0.6244 0.6971 0.0625  -0.0327 0.0640  112 ILE A N   
605  C CA  . ILE A 41  ? 0.7441 0.6266 0.6921 0.0572  -0.0265 0.0577  112 ILE A CA  
606  C C   . ILE A 41  ? 0.7318 0.6054 0.6899 0.0513  -0.0198 0.0627  112 ILE A C   
607  O O   . ILE A 41  ? 0.7254 0.6013 0.6979 0.0490  -0.0190 0.0551  112 ILE A O   
608  C CB  . ILE A 41  ? 0.7511 0.6436 0.6805 0.0554  -0.0226 0.0583  112 ILE A CB  
609  C CG1 . ILE A 41  ? 0.7618 0.6652 0.6866 0.0603  -0.0289 0.0510  112 ILE A CG1 
610  C CG2 . ILE A 41  ? 0.7219 0.6203 0.6539 0.0499  -0.0159 0.0538  112 ILE A CG2 
611  C CD1 . ILE A 41  ? 0.7653 0.6781 0.6744 0.0587  -0.0264 0.0506  112 ILE A CD1 
623  N N   . ASP A 42  ? 0.7219 0.5858 0.6725 0.0487  -0.0149 0.0756  113 ASP A N   
624  C CA  . ASP A 42  ? 0.7799 0.6366 0.7411 0.0420  -0.0067 0.0808  113 ASP A CA  
625  C C   . ASP A 42  ? 0.7680 0.6158 0.7545 0.0420  -0.0104 0.0772  113 ASP A C   
626  O O   . ASP A 42  ? 0.7392 0.5873 0.7418 0.0371  -0.0062 0.0732  113 ASP A O   
627  C CB  . ASP A 42  ? 0.9314 0.7797 0.8775 0.0392  0.0000  0.0964  113 ASP A CB  
628  C CG  . ASP A 42  ? 1.0610 0.9201 0.9847 0.0374  0.0060  0.0972  113 ASP A CG  
629  O OD1 . ASP A 42  ? 1.0692 0.9383 0.9965 0.0343  0.0104  0.0887  113 ASP A OD1 
630  O OD2 . ASP A 42  ? 1.1589 1.0164 1.0618 0.0396  0.0055  0.1058  113 ASP A OD2 
635  N N   . ASN A 43  ? 0.8022 0.6428 0.7948 0.0479  -0.0190 0.0768  114 ASN A N   
636  C CA  . ASN A 43  ? 0.8333 0.6660 0.8521 0.0484  -0.0234 0.0705  114 ASN A CA  
637  C C   . ASN A 43  ? 0.7993 0.6446 0.8291 0.0486  -0.0261 0.0537  114 ASN A C   
638  O O   . ASN A 43  ? 0.7672 0.6099 0.8175 0.0452  -0.0256 0.0480  114 ASN A O   
639  C CB  . ASN A 43  ? 0.9017 0.7260 0.9255 0.0559  -0.0329 0.0710  114 ASN A CB  
640  C CG  . ASN A 43  ? 0.9917 0.7995 1.0093 0.0558  -0.0315 0.0893  114 ASN A CG  
641  O OD1 . ASN A 43  ? 1.0427 0.8430 1.0574 0.0489  -0.0225 0.1013  114 ASN A OD1 
642  N ND2 . ASN A 43  ? 1.0115 0.8139 1.0272 0.0635  -0.0403 0.0918  114 ASN A ND2 
649  N N   . ILE A 44  ? 0.8004 0.6598 0.8166 0.0522  -0.0290 0.0459  115 ILE A N   
650  C CA  . ILE A 44  ? 0.7525 0.6246 0.7744 0.0528  -0.0317 0.0317  115 ILE A CA  
651  C C   . ILE A 44  ? 0.6816 0.5577 0.7063 0.0464  -0.0251 0.0319  115 ILE A C   
652  O O   . ILE A 44  ? 0.6520 0.5316 0.6918 0.0453  -0.0274 0.0226  115 ILE A O   
653  C CB  . ILE A 44  ? 0.7553 0.6405 0.7605 0.0574  -0.0347 0.0265  115 ILE A CB  
654  C CG1 . ILE A 44  ? 0.8126 0.6960 0.8203 0.0644  -0.0419 0.0233  115 ILE A CG1 
655  C CG2 . ILE A 44  ? 0.7090 0.6074 0.7142 0.0573  -0.0358 0.0152  115 ILE A CG2 
656  C CD1 . ILE A 44  ? 0.8517 0.7337 0.8794 0.0679  -0.0481 0.0113  115 ILE A CD1 
668  N N   . ILE A 45  ? 0.6546 0.5314 0.6654 0.0426  -0.0174 0.0412  116 ILE A N   
669  C CA  . ILE A 45  ? 0.6293 0.5105 0.6443 0.0369  -0.0106 0.0409  116 ILE A CA  
670  C C   . ILE A 45  ? 0.6365 0.5096 0.6747 0.0323  -0.0078 0.0418  116 ILE A C   
671  O O   . ILE A 45  ? 0.6249 0.5033 0.6787 0.0301  -0.0085 0.0337  116 ILE A O   
672  C CB  . ILE A 45  ? 0.6050 0.4878 0.6017 0.0340  -0.0023 0.0501  116 ILE A CB  
673  C CG1 . ILE A 45  ? 0.5944 0.4868 0.5722 0.0378  -0.0052 0.0470  116 ILE A CG1 
674  C CG2 . ILE A 45  ? 0.5947 0.4812 0.5993 0.0282  0.0058  0.0499  116 ILE A CG2 
675  C CD1 . ILE A 45  ? 0.5993 0.4927 0.5584 0.0361  0.0010  0.0545  116 ILE A CD1 
687  N N   . ARG A 46  ? 0.8002 0.5928 0.8646 -0.0171 0.0189  0.0931  117 ARG A N   
688  C CA  . ARG A 46  ? 0.8650 0.6413 0.9597 -0.0339 0.0281  0.0971  117 ARG A CA  
689  C C   . ARG A 46  ? 0.8557 0.6266 0.9881 -0.0331 0.0147  0.0763  117 ARG A C   
690  O O   . ARG A 46  ? 0.8896 0.6605 1.0574 -0.0476 0.0202  0.0701  117 ARG A O   
691  C CB  . ARG A 46  ? 0.9402 0.6789 1.0169 -0.0403 0.0351  0.1247  117 ARG A CB  
692  C CG  . ARG A 46  ? 0.9577 0.7004 0.9962 -0.0461 0.0518  0.1455  117 ARG A CG  
693  C CD  . ARG A 46  ? 1.0245 0.7296 1.0442 -0.0572 0.0618  0.1752  117 ARG A CD  
694  N NE  . ARG A 46  ? 1.0604 0.7324 1.0639 -0.0438 0.0431  0.1870  117 ARG A NE  
695  C CZ  . ARG A 46  ? 1.0673 0.7361 1.0296 -0.0303 0.0336  0.1984  117 ARG A CZ  
696  N NH1 . ARG A 46  ? 1.0519 0.7469 0.9824 -0.0294 0.0416  0.1989  117 ARG A NH1 
697  N NH2 . ARG A 46  ? 1.0913 0.7312 1.0473 -0.0171 0.0149  0.2078  117 ARG A NH2 
711  N N   . ALA A 47  ? 0.6862 0.5382 0.7719 0.0340  -0.0194 0.0338  118 ALA A N   
712  C CA  . ALA A 47  ? 0.7077 0.5617 0.8142 0.0366  -0.0281 0.0188  118 ALA A CA  
713  C C   . ALA A 47  ? 0.7387 0.6075 0.8484 0.0362  -0.0305 0.0068  118 ALA A C   
714  O O   . ALA A 47  ? 0.7772 0.6497 0.9032 0.0383  -0.0382 -0.0069 118 ALA A O   
715  C CB  . ALA A 47  ? 0.7058 0.5606 0.8060 0.0448  -0.0370 0.0121  118 ALA A CB  
721  N N   . GLY A 48  ? 0.7279 0.6052 0.8228 0.0340  -0.0248 0.0110  119 GLY A N   
722  C CA  . GLY A 48  ? 0.7084 0.5987 0.8065 0.0341  -0.0276 0.0013  119 GLY A CA  
723  C C   . GLY A 48  ? 0.6973 0.5985 0.7814 0.0406  -0.0358 -0.0083 119 GLY A C   
724  O O   . GLY A 48  ? 0.7191 0.6297 0.8085 0.0419  -0.0413 -0.0180 119 GLY A O   
728  N N   . LEU A 49  ? 0.6810 0.5820 0.7471 0.0448  -0.0369 -0.0056 120 LEU A N   
729  C CA  . LEU A 49  ? 0.6663 0.5784 0.7206 0.0505  -0.0434 -0.0148 120 LEU A CA  
730  C C   . LEU A 49  ? 0.6338 0.5561 0.6698 0.0504  -0.0412 -0.0124 120 LEU A C   
731  O O   . LEU A 49  ? 0.6624 0.5948 0.6901 0.0541  -0.0462 -0.0198 120 LEU A O   
732  C CB  . LEU A 49  ? 0.7024 0.6118 0.7488 0.0552  -0.0455 -0.0144 120 LEU A CB  
733  C CG  . LEU A 49  ? 0.7690 0.6677 0.8353 0.0567  -0.0496 -0.0185 120 LEU A CG  
734  C CD1 . LEU A 49  ? 0.8041 0.6987 0.8644 0.0616  -0.0514 -0.0162 120 LEU A CD1 
735  C CD2 . LEU A 49  ? 0.8004 0.7053 0.8813 0.0594  -0.0574 -0.0347 120 LEU A CD2 
747  N N   . ILE A 50  ? 0.6141 0.5343 0.6439 0.0463  -0.0338 -0.0027 121 ILE A N   
748  C CA  . ILE A 50  ? 0.6068 0.5351 0.6203 0.0465  -0.0319 -0.0004 121 ILE A CA  
749  C C   . ILE A 50  ? 0.5831 0.5198 0.6006 0.0479  -0.0374 -0.0078 121 ILE A C   
750  O O   . ILE A 50  ? 0.5389 0.4835 0.5433 0.0510  -0.0408 -0.0105 121 ILE A O   
751  C CB  . ILE A 50  ? 0.6635 0.5884 0.6727 0.0421  -0.0232 0.0089  121 ILE A CB  
752  C CG1 . ILE A 50  ? 0.6808 0.6002 0.6777 0.0421  -0.0193 0.0165  121 ILE A CG1 
753  C CG2 . ILE A 50  ? 0.6755 0.6079 0.6749 0.0421  -0.0223 0.0092  121 ILE A CG2 
754  C CD1 . ILE A 50  ? 0.6965 0.6134 0.6863 0.0381  -0.0107 0.0247  121 ILE A CD1 
766  N N   . PRO A 51  ? 0.6132 0.5493 0.6489 0.0456  -0.0385 -0.0109 122 PRO A N   
767  C CA  . PRO A 51  ? 0.6464 0.5912 0.6859 0.0479  -0.0456 -0.0181 122 PRO A CA  
768  C C   . PRO A 51  ? 0.6873 0.6390 0.7200 0.0531  -0.0544 -0.0274 122 PRO A C   
769  O O   . PRO A 51  ? 0.6395 0.5994 0.6603 0.0561  -0.0589 -0.0292 122 PRO A O   
770  C CB  . PRO A 51  ? 0.6450 0.5875 0.7104 0.0447  -0.0461 -0.0220 122 PRO A CB  
771  C CG  . PRO A 51  ? 0.6316 0.5646 0.7032 0.0395  -0.0362 -0.0136 122 PRO A CG  
772  C CD  . PRO A 51  ? 0.6234 0.5513 0.6786 0.0412  -0.0342 -0.0089 122 PRO A CD  
780  N N   . LYS A 52  ? 0.7677 0.7159 0.8077 0.0545  -0.0568 -0.0332 123 LYS A N   
781  C CA  . LYS A 52  ? 0.8337 0.7894 0.8678 0.0598  -0.0643 -0.0440 123 LYS A CA  
782  C C   . LYS A 52  ? 0.7725 0.7344 0.7825 0.0624  -0.0620 -0.0405 123 LYS A C   
783  O O   . LYS A 52  ? 0.7784 0.7506 0.7761 0.0660  -0.0666 -0.0462 123 LYS A O   
784  C CB  . LYS A 52  ? 0.9524 0.9016 1.0024 0.0607  -0.0666 -0.0511 123 LYS A CB  
785  C CG  . LYS A 52  ? 1.0622 1.0051 1.1396 0.0572  -0.0684 -0.0548 123 LYS A CG  
786  C CD  . LYS A 52  ? 1.1598 1.0937 1.2540 0.0578  -0.0702 -0.0604 123 LYS A CD  
787  C CE  . LYS A 52  ? 1.2286 1.1562 1.3529 0.0537  -0.0721 -0.0652 123 LYS A CE  
788  N NZ  . LYS A 52  ? 1.2731 1.1882 1.4144 0.0536  -0.0724 -0.0671 123 LYS A NZ  
802  N N   . PHE A 53  ? 0.7236 0.6800 0.7265 0.0605  -0.0549 -0.0314 124 PHE A N   
803  C CA  . PHE A 53  ? 0.6826 0.6452 0.6656 0.0620  -0.0520 -0.0278 124 PHE A CA  
804  C C   . PHE A 53  ? 0.6420 0.6105 0.6128 0.0610  -0.0514 -0.0232 124 PHE A C   
805  O O   . PHE A 53  ? 0.6440 0.6212 0.6001 0.0631  -0.0523 -0.0243 124 PHE A O   
806  C CB  . PHE A 53  ? 0.6860 0.6417 0.6657 0.0598  -0.0454 -0.0189 124 PHE A CB  
807  C CG  . PHE A 53  ? 0.7137 0.6640 0.7012 0.0620  -0.0465 -0.0217 124 PHE A CG  
808  C CD1 . PHE A 53  ? 0.7232 0.6790 0.7139 0.0668  -0.0516 -0.0326 124 PHE A CD1 
809  C CD2 . PHE A 53  ? 0.7455 0.6854 0.7363 0.0598  -0.0425 -0.0132 124 PHE A CD2 
810  C CE1 . PHE A 53  ? 0.7535 0.7034 0.7536 0.0696  -0.0532 -0.0352 124 PHE A CE1 
811  C CE2 . PHE A 53  ? 0.7765 0.7100 0.7745 0.0626  -0.0444 -0.0141 124 PHE A CE2 
812  C CZ  . PHE A 53  ? 0.7783 0.7164 0.7825 0.0676  -0.0500 -0.0253 124 PHE A CZ  
822  N N   . VAL A 54  ? 0.6180 0.5817 0.5952 0.0577  -0.0495 -0.0175 125 VAL A N   
823  C CA  . VAL A 54  ? 0.5919 0.5595 0.5605 0.0573  -0.0498 -0.0128 125 VAL A CA  
824  C C   . VAL A 54  ? 0.6316 0.6076 0.5964 0.0612  -0.0583 -0.0193 125 VAL A C   
825  O O   . VAL A 54  ? 0.6067 0.5878 0.5570 0.0624  -0.0594 -0.0155 125 VAL A O   
826  C CB  . VAL A 54  ? 0.5617 0.5234 0.5422 0.0539  -0.0466 -0.0078 125 VAL A CB  
827  C CG1 . VAL A 54  ? 0.5634 0.5286 0.5401 0.0548  -0.0497 -0.0050 125 VAL A CG1 
828  C CG2 . VAL A 54  ? 0.4980 0.4536 0.4752 0.0504  -0.0379 -0.0006 125 VAL A CG2 
838  N N   . SER A 55  ? 0.6563 0.6335 0.6343 0.0631  -0.0646 -0.0290 126 SER A N   
839  C CA  . SER A 55  ? 0.7160 0.7025 0.6894 0.0674  -0.0739 -0.0368 126 SER A CA  
840  C C   . SER A 55  ? 0.6461 0.6412 0.6005 0.0708  -0.0744 -0.0409 126 SER A C   
841  O O   . SER A 55  ? 0.6215 0.6250 0.5594 0.0734  -0.0780 -0.0403 126 SER A O   
842  C CB  . SER A 55  ? 0.8844 0.8705 0.8795 0.0683  -0.0808 -0.0480 126 SER A CB  
843  O OG  . SER A 55  ? 1.0290 1.0253 1.0190 0.0730  -0.0911 -0.0569 126 SER A OG  
849  N N   . PHE A 56  ? 0.6174 0.6110 0.5740 0.0709  -0.0706 -0.0447 127 PHE A N   
850  C CA  . PHE A 56  ? 0.6452 0.6483 0.5855 0.0738  -0.0692 -0.0488 127 PHE A CA  
851  C C   . PHE A 56  ? 0.6557 0.6625 0.5763 0.0720  -0.0633 -0.0376 127 PHE A C   
852  O O   . PHE A 56  ? 0.7133 0.7307 0.6173 0.0741  -0.0628 -0.0397 127 PHE A O   
853  C CB  . PHE A 56  ? 0.6790 0.6789 0.6279 0.0743  -0.0656 -0.0532 127 PHE A CB  
854  C CG  . PHE A 56  ? 0.7643 0.7619 0.7316 0.0769  -0.0718 -0.0662 127 PHE A CG  
855  C CD1 . PHE A 56  ? 0.7967 0.8012 0.7666 0.0801  -0.0803 -0.0776 127 PHE A CD1 
856  C CD2 . PHE A 56  ? 0.8007 0.7888 0.7833 0.0765  -0.0697 -0.0669 127 PHE A CD2 
857  C CE1 . PHE A 56  ? 0.8180 0.8201 0.8075 0.0822  -0.0862 -0.0909 127 PHE A CE1 
858  C CE2 . PHE A 56  ? 0.8215 0.8057 0.8235 0.0786  -0.0754 -0.0785 127 PHE A CE2 
859  C CZ  . PHE A 56  ? 0.8228 0.8140 0.8294 0.0812  -0.0834 -0.0910 127 PHE A CZ  
869  N N   . LEU A 57  ? 0.6313 0.6300 0.5538 0.0678  -0.0582 -0.0262 128 LEU A N   
870  C CA  . LEU A 57  ? 0.6298 0.6308 0.5366 0.0657  -0.0530 -0.0161 128 LEU A CA  
871  C C   . LEU A 57  ? 0.6482 0.6551 0.5416 0.0676  -0.0578 -0.0133 128 LEU A C   
872  O O   . LEU A 57  ? 0.6419 0.6523 0.5201 0.0663  -0.0537 -0.0056 128 LEU A O   
873  C CB  . LEU A 57  ? 0.6497 0.6408 0.5628 0.0613  -0.0479 -0.0062 128 LEU A CB  
874  C CG  . LEU A 57  ? 0.6438 0.6290 0.5649 0.0590  -0.0424 -0.0055 128 LEU A CG  
875  C CD1 . LEU A 57  ? 0.6187 0.5958 0.5442 0.0551  -0.0384 0.0029  128 LEU A CD1 
876  C CD2 . LEU A 57  ? 0.6479 0.6396 0.5599 0.0590  -0.0377 -0.0060 128 LEU A CD2 
888  N N   . GLY A 58  ? 0.6595 0.6672 0.5589 0.0706  -0.0666 -0.0188 129 GLY A N   
889  C CA  . GLY A 58  ? 0.7662 0.7800 0.6517 0.0737  -0.0733 -0.0165 129 GLY A CA  
890  C C   . GLY A 58  ? 0.8553 0.8821 0.7255 0.0781  -0.0775 -0.0259 129 GLY A C   
891  O O   . GLY A 58  ? 0.8892 0.9223 0.7415 0.0806  -0.0819 -0.0220 129 GLY A O   
895  N N   . LYS A 59  ? 0.8800 0.9111 0.7564 0.0795  -0.0765 -0.0381 130 LYS A N   
896  C CA  . LYS A 59  ? 0.9394 0.9840 0.8038 0.0843  -0.0805 -0.0506 130 LYS A CA  
897  C C   . LYS A 59  ? 0.9606 1.0148 0.8009 0.0836  -0.0726 -0.0448 130 LYS A C   
898  O O   . LYS A 59  ? 0.9796 1.0393 0.8193 0.0833  -0.0656 -0.0500 130 LYS A O   
899  C CB  . LYS A 59  ? 0.9887 1.0334 0.8706 0.0860  -0.0814 -0.0657 130 LYS A CB  
900  C CG  . LYS A 59  ? 1.0791 1.1219 0.9792 0.0886  -0.0922 -0.0776 130 LYS A CG  
901  C CD  . LYS A 59  ? 1.1728 1.2214 1.0824 0.0923  -0.0952 -0.0961 130 LYS A CD  
902  C CE  . LYS A 59  ? 1.2348 1.2851 1.1599 0.0955  -0.1075 -0.1105 130 LYS A CE  
903  N NZ  . LYS A 59  ? 1.2444 1.2804 1.2000 0.0919  -0.1085 -0.1101 130 LYS A NZ  
917  N N   . THR A 60  ? 1.0103 1.0667 0.8316 0.0835  -0.0736 -0.0335 131 THR A N   
918  C CA  . THR A 60  ? 1.1002 1.1646 0.8987 0.0815  -0.0648 -0.0250 131 THR A CA  
919  C C   . THR A 60  ? 1.1705 1.2518 0.9558 0.0851  -0.0628 -0.0383 131 THR A C   
920  O O   . THR A 60  ? 1.1896 1.2787 0.9646 0.0826  -0.0522 -0.0356 131 THR A O   
921  C CB  . THR A 60  ? 1.1814 1.2446 0.9610 0.0817  -0.0683 -0.0107 131 THR A CB  
922  O OG1 . THR A 60  ? 1.2389 1.3106 0.9959 0.0794  -0.0589 -0.0023 131 THR A OG1 
923  C CG2 . THR A 60  ? 1.2012 1.2710 0.9728 0.0882  -0.0818 -0.0187 131 THR A CG2 
931  N N   . ASP A 61  ? 1.2318 1.3199 1.0182 0.0908  -0.0727 -0.0537 132 ASP A N   
932  C CA  . ASP A 61  ? 1.3567 1.4617 1.1320 0.0948  -0.0712 -0.0692 132 ASP A CA  
933  C C   . ASP A 61  ? 1.3110 1.4173 1.1021 0.0934  -0.0623 -0.0773 132 ASP A C   
934  O O   . ASP A 61  ? 1.3330 1.4505 1.1125 0.0922  -0.0520 -0.0770 132 ASP A O   
935  C CB  . ASP A 61  ? 1.5440 1.6541 1.3236 0.1011  -0.0849 -0.0864 132 ASP A CB  
936  C CG  . ASP A 61  ? 1.7231 1.8196 1.5350 0.1008  -0.0918 -0.0928 132 ASP A CG  
937  O OD1 . ASP A 61  ? 1.8397 1.9248 1.6596 0.0987  -0.0963 -0.0822 132 ASP A OD1 
938  O OD2 . ASP A 61  ? 1.7457 1.8429 1.5758 0.1027  -0.0925 -0.1083 132 ASP A OD2 
943  N N   . CYS A 62  ? 1.2013 1.2963 1.0198 0.0935  -0.0659 -0.0840 133 CYS A N   
944  C CA  . CYS A 62  ? 1.0844 1.1787 0.9203 0.0934  -0.0601 -0.0919 133 CYS A CA  
945  C C   . CYS A 62  ? 0.9518 1.0366 0.7927 0.0874  -0.0512 -0.0759 133 CYS A C   
946  O O   . CYS A 62  ? 0.8784 0.9487 0.7376 0.0851  -0.0524 -0.0712 133 CYS A O   
947  C CB  . CYS A 62  ? 1.0727 1.1581 0.9347 0.0962  -0.0685 -0.1046 133 CYS A CB  
948  S SG  . CYS A 62  ? 1.0657 1.1503 0.9498 0.0984  -0.0645 -0.1168 133 CYS A SG  
954  N N   . SER A 63  ? 0.9245 1.0181 0.7485 0.0845  -0.0418 -0.0676 134 SER A N   
955  C CA  . SER A 63  ? 0.9094 0.9955 0.7392 0.0787  -0.0337 -0.0543 134 SER A CA  
956  C C   . SER A 63  ? 0.8543 0.9365 0.7057 0.0793  -0.0318 -0.0610 134 SER A C   
957  O O   . SER A 63  ? 0.7741 0.8443 0.6359 0.0756  -0.0302 -0.0517 134 SER A O   
958  C CB  . SER A 63  ? 0.9900 1.0874 0.8007 0.0751  -0.0234 -0.0455 134 SER A CB  
959  O OG  . SER A 63  ? 1.0546 1.1690 0.8622 0.0776  -0.0177 -0.0578 134 SER A OG  
965  N N   . PRO A 64  ? 0.8909 0.9820 0.7503 0.0842  -0.0326 -0.0769 135 PRO A N   
966  C CA  . PRO A 64  ? 0.8846 0.9690 0.7661 0.0855  -0.0328 -0.0817 135 PRO A CA  
967  C C   . PRO A 64  ? 0.8064 0.8716 0.7034 0.0847  -0.0396 -0.0770 135 PRO A C   
968  O O   . PRO A 64  ? 0.7844 0.8403 0.6926 0.0827  -0.0378 -0.0707 135 PRO A O   
969  C CB  . PRO A 64  ? 0.9181 1.0144 0.8060 0.0921  -0.0348 -0.1012 135 PRO A CB  
970  C CG  . PRO A 64  ? 0.9404 1.0547 0.8057 0.0927  -0.0305 -0.1049 135 PRO A CG  
971  C CD  . PRO A 64  ? 0.9374 1.0454 0.7862 0.0891  -0.0331 -0.0916 135 PRO A CD  
979  N N   . ILE A 65  ? 0.8051 0.8648 0.7033 0.0861  -0.0473 -0.0803 136 ILE A N   
980  C CA  . ILE A 65  ? 0.7509 0.7934 0.6653 0.0846  -0.0521 -0.0756 136 ILE A CA  
981  C C   . ILE A 65  ? 0.6682 0.7024 0.5765 0.0788  -0.0486 -0.0588 136 ILE A C   
982  O O   . ILE A 65  ? 0.6749 0.6964 0.5946 0.0763  -0.0482 -0.0521 136 ILE A O   
983  C CB  . ILE A 65  ? 0.8099 0.8500 0.7326 0.0875  -0.0614 -0.0858 136 ILE A CB  
984  C CG1 . ILE A 65  ? 0.8634 0.8876 0.8100 0.0869  -0.0650 -0.0861 136 ILE A CG1 
985  C CG2 . ILE A 65  ? 0.7963 0.8367 0.7073 0.0857  -0.0650 -0.0794 136 ILE A CG2 
986  C CD1 . ILE A 65  ? 0.9077 0.9299 0.8690 0.0897  -0.0740 -0.0993 136 ILE A CD1 
998  N N   . GLN A 66  ? 0.6500 0.6909 0.5402 0.0768  -0.0457 -0.0516 137 GLN A N   
999  C CA  . GLN A 66  ? 0.6396 0.6724 0.5259 0.0715  -0.0418 -0.0366 137 GLN A CA  
1000 C C   . GLN A 66  ? 0.6407 0.6709 0.5327 0.0687  -0.0351 -0.0318 137 GLN A C   
1001 O O   . GLN A 66  ? 0.6137 0.6326 0.5136 0.0659  -0.0344 -0.0247 137 GLN A O   
1002 C CB  . GLN A 66  ? 0.6855 0.7254 0.5521 0.0700  -0.0395 -0.0291 137 GLN A CB  
1003 C CG  . GLN A 66  ? 0.7346 0.7733 0.5953 0.0719  -0.0473 -0.0284 137 GLN A CG  
1004 C CD  . GLN A 66  ? 0.8088 0.8525 0.6490 0.0704  -0.0451 -0.0179 137 GLN A CD  
1005 O OE1 . GLN A 66  ? 0.8392 0.8933 0.6658 0.0695  -0.0384 -0.0167 137 GLN A OE1 
1006 N NE2 . GLN A 66  ? 0.8401 0.8764 0.6790 0.0701  -0.0504 -0.0098 137 GLN A NE2 
1015 N N   . PHE A 67  ? 0.6534 0.6952 0.5418 0.0698  -0.0304 -0.0367 138 PHE A N   
1016 C CA  . PHE A 67  ? 0.6562 0.6982 0.5509 0.0677  -0.0250 -0.0338 138 PHE A CA  
1017 C C   . PHE A 67  ? 0.6231 0.6548 0.5340 0.0699  -0.0291 -0.0366 138 PHE A C   
1018 O O   . PHE A 67  ? 0.5855 0.6098 0.5009 0.0672  -0.0274 -0.0295 138 PHE A O   
1019 C CB  . PHE A 67  ? 0.7019 0.7608 0.5925 0.0691  -0.0196 -0.0409 138 PHE A CB  
1020 C CG  . PHE A 67  ? 0.7108 0.7727 0.6115 0.0683  -0.0156 -0.0411 138 PHE A CG  
1021 C CD1 . PHE A 67  ? 0.7016 0.7631 0.6000 0.0626  -0.0100 -0.0314 138 PHE A CD1 
1022 C CD2 . PHE A 67  ? 0.7112 0.7763 0.6253 0.0735  -0.0183 -0.0518 138 PHE A CD2 
1023 C CE1 . PHE A 67  ? 0.7000 0.7656 0.6090 0.0620  -0.0075 -0.0328 138 PHE A CE1 
1024 C CE2 . PHE A 67  ? 0.7085 0.7772 0.6329 0.0736  -0.0161 -0.0523 138 PHE A CE2 
1025 C CZ  . PHE A 67  ? 0.7015 0.7712 0.6229 0.0678  -0.0109 -0.0432 138 PHE A CZ  
1035 N N   . GLU A 68  ? 0.6356 0.6666 0.5555 0.0748  -0.0345 -0.0470 139 GLU A N   
1036 C CA  . GLU A 68  ? 0.7053 0.7250 0.6410 0.0769  -0.0383 -0.0483 139 GLU A CA  
1037 C C   . GLU A 68  ? 0.6676 0.6721 0.6065 0.0733  -0.0398 -0.0385 139 GLU A C   
1038 O O   . GLU A 68  ? 0.6707 0.6659 0.6158 0.0724  -0.0394 -0.0328 139 GLU A O   
1039 C CB  . GLU A 68  ? 0.8187 0.8398 0.7656 0.0827  -0.0439 -0.0620 139 GLU A CB  
1040 C CG  . GLU A 68  ? 0.9281 0.9653 0.8745 0.0871  -0.0421 -0.0741 139 GLU A CG  
1041 C CD  . GLU A 68  ? 0.9913 1.0291 0.9489 0.0897  -0.0411 -0.0752 139 GLU A CD  
1042 O OE1 . GLU A 68  ? 1.0502 1.0740 1.0167 0.0894  -0.0439 -0.0682 139 GLU A OE1 
1043 O OE2 . GLU A 68  ? 0.9693 1.0221 0.9271 0.0923  -0.0376 -0.0831 139 GLU A OE2 
1050 N N   . SER A 69  ? 0.6591 0.6617 0.5936 0.0715  -0.0415 -0.0368 140 SER A N   
1051 C CA  . SER A 69  ? 0.6477 0.6380 0.5870 0.0680  -0.0419 -0.0286 140 SER A CA  
1052 C C   . SER A 69  ? 0.5632 0.5510 0.4953 0.0636  -0.0362 -0.0177 140 SER A C   
1053 O O   . SER A 69  ? 0.5348 0.5131 0.4719 0.0615  -0.0348 -0.0118 140 SER A O   
1054 C CB  . SER A 69  ? 0.7147 0.7057 0.6530 0.0677  -0.0457 -0.0304 140 SER A CB  
1055 O OG  . SER A 69  ? 0.7982 0.7912 0.7453 0.0716  -0.0517 -0.0420 140 SER A OG  
1061 N N   . ALA A 70  ? 0.5789 0.5749 0.4992 0.0619  -0.0328 -0.0149 141 ALA A N   
1062 C CA  . ALA A 70  ? 0.5969 0.5908 0.5128 0.0576  -0.0278 -0.0062 141 ALA A CA  
1063 C C   . ALA A 70  ? 0.5863 0.5786 0.5067 0.0578  -0.0262 -0.0058 141 ALA A C   
1064 O O   . ALA A 70  ? 0.5821 0.5679 0.5028 0.0550  -0.0242 0.0001  141 ALA A O   
1065 C CB  . ALA A 70  ? 0.6119 0.6153 0.5167 0.0558  -0.0241 -0.0039 141 ALA A CB  
1071 N N   . TRP A 71  ? 0.5977 0.5963 0.5218 0.0617  -0.0276 -0.0128 142 TRP A N   
1072 C CA  . TRP A 71  ? 0.5909 0.5888 0.5198 0.0629  -0.0277 -0.0125 142 TRP A CA  
1073 C C   . TRP A 71  ? 0.5760 0.5603 0.5113 0.0640  -0.0310 -0.0091 142 TRP A C   
1074 O O   . TRP A 71  ? 0.5845 0.5636 0.5181 0.0623  -0.0300 -0.0031 142 TRP A O   
1075 C CB  . TRP A 71  ? 0.6383 0.6473 0.5719 0.0674  -0.0287 -0.0216 142 TRP A CB  
1076 C CG  . TRP A 71  ? 0.6839 0.6947 0.6241 0.0700  -0.0302 -0.0226 142 TRP A CG  
1077 C CD1 . TRP A 71  ? 0.7076 0.7092 0.6488 0.0696  -0.0322 -0.0162 142 TRP A CD1 
1078 C CD2 . TRP A 71  ? 0.7259 0.7496 0.6727 0.0738  -0.0302 -0.0309 142 TRP A CD2 
1079 N NE1 . TRP A 71  ? 0.7175 0.7248 0.6651 0.0733  -0.0348 -0.0194 142 TRP A NE1 
1080 C CE2 . TRP A 71  ? 0.7274 0.7484 0.6803 0.0759  -0.0336 -0.0289 142 TRP A CE2 
1081 C CE3 . TRP A 71  ? 0.7699 0.8081 0.7179 0.0757  -0.0276 -0.0402 142 TRP A CE3 
1082 C CZ2 . TRP A 71  ? 0.7474 0.7795 0.7102 0.0803  -0.0352 -0.0361 142 TRP A CZ2 
1083 C CZ3 . TRP A 71  ? 0.7955 0.8454 0.7535 0.0797  -0.0277 -0.0480 142 TRP A CZ3 
1084 C CH2 . TRP A 71  ? 0.7830 0.8297 0.7495 0.0820  -0.0319 -0.0461 142 TRP A CH2 
1095 N N   . ALA A 72  ? 0.5623 0.5410 0.5048 0.0662  -0.0346 -0.0127 143 ALA A N   
1096 C CA  . ALA A 72  ? 0.5772 0.5423 0.5270 0.0661  -0.0364 -0.0081 143 ALA A CA  
1097 C C   . ALA A 72  ? 0.5939 0.5525 0.5383 0.0610  -0.0323 0.0008  143 ALA A C   
1098 O O   . ALA A 72  ? 0.6417 0.5927 0.5852 0.0600  -0.0311 0.0073  143 ALA A O   
1099 C CB  . ALA A 72  ? 0.5763 0.5370 0.5371 0.0680  -0.0403 -0.0142 143 ALA A CB  
1105 N N   . LEU A 73  ? 0.5715 0.5334 0.5119 0.0580  -0.0302 0.0012  144 LEU A N   
1106 C CA  . LEU A 73  ? 0.5430 0.4993 0.4815 0.0537  -0.0264 0.0078  144 LEU A CA  
1107 C C   . LEU A 73  ? 0.5379 0.4964 0.4676 0.0515  -0.0227 0.0122  144 LEU A C   
1108 O O   . LEU A 73  ? 0.4969 0.4497 0.4249 0.0490  -0.0196 0.0171  144 LEU A O   
1109 C CB  . LEU A 73  ? 0.5524 0.5113 0.4916 0.0524  -0.0269 0.0064  144 LEU A CB  
1110 C CG  . LEU A 73  ? 0.5785 0.5347 0.5285 0.0538  -0.0310 0.0017  144 LEU A CG  
1111 C CD1 . LEU A 73  ? 0.5837 0.5448 0.5321 0.0536  -0.0332 0.0001  144 LEU A CD1 
1112 C CD2 . LEU A 73  ? 0.5818 0.5282 0.5424 0.0514  -0.0291 0.0052  144 LEU A CD2 
1124 N N   . THR A 74  ? 0.5556 0.5230 0.4804 0.0521  -0.0225 0.0097  145 THR A N   
1125 C CA  . THR A 74  ? 0.5788 0.5490 0.4984 0.0502  -0.0201 0.0120  145 THR A CA  
1126 C C   . THR A 74  ? 0.5691 0.5342 0.4882 0.0519  -0.0216 0.0144  145 THR A C   
1127 O O   . THR A 74  ? 0.5633 0.5260 0.4773 0.0497  -0.0195 0.0178  145 THR A O   
1128 C CB  . THR A 74  ? 0.5883 0.5700 0.5067 0.0510  -0.0200 0.0080  145 THR A CB  
1129 O OG1 . THR A 74  ? 0.5909 0.5763 0.5065 0.0485  -0.0176 0.0084  145 THR A OG1 
1130 C CG2 . THR A 74  ? 0.5937 0.5797 0.5104 0.0495  -0.0188 0.0084  145 THR A CG2 
1138 N N   . ASN A 75  ? 0.5893 0.5523 0.5133 0.0561  -0.0257 0.0126  146 ASN A N   
1139 C CA  . ASN A 75  ? 0.6323 0.5900 0.5548 0.0585  -0.0282 0.0163  146 ASN A CA  
1140 C C   . ASN A 75  ? 0.6458 0.5917 0.5668 0.0564  -0.0259 0.0234  146 ASN A C   
1141 O O   . ASN A 75  ? 0.6631 0.6052 0.5766 0.0563  -0.0255 0.0288  146 ASN A O   
1142 C CB  . ASN A 75  ? 0.6802 0.6391 0.6106 0.0643  -0.0337 0.0121  146 ASN A CB  
1143 C CG  . ASN A 75  ? 0.7249 0.6969 0.6559 0.0665  -0.0353 0.0062  146 ASN A CG  
1144 O OD1 . ASN A 75  ? 0.6961 0.6761 0.6227 0.0630  -0.0318 0.0051  146 ASN A OD1 
1145 N ND2 . ASN A 75  ? 0.7866 0.7607 0.7252 0.0722  -0.0405 0.0023  146 ASN A ND2 
1152 N N   . ILE A 76  ? 0.6233 0.5646 0.5510 0.0545  -0.0241 0.0231  147 ILE A N   
1153 C CA  . ILE A 76  ? 0.6063 0.5385 0.5344 0.0513  -0.0199 0.0294  147 ILE A CA  
1154 C C   . ILE A 76  ? 0.5726 0.5075 0.4922 0.0473  -0.0145 0.0314  147 ILE A C   
1155 O O   . ILE A 76  ? 0.5675 0.4983 0.4802 0.0457  -0.0110 0.0368  147 ILE A O   
1156 C CB  . ILE A 76  ? 0.6125 0.5409 0.5534 0.0502  -0.0199 0.0269  147 ILE A CB  
1157 C CG1 . ILE A 76  ? 0.6310 0.5554 0.5818 0.0542  -0.0255 0.0238  147 ILE A CG1 
1158 C CG2 . ILE A 76  ? 0.6139 0.5351 0.5577 0.0459  -0.0142 0.0327  147 ILE A CG2 
1159 C CD1 . ILE A 76  ? 0.6402 0.5655 0.6037 0.0542  -0.0279 0.0169  147 ILE A CD1 
1171 N N   . ALA A 77  ? 0.5570 0.4988 0.4766 0.0459  -0.0137 0.0271  148 ALA A N   
1172 C CA  . ALA A 77  ? 0.5748 0.5186 0.4896 0.0425  -0.0090 0.0278  148 ALA A CA  
1173 C C   . ALA A 77  ? 0.6032 0.5501 0.5076 0.0427  -0.0089 0.0283  148 ALA A C   
1174 O O   . ALA A 77  ? 0.6367 0.5840 0.5364 0.0401  -0.0049 0.0283  148 ALA A O   
1175 C CB  . ALA A 77  ? 0.5507 0.4996 0.4689 0.0413  -0.0090 0.0242  148 ALA A CB  
1181 N N   . SER A 78  ? 0.6193 0.5692 0.5212 0.0461  -0.0138 0.0275  149 SER A N   
1182 C CA  . SER A 78  ? 0.6458 0.5999 0.5391 0.0470  -0.0156 0.0271  149 SER A CA  
1183 C C   . SER A 78  ? 0.6725 0.6204 0.5561 0.0481  -0.0155 0.0331  149 SER A C   
1184 O O   . SER A 78  ? 0.6591 0.6108 0.5337 0.0496  -0.0182 0.0328  149 SER A O   
1185 C CB  . SER A 78  ? 0.6772 0.6383 0.5740 0.0507  -0.0214 0.0233  149 SER A CB  
1186 O OG  . SER A 78  ? 0.6954 0.6516 0.5925 0.0553  -0.0261 0.0265  149 SER A OG  
1192 N N   . GLY A 79  ? 0.7038 0.6428 0.5889 0.0473  -0.0124 0.0388  150 GLY A N   
1193 C CA  . GLY A 79  ? 0.7358 0.6685 0.6101 0.0479  -0.0113 0.0465  150 GLY A CA  
1194 C C   . GLY A 79  ? 0.7300 0.6630 0.5957 0.0437  -0.0035 0.0478  150 GLY A C   
1195 O O   . GLY A 79  ? 0.7685 0.7084 0.6328 0.0418  -0.0014 0.0414  150 GLY A O   
1199 N N   . THR A 80  ? 0.6742 0.5997 0.5354 0.0421  0.0016  0.0557  151 THR A N   
1200 C CA  . THR A 80  ? 0.6719 0.5987 0.5247 0.0382  0.0105  0.0567  151 THR A CA  
1201 C C   . THR A 80  ? 0.6318 0.5617 0.4985 0.0345  0.0162  0.0500  151 THR A C   
1202 O O   . THR A 80  ? 0.6010 0.5303 0.4829 0.0346  0.0136  0.0470  151 THR A O   
1203 C CB  . THR A 80  ? 0.7168 0.6348 0.5646 0.0365  0.0161  0.0678  151 THR A CB  
1204 O OG1 . THR A 80  ? 0.7372 0.6486 0.6041 0.0349  0.0173  0.0695  151 THR A OG1 
1205 C CG2 . THR A 80  ? 0.7383 0.6511 0.5715 0.0409  0.0097  0.0766  151 THR A CG2 
1213 N N   . SER A 81  ? 0.6728 0.6067 0.5341 0.0316  0.0237  0.0473  152 SER A N   
1214 C CA  . SER A 81  ? 0.7016 0.6378 0.5777 0.0285  0.0293  0.0415  152 SER A CA  
1215 C C   . SER A 81  ? 0.7281 0.6587 0.6195 0.0265  0.0324  0.0457  152 SER A C   
1216 O O   . SER A 81  ? 0.7139 0.6454 0.6217 0.0261  0.0309  0.0411  152 SER A O   
1217 C CB  . SER A 81  ? 0.7463 0.6877 0.6151 0.0260  0.0378  0.0376  152 SER A CB  
1218 O OG  . SER A 81  ? 0.7741 0.7210 0.6293 0.0279  0.0341  0.0326  152 SER A OG  
1224 N N   . GLU A 82  ? 0.7525 0.6771 0.6393 0.0253  0.0362  0.0545  153 GLU A N   
1225 C CA  . GLU A 82  ? 0.8277 0.7466 0.7319 0.0228  0.0390  0.0580  153 GLU A CA  
1226 C C   . GLU A 82  ? 0.7565 0.6726 0.6738 0.0257  0.0292  0.0552  153 GLU A C   
1227 O O   . GLU A 82  ? 0.7502 0.6663 0.6860 0.0244  0.0290  0.0516  153 GLU A O   
1228 C CB  . GLU A 82  ? 0.9905 0.9017 0.8867 0.0209  0.0441  0.0696  153 GLU A CB  
1229 C CG  . GLU A 82  ? 1.1309 1.0353 1.0472 0.0173  0.0477  0.0737  153 GLU A CG  
1230 C CD  . GLU A 82  ? 1.2666 1.1614 1.1749 0.0150  0.0532  0.0874  153 GLU A CD  
1231 O OE1 . GLU A 82  ? 1.3596 1.2522 1.2450 0.0175  0.0514  0.0942  153 GLU A OE1 
1232 O OE2 . GLU A 82  ? 1.2705 1.1596 1.1958 0.0105  0.0588  0.0916  153 GLU A OE2 
1239 N N   . GLN A 83  ? 0.7192 0.6344 0.6275 0.0300  0.0210  0.0558  154 GLN A N   
1240 C CA  . GLN A 83  ? 0.6706 0.5849 0.5897 0.0331  0.0124  0.0520  154 GLN A CA  
1241 C C   . GLN A 83  ? 0.6360 0.5581 0.5604 0.0338  0.0096  0.0434  154 GLN A C   
1242 O O   . GLN A 83  ? 0.6284 0.5510 0.5656 0.0345  0.0059  0.0393  154 GLN A O   
1243 C CB  . GLN A 83  ? 0.6951 0.6072 0.6043 0.0377  0.0053  0.0549  154 GLN A CB  
1244 C CG  . GLN A 83  ? 0.7394 0.6411 0.6454 0.0377  0.0065  0.0653  154 GLN A CG  
1245 C CD  . GLN A 83  ? 0.7668 0.6667 0.6593 0.0428  -0.0003 0.0696  154 GLN A CD  
1246 O OE1 . GLN A 83  ? 0.7917 0.6996 0.6734 0.0451  -0.0037 0.0655  154 GLN A OE1 
1247 N NE2 . GLN A 83  ? 0.7596 0.6487 0.6545 0.0445  -0.0027 0.0779  154 GLN A NE2 
1256 N N   . THR A 84  ? 0.6268 0.5548 0.5416 0.0336  0.0109  0.0405  155 THR A N   
1257 C CA  . THR A 84  ? 0.5953 0.5289 0.5158 0.0336  0.0091  0.0342  155 THR A CA  
1258 C C   . THR A 84  ? 0.5844 0.5176 0.5191 0.0313  0.0127  0.0322  155 THR A C   
1259 O O   . THR A 84  ? 0.5584 0.4936 0.5021 0.0323  0.0086  0.0287  155 THR A O   
1260 C CB  . THR A 84  ? 0.5827 0.5212 0.4932 0.0330  0.0106  0.0314  155 THR A CB  
1261 O OG1 . THR A 84  ? 0.5902 0.5298 0.4885 0.0352  0.0070  0.0330  155 THR A OG1 
1262 C CG2 . THR A 84  ? 0.5532 0.4957 0.4695 0.0331  0.0078  0.0266  155 THR A CG2 
1270 N N   . LYS A 85  ? 0.6071 0.5385 0.5441 0.0284  0.0202  0.0346  156 LYS A N   
1271 C CA  . LYS A 85  ? 0.6284 0.5610 0.5822 0.0262  0.0240  0.0318  156 LYS A CA  
1272 C C   . LYS A 85  ? 0.6062 0.5362 0.5747 0.0269  0.0191  0.0314  156 LYS A C   
1273 O O   . LYS A 85  ? 0.6002 0.5331 0.5823 0.0275  0.0161  0.0268  156 LYS A O   
1274 C CB  . LYS A 85  ? 0.7030 0.6355 0.6568 0.0225  0.0346  0.0342  156 LYS A CB  
1275 C CG  . LYS A 85  ? 0.8164 0.7529 0.7891 0.0205  0.0393  0.0293  156 LYS A CG  
1276 C CD  . LYS A 85  ? 0.9760 0.9124 0.9553 0.0160  0.0502  0.0325  156 LYS A CD  
1277 C CE  . LYS A 85  ? 1.0989 1.0414 1.1003 0.0144  0.0550  0.0259  156 LYS A CE  
1278 N NZ  . LYS A 85  ? 1.1754 1.1182 1.1902 0.0094  0.0647  0.0288  156 LYS A NZ  
1292 N N   . ALA A 86  ? 0.5957 0.5202 0.5626 0.0273  0.0172  0.0356  157 ALA A N   
1293 C CA  . ALA A 86  ? 0.5955 0.5178 0.5780 0.0281  0.0119  0.0331  157 ALA A CA  
1294 C C   . ALA A 86  ? 0.6155 0.5427 0.5984 0.0320  0.0029  0.0269  157 ALA A C   
1295 O O   . ALA A 86  ? 0.6470 0.5764 0.6435 0.0327  -0.0015 0.0220  157 ALA A O   
1296 C CB  . ALA A 86  ? 0.5766 0.4909 0.5577 0.0285  0.0106  0.0382  157 ALA A CB  
1302 N N   . VAL A 87  ? 0.6109 0.5406 0.5787 0.0344  0.0002  0.0270  158 VAL A N   
1303 C CA  . VAL A 87  ? 0.5910 0.5260 0.5569 0.0374  -0.0066 0.0225  158 VAL A CA  
1304 C C   . VAL A 87  ? 0.5617 0.5003 0.5337 0.0369  -0.0067 0.0203  158 VAL A C   
1305 O O   . VAL A 87  ? 0.5325 0.4743 0.5095 0.0390  -0.0127 0.0169  158 VAL A O   
1306 C CB  . VAL A 87  ? 0.5998 0.5375 0.5505 0.0391  -0.0079 0.0235  158 VAL A CB  
1307 C CG1 . VAL A 87  ? 0.5713 0.5150 0.5186 0.0410  -0.0123 0.0204  158 VAL A CG1 
1308 C CG2 . VAL A 87  ? 0.6243 0.5590 0.5720 0.0412  -0.0103 0.0246  158 VAL A CG2 
1318 N N   . VAL A 88  ? 0.5733 0.5118 0.5450 0.0345  -0.0005 0.0218  159 VAL A N   
1319 C CA  . VAL A 88  ? 0.5765 0.5175 0.5564 0.0344  -0.0006 0.0196  159 VAL A CA  
1320 C C   . VAL A 88  ? 0.5874 0.5291 0.5861 0.0342  -0.0017 0.0167  159 VAL A C   
1321 O O   . VAL A 88  ? 0.5713 0.5158 0.5783 0.0364  -0.0074 0.0141  159 VAL A O   
1322 C CB  . VAL A 88  ? 0.5823 0.5232 0.5588 0.0322  0.0068  0.0200  159 VAL A CB  
1323 C CG1 . VAL A 88  ? 0.5581 0.5008 0.5470 0.0327  0.0067  0.0171  159 VAL A CG1 
1324 C CG2 . VAL A 88  ? 0.6086 0.5499 0.5690 0.0324  0.0066  0.0214  159 VAL A CG2 
1334 N N   . ASP A 89  ? 0.6199 0.5594 0.6265 0.0313  0.0039  0.0175  160 ASP A N   
1335 C CA  . ASP A 89  ? 0.6914 0.6325 0.7194 0.0302  0.0035  0.0141  160 ASP A CA  
1336 C C   . ASP A 89  ? 0.6548 0.5969 0.6886 0.0332  -0.0068 0.0102  160 ASP A C   
1337 O O   . ASP A 89  ? 0.6498 0.5955 0.7010 0.0340  -0.0112 0.0053  160 ASP A O   
1338 C CB  . ASP A 89  ? 0.8337 0.7715 0.8681 0.0255  0.0129  0.0171  160 ASP A CB  
1339 C CG  . ASP A 89  ? 1.0059 0.9458 1.0384 0.0225  0.0239  0.0185  160 ASP A CG  
1340 O OD1 . ASP A 89  ? 1.0677 1.0099 1.0912 0.0243  0.0239  0.0172  160 ASP A OD1 
1341 O OD2 . ASP A 89  ? 1.0939 1.0333 1.1344 0.0183  0.0331  0.0206  160 ASP A OD2 
1346 N N   . GLY A 90  ? 0.6094 0.5495 0.6294 0.0353  -0.0110 0.0112  161 GLY A N   
1347 C CA  . GLY A 90  ? 0.5604 0.5029 0.5825 0.0387  -0.0205 0.0062  161 GLY A CA  
1348 C C   . GLY A 90  ? 0.5383 0.4865 0.5538 0.0425  -0.0278 0.0040  161 GLY A C   
1349 O O   . GLY A 90  ? 0.5217 0.4734 0.5352 0.0458  -0.0357 -0.0006 161 GLY A O   
1353 N N   . GLY A 91  ? 0.5469 0.4961 0.5589 0.0423  -0.0255 0.0072  162 GLY A N   
1354 C CA  . GLY A 91  ? 0.5546 0.5075 0.5607 0.0458  -0.0323 0.0074  162 GLY A CA  
1355 C C   . GLY A 91  ? 0.5709 0.5247 0.5565 0.0470  -0.0331 0.0108  162 GLY A C   
1356 O O   . GLY A 91  ? 0.5821 0.5391 0.5602 0.0499  -0.0390 0.0118  162 GLY A O   
1360 N N   . ALA A 92  ? 0.5887 0.5402 0.5650 0.0450  -0.0273 0.0130  163 ALA A N   
1361 C CA  . ALA A 92  ? 0.6144 0.5687 0.5746 0.0461  -0.0280 0.0146  163 ALA A CA  
1362 C C   . ALA A 92  ? 0.5838 0.5386 0.5357 0.0455  -0.0271 0.0194  163 ALA A C   
1363 O O   . ALA A 92  ? 0.5954 0.5541 0.5360 0.0467  -0.0291 0.0208  163 ALA A O   
1364 C CB  . ALA A 92  ? 0.6477 0.5998 0.6027 0.0445  -0.0232 0.0152  163 ALA A CB  
1370 N N   . ILE A 93  ? 0.5577 0.5087 0.5159 0.0436  -0.0235 0.0218  164 ILE A N   
1371 C CA  . ILE A 93  ? 0.5752 0.5248 0.5276 0.0426  -0.0220 0.0263  164 ILE A CA  
1372 C C   . ILE A 93  ? 0.5878 0.5390 0.5358 0.0452  -0.0284 0.0298  164 ILE A C   
1373 O O   . ILE A 93  ? 0.5598 0.5129 0.4960 0.0445  -0.0279 0.0337  164 ILE A O   
1374 C CB  . ILE A 93  ? 0.5639 0.5091 0.5263 0.0406  -0.0173 0.0262  164 ILE A CB  
1375 C CG1 . ILE A 93  ? 0.5462 0.4907 0.5065 0.0378  -0.0105 0.0240  164 ILE A CG1 
1376 C CG2 . ILE A 93  ? 0.5856 0.5278 0.5461 0.0398  -0.0171 0.0304  164 ILE A CG2 
1377 C CD1 . ILE A 93  ? 0.5507 0.4928 0.5194 0.0361  -0.0050 0.0220  164 ILE A CD1 
1389 N N   . PRO A 94  ? 0.6438 0.5949 0.6006 0.0481  -0.0345 0.0290  165 PRO A N   
1390 C CA  . PRO A 94  ? 0.6440 0.5970 0.5931 0.0514  -0.0418 0.0332  165 PRO A CA  
1391 C C   . PRO A 94  ? 0.5994 0.5591 0.5324 0.0526  -0.0438 0.0324  165 PRO A C   
1392 O O   . PRO A 94  ? 0.6094 0.5710 0.5291 0.0532  -0.0453 0.0384  165 PRO A O   
1393 C CB  . PRO A 94  ? 0.6900 0.6441 0.6532 0.0550  -0.0493 0.0294  165 PRO A CB  
1394 C CG  . PRO A 94  ? 0.7216 0.6732 0.7022 0.0527  -0.0440 0.0249  165 PRO A CG  
1395 C CD  . PRO A 94  ? 0.6994 0.6497 0.6735 0.0487  -0.0350 0.0241  165 PRO A CD  
1403 N N   . ALA A 95  ? 0.5754 0.5389 0.5099 0.0529  -0.0435 0.0251  166 ALA A N   
1404 C CA  . ALA A 95  ? 0.5993 0.5703 0.5209 0.0548  -0.0457 0.0219  166 ALA A CA  
1405 C C   . ALA A 95  ? 0.6372 0.6102 0.5464 0.0521  -0.0389 0.0259  166 ALA A C   
1406 O O   . ALA A 95  ? 0.6870 0.6661 0.5823 0.0530  -0.0395 0.0281  166 ALA A O   
1407 C CB  . ALA A 95  ? 0.5845 0.5574 0.5143 0.0559  -0.0470 0.0127  166 ALA A CB  
1413 N N   . PHE A 96  ? 0.6405 0.6094 0.5547 0.0486  -0.0323 0.0269  167 PHE A N   
1414 C CA  . PHE A 96  ? 0.6251 0.5968 0.5308 0.0457  -0.0265 0.0299  167 PHE A CA  
1415 C C   . PHE A 96  ? 0.6283 0.5981 0.5283 0.0438  -0.0254 0.0386  167 PHE A C   
1416 O O   . PHE A 96  ? 0.6231 0.5984 0.5124 0.0425  -0.0227 0.0418  167 PHE A O   
1417 C CB  . PHE A 96  ? 0.6085 0.5765 0.5209 0.0428  -0.0213 0.0285  167 PHE A CB  
1418 C CG  . PHE A 96  ? 0.5900 0.5602 0.5046 0.0444  -0.0215 0.0223  167 PHE A CG  
1419 C CD1 . PHE A 96  ? 0.6136 0.5914 0.5223 0.0462  -0.0220 0.0184  167 PHE A CD1 
1420 C CD2 . PHE A 96  ? 0.5674 0.5319 0.4907 0.0441  -0.0208 0.0206  167 PHE A CD2 
1421 C CE1 . PHE A 96  ? 0.6160 0.5943 0.5289 0.0483  -0.0230 0.0129  167 PHE A CE1 
1422 C CE2 . PHE A 96  ? 0.5667 0.5312 0.4922 0.0455  -0.0213 0.0167  167 PHE A CE2 
1423 C CZ  . PHE A 96  ? 0.5906 0.5613 0.5117 0.0479  -0.0230 0.0128  167 PHE A CZ  
1433 N N   . ILE A 97  ? 0.5900 0.5521 0.4981 0.0436  -0.0271 0.0425  168 ILE A N   
1434 C CA  . ILE A 97  ? 0.5772 0.5350 0.4817 0.0422  -0.0269 0.0518  168 ILE A CA  
1435 C C   . ILE A 97  ? 0.6055 0.5689 0.4950 0.0447  -0.0310 0.0565  168 ILE A C   
1436 O O   . ILE A 97  ? 0.5884 0.5527 0.4680 0.0422  -0.0274 0.0641  168 ILE A O   
1437 C CB  . ILE A 97  ? 0.5722 0.5209 0.4903 0.0431  -0.0297 0.0540  168 ILE A CB  
1438 C CG1 . ILE A 97  ? 0.5802 0.5245 0.5096 0.0396  -0.0235 0.0502  168 ILE A CG1 
1439 C CG2 . ILE A 97  ? 0.5578 0.5008 0.4726 0.0432  -0.0321 0.0647  168 ILE A CG2 
1440 C CD1 . ILE A 97  ? 0.5909 0.5283 0.5359 0.0408  -0.0251 0.0490  168 ILE A CD1 
1452 N N   . SER A 98  ? 0.6396 0.6072 0.5268 0.0496  -0.0383 0.0516  169 SER A N   
1453 C CA  . SER A 98  ? 0.7000 0.6748 0.5701 0.0527  -0.0428 0.0543  169 SER A CA  
1454 C C   . SER A 98  ? 0.7287 0.7131 0.5851 0.0505  -0.0362 0.0530  169 SER A C   
1455 O O   . SER A 98  ? 0.8150 0.8038 0.6552 0.0503  -0.0349 0.0600  169 SER A O   
1456 C CB  . SER A 98  ? 0.7276 0.7071 0.6000 0.0581  -0.0520 0.0455  169 SER A CB  
1457 O OG  . SER A 98  ? 0.7631 0.7356 0.6507 0.0600  -0.0577 0.0458  169 SER A OG  
1463 N N   . LEU A 99  ? 0.6668 0.6549 0.5295 0.0493  -0.0318 0.0443  170 LEU A N   
1464 C CA  . LEU A 99  ? 0.6271 0.6259 0.4802 0.0480  -0.0259 0.0412  170 LEU A CA  
1465 C C   . LEU A 99  ? 0.6451 0.6436 0.4958 0.0422  -0.0172 0.0493  170 LEU A C   
1466 O O   . LEU A 99  ? 0.6249 0.6337 0.4674 0.0407  -0.0115 0.0483  170 LEU A O   
1467 C CB  . LEU A 99  ? 0.6162 0.6182 0.4789 0.0491  -0.0249 0.0298  170 LEU A CB  
1468 C CG  . LEU A 99  ? 0.6606 0.6651 0.5261 0.0543  -0.0324 0.0201  170 LEU A CG  
1469 C CD1 . LEU A 99  ? 0.6720 0.6761 0.5491 0.0548  -0.0310 0.0115  170 LEU A CD1 
1470 C CD2 . LEU A 99  ? 0.6918 0.7077 0.5422 0.0578  -0.0349 0.0161  170 LEU A CD2 
1482 N N   . LEU A 100 ? 0.6701 0.6579 0.5301 0.0388  -0.0157 0.0562  171 LEU A N   
1483 C CA  . LEU A 100 ? 0.7209 0.7079 0.5813 0.0328  -0.0078 0.0636  171 LEU A CA  
1484 C C   . LEU A 100 ? 0.7934 0.7854 0.6374 0.0315  -0.0050 0.0731  171 LEU A C   
1485 O O   . LEU A 100 ? 0.8734 0.8696 0.7162 0.0261  0.0034  0.0774  171 LEU A O   
1486 C CB  . LEU A 100 ? 0.6826 0.6563 0.5561 0.0301  -0.0081 0.0688  171 LEU A CB  
1487 C CG  . LEU A 100 ? 0.6269 0.5967 0.5151 0.0299  -0.0082 0.0603  171 LEU A CG  
1488 C CD1 . LEU A 100 ? 0.6087 0.5663 0.5089 0.0278  -0.0083 0.0645  171 LEU A CD1 
1489 C CD2 . LEU A 100 ? 0.5961 0.5735 0.4868 0.0269  -0.0024 0.0544  171 LEU A CD2 
1501 N N   . ALA A 101 ? 0.7272 0.7195 0.5585 0.0361  -0.0117 0.0766  172 ALA A N   
1502 C CA  . ALA A 101 ? 0.7639 0.7609 0.5756 0.0355  -0.0096 0.0870  172 ALA A CA  
1503 C C   . ALA A 101 ? 0.8223 0.8361 0.6181 0.0383  -0.0080 0.0790  172 ALA A C   
1504 O O   . ALA A 101 ? 0.8656 0.8859 0.6414 0.0387  -0.0066 0.0863  172 ALA A O   
1505 C CB  . ALA A 101 ? 0.7705 0.7583 0.5758 0.0396  -0.0191 0.0964  172 ALA A CB  
1511 N N   . SER A 102 ? 0.8340 0.8551 0.6382 0.0404  -0.0080 0.0643  173 SER A N   
1512 C CA  . SER A 102 ? 0.8409 0.8777 0.6332 0.0438  -0.0071 0.0543  173 SER A CA  
1513 C C   . SER A 102 ? 0.9012 0.9496 0.6818 0.0390  0.0045  0.0595  173 SER A C   
1514 O O   . SER A 102 ? 0.8454 0.8921 0.6365 0.0328  0.0128  0.0637  173 SER A O   
1515 C CB  . SER A 102 ? 0.7606 0.8012 0.5680 0.0463  -0.0082 0.0387  173 SER A CB  
1516 O OG  . SER A 102 ? 0.7304 0.7866 0.5290 0.0498  -0.0069 0.0276  173 SER A OG  
1522 N N   . PRO A 103 ? 1.0183 1.0796 0.7778 0.0417  0.0056  0.0585  174 PRO A N   
1523 C CA  . PRO A 103 ? 1.0844 1.1598 0.8336 0.0370  0.0185  0.0613  174 PRO A CA  
1524 C C   . PRO A 103 ? 1.0730 1.1598 0.8378 0.0359  0.0252  0.0472  174 PRO A C   
1525 O O   . PRO A 103 ? 1.1270 1.2243 0.8917 0.0305  0.0372  0.0495  174 PRO A O   
1526 C CB  . PRO A 103 ? 1.1230 1.2107 0.8451 0.0418  0.0163  0.0600  174 PRO A CB  
1527 C CG  . PRO A 103 ? 1.1008 1.1862 0.8270 0.0499  0.0026  0.0467  174 PRO A CG  
1528 C CD  . PRO A 103 ? 1.0581 1.1242 0.8039 0.0493  -0.0046 0.0515  174 PRO A CD  
1536 N N   . HIS A 104 ? 0.9885 1.0737 0.7677 0.0410  0.0179  0.0331  175 HIS A N   
1537 C CA  . HIS A 104 ? 0.9096 1.0037 0.7053 0.0413  0.0221  0.0200  175 HIS A CA  
1538 C C   . HIS A 104 ? 0.8270 0.9105 0.6426 0.0362  0.0242  0.0246  175 HIS A C   
1539 O O   . HIS A 104 ? 0.8139 0.8835 0.6399 0.0377  0.0166  0.0247  175 HIS A O   
1540 C CB  . HIS A 104 ? 0.9354 1.0302 0.7374 0.0491  0.0127  0.0044  175 HIS A CB  
1541 C CG  . HIS A 104 ? 1.0147 1.1175 0.7985 0.0547  0.0078  -0.0014 175 HIS A CG  
1542 N ND1 . HIS A 104 ? 1.0627 1.1558 0.8397 0.0581  -0.0028 0.0015  175 HIS A ND1 
1543 C CD2 . HIS A 104 ? 1.0445 1.1654 0.8163 0.0579  0.0115  -0.0116 175 HIS A CD2 
1544 C CE1 . HIS A 104 ? 1.1000 1.2046 0.8609 0.0632  -0.0063 -0.0065 175 HIS A CE1 
1545 N NE2 . HIS A 104 ? 1.0889 1.2104 0.8454 0.0632  0.0026  -0.0147 175 HIS A NE2 
1553 N N   . ALA A 105 ? 0.7898 0.8812 0.6115 0.0301  0.0346  0.0275  176 ALA A N   
1554 C CA  . ALA A 105 ? 0.7266 0.8090 0.5665 0.0249  0.0362  0.0314  176 ALA A CA  
1555 C C   . ALA A 105 ? 0.7012 0.7787 0.5573 0.0293  0.0288  0.0207  176 ALA A C   
1556 O O   . ALA A 105 ? 0.6833 0.7474 0.5488 0.0278  0.0248  0.0243  176 ALA A O   
1557 C CB  . ALA A 105 ? 0.6977 0.7927 0.5451 0.0181  0.0482  0.0326  176 ALA A CB  
1563 N N   . HIS A 106 ? 0.7108 0.7987 0.5703 0.0349  0.0270  0.0075  177 HIS A N   
1564 C CA  . HIS A 106 ? 0.6800 0.7628 0.5550 0.0389  0.0203  -0.0011 177 HIS A CA  
1565 C C   . HIS A 106 ? 0.6684 0.7353 0.5419 0.0426  0.0107  0.0004  177 HIS A C   
1566 O O   . HIS A 106 ? 0.6348 0.6926 0.5192 0.0437  0.0061  -0.0010 177 HIS A O   
1567 C CB  . HIS A 106 ? 0.6990 0.7960 0.5801 0.0445  0.0205  -0.0153 177 HIS A CB  
1568 C CG  . HIS A 106 ? 0.7660 0.8690 0.6347 0.0497  0.0182  -0.0217 177 HIS A CG  
1569 N ND1 . HIS A 106 ? 0.8084 0.9215 0.6597 0.0478  0.0244  -0.0184 177 HIS A ND1 
1570 C CD2 . HIS A 106 ? 0.8185 0.9189 0.6897 0.0567  0.0102  -0.0317 177 HIS A CD2 
1571 C CE1 . HIS A 106 ? 0.8435 0.9609 0.6860 0.0539  0.0197  -0.0271 177 HIS A CE1 
1572 N NE2 . HIS A 106 ? 0.8510 0.9606 0.7070 0.0592  0.0110  -0.0358 177 HIS A NE2 
1580 N N   . ILE A 107 ? 0.7066 0.7709 0.5670 0.0447  0.0074  0.0029  178 ILE A N   
1581 C CA  . ILE A 107 ? 0.7018 0.7516 0.5635 0.0471  -0.0010 0.0051  178 ILE A CA  
1582 C C   . ILE A 107 ? 0.6470 0.6844 0.5111 0.0421  -0.0002 0.0165  178 ILE A C   
1583 O O   . ILE A 107 ? 0.6289 0.6553 0.5022 0.0423  -0.0040 0.0169  178 ILE A O   
1584 C CB  . ILE A 107 ? 0.7727 0.8247 0.6213 0.0511  -0.0060 0.0034  178 ILE A CB  
1585 C CG1 . ILE A 107 ? 0.8341 0.8963 0.6845 0.0569  -0.0086 -0.0113 178 ILE A CG1 
1586 C CG2 . ILE A 107 ? 0.7592 0.7969 0.6108 0.0523  -0.0139 0.0075  178 ILE A CG2 
1587 C CD1 . ILE A 107 ? 0.8988 0.9667 0.7356 0.0612  -0.0135 -0.0159 178 ILE A CD1 
1599 N N   . SER A 108 ? 0.6380 0.6769 0.4942 0.0374  0.0053  0.0260  179 SER A N   
1600 C CA  . SER A 108 ? 0.6437 0.6704 0.5047 0.0328  0.0060  0.0360  179 SER A CA  
1601 C C   . SER A 108 ? 0.6391 0.6630 0.5153 0.0301  0.0079  0.0327  179 SER A C   
1602 O O   . SER A 108 ? 0.6196 0.6321 0.5030 0.0296  0.0047  0.0344  179 SER A O   
1603 C CB  . SER A 108 ? 0.7025 0.7314 0.5543 0.0277  0.0125  0.0472  179 SER A CB  
1604 O OG  . SER A 108 ? 0.7258 0.7426 0.5861 0.0230  0.0137  0.0556  179 SER A OG  
1610 N N   . GLU A 109 ? 0.6482 0.6835 0.5296 0.0289  0.0126  0.0270  180 GLU A N   
1611 C CA  . GLU A 109 ? 0.6395 0.6737 0.5344 0.0272  0.0128  0.0229  180 GLU A CA  
1612 C C   . GLU A 109 ? 0.5805 0.6068 0.4795 0.0320  0.0056  0.0179  180 GLU A C   
1613 O O   . GLU A 109 ? 0.5832 0.6018 0.4887 0.0306  0.0041  0.0186  180 GLU A O   
1614 C CB  . GLU A 109 ? 0.7224 0.7723 0.6238 0.0265  0.0176  0.0160  180 GLU A CB  
1615 C CG  . GLU A 109 ? 0.8184 0.8690 0.7337 0.0256  0.0162  0.0109  180 GLU A CG  
1616 C CD  . GLU A 109 ? 0.9320 0.9998 0.8570 0.0246  0.0208  0.0039  180 GLU A CD  
1617 O OE1 . GLU A 109 ? 0.9841 1.0632 0.9043 0.0244  0.0264  0.0029  180 GLU A OE1 
1618 O OE2 . GLU A 109 ? 0.9600 1.0308 0.8972 0.0244  0.0187  -0.0011 180 GLU A OE2 
1625 N N   . GLN A 110 ? 0.5617 0.5900 0.4574 0.0376  0.0014  0.0124  181 GLN A N   
1626 C CA  . GLN A 110 ? 0.5834 0.6035 0.4843 0.0415  -0.0045 0.0087  181 GLN A CA  
1627 C C   . GLN A 110 ? 0.5679 0.5748 0.4680 0.0405  -0.0071 0.0144  181 GLN A C   
1628 O O   . GLN A 110 ? 0.5608 0.5601 0.4661 0.0410  -0.0092 0.0142  181 GLN A O   
1629 C CB  . GLN A 110 ? 0.6329 0.6576 0.5335 0.0474  -0.0083 0.0009  181 GLN A CB  
1630 C CG  . GLN A 110 ? 0.6560 0.6728 0.5644 0.0511  -0.0136 -0.0026 181 GLN A CG  
1631 C CD  . GLN A 110 ? 0.6704 0.6894 0.5856 0.0512  -0.0133 -0.0042 181 GLN A CD  
1632 O OE1 . GLN A 110 ? 0.6775 0.7081 0.5963 0.0521  -0.0114 -0.0091 181 GLN A OE1 
1633 N NE2 . GLN A 110 ? 0.6678 0.6770 0.5850 0.0505  -0.0153 -0.0005 181 GLN A NE2 
1642 N N   . ALA A 111 ? 0.5777 0.5823 0.4714 0.0393  -0.0069 0.0199  182 ALA A N   
1643 C CA  . ALA A 111 ? 0.5841 0.5774 0.4800 0.0386  -0.0093 0.0248  182 ALA A CA  
1644 C C   . ALA A 111 ? 0.5714 0.5591 0.4729 0.0340  -0.0059 0.0286  182 ALA A C   
1645 O O   . ALA A 111 ? 0.5540 0.5334 0.4609 0.0339  -0.0072 0.0289  182 ALA A O   
1646 C CB  . ALA A 111 ? 0.6244 0.6171 0.5125 0.0393  -0.0114 0.0298  182 ALA A CB  
1652 N N   . VAL A 112 ? 0.5750 0.5676 0.4763 0.0300  -0.0012 0.0310  183 VAL A N   
1653 C CA  . VAL A 112 ? 0.5740 0.5625 0.4830 0.0256  0.0017  0.0323  183 VAL A CA  
1654 C C   . VAL A 112 ? 0.5465 0.5350 0.4602 0.0270  0.0000  0.0258  183 VAL A C   
1655 O O   . VAL A 112 ? 0.5352 0.5170 0.4532 0.0258  -0.0002 0.0252  183 VAL A O   
1656 C CB  . VAL A 112 ? 0.6236 0.6194 0.5343 0.0207  0.0073  0.0346  183 VAL A CB  
1657 C CG1 . VAL A 112 ? 0.6270 0.6197 0.5485 0.0161  0.0093  0.0332  183 VAL A CG1 
1658 C CG2 . VAL A 112 ? 0.6389 0.6327 0.5427 0.0189  0.0093  0.0437  183 VAL A CG2 
1668 N N   . TRP A 113 ? 0.5392 0.5356 0.4520 0.0299  -0.0012 0.0207  184 TRP A N   
1669 C CA  . TRP A 113 ? 0.5150 0.5111 0.4306 0.0320  -0.0038 0.0160  184 TRP A CA  
1670 C C   . TRP A 113 ? 0.5351 0.5212 0.4491 0.0344  -0.0065 0.0171  184 TRP A C   
1671 O O   . TRP A 113 ? 0.5171 0.4986 0.4319 0.0335  -0.0064 0.0167  184 TRP A O   
1672 C CB  . TRP A 113 ? 0.5373 0.5431 0.4538 0.0356  -0.0054 0.0108  184 TRP A CB  
1673 C CG  . TRP A 113 ? 0.5758 0.5828 0.4952 0.0384  -0.0090 0.0068  184 TRP A CG  
1674 C CD1 . TRP A 113 ? 0.6278 0.6268 0.5451 0.0394  -0.0116 0.0079  184 TRP A CD1 
1675 C CD2 . TRP A 113 ? 0.5881 0.6054 0.5125 0.0413  -0.0109 0.0013  184 TRP A CD2 
1676 N NE1 . TRP A 113 ? 0.6495 0.6523 0.5684 0.0429  -0.0156 0.0046  184 TRP A NE1 
1677 C CE2 . TRP A 113 ? 0.6221 0.6360 0.5467 0.0444  -0.0158 0.0001  184 TRP A CE2 
1678 C CE3 . TRP A 113 ? 0.5790 0.6090 0.5080 0.0418  -0.0086 -0.0030 184 TRP A CE3 
1679 C CZ2 . TRP A 113 ? 0.6089 0.6308 0.5392 0.0485  -0.0200 -0.0048 184 TRP A CZ2 
1680 C CZ3 . TRP A 113 ? 0.5843 0.6232 0.5209 0.0456  -0.0118 -0.0093 184 TRP A CZ3 
1681 C CH2 . TRP A 113 ? 0.5945 0.6289 0.5322 0.0492  -0.0181 -0.0100 184 TRP A CH2 
1692 N N   . ALA A 114 ? 0.5581 0.5416 0.4701 0.0372  -0.0086 0.0179  185 ALA A N   
1693 C CA  . ALA A 114 ? 0.5628 0.5376 0.4762 0.0387  -0.0103 0.0188  185 ALA A CA  
1694 C C   . ALA A 114 ? 0.5526 0.5210 0.4684 0.0357  -0.0079 0.0216  185 ALA A C   
1695 O O   . ALA A 114 ? 0.5429 0.5063 0.4600 0.0355  -0.0070 0.0213  185 ALA A O   
1696 C CB  . ALA A 114 ? 0.5778 0.5520 0.4915 0.0415  -0.0133 0.0182  185 ALA A CB  
1702 N N   . LEU A 115 ? 0.5367 0.5049 0.4535 0.0334  -0.0066 0.0244  186 LEU A N   
1703 C CA  . LEU A 115 ? 0.5345 0.4961 0.4563 0.0311  -0.0048 0.0261  186 LEU A CA  
1704 C C   . LEU A 115 ? 0.5619 0.5237 0.4851 0.0286  -0.0021 0.0231  186 LEU A C   
1705 O O   . LEU A 115 ? 0.5515 0.5088 0.4781 0.0279  -0.0005 0.0214  186 LEU A O   
1706 C CB  . LEU A 115 ? 0.5458 0.5057 0.4688 0.0296  -0.0048 0.0310  186 LEU A CB  
1707 C CG  . LEU A 115 ? 0.5774 0.5367 0.4982 0.0326  -0.0088 0.0340  186 LEU A CG  
1708 C CD1 . LEU A 115 ? 0.6192 0.5787 0.5363 0.0312  -0.0088 0.0406  186 LEU A CD1 
1709 C CD2 . LEU A 115 ? 0.5803 0.5334 0.5088 0.0344  -0.0109 0.0334  186 LEU A CD2 
1721 N N   . GLY A 116 ? 0.5805 0.5490 0.5020 0.0274  -0.0018 0.0211  187 GLY A N   
1722 C CA  . GLY A 116 ? 0.5938 0.5641 0.5164 0.0257  -0.0009 0.0167  187 GLY A CA  
1723 C C   . GLY A 116 ? 0.5609 0.5294 0.4783 0.0283  -0.0020 0.0146  187 GLY A C   
1724 O O   . GLY A 116 ? 0.5550 0.5218 0.4719 0.0272  -0.0005 0.0116  187 GLY A O   
1728 N N   . ASN A 117 ? 0.5452 0.5140 0.4585 0.0318  -0.0043 0.0162  188 ASN A N   
1729 C CA  . ASN A 117 ? 0.5398 0.5054 0.4478 0.0339  -0.0047 0.0164  188 ASN A CA  
1730 C C   . ASN A 117 ? 0.5530 0.5119 0.4628 0.0328  -0.0012 0.0178  188 ASN A C   
1731 O O   . ASN A 117 ? 0.5278 0.4850 0.4330 0.0325  0.0011  0.0173  188 ASN A O   
1732 C CB  . ASN A 117 ? 0.5693 0.5349 0.4757 0.0377  -0.0081 0.0181  188 ASN A CB  
1733 C CG  . ASN A 117 ? 0.5850 0.5576 0.4900 0.0398  -0.0117 0.0156  188 ASN A CG  
1734 O OD1 . ASN A 117 ? 0.6223 0.5997 0.5260 0.0385  -0.0121 0.0128  188 ASN A OD1 
1735 N ND2 . ASN A 117 ? 0.5606 0.5347 0.4676 0.0433  -0.0149 0.0155  188 ASN A ND2 
1742 N N   . ILE A 118 ? 0.5517 0.5079 0.4682 0.0324  -0.0008 0.0195  189 ILE A N   
1743 C CA  . ILE A 118 ? 0.5516 0.5028 0.4735 0.0317  0.0023  0.0199  189 ILE A CA  
1744 C C   . ILE A 118 ? 0.5624 0.5132 0.4867 0.0294  0.0058  0.0165  189 ILE A C   
1745 O O   . ILE A 118 ? 0.5488 0.4986 0.4722 0.0288  0.0098  0.0145  189 ILE A O   
1746 C CB  . ILE A 118 ? 0.5437 0.4931 0.4731 0.0327  0.0000  0.0218  189 ILE A CB  
1747 C CG1 . ILE A 118 ? 0.5500 0.4999 0.4784 0.0352  -0.0034 0.0228  189 ILE A CG1 
1748 C CG2 . ILE A 118 ? 0.5227 0.4686 0.4614 0.0320  0.0027  0.0210  189 ILE A CG2 
1749 C CD1 . ILE A 118 ? 0.5713 0.5217 0.5051 0.0368  -0.0073 0.0232  189 ILE A CD1 
1761 N N   . ALA A 119 ? 0.5716 0.5234 0.4995 0.0278  0.0048  0.0155  190 ALA A N   
1762 C CA  . ALA A 119 ? 0.5960 0.5466 0.5291 0.0256  0.0076  0.0110  190 ALA A CA  
1763 C C   . ALA A 119 ? 0.6087 0.5633 0.5338 0.0250  0.0089  0.0058  190 ALA A C   
1764 O O   . ALA A 119 ? 0.6261 0.5804 0.5529 0.0241  0.0122  0.0003  190 ALA A O   
1765 C CB  . ALA A 119 ? 0.5963 0.5461 0.5360 0.0234  0.0061  0.0121  190 ALA A CB  
1771 N N   . GLY A 120 ? 0.5946 0.5537 0.5110 0.0261  0.0059  0.0067  191 GLY A N   
1772 C CA  . GLY A 120 ? 0.6320 0.5956 0.5394 0.0264  0.0053  0.0022  191 GLY A CA  
1773 C C   . GLY A 120 ? 0.6693 0.6315 0.5671 0.0278  0.0084  0.0028  191 GLY A C   
1774 O O   . GLY A 120 ? 0.6698 0.6359 0.5574 0.0283  0.0080  -0.0008 191 GLY A O   
1778 N N   . ASP A 121 ? 0.7106 0.6679 0.6113 0.0282  0.0115  0.0074  192 ASP A N   
1779 C CA  . ASP A 121 ? 0.7303 0.6864 0.6230 0.0285  0.0162  0.0090  192 ASP A CA  
1780 C C   . ASP A 121 ? 0.7228 0.6810 0.6160 0.0268  0.0220  0.0020  192 ASP A C   
1781 O O   . ASP A 121 ? 0.7444 0.7049 0.6255 0.0269  0.0259  0.0015  192 ASP A O   
1782 C CB  . ASP A 121 ? 0.7601 0.7114 0.6597 0.0287  0.0184  0.0148  192 ASP A CB  
1783 C CG  . ASP A 121 ? 0.8338 0.7838 0.7258 0.0281  0.0244  0.0180  192 ASP A CG  
1784 O OD1 . ASP A 121 ? 0.8447 0.7934 0.7248 0.0295  0.0225  0.0233  192 ASP A OD1 
1785 O OD2 . ASP A 121 ? 0.8843 0.8346 0.7824 0.0263  0.0312  0.0155  192 ASP A OD2 
1790 N N   . GLY A 122 ? 0.6742 0.6318 0.5809 0.0255  0.0229  -0.0032 193 GLY A N   
1791 C CA  . GLY A 122 ? 0.6553 0.6148 0.5655 0.0244  0.0285  -0.0115 193 GLY A CA  
1792 C C   . GLY A 122 ? 0.6143 0.5700 0.5441 0.0238  0.0291  -0.0145 193 GLY A C   
1793 O O   . GLY A 122 ? 0.6031 0.5547 0.5419 0.0242  0.0252  -0.0091 193 GLY A O   
1797 N N   . SER A 123 ? 0.6208 0.5784 0.5568 0.0233  0.0339  -0.0237 194 SER A N   
1798 C CA  . SER A 123 ? 0.6440 0.5974 0.6006 0.0235  0.0341  -0.0277 194 SER A CA  
1799 C C   . SER A 123 ? 0.6134 0.5633 0.5808 0.0248  0.0342  -0.0208 194 SER A C   
1800 O O   . SER A 123 ? 0.5892 0.5338 0.5694 0.0256  0.0295  -0.0176 194 SER A O   
1801 C CB  . SER A 123 ? 0.7293 0.6864 0.6917 0.0235  0.0403  -0.0400 194 SER A CB  
1802 O OG  . SER A 123 ? 0.7891 0.7501 0.7431 0.0225  0.0390  -0.0483 194 SER A OG  
1808 N N   . ALA A 124 ? 0.6099 0.5628 0.5726 0.0248  0.0392  -0.0184 195 ALA A N   
1809 C CA  . ALA A 124 ? 0.5937 0.5446 0.5699 0.0259  0.0393  -0.0143 195 ALA A CA  
1810 C C   . ALA A 124 ? 0.6016 0.5481 0.5781 0.0269  0.0309  -0.0057 195 ALA A C   
1811 O O   . ALA A 124 ? 0.5679 0.5111 0.5581 0.0286  0.0266  -0.0042 195 ALA A O   
1812 C CB  . ALA A 124 ? 0.5868 0.5417 0.5582 0.0246  0.0467  -0.0125 195 ALA A CB  
1818 N N   . PHE A 125 ? 0.6489 0.5956 0.6099 0.0265  0.0282  -0.0005 196 PHE A N   
1819 C CA  . PHE A 125 ? 0.6524 0.5965 0.6129 0.0277  0.0211  0.0061  196 PHE A CA  
1820 C C   . PHE A 125 ? 0.6284 0.5704 0.5912 0.0277  0.0163  0.0066  196 PHE A C   
1821 O O   . PHE A 125 ? 0.6131 0.5529 0.5791 0.0289  0.0112  0.0114  196 PHE A O   
1822 C CB  . PHE A 125 ? 0.6866 0.6320 0.6326 0.0277  0.0198  0.0104  196 PHE A CB  
1823 C CG  . PHE A 125 ? 0.7517 0.6968 0.6977 0.0275  0.0233  0.0132  196 PHE A CG  
1824 C CD1 . PHE A 125 ? 0.8111 0.7564 0.7706 0.0269  0.0275  0.0114  196 PHE A CD1 
1825 C CD2 . PHE A 125 ? 0.7710 0.7155 0.7055 0.0278  0.0222  0.0176  196 PHE A CD2 
1826 C CE1 . PHE A 125 ? 0.8473 0.7924 0.8090 0.0257  0.0317  0.0143  196 PHE A CE1 
1827 C CE2 . PHE A 125 ? 0.8074 0.7499 0.7432 0.0270  0.0258  0.0213  196 PHE A CE2 
1828 C CZ  . PHE A 125 ? 0.8421 0.7851 0.7917 0.0255  0.0309  0.0198  196 PHE A CZ  
1838 N N   . ARG A 126 ? 0.6141 0.5568 0.5750 0.0261  0.0179  0.0016  197 ARG A N   
1839 C CA  . ARG A 126 ? 0.6192 0.5587 0.5856 0.0251  0.0145  0.0022  197 ARG A CA  
1840 C C   . ARG A 126 ? 0.6072 0.5410 0.5895 0.0265  0.0128  0.0036  197 ARG A C   
1841 O O   . ARG A 126 ? 0.5942 0.5243 0.5791 0.0268  0.0083  0.0100  197 ARG A O   
1842 C CB  . ARG A 126 ? 0.6481 0.5895 0.6136 0.0229  0.0167  -0.0055 197 ARG A CB  
1843 C CG  . ARG A 126 ? 0.6725 0.6099 0.6474 0.0208  0.0142  -0.0056 197 ARG A CG  
1844 C CD  . ARG A 126 ? 0.6990 0.6321 0.6894 0.0206  0.0163  -0.0131 197 ARG A CD  
1845 N NE  . ARG A 126 ? 0.7179 0.6565 0.7038 0.0199  0.0199  -0.0242 197 ARG A NE  
1846 C CZ  . ARG A 126 ? 0.7454 0.6845 0.7396 0.0208  0.0240  -0.0339 197 ARG A CZ  
1847 N NH1 . ARG A 126 ? 0.7431 0.6772 0.7534 0.0228  0.0249  -0.0343 197 ARG A NH1 
1848 N NH2 . ARG A 126 ? 0.7559 0.7017 0.7417 0.0202  0.0269  -0.0439 197 ARG A NH2 
1862 N N   . ASP A 127 ? 0.6097 0.5435 0.6028 0.0278  0.0164  -0.0019 198 ASP A N   
1863 C CA  . ASP A 127 ? 0.6270 0.5556 0.6377 0.0301  0.0137  -0.0013 198 ASP A CA  
1864 C C   . ASP A 127 ? 0.5689 0.4972 0.5813 0.0327  0.0087  0.0059  198 ASP A C   
1865 O O   . ASP A 127 ? 0.5585 0.4817 0.5781 0.0347  0.0028  0.0112  198 ASP A O   
1866 C CB  . ASP A 127 ? 0.7263 0.6567 0.7504 0.0309  0.0193  -0.0110 198 ASP A CB  
1867 C CG  . ASP A 127 ? 0.8559 0.7856 0.8821 0.0291  0.0225  -0.0199 198 ASP A CG  
1868 O OD1 . ASP A 127 ? 0.8484 0.7737 0.8730 0.0273  0.0190  -0.0174 198 ASP A OD1 
1869 O OD2 . ASP A 127 ? 0.9768 0.9112 1.0070 0.0292  0.0289  -0.0300 198 ASP A OD2 
1874 N N   . LEU A 128 ? 0.5851 0.5182 0.5900 0.0327  0.0102  0.0067  199 LEU A N   
1875 C CA  . LEU A 128 ? 0.6298 0.5632 0.6353 0.0350  0.0042  0.0123  199 LEU A CA  
1876 C C   . LEU A 128 ? 0.6228 0.5537 0.6187 0.0353  -0.0019 0.0195  199 LEU A C   
1877 O O   . LEU A 128 ? 0.6429 0.5714 0.6431 0.0380  -0.0082 0.0241  199 LEU A O   
1878 C CB  . LEU A 128 ? 0.7063 0.6442 0.7048 0.0342  0.0067  0.0121  199 LEU A CB  
1879 C CG  . LEU A 128 ? 0.8009 0.7417 0.8135 0.0347  0.0096  0.0087  199 LEU A CG  
1880 C CD1 . LEU A 128 ? 0.8732 0.8154 0.8966 0.0339  0.0169  0.0019  199 LEU A CD1 
1881 C CD2 . LEU A 128 ? 0.8019 0.7450 0.8065 0.0329  0.0128  0.0100  199 LEU A CD2 
1893 N N   . VAL A 129 ? 0.6131 0.5453 0.5957 0.0327  0.0000  0.0204  200 VAL A N   
1894 C CA  . VAL A 129 ? 0.5820 0.5140 0.5552 0.0324  -0.0040 0.0268  200 VAL A CA  
1895 C C   . VAL A 129 ? 0.6193 0.5449 0.5998 0.0324  -0.0065 0.0313  200 VAL A C   
1896 O O   . VAL A 129 ? 0.6272 0.5514 0.6031 0.0336  -0.0112 0.0386  200 VAL A O   
1897 C CB  . VAL A 129 ? 0.5503 0.4861 0.5119 0.0295  -0.0010 0.0255  200 VAL A CB  
1898 C CG1 . VAL A 129 ? 0.5069 0.4433 0.4625 0.0281  -0.0029 0.0311  200 VAL A CG1 
1899 C CG2 . VAL A 129 ? 0.5364 0.4770 0.4898 0.0305  -0.0006 0.0240  200 VAL A CG2 
1909 N N   . ILE A 130 ? 0.5967 0.5181 0.5883 0.0311  -0.0035 0.0271  201 ILE A N   
1910 C CA  . ILE A 130 ? 0.6158 0.5289 0.6175 0.0312  -0.0060 0.0314  201 ILE A CA  
1911 C C   . ILE A 130 ? 0.6373 0.5467 0.6492 0.0360  -0.0119 0.0348  201 ILE A C   
1912 O O   . ILE A 130 ? 0.6424 0.5457 0.6553 0.0374  -0.0171 0.0437  201 ILE A O   
1913 C CB  . ILE A 130 ? 0.6427 0.5525 0.6559 0.0288  -0.0015 0.0234  201 ILE A CB  
1914 C CG1 . ILE A 130 ? 0.6652 0.5784 0.6694 0.0241  0.0020  0.0213  201 ILE A CG1 
1915 C CG2 . ILE A 130 ? 0.6497 0.5490 0.6790 0.0297  -0.0044 0.0267  201 ILE A CG2 
1916 C CD1 . ILE A 130 ? 0.6901 0.6037 0.7024 0.0221  0.0063  0.0099  201 ILE A CD1 
1928 N N   . LYS A 131 ? 0.6606 0.5740 0.6807 0.0386  -0.0113 0.0284  202 LYS A N   
1929 C CA  . LYS A 131 ? 0.7186 0.6303 0.7519 0.0435  -0.0176 0.0299  202 LYS A CA  
1930 C C   . LYS A 131 ? 0.7003 0.6139 0.7225 0.0461  -0.0253 0.0379  202 LYS A C   
1931 O O   . LYS A 131 ? 0.7346 0.6441 0.7622 0.0501  -0.0331 0.0438  202 LYS A O   
1932 C CB  . LYS A 131 ? 0.8171 0.7348 0.8627 0.0448  -0.0139 0.0205  202 LYS A CB  
1933 C CG  . LYS A 131 ? 0.9474 0.8638 1.0086 0.0443  -0.0078 0.0116  202 LYS A CG  
1934 C CD  . LYS A 131 ? 1.0781 1.0013 1.1549 0.0463  -0.0049 0.0039  202 LYS A CD  
1935 C CE  . LYS A 131 ? 1.1747 1.0993 1.2660 0.0457  0.0030  -0.0070 202 LYS A CE  
1936 N NZ  . LYS A 131 ? 1.2151 1.1433 1.2909 0.0410  0.0120  -0.0117 202 LYS A NZ  
1950 N N   . HIS A 132 ? 0.6746 0.5947 0.6817 0.0445  -0.0239 0.0377  203 HIS A N   
1951 C CA  . HIS A 132 ? 0.6577 0.5807 0.6526 0.0469  -0.0308 0.0437  203 HIS A CA  
1952 C C   . HIS A 132 ? 0.6704 0.5891 0.6531 0.0460  -0.0329 0.0538  203 HIS A C   
1953 O O   . HIS A 132 ? 0.6624 0.5846 0.6318 0.0479  -0.0379 0.0589  203 HIS A O   
1954 C CB  . HIS A 132 ? 0.6609 0.5914 0.6444 0.0454  -0.0284 0.0398  203 HIS A CB  
1955 C CG  . HIS A 132 ? 0.6675 0.6021 0.6620 0.0465  -0.0277 0.0324  203 HIS A CG  
1956 N ND1 . HIS A 132 ? 0.6655 0.6040 0.6649 0.0500  -0.0348 0.0308  203 HIS A ND1 
1957 C CD2 . HIS A 132 ? 0.6587 0.5945 0.6604 0.0440  -0.0205 0.0263  203 HIS A CD2 
1958 C CE1 . HIS A 132 ? 0.6462 0.5877 0.6576 0.0491  -0.0314 0.0242  203 HIS A CE1 
1959 N NE2 . HIS A 132 ? 0.6378 0.5776 0.6498 0.0455  -0.0223 0.0221  203 HIS A NE2 
1967 N N   . GLY A 133 ? 0.6570 0.5688 0.6437 0.0429  -0.0289 0.0565  204 GLY A N   
1968 C CA  . GLY A 133 ? 0.7124 0.6191 0.6903 0.0411  -0.0299 0.0675  204 GLY A CA  
1969 C C   . GLY A 133 ? 0.7386 0.6509 0.7001 0.0365  -0.0245 0.0694  204 GLY A C   
1970 O O   . GLY A 133 ? 0.8093 0.7227 0.7576 0.0362  -0.0260 0.0785  204 GLY A O   
1974 N N   . ALA A 134 ? 0.7091 0.6260 0.6713 0.0331  -0.0182 0.0611  205 ALA A N   
1975 C CA  . ALA A 134 ? 0.6518 0.5757 0.6010 0.0295  -0.0138 0.0617  205 ALA A CA  
1976 C C   . ALA A 134 ? 0.6584 0.5781 0.6090 0.0243  -0.0097 0.0678  205 ALA A C   
1977 O O   . ALA A 134 ? 0.6708 0.5963 0.6105 0.0216  -0.0069 0.0719  205 ALA A O   
1978 C CB  . ALA A 134 ? 0.6174 0.5476 0.5667 0.0283  -0.0098 0.0515  205 ALA A CB  
1984 N N   . ILE A 135 ? 0.6285 0.5386 0.5940 0.0226  -0.0089 0.0680  206 ILE A N   
1985 C CA  . ILE A 135 ? 0.6656 0.5717 0.6366 0.0165  -0.0042 0.0716  206 ILE A CA  
1986 C C   . ILE A 135 ? 0.7126 0.6158 0.6746 0.0149  -0.0044 0.0860  206 ILE A C   
1987 O O   . ILE A 135 ? 0.7389 0.6460 0.6970 0.0094  0.0011  0.0895  206 ILE A O   
1988 C CB  . ILE A 135 ? 0.7057 0.6012 0.6969 0.0156  -0.0040 0.0673  206 ILE A CB  
1989 C CG1 . ILE A 135 ? 0.7251 0.6261 0.7214 0.0160  -0.0017 0.0527  206 ILE A CG1 
1990 C CG2 . ILE A 135 ? 0.7203 0.6098 0.7204 0.0089  0.0002  0.0716  206 ILE A CG2 
1991 C CD1 . ILE A 135 ? 0.7651 0.6582 0.7810 0.0156  -0.0009 0.0450  206 ILE A CD1 
2003 N N   . ASP A 136 ? 0.7217 0.6186 0.6805 0.0195  -0.0106 0.0949  207 ASP A N   
2004 C CA  . ASP A 136 ? 0.7827 0.6761 0.7303 0.0180  -0.0109 0.1104  207 ASP A CA  
2005 C C   . ASP A 136 ? 0.6915 0.5984 0.6191 0.0161  -0.0068 0.1118  207 ASP A C   
2006 O O   . ASP A 136 ? 0.6651 0.5734 0.5892 0.0101  0.0000  0.1188  207 ASP A O   
2007 C CB  . ASP A 136 ? 0.9561 0.8423 0.9009 0.0249  -0.0203 0.1188  207 ASP A CB  
2008 C CG  . ASP A 136 ? 1.1607 1.0307 1.1254 0.0255  -0.0235 0.1236  207 ASP A CG  
2009 O OD1 . ASP A 136 ? 1.2222 1.0846 1.1979 0.0194  -0.0178 0.1262  207 ASP A OD1 
2010 O OD2 . ASP A 136 ? 1.2680 1.1329 1.2394 0.0323  -0.0319 0.1239  207 ASP A OD2 
2015 N N   . PRO A 137 ? 0.6903 0.6079 0.6061 0.0209  -0.0100 0.1053  208 PRO A N   
2016 C CA  . PRO A 137 ? 0.7000 0.6308 0.5981 0.0196  -0.0061 0.1055  208 PRO A CA  
2017 C C   . PRO A 137 ? 0.7408 0.6794 0.6442 0.0138  0.0024  0.0984  208 PRO A C   
2018 O O   . PRO A 137 ? 0.7640 0.7114 0.6577 0.0103  0.0082  0.1018  208 PRO A O   
2019 C CB  . PRO A 137 ? 0.6723 0.6108 0.5626 0.0264  -0.0126 0.0971  208 PRO A CB  
2020 C CG  . PRO A 137 ? 0.6481 0.5791 0.5546 0.0295  -0.0174 0.0907  208 PRO A CG  
2021 C CD  . PRO A 137 ? 0.6544 0.5719 0.5730 0.0278  -0.0179 0.0987  208 PRO A CD  
2029 N N   . LEU A 138 ? 0.7488 0.6853 0.6671 0.0127  0.0031  0.0883  209 LEU A N   
2030 C CA  . LEU A 138 ? 0.7543 0.6981 0.6788 0.0076  0.0095  0.0813  209 LEU A CA  
2031 C C   . LEU A 138 ? 0.7787 0.7187 0.7103 0.0002  0.0157  0.0894  209 LEU A C   
2032 O O   . LEU A 138 ? 0.8130 0.7630 0.7419 -0.0042 0.0221  0.0899  209 LEU A O   
2033 C CB  . LEU A 138 ? 0.7461 0.6876 0.6833 0.0084  0.0080  0.0697  209 LEU A CB  
2034 C CG  . LEU A 138 ? 0.7640 0.7109 0.6956 0.0140  0.0042  0.0611  209 LEU A CG  
2035 C CD1 . LEU A 138 ? 0.7888 0.7309 0.7313 0.0147  0.0032  0.0528  209 LEU A CD1 
2036 C CD2 . LEU A 138 ? 0.7609 0.7209 0.6849 0.0141  0.0064  0.0555  209 LEU A CD2 
2048 N N   . LEU A 139 ? 0.7316 0.6573 0.6745 -0.0013 0.0143  0.0958  210 LEU A N   
2049 C CA  . LEU A 139 ? 0.7256 0.6454 0.6784 -0.0090 0.0203  0.1040  210 LEU A CA  
2050 C C   . LEU A 139 ? 0.7622 0.6850 0.6996 -0.0114 0.0244  0.1186  210 LEU A C   
2051 O O   . LEU A 139 ? 0.7897 0.7153 0.7317 -0.0190 0.0325  0.1236  210 LEU A O   
2052 C CB  . LEU A 139 ? 0.7281 0.6301 0.6978 -0.0093 0.0170  0.1077  210 LEU A CB  
2053 C CG  . LEU A 139 ? 0.7086 0.6094 0.6936 -0.0077 0.0145  0.0918  210 LEU A CG  
2054 C CD1 . LEU A 139 ? 0.7544 0.6387 0.7585 -0.0077 0.0117  0.0931  210 LEU A CD1 
2055 C CD2 . LEU A 139 ? 0.6770 0.5883 0.6693 -0.0129 0.0195  0.0804  210 LEU A CD2 
2067 N N   . ALA A 140 ? 0.7572 0.6808 0.6761 -0.0052 0.0193  0.1250  211 ALA A N   
2068 C CA  . ALA A 140 ? 0.7836 0.7118 0.6835 -0.0068 0.0232  0.1384  211 ALA A CA  
2069 C C   . ALA A 140 ? 0.7837 0.7307 0.6762 -0.0103 0.0315  0.1321  211 ALA A C   
2070 O O   . ALA A 140 ? 0.8408 0.7928 0.7257 -0.0158 0.0398  0.1420  211 ALA A O   
2071 C CB  . ALA A 140 ? 0.7892 0.7167 0.6702 0.0016  0.0144  0.1434  211 ALA A CB  
2077 N N   . LEU A 141 ? 0.7263 0.6838 0.6218 -0.0071 0.0298  0.1162  212 LEU A N   
2078 C CA  . LEU A 141 ? 0.7177 0.6929 0.6105 -0.0097 0.0368  0.1085  212 LEU A CA  
2079 C C   . LEU A 141 ? 0.7418 0.7193 0.6523 -0.0188 0.0456  0.1083  212 LEU A C   
2080 O O   . LEU A 141 ? 0.7686 0.7610 0.6778 -0.0226 0.0535  0.1061  212 LEU A O   
2081 C CB  . LEU A 141 ? 0.7127 0.6960 0.6076 -0.0038 0.0317  0.0922  212 LEU A CB  
2082 C CG  . LEU A 141 ? 0.7397 0.7232 0.6207 0.0048  0.0234  0.0892  212 LEU A CG  
2083 C CD1 . LEU A 141 ? 0.7249 0.7133 0.6122 0.0091  0.0193  0.0745  212 LEU A CD1 
2084 C CD2 . LEU A 141 ? 0.7712 0.7658 0.6320 0.0068  0.0255  0.0931  212 LEU A CD2 
2096 N N   . LEU A 142 ? 0.7511 0.7153 0.6800 -0.0225 0.0444  0.1091  213 LEU A N   
2097 C CA  . LEU A 142 ? 0.8085 0.7741 0.7576 -0.0315 0.0517  0.1075  213 LEU A CA  
2098 C C   . LEU A 142 ? 0.8819 0.8358 0.8357 -0.0389 0.0576  0.1245  213 LEU A C   
2099 O O   . LEU A 142 ? 0.9368 0.8883 0.9111 -0.0472 0.0632  0.1242  213 LEU A O   
2100 C CB  . LEU A 142 ? 0.7953 0.7551 0.7635 -0.0309 0.0464  0.0945  213 LEU A CB  
2101 C CG  . LEU A 142 ? 0.7822 0.7532 0.7465 -0.0245 0.0413  0.0790  213 LEU A CG  
2102 C CD1 . LEU A 142 ? 0.7872 0.7500 0.7628 -0.0218 0.0348  0.0689  213 LEU A CD1 
2103 C CD2 . LEU A 142 ? 0.7680 0.7568 0.7382 -0.0280 0.0468  0.0708  213 LEU A CD2 
2115 N N   . ALA A 143 ? 0.8410 0.7875 0.7763 -0.0360 0.0561  0.1395  214 ALA A N   
2116 C CA  . ALA A 143 ? 0.9021 0.8348 0.8390 -0.0420 0.0604  0.1586  214 ALA A CA  
2117 C C   . ALA A 143 ? 0.9835 0.9271 0.9157 -0.0508 0.0738  0.1682  214 ALA A C   
2118 O O   . ALA A 143 ? 1.0572 0.9897 0.9882 -0.0565 0.0788  0.1865  214 ALA A O   
2119 C CB  . ALA A 143 ? 0.9155 0.8372 0.8323 -0.0346 0.0524  0.1716  214 ALA A CB  
2125 N N   . VAL A 144 ? 0.9906 0.9555 0.9208 -0.0521 0.0799  0.1568  215 VAL A N   
2126 C CA  . VAL A 144 ? 1.0348 1.0132 0.9624 -0.0607 0.0940  0.1641  215 VAL A CA  
2127 C C   . VAL A 144 ? 1.0667 1.0393 1.0242 -0.0724 0.1019  0.1664  215 VAL A C   
2128 O O   . VAL A 144 ? 1.0078 0.9782 0.9891 -0.0730 0.0972  0.1520  215 VAL A O   
2129 C CB  . VAL A 144 ? 1.0315 1.0350 0.9532 -0.0579 0.0975  0.1486  215 VAL A CB  
2130 C CG1 . VAL A 144 ? 1.0739 1.0824 0.9679 -0.0467 0.0897  0.1456  215 VAL A CG1 
2131 C CG2 . VAL A 144 ? 0.9719 0.9815 0.9183 -0.0577 0.0937  0.1287  215 VAL A CG2 
2141 N N   . PRO A 145 ? 1.1622 1.1333 1.1202 -0.0821 0.1140  0.1832  216 PRO A N   
2142 C CA  . PRO A 145 ? 1.2147 1.1783 1.2050 -0.0939 0.1211  0.1855  216 PRO A CA  
2143 C C   . PRO A 145 ? 1.1834 1.1665 1.1983 -0.0987 0.1258  0.1657  216 PRO A C   
2144 O O   . PRO A 145 ? 1.1925 1.1690 1.2381 -0.1052 0.1255  0.1592  216 PRO A O   
2145 C CB  . PRO A 145 ? 1.2824 1.2430 1.2632 -0.1031 0.1346  0.2093  216 PRO A CB  
2146 C CG  . PRO A 145 ? 1.2889 1.2516 1.2299 -0.0946 0.1317  0.2204  216 PRO A CG  
2147 C CD  . PRO A 145 ? 1.2265 1.2047 1.1565 -0.0835 0.1228  0.1999  216 PRO A CD  
2155 N N   . ASP A 146 ? 1.1310 1.1380 1.1345 -0.0955 0.1295  0.1554  217 ASP A N   
2156 C CA  . ASP A 146 ? 1.0887 1.1159 1.1149 -0.0985 0.1326  0.1362  217 ASP A CA  
2157 C C   . ASP A 146 ? 0.9893 1.0259 1.0056 -0.0861 0.1207  0.1180  217 ASP A C   
2158 O O   . ASP A 146 ? 0.9799 1.0271 0.9719 -0.0790 0.1205  0.1173  217 ASP A O   
2159 C CB  . ASP A 146 ? 1.1804 1.2293 1.2070 -0.1064 0.1490  0.1399  217 ASP A CB  
2160 C CG  . ASP A 146 ? 1.2361 1.3082 1.2873 -0.1084 0.1515  0.1193  217 ASP A CG  
2161 O OD1 . ASP A 146 ? 1.2254 1.3117 1.2668 -0.0988 0.1453  0.1049  217 ASP A OD1 
2162 O OD2 . ASP A 146 ? 1.2873 1.3632 1.3690 -0.1194 0.1591  0.1174  217 ASP A OD2 
2167 N N   . LEU A 147 ? 0.9687 1.0014 1.0035 -0.0835 0.1110  0.1030  218 LEU A N   
2168 C CA  . LEU A 147 ? 0.9161 0.9548 0.9411 -0.0720 0.0996  0.0880  218 LEU A CA  
2169 C C   . LEU A 147 ? 0.9679 1.0319 0.9933 -0.0697 0.1032  0.0757  218 LEU A C   
2170 O O   . LEU A 147 ? 0.9123 0.9817 0.9240 -0.0597 0.0954  0.0668  218 LEU A O   
2171 C CB  . LEU A 147 ? 0.8299 0.8597 0.8732 -0.0703 0.0893  0.0755  218 LEU A CB  
2172 C CG  . LEU A 147 ? 0.8024 0.8074 0.8459 -0.0698 0.0834  0.0836  218 LEU A CG  
2173 C CD1 . LEU A 147 ? 0.7718 0.7719 0.8353 -0.0692 0.0753  0.0688  218 LEU A CD1 
2174 C CD2 . LEU A 147 ? 0.7955 0.7915 0.8117 -0.0599 0.0765  0.0898  218 LEU A CD2 
2186 N N   . SER A 148 ? 1.1183 1.1979 1.1609 -0.0787 0.1148  0.0747  219 SER A N   
2187 C CA  . SER A 148 ? 1.1762 1.2812 1.2234 -0.0763 0.1183  0.0616  219 SER A CA  
2188 C C   . SER A 148 ? 1.1291 1.2441 1.1490 -0.0708 0.1231  0.0661  219 SER A C   
2189 O O   . SER A 148 ? 1.1164 1.2517 1.1381 -0.0666 0.1246  0.0539  219 SER A O   
2190 C CB  . SER A 148 ? 1.2649 1.3851 1.3414 -0.0880 0.1303  0.0588  219 SER A CB  
2191 O OG  . SER A 148 ? 1.2993 1.4121 1.4031 -0.0927 0.1247  0.0516  219 SER A OG  
2197 N N   . THR A 149 ? 1.0522 1.1538 1.0474 -0.0702 0.1248  0.0824  220 THR A N   
2198 C CA  . THR A 149 ? 1.0490 1.1598 1.0159 -0.0639 0.1275  0.0853  220 THR A CA  
2199 C C   . THR A 149 ? 1.0437 1.1517 0.9967 -0.0509 0.1134  0.0745  220 THR A C   
2200 O O   . THR A 149 ? 1.0288 1.1498 0.9659 -0.0446 0.1142  0.0692  220 THR A O   
2201 C CB  . THR A 149 ? 1.0982 1.1960 1.0421 -0.0673 0.1328  0.1069  220 THR A CB  
2202 O OG1 . THR A 149 ? 1.1043 1.1781 1.0398 -0.0622 0.1201  0.1132  220 THR A OG1 
2203 C CG2 . THR A 149 ? 1.1325 1.2290 1.0912 -0.0812 0.1469  0.1203  220 THR A CG2 
2211 N N   . LEU A 150 ? 1.0729 1.1650 1.0325 -0.0469 0.1010  0.0707  221 LEU A N   
2212 C CA  . LEU A 150 ? 1.0435 1.1331 0.9935 -0.0356 0.0886  0.0605  221 LEU A CA  
2213 C C   . LEU A 150 ? 0.9913 1.0980 0.9567 -0.0321 0.0864  0.0430  221 LEU A C   
2214 O O   . LEU A 150 ? 0.9430 1.0575 0.9313 -0.0377 0.0897  0.0370  221 LEU A O   
2215 C CB  . LEU A 150 ? 1.0325 1.1005 0.9847 -0.0331 0.0777  0.0624  221 LEU A CB  
2216 C CG  . LEU A 150 ? 1.0403 1.0894 0.9783 -0.0339 0.0762  0.0783  221 LEU A CG  
2217 C CD1 . LEU A 150 ? 0.9956 1.0261 0.9431 -0.0327 0.0673  0.0776  221 LEU A CD1 
2218 C CD2 . LEU A 150 ? 1.0759 1.1255 0.9881 -0.0258 0.0722  0.0811  221 LEU A CD2 
2230 N N   . ALA A 151 ? 0.9929 1.1054 0.9468 -0.0225 0.0804  0.0345  222 ALA A N   
2231 C CA  . ALA A 151 ? 0.9502 1.0759 0.9183 -0.0173 0.0758  0.0186  222 ALA A CA  
2232 C C   . ALA A 151 ? 0.9183 1.0344 0.9015 -0.0169 0.0666  0.0134  222 ALA A C   
2233 O O   . ALA A 151 ? 0.9618 1.0596 0.9381 -0.0157 0.0599  0.0188  222 ALA A O   
2234 C CB  . ALA A 151 ? 0.9243 1.0523 0.8777 -0.0066 0.0691  0.0117  222 ALA A CB  
2240 N N   . CYS A 152 ? 0.8660 0.9958 0.8700 -0.0176 0.0660  0.0022  223 CYS A N   
2241 C CA  . CYS A 152 ? 0.8547 0.9782 0.8726 -0.0174 0.0572  -0.0037 223 CYS A CA  
2242 C C   . CYS A 152 ? 0.7862 0.8953 0.7903 -0.0085 0.0451  -0.0050 223 CYS A C   
2243 O O   . CYS A 152 ? 0.7741 0.8690 0.7777 -0.0095 0.0399  -0.0027 223 CYS A O   
2244 C CB  . CYS A 152 ? 0.9758 1.1187 1.0162 -0.0170 0.0563  -0.0170 223 CYS A CB  
2245 S SG  . CYS A 152 ? 1.0847 1.2257 1.1479 -0.0222 0.0506  -0.0234 223 CYS A SG  
2251 N N   . GLY A 153 ? 0.7758 0.8886 0.7699 0.0000  0.0411  -0.0092 224 GLY A N   
2252 C CA  . GLY A 153 ? 0.7804 0.8797 0.7630 0.0076  0.0307  -0.0096 224 GLY A CA  
2253 C C   . GLY A 153 ? 0.7778 0.8593 0.7446 0.0065  0.0305  0.0010  224 GLY A C   
2254 O O   . GLY A 153 ? 0.8174 0.8855 0.7806 0.0085  0.0240  0.0022  224 GLY A O   
2258 N N   . TYR A 154 ? 0.7433 0.8254 0.7004 0.0037  0.0376  0.0087  225 TYR A N   
2259 C CA  . TYR A 154 ? 0.7311 0.7972 0.6747 0.0028  0.0369  0.0193  225 TYR A CA  
2260 C C   . TYR A 154 ? 0.6746 0.7289 0.6270 -0.0030 0.0367  0.0238  225 TYR A C   
2261 O O   . TYR A 154 ? 0.6627 0.7030 0.6113 -0.0007 0.0309  0.0256  225 TYR A O   
2262 C CB  . TYR A 154 ? 0.8136 0.8846 0.7455 0.0001  0.0449  0.0273  225 TYR A CB  
2263 C CG  . TYR A 154 ? 0.8641 0.9220 0.7784 0.0023  0.0421  0.0370  225 TYR A CG  
2264 C CD1 . TYR A 154 ? 0.8840 0.9300 0.7934 0.0082  0.0329  0.0355  225 TYR A CD1 
2265 C CD2 . TYR A 154 ? 0.8836 0.9419 0.7865 -0.0016 0.0487  0.0480  225 TYR A CD2 
2266 C CE1 . TYR A 154 ? 0.9174 0.9532 0.8137 0.0105  0.0297  0.0431  225 TYR A CE1 
2267 C CE2 . TYR A 154 ? 0.9176 0.9649 0.8050 0.0012  0.0447  0.0566  225 TYR A CE2 
2268 C CZ  . TYR A 154 ? 0.9571 0.9937 0.8424 0.0073  0.0348  0.0534  225 TYR A CZ  
2269 O OH  . TYR A 154 ? 1.0260 1.0529 0.8982 0.0104  0.0300  0.0610  225 TYR A OH  
2279 N N   . LEU A 155 ? 0.6627 0.7233 0.6290 -0.0108 0.0435  0.0246  226 LEU A N   
2280 C CA  . LEU A 155 ? 0.6799 0.7293 0.6573 -0.0170 0.0438  0.0281  226 LEU A CA  
2281 C C   . LEU A 155 ? 0.6787 0.7235 0.6629 -0.0137 0.0351  0.0186  226 LEU A C   
2282 O O   . LEU A 155 ? 0.6988 0.7299 0.6843 -0.0146 0.0321  0.0206  226 LEU A O   
2283 C CB  . LEU A 155 ? 0.7015 0.7603 0.6959 -0.0263 0.0528  0.0290  226 LEU A CB  
2284 C CG  . LEU A 155 ? 0.7319 0.7791 0.7413 -0.0341 0.0544  0.0327  226 LEU A CG  
2285 C CD1 . LEU A 155 ? 0.7341 0.7624 0.7325 -0.0346 0.0544  0.0460  226 LEU A CD1 
2286 C CD2 . LEU A 155 ? 0.7707 0.8292 0.7988 -0.0439 0.0644  0.0336  226 LEU A CD2 
2298 N N   . ARG A 156 ? 0.6554 0.7119 0.6436 -0.0092 0.0309  0.0083  227 ARG A N   
2299 C CA  . ARG A 156 ? 0.6312 0.6843 0.6219 -0.0053 0.0223  0.0002  227 ARG A CA  
2300 C C   . ARG A 156 ? 0.6040 0.6430 0.5789 0.0005  0.0170  0.0037  227 ARG A C   
2301 O O   . ARG A 156 ? 0.6277 0.6574 0.6031 0.0004  0.0134  0.0021  227 ARG A O   
2302 C CB  . ARG A 156 ? 0.6627 0.7307 0.6592 -0.0007 0.0179  -0.0098 227 ARG A CB  
2303 C CG  . ARG A 156 ? 0.7145 0.7968 0.7316 -0.0066 0.0212  -0.0162 227 ARG A CG  
2304 C CD  . ARG A 156 ? 0.7793 0.8782 0.8033 -0.0013 0.0177  -0.0252 227 ARG A CD  
2305 N NE  . ARG A 156 ? 0.8664 0.9807 0.9133 -0.0069 0.0202  -0.0329 227 ARG A NE  
2306 C CZ  . ARG A 156 ? 0.9543 1.0859 1.0136 -0.0032 0.0172  -0.0423 227 ARG A CZ  
2307 N NH1 . ARG A 156 ? 0.9752 1.1090 1.0253 0.0063  0.0114  -0.0446 227 ARG A NH1 
2308 N NH2 . ARG A 156 ? 1.0019 1.1482 1.0849 -0.0089 0.0196  -0.0499 227 ARG A NH2 
2322 N N   . ASN A 157 ? 0.5997 0.6381 0.5619 0.0055  0.0166  0.0074  228 ASN A N   
2323 C CA  . ASN A 157 ? 0.6205 0.6466 0.5706 0.0106  0.0119  0.0101  228 ASN A CA  
2324 C C   . ASN A 157 ? 0.5791 0.5918 0.5277 0.0072  0.0138  0.0174  228 ASN A C   
2325 O O   . ASN A 157 ? 0.5307 0.5337 0.4770 0.0091  0.0103  0.0168  228 ASN A O   
2326 C CB  . ASN A 157 ? 0.7414 0.7700 0.6810 0.0161  0.0108  0.0113  228 ASN A CB  
2327 C CG  . ASN A 157 ? 0.8420 0.8787 0.7833 0.0219  0.0060  0.0036  228 ASN A CG  
2328 O OD1 . ASN A 157 ? 0.8725 0.9062 0.8151 0.0243  0.0008  0.0000  228 ASN A OD1 
2329 N ND2 . ASN A 157 ? 0.8870 0.9342 0.8282 0.0244  0.0077  0.0009  228 ASN A ND2 
2336 N N   . LEU A 158 ? 0.6043 0.6165 0.5548 0.0021  0.0195  0.0245  229 LEU A N   
2337 C CA  . LEU A 158 ? 0.6346 0.6334 0.5862 -0.0008 0.0205  0.0321  229 LEU A CA  
2338 C C   . LEU A 158 ? 0.6100 0.6031 0.5747 -0.0042 0.0195  0.0270  229 LEU A C   
2339 O O   . LEU A 158 ? 0.6266 0.6084 0.5917 -0.0029 0.0169  0.0274  229 LEU A O   
2340 C CB  . LEU A 158 ? 0.6864 0.6858 0.6375 -0.0060 0.0270  0.0421  229 LEU A CB  
2341 C CG  . LEU A 158 ? 0.7147 0.7160 0.6494 -0.0023 0.0274  0.0489  229 LEU A CG  
2342 C CD1 . LEU A 158 ? 0.7240 0.7337 0.6561 -0.0073 0.0354  0.0557  229 LEU A CD1 
2343 C CD2 . LEU A 158 ? 0.7331 0.7198 0.6618 0.0002  0.0233  0.0564  229 LEU A CD2 
2355 N N   . THR A 159 ? 0.5857 0.5877 0.5625 -0.0084 0.0213  0.0207  230 THR A N   
2356 C CA  . THR A 159 ? 0.5883 0.5869 0.5778 -0.0113 0.0192  0.0132  230 THR A CA  
2357 C C   . THR A 159 ? 0.5709 0.5674 0.5525 -0.0051 0.0129  0.0058  230 THR A C   
2358 O O   . THR A 159 ? 0.5612 0.5490 0.5457 -0.0052 0.0113  0.0029  230 THR A O   
2359 C CB  . THR A 159 ? 0.6312 0.6422 0.6364 -0.0166 0.0212  0.0061  230 THR A CB  
2360 O OG1 . THR A 159 ? 0.6654 0.6794 0.6775 -0.0230 0.0289  0.0140  230 THR A OG1 
2361 C CG2 . THR A 159 ? 0.6036 0.6110 0.6238 -0.0203 0.0190  -0.0025 230 THR A CG2 
2369 N N   . TRP A 160 ? 0.5509 0.5553 0.5229 0.0004  0.0095  0.0030  231 TRP A N   
2370 C CA  . TRP A 160 ? 0.5474 0.5492 0.5106 0.0057  0.0043  -0.0020 231 TRP A CA  
2371 C C   . TRP A 160 ? 0.5605 0.5500 0.5155 0.0083  0.0045  0.0033  231 TRP A C   
2372 O O   . TRP A 160 ? 0.6013 0.5857 0.5549 0.0094  0.0031  -0.0007 231 TRP A O   
2373 C CB  . TRP A 160 ? 0.5535 0.5643 0.5094 0.0111  0.0005  -0.0042 231 TRP A CB  
2374 C CG  . TRP A 160 ? 0.5935 0.6001 0.5384 0.0165  -0.0041 -0.0061 231 TRP A CG  
2375 C CD1 . TRP A 160 ? 0.6118 0.6197 0.5549 0.0174  -0.0078 -0.0127 231 TRP A CD1 
2376 C CD2 . TRP A 160 ? 0.6236 0.6245 0.5574 0.0213  -0.0052 -0.0012 231 TRP A CD2 
2377 N NE1 . TRP A 160 ? 0.6349 0.6379 0.5650 0.0224  -0.0103 -0.0107 231 TRP A NE1 
2378 C CE2 . TRP A 160 ? 0.6545 0.6528 0.5803 0.0246  -0.0086 -0.0037 231 TRP A CE2 
2379 C CE3 . TRP A 160 ? 0.6382 0.6364 0.5682 0.0232  -0.0038 0.0046  231 TRP A CE3 
2380 C CZ2 . TRP A 160 ? 0.6704 0.6627 0.5867 0.0287  -0.0097 0.0005  231 TRP A CZ2 
2381 C CZ3 . TRP A 160 ? 0.6471 0.6396 0.5690 0.0276  -0.0059 0.0071  231 TRP A CZ3 
2382 C CH2 . TRP A 160 ? 0.6631 0.6522 0.5791 0.0300  -0.0083 0.0056  231 TRP A CH2 
2393 N N   . THR A 161 ? 0.5300 0.5159 0.4802 0.0093  0.0063  0.0114  232 THR A N   
2394 C CA  . THR A 161 ? 0.5216 0.4971 0.4669 0.0119  0.0057  0.0157  232 THR A CA  
2395 C C   . THR A 161 ? 0.5500 0.5162 0.5049 0.0086  0.0075  0.0165  232 THR A C   
2396 O O   . THR A 161 ? 0.5475 0.5074 0.5028 0.0105  0.0067  0.0142  232 THR A O   
2397 C CB  . THR A 161 ? 0.5120 0.4873 0.4504 0.0141  0.0059  0.0230  232 THR A CB  
2398 O OG1 . THR A 161 ? 0.5091 0.4916 0.4404 0.0181  0.0036  0.0204  232 THR A OG1 
2399 C CG2 . THR A 161 ? 0.5057 0.4710 0.4426 0.0164  0.0045  0.0271  232 THR A CG2 
2407 N N   . LEU A 162 ? 0.5557 0.5208 0.5198 0.0034  0.0103  0.0199  233 LEU A N   
2408 C CA  . LEU A 162 ? 0.6123 0.5675 0.5889 0.0002  0.0114  0.0198  233 LEU A CA  
2409 C C   . LEU A 162 ? 0.5833 0.5395 0.5657 0.0001  0.0101  0.0079  233 LEU A C   
2410 O O   . LEU A 162 ? 0.5854 0.5337 0.5733 0.0010  0.0099  0.0048  233 LEU A O   
2411 C CB  . LEU A 162 ? 0.6896 0.6434 0.6769 -0.0062 0.0151  0.0253  233 LEU A CB  
2412 C CG  . LEU A 162 ? 0.7894 0.7369 0.7724 -0.0067 0.0168  0.0391  233 LEU A CG  
2413 C CD1 . LEU A 162 ? 0.8465 0.7926 0.8403 -0.0141 0.0217  0.0454  233 LEU A CD1 
2414 C CD2 . LEU A 162 ? 0.8218 0.7564 0.8065 -0.0034 0.0139  0.0432  233 LEU A CD2 
2426 N N   . SER A 163 ? 0.5897 0.5563 0.5704 -0.0004 0.0088  0.0004  234 SER A N   
2427 C CA  . SER A 163 ? 0.6105 0.5792 0.5947 -0.0003 0.0068  -0.0113 234 SER A CA  
2428 C C   . SER A 163 ? 0.5597 0.5256 0.5321 0.0050  0.0058  -0.0134 234 SER A C   
2429 O O   . SER A 163 ? 0.5647 0.5277 0.5407 0.0052  0.0061  -0.0211 234 SER A O   
2430 C CB  . SER A 163 ? 0.6862 0.6677 0.6708 -0.0011 0.0041  -0.0188 234 SER A CB  
2431 O OG  . SER A 163 ? 0.7207 0.7087 0.6902 0.0042  0.0011  -0.0179 234 SER A OG  
2437 N N   . ASN A 164 ? 0.5340 0.5008 0.4937 0.0091  0.0052  -0.0070 235 ASN A N   
2438 C CA  . ASN A 164 ? 0.5348 0.4988 0.4852 0.0132  0.0053  -0.0077 235 ASN A CA  
2439 C C   . ASN A 164 ? 0.5300 0.4844 0.4878 0.0133  0.0077  -0.0055 235 ASN A C   
2440 O O   . ASN A 164 ? 0.5435 0.4963 0.4991 0.0153  0.0094  -0.0095 235 ASN A O   
2441 C CB  . ASN A 164 ? 0.5688 0.5354 0.5070 0.0170  0.0038  -0.0018 235 ASN A CB  
2442 C CG  . ASN A 164 ? 0.6006 0.5746 0.5289 0.0193  0.0008  -0.0057 235 ASN A CG  
2443 O OD1 . ASN A 164 ? 0.6413 0.6200 0.5702 0.0182  -0.0007 -0.0132 235 ASN A OD1 
2444 N ND2 . ASN A 164 ? 0.5867 0.5618 0.5064 0.0229  -0.0010 -0.0010 235 ASN A ND2 
2451 N N   . LEU A 165 ? 0.5291 0.4777 0.4962 0.0114  0.0081  0.0009  236 LEU A N   
2452 C CA  . LEU A 165 ? 0.5935 0.5327 0.5704 0.0121  0.0090  0.0024  236 LEU A CA  
2453 C C   . LEU A 165 ? 0.6485 0.5842 0.6386 0.0100  0.0104  -0.0069 236 LEU A C   
2454 O O   . LEU A 165 ? 0.7209 0.6502 0.7200 0.0117  0.0113  -0.0089 236 LEU A O   
2455 C CB  . LEU A 165 ? 0.6236 0.5568 0.6050 0.0113  0.0080  0.0132  236 LEU A CB  
2456 C CG  . LEU A 165 ? 0.6283 0.5648 0.5976 0.0138  0.0063  0.0215  236 LEU A CG  
2457 C CD1 . LEU A 165 ? 0.6402 0.5707 0.6126 0.0130  0.0052  0.0319  236 LEU A CD1 
2458 C CD2 . LEU A 165 ? 0.6020 0.5389 0.5660 0.0183  0.0052  0.0202  236 LEU A CD2 
2470 N N   . CYS A 166 ? 0.6279 0.5681 0.6215 0.0065  0.0102  -0.0137 237 CYS A N   
2471 C CA  . CYS A 166 ? 0.6390 0.5775 0.6453 0.0045  0.0109  -0.0255 237 CYS A CA  
2472 C C   . CYS A 166 ? 0.6147 0.5607 0.6109 0.0071  0.0114  -0.0371 237 CYS A C   
2473 O O   . CYS A 166 ? 0.6776 0.6228 0.6827 0.0067  0.0124  -0.0486 237 CYS A O   
2474 C CB  . CYS A 166 ? 0.6845 0.6252 0.7014 -0.0010 0.0099  -0.0283 237 CYS A CB  
2475 S SG  . CYS A 166 ? 0.7226 0.6545 0.7507 -0.0053 0.0111  -0.0136 237 CYS A SG  
2481 N N   . ARG A 167 ? 0.5342 0.4873 0.5122 0.0098  0.0108  -0.0342 238 ARG A N   
2482 C CA  . ARG A 167 ? 0.5580 0.5191 0.5221 0.0120  0.0107  -0.0425 238 ARG A CA  
2483 C C   . ARG A 167 ? 0.7056 0.6651 0.6657 0.0147  0.0152  -0.0457 238 ARG A C   
2484 O O   . ARG A 167 ? 0.8075 0.7610 0.7729 0.0160  0.0177  -0.0395 238 ARG A O   
2485 C CB  . ARG A 167 ? 0.5310 0.4982 0.4783 0.0141  0.0081  -0.0358 238 ARG A CB  
2486 C CG  . ARG A 167 ? 0.5465 0.5228 0.4792 0.0159  0.0056  -0.0430 238 ARG A CG  
2487 C CD  . ARG A 167 ? 0.5913 0.5719 0.5119 0.0183  0.0018  -0.0352 238 ARG A CD  
2488 N NE  . ARG A 167 ? 0.7106 0.6999 0.6187 0.0204  -0.0027 -0.0411 238 ARG A NE  
2489 C CZ  . ARG A 167 ? 0.8367 0.8317 0.7386 0.0225  -0.0082 -0.0378 238 ARG A CZ  
2490 N NH1 . ARG A 167 ? 0.8354 0.8288 0.7428 0.0226  -0.0087 -0.0296 238 ARG A NH1 
2491 N NH2 . ARG A 167 ? 0.9367 0.9394 0.8267 0.0252  -0.0135 -0.0432 238 ARG A NH2 
2505 N N   . ASN A 168 ? 0.6989 0.6654 0.6486 0.0158  0.0163  -0.0557 239 ASN A N   
2506 C CA  . ASN A 168 ? 0.7102 0.6787 0.6506 0.0183  0.0219  -0.0587 239 ASN A CA  
2507 C C   . ASN A 168 ? 0.7063 0.6711 0.6639 0.0181  0.0263  -0.0678 239 ASN A C   
2508 O O   . ASN A 168 ? 0.6940 0.6514 0.6714 0.0166  0.0246  -0.0680 239 ASN A O   
2509 C CB  . ASN A 168 ? 0.7055 0.6715 0.6376 0.0201  0.0240  -0.0459 239 ASN A CB  
2510 C CG  . ASN A 168 ? 0.6974 0.6677 0.6108 0.0213  0.0204  -0.0390 239 ASN A CG  
2511 O OD1 . ASN A 168 ? 0.6984 0.6661 0.6121 0.0217  0.0172  -0.0294 239 ASN A OD1 
2512 N ND2 . ASN A 168 ? 0.6825 0.6598 0.5797 0.0225  0.0204  -0.0444 239 ASN A ND2 
2519 N N   . LYS A 169 ? 0.7251 0.6949 0.6754 0.0198  0.0323  -0.0749 240 LYS A N   
2520 C CA  . LYS A 169 ? 0.7973 0.7663 0.7635 0.0203  0.0370  -0.0873 240 LYS A CA  
2521 C C   . LYS A 169 ? 0.8031 0.7748 0.7655 0.0222  0.0453  -0.0857 240 LYS A C   
2522 O O   . LYS A 169 ? 0.7441 0.7168 0.6933 0.0226  0.0470  -0.0742 240 LYS A O   
2523 C CB  . LYS A 169 ? 0.8927 0.8693 0.8553 0.0199  0.0366  -0.1045 240 LYS A CB  
2524 C CG  . LYS A 169 ? 0.9731 0.9470 0.9473 0.0173  0.0290  -0.1089 240 LYS A CG  
2525 C CD  . LYS A 169 ? 1.0660 1.0469 1.0427 0.0170  0.0282  -0.1292 240 LYS A CD  
2526 C CE  . LYS A 169 ? 1.1433 1.1373 1.0914 0.0185  0.0269  -0.1341 240 LYS A CE  
2527 N NZ  . LYS A 169 ? 1.2042 1.2070 1.1507 0.0196  0.0288  -0.1555 240 LYS A NZ  
2541 N N   . ASN A 170 ? 0.8891 0.8625 0.8657 0.0233  0.0508  -0.0979 241 ASN A N   
2542 C CA  . ASN A 170 ? 0.9508 0.9288 0.9282 0.0248  0.0602  -0.0993 241 ASN A CA  
2543 C C   . ASN A 170 ? 0.8544 0.8272 0.8361 0.0250  0.0600  -0.0837 241 ASN A C   
2544 O O   . ASN A 170 ? 0.8736 0.8504 0.8399 0.0245  0.0645  -0.0760 241 ASN A O   
2545 C CB  . ASN A 170 ? 1.0908 1.0805 1.0418 0.0246  0.0669  -0.1037 241 ASN A CB  
2546 C CG  . ASN A 170 ? 1.2248 1.2223 1.1741 0.0252  0.0689  -0.1233 241 ASN A CG  
2547 O OD1 . ASN A 170 ? 1.2640 1.2667 1.1948 0.0249  0.0648  -0.1276 241 ASN A OD1 
2548 N ND2 . ASN A 170 ? 1.2882 1.2871 1.2584 0.0266  0.0746  -0.1364 241 ASN A ND2 
2555 N N   . PRO A 171 ? 0.7311 0.6946 0.7340 0.0258  0.0546  -0.0789 242 PRO A N   
2556 C CA  . PRO A 171 ? 0.6827 0.6389 0.7054 0.0261  0.0493  -0.0855 242 PRO A CA  
2557 C C   . PRO A 171 ? 0.6792 0.6293 0.6973 0.0238  0.0409  -0.0782 242 PRO A C   
2558 O O   . PRO A 171 ? 0.6465 0.5972 0.6489 0.0228  0.0380  -0.0668 242 PRO A O   
2559 C CB  . PRO A 171 ? 0.6354 0.5847 0.6815 0.0286  0.0482  -0.0811 242 PRO A CB  
2560 C CG  . PRO A 171 ? 0.6226 0.5726 0.6575 0.0285  0.0476  -0.0665 242 PRO A CG  
2561 C CD  . PRO A 171 ? 0.6605 0.6196 0.6702 0.0267  0.0532  -0.0664 242 PRO A CD  
2569 N N   . ALA A 172 ? 0.7104 0.6549 0.7445 0.0228  0.0374  -0.0855 243 ALA A N   
2570 C CA  . ALA A 172 ? 0.6857 0.6240 0.7215 0.0199  0.0306  -0.0788 243 ALA A CA  
2571 C C   . ALA A 172 ? 0.6674 0.5960 0.7122 0.0205  0.0267  -0.0634 243 ALA A C   
2572 O O   . ALA A 172 ? 0.6663 0.5921 0.7207 0.0236  0.0280  -0.0609 243 ALA A O   
2573 C CB  . ALA A 172 ? 0.6802 0.6146 0.7340 0.0181  0.0288  -0.0916 243 ALA A CB  
2579 N N   . PRO A 173 ? 0.6520 0.5764 0.6936 0.0178  0.0220  -0.0534 244 PRO A N   
2580 C CA  . PRO A 173 ? 0.6600 0.5758 0.7073 0.0185  0.0182  -0.0388 244 PRO A CA  
2581 C C   . PRO A 173 ? 0.6931 0.5979 0.7648 0.0202  0.0166  -0.0398 244 PRO A C   
2582 O O   . PRO A 173 ? 0.6679 0.5694 0.7548 0.0191  0.0174  -0.0509 244 PRO A O   
2583 C CB  . PRO A 173 ? 0.6515 0.5665 0.6926 0.0144  0.0152  -0.0314 244 PRO A CB  
2584 C CG  . PRO A 173 ? 0.6361 0.5619 0.6635 0.0126  0.0166  -0.0404 244 PRO A CG  
2585 C CD  . PRO A 173 ? 0.6345 0.5634 0.6672 0.0140  0.0199  -0.0556 244 PRO A CD  
2593 N N   . PRO A 174 ? 0.7077 0.6064 0.7848 0.0232  0.0134  -0.0289 245 PRO A N   
2594 C CA  . PRO A 174 ? 0.7409 0.6281 0.8421 0.0259  0.0104  -0.0286 245 PRO A CA  
2595 C C   . PRO A 174 ? 0.7476 0.6236 0.8598 0.0220  0.0076  -0.0243 245 PRO A C   
2596 O O   . PRO A 174 ? 0.7588 0.6342 0.8596 0.0181  0.0064  -0.0142 245 PRO A O   
2597 C CB  . PRO A 174 ? 0.7417 0.6264 0.8411 0.0299  0.0059  -0.0157 245 PRO A CB  
2598 C CG  . PRO A 174 ? 0.7404 0.6361 0.8179 0.0295  0.0080  -0.0130 245 PRO A CG  
2599 C CD  . PRO A 174 ? 0.7338 0.6353 0.7962 0.0247  0.0112  -0.0165 245 PRO A CD  
2607 N N   . LEU A 175 ? 0.7075 0.7212 0.8558 0.0304  -0.0735 -0.0743 246 LEU A N   
2608 C CA  . LEU A 175 ? 0.7490 0.7302 0.8790 0.0374  -0.0840 -0.0711 246 LEU A CA  
2609 C C   . LEU A 175 ? 0.7649 0.7104 0.8777 0.0370  -0.0931 -0.0649 246 LEU A C   
2610 O O   . LEU A 175 ? 0.7362 0.6532 0.8293 0.0333  -0.0941 -0.0537 246 LEU A O   
2611 C CB  . LEU A 175 ? 0.8275 0.8171 0.9636 0.0524  -0.0986 -0.0880 246 LEU A CB  
2612 C CG  . LEU A 175 ? 0.9036 0.9245 1.0521 0.0543  -0.0912 -0.0939 246 LEU A CG  
2613 C CD1 . LEU A 175 ? 0.9827 1.0111 1.1373 0.0719  -0.1089 -0.1135 246 LEU A CD1 
2614 C CD2 . LEU A 175 ? 0.9035 0.9098 1.0388 0.0472  -0.0818 -0.0790 246 LEU A CD2 
2626 N N   . ASP A 176 ? 0.8375 0.7855 0.9571 0.0401  -0.0999 -0.0725 247 ASP A N   
2627 C CA  . ASP A 176 ? 0.9378 0.8532 1.0407 0.0391  -0.1081 -0.0667 247 ASP A CA  
2628 C C   . ASP A 176 ? 0.8107 0.7124 0.9011 0.0264  -0.0952 -0.0493 247 ASP A C   
2629 O O   . ASP A 176 ? 0.8354 0.7078 0.9049 0.0238  -0.0994 -0.0407 247 ASP A O   
2630 C CB  . ASP A 176 ? 1.1347 1.0607 1.2501 0.0427  -0.1140 -0.0769 247 ASP A CB  
2631 C CG  . ASP A 176 ? 1.3432 1.2825 1.4705 0.0574  -0.1296 -0.0967 247 ASP A CG  
2632 O OD1 . ASP A 176 ? 1.4596 1.3851 1.5778 0.0665  -0.1414 -0.1014 247 ASP A OD1 
2633 O OD2 . ASP A 176 ? 1.3833 1.3468 1.5286 0.0602  -0.1311 -0.1083 247 ASP A OD2 
2638 N N   . ALA A 177 ? 0.7309 0.6540 0.8330 0.0181  -0.0802 -0.0447 248 ALA A N   
2639 C CA  . ALA A 177 ? 0.6765 0.5880 0.7679 0.0083  -0.0696 -0.0306 248 ALA A CA  
2640 C C   . ALA A 177 ? 0.6672 0.5676 0.7450 0.0058  -0.0650 -0.0218 248 ALA A C   
2641 O O   . ALA A 177 ? 0.6425 0.5236 0.7039 0.0015  -0.0636 -0.0128 248 ALA A O   
2642 C CB  . ALA A 177 ? 0.6568 0.5907 0.7621 0.0004  -0.0576 -0.0284 248 ALA A CB  
2648 N N   . VAL A 178 ? 0.6991 0.6135 0.7835 0.0084  -0.0627 -0.0251 249 VAL A N   
2649 C CA  . VAL A 178 ? 0.7260 0.6311 0.7984 0.0060  -0.0587 -0.0173 249 VAL A CA  
2650 C C   . VAL A 178 ? 0.7566 0.6327 0.8090 0.0077  -0.0705 -0.0151 249 VAL A C   
2651 O O   . VAL A 178 ? 0.7507 0.6124 0.7873 0.0010  -0.0669 -0.0054 249 VAL A O   
2652 C CB  . VAL A 178 ? 0.7080 0.6337 0.7916 0.0096  -0.0557 -0.0226 249 VAL A CB  
2653 C CG1 . VAL A 178 ? 0.7024 0.6178 0.7736 0.0074  -0.0525 -0.0151 249 VAL A CG1 
2654 C CG2 . VAL A 178 ? 0.7022 0.6555 0.8016 0.0043  -0.0435 -0.0228 249 VAL A CG2 
2664 N N   . GLU A 179 ? 0.8238 0.6911 0.8753 0.0161  -0.0859 -0.0246 250 GLU A N   
2665 C CA  . GLU A 179 ? 0.8735 0.7086 0.9022 0.0162  -0.0997 -0.0219 250 GLU A CA  
2666 C C   . GLU A 179 ? 0.8414 0.6586 0.8549 0.0087  -0.0992 -0.0137 250 GLU A C   
2667 O O   . GLU A 179 ? 0.8677 0.6626 0.8589 0.0019  -0.1031 -0.0058 250 GLU A O   
2668 C CB  . GLU A 179 ? 0.9873 0.8138 1.0172 0.0283  -0.1191 -0.0351 250 GLU A CB  
2669 C CG  . GLU A 179 ? 1.1495 0.9383 1.1523 0.0278  -0.1363 -0.0319 250 GLU A CG  
2670 C CD  . GLU A 179 ? 1.2664 1.0466 1.2554 0.0196  -0.1315 -0.0218 250 GLU A CD  
2671 O OE1 . GLU A 179 ? 1.3173 1.1120 1.3168 0.0246  -0.1294 -0.0263 250 GLU A OE1 
2672 O OE2 . GLU A 179 ? 1.2941 1.0557 1.2623 0.0077  -0.1294 -0.0099 250 GLU A OE2 
2679 N N   . GLN A 180 ? 0.7831 0.6110 0.8076 0.0086  -0.0941 -0.0154 251 GLN A N   
2680 C CA  . GLN A 180 ? 0.8087 0.6221 0.8197 0.0024  -0.0932 -0.0086 251 GLN A CA  
2681 C C   . GLN A 180 ? 0.7822 0.5999 0.7863 -0.0068 -0.0790 0.0020  251 GLN A C   
2682 O O   . GLN A 180 ? 0.7880 0.5917 0.7739 -0.0132 -0.0795 0.0082  251 GLN A O   
2683 C CB  . GLN A 180 ? 0.8600 0.6837 0.8855 0.0055  -0.0927 -0.0142 251 GLN A CB  
2684 C CG  . GLN A 180 ? 0.9376 0.7454 0.9498 0.0016  -0.0947 -0.0097 251 GLN A CG  
2685 C CD  . GLN A 180 ? 0.9752 0.7923 1.0025 0.0051  -0.0958 -0.0161 251 GLN A CD  
2686 O OE1 . GLN A 180 ? 0.9377 0.7749 0.9854 0.0093  -0.0949 -0.0240 251 GLN A OE1 
2687 N NE2 . GLN A 180 ? 1.0333 0.8377 1.0504 0.0027  -0.0978 -0.0131 251 GLN A NE2 
2696 N N   . ILE A 181 ? 0.7567 0.5950 0.7745 -0.0076 -0.0669 0.0032  252 ILE A N   
2697 C CA  . ILE A 181 ? 0.6836 0.5278 0.6971 -0.0140 -0.0546 0.0110  252 ILE A CA  
2698 C C   . ILE A 181 ? 0.6534 0.4927 0.6537 -0.0185 -0.0529 0.0162  252 ILE A C   
2699 O O   . ILE A 181 ? 0.6171 0.4577 0.6081 -0.0243 -0.0460 0.0217  252 ILE A O   
2700 C CB  . ILE A 181 ? 0.6385 0.5034 0.6699 -0.0134 -0.0442 0.0103  252 ILE A CB  
2701 C CG1 . ILE A 181 ? 0.6489 0.5172 0.6897 -0.0125 -0.0451 0.0072  252 ILE A CG1 
2702 C CG2 . ILE A 181 ? 0.6216 0.4915 0.6480 -0.0178 -0.0336 0.0170  252 ILE A CG2 
2703 C CD1 . ILE A 181 ? 0.6625 0.5495 0.7194 -0.0141 -0.0373 0.0065  252 ILE A CD1 
2715 N N   . LEU A 182 ? 0.6923 0.5279 0.6924 -0.0157 -0.0593 0.0136  253 LEU A N   
2716 C CA  . LEU A 182 ? 0.7503 0.5839 0.7407 -0.0203 -0.0569 0.0184  253 LEU A CA  
2717 C C   . LEU A 182 ? 0.7651 0.5840 0.7324 -0.0302 -0.0587 0.0254  253 LEU A C   
2718 O O   . LEU A 182 ? 0.7398 0.5674 0.7026 -0.0363 -0.0498 0.0302  253 LEU A O   
2719 C CB  . LEU A 182 ? 0.8121 0.6398 0.8039 -0.0146 -0.0671 0.0132  253 LEU A CB  
2720 C CG  . LEU A 182 ? 0.8381 0.6878 0.8484 -0.0093 -0.0595 0.0094  253 LEU A CG  
2721 C CD1 . LEU A 182 ? 0.8836 0.7290 0.8969 -0.0008 -0.0723 0.0009  253 LEU A CD1 
2722 C CD2 . LEU A 182 ? 0.8174 0.6745 0.8239 -0.0154 -0.0484 0.0165  253 LEU A CD2 
2734 N N   . PRO A 183 ? 0.8101 0.6081 0.7613 -0.0330 -0.0703 0.0259  254 PRO A N   
2735 C CA  . PRO A 183 ? 0.7905 0.5773 0.7175 -0.0455 -0.0712 0.0332  254 PRO A CA  
2736 C C   . PRO A 183 ? 0.7683 0.5740 0.6967 -0.0503 -0.0571 0.0360  254 PRO A C   
2737 O O   . PRO A 183 ? 0.7777 0.5898 0.6946 -0.0598 -0.0515 0.0405  254 PRO A O   
2738 C CB  . PRO A 183 ? 0.7972 0.5592 0.7090 -0.0461 -0.0860 0.0323  254 PRO A CB  
2739 C CG  . PRO A 183 ? 0.8140 0.5688 0.7378 -0.0339 -0.0973 0.0243  254 PRO A CG  
2740 C CD  . PRO A 183 ? 0.8215 0.6045 0.7737 -0.0255 -0.0847 0.0194  254 PRO A CD  
2748 N N   . THR A 184 ? 0.7067 0.5221 0.6486 -0.0438 -0.0523 0.0324  255 THR A N   
2749 C CA  . THR A 184 ? 0.7115 0.5437 0.6549 -0.0458 -0.0413 0.0331  255 THR A CA  
2750 C C   . THR A 184 ? 0.7254 0.5759 0.6794 -0.0445 -0.0308 0.0334  255 THR A C   
2751 O O   . THR A 184 ? 0.7111 0.5746 0.6596 -0.0488 -0.0235 0.0344  255 THR A O   
2752 C CB  . THR A 184 ? 0.7227 0.5572 0.6777 -0.0386 -0.0410 0.0291  255 THR A CB  
2753 O OG1 . THR A 184 ? 0.7667 0.5838 0.7110 -0.0396 -0.0513 0.0285  255 THR A OG1 
2754 C CG2 . THR A 184 ? 0.6982 0.5474 0.6541 -0.0384 -0.0324 0.0282  255 THR A CG2 
2762 N N   . LEU A 185 ? 0.7879 0.6409 0.7563 -0.0384 -0.0304 0.0318  256 LEU A N   
2763 C CA  . LEU A 185 ? 0.8086 0.6767 0.7859 -0.0370 -0.0216 0.0323  256 LEU A CA  
2764 C C   . LEU A 185 ? 0.7942 0.6636 0.7590 -0.0447 -0.0203 0.0358  256 LEU A C   
2765 O O   . LEU A 185 ? 0.7883 0.6725 0.7549 -0.0459 -0.0121 0.0361  256 LEU A O   
2766 C CB  . LEU A 185 ? 0.8238 0.6947 0.8171 -0.0303 -0.0224 0.0297  256 LEU A CB  
2767 C CG  . LEU A 185 ? 0.8268 0.7129 0.8333 -0.0268 -0.0133 0.0293  256 LEU A CG  
2768 C CD1 . LEU A 185 ? 0.8356 0.7250 0.8453 -0.0252 -0.0098 0.0288  256 LEU A CD1 
2769 C CD2 . LEU A 185 ? 0.8215 0.7120 0.8417 -0.0223 -0.0150 0.0262  256 LEU A CD2 
2781 N N   . VAL A 186 ? 0.7959 0.6486 0.7470 -0.0503 -0.0298 0.0381  257 VAL A N   
2782 C CA  . VAL A 186 ? 0.8043 0.6557 0.7407 -0.0605 -0.0301 0.0423  257 VAL A CA  
2783 C C   . VAL A 186 ? 0.7950 0.6587 0.7195 -0.0700 -0.0235 0.0441  257 VAL A C   
2784 O O   . VAL A 186 ? 0.8074 0.6871 0.7302 -0.0752 -0.0163 0.0448  257 VAL A O   
2785 C CB  . VAL A 186 ? 0.8564 0.6817 0.7768 -0.0653 -0.0447 0.0448  257 VAL A CB  
2786 C CG1 . VAL A 186 ? 0.8856 0.7068 0.7863 -0.0798 -0.0462 0.0506  257 VAL A CG1 
2787 C CG2 . VAL A 186 ? 0.8446 0.6640 0.7786 -0.0543 -0.0510 0.0404  257 VAL A CG2 
2797 N N   . ARG A 187 ? 0.7652 0.6243 0.6819 -0.0720 -0.0260 0.0437  258 ARG A N   
2798 C CA  . ARG A 187 ? 0.7816 0.6571 0.6881 -0.0799 -0.0195 0.0433  258 ARG A CA  
2799 C C   . ARG A 187 ? 0.7369 0.6381 0.6591 -0.0718 -0.0084 0.0379  258 ARG A C   
2800 O O   . ARG A 187 ? 0.6944 0.6161 0.6122 -0.0776 -0.0017 0.0362  258 ARG A O   
2801 C CB  . ARG A 187 ? 0.8593 0.7258 0.7566 -0.0810 -0.0244 0.0426  258 ARG A CB  
2802 C CG  . ARG A 187 ? 0.9443 0.7837 0.8201 -0.0907 -0.0370 0.0480  258 ARG A CG  
2803 C CD  . ARG A 187 ? 1.0031 0.8350 0.8710 -0.0903 -0.0413 0.0467  258 ARG A CD  
2804 N NE  . ARG A 187 ? 1.0513 0.9055 0.9101 -0.0979 -0.0331 0.0452  258 ARG A NE  
2805 C CZ  . ARG A 187 ? 1.0973 0.9588 0.9576 -0.0932 -0.0314 0.0407  258 ARG A CZ  
2806 N NH1 . ARG A 187 ? 1.1030 0.9500 0.9737 -0.0817 -0.0371 0.0382  258 ARG A NH1 
2807 N NH2 . ARG A 187 ? 1.1247 1.0104 0.9766 -0.0998 -0.0242 0.0377  258 ARG A NH2 
2821 N N   . LEU A 188 ? 0.7650 0.6654 0.7049 -0.0589 -0.0073 0.0346  259 LEU A N   
2822 C CA  . LEU A 188 ? 0.7444 0.6637 0.6961 -0.0510 0.0004  0.0296  259 LEU A CA  
2823 C C   . LEU A 188 ? 0.7383 0.6697 0.6943 -0.0516 0.0058  0.0298  259 LEU A C   
2824 O O   . LEU A 188 ? 0.7366 0.6871 0.6954 -0.0487 0.0116  0.0250  259 LEU A O   
2825 C CB  . LEU A 188 ? 0.7241 0.6360 0.6904 -0.0400 -0.0012 0.0277  259 LEU A CB  
2826 C CG  . LEU A 188 ? 0.7273 0.6317 0.6907 -0.0379 -0.0057 0.0256  259 LEU A CG  
2827 C CD1 . LEU A 188 ? 0.7685 0.6636 0.7459 -0.0301 -0.0083 0.0250  259 LEU A CD1 
2828 C CD2 . LEU A 188 ? 0.6988 0.6187 0.6571 -0.0363 -0.0026 0.0200  259 LEU A CD2 
2840 N N   . LEU A 189 ? 0.7329 0.6538 0.6895 -0.0542 0.0031  0.0341  260 LEU A N   
2841 C CA  . LEU A 189 ? 0.7210 0.6514 0.6815 -0.0547 0.0074  0.0345  260 LEU A CA  
2842 C C   . LEU A 189 ? 0.7508 0.6958 0.6988 -0.0660 0.0108  0.0347  260 LEU A C   
2843 O O   . LEU A 189 ? 0.7518 0.7112 0.7041 -0.0657 0.0158  0.0331  260 LEU A O   
2844 C CB  . LEU A 189 ? 0.7079 0.6223 0.6707 -0.0544 0.0017  0.0381  260 LEU A CB  
2845 C CG  . LEU A 189 ? 0.7076 0.6282 0.6801 -0.0501 0.0052  0.0379  260 LEU A CG  
2846 C CD1 . LEU A 189 ? 0.6884 0.6190 0.6751 -0.0400 0.0111  0.0347  260 LEU A CD1 
2847 C CD2 . LEU A 189 ? 0.7284 0.6330 0.7025 -0.0484 -0.0026 0.0394  260 LEU A CD2 
2859 N N   . HIS A 190 ? 0.7575 0.7003 0.6895 -0.0770 0.0079  0.0366  261 HIS A N   
2860 C CA  . HIS A 190 ? 0.7815 0.7419 0.6999 -0.0910 0.0115  0.0367  261 HIS A CA  
2861 C C   . HIS A 190 ? 0.8400 0.8268 0.7588 -0.0894 0.0178  0.0289  261 HIS A C   
2862 O O   . HIS A 190 ? 0.9039 0.9132 0.8128 -0.1011 0.0222  0.0268  261 HIS A O   
2863 C CB  . HIS A 190 ? 0.7719 0.7132 0.6681 -0.1073 0.0034  0.0442  261 HIS A CB  
2864 C CG  . HIS A 190 ? 0.8123 0.7326 0.7039 -0.1116 -0.0038 0.0503  261 HIS A CG  
2865 N ND1 . HIS A 190 ? 0.8619 0.7576 0.7606 -0.1016 -0.0119 0.0517  261 HIS A ND1 
2866 C CD2 . HIS A 190 ? 0.8240 0.7461 0.7058 -0.1238 -0.0045 0.0541  261 HIS A CD2 
2867 C CE1 . HIS A 190 ? 0.8900 0.7722 0.7829 -0.1063 -0.0182 0.0555  261 HIS A CE1 
2868 N NE2 . HIS A 190 ? 0.8682 0.7642 0.7503 -0.1202 -0.0141 0.0577  261 HIS A NE2 
2876 N N   . HIS A 191 ? 0.8238 0.8098 0.7532 -0.0757 0.0178  0.0239  262 HIS A N   
2877 C CA  . HIS A 191 ? 0.8714 0.8823 0.8024 -0.0709 0.0220  0.0144  262 HIS A CA  
2878 C C   . HIS A 191 ? 0.9809 1.0187 0.9207 -0.0658 0.0283  0.0068  262 HIS A C   
2879 O O   . HIS A 191 ? 1.0083 1.0444 0.9526 -0.0667 0.0298  0.0098  262 HIS A O   
2880 C CB  . HIS A 191 ? 0.8360 0.8353 0.7760 -0.0568 0.0184  0.0111  262 HIS A CB  
2881 C CG  . HIS A 191 ? 0.8315 0.8499 0.7684 -0.0530 0.0194  0.0018  262 HIS A CG  
2882 N ND1 . HIS A 191 ? 0.8249 0.8566 0.7722 -0.0382 0.0197  -0.0084 262 HIS A ND1 
2883 C CD2 . HIS A 191 ? 0.8404 0.8671 0.7638 -0.0616 0.0190  0.0003  262 HIS A CD2 
2884 C CE1 . HIS A 191 ? 0.8341 0.8828 0.7760 -0.0365 0.0194  -0.0169 262 HIS A CE1 
2885 N NE2 . HIS A 191 ? 0.8431 0.8906 0.7707 -0.0511 0.0198  -0.0116 262 HIS A NE2 
2893 N N   . ASN A 192 ? 1.0841 1.1477 1.0260 -0.0594 0.0309  -0.0045 263 ASN A N   
2894 C CA  . ASN A 192 ? 1.1619 1.2550 1.1110 -0.0543 0.0357  -0.0143 263 ASN A CA  
2895 C C   . ASN A 192 ? 1.0661 1.1583 1.0286 -0.0336 0.0327  -0.0230 263 ASN A C   
2896 O O   . ASN A 192 ? 1.1581 1.2652 1.1279 -0.0267 0.0345  -0.0295 263 ASN A O   
2897 C CB  . ASN A 192 ? 1.3345 1.4655 1.2751 -0.0630 0.0403  -0.0237 263 ASN A CB  
2898 C CG  . ASN A 192 ? 1.4997 1.6657 1.4485 -0.0578 0.0448  -0.0359 263 ASN A CG  
2899 O OD1 . ASN A 192 ? 1.5611 1.7418 1.5192 -0.0406 0.0428  -0.0491 263 ASN A OD1 
2900 N ND2 . ASN A 192 ? 1.5670 1.7450 1.5121 -0.0718 0.0494  -0.0319 263 ASN A ND2 
2907 N N   . ASP A 193 ? 0.8731 0.9466 0.8378 -0.0240 0.0271  -0.0232 264 ASP A N   
2908 C CA  . ASP A 193 ? 0.7696 0.8386 0.7433 -0.0059 0.0220  -0.0312 264 ASP A CA  
2909 C C   . ASP A 193 ? 0.7180 0.7676 0.6992 -0.0015 0.0211  -0.0245 264 ASP A C   
2910 O O   . ASP A 193 ? 0.6566 0.6838 0.6383 -0.0079 0.0213  -0.0129 264 ASP A O   
2911 C CB  . ASP A 193 ? 0.7954 0.8456 0.7680 0.0010  0.0153  -0.0315 264 ASP A CB  
2912 C CG  . ASP A 193 ? 0.8663 0.9092 0.8447 0.0188  0.0075  -0.0400 264 ASP A CG  
2913 O OD1 . ASP A 193 ? 0.9079 0.9725 0.8859 0.0286  0.0047  -0.0543 264 ASP A OD1 
2914 O OD2 . ASP A 193 ? 0.8835 0.8993 0.8658 0.0227  0.0032  -0.0331 264 ASP A OD2 
2919 N N   . PRO A 194 ? 0.8021 0.8601 0.7888 0.0097  0.0195  -0.0323 265 PRO A N   
2920 C CA  . PRO A 194 ? 0.7847 0.8245 0.7765 0.0126  0.0187  -0.0254 265 PRO A CA  
2921 C C   . PRO A 194 ? 0.7484 0.7559 0.7416 0.0142  0.0140  -0.0163 265 PRO A C   
2922 O O   . PRO A 194 ? 0.7693 0.7634 0.7652 0.0086  0.0164  -0.0066 265 PRO A O   
2923 C CB  . PRO A 194 ? 0.8263 0.8781 0.8211 0.0269  0.0147  -0.0376 265 PRO A CB  
2924 C CG  . PRO A 194 ? 0.8561 0.9425 0.8494 0.0276  0.0169  -0.0507 265 PRO A CG  
2925 C CD  . PRO A 194 ? 0.8557 0.9414 0.8436 0.0206  0.0175  -0.0486 265 PRO A CD  
2933 N N   . GLU A 195 ? 0.6981 0.6945 0.6897 0.0217  0.0070  -0.0200 266 GLU A N   
2934 C CA  . GLU A 195 ? 0.7142 0.6819 0.7071 0.0220  0.0022  -0.0118 266 GLU A CA  
2935 C C   . GLU A 195 ? 0.6425 0.6016 0.6361 0.0107  0.0057  -0.0023 266 GLU A C   
2936 O O   . GLU A 195 ? 0.6373 0.5809 0.6347 0.0069  0.0058  0.0060  266 GLU A O   
2937 C CB  . GLU A 195 ? 0.8644 0.8209 0.8540 0.0323  -0.0077 -0.0184 266 GLU A CB  
2938 C CG  . GLU A 195 ? 1.0167 0.9726 1.0041 0.0456  -0.0154 -0.0276 266 GLU A CG  
2939 C CD  . GLU A 195 ? 1.1677 1.1085 1.1500 0.0565  -0.0280 -0.0346 266 GLU A CD  
2940 O OE1 . GLU A 195 ? 1.2287 1.1498 1.2098 0.0522  -0.0313 -0.0280 266 GLU A OE1 
2941 O OE2 . GLU A 195 ? 1.2187 1.1677 1.1982 0.0701  -0.0356 -0.0478 266 GLU A OE2 
2948 N N   . VAL A 196 ? 0.6114 0.5812 0.6008 0.0053  0.0078  -0.0041 267 VAL A N   
2949 C CA  . VAL A 196 ? 0.6285 0.5889 0.6166 -0.0049 0.0093  0.0040  267 VAL A CA  
2950 C C   . VAL A 196 ? 0.6207 0.5798 0.6115 -0.0115 0.0136  0.0109  267 VAL A C   
2951 O O   . VAL A 196 ? 0.6018 0.5465 0.5965 -0.0144 0.0124  0.0173  267 VAL A O   
2952 C CB  . VAL A 196 ? 0.6503 0.6229 0.6296 -0.0110 0.0104  0.0010  267 VAL A CB  
2953 C CG1 . VAL A 196 ? 0.6343 0.5955 0.6089 -0.0222 0.0105  0.0094  267 VAL A CG1 
2954 C CG2 . VAL A 196 ? 0.6909 0.6617 0.6683 -0.0035 0.0051  -0.0056 267 VAL A CG2 
2964 N N   . LEU A 197 ? 0.6565 0.6322 0.6456 -0.0134 0.0180  0.0084  268 LEU A N   
2965 C CA  . LEU A 197 ? 0.6693 0.6433 0.6604 -0.0191 0.0211  0.0143  268 LEU A CA  
2966 C C   . LEU A 197 ? 0.6556 0.6174 0.6550 -0.0137 0.0202  0.0178  268 LEU A C   
2967 O O   . LEU A 197 ? 0.6671 0.6204 0.6696 -0.0175 0.0204  0.0234  268 LEU A O   
2968 C CB  . LEU A 197 ? 0.6918 0.6868 0.6805 -0.0217 0.0256  0.0103  268 LEU A CB  
2969 C CG  . LEU A 197 ? 0.7343 0.7450 0.7130 -0.0320 0.0276  0.0082  268 LEU A CG  
2970 C CD1 . LEU A 197 ? 0.7316 0.7689 0.7102 -0.0333 0.0324  0.0017  268 LEU A CD1 
2971 C CD2 . LEU A 197 ? 0.7665 0.7623 0.7379 -0.0440 0.0258  0.0172  268 LEU A CD2 
2983 N N   . ALA A 198 ? 0.6453 0.6061 0.6470 -0.0050 0.0184  0.0139  269 ALA A N   
2984 C CA  . ALA A 198 ? 0.6318 0.5811 0.6383 -0.0021 0.0174  0.0180  269 ALA A CA  
2985 C C   . ALA A 198 ? 0.6317 0.5666 0.6417 -0.0059 0.0152  0.0236  269 ALA A C   
2986 O O   . ALA A 198 ? 0.6229 0.5553 0.6377 -0.0093 0.0171  0.0281  269 ALA A O   
2987 C CB  . ALA A 198 ? 0.6382 0.5841 0.6424 0.0072  0.0130  0.0131  269 ALA A CB  
2993 N N   . ASP A 199 ? 0.6410 0.5688 0.6492 -0.0049 0.0111  0.0221  270 ASP A N   
2994 C CA  . ASP A 199 ? 0.6624 0.5788 0.6748 -0.0086 0.0087  0.0263  270 ASP A CA  
2995 C C   . ASP A 199 ? 0.6341 0.5524 0.6492 -0.0142 0.0102  0.0287  270 ASP A C   
2996 O O   . ASP A 199 ? 0.6334 0.5484 0.6549 -0.0166 0.0097  0.0312  270 ASP A O   
2997 C CB  . ASP A 199 ? 0.7345 0.6424 0.7441 -0.0060 0.0030  0.0236  270 ASP A CB  
2998 C CG  . ASP A 199 ? 0.8132 0.7126 0.8191 0.0000  -0.0020 0.0215  270 ASP A CG  
2999 O OD1 . ASP A 199 ? 0.8543 0.7518 0.8601 0.0006  -0.0012 0.0236  270 ASP A OD1 
3000 O OD2 . ASP A 199 ? 0.8413 0.7342 0.8432 0.0045  -0.0081 0.0173  270 ASP A OD2 
3005 N N   . SER A 200 ? 0.6141 0.5380 0.6233 -0.0168 0.0110  0.0274  271 SER A N   
3006 C CA  . SER A 200 ? 0.6303 0.5511 0.6386 -0.0220 0.0097  0.0298  271 SER A CA  
3007 C C   . SER A 200 ? 0.5918 0.5155 0.6057 -0.0221 0.0119  0.0318  271 SER A C   
3008 O O   . SER A 200 ? 0.6033 0.5227 0.6220 -0.0228 0.0090  0.0324  271 SER A O   
3009 C CB  . SER A 200 ? 0.6749 0.5997 0.6718 -0.0273 0.0096  0.0293  271 SER A CB  
3010 O OG  . SER A 200 ? 0.7168 0.6407 0.7079 -0.0275 0.0075  0.0269  271 SER A OG  
3016 N N   . CYS A 201 ? 0.5718 0.5040 0.5856 -0.0206 0.0162  0.0315  272 CYS A N   
3017 C CA  . CYS A 201 ? 0.5977 0.5334 0.6167 -0.0200 0.0184  0.0330  272 CYS A CA  
3018 C C   . CYS A 201 ? 0.5951 0.5290 0.6226 -0.0181 0.0186  0.0340  272 CYS A C   
3019 O O   . CYS A 201 ? 0.6194 0.5562 0.6527 -0.0184 0.0185  0.0341  272 CYS A O   
3020 C CB  . CYS A 201 ? 0.6430 0.5879 0.6598 -0.0180 0.0226  0.0319  272 CYS A CB  
3021 S SG  . CYS A 201 ? 0.6856 0.6384 0.6938 -0.0238 0.0234  0.0310  272 CYS A SG  
3027 N N   . TRP A 202 ? 0.5794 0.5095 0.6069 -0.0167 0.0182  0.0342  273 TRP A N   
3028 C CA  . TRP A 202 ? 0.5642 0.4931 0.5977 -0.0183 0.0182  0.0361  273 TRP A CA  
3029 C C   . TRP A 202 ? 0.5508 0.4806 0.5910 -0.0206 0.0156  0.0348  273 TRP A C   
3030 O O   . TRP A 202 ? 0.5340 0.4718 0.5818 -0.0222 0.0167  0.0342  273 TRP A O   
3031 C CB  . TRP A 202 ? 0.5817 0.5015 0.6109 -0.0179 0.0157  0.0371  273 TRP A CB  
3032 C CG  . TRP A 202 ? 0.6085 0.5264 0.6321 -0.0150 0.0164  0.0380  273 TRP A CG  
3033 C CD1 . TRP A 202 ? 0.6421 0.5560 0.6586 -0.0092 0.0137  0.0349  273 TRP A CD1 
3034 C CD2 . TRP A 202 ? 0.6182 0.5388 0.6423 -0.0171 0.0191  0.0410  273 TRP A CD2 
3035 N NE1 . TRP A 202 ? 0.6535 0.5652 0.6657 -0.0067 0.0135  0.0357  273 TRP A NE1 
3036 C CE2 . TRP A 202 ? 0.6412 0.5559 0.6572 -0.0122 0.0170  0.0403  273 TRP A CE2 
3037 C CE3 . TRP A 202 ? 0.6211 0.5501 0.6514 -0.0221 0.0225  0.0433  273 TRP A CE3 
3038 C CZ2 . TRP A 202 ? 0.6586 0.5721 0.6710 -0.0129 0.0181  0.0431  273 TRP A CZ2 
3039 C CZ3 . TRP A 202 ? 0.6471 0.5778 0.6742 -0.0235 0.0248  0.0460  273 TRP A CZ3 
3040 C CH2 . TRP A 202 ? 0.6629 0.5843 0.6804 -0.0193 0.0224  0.0466  273 TRP A CH2 
3051 N N   . ALA A 203 ? 0.5349 0.4584 0.5723 -0.0205 0.0116  0.0332  274 ALA A N   
3052 C CA  . ALA A 203 ? 0.5431 0.4660 0.5862 -0.0212 0.0073  0.0307  274 ALA A CA  
3053 C C   . ALA A 203 ? 0.5701 0.4983 0.6166 -0.0197 0.0060  0.0284  274 ALA A C   
3054 O O   . ALA A 203 ? 0.5763 0.5124 0.6321 -0.0188 0.0044  0.0248  274 ALA A O   
3055 C CB  . ALA A 203 ? 0.5301 0.4430 0.5667 -0.0211 0.0025  0.0297  274 ALA A CB  
3061 N N   . ILE A 204 ? 0.6063 0.5315 0.6450 -0.0195 0.0059  0.0295  275 ILE A N   
3062 C CA  . ILE A 204 ? 0.6241 0.5508 0.6640 -0.0178 0.0025  0.0273  275 ILE A CA  
3063 C C   . ILE A 204 ? 0.5901 0.5306 0.6399 -0.0156 0.0069  0.0258  275 ILE A C   
3064 O O   . ILE A 204 ? 0.5574 0.5040 0.6139 -0.0123 0.0031  0.0208  275 ILE A O   
3065 C CB  . ILE A 204 ? 0.6447 0.5657 0.6731 -0.0203 0.0019  0.0298  275 ILE A CB  
3066 C CG1 . ILE A 204 ? 0.6778 0.5879 0.6943 -0.0248 -0.0017 0.0315  275 ILE A CG1 
3067 C CG2 . ILE A 204 ? 0.6553 0.5739 0.6835 -0.0184 -0.0038 0.0275  275 ILE A CG2 
3068 C CD1 . ILE A 204 ? 0.6970 0.5942 0.7097 -0.0247 -0.0117 0.0296  275 ILE A CD1 
3080 N N   . SER A 205 ? 0.5822 0.5280 0.6319 -0.0170 0.0139  0.0292  276 SER A N   
3081 C CA  . SER A 205 ? 0.5891 0.5476 0.6456 -0.0165 0.0182  0.0286  276 SER A CA  
3082 C C   . SER A 205 ? 0.5852 0.5542 0.6515 -0.0183 0.0180  0.0255  276 SER A C   
3083 O O   . SER A 205 ? 0.5959 0.5799 0.6699 -0.0172 0.0191  0.0215  276 SER A O   
3084 C CB  . SER A 205 ? 0.5918 0.5498 0.6432 -0.0179 0.0238  0.0332  276 SER A CB  
3085 O OG  . SER A 205 ? 0.5975 0.5526 0.6483 -0.0215 0.0248  0.0357  276 SER A OG  
3091 N N   . TYR A 206 ? 0.5604 0.5240 0.6270 -0.0212 0.0163  0.0262  277 TYR A N   
3092 C CA  . TYR A 206 ? 0.5412 0.5170 0.6179 -0.0241 0.0156  0.0224  277 TYR A CA  
3093 C C   . TYR A 206 ? 0.5278 0.5109 0.6125 -0.0184 0.0093  0.0137  277 TYR A C   
3094 O O   . TYR A 206 ? 0.5018 0.5049 0.5971 -0.0177 0.0097  0.0072  277 TYR A O   
3095 C CB  . TYR A 206 ? 0.5609 0.5270 0.6355 -0.0283 0.0138  0.0250  277 TYR A CB  
3096 C CG  . TYR A 206 ? 0.5840 0.5385 0.6491 -0.0321 0.0165  0.0320  277 TYR A CG  
3097 C CD1 . TYR A 206 ? 0.5614 0.5193 0.6229 -0.0353 0.0210  0.0360  277 TYR A CD1 
3098 C CD2 . TYR A 206 ? 0.6357 0.5750 0.6945 -0.0317 0.0129  0.0338  277 TYR A CD2 
3099 C CE1 . TYR A 206 ? 0.5963 0.5403 0.6475 -0.0372 0.0205  0.0413  277 TYR A CE1 
3100 C CE2 . TYR A 206 ? 0.6665 0.5943 0.7164 -0.0330 0.0128  0.0382  277 TYR A CE2 
3101 C CZ  . TYR A 206 ? 0.6560 0.5848 0.7016 -0.0354 0.0158  0.0419  277 TYR A CZ  
3102 O OH  . TYR A 206 ? 0.6867 0.6006 0.7217 -0.0352 0.0129  0.0452  277 TYR A OH  
3112 N N   . LEU A 207 ? 0.5356 0.5030 0.6142 -0.0142 0.0023  0.0127  278 LEU A N   
3113 C CA  . LEU A 207 ? 0.5739 0.5423 0.6571 -0.0079 -0.0070 0.0041  278 LEU A CA  
3114 C C   . LEU A 207 ? 0.6192 0.5968 0.7056 -0.0022 -0.0092 -0.0012 278 LEU A C   
3115 O O   . LEU A 207 ? 0.6791 0.6668 0.7741 0.0044  -0.0164 -0.0114 278 LEU A O   
3116 C CB  . LEU A 207 ? 0.5912 0.5362 0.6624 -0.0066 -0.0151 0.0058  278 LEU A CB  
3117 C CG  . LEU A 207 ? 0.6168 0.5531 0.6850 -0.0105 -0.0147 0.0092  278 LEU A CG  
3118 C CD1 . LEU A 207 ? 0.6337 0.5487 0.6877 -0.0104 -0.0220 0.0113  278 LEU A CD1 
3119 C CD2 . LEU A 207 ? 0.6371 0.5852 0.7181 -0.0099 -0.0171 0.0027  278 LEU A CD2 
3131 N N   . THR A 208 ? 0.6227 0.5980 0.7031 -0.0034 -0.0042 0.0041  279 THR A N   
3132 C CA  . THR A 208 ? 0.6325 0.6158 0.7155 0.0023  -0.0067 -0.0010 279 THR A CA  
3133 C C   . THR A 208 ? 0.6496 0.6595 0.7438 0.0017  0.0011  -0.0043 279 THR A C   
3134 O O   . THR A 208 ? 0.6379 0.6583 0.7357 0.0071  -0.0005 -0.0098 279 THR A O   
3135 C CB  . THR A 208 ? 0.6497 0.6187 0.7207 0.0010  -0.0057 0.0056  279 THR A CB  
3136 O OG1 . THR A 208 ? 0.6441 0.6144 0.7117 -0.0051 0.0047  0.0138  279 THR A OG1 
3137 C CG2 . THR A 208 ? 0.6715 0.6167 0.7297 0.0001  -0.0148 0.0078  279 THR A CG2 
3145 N N   . ASP A 209 ? 0.6578 0.6782 0.7561 -0.0057 0.0087  -0.0010 280 ASP A N   
3146 C CA  . ASP A 209 ? 0.7317 0.7777 0.8379 -0.0099 0.0162  -0.0029 280 ASP A CA  
3147 C C   . ASP A 209 ? 0.7631 0.8328 0.8834 -0.0074 0.0125  -0.0150 280 ASP A C   
3148 O O   . ASP A 209 ? 0.8291 0.9062 0.9543 -0.0139 0.0141  -0.0151 280 ASP A O   
3149 C CB  . ASP A 209 ? 0.7904 0.8320 0.8905 -0.0209 0.0243  0.0074  280 ASP A CB  
3150 C CG  . ASP A 209 ? 0.8895 0.9526 0.9919 -0.0280 0.0319  0.0083  280 ASP A CG  
3151 O OD1 . ASP A 209 ? 0.8821 0.9646 0.9909 -0.0234 0.0326  0.0012  280 ASP A OD1 
3152 O OD2 . ASP A 209 ? 0.9792 1.0385 1.0754 -0.0384 0.0364  0.0162  280 ASP A OD2 
3157 N N   . GLY A 210 ? 0.7119 0.7943 0.8392 0.0027  0.0063  -0.0263 281 GLY A N   
3158 C CA  . GLY A 210 ? 0.7144 0.8213 0.8560 0.0083  0.0006  -0.0410 281 GLY A CA  
3159 C C   . GLY A 210 ? 0.7137 0.8239 0.8589 0.0232  -0.0109 -0.0539 281 GLY A C   
3160 O O   . GLY A 210 ? 0.7006 0.7992 0.8383 0.0272  -0.0121 -0.0509 281 GLY A O   
3164 N N   . PRO A 211 ? 0.7173 0.8420 0.8736 0.0323  -0.0209 -0.0692 282 PRO A N   
3165 C CA  . PRO A 211 ? 0.7061 0.8341 0.8660 0.0486  -0.0348 -0.0842 282 PRO A CA  
3166 C C   . PRO A 211 ? 0.6824 0.7669 0.8253 0.0543  -0.0470 -0.0782 282 PRO A C   
3167 O O   . PRO A 211 ? 0.6622 0.7170 0.7928 0.0473  -0.0468 -0.0658 282 PRO A O   
3168 C CB  . PRO A 211 ? 0.7450 0.8935 0.9191 0.0568  -0.0444 -0.1015 282 PRO A CB  
3169 C CG  . PRO A 211 ? 0.7554 0.9176 0.9352 0.0423  -0.0325 -0.0949 282 PRO A CG  
3170 C CD  . PRO A 211 ? 0.7388 0.8715 0.9032 0.0295  -0.0227 -0.0737 282 PRO A CD  
3178 N N   . ASN A 212 ? 0.7369 0.8184 0.8784 0.0668  -0.0589 -0.0879 283 ASN A N   
3179 C CA  . ASN A 212 ? 0.7922 0.8318 0.9155 0.0707  -0.0724 -0.0825 283 ASN A CA  
3180 C C   . ASN A 212 ? 0.7847 0.7956 0.8989 0.0718  -0.0853 -0.0821 283 ASN A C   
3181 O O   . ASN A 212 ? 0.8311 0.8054 0.9265 0.0665  -0.0907 -0.0707 283 ASN A O   
3182 C CB  . ASN A 212 ? 0.8789 0.9200 1.0027 0.0856  -0.0869 -0.0961 283 ASN A CB  
3183 C CG  . ASN A 212 ? 0.9610 1.0167 1.0862 0.0831  -0.0759 -0.0921 283 ASN A CG  
3184 O OD1 . ASN A 212 ? 0.9362 1.0085 1.0651 0.0714  -0.0571 -0.0821 283 ASN A OD1 
3185 N ND2 . ASN A 212 ? 1.0583 1.1051 1.1789 0.0941  -0.0888 -0.0998 283 ASN A ND2 
3192 N N   . GLU A 213 ? 0.7010 0.7291 0.8276 0.0779  -0.0905 -0.0946 284 GLU A N   
3193 C CA  . GLU A 213 ? 0.7390 0.7404 0.8572 0.0795  -0.1032 -0.0948 284 GLU A CA  
3194 C C   . GLU A 213 ? 0.6943 0.6748 0.8006 0.0637  -0.0918 -0.0755 284 GLU A C   
3195 O O   . GLU A 213 ? 0.6785 0.6228 0.7665 0.0609  -0.1012 -0.0680 284 GLU A O   
3196 C CB  . GLU A 213 ? 0.8918 0.9226 1.0288 0.0874  -0.1073 -0.1117 284 GLU A CB  
3197 C CG  . GLU A 213 ? 1.0574 1.1327 1.2148 0.0996  -0.1088 -0.1321 284 GLU A CG  
3198 C CD  . GLU A 213 ? 1.2133 1.2751 1.3653 0.1179  -0.1306 -0.1464 284 GLU A CD  
3199 O OE1 . GLU A 213 ? 1.2290 1.3074 1.3923 0.1342  -0.1461 -0.1681 284 GLU A OE1 
3200 O OE2 . GLU A 213 ? 1.3011 1.3360 1.4376 0.1164  -0.1334 -0.1368 284 GLU A OE2 
3207 N N   . ARG A 214 ? 0.7456 0.7483 0.8608 0.0528  -0.0724 -0.0677 285 ARG A N   
3208 C CA  . ARG A 214 ? 0.7907 0.7759 0.8955 0.0395  -0.0621 -0.0511 285 ARG A CA  
3209 C C   . ARG A 214 ? 0.7344 0.6952 0.8218 0.0342  -0.0603 -0.0386 285 ARG A C   
3210 O O   . ARG A 214 ? 0.7301 0.6664 0.8030 0.0270  -0.0605 -0.0283 285 ARG A O   
3211 C CB  . ARG A 214 ? 0.8715 0.8837 0.9880 0.0299  -0.0445 -0.0465 285 ARG A CB  
3212 C CG  . ARG A 214 ? 0.9663 0.9958 1.0956 0.0292  -0.0446 -0.0537 285 ARG A CG  
3213 C CD  . ARG A 214 ? 1.0272 1.0659 1.1589 0.0156  -0.0296 -0.0433 285 ARG A CD  
3214 N NE  . ARG A 214 ? 1.0457 1.0793 1.1796 0.0129  -0.0325 -0.0438 285 ARG A NE  
3215 C CZ  . ARG A 214 ? 1.0097 1.0631 1.1573 0.0174  -0.0383 -0.0568 285 ARG A CZ  
3216 N NH1 . ARG A 214 ? 1.0132 1.0951 1.1741 0.0253  -0.0419 -0.0714 285 ARG A NH1 
3217 N NH2 . ARG A 214 ? 0.9639 1.0108 1.1127 0.0146  -0.0410 -0.0566 285 ARG A NH2 
3231 N N   . ILE A 215 ? 0.6906 0.6596 0.7793 0.0372  -0.0585 -0.0402 286 ILE A N   
3232 C CA  . ILE A 215 ? 0.6715 0.6193 0.7445 0.0319  -0.0574 -0.0295 286 ILE A CA  
3233 C C   . ILE A 215 ? 0.6869 0.6001 0.7418 0.0332  -0.0746 -0.0286 286 ILE A C   
3234 O O   . ILE A 215 ? 0.6781 0.5703 0.7168 0.0234  -0.0731 -0.0170 286 ILE A O   
3235 C CB  . ILE A 215 ? 0.6780 0.6410 0.7562 0.0360  -0.0539 -0.0325 286 ILE A CB  
3236 C CG1 . ILE A 215 ? 0.6528 0.6443 0.7427 0.0302  -0.0356 -0.0289 286 ILE A CG1 
3237 C CG2 . ILE A 215 ? 0.7009 0.6403 0.7625 0.0315  -0.0566 -0.0237 286 ILE A CG2 
3238 C CD1 . ILE A 215 ? 0.6454 0.6565 0.7417 0.0345  -0.0315 -0.0333 286 ILE A CD1 
3250 N N   . GLU A 216 ? 0.7241 0.6311 0.7802 0.0446  -0.0920 -0.0412 287 GLU A N   
3251 C CA  . GLU A 216 ? 0.8187 0.6878 0.8539 0.0456  -0.1116 -0.0404 287 GLU A CA  
3252 C C   . GLU A 216 ? 0.8508 0.7003 0.8742 0.0369  -0.1126 -0.0323 287 GLU A C   
3253 O O   . GLU A 216 ? 0.8677 0.6859 0.8685 0.0288  -0.1207 -0.0236 287 GLU A O   
3254 C CB  . GLU A 216 ? 0.9176 0.7841 0.9569 0.0624  -0.1324 -0.0578 287 GLU A CB  
3255 C CG  . GLU A 216 ? 1.0553 0.8773 1.0693 0.0638  -0.1562 -0.0570 287 GLU A CG  
3256 C CD  . GLU A 216 ? 1.1510 0.9551 1.1491 0.0560  -0.1570 -0.0472 287 GLU A CD  
3257 O OE1 . GLU A 216 ? 1.1598 0.9858 1.1700 0.0608  -0.1498 -0.0511 287 GLU A OE1 
3258 O OE2 . GLU A 216 ? 1.2068 0.9763 1.1799 0.0440  -0.1646 -0.0355 287 GLU A OE2 
3265 N N   . MET A 217 ? 0.8724 0.7401 0.9096 0.0375  -0.1047 -0.0352 288 MET A N   
3266 C CA  . MET A 217 ? 0.9113 0.7628 0.9382 0.0293  -0.1039 -0.0274 288 MET A CA  
3267 C C   . MET A 217 ? 0.8333 0.6754 0.8463 0.0149  -0.0922 -0.0118 288 MET A C   
3268 O O   . MET A 217 ? 0.8627 0.6791 0.8554 0.0070  -0.0986 -0.0045 288 MET A O   
3269 C CB  . MET A 217 ? 0.9840 0.8605 1.0298 0.0307  -0.0942 -0.0317 288 MET A CB  
3270 C CG  . MET A 217 ? 1.0743 0.9579 1.1312 0.0430  -0.1073 -0.0472 288 MET A CG  
3271 S SD  . MET A 217 ? 1.1135 1.0286 1.1917 0.0399  -0.0931 -0.0497 288 MET A SD  
3272 C CE  . MET A 217 ? 1.1443 1.0318 1.2050 0.0288  -0.0907 -0.0359 288 MET A CE  
3282 N N   . VAL A 218 ? 0.7558 0.6200 0.7790 0.0111  -0.0752 -0.0074 289 VAL A N   
3283 C CA  . VAL A 218 ? 0.7023 0.5630 0.7151 -0.0006 -0.0639 0.0048  289 VAL A CA  
3284 C C   . VAL A 218 ? 0.6971 0.5384 0.6916 -0.0060 -0.0711 0.0098  289 VAL A C   
3285 O O   . VAL A 218 ? 0.6673 0.4949 0.6449 -0.0171 -0.0705 0.0183  289 VAL A O   
3286 C CB  . VAL A 218 ? 0.6820 0.5692 0.7097 -0.0015 -0.0466 0.0068  289 VAL A CB  
3287 C CG1 . VAL A 218 ? 0.6740 0.5596 0.6920 -0.0106 -0.0370 0.0164  289 VAL A CG1 
3288 C CG2 . VAL A 218 ? 0.6664 0.5679 0.7072 -0.0005 -0.0401 0.0046  289 VAL A CG2 
3298 N N   . VAL A 219 ? 0.7319 0.5744 0.7298 0.0008  -0.0775 0.0043  290 VAL A N   
3299 C CA  . VAL A 219 ? 0.8068 0.6301 0.7874 -0.0047 -0.0856 0.0089  290 VAL A CA  
3300 C C   . VAL A 219 ? 0.8634 0.6520 0.8199 -0.0107 -0.1032 0.0119  290 VAL A C   
3301 O O   . VAL A 219 ? 0.8415 0.6140 0.7780 -0.0242 -0.1048 0.0213  290 VAL A O   
3302 C CB  . VAL A 219 ? 0.8457 0.6748 0.8347 0.0063  -0.0924 0.0002  290 VAL A CB  
3303 C CG1 . VAL A 219 ? 0.9231 0.7226 0.8908 0.0024  -0.1088 0.0028  290 VAL A CG1 
3304 C CG2 . VAL A 219 ? 0.7998 0.6581 0.8047 0.0072  -0.0747 0.0012  290 VAL A CG2 
3314 N N   . LYS A 220 ? 0.9266 0.7033 0.8835 -0.0013 -0.1177 0.0035  291 LYS A N   
3315 C CA  . LYS A 220 ? 1.0370 0.7762 0.9684 -0.0061 -0.1376 0.0060  291 LYS A CA  
3316 C C   . LYS A 220 ? 0.9802 0.7109 0.8957 -0.0221 -0.1308 0.0176  291 LYS A C   
3317 O O   . LYS A 220 ? 1.0341 0.7333 0.9230 -0.0320 -0.1447 0.0234  291 LYS A O   
3318 C CB  . LYS A 220 ? 1.2052 0.9358 1.1421 0.0091  -0.1545 -0.0071 291 LYS A CB  
3319 C CG  . LYS A 220 ? 1.3937 1.0798 1.3013 0.0058  -0.1792 -0.0055 291 LYS A CG  
3320 C CD  . LYS A 220 ? 1.5080 1.1845 1.4210 0.0242  -0.1997 -0.0213 291 LYS A CD  
3321 C CE  . LYS A 220 ? 1.5898 1.2165 1.4697 0.0204  -0.2262 -0.0188 291 LYS A CE  
3322 N NZ  . LYS A 220 ? 1.6087 1.2253 1.4937 0.0403  -0.2482 -0.0360 291 LYS A NZ  
3336 N N   . LYS A 221 ? 0.8910 0.6484 0.8207 -0.0251 -0.1107 0.0207  292 LYS A N   
3337 C CA  . LYS A 221 ? 0.8661 0.6202 0.7822 -0.0388 -0.1036 0.0299  292 LYS A CA  
3338 C C   . LYS A 221 ? 0.8726 0.6287 0.7746 -0.0544 -0.0958 0.0395  292 LYS A C   
3339 O O   . LYS A 221 ? 0.8865 0.6432 0.7759 -0.0668 -0.0902 0.0462  292 LYS A O   
3340 C CB  . LYS A 221 ? 0.8415 0.6221 0.7775 -0.0348 -0.0874 0.0281  292 LYS A CB  
3341 C CG  . LYS A 221 ? 0.8850 0.6656 0.8330 -0.0234 -0.0936 0.0197  292 LYS A CG  
3342 C CD  . LYS A 221 ? 0.9964 0.7484 0.9238 -0.0274 -0.1086 0.0212  292 LYS A CD  
3343 C CE  . LYS A 221 ? 1.0953 0.8495 1.0351 -0.0166 -0.1138 0.0125  292 LYS A CE  
3344 N NZ  . LYS A 221 ? 1.1990 0.9215 1.1158 -0.0202 -0.1305 0.0141  292 LYS A NZ  
3358 N N   . GLY A 222 ? 0.9205 0.6808 0.8250 -0.0541 -0.0950 0.0396  293 GLY A N   
3359 C CA  . GLY A 222 ? 0.9524 0.7151 0.8434 -0.0695 -0.0892 0.0479  293 GLY A CA  
3360 C C   . GLY A 222 ? 0.9515 0.7477 0.8570 -0.0716 -0.0679 0.0493  293 GLY A C   
3361 O O   . GLY A 222 ? 0.9990 0.8021 0.8933 -0.0854 -0.0618 0.0551  293 GLY A O   
3365 N N   . VAL A 223 ? 0.8832 0.7009 0.8128 -0.0586 -0.0574 0.0437  294 VAL A N   
3366 C CA  . VAL A 223 ? 0.8250 0.6698 0.7661 -0.0594 -0.0399 0.0446  294 VAL A CA  
3367 C C   . VAL A 223 ? 0.7887 0.6479 0.7361 -0.0593 -0.0328 0.0448  294 VAL A C   
3368 O O   . VAL A 223 ? 0.7920 0.6716 0.7452 -0.0610 -0.0203 0.0453  294 VAL A O   
3369 C CB  . VAL A 223 ? 0.8083 0.6666 0.7693 -0.0476 -0.0330 0.0396  294 VAL A CB  
3370 C CG1 . VAL A 223 ? 0.8733 0.7190 0.8293 -0.0473 -0.0397 0.0388  294 VAL A CG1 
3371 C CG2 . VAL A 223 ? 0.7414 0.6046 0.7182 -0.0359 -0.0347 0.0340  294 VAL A CG2 
3381 N N   . VAL A 224 ? 0.7651 0.6139 0.7115 -0.0561 -0.0413 0.0434  295 VAL A N   
3382 C CA  . VAL A 224 ? 0.7435 0.6072 0.6994 -0.0529 -0.0344 0.0423  295 VAL A CA  
3383 C C   . VAL A 224 ? 0.7449 0.6182 0.6912 -0.0657 -0.0275 0.0471  295 VAL A C   
3384 O O   . VAL A 224 ? 0.7094 0.6042 0.6670 -0.0625 -0.0158 0.0456  295 VAL A O   
3385 C CB  . VAL A 224 ? 0.7861 0.6361 0.7420 -0.0461 -0.0468 0.0386  295 VAL A CB  
3386 C CG1 . VAL A 224 ? 0.7881 0.6533 0.7530 -0.0429 -0.0398 0.0376  295 VAL A CG1 
3387 C CG2 . VAL A 224 ? 0.7713 0.6218 0.7407 -0.0322 -0.0513 0.0312  295 VAL A CG2 
3397 N N   . PRO A 225 ? 0.7888 0.6483 0.7142 -0.0808 -0.0346 0.0524  296 PRO A N   
3398 C CA  . PRO A 225 ? 0.7676 0.6434 0.6854 -0.0944 -0.0266 0.0557  296 PRO A CA  
3399 C C   . PRO A 225 ? 0.7345 0.6377 0.6620 -0.0928 -0.0120 0.0531  296 PRO A C   
3400 O O   . PRO A 225 ? 0.7295 0.6553 0.6627 -0.0943 -0.0026 0.0511  296 PRO A O   
3401 C CB  . PRO A 225 ? 0.8002 0.6546 0.6912 -0.1129 -0.0379 0.0624  296 PRO A CB  
3402 C CG  . PRO A 225 ? 0.8270 0.6484 0.7113 -0.1066 -0.0553 0.0623  296 PRO A CG  
3403 C CD  . PRO A 225 ? 0.8251 0.6532 0.7313 -0.0869 -0.0518 0.0553  296 PRO A CD  
3411 N N   . GLN A 226 ? 0.7000 0.6015 0.6297 -0.0887 -0.0111 0.0519  297 GLN A N   
3412 C CA  . GLN A 226 ? 0.6792 0.6041 0.6174 -0.0854 0.0005  0.0483  297 GLN A CA  
3413 C C   . GLN A 226 ? 0.6430 0.5800 0.6016 -0.0698 0.0076  0.0436  297 GLN A C   
3414 O O   . GLN A 226 ? 0.6344 0.5921 0.5996 -0.0667 0.0163  0.0398  297 GLN A O   
3415 C CB  . GLN A 226 ? 0.7131 0.6299 0.6456 -0.0863 -0.0022 0.0487  297 GLN A CB  
3416 C CG  . GLN A 226 ? 0.7412 0.6790 0.6822 -0.0809 0.0072  0.0438  297 GLN A CG  
3417 C CD  . GLN A 226 ? 0.7765 0.7386 0.7101 -0.0910 0.0141  0.0417  297 GLN A CD  
3418 O OE1 . GLN A 226 ? 0.7959 0.7598 0.7165 -0.1052 0.0125  0.0451  297 GLN A OE1 
3419 N NE2 . GLN A 226 ? 0.7698 0.7519 0.7113 -0.0840 0.0209  0.0352  297 GLN A NE2 
3428 N N   . LEU A 227 ? 0.6508 0.5759 0.6186 -0.0600 0.0035  0.0430  298 LEU A N   
3429 C CA  . LEU A 227 ? 0.6374 0.5739 0.6214 -0.0484 0.0100  0.0398  298 LEU A CA  
3430 C C   . LEU A 227 ? 0.6337 0.5830 0.6192 -0.0494 0.0147  0.0391  298 LEU A C   
3431 O O   . LEU A 227 ? 0.6088 0.5723 0.6028 -0.0430 0.0218  0.0362  298 LEU A O   
3432 C CB  . LEU A 227 ? 0.6579 0.5842 0.6505 -0.0400 0.0049  0.0385  298 LEU A CB  
3433 C CG  . LEU A 227 ? 0.6873 0.6070 0.6847 -0.0355 0.0021  0.0371  298 LEU A CG  
3434 C CD1 . LEU A 227 ? 0.6909 0.6061 0.6968 -0.0282 -0.0035 0.0339  298 LEU A CD1 
3435 C CD2 . LEU A 227 ? 0.6968 0.6276 0.7024 -0.0312 0.0102  0.0361  298 LEU A CD2 
3447 N N   . VAL A 228 ? 0.6602 0.6028 0.6367 -0.0571 0.0094  0.0415  299 VAL A N   
3448 C CA  . VAL A 228 ? 0.6866 0.6415 0.6651 -0.0583 0.0134  0.0405  299 VAL A CA  
3449 C C   . VAL A 228 ? 0.7085 0.6849 0.6845 -0.0643 0.0210  0.0382  299 VAL A C   
3450 O O   . VAL A 228 ? 0.6872 0.6803 0.6714 -0.0584 0.0273  0.0342  299 VAL A O   
3451 C CB  . VAL A 228 ? 0.7372 0.6774 0.7053 -0.0660 0.0041  0.0437  299 VAL A CB  
3452 C CG1 . VAL A 228 ? 0.7504 0.7044 0.7188 -0.0699 0.0081  0.0429  299 VAL A CG1 
3453 C CG2 . VAL A 228 ? 0.7268 0.6518 0.7011 -0.0556 -0.0033 0.0424  299 VAL A CG2 
3463 N N   . LYS A 229 ? 0.7390 0.7167 0.7034 -0.0755 0.0201  0.0397  300 LYS A N   
3464 C CA  . LYS A 229 ? 0.7856 0.7893 0.7489 -0.0801 0.0275  0.0351  300 LYS A CA  
3465 C C   . LYS A 229 ? 0.7621 0.7780 0.7387 -0.0651 0.0333  0.0286  300 LYS A C   
3466 O O   . LYS A 229 ? 0.7997 0.8375 0.7818 -0.0611 0.0387  0.0221  300 LYS A O   
3467 C CB  . LYS A 229 ? 0.8638 0.8670 0.8117 -0.0944 0.0254  0.0376  300 LYS A CB  
3468 C CG  . LYS A 229 ? 0.9499 0.9854 0.8954 -0.1016 0.0329  0.0315  300 LYS A CG  
3469 C CD  . LYS A 229 ? 1.0691 1.1079 1.0050 -0.1081 0.0329  0.0311  300 LYS A CD  
3470 C CE  . LYS A 229 ? 1.1995 1.2172 1.1148 -0.1261 0.0252  0.0403  300 LYS A CE  
3471 N NZ  . LYS A 229 ? 1.2810 1.3021 1.1858 -0.1326 0.0253  0.0399  300 LYS A NZ  
3485 N N   . LEU A 230 ? 0.7056 0.7068 0.6867 -0.0568 0.0312  0.0298  301 LEU A N   
3486 C CA  . LEU A 230 ? 0.6602 0.6677 0.6512 -0.0439 0.0344  0.0248  301 LEU A CA  
3487 C C   . LEU A 230 ? 0.6061 0.6141 0.6063 -0.0342 0.0362  0.0236  301 LEU A C   
3488 O O   . LEU A 230 ? 0.5741 0.5885 0.5794 -0.0247 0.0380  0.0189  301 LEU A O   
3489 C CB  . LEU A 230 ? 0.6876 0.6787 0.6801 -0.0397 0.0312  0.0270  301 LEU A CB  
3490 C CG  . LEU A 230 ? 0.7284 0.7189 0.7113 -0.0474 0.0293  0.0273  301 LEU A CG  
3491 C CD1 . LEU A 230 ? 0.7537 0.7273 0.7393 -0.0428 0.0254  0.0293  301 LEU A CD1 
3492 C CD2 . LEU A 230 ? 0.7270 0.7400 0.7085 -0.0466 0.0334  0.0199  301 LEU A CD2 
3504 N N   . LEU A 231 ? 0.6324 0.6320 0.6336 -0.0359 0.0344  0.0276  302 LEU A N   
3505 C CA  . LEU A 231 ? 0.6473 0.6497 0.6556 -0.0282 0.0363  0.0265  302 LEU A CA  
3506 C C   . LEU A 231 ? 0.6885 0.7104 0.6970 -0.0278 0.0399  0.0210  302 LEU A C   
3507 O O   . LEU A 231 ? 0.6938 0.7205 0.7076 -0.0185 0.0416  0.0176  302 LEU A O   
3508 C CB  . LEU A 231 ? 0.6217 0.6131 0.6301 -0.0304 0.0327  0.0305  302 LEU A CB  
3509 C CG  . LEU A 231 ? 0.6247 0.6152 0.6406 -0.0220 0.0339  0.0302  302 LEU A CG  
3510 C CD1 . LEU A 231 ? 0.5902 0.5752 0.6114 -0.0155 0.0348  0.0308  302 LEU A CD1 
3511 C CD2 . LEU A 231 ? 0.6452 0.6268 0.6603 -0.0241 0.0287  0.0323  302 LEU A CD2 
3523 N N   . GLY A 232 ? 0.6880 0.7219 0.6900 -0.0386 0.0406  0.0198  303 GLY A N   
3524 C CA  . GLY A 232 ? 0.7243 0.7822 0.7273 -0.0395 0.0443  0.0130  303 GLY A CA  
3525 C C   . GLY A 232 ? 0.7581 0.8342 0.7631 -0.0336 0.0465  0.0041  303 GLY A C   
3526 O O   . GLY A 232 ? 0.7846 0.8858 0.7911 -0.0340 0.0492  -0.0040 303 GLY A O   
3530 N N   . ALA A 233 ? 0.7752 0.8408 0.7804 -0.0277 0.0448  0.0043  304 ALA A N   
3531 C CA  . ALA A 233 ? 0.8000 0.8814 0.8063 -0.0206 0.0450  -0.0053 304 ALA A CA  
3532 C C   . ALA A 233 ? 0.8608 0.9483 0.8733 -0.0060 0.0436  -0.0132 304 ALA A C   
3533 O O   . ALA A 233 ? 0.8725 0.9479 0.8879 -0.0015 0.0428  -0.0094 304 ALA A O   
3534 C CB  . ALA A 233 ? 0.7851 0.8500 0.7895 -0.0173 0.0419  -0.0028 304 ALA A CB  
3540 N N   . THR A 234 ? 0.8956 1.0022 0.9093 0.0020  0.0422  -0.0252 305 THR A N   
3541 C CA  . THR A 234 ? 0.9412 1.0509 0.9587 0.0180  0.0378  -0.0346 305 THR A CA  
3542 C C   . THR A 234 ? 0.9266 1.0120 0.9420 0.0300  0.0305  -0.0343 305 THR A C   
3543 O O   . THR A 234 ? 0.9756 1.0515 0.9906 0.0421  0.0246  -0.0382 305 THR A O   
3544 C CB  . THR A 234 ? 0.9985 1.1448 1.0188 0.0225  0.0382  -0.0510 305 THR A CB  
3545 O OG1 . THR A 234 ? 1.0224 1.1804 1.0402 0.0214  0.0378  -0.0567 305 THR A OG1 
3546 C CG2 . THR A 234 ? 1.0045 1.1767 1.0267 0.0095  0.0450  -0.0517 305 THR A CG2 
3554 N N   . GLU A 235 ? 0.8692 0.9430 0.8815 0.0263  0.0296  -0.0299 306 GLU A N   
3555 C CA  . GLU A 235 ? 0.8601 0.9097 0.8694 0.0355  0.0220  -0.0289 306 GLU A CA  
3556 C C   . GLU A 235 ? 0.7800 0.8017 0.7885 0.0319  0.0219  -0.0156 306 GLU A C   
3557 O O   . GLU A 235 ? 0.7649 0.7797 0.7744 0.0214  0.0263  -0.0061 306 GLU A O   
3558 C CB  . GLU A 235 ? 0.9493 0.9995 0.9563 0.0326  0.0212  -0.0299 306 GLU A CB  
3559 C CG  . GLU A 235 ? 1.0584 1.1407 1.0657 0.0346  0.0221  -0.0437 306 GLU A CG  
3560 C CD  . GLU A 235 ? 1.1519 1.2549 1.1582 0.0180  0.0311  -0.0404 306 GLU A CD  
3561 O OE1 . GLU A 235 ? 1.1609 1.2653 1.1682 0.0087  0.0360  -0.0336 306 GLU A OE1 
3562 O OE2 . GLU A 235 ? 1.2116 1.3282 1.2146 0.0137  0.0322  -0.0445 306 GLU A OE2 
3569 N N   . LEU A 236 ? 0.7462 0.7525 0.7518 0.0405  0.0161  -0.0157 307 LEU A N   
3570 C CA  . LEU A 236 ? 0.7112 0.6950 0.7149 0.0361  0.0163  -0.0040 307 LEU A CA  
3571 C C   . LEU A 236 ? 0.6717 0.6396 0.6746 0.0293  0.0160  0.0040  307 LEU A C   
3572 O O   . LEU A 236 ? 0.6208 0.5819 0.6261 0.0215  0.0201  0.0130  307 LEU A O   
3573 C CB  . LEU A 236 ? 0.7550 0.7230 0.7516 0.0459  0.0079  -0.0061 307 LEU A CB  
3574 C CG  . LEU A 236 ? 0.8163 0.7631 0.8082 0.0410  0.0074  0.0049  307 LEU A CG  
3575 C CD1 . LEU A 236 ? 0.8179 0.7762 0.8159 0.0351  0.0160  0.0095  307 LEU A CD1 
3576 C CD2 . LEU A 236 ? 0.8718 0.7990 0.8520 0.0504  -0.0040 0.0023  307 LEU A CD2 
3588 N N   . PRO A 237 ? 0.7134 0.6758 0.7134 0.0325  0.0108  0.0003  308 PRO A N   
3589 C CA  . PRO A 237 ? 0.7146 0.6630 0.7147 0.0256  0.0106  0.0077  308 PRO A CA  
3590 C C   . PRO A 237 ? 0.6971 0.6558 0.7028 0.0160  0.0178  0.0116  308 PRO A C   
3591 O O   . PRO A 237 ? 0.7103 0.6588 0.7175 0.0103  0.0179  0.0176  308 PRO A O   
3592 C CB  . PRO A 237 ? 0.7404 0.6828 0.7358 0.0330  0.0023  0.0007  308 PRO A CB  
3593 C CG  . PRO A 237 ? 0.7741 0.7204 0.7653 0.0454  -0.0043 -0.0095 308 PRO A CG  
3594 C CD  . PRO A 237 ? 0.7586 0.7255 0.7548 0.0444  0.0030  -0.0117 308 PRO A CD  
3602 N N   . ILE A 238 ? 0.6718 0.6496 0.6794 0.0136  0.0227  0.0079  309 ILE A N   
3603 C CA  . ILE A 238 ? 0.6413 0.6236 0.6509 0.0035  0.0274  0.0128  309 ILE A CA  
3604 C C   . ILE A 238 ? 0.6397 0.6203 0.6525 -0.0002 0.0306  0.0184  309 ILE A C   
3605 O O   . ILE A 238 ? 0.6383 0.6120 0.6532 -0.0059 0.0312  0.0239  309 ILE A O   
3606 C CB  . ILE A 238 ? 0.6294 0.6317 0.6363 -0.0003 0.0299  0.0070  309 ILE A CB  
3607 C CG1 . ILE A 238 ? 0.6555 0.6601 0.6590 0.0021  0.0269  0.0018  309 ILE A CG1 
3608 C CG2 . ILE A 238 ? 0.6143 0.6175 0.6193 -0.0120 0.0329  0.0129  309 ILE A CG2 
3609 C CD1 . ILE A 238 ? 0.6920 0.7221 0.6921 -0.0018 0.0299  -0.0057 309 ILE A CD1 
3621 N N   . VAL A 239 ? 0.6554 0.6431 0.6689 0.0039  0.0319  0.0159  310 VAL A N   
3622 C CA  . VAL A 239 ? 0.6378 0.6259 0.6542 0.0008  0.0347  0.0201  310 VAL A CA  
3623 C C   . VAL A 239 ? 0.6208 0.5953 0.6395 0.0006  0.0340  0.0262  310 VAL A C   
3624 O O   . VAL A 239 ? 0.6109 0.5846 0.6330 -0.0034 0.0354  0.0297  310 VAL A O   
3625 C CB  . VAL A 239 ? 0.6334 0.6319 0.6499 0.0061  0.0357  0.0155  310 VAL A CB  
3626 C CG1 . VAL A 239 ? 0.6112 0.6085 0.6305 0.0040  0.0380  0.0199  310 VAL A CG1 
3627 C CG2 . VAL A 239 ? 0.6309 0.6496 0.6465 0.0042  0.0374  0.0085  310 VAL A CG2 
3637 N N   . THR A 240 ? 0.6130 0.5774 0.6290 0.0045  0.0310  0.0267  311 THR A N   
3638 C CA  . THR A 240 ? 0.6022 0.5568 0.6191 0.0018  0.0309  0.0325  311 THR A CA  
3639 C C   . THR A 240 ? 0.5979 0.5520 0.6202 -0.0043 0.0318  0.0353  311 THR A C   
3640 O O   . THR A 240 ? 0.5852 0.5438 0.6123 -0.0068 0.0340  0.0371  311 THR A O   
3641 C CB  . THR A 240 ? 0.6241 0.5646 0.6339 0.0046  0.0255  0.0331  311 THR A CB  
3642 O OG1 . THR A 240 ? 0.6648 0.6055 0.6692 0.0124  0.0225  0.0285  311 THR A OG1 
3643 C CG2 . THR A 240 ? 0.5925 0.5243 0.6006 -0.0014 0.0255  0.0399  311 THR A CG2 
3651 N N   . PRO A 241 ? 0.6156 0.5653 0.6375 -0.0057 0.0295  0.0346  312 PRO A N   
3652 C CA  . PRO A 241 ? 0.6179 0.5669 0.6449 -0.0103 0.0292  0.0362  312 PRO A CA  
3653 C C   . PRO A 241 ? 0.5730 0.5277 0.6018 -0.0121 0.0297  0.0352  312 PRO A C   
3654 O O   . PRO A 241 ? 0.5561 0.5109 0.5897 -0.0138 0.0284  0.0355  312 PRO A O   
3655 C CB  . PRO A 241 ? 0.6588 0.6012 0.6831 -0.0105 0.0258  0.0349  312 PRO A CB  
3656 C CG  . PRO A 241 ? 0.6667 0.6123 0.6851 -0.0058 0.0253  0.0308  312 PRO A CG  
3657 C CD  . PRO A 241 ? 0.6491 0.5951 0.6660 -0.0020 0.0260  0.0310  312 PRO A CD  
3665 N N   . ALA A 242 ? 0.5591 0.5188 0.5836 -0.0122 0.0305  0.0333  313 ALA A N   
3666 C CA  . ALA A 242 ? 0.5408 0.5021 0.5638 -0.0161 0.0293  0.0335  313 ALA A CA  
3667 C C   . ALA A 242 ? 0.5520 0.5160 0.5796 -0.0142 0.0300  0.0341  313 ALA A C   
3668 O O   . ALA A 242 ? 0.5727 0.5334 0.6022 -0.0152 0.0263  0.0339  313 ALA A O   
3669 C CB  . ALA A 242 ? 0.5272 0.4960 0.5436 -0.0192 0.0305  0.0317  313 ALA A CB  
3675 N N   . LEU A 243 ? 0.5452 0.5148 0.5739 -0.0106 0.0335  0.0338  314 LEU A N   
3676 C CA  . LEU A 243 ? 0.5527 0.5263 0.5853 -0.0084 0.0346  0.0340  314 LEU A CA  
3677 C C   . LEU A 243 ? 0.5941 0.5679 0.6328 -0.0081 0.0342  0.0344  314 LEU A C   
3678 O O   . LEU A 243 ? 0.5864 0.5648 0.6295 -0.0067 0.0329  0.0326  314 LEU A O   
3679 C CB  . LEU A 243 ? 0.5510 0.5286 0.5818 -0.0046 0.0378  0.0338  314 LEU A CB  
3680 C CG  . LEU A 243 ? 0.5539 0.5362 0.5875 -0.0023 0.0395  0.0342  314 LEU A CG  
3681 C CD1 . LEU A 243 ? 0.5431 0.5289 0.5784 -0.0026 0.0377  0.0325  314 LEU A CD1 
3682 C CD2 . LEU A 243 ? 0.5733 0.5563 0.6027 0.0015  0.0412  0.0342  314 LEU A CD2 
3694 N N   . ARG A 244 ? 0.5887 0.5592 0.6278 -0.0095 0.0347  0.0359  315 ARG A N   
3695 C CA  . ARG A 244 ? 0.6131 0.5876 0.6585 -0.0113 0.0344  0.0355  315 ARG A CA  
3696 C C   . ARG A 244 ? 0.5431 0.5181 0.5932 -0.0106 0.0297  0.0318  315 ARG A C   
3697 O O   . ARG A 244 ? 0.5050 0.4891 0.5620 -0.0087 0.0284  0.0280  315 ARG A O   
3698 C CB  . ARG A 244 ? 0.7319 0.7005 0.7753 -0.0146 0.0345  0.0382  315 ARG A CB  
3699 C CG  . ARG A 244 ? 0.8736 0.8498 0.9235 -0.0188 0.0351  0.0378  315 ARG A CG  
3700 C CD  . ARG A 244 ? 1.0087 0.9941 1.0580 -0.0213 0.0391  0.0395  315 ARG A CD  
3701 N NE  . ARG A 244 ? 1.1176 1.0913 1.1563 -0.0237 0.0392  0.0448  315 ARG A NE  
3702 C CZ  . ARG A 244 ? 1.2022 1.1687 1.2358 -0.0304 0.0379  0.0488  315 ARG A CZ  
3703 N NH1 . ARG A 244 ? 1.2014 1.1749 1.2414 -0.0363 0.0379  0.0480  315 ARG A NH1 
3704 N NH2 . ARG A 244 ? 1.2646 1.2159 1.2861 -0.0312 0.0353  0.0531  315 ARG A NH2 
3718 N N   . ALA A 245 ? 0.5558 0.5212 0.6014 -0.0118 0.0260  0.0320  316 ALA A N   
3719 C CA  . ALA A 245 ? 0.5742 0.5347 0.6208 -0.0113 0.0190  0.0289  316 ALA A CA  
3720 C C   . ALA A 245 ? 0.5960 0.5565 0.6416 -0.0086 0.0147  0.0263  316 ALA A C   
3721 O O   . ALA A 245 ? 0.6036 0.5653 0.6539 -0.0048 0.0085  0.0212  316 ALA A O   
3722 C CB  . ALA A 245 ? 0.5845 0.5333 0.6228 -0.0148 0.0158  0.0307  316 ALA A CB  
3728 N N   . ILE A 246 ? 0.6002 0.5597 0.6399 -0.0101 0.0168  0.0287  317 ILE A N   
3729 C CA  . ILE A 246 ? 0.5973 0.5553 0.6351 -0.0082 0.0121  0.0267  317 ILE A CA  
3730 C C   . ILE A 246 ? 0.5451 0.5154 0.5924 -0.0019 0.0134  0.0225  317 ILE A C   
3731 O O   . ILE A 246 ? 0.5508 0.5206 0.6004 0.0027  0.0060  0.0172  317 ILE A O   
3732 C CB  . ILE A 246 ? 0.6313 0.5895 0.6620 -0.0120 0.0155  0.0300  317 ILE A CB  
3733 C CG1 . ILE A 246 ? 0.6810 0.6309 0.7013 -0.0197 0.0135  0.0328  317 ILE A CG1 
3734 C CG2 . ILE A 246 ? 0.6226 0.5801 0.6520 -0.0100 0.0112  0.0282  317 ILE A CG2 
3735 C CD1 . ILE A 246 ? 0.7267 0.6610 0.7386 -0.0236 0.0028  0.0329  317 ILE A CD1 
3747 N N   . GLY A 247 ? 0.4914 0.4729 0.5430 -0.0018 0.0218  0.0241  318 GLY A N   
3748 C CA  . GLY A 247 ? 0.4908 0.4871 0.5502 0.0021  0.0240  0.0203  318 GLY A CA  
3749 C C   . GLY A 247 ? 0.5242 0.5282 0.5919 0.0050  0.0192  0.0135  318 GLY A C   
3750 O O   . GLY A 247 ? 0.5039 0.5184 0.5774 0.0109  0.0155  0.0065  318 GLY A O   
3754 N N   . ASN A 248 ? 0.5657 0.5657 0.6346 0.0019  0.0184  0.0143  319 ASN A N   
3755 C CA  . ASN A 248 ? 0.5554 0.5647 0.6332 0.0053  0.0131  0.0064  319 ASN A CA  
3756 C C   . ASN A 248 ? 0.5376 0.5374 0.6139 0.0123  0.0008  -0.0003 319 ASN A C   
3757 O O   . ASN A 248 ? 0.5130 0.5256 0.5976 0.0196  -0.0048 -0.0103 319 ASN A O   
3758 C CB  . ASN A 248 ? 0.5614 0.5658 0.6398 0.0006  0.0136  0.0087  319 ASN A CB  
3759 C CG  . ASN A 248 ? 0.5712 0.5832 0.6503 -0.0064 0.0229  0.0142  319 ASN A CG  
3760 O OD1 . ASN A 248 ? 0.5730 0.5973 0.6532 -0.0081 0.0288  0.0153  319 ASN A OD1 
3761 N ND2 . ASN A 248 ? 0.5894 0.5922 0.6660 -0.0109 0.0232  0.0180  319 ASN A ND2 
3768 N N   . ILE A 249 ? 0.5157 0.4935 0.5804 0.0100  -0.0045 0.0045  320 ILE A N   
3769 C CA  . ILE A 249 ? 0.5560 0.5180 0.6149 0.0146  -0.0189 -0.0004 320 ILE A CA  
3770 C C   . ILE A 249 ? 0.6168 0.5840 0.6777 0.0219  -0.0240 -0.0065 320 ILE A C   
3771 O O   . ILE A 249 ? 0.6965 0.6604 0.7590 0.0304  -0.0369 -0.0160 320 ILE A O   
3772 C CB  . ILE A 249 ? 0.5358 0.4737 0.5787 0.0068  -0.0227 0.0076  320 ILE A CB  
3773 C CG1 . ILE A 249 ? 0.5933 0.5263 0.6346 0.0019  -0.0204 0.0109  320 ILE A CG1 
3774 C CG2 . ILE A 249 ? 0.5264 0.4430 0.5584 0.0091  -0.0393 0.0044  320 ILE A CG2 
3775 C CD1 . ILE A 249 ? 0.6331 0.5505 0.6596 -0.0075 -0.0199 0.0190  320 ILE A CD1 
3787 N N   . VAL A 250 ? 0.5810 0.5560 0.6418 0.0199  -0.0154 -0.0024 321 VAL A N   
3788 C CA  . VAL A 250 ? 0.5537 0.5338 0.6163 0.0272  -0.0204 -0.0083 321 VAL A CA  
3789 C C   . VAL A 250 ? 0.5538 0.5617 0.6306 0.0349  -0.0173 -0.0181 321 VAL A C   
3790 O O   . VAL A 250 ? 0.5546 0.5713 0.6343 0.0421  -0.0205 -0.0245 321 VAL A O   
3791 C CB  . VAL A 250 ? 0.5338 0.5121 0.5904 0.0228  -0.0134 -0.0012 321 VAL A CB  
3792 C CG1 . VAL A 250 ? 0.5346 0.4928 0.5781 0.0132  -0.0143 0.0077  321 VAL A CG1 
3793 C CG2 . VAL A 250 ? 0.5036 0.5018 0.5669 0.0206  0.0014  0.0021  321 VAL A CG2 
3803 N N   . THR A 251 ? 0.5650 0.5888 0.6505 0.0329  -0.0111 -0.0198 322 THR A N   
3804 C CA  . THR A 251 ? 0.6267 0.6798 0.7257 0.0396  -0.0106 -0.0317 322 THR A CA  
3805 C C   . THR A 251 ? 0.6784 0.7305 0.7821 0.0508  -0.0264 -0.0454 322 THR A C   
3806 O O   . THR A 251 ? 0.7114 0.7903 0.8269 0.0594  -0.0289 -0.0588 322 THR A O   
3807 C CB  . THR A 251 ? 0.6564 0.7295 0.7628 0.0316  0.0010  -0.0293 322 THR A CB  
3808 O OG1 . THR A 251 ? 0.6572 0.7190 0.7636 0.0293  -0.0033 -0.0286 322 THR A OG1 
3809 C CG2 . THR A 251 ? 0.6748 0.7453 0.7746 0.0215  0.0138  -0.0166 322 THR A CG2 
3817 N N   . GLY A 252 ? 0.6645 0.6875 0.7586 0.0511  -0.0379 -0.0431 323 GLY A N   
3818 C CA  . GLY A 252 ? 0.6467 0.6629 0.7424 0.0622  -0.0557 -0.0560 323 GLY A CA  
3819 C C   . GLY A 252 ? 0.6523 0.6581 0.7431 0.0734  -0.0709 -0.0645 323 GLY A C   
3820 O O   . GLY A 252 ? 0.6183 0.6407 0.7138 0.0770  -0.0662 -0.0675 323 GLY A O   
3824 N N   . THR A 253 ? 0.6932 0.6687 0.7725 0.0786  -0.0904 -0.0679 324 THR A N   
3825 C CA  . THR A 253 ? 0.7581 0.7192 0.8313 0.0908  -0.1098 -0.0781 324 THR A CA  
3826 C C   . THR A 253 ? 0.7779 0.7127 0.8345 0.0824  -0.1107 -0.0656 324 THR A C   
3827 O O   . THR A 253 ? 0.7666 0.6916 0.8150 0.0674  -0.0986 -0.0498 324 THR A O   
3828 C CB  . THR A 253 ? 0.7937 0.7277 0.8580 0.0992  -0.1333 -0.0866 324 THR A CB  
3829 O OG1 . THR A 253 ? 0.7948 0.6910 0.8386 0.0853  -0.1364 -0.0710 324 THR A OG1 
3830 C CG2 . THR A 253 ? 0.7981 0.7583 0.8790 0.1064  -0.1322 -0.0989 324 THR A CG2 
3838 N N   . ASP A 254 ? 0.8408 0.7646 0.8922 0.0927  -0.1268 -0.0740 325 ASP A N   
3839 C CA  . ASP A 254 ? 0.8837 0.7813 0.9186 0.0848  -0.1307 -0.0636 325 ASP A CA  
3840 C C   . ASP A 254 ? 0.9041 0.7615 0.9167 0.0711  -0.1396 -0.0509 325 ASP A C   
3841 O O   . ASP A 254 ? 0.9166 0.7605 0.9169 0.0567  -0.1334 -0.0372 325 ASP A O   
3842 C CB  . ASP A 254 ? 0.9453 0.8363 0.9782 0.0997  -0.1496 -0.0767 325 ASP A CB  
3843 C CG  . ASP A 254 ? 0.9716 0.9045 1.0242 0.1101  -0.1379 -0.0870 325 ASP A CG  
3844 O OD1 . ASP A 254 ? 0.9342 0.8939 0.9969 0.1016  -0.1145 -0.0792 325 ASP A OD1 
3845 O OD2 . ASP A 254 ? 1.0299 0.9683 1.0867 0.1269  -0.1531 -0.1033 325 ASP A OD2 
3850 N N   . GLU A 255 ? 0.8916 0.7320 0.8985 0.0747  -0.1535 -0.0556 326 GLU A N   
3851 C CA  . GLU A 255 ? 0.9407 0.7437 0.9246 0.0606  -0.1620 -0.0435 326 GLU A CA  
3852 C C   . GLU A 255 ? 0.8569 0.6719 0.8432 0.0450  -0.1398 -0.0298 326 GLU A C   
3853 O O   . GLU A 255 ? 0.8652 0.6603 0.8339 0.0285  -0.1379 -0.0163 326 GLU A O   
3854 C CB  . GLU A 255 ? 1.0949 0.8747 1.0710 0.0707  -0.1854 -0.0538 326 GLU A CB  
3855 C CG  . GLU A 255 ? 1.2576 1.0126 1.2236 0.0855  -0.2141 -0.0666 326 GLU A CG  
3856 C CD  . GLU A 255 ? 1.3308 1.1212 1.3198 0.1053  -0.2130 -0.0844 326 GLU A CD  
3857 O OE1 . GLU A 255 ? 1.3017 1.1362 1.3148 0.1089  -0.1923 -0.0890 326 GLU A OE1 
3858 O OE2 . GLU A 255 ? 1.4016 1.1750 1.3829 0.1166  -0.2335 -0.0939 326 GLU A OE2 
3865 N N   . GLN A 256 ? 0.8229 0.6709 0.8297 0.0492  -0.1236 -0.0336 327 GLN A N   
3866 C CA  . GLN A 256 ? 0.7776 0.6361 0.7866 0.0359  -0.1039 -0.0216 327 GLN A CA  
3867 C C   . GLN A 256 ? 0.7178 0.5888 0.7279 0.0271  -0.0874 -0.0123 327 GLN A C   
3868 O O   . GLN A 256 ? 0.6936 0.5596 0.6953 0.0137  -0.0781 -0.0008 327 GLN A O   
3869 C CB  . GLN A 256 ? 0.7751 0.6622 0.8037 0.0418  -0.0933 -0.0279 327 GLN A CB  
3870 C CG  . GLN A 256 ? 0.8090 0.6855 0.8371 0.0494  -0.1083 -0.0370 327 GLN A CG  
3871 C CD  . GLN A 256 ? 0.8223 0.7333 0.8732 0.0591  -0.1017 -0.0489 327 GLN A CD  
3872 O OE1 . GLN A 256 ? 0.7996 0.7400 0.8651 0.0644  -0.0932 -0.0550 327 GLN A OE1 
3873 N NE2 . GLN A 256 ? 0.8535 0.7625 0.9068 0.0602  -0.1056 -0.0522 327 GLN A NE2 
3882 N N   . THR A 257 ? 0.7045 0.5934 0.7250 0.0351  -0.0841 -0.0181 328 THR A N   
3883 C CA  . THR A 257 ? 0.6944 0.5921 0.7145 0.0280  -0.0711 -0.0102 328 THR A CA  
3884 C C   . THR A 257 ? 0.7422 0.6124 0.7421 0.0168  -0.0795 -0.0017 328 THR A C   
3885 O O   . THR A 257 ? 0.7430 0.6160 0.7381 0.0048  -0.0682 0.0080  328 THR A O   
3886 C CB  . THR A 257 ? 0.6632 0.5816 0.6954 0.0391  -0.0691 -0.0187 328 THR A CB  
3887 O OG1 . THR A 257 ? 0.6370 0.5834 0.6865 0.0474  -0.0619 -0.0271 328 THR A OG1 
3888 C CG2 . THR A 257 ? 0.6404 0.5692 0.6732 0.0327  -0.0552 -0.0110 328 THR A CG2 
3896 N N   . GLN A 258 ? 0.7895 0.6329 0.7765 0.0199  -0.1006 -0.0058 329 GLN A N   
3897 C CA  . GLN A 258 ? 0.8170 0.6325 0.7822 0.0068  -0.1104 0.0028  329 GLN A CA  
3898 C C   . GLN A 258 ? 0.8024 0.6082 0.7544 -0.0107 -0.1047 0.0144  329 GLN A C   
3899 O O   . GLN A 258 ? 0.7802 0.5791 0.7190 -0.0258 -0.1021 0.0235  329 GLN A O   
3900 C CB  . GLN A 258 ? 0.8776 0.6604 0.8280 0.0132  -0.1374 -0.0037 329 GLN A CB  
3901 C CG  . GLN A 258 ? 0.9297 0.6821 0.8559 -0.0015 -0.1495 0.0052  329 GLN A CG  
3902 C CD  . GLN A 258 ? 0.9515 0.7189 0.8836 -0.0029 -0.1407 0.0067  329 GLN A CD  
3903 O OE1 . GLN A 258 ? 0.9549 0.7386 0.9021 0.0128  -0.1403 -0.0032 329 GLN A OE1 
3904 N NE2 . GLN A 258 ? 0.9669 0.7313 0.8872 -0.0221 -0.1335 0.0184  329 GLN A NE2 
3913 N N   . LYS A 259 ? 0.8176 0.6246 0.7727 -0.0092 -0.1028 0.0135  330 LYS A N   
3914 C CA  . LYS A 259 ? 0.8487 0.6491 0.7915 -0.0251 -0.0970 0.0236  330 LYS A CA  
3915 C C   . LYS A 259 ? 0.8051 0.6334 0.7575 -0.0320 -0.0747 0.0292  330 LYS A C   
3916 O O   . LYS A 259 ? 0.8118 0.6382 0.7521 -0.0473 -0.0698 0.0374  330 LYS A O   
3917 C CB  . LYS A 259 ? 0.9081 0.7033 0.8525 -0.0207 -0.1006 0.0206  330 LYS A CB  
3918 C CG  . LYS A 259 ? 1.0199 0.7807 0.9480 -0.0169 -0.1257 0.0163  330 LYS A CG  
3919 C CD  . LYS A 259 ? 1.1181 0.8741 1.0472 -0.0136 -0.1289 0.0137  330 LYS A CD  
3920 C CE  . LYS A 259 ? 1.2375 0.9567 1.1488 -0.0087 -0.1560 0.0086  330 LYS A CE  
3921 N NZ  . LYS A 259 ? 1.2891 1.0031 1.2005 -0.0057 -0.1595 0.0060  330 LYS A NZ  
3935 N N   . VAL A 260 ? 0.7710 0.6257 0.7441 -0.0212 -0.0620 0.0244  331 VAL A N   
3936 C CA  . VAL A 260 ? 0.7198 0.5973 0.7004 -0.0258 -0.0438 0.0287  331 VAL A CA  
3937 C C   . VAL A 260 ? 0.6923 0.5688 0.6648 -0.0339 -0.0438 0.0324  331 VAL A C   
3938 O O   . VAL A 260 ? 0.6890 0.5746 0.6570 -0.0447 -0.0348 0.0376  331 VAL A O   
3939 C CB  . VAL A 260 ? 0.7018 0.6031 0.7026 -0.0135 -0.0329 0.0232  331 VAL A CB  
3940 C CG1 . VAL A 260 ? 0.6735 0.5942 0.6801 -0.0164 -0.0176 0.0268  331 VAL A CG1 
3941 C CG2 . VAL A 260 ? 0.7055 0.6107 0.7137 -0.0094 -0.0310 0.0208  331 VAL A CG2 
3951 N N   . ILE A 261 ? 0.6667 0.5339 0.6376 -0.0283 -0.0543 0.0286  332 ILE A N   
3952 C CA  . ILE A 261 ? 0.6873 0.5516 0.6501 -0.0361 -0.0561 0.0319  332 ILE A CA  
3953 C C   . ILE A 261 ? 0.7447 0.5884 0.6849 -0.0549 -0.0646 0.0397  332 ILE A C   
3954 O O   . ILE A 261 ? 0.7077 0.5606 0.6421 -0.0678 -0.0578 0.0447  332 ILE A O   
3955 C CB  . ILE A 261 ? 0.7086 0.5653 0.6743 -0.0245 -0.0678 0.0251  332 ILE A CB  
3956 C CG1 . ILE A 261 ? 0.6957 0.5781 0.6828 -0.0086 -0.0571 0.0178  332 ILE A CG1 
3957 C CG2 . ILE A 261 ? 0.7223 0.5724 0.6780 -0.0334 -0.0719 0.0286  332 ILE A CG2 
3958 C CD1 . ILE A 261 ? 0.7102 0.5898 0.7019 0.0051  -0.0686 0.0085  332 ILE A CD1 
3970 N N   . ASP A 262 ? 0.8391 0.6557 0.7651 -0.0575 -0.0801 0.0405  333 ASP A N   
3971 C CA  . ASP A 262 ? 0.9442 0.7381 0.8446 -0.0776 -0.0896 0.0491  333 ASP A CA  
3972 C C   . ASP A 262 ? 0.8715 0.6853 0.7703 -0.0914 -0.0737 0.0549  333 ASP A C   
3973 O O   . ASP A 262 ? 0.8625 0.6728 0.7438 -0.1111 -0.0746 0.0619  333 ASP A O   
3974 C CB  . ASP A 262 ? 1.0905 0.8510 0.9760 -0.0758 -0.1092 0.0483  333 ASP A CB  
3975 C CG  . ASP A 262 ? 1.2153 0.9496 1.0953 -0.0648 -0.1308 0.0420  333 ASP A CG  
3976 O OD1 . ASP A 262 ? 1.2734 1.0092 1.1544 -0.0641 -0.1327 0.0411  333 ASP A OD1 
3977 O OD2 . ASP A 262 ? 1.2487 0.9605 1.1229 -0.0558 -0.1470 0.0370  333 ASP A OD2 
3982 N N   . ALA A 263 ? 0.8220 0.6567 0.7376 -0.0820 -0.0602 0.0517  334 ALA A N   
3983 C CA  . ALA A 263 ? 0.7941 0.6491 0.7099 -0.0917 -0.0462 0.0549  334 ALA A CA  
3984 C C   . ALA A 263 ? 0.7821 0.6664 0.7075 -0.0941 -0.0317 0.0540  334 ALA A C   
3985 O O   . ALA A 263 ? 0.7673 0.6724 0.6943 -0.1001 -0.0203 0.0543  334 ALA A O   
3986 C CB  . ALA A 263 ? 0.7512 0.6153 0.6807 -0.0800 -0.0390 0.0513  334 ALA A CB  
3992 N N   . GLY A 264 ? 0.8036 0.6908 0.7356 -0.0882 -0.0327 0.0516  335 GLY A N   
3993 C CA  . GLY A 264 ? 0.7561 0.6693 0.6962 -0.0901 -0.0210 0.0501  335 GLY A CA  
3994 C C   . GLY A 264 ? 0.7201 0.6555 0.6812 -0.0739 -0.0083 0.0445  335 GLY A C   
3995 O O   . GLY A 264 ? 0.7046 0.6627 0.6717 -0.0748 0.0018  0.0423  335 GLY A O   
3999 N N   . ALA A 265 ? 0.7141 0.6440 0.6855 -0.0595 -0.0091 0.0416  336 ALA A N   
4000 C CA  . ALA A 265 ? 0.6999 0.6485 0.6874 -0.0474 0.0024  0.0378  336 ALA A CA  
4001 C C   . ALA A 265 ? 0.7053 0.6670 0.7001 -0.0422 0.0071  0.0353  336 ALA A C   
4002 O O   . ALA A 265 ? 0.7185 0.6971 0.7212 -0.0371 0.0166  0.0330  336 ALA A O   
4003 C CB  . ALA A 265 ? 0.6740 0.6161 0.6701 -0.0357 0.0002  0.0354  336 ALA A CB  
4009 N N   . LEU A 266 ? 0.6840 0.6363 0.6751 -0.0426 -0.0008 0.0351  337 LEU A N   
4010 C CA  . LEU A 266 ? 0.6703 0.6342 0.6688 -0.0363 0.0031  0.0322  337 LEU A CA  
4011 C C   . LEU A 266 ? 0.6899 0.6715 0.6872 -0.0440 0.0103  0.0320  337 LEU A C   
4012 O O   . LEU A 266 ? 0.6988 0.6938 0.7038 -0.0370 0.0159  0.0288  337 LEU A O   
4013 C CB  . LEU A 266 ? 0.6832 0.6319 0.6774 -0.0346 -0.0087 0.0313  337 LEU A CB  
4014 C CG  . LEU A 266 ? 0.7125 0.6484 0.7100 -0.0240 -0.0170 0.0280  337 LEU A CG  
4015 C CD1 . LEU A 266 ? 0.7495 0.6692 0.7412 -0.0214 -0.0313 0.0255  337 LEU A CD1 
4016 C CD2 . LEU A 266 ? 0.7094 0.6616 0.7218 -0.0107 -0.0078 0.0240  337 LEU A CD2 
4028 N N   . ALA A 267 ? 0.6967 0.6809 0.6844 -0.0580 0.0104  0.0345  338 ALA A N   
4029 C CA  . ALA A 267 ? 0.6935 0.7011 0.6820 -0.0646 0.0179  0.0319  338 ALA A CA  
4030 C C   . ALA A 267 ? 0.7322 0.7585 0.7315 -0.0541 0.0278  0.0269  338 ALA A C   
4031 O O   . ALA A 267 ? 0.7391 0.7861 0.7429 -0.0527 0.0333  0.0217  338 ALA A O   
4032 C CB  . ALA A 267 ? 0.6801 0.6892 0.6545 -0.0842 0.0156  0.0354  338 ALA A CB  
4038 N N   . VAL A 268 ? 0.7706 0.7890 0.7733 -0.0463 0.0290  0.0276  339 VAL A N   
4039 C CA  . VAL A 268 ? 0.7784 0.8093 0.7886 -0.0367 0.0358  0.0233  339 VAL A CA  
4040 C C   . VAL A 268 ? 0.6670 0.6960 0.6853 -0.0229 0.0376  0.0217  339 VAL A C   
4041 O O   . VAL A 268 ? 0.6521 0.6905 0.6744 -0.0150 0.0414  0.0176  339 VAL A O   
4042 C CB  . VAL A 268 ? 0.8851 0.9082 0.8936 -0.0366 0.0358  0.0252  339 VAL A CB  
4043 C CG1 . VAL A 268 ? 0.8991 0.9311 0.9135 -0.0265 0.0405  0.0207  339 VAL A CG1 
4044 C CG2 . VAL A 268 ? 0.9521 0.9776 0.9505 -0.0508 0.0343  0.0268  339 VAL A CG2 
4054 N N   . PHE A 269 ? 0.6155 0.6327 0.6352 -0.0197 0.0339  0.0242  340 PHE A N   
4055 C CA  . PHE A 269 ? 0.6185 0.6344 0.6443 -0.0084 0.0359  0.0234  340 PHE A CA  
4056 C C   . PHE A 269 ? 0.6246 0.6517 0.6530 -0.0024 0.0390  0.0196  340 PHE A C   
4057 O O   . PHE A 269 ? 0.6338 0.6597 0.6641 0.0059  0.0412  0.0191  340 PHE A O   
4058 C CB  . PHE A 269 ? 0.6733 0.6786 0.7004 -0.0061 0.0310  0.0250  340 PHE A CB  
4059 C CG  . PHE A 269 ? 0.7299 0.7268 0.7585 -0.0049 0.0294  0.0266  340 PHE A CG  
4060 C CD1 . PHE A 269 ? 0.7640 0.7523 0.7878 -0.0119 0.0252  0.0284  340 PHE A CD1 
4061 C CD2 . PHE A 269 ? 0.7569 0.7557 0.7908 0.0020  0.0323  0.0263  340 PHE A CD2 
4062 C CE1 . PHE A 269 ? 0.7890 0.7706 0.8149 -0.0102 0.0234  0.0290  340 PHE A CE1 
4063 C CE2 . PHE A 269 ? 0.7804 0.7750 0.8167 0.0022  0.0312  0.0269  340 PHE A CE2 
4064 C CZ  . PHE A 269 ? 0.7937 0.7798 0.8268 -0.0030 0.0266  0.0278  340 PHE A CZ  
4074 N N   . PRO A 270 ? 0.6191 0.6563 0.6465 -0.0065 0.0387  0.0168  341 PRO A N   
4075 C CA  . PRO A 270 ? 0.6208 0.6692 0.6512 0.0011  0.0410  0.0118  341 PRO A CA  
4076 C C   . PRO A 270 ? 0.5767 0.6308 0.6077 0.0080  0.0435  0.0078  341 PRO A C   
4077 O O   . PRO A 270 ? 0.5967 0.6486 0.6281 0.0177  0.0434  0.0060  341 PRO A O   
4078 C CB  . PRO A 270 ? 0.6367 0.6981 0.6661 -0.0074 0.0402  0.0089  341 PRO A CB  
4079 C CG  . PRO A 270 ? 0.6559 0.7054 0.6802 -0.0181 0.0355  0.0143  341 PRO A CG  
4080 C CD  . PRO A 270 ? 0.6476 0.6858 0.6699 -0.0189 0.0352  0.0180  341 PRO A CD  
4088 N N   . SER A 271 ? 0.5536 0.6135 0.5833 0.0034  0.0445  0.0062  342 SER A N   
4089 C CA  . SER A 271 ? 0.5664 0.6299 0.5960 0.0116  0.0446  0.0011  342 SER A CA  
4090 C C   . SER A 271 ? 0.5824 0.6267 0.6098 0.0167  0.0434  0.0063  342 SER A C   
4091 O O   . SER A 271 ? 0.6267 0.6660 0.6518 0.0256  0.0412  0.0038  342 SER A O   
4092 C CB  . SER A 271 ? 0.6036 0.6820 0.6326 0.0058  0.0458  -0.0037 342 SER A CB  
4093 O OG  . SER A 271 ? 0.6449 0.7144 0.6708 -0.0039 0.0460  0.0028  342 SER A OG  
4099 N N   . LEU A 272 ? 0.5513 0.5844 0.5785 0.0109  0.0437  0.0131  343 LEU A N   
4100 C CA  . LEU A 272 ? 0.5321 0.5507 0.5581 0.0139  0.0431  0.0179  343 LEU A CA  
4101 C C   . LEU A 272 ? 0.5378 0.5516 0.5628 0.0196  0.0430  0.0194  343 LEU A C   
4102 O O   . LEU A 272 ? 0.5414 0.5459 0.5618 0.0233  0.0418  0.0212  343 LEU A O   
4103 C CB  . LEU A 272 ? 0.5240 0.5357 0.5516 0.0073  0.0428  0.0227  343 LEU A CB  
4104 C CG  . LEU A 272 ? 0.5409 0.5546 0.5669 0.0006  0.0422  0.0222  343 LEU A CG  
4105 C CD1 . LEU A 272 ? 0.5962 0.6014 0.6224 -0.0052 0.0398  0.0262  343 LEU A CD1 
4106 C CD2 . LEU A 272 ? 0.5109 0.5219 0.5352 0.0033  0.0421  0.0210  343 LEU A CD2 
4118 N N   . LEU A 273 ? 0.5338 0.5523 0.5612 0.0193  0.0435  0.0193  344 LEU A N   
4119 C CA  . LEU A 273 ? 0.5267 0.5423 0.5523 0.0245  0.0437  0.0205  344 LEU A CA  
4120 C C   . LEU A 273 ? 0.5344 0.5504 0.5555 0.0318  0.0420  0.0166  344 LEU A C   
4121 O O   . LEU A 273 ? 0.5532 0.5628 0.5692 0.0357  0.0411  0.0185  344 LEU A O   
4122 C CB  . LEU A 273 ? 0.5272 0.5480 0.5567 0.0237  0.0436  0.0200  344 LEU A CB  
4123 C CG  . LEU A 273 ? 0.5422 0.5602 0.5751 0.0193  0.0425  0.0224  344 LEU A CG  
4124 C CD1 . LEU A 273 ? 0.5708 0.5916 0.6058 0.0188  0.0393  0.0203  344 LEU A CD1 
4125 C CD2 . LEU A 273 ? 0.5555 0.5713 0.5885 0.0209  0.0441  0.0249  344 LEU A CD2 
4137 N N   . THR A 274 ? 0.5008 0.5251 0.5228 0.0339  0.0407  0.0104  345 THR A N   
4138 C CA  . THR A 274 ? 0.5321 0.5570 0.5498 0.0432  0.0369  0.0042  345 THR A CA  
4139 C C   . THR A 274 ? 0.5383 0.5586 0.5523 0.0469  0.0330  0.0007  345 THR A C   
4140 O O   . THR A 274 ? 0.5555 0.5790 0.5669 0.0560  0.0280  -0.0076 345 THR A O   
4141 C CB  . THR A 274 ? 0.5783 0.6217 0.6014 0.0451  0.0372  -0.0035 345 THR A CB  
4142 O OG1 . THR A 274 ? 0.5658 0.6242 0.5941 0.0376  0.0397  -0.0065 345 THR A OG1 
4143 C CG2 . THR A 274 ? 0.6049 0.6491 0.6302 0.0431  0.0390  -0.0003 345 THR A CG2 
4151 N N   . ASN A 275 ? 0.5506 0.5627 0.5638 0.0413  0.0341  0.0059  346 ASN A N   
4152 C CA  . ASN A 275 ? 0.5930 0.5986 0.6021 0.0450  0.0296  0.0028  346 ASN A CA  
4153 C C   . ASN A 275 ? 0.6838 0.6703 0.6816 0.0531  0.0218  0.0028  346 ASN A C   
4154 O O   . ASN A 275 ? 0.6569 0.6309 0.6487 0.0510  0.0218  0.0099  346 ASN A O   
4155 C CB  . ASN A 275 ? 0.5828 0.5808 0.5928 0.0368  0.0320  0.0096  346 ASN A CB  
4156 C CG  . ASN A 275 ? 0.6208 0.6165 0.6286 0.0396  0.0279  0.0053  346 ASN A CG  
4157 O OD1 . ASN A 275 ? 0.6465 0.6256 0.6461 0.0447  0.0213  0.0054  346 ASN A OD1 
4158 N ND2 . ASN A 275 ? 0.6188 0.6294 0.6322 0.0354  0.0311  0.0018  346 ASN A ND2 
4165 N N   . PRO A 276 ? 0.7904 0.7739 0.7836 0.0625  0.0139  -0.0056 347 PRO A N   
4166 C CA  . PRO A 276 ? 0.8580 0.8173 0.8368 0.0703  0.0033  -0.0053 347 PRO A CA  
4167 C C   . PRO A 276 ? 0.8793 0.8137 0.8478 0.0628  0.0008  0.0057  347 PRO A C   
4168 O O   . PRO A 276 ? 0.9475 0.8595 0.9016 0.0633  -0.0061 0.0107  347 PRO A O   
4169 C CB  . PRO A 276 ? 0.8734 0.8381 0.8513 0.0834  -0.0060 -0.0195 347 PRO A CB  
4170 C CG  . PRO A 276 ? 0.8624 0.8496 0.8520 0.0791  0.0006  -0.0238 347 PRO A CG  
4171 C CD  . PRO A 276 ? 0.8367 0.8390 0.8362 0.0668  0.0130  -0.0166 347 PRO A CD  
4179 N N   . LYS A 277 ? 0.8141 0.7516 0.7886 0.0547  0.0058  0.0098  348 LYS A N   
4180 C CA  . LYS A 277 ? 0.7869 0.7047 0.7535 0.0459  0.0044  0.0200  348 LYS A CA  
4181 C C   . LYS A 277 ? 0.7359 0.6571 0.7046 0.0355  0.0128  0.0294  348 LYS A C   
4182 O O   . LYS A 277 ? 0.6571 0.5960 0.6384 0.0307  0.0216  0.0302  348 LYS A O   
4183 C CB  . LYS A 277 ? 0.8482 0.7696 0.8212 0.0422  0.0062  0.0196  348 LYS A CB  
4184 C CG  . LYS A 277 ? 0.9692 0.8682 0.9324 0.0353  0.0013  0.0275  348 LYS A CG  
4185 C CD  . LYS A 277 ? 1.0762 0.9814 1.0479 0.0299  0.0052  0.0283  348 LYS A CD  
4186 C CE  . LYS A 277 ? 1.1849 1.0683 1.1471 0.0230  -0.0006 0.0352  348 LYS A CE  
4187 N NZ  . LYS A 277 ? 1.2638 1.1216 1.2093 0.0299  -0.0150 0.0330  348 LYS A NZ  
4201 N N   . THR A 278 ? 0.8134 0.7174 0.7683 0.0318  0.0088  0.0362  349 THR A N   
4202 C CA  . THR A 278 ? 0.8673 0.7774 0.8228 0.0221  0.0162  0.0438  349 THR A CA  
4203 C C   . THR A 278 ? 0.7863 0.7086 0.7531 0.0125  0.0241  0.0475  349 THR A C   
4204 O O   . THR A 278 ? 0.7697 0.7084 0.7454 0.0088  0.0317  0.0485  349 THR A O   
4205 C CB  . THR A 278 ? 1.0194 0.9069 0.9547 0.0162  0.0097  0.0515  349 THR A CB  
4206 O OG1 . THR A 278 ? 1.0600 0.9365 0.9846 0.0260  0.0019  0.0476  349 THR A OG1 
4207 C CG2 . THR A 278 ? 1.0738 0.9724 1.0096 0.0040  0.0182  0.0589  349 THR A CG2 
4215 N N   . ASN A 279 ? 0.7467 0.6603 0.7124 0.0089  0.0212  0.0490  350 ASN A N   
4216 C CA  . ASN A 279 ? 0.7379 0.6625 0.7143 0.0008  0.0274  0.0514  350 ASN A CA  
4217 C C   . ASN A 279 ? 0.6107 0.5549 0.6031 0.0045  0.0335  0.0460  350 ASN A C   
4218 O O   . ASN A 279 ? 0.5474 0.5042 0.5491 -0.0003 0.0387  0.0469  350 ASN A O   
4219 C CB  . ASN A 279 ? 0.8995 0.8100 0.8718 -0.0020 0.0220  0.0528  350 ASN A CB  
4220 C CG  . ASN A 279 ? 1.0474 0.9701 1.0324 -0.0075 0.0274  0.0529  350 ASN A CG  
4221 O OD1 . ASN A 279 ? 1.1291 1.0593 1.1171 -0.0165 0.0316  0.0569  350 ASN A OD1 
4222 N ND2 . ASN A 279 ? 1.0787 1.0053 1.0711 -0.0021 0.0270  0.0477  350 ASN A ND2 
4229 N N   . ILE A 280 ? 0.6271 0.5742 0.6221 0.0126  0.0316  0.0397  351 ILE A N   
4230 C CA  . ILE A 280 ? 0.6259 0.5891 0.6324 0.0133  0.0362  0.0358  351 ILE A CA  
4231 C C   . ILE A 280 ? 0.6174 0.5909 0.6279 0.0136  0.0400  0.0358  351 ILE A C   
4232 O O   . ILE A 280 ? 0.6308 0.6135 0.6494 0.0107  0.0431  0.0356  351 ILE A O   
4233 C CB  . ILE A 280 ? 0.6482 0.6160 0.6554 0.0195  0.0338  0.0287  351 ILE A CB  
4234 C CG1 . ILE A 280 ? 0.6890 0.6479 0.6927 0.0204  0.0294  0.0274  351 ILE A CG1 
4235 C CG2 . ILE A 280 ? 0.6273 0.6105 0.6431 0.0170  0.0380  0.0260  351 ILE A CG2 
4236 C CD1 . ILE A 280 ? 0.7094 0.6702 0.7189 0.0136  0.0319  0.0299  351 ILE A CD1 
4248 N N   . GLN A 281 ? 0.6127 0.5836 0.6169 0.0180  0.0386  0.0353  352 GLN A N   
4249 C CA  . GLN A 281 ? 0.6220 0.6027 0.6297 0.0190  0.0418  0.0348  352 GLN A CA  
4250 C C   . GLN A 281 ? 0.6039 0.5897 0.6147 0.0129  0.0453  0.0387  352 GLN A C   
4251 O O   . GLN A 281 ? 0.6075 0.6046 0.6266 0.0130  0.0475  0.0365  352 GLN A O   
4252 C CB  . GLN A 281 ? 0.6744 0.6495 0.6731 0.0245  0.0389  0.0342  352 GLN A CB  
4253 C CG  . GLN A 281 ? 0.7156 0.6921 0.7137 0.0327  0.0353  0.0273  352 GLN A CG  
4254 C CD  . GLN A 281 ? 0.7682 0.7395 0.7579 0.0394  0.0315  0.0256  352 GLN A CD  
4255 O OE1 . GLN A 281 ? 0.7579 0.7243 0.7413 0.0369  0.0323  0.0305  352 GLN A OE1 
4256 N NE2 . GLN A 281 ? 0.8008 0.7750 0.7903 0.0478  0.0272  0.0178  352 GLN A NE2 
4265 N N   . LYS A 282 ? 0.6080 0.5863 0.6115 0.0073  0.0449  0.0437  353 LYS A N   
4266 C CA  . LYS A 282 ? 0.6246 0.6132 0.6313 0.0005  0.0488  0.0460  353 LYS A CA  
4267 C C   . LYS A 282 ? 0.5928 0.5912 0.6121 -0.0007 0.0502  0.0429  353 LYS A C   
4268 O O   . LYS A 282 ? 0.5818 0.5946 0.6091 -0.0002 0.0522  0.0396  353 LYS A O   
4269 C CB  . LYS A 282 ? 0.7372 0.7157 0.7321 -0.0082 0.0476  0.0525  353 LYS A CB  
4270 C CG  . LYS A 282 ? 0.8365 0.8312 0.8346 -0.0173 0.0524  0.0540  353 LYS A CG  
4271 C CD  . LYS A 282 ? 0.9702 0.9557 0.9520 -0.0287 0.0513  0.0617  353 LYS A CD  
4272 C CE  . LYS A 282 ? 1.0870 1.0566 1.0633 -0.0354 0.0471  0.0659  353 LYS A CE  
4273 N NZ  . LYS A 282 ? 1.1484 1.1351 1.1382 -0.0409 0.0511  0.0635  353 LYS A NZ  
4287 N N   . GLU A 283 ? 0.5838 0.5741 0.6044 -0.0013 0.0479  0.0429  354 GLU A N   
4288 C CA  . GLU A 283 ? 0.6276 0.6237 0.6580 -0.0024 0.0477  0.0402  354 GLU A CA  
4289 C C   . GLU A 283 ? 0.5904 0.5922 0.6267 0.0025  0.0467  0.0357  354 GLU A C   
4290 O O   . GLU A 283 ? 0.5626 0.5712 0.6060 0.0028  0.0453  0.0325  354 GLU A O   
4291 C CB  . GLU A 283 ? 0.7399 0.7248 0.7682 -0.0038 0.0451  0.0413  354 GLU A CB  
4292 C CG  . GLU A 283 ? 0.8877 0.8755 0.9233 -0.0067 0.0443  0.0399  354 GLU A CG  
4293 C CD  . GLU A 283 ? 1.0513 1.0395 1.0867 -0.0133 0.0450  0.0427  354 GLU A CD  
4294 O OE1 . GLU A 283 ? 1.0870 1.0643 1.1132 -0.0165 0.0439  0.0470  354 GLU A OE1 
4295 O OE2 . GLU A 283 ? 1.1378 1.1370 1.1814 -0.0155 0.0455  0.0400  354 GLU A OE2 
4302 N N   . ALA A 284 ? 0.6135 0.6122 0.6463 0.0062  0.0460  0.0348  355 ALA A N   
4303 C CA  . ALA A 284 ? 0.5872 0.5895 0.6236 0.0082  0.0441  0.0315  355 ALA A CA  
4304 C C   . ALA A 284 ? 0.5416 0.5521 0.5812 0.0114  0.0441  0.0292  355 ALA A C   
4305 O O   . ALA A 284 ? 0.5197 0.5319 0.5632 0.0125  0.0404  0.0261  355 ALA A O   
4306 C CB  . ALA A 284 ? 0.5947 0.5957 0.6271 0.0099  0.0439  0.0303  355 ALA A CB  
4312 N N   . THR A 285 ? 0.5343 0.5486 0.5709 0.0129  0.0471  0.0305  356 THR A N   
4313 C CA  . THR A 285 ? 0.5524 0.5773 0.5919 0.0160  0.0476  0.0276  356 THR A CA  
4314 C C   . THR A 285 ? 0.5363 0.5716 0.5829 0.0150  0.0471  0.0244  356 THR A C   
4315 O O   . THR A 285 ? 0.5183 0.5613 0.5705 0.0196  0.0438  0.0187  356 THR A O   
4316 C CB  . THR A 285 ? 0.5939 0.6200 0.6259 0.0163  0.0508  0.0304  356 THR A CB  
4317 O OG1 . THR A 285 ? 0.6004 0.6174 0.6264 0.0192  0.0497  0.0314  356 THR A OG1 
4318 C CG2 . THR A 285 ? 0.6213 0.6606 0.6558 0.0198  0.0517  0.0268  356 THR A CG2 
4326 N N   . TRP A 286 ? 0.5509 0.5874 0.5974 0.0095  0.0494  0.0269  357 TRP A N   
4327 C CA  . TRP A 286 ? 0.5565 0.6062 0.6113 0.0086  0.0488  0.0222  357 TRP A CA  
4328 C C   . TRP A 286 ? 0.5516 0.5967 0.6124 0.0132  0.0417  0.0171  357 TRP A C   
4329 O O   . TRP A 286 ? 0.5745 0.6301 0.6421 0.0185  0.0375  0.0094  357 TRP A O   
4330 C CB  . TRP A 286 ? 0.5732 0.6224 0.6263 0.0005  0.0517  0.0264  357 TRP A CB  
4331 C CG  . TRP A 286 ? 0.6189 0.6825 0.6820 -0.0004 0.0504  0.0205  357 TRP A CG  
4332 C CD1 . TRP A 286 ? 0.6356 0.7234 0.7057 0.0000  0.0520  0.0138  357 TRP A CD1 
4333 C CD2 . TRP A 286 ? 0.6836 0.7404 0.7510 -0.0012 0.0467  0.0193  357 TRP A CD2 
4334 N NE1 . TRP A 286 ? 0.6630 0.7604 0.7425 0.0003  0.0491  0.0076  357 TRP A NE1 
4335 C CE2 . TRP A 286 ? 0.6988 0.7757 0.7764 -0.0005 0.0456  0.0114  357 TRP A CE2 
4336 C CE3 . TRP A 286 ? 0.7215 0.7591 0.7850 -0.0022 0.0440  0.0233  357 TRP A CE3 
4337 C CZ2 . TRP A 286 ? 0.7420 0.8177 0.8257 -0.0002 0.0412  0.0078  357 TRP A CZ2 
4338 C CZ3 . TRP A 286 ? 0.7507 0.7864 0.8193 -0.0028 0.0402  0.0207  357 TRP A CZ3 
4339 C CH2 . TRP A 286 ? 0.7591 0.8124 0.8375 -0.0016 0.0385  0.0132  357 TRP A CH2 
4350 N N   . THR A 287 ? 0.5396 0.5685 0.5966 0.0113  0.0394  0.0206  358 THR A N   
4351 C CA  . THR A 287 ? 0.5558 0.5759 0.6141 0.0132  0.0316  0.0174  358 THR A CA  
4352 C C   . THR A 287 ? 0.5800 0.5992 0.6379 0.0185  0.0261  0.0134  358 THR A C   
4353 O O   . THR A 287 ? 0.5719 0.5868 0.6314 0.0220  0.0171  0.0082  358 THR A O   
4354 C CB  . THR A 287 ? 0.5792 0.5849 0.6312 0.0083  0.0315  0.0225  358 THR A CB  
4355 O OG1 . THR A 287 ? 0.5887 0.5938 0.6410 0.0044  0.0350  0.0255  358 THR A OG1 
4356 C CG2 . THR A 287 ? 0.5948 0.5890 0.6441 0.0074  0.0230  0.0209  358 THR A CG2 
4364 N N   . MET A 288 ? 0.6270 0.6484 0.6818 0.0196  0.0297  0.0153  359 MET A N   
4365 C CA  . MET A 288 ? 0.6477 0.6679 0.7018 0.0243  0.0241  0.0115  359 MET A CA  
4366 C C   . MET A 288 ? 0.6223 0.6561 0.6830 0.0318  0.0210  0.0036  359 MET A C   
4367 O O   . MET A 288 ? 0.6590 0.6887 0.7202 0.0373  0.0116  -0.0021 359 MET A O   
4368 C CB  . MET A 288 ? 0.6877 0.7088 0.7376 0.0241  0.0288  0.0147  359 MET A CB  
4369 C CG  . MET A 288 ? 0.7580 0.7699 0.8023 0.0184  0.0297  0.0190  359 MET A CG  
4370 S SD  . MET A 288 ? 0.7999 0.7981 0.8393 0.0130  0.0200  0.0188  359 MET A SD  
4371 C CE  . MET A 288 ? 0.8054 0.8032 0.8452 0.0189  0.0126  0.0140  359 MET A CE  
4381 N N   . SER A 289 ? 0.5487 0.5993 0.6137 0.0317  0.0279  0.0026  360 SER A N   
4382 C CA  . SER A 289 ? 0.5499 0.6203 0.6220 0.0384  0.0263  -0.0065 360 SER A CA  
4383 C C   . SER A 289 ? 0.5598 0.6322 0.6387 0.0436  0.0168  -0.0154 360 SER A C   
4384 O O   . SER A 289 ? 0.5860 0.6684 0.6700 0.0530  0.0094  -0.0259 360 SER A O   
4385 C CB  . SER A 289 ? 0.5638 0.6535 0.6369 0.0335  0.0365  -0.0047 360 SER A CB  
4386 O OG  . SER A 289 ? 0.5876 0.6804 0.6639 0.0277  0.0385  -0.0036 360 SER A OG  
4392 N N   . ASN A 290 ? 0.5410 0.6037 0.6197 0.0389  0.0156  -0.0124 361 ASN A N   
4393 C CA  . ASN A 290 ? 0.5644 0.6252 0.6479 0.0445  0.0047  -0.0211 361 ASN A CA  
4394 C C   . ASN A 290 ? 0.5860 0.6215 0.6621 0.0481  -0.0089 -0.0220 361 ASN A C   
4395 O O   . ASN A 290 ? 0.5887 0.6206 0.6669 0.0563  -0.0221 -0.0316 361 ASN A O   
4396 C CB  . ASN A 290 ? 0.5905 0.6491 0.6757 0.0381  0.0076  -0.0177 361 ASN A CB  
4397 C CG  . ASN A 290 ? 0.6253 0.7115 0.7194 0.0358  0.0159  -0.0213 361 ASN A CG  
4398 O OD1 . ASN A 290 ? 0.6484 0.7586 0.7507 0.0422  0.0146  -0.0320 361 ASN A OD1 
4399 N ND2 . ASN A 290 ? 0.6187 0.7031 0.7106 0.0260  0.0241  -0.0130 361 ASN A ND2 
4406 N N   . ILE A 291 ? 0.6105 0.6286 0.6770 0.0415  -0.0072 -0.0127 362 ILE A N   
4407 C CA  . ILE A 291 ? 0.6432 0.6385 0.7005 0.0420  -0.0201 -0.0127 362 ILE A CA  
4408 C C   . ILE A 291 ? 0.6694 0.6695 0.7283 0.0515  -0.0270 -0.0204 362 ILE A C   
4409 O O   . ILE A 291 ? 0.6856 0.6730 0.7413 0.0583  -0.0428 -0.0277 362 ILE A O   
4410 C CB  . ILE A 291 ? 0.6262 0.6077 0.6737 0.0307  -0.0150 -0.0016 362 ILE A CB  
4411 C CG1 . ILE A 291 ? 0.6580 0.6327 0.7028 0.0230  -0.0117 0.0039  362 ILE A CG1 
4412 C CG2 . ILE A 291 ? 0.6039 0.5649 0.6405 0.0282  -0.0271 -0.0007 362 ILE A CG2 
4413 C CD1 . ILE A 291 ? 0.6832 0.6491 0.7190 0.0121  -0.0067 0.0127  362 ILE A CD1 
4425 N N   . THR A 292 ? 0.6675 0.6840 0.7300 0.0525  -0.0167 -0.0193 363 THR A N   
4426 C CA  . THR A 292 ? 0.6610 0.6842 0.7254 0.0621  -0.0226 -0.0271 363 THR A CA  
4427 C C   . THR A 292 ? 0.6664 0.7084 0.7406 0.0742  -0.0289 -0.0412 363 THR A C   
4428 O O   . THR A 292 ? 0.6854 0.7343 0.7618 0.0844  -0.0360 -0.0503 363 THR A O   
4429 C CB  . THR A 292 ? 0.6215 0.6592 0.6870 0.0607  -0.0101 -0.0231 363 THR A CB  
4430 O OG1 . THR A 292 ? 0.6013 0.6609 0.6729 0.0587  0.0023  -0.0224 363 THR A OG1 
4431 C CG2 . THR A 292 ? 0.5971 0.6201 0.6544 0.0512  -0.0054 -0.0124 363 THR A CG2 
4439 N N   . ALA A 293 ? 0.6444 0.6976 0.7252 0.0737  -0.0262 -0.0441 364 ALA A N   
4440 C CA  . ALA A 293 ? 0.6536 0.7267 0.7445 0.0854  -0.0338 -0.0596 364 ALA A CA  
4441 C C   . ALA A 293 ? 0.7158 0.7659 0.8027 0.0933  -0.0544 -0.0675 364 ALA A C   
4442 O O   . ALA A 293 ? 0.7487 0.8137 0.8441 0.1052  -0.0637 -0.0826 364 ALA A O   
4443 C CB  . ALA A 293 ? 0.6358 0.7331 0.7357 0.0801  -0.0220 -0.0598 364 ALA A CB  
4449 N N   . GLY A 294 ? 0.7371 0.7521 0.8103 0.0867  -0.0626 -0.0583 365 GLY A N   
4450 C CA  . GLY A 294 ? 0.7777 0.7645 0.8423 0.0913  -0.0834 -0.0632 365 GLY A CA  
4451 C C   . GLY A 294 ? 0.7887 0.7570 0.8453 0.1007  -0.1025 -0.0705 365 GLY A C   
4452 O O   . GLY A 294 ? 0.7906 0.7765 0.8535 0.1095  -0.1014 -0.0779 365 GLY A O   
4456 N N   . ARG A 295 ? 0.7736 0.7042 0.8145 0.0982  -0.1211 -0.0682 366 ARG A N   
4457 C CA  . ARG A 295 ? 0.8037 0.7084 0.8330 0.1062  -0.1438 -0.0747 366 ARG A CA  
4458 C C   . ARG A 295 ? 0.7758 0.6750 0.7988 0.0983  -0.1381 -0.0657 366 ARG A C   
4459 O O   . ARG A 295 ? 0.7468 0.6512 0.7688 0.0836  -0.1202 -0.0518 366 ARG A O   
4460 C CB  . ARG A 295 ? 0.8766 0.7371 0.8858 0.1009  -0.1653 -0.0712 366 ARG A CB  
4461 C CG  . ARG A 295 ? 0.9350 0.7952 0.9480 0.1091  -0.1742 -0.0804 366 ARG A CG  
4462 C CD  . ARG A 295 ? 1.0279 0.8386 1.0171 0.1063  -0.2009 -0.0786 366 ARG A CD  
4463 N NE  . ARG A 295 ? 1.0783 0.8644 1.0497 0.0827  -0.1942 -0.0584 366 ARG A NE  
4464 C CZ  . ARG A 295 ? 1.1086 0.8796 1.0710 0.0723  -0.1942 -0.0506 366 ARG A CZ  
4465 N NH1 . ARG A 295 ? 1.1352 0.9097 1.1042 0.0833  -0.2013 -0.0608 366 ARG A NH1 
4466 N NH2 . ARG A 295 ? 1.1020 0.8560 1.0486 0.0505  -0.1870 -0.0333 366 ARG A NH2 
4480 N N   . GLN A 296 ? 0.8093 0.6971 0.8276 0.1090  -0.1553 -0.0747 367 GLN A N   
4481 C CA  . GLN A 296 ? 0.8193 0.7016 0.8318 0.1027  -0.1522 -0.0677 367 GLN A CA  
4482 C C   . GLN A 296 ? 0.7922 0.6440 0.7863 0.0812  -0.1527 -0.0505 367 GLN A C   
4483 O O   . GLN A 296 ? 0.7730 0.6322 0.7669 0.0702  -0.1388 -0.0407 367 GLN A O   
4484 C CB  . GLN A 296 ? 0.8806 0.7515 0.8895 0.1186  -0.1743 -0.0813 367 GLN A CB  
4485 C CG  . GLN A 296 ? 0.9012 0.8110 0.9295 0.1392  -0.1707 -0.0992 367 GLN A CG  
4486 C CD  . GLN A 296 ? 0.9401 0.8414 0.9654 0.1562  -0.1922 -0.1139 367 GLN A CD  
4487 O OE1 . GLN A 296 ? 0.9691 0.8290 0.9764 0.1551  -0.2155 -0.1129 367 GLN A OE1 
4488 N NE2 . GLN A 296 ? 0.9370 0.8771 0.9787 0.1713  -0.1851 -0.1276 367 GLN A NE2 
4497 N N   . ASP A 297 ? 0.8384 0.6578 0.8167 0.0745  -0.1683 -0.0471 368 ASP A N   
4498 C CA  . ASP A 297 ? 0.8637 0.6581 0.8235 0.0517  -0.1677 -0.0307 368 ASP A CA  
4499 C C   . ASP A 297 ? 0.8276 0.6458 0.7959 0.0391  -0.1416 -0.0201 368 ASP A C   
4500 O O   . ASP A 297 ? 0.8388 0.6529 0.7984 0.0214  -0.1335 -0.0080 368 ASP A O   
4501 C CB  . ASP A 297 ? 0.9764 0.7288 0.9144 0.0469  -0.1921 -0.0295 368 ASP A CB  
4502 C CG  . ASP A 297 ? 1.0773 0.8351 1.0208 0.0504  -0.1890 -0.0320 368 ASP A CG  
4503 O OD1 . ASP A 297 ? 1.1191 0.8847 1.0730 0.0701  -0.1983 -0.0470 368 ASP A OD1 
4504 O OD2 . ASP A 297 ? 1.1256 0.8815 1.0632 0.0339  -0.1777 -0.0199 368 ASP A OD2 
4509 N N   . GLN A 298 ? 0.7851 0.6293 0.7700 0.0479  -0.1291 -0.0251 369 GLN A N   
4510 C CA  . GLN A 298 ? 0.7460 0.6114 0.7387 0.0376  -0.1059 -0.0159 369 GLN A CA  
4511 C C   . GLN A 298 ? 0.7319 0.6246 0.7362 0.0382  -0.0877 -0.0141 369 GLN A C   
4512 O O   . GLN A 298 ? 0.7338 0.6342 0.7373 0.0263  -0.0733 -0.0046 369 GLN A O   
4513 C CB  . GLN A 298 ? 0.7304 0.6105 0.7346 0.0450  -0.1006 -0.0212 369 GLN A CB  
4514 C CG  . GLN A 298 ? 0.7656 0.6175 0.7571 0.0433  -0.1178 -0.0220 369 GLN A CG  
4515 C CD  . GLN A 298 ? 0.7670 0.6343 0.7709 0.0515  -0.1141 -0.0287 369 GLN A CD  
4516 O OE1 . GLN A 298 ? 0.7149 0.6103 0.7360 0.0642  -0.1082 -0.0390 369 GLN A OE1 
4517 N NE2 . GLN A 298 ? 0.8213 0.6715 0.8158 0.0430  -0.1174 -0.0230 369 GLN A NE2 
4526 N N   . ILE A 299 ? 0.6947 0.6026 0.7090 0.0526  -0.0891 -0.0239 370 ILE A N   
4527 C CA  . ILE A 299 ? 0.6754 0.6032 0.6966 0.0528  -0.0755 -0.0219 370 ILE A CA  
4528 C C   . ILE A 299 ? 0.6867 0.5974 0.6954 0.0405  -0.0789 -0.0138 370 ILE A C   
4529 O O   . ILE A 299 ? 0.6436 0.5677 0.6552 0.0340  -0.0649 -0.0079 370 ILE A O   
4530 C CB  . ILE A 299 ? 0.6917 0.6361 0.7227 0.0700  -0.0795 -0.0347 370 ILE A CB  
4531 C CG1 . ILE A 299 ? 0.6936 0.6668 0.7392 0.0786  -0.0694 -0.0417 370 ILE A CG1 
4532 C CG2 . ILE A 299 ? 0.6743 0.6305 0.7077 0.0700  -0.0709 -0.0326 370 ILE A CG2 
4533 C CD1 . ILE A 299 ? 0.7124 0.7046 0.7673 0.0961  -0.0765 -0.0575 370 ILE A CD1 
4545 N N   . GLN A 300 ? 0.7576 0.6383 0.7515 0.0365  -0.0986 -0.0137 371 GLN A N   
4546 C CA  . GLN A 300 ? 0.7707 0.6357 0.7515 0.0228  -0.1032 -0.0063 371 GLN A CA  
4547 C C   . GLN A 300 ? 0.7473 0.6143 0.7221 0.0035  -0.0913 0.0054  371 GLN A C   
4548 O O   . GLN A 300 ? 0.7281 0.6019 0.7006 -0.0071 -0.0842 0.0108  371 GLN A O   
4549 C CB  . GLN A 300 ? 0.8030 0.6314 0.7661 0.0217  -0.1296 -0.0085 371 GLN A CB  
4550 C CG  . GLN A 300 ? 0.8381 0.6498 0.7869 0.0072  -0.1368 -0.0017 371 GLN A CG  
4551 C CD  . GLN A 300 ? 0.8594 0.6917 0.8196 0.0148  -0.1287 -0.0056 371 GLN A CD  
4552 O OE1 . GLN A 300 ? 0.8664 0.7081 0.8370 0.0337  -0.1322 -0.0164 371 GLN A OE1 
4553 N NE2 . GLN A 300 ? 0.8738 0.7157 0.8324 0.0003  -0.1177 0.0022  371 GLN A NE2 
4562 N N   . GLN A 301 ? 0.7659 0.6295 0.7388 -0.0006 -0.0890 0.0083  372 GLN A N   
4563 C CA  . GLN A 301 ? 0.7690 0.6389 0.7375 -0.0171 -0.0769 0.0177  372 GLN A CA  
4564 C C   . GLN A 301 ? 0.6901 0.5922 0.6745 -0.0136 -0.0553 0.0179  372 GLN A C   
4565 O O   . GLN A 301 ? 0.6770 0.5896 0.6594 -0.0253 -0.0453 0.0233  372 GLN A O   
4566 C CB  . GLN A 301 ? 0.8518 0.7089 0.8138 -0.0210 -0.0810 0.0200  372 GLN A CB  
4567 C CG  . GLN A 301 ? 0.9500 0.7716 0.8948 -0.0222 -0.1049 0.0188  372 GLN A CG  
4568 C CD  . GLN A 301 ? 1.0325 0.8372 0.9646 -0.0326 -0.1098 0.0242  372 GLN A CD  
4569 O OE1 . GLN A 301 ? 1.0454 0.8394 0.9782 -0.0225 -0.1190 0.0189  372 GLN A OE1 
4570 N NE2 . GLN A 301 ? 1.0838 0.8877 1.0039 -0.0530 -0.1038 0.0341  372 GLN A NE2 
4579 N N   . VAL A 302 ? 0.6479 0.5661 0.6468 0.0021  -0.0490 0.0115  373 VAL A N   
4580 C CA  . VAL A 302 ? 0.6088 0.5524 0.6193 0.0057  -0.0317 0.0118  373 VAL A CA  
4581 C C   . VAL A 302 ? 0.6212 0.5701 0.6307 0.0033  -0.0303 0.0121  373 VAL A C   
4582 O O   . VAL A 302 ? 0.6083 0.5714 0.6202 -0.0017 -0.0191 0.0149  373 VAL A O   
4583 C CB  . VAL A 302 ? 0.6164 0.5744 0.6394 0.0206  -0.0271 0.0053  373 VAL A CB  
4584 C CG1 . VAL A 302 ? 0.5989 0.5777 0.6297 0.0236  -0.0124 0.0062  373 VAL A CG1 
4585 C CG2 . VAL A 302 ? 0.6267 0.5832 0.6521 0.0217  -0.0270 0.0048  373 VAL A CG2 
4595 N N   . VAL A 303 ? 0.6283 0.5657 0.6341 0.0077  -0.0429 0.0082  374 VAL A N   
4596 C CA  . VAL A 303 ? 0.6509 0.5915 0.6552 0.0052  -0.0435 0.0082  374 VAL A CA  
4597 C C   . VAL A 303 ? 0.6443 0.5802 0.6382 -0.0137 -0.0434 0.0150  374 VAL A C   
4598 O O   . VAL A 303 ? 0.6236 0.5765 0.6211 -0.0182 -0.0337 0.0160  374 VAL A O   
4599 C CB  . VAL A 303 ? 0.7116 0.6372 0.7125 0.0140  -0.0598 0.0020  374 VAL A CB  
4600 C CG1 . VAL A 303 ? 0.7445 0.6679 0.7409 0.0084  -0.0635 0.0029  374 VAL A CG1 
4601 C CG2 . VAL A 303 ? 0.7061 0.6470 0.7195 0.0326  -0.0563 -0.0064 374 VAL A CG2 
4611 N N   . ASN A 304 ? 0.6655 0.5798 0.6456 -0.0255 -0.0546 0.0193  375 ASN A N   
4612 C CA  . ASN A 304 ? 0.7074 0.6169 0.6744 -0.0466 -0.0564 0.0260  375 ASN A CA  
4613 C C   . ASN A 304 ? 0.6421 0.5751 0.6139 -0.0546 -0.0399 0.0289  375 ASN A C   
4614 O O   . ASN A 304 ? 0.6447 0.5891 0.6120 -0.0692 -0.0359 0.0313  375 ASN A O   
4615 C CB  . ASN A 304 ? 0.8115 0.6888 0.7592 -0.0581 -0.0738 0.0307  375 ASN A CB  
4616 C CG  . ASN A 304 ? 0.8903 0.7405 0.8305 -0.0500 -0.0941 0.0267  375 ASN A CG  
4617 O OD1 . ASN A 304 ? 0.8649 0.7189 0.8099 -0.0429 -0.0966 0.0225  375 ASN A OD1 
4618 N ND2 . ASN A 304 ? 0.9744 0.7962 0.9023 -0.0498 -0.1101 0.0271  375 ASN A ND2 
4625 N N   . HIS A 305 ? 0.6150 0.5564 0.5954 -0.0458 -0.0311 0.0278  376 HIS A N   
4626 C CA  . HIS A 305 ? 0.6062 0.5700 0.5923 -0.0498 -0.0164 0.0286  376 HIS A CA  
4627 C C   . HIS A 305 ? 0.6012 0.5885 0.6007 -0.0392 -0.0050 0.0238  376 HIS A C   
4628 O O   . HIS A 305 ? 0.5678 0.5723 0.5732 -0.0376 0.0057  0.0225  376 HIS A O   
4629 C CB  . HIS A 305 ? 0.6422 0.6031 0.6309 -0.0451 -0.0130 0.0295  376 HIS A CB  
4630 C CG  . HIS A 305 ? 0.7278 0.6705 0.7022 -0.0584 -0.0214 0.0346  376 HIS A CG  
4631 N ND1 . HIS A 305 ? 0.8082 0.7229 0.7708 -0.0606 -0.0378 0.0361  376 HIS A ND1 
4632 C CD2 . HIS A 305 ? 0.7454 0.6927 0.7137 -0.0698 -0.0168 0.0381  376 HIS A CD2 
4633 C CE1 . HIS A 305 ? 0.8410 0.7418 0.7897 -0.0737 -0.0432 0.0413  376 HIS A CE1 
4634 N NE2 . HIS A 305 ? 0.8028 0.7242 0.7550 -0.0799 -0.0299 0.0427  376 HIS A NE2 
4642 N N   . GLY A 306 ? 0.6241 0.6107 0.6273 -0.0311 -0.0084 0.0206  377 GLY A N   
4643 C CA  . GLY A 306 ? 0.6214 0.6276 0.6345 -0.0221 0.0006  0.0162  377 GLY A CA  
4644 C C   . GLY A 306 ? 0.5991 0.6135 0.6209 -0.0088 0.0094  0.0144  377 GLY A C   
4645 O O   . GLY A 306 ? 0.5935 0.6232 0.6205 -0.0043 0.0174  0.0118  377 GLY A O   
4649 N N   . LEU A 307 ? 0.5776 0.5817 0.6005 -0.0026 0.0072  0.0153  378 LEU A N   
4650 C CA  . LEU A 307 ? 0.5642 0.5755 0.5933 0.0063  0.0154  0.0148  378 LEU A CA  
4651 C C   . LEU A 307 ? 0.5397 0.5563 0.5739 0.0184  0.0173  0.0117  378 LEU A C   
4652 O O   . LEU A 307 ? 0.5356 0.5591 0.5723 0.0237  0.0245  0.0119  378 LEU A O   
4653 C CB  . LEU A 307 ? 0.5995 0.6013 0.6278 0.0054  0.0132  0.0169  378 LEU A CB  
4654 C CG  . LEU A 307 ? 0.6531 0.6514 0.6762 -0.0055 0.0138  0.0204  378 LEU A CG  
4655 C CD1 . LEU A 307 ? 0.6799 0.6667 0.7022 -0.0047 0.0096  0.0215  378 LEU A CD1 
4656 C CD2 . LEU A 307 ? 0.6528 0.6647 0.6786 -0.0055 0.0235  0.0203  378 LEU A CD2 
4668 N N   . VAL A 308 ? 0.5297 0.5424 0.5638 0.0224  0.0104  0.0088  379 VAL A N   
4669 C CA  . VAL A 308 ? 0.5389 0.5589 0.5769 0.0336  0.0125  0.0053  379 VAL A CA  
4670 C C   . VAL A 308 ? 0.5241 0.5545 0.5628 0.0364  0.0203  0.0054  379 VAL A C   
4671 O O   . VAL A 308 ? 0.5464 0.5820 0.5858 0.0422  0.0259  0.0057  379 VAL A O   
4672 C CB  . VAL A 308 ? 0.5658 0.5803 0.6032 0.0380  0.0024  0.0009  379 VAL A CB  
4673 C CG1 . VAL A 308 ? 0.5909 0.6164 0.6320 0.0494  0.0056  -0.0033 379 VAL A CG1 
4674 C CG2 . VAL A 308 ? 0.5575 0.5597 0.5933 0.0384  -0.0080 -0.0011 379 VAL A CG2 
4684 N N   . PRO A 309 ? 0.5278 0.5617 0.5655 0.0324  0.0203  0.0046  380 PRO A N   
4685 C CA  . PRO A 309 ? 0.5232 0.5665 0.5614 0.0372  0.0261  0.0030  380 PRO A CA  
4686 C C   . PRO A 309 ? 0.5558 0.5999 0.5928 0.0381  0.0320  0.0052  380 PRO A C   
4687 O O   . PRO A 309 ? 0.5510 0.5970 0.5858 0.0448  0.0348  0.0045  380 PRO A O   
4688 C CB  . PRO A 309 ? 0.5344 0.5846 0.5729 0.0305  0.0244  0.0005  380 PRO A CB  
4689 C CG  . PRO A 309 ? 0.5303 0.5717 0.5667 0.0233  0.0163  0.0016  380 PRO A CG  
4690 C CD  . PRO A 309 ? 0.5115 0.5416 0.5464 0.0225  0.0142  0.0048  380 PRO A CD  
4698 N N   . PHE A 310 ? 0.5856 0.6262 0.6224 0.0317  0.0328  0.0080  381 PHE A N   
4699 C CA  . PHE A 310 ? 0.6033 0.6430 0.6384 0.0332  0.0372  0.0098  381 PHE A CA  
4700 C C   . PHE A 310 ? 0.6135 0.6482 0.6473 0.0369  0.0390  0.0128  381 PHE A C   
4701 O O   . PHE A 310 ? 0.6181 0.6504 0.6476 0.0395  0.0416  0.0145  381 PHE A O   
4702 C CB  . PHE A 310 ? 0.5798 0.6187 0.6149 0.0252  0.0377  0.0113  381 PHE A CB  
4703 C CG  . PHE A 310 ? 0.5291 0.5783 0.5646 0.0200  0.0375  0.0077  381 PHE A CG  
4704 C CD1 . PHE A 310 ? 0.5161 0.5743 0.5516 0.0235  0.0399  0.0034  381 PHE A CD1 
4705 C CD2 . PHE A 310 ? 0.5089 0.5595 0.5438 0.0112  0.0340  0.0078  381 PHE A CD2 
4706 C CE1 . PHE A 310 ? 0.5317 0.6055 0.5689 0.0186  0.0403  -0.0018 381 PHE A CE1 
4707 C CE2 . PHE A 310 ? 0.5261 0.5900 0.5608 0.0038  0.0345  0.0044  381 PHE A CE2 
4708 C CZ  . PHE A 310 ? 0.5403 0.6187 0.5773 0.0075  0.0384  -0.0010 381 PHE A CZ  
4718 N N   . LEU A 311 ? 0.5876 0.6213 0.6239 0.0368  0.0367  0.0129  382 LEU A N   
4719 C CA  . LEU A 311 ? 0.6108 0.6466 0.6468 0.0396  0.0391  0.0140  382 LEU A CA  
4720 C C   . LEU A 311 ? 0.6024 0.6426 0.6346 0.0454  0.0409  0.0132  382 LEU A C   
4721 O O   . LEU A 311 ? 0.5985 0.6392 0.6256 0.0452  0.0445  0.0160  382 LEU A O   
4722 C CB  . LEU A 311 ? 0.6650 0.7025 0.7060 0.0402  0.0350  0.0113  382 LEU A CB  
4723 C CG  . LEU A 311 ? 0.7382 0.7693 0.7810 0.0346  0.0327  0.0127  382 LEU A CG  
4724 C CD1 . LEU A 311 ? 0.7995 0.8285 0.8458 0.0369  0.0246  0.0082  382 LEU A CD1 
4725 C CD2 . LEU A 311 ? 0.7412 0.7738 0.7837 0.0320  0.0380  0.0160  382 LEU A CD2 
4737 N N   . VAL A 312 ? 0.6178 0.6603 0.6509 0.0494  0.0381  0.0097  383 VAL A N   
4738 C CA  . VAL A 312 ? 0.6547 0.7001 0.6830 0.0552  0.0392  0.0087  383 VAL A CA  
4739 C C   . VAL A 312 ? 0.6348 0.6743 0.6556 0.0556  0.0412  0.0113  383 VAL A C   
4740 O O   . VAL A 312 ? 0.6645 0.7011 0.6767 0.0572  0.0426  0.0137  383 VAL A O   
4741 C CB  . VAL A 312 ? 0.7012 0.7495 0.7325 0.0593  0.0348  0.0040  383 VAL A CB  
4742 C CG1 . VAL A 312 ? 0.7587 0.8092 0.7845 0.0658  0.0356  0.0027  383 VAL A CG1 
4743 C CG2 . VAL A 312 ? 0.6809 0.7314 0.7173 0.0606  0.0301  0.0007  383 VAL A CG2 
4753 N N   . GLY A 313 ? 0.5651 0.6024 0.5876 0.0539  0.0402  0.0101  384 GLY A N   
4754 C CA  . GLY A 313 ? 0.5487 0.5797 0.5643 0.0561  0.0398  0.0105  384 GLY A CA  
4755 C C   . GLY A 313 ? 0.5458 0.5673 0.5538 0.0530  0.0413  0.0163  384 GLY A C   
4756 O O   . GLY A 313 ? 0.5663 0.5787 0.5631 0.0554  0.0396  0.0184  384 GLY A O   
4760 N N   . VAL A 314 ? 0.5435 0.5657 0.5560 0.0467  0.0435  0.0190  385 VAL A N   
4761 C CA  . VAL A 314 ? 0.5686 0.5836 0.5747 0.0420  0.0450  0.0245  385 VAL A CA  
4762 C C   . VAL A 314 ? 0.5966 0.6129 0.5950 0.0411  0.0467  0.0276  385 VAL A C   
4763 O O   . VAL A 314 ? 0.6095 0.6152 0.5951 0.0385  0.0457  0.0322  385 VAL A O   
4764 C CB  . VAL A 314 ? 0.5903 0.6091 0.6046 0.0361  0.0470  0.0256  385 VAL A CB  
4765 C CG1 . VAL A 314 ? 0.6110 0.6266 0.6202 0.0302  0.0491  0.0307  385 VAL A CG1 
4766 C CG2 . VAL A 314 ? 0.5862 0.6018 0.6037 0.0351  0.0454  0.0241  385 VAL A CG2 
4776 N N   . LEU A 315 ? 0.6207 0.6497 0.6256 0.0426  0.0484  0.0247  386 LEU A N   
4777 C CA  . LEU A 315 ? 0.6714 0.7071 0.6697 0.0414  0.0508  0.0263  386 LEU A CA  
4778 C C   . LEU A 315 ? 0.7203 0.7460 0.7048 0.0446  0.0485  0.0282  386 LEU A C   
4779 O O   . LEU A 315 ? 0.7450 0.7698 0.7173 0.0401  0.0498  0.0325  386 LEU A O   
4780 C CB  . LEU A 315 ? 0.6803 0.7321 0.6887 0.0458  0.0511  0.0202  386 LEU A CB  
4781 C CG  . LEU A 315 ? 0.7262 0.7932 0.7317 0.0445  0.0544  0.0191  386 LEU A CG  
4782 C CD1 . LEU A 315 ? 0.7240 0.8009 0.7321 0.0366  0.0580  0.0205  386 LEU A CD1 
4783 C CD2 . LEU A 315 ? 0.7520 0.8315 0.7669 0.0528  0.0517  0.0110  386 LEU A CD2 
4795 N N   . SER A 316 ? 0.7335 0.7523 0.7187 0.0516  0.0444  0.0248  387 SER A N   
4796 C CA  . SER A 316 ? 0.7675 0.7769 0.7403 0.0569  0.0405  0.0247  387 SER A CA  
4797 C C   . SER A 316 ? 0.8126 0.8018 0.7711 0.0560  0.0354  0.0284  387 SER A C   
4798 O O   . SER A 316 ? 0.8828 0.8590 0.8241 0.0555  0.0317  0.0322  387 SER A O   
4799 C CB  . SER A 316 ? 0.7697 0.7841 0.7507 0.0658  0.0376  0.0174  387 SER A CB  
4800 O OG  . SER A 316 ? 0.7674 0.7960 0.7587 0.0670  0.0398  0.0140  387 SER A OG  
4806 N N   . LYS A 317 ? 0.7517 0.7368 0.7155 0.0556  0.0339  0.0272  388 LYS A N   
4807 C CA  . LYS A 317 ? 0.7981 0.7649 0.7508 0.0593  0.0263  0.0268  388 LYS A CA  
4808 C C   . LYS A 317 ? 0.7937 0.7484 0.7403 0.0516  0.0254  0.0325  388 LYS A C   
4809 O O   . LYS A 317 ? 0.8695 0.8048 0.8035 0.0545  0.0170  0.0328  388 LYS A O   
4810 C CB  . LYS A 317 ? 0.8375 0.8119 0.8014 0.0681  0.0236  0.0172  388 LYS A CB  
4811 C CG  . LYS A 317 ? 0.8665 0.8569 0.8405 0.0733  0.0255  0.0111  388 LYS A CG  
4812 C CD  . LYS A 317 ? 0.8948 0.8937 0.8763 0.0810  0.0218  0.0011  388 LYS A CD  
4813 C CE  . LYS A 317 ? 0.9143 0.9274 0.9097 0.0755  0.0262  -0.0011 388 LYS A CE  
4814 N NZ  . LYS A 317 ? 0.9414 0.9656 0.9422 0.0816  0.0226  -0.0115 388 LYS A NZ  
4828 N N   . ALA A 318 ? 0.7322 0.6972 0.6874 0.0429  0.0323  0.0362  389 ALA A N   
4829 C CA  . ALA A 318 ? 0.6775 0.6329 0.6291 0.0358  0.0314  0.0408  389 ALA A CA  
4830 C C   . ALA A 318 ? 0.7220 0.6626 0.6544 0.0260  0.0293  0.0498  389 ALA A C   
4831 O O   . ALA A 318 ? 0.7092 0.6495 0.6312 0.0239  0.0297  0.0527  389 ALA A O   
4832 C CB  . ALA A 318 ? 0.6156 0.5879 0.5839 0.0308  0.0385  0.0402  389 ALA A CB  
4838 N N   . ASP A 319 ? 0.8237 0.7517 0.7499 0.0189  0.0267  0.0545  390 ASP A N   
4839 C CA  . ASP A 319 ? 0.9197 0.8348 0.8274 0.0055  0.0250  0.0641  390 ASP A CA  
4840 C C   . ASP A 319 ? 0.8967 0.8371 0.8122 -0.0047 0.0357  0.0665  390 ASP A C   
4841 O O   . ASP A 319 ? 0.8901 0.8538 0.8259 -0.0007 0.0427  0.0607  390 ASP A O   
4842 C CB  . ASP A 319 ? 1.0191 0.9165 0.9208 0.0000  0.0195  0.0677  390 ASP A CB  
4843 C CG  . ASP A 319 ? 1.0758 0.9915 0.9986 -0.0013 0.0266  0.0645  390 ASP A CG  
4844 O OD1 . ASP A 319 ? 1.1125 1.0372 1.0505 0.0092  0.0277  0.0569  390 ASP A OD1 
4845 O OD2 . ASP A 319 ? 1.0848 1.0060 1.0082 -0.0134 0.0306  0.0696  390 ASP A OD2 
4850 N N   . PHE A 320 ? 0.8700 0.8060 0.7681 -0.0183 0.0360  0.0746  391 PHE A N   
4851 C CA  . PHE A 320 ? 0.8565 0.8216 0.7611 -0.0269 0.0459  0.0747  391 PHE A CA  
4852 C C   . PHE A 320 ? 0.8129 0.8004 0.7378 -0.0304 0.0528  0.0711  391 PHE A C   
4853 O O   . PHE A 320 ? 0.7831 0.7989 0.7237 -0.0279 0.0598  0.0648  391 PHE A O   
4854 C CB  . PHE A 320 ? 0.9433 0.9021 0.8237 -0.0440 0.0452  0.0843  391 PHE A CB  
4855 C CG  . PHE A 320 ? 1.0164 1.0105 0.9032 -0.0520 0.0557  0.0824  391 PHE A CG  
4856 C CD1 . PHE A 320 ? 1.0173 1.0281 0.9099 -0.0426 0.0591  0.0763  391 PHE A CD1 
4857 C CD2 . PHE A 320 ? 1.1021 1.1155 0.9904 -0.0681 0.0617  0.0850  391 PHE A CD2 
4858 C CE1 . PHE A 320 ? 1.0669 1.1126 0.9661 -0.0481 0.0678  0.0724  391 PHE A CE1 
4859 C CE2 . PHE A 320 ? 1.1493 1.2007 1.0452 -0.0742 0.0711  0.0805  391 PHE A CE2 
4860 C CZ  . PHE A 320 ? 1.1286 1.1963 1.0298 -0.0636 0.0739  0.0738  391 PHE A CZ  
4870 N N   . LYS A 321 ? 0.7982 0.7729 0.7223 -0.0355 0.0498  0.0743  392 LYS A N   
4871 C CA  . LYS A 321 ? 0.8192 0.8144 0.7616 -0.0388 0.0555  0.0706  392 LYS A CA  
4872 C C   . LYS A 321 ? 0.7537 0.7608 0.7178 -0.0243 0.0573  0.0613  392 LYS A C   
4873 O O   . LYS A 321 ? 0.7271 0.7583 0.7069 -0.0233 0.0623  0.0554  392 LYS A O   
4874 C CB  . LYS A 321 ? 0.9401 0.9170 0.8763 -0.0468 0.0510  0.0760  392 LYS A CB  
4875 C CG  . LYS A 321 ? 1.1142 1.0801 1.0282 -0.0652 0.0487  0.0861  392 LYS A CG  
4876 C CD  . LYS A 321 ? 1.2823 1.2254 1.1891 -0.0719 0.0420  0.0912  392 LYS A CD  
4877 C CE  . LYS A 321 ? 1.4416 1.3708 1.3234 -0.0931 0.0383  0.1025  392 LYS A CE  
4878 N NZ  . LYS A 321 ? 1.5255 1.4301 1.3991 -0.1000 0.0301  0.1075  392 LYS A NZ  
4892 N N   . THR A 322 ? 0.7611 0.7519 0.7254 -0.0133 0.0522  0.0591  393 THR A N   
4893 C CA  . THR A 322 ? 0.6753 0.6764 0.6568 -0.0023 0.0534  0.0513  393 THR A CA  
4894 C C   . THR A 322 ? 0.6307 0.6491 0.6176 0.0027  0.0566  0.0468  393 THR A C   
4895 O O   . THR A 322 ? 0.5887 0.6218 0.5901 0.0075  0.0582  0.0406  393 THR A O   
4896 C CB  . THR A 322 ? 0.6664 0.6507 0.6458 0.0064  0.0478  0.0495  393 THR A CB  
4897 O OG1 . THR A 322 ? 0.7023 0.6721 0.6774 0.0030  0.0442  0.0523  393 THR A OG1 
4898 C CG2 . THR A 322 ? 0.6080 0.6030 0.6026 0.0143  0.0489  0.0425  393 THR A CG2 
4906 N N   . GLN A 323 ? 0.6429 0.6580 0.6169 0.0018  0.0562  0.0496  394 GLN A N   
4907 C CA  . GLN A 323 ? 0.6877 0.7198 0.6661 0.0068  0.0589  0.0449  394 GLN A CA  
4908 C C   . GLN A 323 ? 0.7110 0.7697 0.6995 0.0024  0.0643  0.0409  394 GLN A C   
4909 O O   . GLN A 323 ? 0.7227 0.7976 0.7227 0.0101  0.0649  0.0333  394 GLN A O   
4910 C CB  . GLN A 323 ? 0.7344 0.7575 0.6947 0.0052  0.0573  0.0492  394 GLN A CB  
4911 C CG  . GLN A 323 ? 0.7750 0.7791 0.7297 0.0151  0.0511  0.0482  394 GLN A CG  
4912 C CD  . GLN A 323 ? 0.8425 0.8320 0.7760 0.0132  0.0472  0.0531  394 GLN A CD  
4913 O OE1 . GLN A 323 ? 0.8757 0.8538 0.7920 0.0020  0.0457  0.0609  394 GLN A OE1 
4914 N NE2 . GLN A 323 ? 0.8535 0.8421 0.7865 0.0233  0.0447  0.0489  394 GLN A NE2 
4923 N N   . LYS A 324 ? 0.7243 0.7886 0.7083 -0.0097 0.0672  0.0451  395 LYS A N   
4924 C CA  . LYS A 324 ? 0.7285 0.8225 0.7242 -0.0133 0.0720  0.0391  395 LYS A CA  
4925 C C   . LYS A 324 ? 0.6732 0.7731 0.6880 -0.0037 0.0697  0.0309  395 LYS A C   
4926 O O   . LYS A 324 ? 0.6537 0.7743 0.6803 0.0032  0.0697  0.0215  395 LYS A O   
4927 C CB  . LYS A 324 ? 0.8314 0.9300 0.8197 -0.0295 0.0751  0.0450  395 LYS A CB  
4928 C CG  . LYS A 324 ? 0.9835 1.0797 0.9501 -0.0427 0.0770  0.0534  395 LYS A CG  
4929 C CD  . LYS A 324 ? 1.1502 1.2408 1.1056 -0.0608 0.0776  0.0617  395 LYS A CD  
4930 C CE  . LYS A 324 ? 1.2825 1.4090 1.2529 -0.0681 0.0839  0.0551  395 LYS A CE  
4931 N NZ  . LYS A 324 ? 1.3861 1.5059 1.3489 -0.0849 0.0837  0.0625  395 LYS A NZ  
4945 N N   . GLU A 325 ? 0.6632 0.7437 0.6797 -0.0030 0.0664  0.0338  396 GLU A N   
4946 C CA  . GLU A 325 ? 0.6591 0.7414 0.6901 0.0040  0.0632  0.0274  396 GLU A CA  
4947 C C   . GLU A 325 ? 0.6115 0.6935 0.6480 0.0153  0.0595  0.0216  396 GLU A C   
4948 O O   . GLU A 325 ? 0.5871 0.6791 0.6343 0.0214  0.0561  0.0137  396 GLU A O   
4949 C CB  . GLU A 325 ? 0.7115 0.7729 0.7407 0.0018  0.0607  0.0323  396 GLU A CB  
4950 C CG  . GLU A 325 ? 0.7972 0.8547 0.8196 -0.0095 0.0626  0.0385  396 GLU A CG  
4951 C CD  . GLU A 325 ? 0.8686 0.9495 0.9003 -0.0151 0.0656  0.0341  396 GLU A CD  
4952 O OE1 . GLU A 325 ? 0.8389 0.9312 0.8842 -0.0081 0.0635  0.0257  396 GLU A OE1 
4953 O OE2 . GLU A 325 ? 0.9563 1.0441 0.9808 -0.0269 0.0690  0.0385  396 GLU A OE2 
4960 N N   . ALA A 326 ? 0.6199 0.6896 0.6483 0.0184  0.0588  0.0248  397 ALA A N   
4961 C CA  . ALA A 326 ? 0.6153 0.6841 0.6482 0.0276  0.0549  0.0198  397 ALA A CA  
4962 C C   . ALA A 326 ? 0.6206 0.7094 0.6586 0.0326  0.0549  0.0125  397 ALA A C   
4963 O O   . ALA A 326 ? 0.6276 0.7193 0.6736 0.0400  0.0495  0.0055  397 ALA A O   
4964 C CB  . ALA A 326 ? 0.6045 0.6596 0.6282 0.0298  0.0543  0.0235  397 ALA A CB  
4970 N N   . ALA A 327 ? 0.6060 0.7086 0.6382 0.0282  0.0599  0.0136  398 ALA A N   
4971 C CA  . ALA A 327 ? 0.5782 0.7053 0.6153 0.0327  0.0606  0.0052  398 ALA A CA  
4972 C C   . ALA A 327 ? 0.5730 0.7162 0.6243 0.0368  0.0573  -0.0045 398 ALA A C   
4973 O O   . ALA A 327 ? 0.5820 0.7352 0.6410 0.0471  0.0518  -0.0145 398 ALA A O   
4974 C CB  . ALA A 327 ? 0.5745 0.7154 0.6009 0.0232  0.0676  0.0093  398 ALA A CB  
4980 N N   . TRP A 328 ? 0.5804 0.7254 0.6345 0.0296  0.0592  -0.0025 399 TRP A N   
4981 C CA  . TRP A 328 ? 0.6445 0.8020 0.7118 0.0347  0.0544  -0.0125 399 TRP A CA  
4982 C C   . TRP A 328 ? 0.5839 0.7226 0.6557 0.0447  0.0442  -0.0163 399 TRP A C   
4983 O O   . TRP A 328 ? 0.6093 0.7572 0.6894 0.0545  0.0363  -0.0276 399 TRP A O   
4984 C CB  . TRP A 328 ? 0.7981 0.9555 0.8668 0.0250  0.0574  -0.0084 399 TRP A CB  
4985 C CG  . TRP A 328 ? 0.9646 1.1518 1.0343 0.0161  0.0646  -0.0108 399 TRP A CG  
4986 C CD1 . TRP A 328 ? 1.0340 1.2211 1.0926 0.0011  0.0720  -0.0008 399 TRP A CD1 
4987 C CD2 . TRP A 328 ? 1.0464 1.2694 1.1278 0.0207  0.0642  -0.0249 399 TRP A CD2 
4988 N NE1 . TRP A 328 ? 1.0893 1.3111 1.1517 -0.0062 0.0773  -0.0067 399 TRP A NE1 
4989 C CE2 . TRP A 328 ? 1.1264 1.3734 1.2039 0.0064  0.0732  -0.0224 399 TRP A CE2 
4990 C CE3 . TRP A 328 ? 1.0378 1.2748 1.1317 0.0358  0.0558  -0.0402 399 TRP A CE3 
4991 C CZ2 . TRP A 328 ? 1.1978 1.4879 1.2856 0.0062  0.0758  -0.0357 399 TRP A CZ2 
4992 C CZ3 . TRP A 328 ? 1.0816 1.3589 1.1859 0.0383  0.0569  -0.0543 399 TRP A CZ3 
4993 C CH2 . TRP A 328 ? 1.1619 1.4682 1.2641 0.0235  0.0677  -0.0525 399 TRP A CH2 
5004 N N   . ALA A 329 ? 0.5443 0.6568 0.6097 0.0420  0.0431  -0.0077 400 ALA A N   
5005 C CA  . ALA A 329 ? 0.5502 0.6450 0.6172 0.0477  0.0337  -0.0099 400 ALA A CA  
5006 C C   . ALA A 329 ? 0.6103 0.7079 0.6779 0.0569  0.0280  -0.0163 400 ALA A C   
5007 O O   . ALA A 329 ? 0.6019 0.6903 0.6718 0.0631  0.0172  -0.0220 400 ALA A O   
5008 C CB  . ALA A 329 ? 0.5402 0.6128 0.6002 0.0417  0.0352  -0.0002 400 ALA A CB  
5014 N N   . ILE A 330 ? 0.6682 0.7760 0.7320 0.0576  0.0337  -0.0153 401 ILE A N   
5015 C CA  . ILE A 330 ? 0.6853 0.7972 0.7497 0.0669  0.0284  -0.0220 401 ILE A CA  
5016 C C   . ILE A 330 ? 0.6486 0.7829 0.7215 0.0758  0.0234  -0.0353 401 ILE A C   
5017 O O   . ILE A 330 ? 0.6525 0.7825 0.7288 0.0857  0.0118  -0.0440 401 ILE A O   
5018 C CB  . ILE A 330 ? 0.6948 0.8103 0.7515 0.0652  0.0357  -0.0171 401 ILE A CB  
5019 C CG1 . ILE A 330 ? 0.6446 0.7394 0.6938 0.0587  0.0389  -0.0065 401 ILE A CG1 
5020 C CG2 . ILE A 330 ? 0.7402 0.8600 0.7978 0.0753  0.0299  -0.0243 401 ILE A CG2 
5021 C CD1 . ILE A 330 ? 0.6093 0.6866 0.6594 0.0602  0.0317  -0.0062 401 ILE A CD1 
5033 N N   . THR A 331 ? 0.6028 0.7622 0.6787 0.0722  0.0311  -0.0378 402 THR A N   
5034 C CA  . THR A 331 ? 0.6280 0.8153 0.7137 0.0810  0.0267  -0.0529 402 THR A CA  
5035 C C   . THR A 331 ? 0.5902 0.7666 0.6831 0.0893  0.0131  -0.0613 402 THR A C   
5036 O O   . THR A 331 ? 0.5866 0.7676 0.6842 0.1025  0.0013  -0.0742 402 THR A O   
5037 C CB  . THR A 331 ? 0.7238 0.9408 0.8118 0.0721  0.0376  -0.0534 402 THR A CB  
5038 O OG1 . THR A 331 ? 0.7617 0.9863 0.8396 0.0642  0.0479  -0.0458 402 THR A OG1 
5039 C CG2 . THR A 331 ? 0.7658 1.0183 0.8660 0.0818  0.0332  -0.0717 402 THR A CG2 
5047 N N   . ASN A 332 ? 0.5721 0.7319 0.6644 0.0820  0.0131  -0.0544 403 ASN A N   
5048 C CA  . ASN A 332 ? 0.5755 0.7212 0.6717 0.0887  -0.0008 -0.0613 403 ASN A CA  
5049 C C   . ASN A 332 ? 0.5584 0.6764 0.6484 0.0950  -0.0141 -0.0616 403 ASN A C   
5050 O O   . ASN A 332 ? 0.5356 0.6477 0.6277 0.1061  -0.0298 -0.0730 403 ASN A O   
5051 C CB  . ASN A 332 ? 0.5993 0.7295 0.6935 0.0783  0.0024  -0.0519 403 ASN A CB  
5052 C CG  . ASN A 332 ? 0.6331 0.7890 0.7336 0.0717  0.0128  -0.0526 403 ASN A CG  
5053 O OD1 . ASN A 332 ? 0.6656 0.8539 0.7728 0.0747  0.0167  -0.0619 403 ASN A OD1 
5054 N ND2 . ASN A 332 ? 0.6219 0.7647 0.7198 0.0619  0.0171  -0.0433 403 ASN A ND2 
5061 N N   . TYR A 333 ? 0.5854 0.6861 0.6669 0.0878  -0.0091 -0.0499 404 TYR A N   
5062 C CA  . TYR A 333 ? 0.6148 0.6914 0.6897 0.0910  -0.0207 -0.0493 404 TYR A CA  
5063 C C   . TYR A 333 ? 0.6093 0.6970 0.6873 0.1048  -0.0299 -0.0622 404 TYR A C   
5064 O O   . TYR A 333 ? 0.6669 0.7376 0.7424 0.1126  -0.0471 -0.0693 404 TYR A O   
5065 C CB  . TYR A 333 ? 0.6026 0.6678 0.6701 0.0812  -0.0116 -0.0365 404 TYR A CB  
5066 C CG  . TYR A 333 ? 0.6036 0.6465 0.6639 0.0804  -0.0210 -0.0340 404 TYR A CG  
5067 C CD1 . TYR A 333 ? 0.6180 0.6622 0.6779 0.0894  -0.0288 -0.0410 404 TYR A CD1 
5068 C CD2 . TYR A 333 ? 0.5852 0.6079 0.6385 0.0694  -0.0214 -0.0246 404 TYR A CD2 
5069 C CE1 . TYR A 333 ? 0.6439 0.6674 0.6964 0.0865  -0.0374 -0.0380 404 TYR A CE1 
5070 C CE2 . TYR A 333 ? 0.6101 0.6154 0.6561 0.0654  -0.0290 -0.0218 404 TYR A CE2 
5071 C CZ  . TYR A 333 ? 0.6397 0.6443 0.6851 0.0735  -0.0372 -0.0281 404 TYR A CZ  
5072 O OH  . TYR A 333 ? 0.6625 0.6496 0.7000 0.0676  -0.0450 -0.0247 404 TYR A OH  
5082 N N   . THR A 334 ? 0.5591 0.6743 0.6413 0.1078  -0.0199 -0.0657 405 THR A N   
5083 C CA  . THR A 334 ? 0.5877 0.7147 0.6722 0.1211  -0.0279 -0.0779 405 THR A CA  
5084 C C   . THR A 334 ? 0.6492 0.7947 0.7428 0.1350  -0.0393 -0.0960 405 THR A C   
5085 O O   . THR A 334 ? 0.6867 0.8328 0.7812 0.1486  -0.0527 -0.1082 405 THR A O   
5086 C CB  . THR A 334 ? 0.6116 0.7627 0.6957 0.1196  -0.0140 -0.0760 405 THR A CB  
5087 O OG1 . THR A 334 ? 0.6085 0.7884 0.6973 0.1142  -0.0015 -0.0767 405 THR A OG1 
5088 C CG2 . THR A 334 ? 0.6149 0.7471 0.6900 0.1094  -0.0058 -0.0609 405 THR A CG2 
5096 N N   . SER A 335 ? 0.6580 0.8191 0.7584 0.1326  -0.0353 -0.0992 406 SER A N   
5097 C CA  . SER A 335 ? 0.6858 0.8675 0.7962 0.1470  -0.0470 -0.1187 406 SER A CA  
5098 C C   . SER A 335 ? 0.7297 0.8783 0.8364 0.1540  -0.0682 -0.1233 406 SER A C   
5099 O O   . SER A 335 ? 0.7661 0.9214 0.8778 0.1705  -0.0850 -0.1416 406 SER A O   
5100 C CB  . SER A 335 ? 0.6659 0.8820 0.7856 0.1410  -0.0340 -0.1215 406 SER A CB  
5101 O OG  . SER A 335 ? 0.6583 0.8550 0.7768 0.1327  -0.0345 -0.1136 406 SER A OG  
5107 N N   . GLY A 336 ? 0.7248 0.8380 0.8218 0.1419  -0.0687 -0.1079 407 GLY A N   
5108 C CA  . GLY A 336 ? 0.7131 0.7915 0.8027 0.1453  -0.0889 -0.1100 407 GLY A CA  
5109 C C   . GLY A 336 ? 0.7017 0.7414 0.7768 0.1423  -0.1013 -0.1024 407 GLY A C   
5110 O O   . GLY A 336 ? 0.7324 0.7399 0.7979 0.1450  -0.1215 -0.1047 407 GLY A O   
5114 N N   . GLY A 337 ? 0.6567 0.6985 0.7290 0.1361  -0.0905 -0.0936 408 GLY A N   
5115 C CA  . GLY A 337 ? 0.6808 0.6889 0.7398 0.1297  -0.0997 -0.0850 408 GLY A CA  
5116 C C   . GLY A 337 ? 0.7342 0.7319 0.7896 0.1439  -0.1198 -0.0972 408 GLY A C   
5117 O O   . GLY A 337 ? 0.7217 0.7441 0.7863 0.1599  -0.1232 -0.1126 408 GLY A O   
5121 N N   . THR A 338 ? 0.7708 0.7312 0.8114 0.1370  -0.1338 -0.0903 409 THR A N   
5122 C CA  . THR A 338 ? 0.8245 0.7687 0.8588 0.1480  -0.1540 -0.0995 409 THR A CA  
5123 C C   . THR A 338 ? 0.8017 0.7653 0.8409 0.1490  -0.1417 -0.0980 409 THR A C   
5124 O O   . THR A 338 ? 0.7821 0.7655 0.8268 0.1394  -0.1191 -0.0881 409 THR A O   
5125 C CB  . THR A 338 ? 0.8869 0.7838 0.9013 0.1365  -0.1729 -0.0907 409 THR A CB  
5126 O OG1 . THR A 338 ? 0.8685 0.7611 0.8779 0.1161  -0.1571 -0.0730 409 THR A OG1 
5127 C CG2 . THR A 338 ? 0.9363 0.8097 0.9426 0.1343  -0.1864 -0.0909 409 THR A CG2 
5135 N N   . VAL A 339 ? 0.7622 0.7179 0.7983 0.1617  -0.1584 -0.1086 410 VAL A N   
5136 C CA  . VAL A 339 ? 0.7439 0.7153 0.7835 0.1638  -0.1492 -0.1081 410 VAL A CA  
5137 C C   . VAL A 339 ? 0.7274 0.6816 0.7585 0.1441  -0.1402 -0.0902 410 VAL A C   
5138 O O   . VAL A 339 ? 0.6896 0.6641 0.7262 0.1395  -0.1215 -0.0841 410 VAL A O   
5139 C CB  . VAL A 339 ? 0.7984 0.7614 0.8353 0.1817  -0.1716 -0.1236 410 VAL A CB  
5140 C CG1 . VAL A 339 ? 0.8066 0.7819 0.8454 0.1823  -0.1629 -0.1217 410 VAL A CG1 
5141 C CG2 . VAL A 339 ? 0.8070 0.7979 0.8554 0.2028  -0.1778 -0.1441 410 VAL A CG2 
5151 N N   . GLU A 340 ? 0.8246 0.7422 0.8416 0.1317  -0.1538 -0.0821 411 GLU A N   
5152 C CA  . GLU A 340 ? 0.9130 0.8190 0.9224 0.1121  -0.1455 -0.0667 411 GLU A CA  
5153 C C   . GLU A 340 ? 0.8279 0.7531 0.8437 0.0998  -0.1212 -0.0557 411 GLU A C   
5154 O O   . GLU A 340 ? 0.8262 0.7597 0.8429 0.0898  -0.1076 -0.0472 411 GLU A O   
5155 C CB  . GLU A 340 ? 1.1292 0.9933 1.1198 0.0991  -0.1661 -0.0605 411 GLU A CB  
5156 C CG  . GLU A 340 ? 1.3305 1.1827 1.3122 0.0824  -0.1653 -0.0502 411 GLU A CG  
5157 C CD  . GLU A 340 ? 1.4970 1.3518 1.4807 0.0937  -0.1729 -0.0581 411 GLU A CD  
5158 O OE1 . GLU A 340 ? 1.5683 1.4097 1.5489 0.1096  -0.1934 -0.0703 411 GLU A OE1 
5159 O OE2 . GLU A 340 ? 1.5411 1.4115 1.5295 0.0876  -0.1592 -0.0532 411 GLU A OE2 
5166 N N   . GLN A 341 ? 0.7964 0.7289 0.8167 0.1013  -0.1165 -0.0567 412 GLN A N   
5167 C CA  . GLN A 341 ? 0.7283 0.6782 0.7545 0.0911  -0.0948 -0.0472 412 GLN A CA  
5168 C C   . GLN A 341 ? 0.6671 0.6494 0.7047 0.0977  -0.0766 -0.0490 412 GLN A C   
5169 O O   . GLN A 341 ? 0.6294 0.6213 0.6684 0.0885  -0.0605 -0.0400 412 GLN A O   
5170 C CB  . GLN A 341 ? 0.7270 0.6762 0.7551 0.0916  -0.0956 -0.0485 412 GLN A CB  
5171 C CG  . GLN A 341 ? 0.7395 0.6578 0.7541 0.0780  -0.1062 -0.0406 412 GLN A CG  
5172 C CD  . GLN A 341 ? 0.7325 0.6415 0.7462 0.0841  -0.1174 -0.0468 412 GLN A CD  
5173 O OE1 . GLN A 341 ? 0.7220 0.6495 0.7465 0.0997  -0.1187 -0.0589 412 GLN A OE1 
5174 N NE2 . GLN A 341 ? 0.7334 0.6151 0.7337 0.0714  -0.1261 -0.0391 412 GLN A NE2 
5183 N N   . ILE A 342 ? 0.6736 0.6727 0.7179 0.1135  -0.0801 -0.0613 413 ILE A N   
5184 C CA  . ILE A 342 ? 0.6843 0.7134 0.7365 0.1185  -0.0639 -0.0628 413 ILE A CA  
5185 C C   . ILE A 342 ? 0.6867 0.7134 0.7354 0.1160  -0.0607 -0.0585 413 ILE A C   
5186 O O   . ILE A 342 ? 0.6550 0.6958 0.7053 0.1119  -0.0451 -0.0525 413 ILE A O   
5187 C CB  . ILE A 342 ? 0.7213 0.7729 0.7812 0.1353  -0.0690 -0.0785 413 ILE A CB  
5188 C CG1 . ILE A 342 ? 0.7448 0.8047 0.8101 0.1366  -0.0692 -0.0829 413 ILE A CG1 
5189 C CG2 . ILE A 342 ? 0.7088 0.7902 0.7734 0.1392  -0.0543 -0.0802 413 ILE A CG2 
5190 C CD1 . ILE A 342 ? 0.7639 0.8522 0.8385 0.1527  -0.0736 -0.1003 413 ILE A CD1 
5202 N N   . VAL A 343 ? 0.7307 0.7380 0.7737 0.1185  -0.0766 -0.0617 414 VAL A N   
5203 C CA  . VAL A 343 ? 0.7283 0.7324 0.7682 0.1152  -0.0748 -0.0579 414 VAL A CA  
5204 C C   . VAL A 343 ? 0.6955 0.6971 0.7330 0.0990  -0.0620 -0.0451 414 VAL A C   
5205 O O   . VAL A 343 ? 0.6896 0.7042 0.7293 0.0978  -0.0499 -0.0418 414 VAL A O   
5206 C CB  . VAL A 343 ? 0.7671 0.7457 0.7991 0.1171  -0.0963 -0.0622 414 VAL A CB  
5207 C CG1 . VAL A 343 ? 0.7360 0.7105 0.7648 0.1106  -0.0946 -0.0574 414 VAL A CG1 
5208 C CG2 . VAL A 343 ? 0.8227 0.8065 0.8577 0.1365  -0.1099 -0.0776 414 VAL A CG2 
5218 N N   . TYR A 344 ? 0.6748 0.6602 0.7074 0.0871  -0.0653 -0.0387 415 TYR A N   
5219 C CA  . TYR A 344 ? 0.6618 0.6482 0.6927 0.0723  -0.0536 -0.0283 415 TYR A CA  
5220 C C   . TYR A 344 ? 0.6274 0.6350 0.6650 0.0743  -0.0357 -0.0258 415 TYR A C   
5221 O O   . TYR A 344 ? 0.6124 0.6279 0.6505 0.0693  -0.0252 -0.0211 415 TYR A O   
5222 C CB  . TYR A 344 ? 0.6860 0.6529 0.7094 0.0597  -0.0608 -0.0228 415 TYR A CB  
5223 C CG  . TYR A 344 ? 0.6804 0.6525 0.7029 0.0454  -0.0485 -0.0139 415 TYR A CG  
5224 C CD1 . TYR A 344 ? 0.6668 0.6399 0.6860 0.0343  -0.0464 -0.0099 415 TYR A CD1 
5225 C CD2 . TYR A 344 ? 0.6763 0.6544 0.7017 0.0434  -0.0394 -0.0108 415 TYR A CD2 
5226 C CE1 . TYR A 344 ? 0.6570 0.6390 0.6763 0.0227  -0.0356 -0.0042 415 TYR A CE1 
5227 C CE2 . TYR A 344 ? 0.6674 0.6511 0.6921 0.0321  -0.0292 -0.0042 415 TYR A CE2 
5228 C CZ  . TYR A 344 ? 0.6718 0.6585 0.6936 0.0223  -0.0273 -0.0015 415 TYR A CZ  
5229 O OH  . TYR A 344 ? 0.7051 0.7015 0.7271 0.0123  -0.0176 0.0028  415 TYR A OH  
5239 N N   . LEU A 345 ? 0.6157 0.6325 0.6576 0.0815  -0.0330 -0.0295 416 LEU A N   
5240 C CA  . LEU A 345 ? 0.6172 0.6522 0.6631 0.0821  -0.0175 -0.0266 416 LEU A CA  
5241 C C   . LEU A 345 ? 0.6044 0.6519 0.6506 0.0879  -0.0111 -0.0279 416 LEU A C   
5242 O O   . LEU A 345 ? 0.6096 0.6630 0.6543 0.0842  -0.0003 -0.0225 416 LEU A O   
5243 C CB  . LEU A 345 ? 0.6506 0.6967 0.7013 0.0882  -0.0168 -0.0318 416 LEU A CB  
5244 C CG  . LEU A 345 ? 0.6704 0.7345 0.7231 0.0866  -0.0020 -0.0285 416 LEU A CG  
5245 C CD1 . LEU A 345 ? 0.6635 0.7203 0.7137 0.0754  0.0061  -0.0186 416 LEU A CD1 
5246 C CD2 . LEU A 345 ? 0.6968 0.7768 0.7551 0.0926  -0.0027 -0.0360 416 LEU A CD2 
5258 N N   . VAL A 346 ? 0.6022 0.6524 0.6491 0.0976  -0.0189 -0.0356 417 VAL A N   
5259 C CA  . VAL A 346 ? 0.6026 0.6641 0.6486 0.1035  -0.0137 -0.0372 417 VAL A CA  
5260 C C   . VAL A 346 ? 0.6141 0.6672 0.6571 0.0974  -0.0125 -0.0323 417 VAL A C   
5261 O O   . VAL A 346 ? 0.5713 0.6317 0.6124 0.0981  -0.0041 -0.0297 417 VAL A O   
5262 C CB  . VAL A 346 ? 0.6179 0.6854 0.6657 0.1163  -0.0234 -0.0480 417 VAL A CB  
5263 C CG1 . VAL A 346 ? 0.5949 0.6698 0.6404 0.1217  -0.0203 -0.0494 417 VAL A CG1 
5264 C CG2 . VAL A 346 ? 0.6375 0.7233 0.6894 0.1233  -0.0213 -0.0549 417 VAL A CG2 
5274 N N   . HIS A 347 ? 0.6546 0.6927 0.6963 0.0909  -0.0219 -0.0313 418 HIS A N   
5275 C CA  . HIS A 347 ? 0.6937 0.7285 0.7337 0.0834  -0.0208 -0.0278 418 HIS A CA  
5276 C C   . HIS A 347 ? 0.6742 0.7144 0.7145 0.0755  -0.0094 -0.0216 418 HIS A C   
5277 O O   . HIS A 347 ? 0.7147 0.7595 0.7550 0.0726  -0.0059 -0.0210 418 HIS A O   
5278 C CB  . HIS A 347 ? 0.7834 0.8014 0.8198 0.0746  -0.0336 -0.0274 418 HIS A CB  
5279 C CG  . HIS A 347 ? 0.9169 0.9263 0.9515 0.0825  -0.0476 -0.0341 418 HIS A CG  
5280 N ND1 . HIS A 347 ? 0.9923 1.0119 1.0295 0.0951  -0.0469 -0.0401 418 HIS A ND1 
5281 C CD2 . HIS A 347 ? 0.9808 0.9703 1.0097 0.0800  -0.0641 -0.0361 418 HIS A CD2 
5282 C CE1 . HIS A 347 ? 1.0301 1.0385 1.0648 0.1009  -0.0620 -0.0463 418 HIS A CE1 
5283 N NE2 . HIS A 347 ? 1.0242 1.0128 1.0535 0.0920  -0.0734 -0.0440 418 HIS A NE2 
5291 N N   . CYS A 348 ? 0.6359 0.6764 0.6765 0.0729  -0.0043 -0.0183 419 CYS A N   
5292 C CA  . CYS A 348 ? 0.6311 0.6760 0.6714 0.0672  0.0055  -0.0133 419 CYS A CA  
5293 C C   . CYS A 348 ? 0.6227 0.6761 0.6611 0.0742  0.0137  -0.0129 419 CYS A C   
5294 O O   . CYS A 348 ? 0.6445 0.6991 0.6811 0.0713  0.0199  -0.0096 419 CYS A O   
5295 C CB  . CYS A 348 ? 0.6636 0.7035 0.7040 0.0607  0.0068  -0.0095 419 CYS A CB  
5296 S SG  . CYS A 348 ? 0.7033 0.7294 0.7410 0.0484  -0.0027 -0.0076 419 CYS A SG  
5302 N N   . GLY A 349 ? 0.6149 0.6734 0.6523 0.0830  0.0129  -0.0164 420 GLY A N   
5303 C CA  . GLY A 349 ? 0.6371 0.7015 0.6692 0.0876  0.0195  -0.0150 420 GLY A CA  
5304 C C   . GLY A 349 ? 0.6565 0.7251 0.6859 0.0860  0.0254  -0.0119 420 GLY A C   
5305 O O   . GLY A 349 ? 0.6913 0.7588 0.7134 0.0844  0.0309  -0.0075 420 GLY A O   
5309 N N   . ILE A 350 ? 0.6479 0.7209 0.6820 0.0862  0.0231  -0.0145 421 ILE A N   
5310 C CA  . ILE A 350 ? 0.6374 0.7182 0.6704 0.0834  0.0288  -0.0125 421 ILE A CA  
5311 C C   . ILE A 350 ? 0.6564 0.7493 0.6825 0.0864  0.0338  -0.0130 421 ILE A C   
5312 O O   . ILE A 350 ? 0.6575 0.7533 0.6771 0.0805  0.0402  -0.0078 421 ILE A O   
5313 C CB  . ILE A 350 ? 0.6484 0.7333 0.6891 0.0847  0.0237  -0.0176 421 ILE A CB  
5314 C CG1 . ILE A 350 ? 0.6926 0.7866 0.7337 0.0798  0.0300  -0.0155 421 ILE A CG1 
5315 C CG2 . ILE A 350 ? 0.6314 0.7265 0.6755 0.0948  0.0170  -0.0273 421 ILE A CG2 
5316 C CD1 . ILE A 350 ? 0.7261 0.8087 0.7642 0.0707  0.0347  -0.0070 421 ILE A CD1 
5328 N N   . ILE A 351 ? 0.6627 0.7625 0.6887 0.0944  0.0303  -0.0188 422 ILE A N   
5329 C CA  . ILE A 351 ? 0.7211 0.8373 0.7410 0.0968  0.0346  -0.0210 422 ILE A CA  
5330 C C   . ILE A 351 ? 0.7073 0.8180 0.7131 0.0899  0.0414  -0.0122 422 ILE A C   
5331 O O   . ILE A 351 ? 0.6957 0.8160 0.6948 0.0831  0.0473  -0.0090 422 ILE A O   
5332 C CB  . ILE A 351 ? 0.7600 0.8821 0.7808 0.1073  0.0291  -0.0287 422 ILE A CB  
5333 C CG1 . ILE A 351 ? 0.7521 0.8767 0.7843 0.1147  0.0194  -0.0382 422 ILE A CG1 
5334 C CG2 . ILE A 351 ? 0.7983 0.9393 0.8112 0.1087  0.0342  -0.0308 422 ILE A CG2 
5335 C CD1 . ILE A 351 ? 0.7406 0.8820 0.7789 0.1158  0.0195  -0.0443 422 ILE A CD1 
5347 N N   . GLU A 352 ? 0.7361 0.8311 0.7362 0.0914  0.0394  -0.0088 423 GLU A N   
5348 C CA  . GLU A 352 ? 0.7584 0.8441 0.7422 0.0874  0.0424  -0.0018 423 GLU A CA  
5349 C C   . GLU A 352 ? 0.6752 0.7541 0.6530 0.0769  0.0463  0.0059  423 GLU A C   
5350 O O   . GLU A 352 ? 0.6110 0.6933 0.5761 0.0698  0.0503  0.0107  423 GLU A O   
5351 C CB  . GLU A 352 ? 0.8975 0.9684 0.8785 0.0931  0.0375  -0.0023 423 GLU A CB  
5352 C CG  . GLU A 352 ? 1.0339 1.0937 0.9961 0.0932  0.0368  0.0022  423 GLU A CG  
5353 C CD  . GLU A 352 ? 1.1336 1.1858 1.0952 0.1027  0.0308  -0.0022 423 GLU A CD  
5354 O OE1 . GLU A 352 ? 1.1966 1.2482 1.1708 0.1059  0.0279  -0.0066 423 GLU A OE1 
5355 O OE2 . GLU A 352 ? 1.1408 1.1886 1.0885 0.1060  0.0289  -0.0015 423 GLU A OE2 
5362 N N   . PRO A 353 ? 0.6693 0.7386 0.6541 0.0745  0.0453  0.0075  424 PRO A N   
5363 C CA  . PRO A 353 ? 0.6812 0.7436 0.6601 0.0650  0.0484  0.0145  424 PRO A CA  
5364 C C   . PRO A 353 ? 0.7029 0.7825 0.6836 0.0580  0.0536  0.0148  424 PRO A C   
5365 O O   . PRO A 353 ? 0.7388 0.8153 0.7093 0.0480  0.0567  0.0215  424 PRO A O   
5366 C CB  . PRO A 353 ? 0.6453 0.6997 0.6349 0.0653  0.0462  0.0136  424 PRO A CB  
5367 C CG  . PRO A 353 ? 0.6362 0.6978 0.6387 0.0720  0.0429  0.0065  424 PRO A CG  
5368 C CD  . PRO A 353 ? 0.6545 0.7200 0.6522 0.0788  0.0412  0.0033  424 PRO A CD  
5376 N N   . LEU A 354 ? 0.6877 0.7858 0.6810 0.0630  0.0535  0.0069  425 LEU A N   
5377 C CA  . LEU A 354 ? 0.7015 0.8219 0.6984 0.0586  0.0577  0.0039  425 LEU A CA  
5378 C C   . LEU A 354 ? 0.7497 0.8834 0.7328 0.0539  0.0623  0.0056  425 LEU A C   
5379 O O   . LEU A 354 ? 0.7617 0.9054 0.7376 0.0424  0.0677  0.0098  425 LEU A O   
5380 C CB  . LEU A 354 ? 0.6859 0.8204 0.6992 0.0682  0.0533  -0.0072 425 LEU A CB  
5381 C CG  . LEU A 354 ? 0.6763 0.8283 0.7007 0.0669  0.0538  -0.0131 425 LEU A CG  
5382 C CD1 . LEU A 354 ? 0.6472 0.7868 0.6728 0.0584  0.0555  -0.0064 425 LEU A CD1 
5383 C CD2 . LEU A 354 ? 0.6936 0.8488 0.7309 0.0787  0.0450  -0.0240 425 LEU A CD2 
5395 N N   . MET A 355 ? 0.7663 0.9006 0.7444 0.0613  0.0601  0.0027  426 MET A N   
5396 C CA  . MET A 355 ? 0.8212 0.9661 0.7831 0.0560  0.0640  0.0052  426 MET A CA  
5397 C C   . MET A 355 ? 0.8110 0.9352 0.7517 0.0432  0.0654  0.0179  426 MET A C   
5398 O O   . MET A 355 ? 0.8348 0.9687 0.7604 0.0311  0.0699  0.0227  426 MET A O   
5399 C CB  . MET A 355 ? 0.9046 1.0480 0.8634 0.0670  0.0601  0.0006  426 MET A CB  
5400 C CG  . MET A 355 ? 0.9609 1.1216 0.9371 0.0801  0.0564  -0.0121 426 MET A CG  
5401 S SD  . MET A 355 ? 1.0006 1.2014 0.9867 0.0799  0.0604  -0.0230 426 MET A SD  
5402 C CE  . MET A 355 ? 1.0027 1.1974 1.0097 0.0858  0.0544  -0.0286 426 MET A CE  
5412 N N   . ASN A 356 ? 0.8045 0.9001 0.7423 0.0453  0.0604  0.0230  427 ASN A N   
5413 C CA  . ASN A 356 ? 0.8269 0.8982 0.7426 0.0355  0.0583  0.0338  427 ASN A CA  
5414 C C   . ASN A 356 ? 0.8765 0.9518 0.7872 0.0200  0.0627  0.0403  427 ASN A C   
5415 O O   . ASN A 356 ? 0.9440 1.0062 0.8319 0.0074  0.0619  0.0497  427 ASN A O   
5416 C CB  . ASN A 356 ? 0.8162 0.8603 0.7328 0.0432  0.0512  0.0347  427 ASN A CB  
5417 C CG  . ASN A 356 ? 0.8675 0.9048 0.7826 0.0555  0.0460  0.0301  427 ASN A CG  
5418 O OD1 . ASN A 356 ? 0.9349 0.9852 0.8471 0.0584  0.0475  0.0270  427 ASN A OD1 
5419 N ND2 . ASN A 356 ? 0.8588 0.8781 0.7762 0.0631  0.0398  0.0285  427 ASN A ND2 
5426 N N   . LEU A 357 ? 0.8605 0.9521 0.7906 0.0200  0.0663  0.0355  428 LEU A N   
5427 C CA  . LEU A 357 ? 0.8758 0.9742 0.8036 0.0056  0.0705  0.0404  428 LEU A CA  
5428 C C   . LEU A 357 ? 0.8595 0.9896 0.7825 -0.0054 0.0778  0.0390  428 LEU A C   
5429 O O   . LEU A 357 ? 0.8985 1.0365 0.8167 -0.0203 0.0817  0.0437  428 LEU A O   
5430 C CB  . LEU A 357 ? 0.8738 0.9787 0.8238 0.0101  0.0710  0.0349  428 LEU A CB  
5431 C CG  . LEU A 357 ? 0.8713 0.9483 0.8233 0.0133  0.0658  0.0386  428 LEU A CG  
5432 C CD1 . LEU A 357 ? 0.8474 0.9349 0.8193 0.0158  0.0669  0.0331  428 LEU A CD1 
5433 C CD2 . LEU A 357 ? 0.8883 0.9417 0.8204 0.0014  0.0635  0.0496  428 LEU A CD2 
5445 N N   . LEU A 358 ? 0.7943 0.9452 0.7190 0.0012  0.0796  0.0318  429 LEU A N   
5446 C CA  . LEU A 358 ? 0.8097 0.9943 0.7278 -0.0099 0.0868  0.0297  429 LEU A CA  
5447 C C   . LEU A 358 ? 0.9276 1.0977 0.8145 -0.0287 0.0876  0.0433  429 LEU A C   
5448 O O   . LEU A 358 ? 0.9598 1.1574 0.8375 -0.0439 0.0943  0.0442  429 LEU A O   
5449 C CB  . LEU A 358 ? 0.7636 0.9729 0.6902 0.0034  0.0873  0.0179  429 LEU A CB  
5450 C CG  . LEU A 358 ? 0.7210 0.9552 0.6756 0.0182  0.0864  0.0025  429 LEU A CG  
5451 C CD1 . LEU A 358 ? 0.6884 0.9415 0.6482 0.0320  0.0846  -0.0088 429 LEU A CD1 
5452 C CD2 . LEU A 358 ? 0.7315 1.0000 0.6959 0.0091  0.0924  -0.0033 429 LEU A CD2 
5464 N N   . SER A 359 ? 1.0250 1.1532 0.8947 -0.0283 0.0800  0.0532  430 SER A N   
5465 C CA  . SER A 359 ? 1.1257 1.2307 0.9629 -0.0467 0.0771  0.0672  430 SER A CA  
5466 C C   . SER A 359 ? 1.2480 1.3467 1.0799 -0.0640 0.0782  0.0752  430 SER A C   
5467 O O   . SER A 359 ? 1.2537 1.3374 1.0574 -0.0836 0.0762  0.0872  430 SER A O   
5468 C CB  . SER A 359 ? 1.1191 1.1793 0.9403 -0.0375 0.0658  0.0728  430 SER A CB  
5469 O OG  . SER A 359 ? 1.1017 1.1671 0.9295 -0.0209 0.0643  0.0649  430 SER A OG  
5475 N N   . ALA A 360 ? 1.3323 1.4399 1.1888 -0.0580 0.0802  0.0693  431 ALA A N   
5476 C CA  . ALA A 360 ? 1.4462 1.5457 1.2989 -0.0729 0.0803  0.0765  431 ALA A CA  
5477 C C   . ALA A 360 ? 1.4608 1.5937 1.3052 -0.0952 0.0889  0.0788  431 ALA A C   
5478 O O   . ALA A 360 ? 1.5127 1.6895 1.3720 -0.0932 0.0972  0.0681  431 ALA A O   
5479 C CB  . ALA A 360 ? 1.4372 1.5425 1.3189 -0.0609 0.0809  0.0685  431 ALA A CB  
5485 N N   . LYS A 361 ? 1.4491 1.5614 1.2687 -0.1168 0.0860  0.0922  432 LYS A N   
5486 C CA  . LYS A 361 ? 1.4277 1.5721 1.2381 -0.1419 0.0942  0.0954  432 LYS A CA  
5487 C C   . LYS A 361 ? 1.4388 1.6239 1.2803 -0.1401 0.1024  0.0839  432 LYS A C   
5488 O O   . LYS A 361 ? 1.4049 1.6376 1.2524 -0.1512 0.1120  0.0773  432 LYS A O   
5489 C CB  . LYS A 361 ? 1.4992 1.6063 1.2757 -0.1661 0.0869  0.1131  432 LYS A CB  
5490 C CG  . LYS A 361 ? 1.5517 1.6248 1.3336 -0.1623 0.0790  0.1171  432 LYS A CG  
5491 C CD  . LYS A 361 ? 1.6615 1.6951 1.4079 -0.1862 0.0695  0.1341  432 LYS A CD  
5492 C CE  . LYS A 361 ? 1.7166 1.7213 1.4709 -0.1814 0.0619  0.1361  432 LYS A CE  
5493 N NZ  . LYS A 361 ? 1.7983 1.7616 1.5177 -0.2039 0.0504  0.1520  432 LYS A NZ  
5507 N N   . ASP A 362 ? 1.4589 1.6278 1.3203 -0.1258 0.0984  0.0802  433 ASP A N   
5508 C CA  . ASP A 362 ? 1.4322 1.6328 1.3210 -0.1236 0.1038  0.0700  433 ASP A CA  
5509 C C   . ASP A 362 ? 1.2853 1.5367 1.1970 -0.1124 0.1111  0.0529  433 ASP A C   
5510 O O   . ASP A 362 ? 1.3353 1.5857 1.2574 -0.0922 0.1088  0.0450  433 ASP A O   
5511 C CB  . ASP A 362 ? 1.4372 1.6092 1.3423 -0.1065 0.0972  0.0681  433 ASP A CB  
5512 C CG  . ASP A 362 ? 1.4540 1.6506 1.3832 -0.1059 0.1007  0.0597  433 ASP A CG  
5513 O OD1 . ASP A 362 ? 1.4202 1.6498 1.3730 -0.0927 0.1041  0.0451  433 ASP A OD1 
5514 O OD2 . ASP A 362 ? 1.5055 1.6865 1.4292 -0.1178 0.0986  0.0672  433 ASP A OD2 
5519 N N   . THR A 363 ? 1.0978 1.3946 1.0174 -0.1256 0.1191  0.0463  434 THR A N   
5520 C CA  . THR A 363 ? 0.9735 1.3231 0.9138 -0.1152 0.1250  0.0279  434 THR A CA  
5521 C C   . THR A 363 ? 0.9376 1.2941 0.9095 -0.0911 0.1211  0.0129  434 THR A C   
5522 O O   . THR A 363 ? 0.8304 1.2085 0.8177 -0.0726 0.1200  -0.0016 434 THR A O   
5523 C CB  . THR A 363 ? 0.9938 1.3942 0.9326 -0.1375 0.1345  0.0239  434 THR A CB  
5524 O OG1 . THR A 363 ? 1.0553 1.4510 0.9618 -0.1612 0.1378  0.0376  434 THR A OG1 
5525 C CG2 . THR A 363 ? 0.9615 1.4208 0.9250 -0.1238 0.1393  0.0012  434 THR A CG2 
5533 N N   . LYS A 364 ? 1.0418 1.3797 1.0219 -0.0916 0.1178  0.0160  435 LYS A N   
5534 C CA  . LYS A 364 ? 1.0749 1.4182 1.0821 -0.0711 0.1132  0.0025  435 LYS A CA  
5535 C C   . LYS A 364 ? 0.9671 1.2808 0.9785 -0.0491 0.1058  0.0007  435 LYS A C   
5536 O O   . LYS A 364 ? 0.9439 1.2730 0.9739 -0.0307 0.1019  -0.0138 435 LYS A O   
5537 C CB  . LYS A 364 ? 1.1745 1.4990 1.1861 -0.0773 0.1109  0.0081  435 LYS A CB  
5538 C CG  . LYS A 364 ? 1.2352 1.5683 1.2727 -0.0595 0.1059  -0.0059 435 LYS A CG  
5539 C CD  . LYS A 364 ? 1.2672 1.6564 1.3227 -0.0590 0.1097  -0.0238 435 LYS A CD  
5540 C CE  . LYS A 364 ? 1.2329 1.6264 1.3122 -0.0375 0.1013  -0.0394 435 LYS A CE  
5541 N NZ  . LYS A 364 ? 1.1970 1.5532 1.2780 -0.0369 0.0961  -0.0313 435 LYS A NZ  
5555 N N   . ILE A 365 ? 0.9074 1.1789 0.9009 -0.0509 0.1026  0.0148  436 ILE A N   
5556 C CA  . ILE A 365 ? 0.8363 1.0810 0.8337 -0.0321 0.0959  0.0134  436 ILE A CA  
5557 C C   . ILE A 365 ? 0.8076 1.0718 0.8053 -0.0226 0.0966  0.0052  436 ILE A C   
5558 O O   . ILE A 365 ? 0.7562 1.0152 0.7656 -0.0046 0.0910  -0.0028 436 ILE A O   
5559 C CB  . ILE A 365 ? 0.8466 1.0447 0.8260 -0.0358 0.0917  0.0284  436 ILE A CB  
5560 C CG1 . ILE A 365 ? 0.8256 0.9998 0.8139 -0.0172 0.0849  0.0254  436 ILE A CG1 
5561 C CG2 . ILE A 365 ? 0.8772 1.0671 0.8316 -0.0463 0.0932  0.0378  436 ILE A CG2 
5562 C CD1 . ILE A 365 ? 0.8345 0.9675 0.8086 -0.0177 0.0799  0.0366  436 ILE A CD1 
5574 N N   . ILE A 366 ? 0.8141 1.1001 0.7977 -0.0352 0.1028  0.0073  437 ILE A N   
5575 C CA  . ILE A 366 ? 0.8325 1.1400 0.8165 -0.0258 0.1036  -0.0015 437 ILE A CA  
5576 C C   . ILE A 366 ? 0.7987 1.1427 0.8078 -0.0101 0.1020  -0.0214 437 ILE A C   
5577 O O   . ILE A 366 ? 0.7825 1.1278 0.7997 0.0077  0.0967  -0.0309 437 ILE A O   
5578 C CB  . ILE A 366 ? 0.8783 1.2061 0.8410 -0.0448 0.1112  0.0043  437 ILE A CB  
5579 C CG1 . ILE A 366 ? 0.9305 1.2140 0.8648 -0.0568 0.1087  0.0234  437 ILE A CG1 
5580 C CG2 . ILE A 366 ? 0.8627 1.2205 0.8282 -0.0345 0.1126  -0.0075 437 ILE A CG2 
5581 C CD1 . ILE A 366 ? 0.9792 1.2746 0.8866 -0.0801 0.1145  0.0326  437 ILE A CD1 
5593 N N   . GLN A 367 ? 0.8219 1.1953 0.8431 -0.0161 0.1051  -0.0287 438 GLN A N   
5594 C CA  . GLN A 367 ? 0.8348 1.2416 0.8798 0.0004  0.1011  -0.0495 438 GLN A CA  
5595 C C   . GLN A 367 ? 0.7390 1.1134 0.7966 0.0197  0.0897  -0.0529 438 GLN A C   
5596 O O   . GLN A 367 ? 0.6725 1.0564 0.7424 0.0384  0.0819  -0.0674 438 GLN A O   
5597 C CB  . GLN A 367 ? 0.9876 1.4310 1.0430 -0.0101 0.1059  -0.0567 438 GLN A CB  
5598 C CG  . GLN A 367 ? 1.1606 1.6347 1.2011 -0.0349 0.1176  -0.0508 438 GLN A CG  
5599 C CD  . GLN A 367 ? 1.3050 1.8301 1.3602 -0.0427 0.1226  -0.0640 438 GLN A CD  
5600 O OE1 . GLN A 367 ? 1.3998 1.9609 1.4763 -0.0260 0.1187  -0.0854 438 GLN A OE1 
5601 N NE2 . GLN A 367 ? 1.3177 1.8459 1.3613 -0.0680 0.1299  -0.0520 438 GLN A NE2 
5610 N N   . VAL A 368 ? 0.7518 1.0877 0.8052 0.0149  0.0877  -0.0400 439 VAL A N   
5611 C CA  . VAL A 368 ? 0.7529 1.0571 0.8150 0.0296  0.0775  -0.0413 439 VAL A CA  
5612 C C   . VAL A 368 ? 0.7163 1.0031 0.7741 0.0418  0.0724  -0.0415 439 VAL A C   
5613 O O   . VAL A 368 ? 0.6914 0.9747 0.7598 0.0577  0.0629  -0.0519 439 VAL A O   
5614 C CB  . VAL A 368 ? 0.7829 1.0518 0.8386 0.0201  0.0779  -0.0266 439 VAL A CB  
5615 C CG1 . VAL A 368 ? 0.7570 0.9932 0.8180 0.0321  0.0687  -0.0259 439 VAL A CG1 
5616 C CG2 . VAL A 368 ? 0.8199 1.1066 0.8825 0.0100  0.0813  -0.0284 439 VAL A CG2 
5626 N N   . ILE A 369 ? 0.7167 0.9911 0.7577 0.0341  0.0773  -0.0303 440 ILE A N   
5627 C CA  . ILE A 369 ? 0.7008 0.9576 0.7368 0.0445  0.0728  -0.0297 440 ILE A CA  
5628 C C   . ILE A 369 ? 0.6838 0.9704 0.7282 0.0575  0.0697  -0.0454 440 ILE A C   
5629 O O   . ILE A 369 ? 0.6632 0.9392 0.7147 0.0725  0.0605  -0.0525 440 ILE A O   
5630 C CB  . ILE A 369 ? 0.7226 0.9619 0.7377 0.0335  0.0779  -0.0155 440 ILE A CB  
5631 C CG1 . ILE A 369 ? 0.7510 0.9561 0.7588 0.0253  0.0774  -0.0022 440 ILE A CG1 
5632 C CG2 . ILE A 369 ? 0.7066 0.9353 0.7167 0.0442  0.0740  -0.0168 440 ILE A CG2 
5633 C CD1 . ILE A 369 ? 0.7962 0.9833 0.7811 0.0127  0.0806  0.0114  440 ILE A CD1 
5645 N N   . LEU A 370 ? 0.6604 0.9854 0.7030 0.0513  0.0767  -0.0515 441 LEU A N   
5646 C CA  . LEU A 370 ? 0.6839 1.0422 0.7350 0.0646  0.0736  -0.0687 441 LEU A CA  
5647 C C   . LEU A 370 ? 0.7103 1.0738 0.7810 0.0820  0.0620  -0.0848 441 LEU A C   
5648 O O   . LEU A 370 ? 0.6333 1.0002 0.7102 0.0988  0.0528  -0.0969 441 LEU A O   
5649 C CB  . LEU A 370 ? 0.7255 1.1310 0.7731 0.0529  0.0840  -0.0740 441 LEU A CB  
5650 C CG  . LEU A 370 ? 0.7920 1.1939 0.8162 0.0356  0.0934  -0.0594 441 LEU A CG  
5651 C CD1 . LEU A 370 ? 0.8571 1.3106 0.8778 0.0225  0.1033  -0.0661 441 LEU A CD1 
5652 C CD2 . LEU A 370 ? 0.7877 1.1712 0.8033 0.0462  0.0892  -0.0579 441 LEU A CD2 
5664 N N   . ASP A 371 ? 0.8583 1.2202 0.9377 0.0786  0.0608  -0.0853 442 ASP A N   
5665 C CA  . ASP A 371 ? 0.9249 1.2854 1.0201 0.0948  0.0475  -0.0997 442 ASP A CA  
5666 C C   . ASP A 371 ? 0.7901 1.1075 0.8831 0.1052  0.0359  -0.0954 442 ASP A C   
5667 O O   . ASP A 371 ? 0.7756 1.0921 0.8754 0.1219  0.0229  -0.1086 442 ASP A O   
5668 C CB  . ASP A 371 ? 1.1052 1.4667 1.2076 0.0875  0.0486  -0.0985 442 ASP A CB  
5669 C CG  . ASP A 371 ? 1.2983 1.7120 1.4103 0.0841  0.0544  -0.1123 442 ASP A CG  
5670 O OD1 . ASP A 371 ? 1.4083 1.8575 1.5175 0.0814  0.0616  -0.1181 442 ASP A OD1 
5671 O OD2 . ASP A 371 ? 1.3391 1.7601 1.4614 0.0837  0.0518  -0.1177 442 ASP A OD2 
5676 N N   . ALA A 372 ? 0.7021 0.9842 0.7848 0.0951  0.0397  -0.0775 443 ALA A N   
5677 C CA  . ALA A 372 ? 0.6323 0.8774 0.7124 0.1019  0.0301  -0.0730 443 ALA A CA  
5678 C C   . ALA A 372 ? 0.5896 0.8376 0.6668 0.1124  0.0257  -0.0789 443 ALA A C   
5679 O O   . ALA A 372 ? 0.5699 0.8020 0.6505 0.1242  0.0126  -0.0855 443 ALA A O   
5680 C CB  . ALA A 372 ? 0.6247 0.8394 0.6945 0.0891  0.0365  -0.0548 443 ALA A CB  
5686 N N   . ILE A 373 ? 0.6078 0.8745 0.6774 0.1076  0.0356  -0.0764 444 ILE A N   
5687 C CA  . ILE A 373 ? 0.6506 0.9212 0.7169 0.1176  0.0318  -0.0821 444 ILE A CA  
5688 C C   . ILE A 373 ? 0.7022 0.9947 0.7803 0.1348  0.0203  -0.1024 444 ILE A C   
5689 O O   . ILE A 373 ? 0.7046 0.9832 0.7839 0.1476  0.0084  -0.1088 444 ILE A O   
5690 C CB  . ILE A 373 ? 0.6883 0.9775 0.7424 0.1083  0.0442  -0.0764 444 ILE A CB  
5691 C CG1 . ILE A 373 ? 0.7293 0.9906 0.7697 0.0936  0.0518  -0.0571 444 ILE A CG1 
5692 C CG2 . ILE A 373 ? 0.6793 0.9742 0.7302 0.1195  0.0401  -0.0832 444 ILE A CG2 
5693 C CD1 . ILE A 373 ? 0.7744 1.0491 0.7986 0.0811  0.0628  -0.0495 444 ILE A CD1 
5705 N N   . SER A 374 ? 0.7080 1.0354 0.7947 0.1358  0.0225  -0.1139 445 SER A N   
5706 C CA  . SER A 374 ? 0.7513 1.1031 0.8499 0.1543  0.0102  -0.1362 445 SER A CA  
5707 C C   . SER A 374 ? 0.6958 1.0146 0.7998 0.1662  -0.0084 -0.1411 445 SER A C   
5708 O O   . SER A 374 ? 0.6766 0.9909 0.7834 0.1830  -0.0237 -0.1541 445 SER A O   
5709 C CB  . SER A 374 ? 0.8546 1.2532 0.9625 0.1521  0.0166  -0.1484 445 SER A CB  
5710 O OG  . SER A 374 ? 0.9348 1.3566 1.0554 0.1725  0.0023  -0.1723 445 SER A OG  
5716 N N   . ASN A 375 ? 0.6980 0.9911 0.8016 0.1571  -0.0084 -0.1304 446 ASN A N   
5717 C CA  . ASN A 375 ? 0.7029 0.9621 0.8082 0.1655  -0.0264 -0.1333 446 ASN A CA  
5718 C C   . ASN A 375 ? 0.6848 0.9098 0.7815 0.1685  -0.0350 -0.1269 446 ASN A C   
5719 O O   . ASN A 375 ? 0.7030 0.9104 0.8002 0.1812  -0.0538 -0.1365 446 ASN A O   
5720 C CB  . ASN A 375 ? 0.7324 0.9712 0.8369 0.1530  -0.0230 -0.1213 446 ASN A CB  
5721 C CG  . ASN A 375 ? 0.7488 1.0196 0.8629 0.1510  -0.0174 -0.1293 446 ASN A CG  
5722 O OD1 . ASN A 375 ? 0.7313 1.0379 0.8548 0.1623  -0.0211 -0.1477 446 ASN A OD1 
5723 N ND2 . ASN A 375 ? 0.7735 1.0332 0.8858 0.1368  -0.0089 -0.1164 446 ASN A ND2 
5730 N N   . ILE A 376 ? 0.6534 0.8682 0.7417 0.1569  -0.0227 -0.1114 447 ILE A N   
5731 C CA  . ILE A 376 ? 0.6387 0.8250 0.7198 0.1587  -0.0297 -0.1058 447 ILE A CA  
5732 C C   . ILE A 376 ? 0.6763 0.8770 0.7590 0.1743  -0.0386 -0.1202 447 ILE A C   
5733 O O   . ILE A 376 ? 0.6738 0.8515 0.7541 0.1824  -0.0540 -0.1240 447 ILE A O   
5734 C CB  . ILE A 376 ? 0.6121 0.7884 0.6847 0.1445  -0.0148 -0.0883 447 ILE A CB  
5735 C CG1 . ILE A 376 ? 0.6035 0.7640 0.6744 0.1306  -0.0081 -0.0755 447 ILE A CG1 
5736 C CG2 . ILE A 376 ? 0.5883 0.7405 0.6550 0.1464  -0.0216 -0.0842 447 ILE A CG2 
5737 C CD1 . ILE A 376 ? 0.6057 0.7589 0.6684 0.1183  0.0055  -0.0604 447 ILE A CD1 
5749 N N   . PHE A 377 ? 0.6895 0.9290 0.7755 0.1780  -0.0294 -0.1285 448 PHE A N   
5750 C CA  . PHE A 377 ? 0.7594 1.0180 0.8476 0.1942  -0.0377 -0.1444 448 PHE A CA  
5751 C C   . PHE A 377 ? 0.8335 1.0905 0.9295 0.2119  -0.0590 -0.1633 448 PHE A C   
5752 O O   . PHE A 377 ? 0.8785 1.1272 0.9736 0.2263  -0.0743 -0.1738 448 PHE A O   
5753 C CB  . PHE A 377 ? 0.7534 1.0584 0.8428 0.1925  -0.0229 -0.1502 448 PHE A CB  
5754 C CG  . PHE A 377 ? 0.7458 1.0508 0.8240 0.1845  -0.0108 -0.1387 448 PHE A CG  
5755 C CD1 . PHE A 377 ? 0.7557 1.0535 0.8304 0.1953  -0.0186 -0.1435 448 PHE A CD1 
5756 C CD2 . PHE A 377 ? 0.7225 1.0331 0.7925 0.1667  0.0069  -0.1237 448 PHE A CD2 
5757 C CE1 . PHE A 377 ? 0.7421 1.0392 0.8060 0.1889  -0.0084 -0.1337 448 PHE A CE1 
5758 C CE2 . PHE A 377 ? 0.7107 1.0182 0.7684 0.1603  0.0157  -0.1139 448 PHE A CE2 
5759 C CZ  . PHE A 377 ? 0.7195 1.0210 0.7745 0.1716  0.0083  -0.1190 448 PHE A CZ  
5769 N N   . GLN A 378 ? 0.8592 1.1223 0.9621 0.2119  -0.0619 -0.1684 449 GLN A N   
5770 C CA  . GLN A 378 ? 0.9126 1.1697 1.0212 0.2298  -0.0849 -0.1869 449 GLN A CA  
5771 C C   . GLN A 378 ? 0.9338 1.1377 1.0332 0.2309  -0.1037 -0.1803 449 GLN A C   
5772 O O   . GLN A 378 ? 0.9479 1.1392 1.0463 0.2475  -0.1257 -0.1945 449 GLN A O   
5773 C CB  . GLN A 378 ? 0.9782 1.2507 1.0953 0.2286  -0.0840 -0.1928 449 GLN A CB  
5774 C CG  . GLN A 378 ? 1.0519 1.3822 1.1792 0.2293  -0.0696 -0.2043 449 GLN A CG  
5775 C CD  . GLN A 378 ? 1.1338 1.4806 1.2706 0.2282  -0.0695 -0.2112 449 GLN A CD  
5776 O OE1 . GLN A 378 ? 1.2004 1.5316 1.3411 0.2412  -0.0895 -0.2232 449 GLN A OE1 
5777 N NE2 . GLN A 378 ? 1.1290 1.5052 1.2684 0.2120  -0.0484 -0.2034 449 GLN A NE2 
5786 N N   . ALA A 379 ? 0.9142 1.0868 1.0058 0.2129  -0.0963 -0.1594 450 ALA A N   
5787 C CA  . ALA A 379 ? 0.9285 1.0539 1.0096 0.2098  -0.1118 -0.1515 450 ALA A CA  
5788 C C   . ALA A 379 ? 0.9336 1.0526 1.0098 0.2150  -0.1162 -0.1523 450 ALA A C   
5789 O O   . ALA A 379 ? 0.9517 1.0407 1.0212 0.2213  -0.1370 -0.1563 450 ALA A O   
5790 C CB  . ALA A 379 ? 0.9082 1.0101 0.9830 0.1886  -0.1002 -0.1300 450 ALA A CB  
5796 N N   . ALA A 380 ? 0.9142 1.0591 0.9923 0.2116  -0.0979 -0.1482 451 ALA A N   
5797 C CA  . ALA A 380 ? 0.9154 1.0564 0.9893 0.2170  -0.1012 -0.1495 451 ALA A CA  
5798 C C   . ALA A 380 ? 0.9136 1.0662 0.9910 0.2392  -0.1197 -0.1714 451 ALA A C   
5799 O O   . ALA A 380 ? 0.9203 1.0527 0.9923 0.2461  -0.1338 -0.1745 451 ALA A O   
5800 C CB  . ALA A 380 ? 0.8965 1.0629 0.9699 0.2093  -0.0785 -0.1412 451 ALA A CB  
5806 N N   . GLU A 381 ? 0.9392 1.1251 1.0259 0.2509  -0.1208 -0.1878 452 GLU A N   
5807 C CA  . GLU A 381 ? 0.9510 1.1511 1.0422 0.2746  -0.1402 -0.2120 452 GLU A CA  
5808 C C   . GLU A 381 ? 0.9513 1.1068 1.0360 0.2834  -0.1698 -0.2177 452 GLU A C   
5809 O O   . GLU A 381 ? 0.9515 1.0965 1.0332 0.2992  -0.1895 -0.2305 452 GLU A O   
5810 C CB  . GLU A 381 ? 1.0102 1.2589 1.1139 0.2844  -0.1354 -0.2297 452 GLU A CB  
5811 C CG  . GLU A 381 ? 1.1028 1.4008 1.2107 0.2795  -0.1114 -0.2299 452 GLU A CG  
5812 C CD  . GLU A 381 ? 1.2303 1.5791 1.3503 0.2847  -0.1049 -0.2461 452 GLU A CD  
5813 O OE1 . GLU A 381 ? 1.2976 1.6462 1.4247 0.2978  -0.1218 -0.2618 452 GLU A OE1 
5814 O OE2 . GLU A 381 ? 1.2637 1.6524 1.3851 0.2750  -0.0834 -0.2432 452 GLU A OE2 
5821 N N   . LYS A 382 ? 0.9510 1.0781 1.0319 0.2731  -0.1744 -0.2083 453 LYS A N   
5822 C CA  . LYS A 382 ? 1.0165 1.0957 1.0868 0.2780  -0.2033 -0.2111 453 LYS A CA  
5823 C C   . LYS A 382 ? 1.0619 1.1055 1.1200 0.2720  -0.2123 -0.2012 453 LYS A C   
5824 O O   . LYS A 382 ? 1.1409 1.1547 1.1905 0.2834  -0.2396 -0.2108 453 LYS A O   
5825 C CB  . LYS A 382 ? 1.0404 1.0938 1.1059 0.2628  -0.2030 -0.1982 453 LYS A CB  
5826 C CG  . LYS A 382 ? 1.0606 1.1484 1.1381 0.2629  -0.1892 -0.2029 453 LYS A CG  
5827 C CD  . LYS A 382 ? 1.1116 1.2124 1.1959 0.2856  -0.2099 -0.2281 453 LYS A CD  
5828 C CE  . LYS A 382 ? 1.1382 1.2365 1.2253 0.2802  -0.2092 -0.2265 453 LYS A CE  
5829 N NZ  . LYS A 382 ? 1.1249 1.2551 1.2207 0.2631  -0.1778 -0.2134 453 LYS A NZ  
5843 N N   . LEU A 383 ? 0.9993 1.0452 1.0558 0.2544  -0.1907 -0.1828 454 LEU A N   
5844 C CA  . LEU A 383 ? 1.0250 1.0416 1.0714 0.2462  -0.1962 -0.1725 454 LEU A CA  
5845 C C   . LEU A 383 ? 1.0736 1.1107 1.1234 0.2595  -0.1956 -0.1823 454 LEU A C   
5846 O O   . LEU A 383 ? 1.0257 1.0401 1.0679 0.2551  -0.2023 -0.1764 454 LEU A O   
5847 C CB  . LEU A 383 ? 0.9873 0.9977 1.0310 0.2217  -0.1743 -0.1494 454 LEU A CB  
5848 C CG  . LEU A 383 ? 0.9624 0.9509 1.0011 0.2051  -0.1729 -0.1367 454 LEU A CG  
5849 C CD1 . LEU A 383 ? 0.9229 0.9179 0.9623 0.1853  -0.1485 -0.1182 454 LEU A CD1 
5850 C CD2 . LEU A 383 ? 0.9876 0.9284 1.0114 0.1997  -0.1986 -0.1340 454 LEU A CD2 
5862 N N   . GLY A 384 ? 1.1387 1.2194 1.1993 0.2746  -0.1877 -0.1973 455 GLY A N   
5863 C CA  . GLY A 384 ? 1.1828 1.2873 1.2460 0.2855  -0.1836 -0.2055 455 GLY A CA  
5864 C C   . GLY A 384 ? 1.1499 1.2592 1.2107 0.2695  -0.1611 -0.1877 455 GLY A C   
5865 O O   . GLY A 384 ? 1.1894 1.2944 1.2467 0.2735  -0.1642 -0.1884 455 GLY A O   
5869 N N   . GLU A 385 ? 1.1104 1.2280 1.1726 0.2524  -0.1394 -0.1725 456 GLU A N   
5870 C CA  . GLU A 385 ? 1.0444 1.1630 1.1032 0.2374  -0.1199 -0.1557 456 GLU A CA  
5871 C C   . GLU A 385 ? 0.9776 1.1327 1.0402 0.2319  -0.0959 -0.1520 456 GLU A C   
5872 O O   . GLU A 385 ? 0.9702 1.1218 1.0294 0.2167  -0.0797 -0.1362 456 GLU A O   
5873 C CB  . GLU A 385 ? 1.0819 1.1658 1.1350 0.2187  -0.1195 -0.1383 456 GLU A CB  
5874 C CG  . GLU A 385 ? 1.1693 1.2156 1.2149 0.2185  -0.1413 -0.1383 456 GLU A CG  
5875 C CD  . GLU A 385 ? 1.2454 1.2616 1.2846 0.1978  -0.1408 -0.1218 456 GLU A CD  
5876 O OE1 . GLU A 385 ? 1.2820 1.3030 1.3231 0.1867  -0.1276 -0.1128 456 GLU A OE1 
5877 O OE2 . GLU A 385 ? 1.2694 1.2583 1.3011 0.1919  -0.1539 -0.1182 456 GLU A OE2 
5884 N N   . THR A 386 ? 0.9370 1.1279 1.0058 0.2438  -0.0942 -0.1669 457 THR A N   
5885 C CA  . THR A 386 ? 0.9390 1.1654 1.0091 0.2361  -0.0722 -0.1632 457 THR A CA  
5886 C C   . THR A 386 ? 0.9548 1.1896 1.0174 0.2313  -0.0590 -0.1552 457 THR A C   
5887 O O   . THR A 386 ? 0.8991 1.1471 0.9572 0.2185  -0.0408 -0.1443 457 THR A O   
5888 C CB  . THR A 386 ? 0.9714 1.2392 1.0499 0.2495  -0.0742 -0.1830 457 THR A CB  
5889 O OG1 . THR A 386 ? 1.0019 1.2780 1.0818 0.2690  -0.0892 -0.2006 457 THR A OG1 
5890 C CG2 . THR A 386 ? 0.9797 1.2426 1.0655 0.2520  -0.0838 -0.1894 457 THR A CG2 
5898 N N   . GLU A 387 ? 1.0129 1.2388 1.0728 0.2416  -0.0693 -0.1609 458 GLU A N   
5899 C CA  . GLU A 387 ? 1.0632 1.2920 1.1149 0.2378  -0.0590 -0.1533 458 GLU A CA  
5900 C C   . GLU A 387 ? 0.9818 1.1816 1.0278 0.2214  -0.0511 -0.1337 458 GLU A C   
5901 O O   . GLU A 387 ? 0.9364 1.1429 0.9752 0.2117  -0.0359 -0.1232 458 GLU A O   
5902 C CB  . GLU A 387 ? 1.1947 1.4187 1.2458 0.2536  -0.0739 -0.1649 458 GLU A CB  
5903 C CG  . GLU A 387 ? 1.3037 1.4886 1.3559 0.2570  -0.0943 -0.1655 458 GLU A CG  
5904 C CD  . GLU A 387 ? 1.3734 1.5524 1.4316 0.2669  -0.1123 -0.1783 458 GLU A CD  
5905 O OE1 . GLU A 387 ? 1.3975 1.6083 1.4617 0.2764  -0.1111 -0.1917 458 GLU A OE1 
5906 O OE2 . GLU A 387 ? 1.3925 1.5355 1.4486 0.2648  -0.1284 -0.1755 458 GLU A OE2 
5913 N N   . LYS A 388 ? 1.0102 1.1781 1.0581 0.2179  -0.0622 -0.1292 459 LYS A N   
5914 C CA  . LYS A 388 ? 0.9945 1.1396 1.0385 0.2027  -0.0551 -0.1128 459 LYS A CA  
5915 C C   . LYS A 388 ? 0.8958 1.0492 0.9387 0.1900  -0.0391 -0.1025 459 LYS A C   
5916 O O   . LYS A 388 ? 0.8868 1.0363 0.9238 0.1806  -0.0277 -0.0912 459 LYS A O   
5917 C CB  . LYS A 388 ? 1.0915 1.2053 1.1370 0.1990  -0.0698 -0.1107 459 LYS A CB  
5918 C CG  . LYS A 388 ? 1.2190 1.3173 1.2625 0.2062  -0.0845 -0.1160 459 LYS A CG  
5919 C CD  . LYS A 388 ? 1.3359 1.4093 1.3795 0.2089  -0.1060 -0.1217 459 LYS A CD  
5920 C CE  . LYS A 388 ? 1.4070 1.4611 1.4467 0.2128  -0.1214 -0.1251 459 LYS A CE  
5921 N NZ  . LYS A 388 ? 1.4229 1.4644 1.4598 0.1977  -0.1145 -0.1122 459 LYS A NZ  
5935 N N   . LEU A 389 ? 0.8395 1.0037 0.8876 0.1903  -0.0393 -0.1070 460 LEU A N   
5936 C CA  . LEU A 389 ? 0.7904 0.9621 0.8375 0.1778  -0.0249 -0.0974 460 LEU A CA  
5937 C C   . LEU A 389 ? 0.8050 1.0018 0.8453 0.1750  -0.0105 -0.0953 460 LEU A C   
5938 O O   . LEU A 389 ? 0.7942 0.9877 0.8279 0.1626  0.0013  -0.0830 460 LEU A O   
5939 C CB  . LEU A 389 ? 0.7611 0.9403 0.8159 0.1795  -0.0294 -0.1041 460 LEU A CB  
5940 C CG  . LEU A 389 ? 0.7351 0.9212 0.7896 0.1663  -0.0159 -0.0947 460 LEU A CG  
5941 C CD1 . LEU A 389 ? 0.6954 0.8539 0.7455 0.1533  -0.0115 -0.0791 460 LEU A CD1 
5942 C CD2 . LEU A 389 ? 0.7600 0.9551 0.8232 0.1701  -0.0220 -0.1036 460 LEU A CD2 
5954 N N   . SER A 390 ? 0.8046 1.0253 0.8447 0.1859  -0.0126 -0.1071 461 SER A N   
5955 C CA  . SER A 390 ? 0.8259 1.0727 0.8571 0.1817  0.0005  -0.1055 461 SER A CA  
5956 C C   . SER A 390 ? 0.7714 1.0017 0.7898 0.1760  0.0061  -0.0938 461 SER A C   
5957 O O   . SER A 390 ? 0.7335 0.9679 0.7403 0.1646  0.0177  -0.0839 461 SER A O   
5958 C CB  . SER A 390 ? 0.9014 1.1806 0.9360 0.1957  -0.0040 -0.1230 461 SER A CB  
5959 O OG  . SER A 390 ? 0.9489 1.2572 0.9739 0.1885  0.0094  -0.1214 461 SER A OG  
5965 N N   . ILE A 391 ? 0.7922 1.0031 0.8115 0.1836  -0.0033 -0.0953 462 ILE A N   
5966 C CA  . ILE A 391 ? 0.8122 1.0069 0.8208 0.1793  0.0006  -0.0855 462 ILE A CA  
5967 C C   . ILE A 391 ? 0.8006 0.9742 0.8067 0.1663  0.0063  -0.0717 462 ILE A C   
5968 O O   . ILE A 391 ? 0.7477 0.9141 0.7418 0.1596  0.0132  -0.0626 462 ILE A O   
5969 C CB  . ILE A 391 ? 0.8786 1.0597 0.8904 0.1901  -0.0112 -0.0913 462 ILE A CB  
5970 C CG1 . ILE A 391 ? 0.9591 1.1617 0.9723 0.2045  -0.0175 -0.1060 462 ILE A CG1 
5971 C CG2 . ILE A 391 ? 0.8702 1.0363 0.8722 0.1869  -0.0080 -0.0829 462 ILE A CG2 
5972 C CD1 . ILE A 391 ? 1.0206 1.2486 1.0216 0.2040  -0.0072 -0.1067 462 ILE A CD1 
5984 N N   . MET A 392 ? 0.8597 1.0221 0.8757 0.1630  0.0023  -0.0707 463 MET A N   
5985 C CA  . MET A 392 ? 0.8722 1.0179 0.8865 0.1511  0.0077  -0.0591 463 MET A CA  
5986 C C   . MET A 392 ? 0.8139 0.9694 0.8194 0.1415  0.0193  -0.0518 463 MET A C   
5987 O O   . MET A 392 ? 0.8433 0.9854 0.8400 0.1336  0.0244  -0.0419 463 MET A O   
5988 C CB  . MET A 392 ? 0.8909 1.0258 0.9159 0.1485  0.0016  -0.0597 463 MET A CB  
5989 C CG  . MET A 392 ? 0.9393 1.0566 0.9696 0.1517  -0.0100 -0.0624 463 MET A CG  
5990 S SD  . MET A 392 ? 0.9750 1.0782 1.0130 0.1453  -0.0171 -0.0613 463 MET A SD  
5991 C CE  . MET A 392 ? 0.9879 1.0855 1.0228 0.1314  -0.0044 -0.0485 463 MET A CE  
6001 N N   . ILE A 393 ? 0.7446 0.9238 0.7519 0.1417  0.0227  -0.0574 464 ILE A N   
6002 C CA  . ILE A 393 ? 0.7172 0.9069 0.7151 0.1298  0.0335  -0.0501 464 ILE A CA  
6003 C C   . ILE A 393 ? 0.8096 1.0004 0.7893 0.1262  0.0387  -0.0445 464 ILE A C   
6004 O O   . ILE A 393 ? 0.7989 0.9805 0.7651 0.1144  0.0448  -0.0335 464 ILE A O   
6005 C CB  . ILE A 393 ? 0.6844 0.9040 0.6902 0.1303  0.0357  -0.0592 464 ILE A CB  
6006 C CG1 . ILE A 393 ? 0.6832 0.8947 0.7031 0.1310  0.0305  -0.0614 464 ILE A CG1 
6007 C CG2 . ILE A 393 ? 0.6537 0.8899 0.6478 0.1165  0.0472  -0.0526 464 ILE A CG2 
6008 C CD1 . ILE A 393 ? 0.6960 0.9353 0.7268 0.1366  0.0282  -0.0744 464 ILE A CD1 
6020 N N   . GLU A 394 ? 0.8548 1.0542 0.8321 0.1362  0.0351  -0.0518 465 GLU A N   
6021 C CA  . GLU A 394 ? 0.9363 1.1328 0.8944 0.1333  0.0384  -0.0463 465 GLU A CA  
6022 C C   . GLU A 394 ? 0.8872 1.0510 0.8375 0.1315  0.0355  -0.0368 465 GLU A C   
6023 O O   . GLU A 394 ? 0.8587 1.0109 0.7905 0.1229  0.0389  -0.0272 465 GLU A O   
6024 C CB  . GLU A 394 ? 1.0424 1.2550 1.0010 0.1460  0.0340  -0.0574 465 GLU A CB  
6025 C CG  . GLU A 394 ? 1.1210 1.3391 1.0578 0.1420  0.0385  -0.0534 465 GLU A CG  
6026 C CD  . GLU A 394 ? 1.1438 1.3827 1.0819 0.1550  0.0346  -0.0659 465 GLU A CD  
6027 O OE1 . GLU A 394 ? 1.1579 1.3956 1.1121 0.1690  0.0257  -0.0762 465 GLU A OE1 
6028 O OE2 . GLU A 394 ? 1.1391 1.3950 1.0607 0.1506  0.0399  -0.0654 465 GLU A OE2 
6035 N N   . GLU A 395 ? 0.9023 1.0512 0.8656 0.1389  0.0284  -0.0398 466 GLU A N   
6036 C CA  . GLU A 395 ? 0.9088 1.0327 0.8674 0.1388  0.0252  -0.0340 466 GLU A CA  
6037 C C   . GLU A 395 ? 0.9253 1.0342 0.8791 0.1282  0.0288  -0.0243 466 GLU A C   
6038 O O   . GLU A 395 ? 0.9517 1.0418 0.8992 0.1286  0.0259  -0.0204 466 GLU A O   
6039 C CB  . GLU A 395 ? 0.9008 1.0176 0.8752 0.1468  0.0172  -0.0404 466 GLU A CB  
6040 C CG  . GLU A 395 ? 0.9601 1.0855 0.9380 0.1583  0.0110  -0.0499 466 GLU A CG  
6041 C CD  . GLU A 395 ? 1.0444 1.1619 1.0372 0.1631  0.0021  -0.0554 466 GLU A CD  
6042 O OE1 . GLU A 395 ? 1.0626 1.1726 1.0639 0.1568  0.0015  -0.0527 466 GLU A OE1 
6043 O OE2 . GLU A 395 ? 1.1002 1.2184 1.0947 0.1721  -0.0048 -0.0622 466 GLU A OE2 
6050 N N   . CYS A 396 ? 0.9471 1.0642 0.9044 0.1199  0.0340  -0.0215 467 CYS A N   
6051 C CA  . CYS A 396 ? 0.9696 1.0726 0.9220 0.1098  0.0369  -0.0126 467 CYS A CA  
6052 C C   . CYS A 396 ? 0.9082 1.0111 0.8403 0.0989  0.0422  -0.0043 467 CYS A C   
6053 O O   . CYS A 396 ? 0.9401 1.0321 0.8667 0.0894  0.0443  0.0033  467 CYS A O   
6054 C CB  . CYS A 396 ? 1.0562 1.1655 1.0248 0.1064  0.0385  -0.0141 467 CYS A CB  
6055 S SG  . CYS A 396 ? 1.1199 1.2209 1.1069 0.1136  0.0312  -0.0199 467 CYS A SG  
6061 N N   . GLY A 397 ? 0.8265 0.9411 0.7462 0.0990  0.0439  -0.0054 468 GLY A N   
6062 C CA  . GLY A 397 ? 0.8244 0.9427 0.7231 0.0854  0.0492  0.0026  468 GLY A CA  
6063 C C   . GLY A 397 ? 0.8600 1.0062 0.7658 0.0765  0.0569  0.0008  468 GLY A C   
6064 O O   . GLY A 397 ? 0.9054 1.0564 0.7942 0.0616  0.0620  0.0083  468 GLY A O   
6068 N N   . GLY A 398 ? 0.8367 1.0014 0.7659 0.0847  0.0568  -0.0095 469 GLY A N   
6069 C CA  . GLY A 398 ? 0.8291 1.0199 0.7682 0.0784  0.0624  -0.0133 469 GLY A CA  
6070 C C   . GLY A 398 ? 0.8211 1.0482 0.7555 0.0755  0.0680  -0.0199 469 GLY A C   
6071 O O   . GLY A 398 ? 0.8404 1.0888 0.7721 0.0631  0.0749  -0.0187 469 GLY A O   
6075 N N   . LEU A 399 ? 0.7974 1.0346 0.7311 0.0866  0.0650  -0.0278 470 LEU A N   
6076 C CA  . LEU A 399 ? 0.8410 1.1184 0.7732 0.0862  0.0699  -0.0374 470 LEU A CA  
6077 C C   . LEU A 399 ? 0.9320 1.2193 0.8396 0.0660  0.0786  -0.0272 470 LEU A C   
6078 O O   . LEU A 399 ? 0.9370 1.2624 0.8454 0.0576  0.0858  -0.0327 470 LEU A O   
6079 C CB  . LEU A 399 ? 0.8861 1.1687 0.8195 0.1021  0.0642  -0.0469 470 LEU A CB  
6080 C CG  . LEU A 399 ? 0.9660 1.2931 0.8991 0.1049  0.0681  -0.0596 470 LEU A CG  
6081 C CD1 . LEU A 399 ? 0.9832 1.3475 0.9327 0.1036  0.0718  -0.0706 470 LEU A CD1 
6082 C CD2 . LEU A 399 ? 0.9967 1.3251 0.9387 0.1252  0.0591  -0.0719 470 LEU A CD2 
6094 N N   . ASP A 400 ? 1.0606 1.3147 0.9450 0.0575  0.0771  -0.0130 471 ASP A N   
6095 C CA  . ASP A 400 ? 1.2053 1.4625 1.0617 0.0362  0.0831  -0.0016 471 ASP A CA  
6096 C C   . ASP A 400 ? 1.2064 1.4722 1.0638 0.0190  0.0892  0.0041  471 ASP A C   
6097 O O   . ASP A 400 ? 1.2781 1.5712 1.1227 0.0013  0.0970  0.0064  471 ASP A O   
6098 C CB  . ASP A 400 ? 1.3371 1.5494 1.1674 0.0324  0.0767  0.0122  471 ASP A CB  
6099 C CG  . ASP A 400 ? 1.4459 1.6531 1.2706 0.0466  0.0714  0.0070  471 ASP A CG  
6100 O OD1 . ASP A 400 ? 1.4730 1.7149 1.3050 0.0533  0.0746  -0.0045 471 ASP A OD1 
6101 O OD2 . ASP A 400 ? 1.4963 1.6659 1.3095 0.0518  0.0633  0.0134  471 ASP A OD2 
6106 N N   . LYS A 401 ? 1.1376 1.3825 1.0101 0.0231  0.0859  0.0061  472 LYS A N   
6107 C CA  . LYS A 401 ? 1.0649 1.3158 0.9397 0.0079  0.0908  0.0112  472 LYS A CA  
6108 C C   . LYS A 401 ? 1.0413 1.3422 0.9362 0.0084  0.0975  -0.0027 472 LYS A C   
6109 O O   . LYS A 401 ? 1.0691 1.3918 0.9589 -0.0093 0.1046  0.0001  472 LYS A O   
6110 C CB  . LYS A 401 ? 1.0017 1.2192 0.8885 0.0142  0.0851  0.0152  472 LYS A CB  
6111 C CG  . LYS A 401 ? 0.9944 1.1654 0.8608 0.0114  0.0782  0.0283  472 LYS A CG  
6112 C CD  . LYS A 401 ? 0.9689 1.1148 0.8523 0.0269  0.0713  0.0256  472 LYS A CD  
6113 C CE  . LYS A 401 ? 0.9865 1.0901 0.8513 0.0270  0.0633  0.0354  472 LYS A CE  
6114 N NZ  . LYS A 401 ? 0.9983 1.0802 0.8548 0.0150  0.0619  0.0452  472 LYS A NZ  
6128 N N   . ILE A 402 ? 0.9845 1.3039 0.9021 0.0287  0.0942  -0.0186 473 ILE A N   
6129 C CA  . ILE A 402 ? 1.0019 1.3692 0.9388 0.0326  0.0979  -0.0348 473 ILE A CA  
6130 C C   . ILE A 402 ? 1.1286 1.5385 1.0522 0.0212  0.1063  -0.0390 473 ILE A C   
6131 O O   . ILE A 402 ? 1.1733 1.6244 1.1026 0.0111  0.1134  -0.0458 473 ILE A O   
6132 C CB  . ILE A 402 ? 0.9212 1.2924 0.8822 0.0579  0.0891  -0.0510 473 ILE A CB  
6133 C CG1 . ILE A 402 ? 0.8709 1.2015 0.8425 0.0653  0.0815  -0.0457 473 ILE A CG1 
6134 C CG2 . ILE A 402 ? 0.9063 1.3267 0.8869 0.0648  0.0903  -0.0703 473 ILE A CG2 
6135 C CD1 . ILE A 402 ? 0.8427 1.1727 0.8359 0.0867  0.0713  -0.0599 473 ILE A CD1 
6147 N N   . GLU A 403 ? 1.1214 1.5246 1.0272 0.0224  0.1055  -0.0358 474 GLU A N   
6148 C CA  . GLU A 403 ? 1.2043 1.6468 1.0935 0.0093  0.1137  -0.0383 474 GLU A CA  
6149 C C   . GLU A 403 ? 1.1671 1.6100 1.0331 -0.0210 0.1217  -0.0227 474 GLU A C   
6150 O O   . GLU A 403 ? 1.3083 1.7988 1.1729 -0.0357 0.1309  -0.0284 474 GLU A O   
6151 C CB  . GLU A 403 ? 1.3366 1.7636 1.2082 0.0161  0.1100  -0.0357 474 GLU A CB  
6152 C CG  . GLU A 403 ? 1.5054 1.9783 1.3629 0.0075  0.1175  -0.0423 474 GLU A CG  
6153 C CD  . GLU A 403 ? 1.6944 2.1558 1.5144 -0.0213 0.1232  -0.0233 474 GLU A CD  
6154 O OE1 . GLU A 403 ? 1.8141 2.2248 1.6127 -0.0237 0.1168  -0.0080 474 GLU A OE1 
6155 O OE2 . GLU A 403 ? 1.7188 2.2218 1.5297 -0.0421 0.1331  -0.0241 474 GLU A OE2 
6162 N N   . ALA A 404 ? 1.1123 1.5033 0.9604 -0.0307 0.1176  -0.0038 475 ALA A N   
6163 C CA  . ALA A 404 ? 1.0920 1.4745 0.9155 -0.0598 0.1223  0.0124  475 ALA A CA  
6164 C C   . ALA A 404 ? 1.2653 1.6812 1.1060 -0.0700 0.1291  0.0070  475 ALA A C   
6165 O O   . ALA A 404 ? 1.2345 1.6645 1.0569 -0.0967 0.1357  0.0158  475 ALA A O   
6166 C CB  . ALA A 404 ? 1.0280 1.3457 0.8343 -0.0627 0.1133  0.0303  475 ALA A CB  
6172 N N   . LEU A 405 ? 1.4370 1.8646 1.3111 -0.0503 0.1268  -0.0072 476 LEU A N   
6173 C CA  . LEU A 405 ? 1.6421 2.0969 1.5330 -0.0583 0.1316  -0.0125 476 LEU A CA  
6174 C C   . LEU A 405 ? 1.8786 2.4000 1.7719 -0.0704 0.1419  -0.0248 476 LEU A C   
6175 O O   . LEU A 405 ? 1.9474 2.4939 1.8442 -0.0872 0.1481  -0.0248 476 LEU A O   
6176 C CB  . LEU A 405 ? 1.5282 1.9792 1.4522 -0.0333 0.1250  -0.0258 476 LEU A CB  
6177 C CG  . LEU A 405 ? 1.4185 1.8113 1.3443 -0.0245 0.1163  -0.0149 476 LEU A CG  
6178 C CD1 . LEU A 405 ? 1.3782 1.7766 1.3348 -0.0050 0.1110  -0.0286 476 LEU A CD1 
6179 C CD2 . LEU A 405 ? 1.3689 1.7315 1.2767 -0.0460 0.1176  0.0036  476 LEU A CD2 
6191 N N   . GLN A 406 ? 1.9871 2.5408 1.8795 -0.0620 0.1439  -0.0365 477 GLN A N   
6192 C CA  . GLN A 406 ? 2.0616 2.6854 1.9577 -0.0725 0.1539  -0.0509 477 GLN A CA  
6193 C C   . GLN A 406 ? 2.0635 2.6987 1.9332 -0.1097 0.1635  -0.0355 477 GLN A C   
6194 O O   . GLN A 406 ? 2.1411 2.8264 2.0209 -0.1227 0.1716  -0.0445 477 GLN A O   
6195 C CB  . GLN A 406 ? 2.0919 2.7419 1.9828 -0.0616 0.1545  -0.0618 477 GLN A CB  
6196 C CG  . GLN A 406 ? 2.0805 2.8104 1.9834 -0.0643 0.1632  -0.0835 477 GLN A CG  
6197 C CD  . GLN A 406 ? 2.0489 2.8073 1.9488 -0.0507 0.1629  -0.0968 477 GLN A CD  
6198 O OE1 . GLN A 406 ? 2.0569 2.7740 1.9493 -0.0360 0.1551  -0.0913 477 GLN A OE1 
6199 N NE2 . GLN A 406 ? 2.0134 2.8454 1.9199 -0.0553 0.1713  -0.1157 477 GLN A NE2 
6208 N N   . ARG A 407 ? 1.8886 2.4766 1.7233 -0.1275 0.1616  -0.0125 478 ARG A N   
6209 C CA  . ARG A 407 ? 1.8242 2.4126 1.6280 -0.1649 0.1680  0.0050  478 ARG A CA  
6210 C C   . ARG A 407 ? 1.7237 2.3025 1.5366 -0.1767 0.1684  0.0109  478 ARG A C   
6211 O O   . ARG A 407 ? 1.8329 2.4200 1.6239 -0.2091 0.1739  0.0230  478 ARG A O   
6212 C CB  . ARG A 407 ? 1.8738 2.4005 1.6376 -0.1770 0.1610  0.0284  478 ARG A CB  
6213 C CG  . ARG A 407 ? 1.9039 2.4335 1.6539 -0.1674 0.1598  0.0252  478 ARG A CG  
6214 C CD  . ARG A 407 ? 1.9509 2.5414 1.6846 -0.1901 0.1714  0.0203  478 ARG A CD  
6215 N NE  . ARG A 407 ? 1.9980 2.5900 1.7163 -0.1815 0.1699  0.0178  478 ARG A NE  
6216 C CZ  . ARG A 407 ? 2.0764 2.6251 1.7541 -0.1959 0.1648  0.0368  478 ARG A CZ  
6217 N NH1 . ARG A 407 ? 2.0972 2.5951 1.7444 -0.2195 0.1593  0.0598  478 ARG A NH1 
6218 N NH2 . ARG A 407 ? 2.1265 2.6808 1.7933 -0.1858 0.1635  0.0322  478 ARG A NH2 
6232 N N   . HIS A 408 ? 1.6509 2.2118 1.4937 -0.1528 0.1622  0.0032  479 HIS A N   
6233 C CA  . HIS A 408 ? 1.4931 2.0364 1.3427 -0.1624 0.1611  0.0104  479 HIS A CA  
6234 C C   . HIS A 408 ? 1.4767 2.0825 1.3345 -0.1832 0.1719  0.0016  479 HIS A C   
6235 O O   . HIS A 408 ? 1.4555 2.1249 1.3303 -0.1775 0.1787  -0.0186 479 HIS A O   
6236 C CB  . HIS A 408 ? 1.3247 1.8459 1.2065 -0.1319 0.1531  0.0007  479 HIS A CB  
6237 C CG  . HIS A 408 ? 1.2002 1.6889 1.0852 -0.1392 0.1497  0.0110  479 HIS A CG  
6238 N ND1 . HIS A 408 ? 1.1260 1.6392 1.0400 -0.1317 0.1507  -0.0016 479 HIS A ND1 
6239 C CD2 . HIS A 408 ? 1.1683 1.6016 1.0305 -0.1523 0.1442  0.0317  479 HIS A CD2 
6240 C CE1 . HIS A 408 ? 1.1040 1.5787 1.0131 -0.1405 0.1470  0.0117  479 HIS A CE1 
6241 N NE2 . HIS A 408 ? 1.1303 1.5567 1.0086 -0.1527 0.1428  0.0315  479 HIS A NE2 
6249 N N   . GLU A 409 ? 1.5029 2.0908 1.3488 -0.2070 0.1727  0.0159  480 GLU A N   
6250 C CA  . GLU A 409 ? 1.5134 2.1582 1.3655 -0.2303 0.1827  0.0094  480 GLU A CA  
6251 C C   . GLU A 409 ? 1.4348 2.1217 1.3305 -0.2070 0.1836  -0.0151 480 GLU A C   
6252 O O   . GLU A 409 ? 1.4343 2.1921 1.3462 -0.2094 0.1919  -0.0345 480 GLU A O   
6253 C CB  . GLU A 409 ? 1.6073 2.2148 1.4353 -0.2604 0.1810  0.0317  480 GLU A CB  
6254 C CG  . GLU A 409 ? 1.7084 2.2597 1.4904 -0.2810 0.1753  0.0572  480 GLU A CG  
6255 C CD  . GLU A 409 ? 1.7926 2.3122 1.5476 -0.3142 0.1725  0.0782  480 GLU A CD  
6256 O OE1 . GLU A 409 ? 1.8202 2.2942 1.5339 -0.3345 0.1662  0.0991  480 GLU A OE1 
6257 O OE2 . GLU A 409 ? 1.8289 2.3675 1.6029 -0.3200 0.1754  0.0735  480 GLU A OE2 
6264 N N   . ASN A 410 ? 1.4097 2.0545 1.3240 -0.1843 0.1743  -0.0154 481 ASN A N   
6265 C CA  . ASN A 410 ? 1.3497 2.0251 1.3020 -0.1627 0.1725  -0.0368 481 ASN A CA  
6266 C C   . ASN A 410 ? 1.3639 2.0904 1.3379 -0.1389 0.1731  -0.0625 481 ASN A C   
6267 O O   . ASN A 410 ? 1.3735 2.0930 1.3377 -0.1293 0.1717  -0.0627 481 ASN A O   
6268 C CB  . ASN A 410 ? 1.2811 1.8963 1.2448 -0.1414 0.1613  -0.0312 481 ASN A CB  
6269 C CG  . ASN A 410 ? 1.2225 1.8609 1.2207 -0.1225 0.1578  -0.0503 481 ASN A CG  
6270 O OD1 . ASN A 410 ? 1.2142 1.8730 1.2344 -0.0960 0.1530  -0.0699 481 ASN A OD1 
6271 N ND2 . ASN A 410 ? 1.1902 1.8227 1.1923 -0.1354 0.1585  -0.0447 481 ASN A ND2 
6278 N N   . GLU A 411 ? 1.3163 2.0943 1.3200 -0.1283 0.1740  -0.0854 482 GLU A N   
6279 C CA  . GLU A 411 ? 1.3603 2.1935 1.3856 -0.1057 0.1732  -0.1131 482 GLU A CA  
6280 C C   . GLU A 411 ? 1.2739 2.0738 1.3191 -0.0681 0.1590  -0.1237 482 GLU A C   
6281 O O   . GLU A 411 ? 1.2802 2.0834 1.3260 -0.0502 0.1550  -0.1325 482 GLU A O   
6282 C CB  . GLU A 411 ? 1.4953 2.4025 1.5432 -0.1103 0.1789  -0.1356 482 GLU A CB  
6283 C CG  . GLU A 411 ? 1.6061 2.5838 1.6713 -0.0932 0.1800  -0.1654 482 GLU A CG  
6284 C CD  . GLU A 411 ? 1.7036 2.7173 1.7446 -0.1155 0.1920  -0.1610 482 GLU A CD  
6285 O OE1 . GLU A 411 ? 1.7674 2.8199 1.7975 -0.1468 0.2024  -0.1572 482 GLU A OE1 
6286 O OE2 . GLU A 411 ? 1.7052 2.7023 1.7366 -0.1022 0.1886  -0.1602 482 GLU A OE2 
6293 N N   . SER A 412 ? 1.1962 1.9638 1.2566 -0.0570 0.1508  -0.1230 483 SER A N   
6294 C CA  . SER A 412 ? 1.1054 1.8401 1.1826 -0.0243 0.1365  -0.1322 483 SER A CA  
6295 C C   . SER A 412 ? 1.1233 1.8035 1.1829 -0.0177 0.1321  -0.1165 483 SER A C   
6296 O O   . SER A 412 ? 1.0217 1.6938 1.0903 0.0070  0.1227  -0.1276 483 SER A O   
6297 C CB  . SER A 412 ? 1.0496 1.7532 1.1398 -0.0194 0.1295  -0.1292 483 SER A CB  
6298 O OG  . SER A 412 ? 1.0437 1.7126 1.1153 -0.0444 0.1357  -0.1046 483 SER A OG  
6304 N N   . VAL A 413 ? 1.2470 1.8886 1.2810 -0.0394 0.1375  -0.0913 484 VAL A N   
6305 C CA  . VAL A 413 ? 1.2956 1.8905 1.3111 -0.0348 0.1339  -0.0772 484 VAL A CA  
6306 C C   . VAL A 413 ? 1.3023 1.9317 1.3123 -0.0297 0.1368  -0.0875 484 VAL A C   
6307 O O   . VAL A 413 ? 1.3461 1.9570 1.3588 -0.0092 0.1293  -0.0921 484 VAL A O   
6308 C CB  . VAL A 413 ? 1.2511 1.8037 1.2383 -0.0600 0.1381  -0.0505 484 VAL A CB  
6309 C CG1 . VAL A 413 ? 1.2646 1.7758 1.2311 -0.0562 0.1345  -0.0378 484 VAL A CG1 
6310 C CG2 . VAL A 413 ? 1.1840 1.6980 1.1775 -0.0608 0.1334  -0.0412 484 VAL A CG2 
6320 N N   . TYR A 414 ? 1.1779 1.8590 1.1793 -0.0496 0.1479  -0.0913 485 TYR A N   
6321 C CA  . TYR A 414 ? 1.2046 1.9233 1.1986 -0.0475 0.1520  -0.1010 485 TYR A CA  
6322 C C   . TYR A 414 ? 1.1738 1.9183 1.1942 -0.0143 0.1430  -0.1275 485 TYR A C   
6323 O O   . TYR A 414 ? 1.0864 1.8159 1.1027 0.0015  0.1375  -0.1299 485 TYR A O   
6324 C CB  . TYR A 414 ? 1.3618 2.1415 1.3460 -0.0753 0.1657  -0.1040 485 TYR A CB  
6325 C CG  . TYR A 414 ? 1.5353 2.3711 1.5175 -0.0720 0.1708  -0.1203 485 TYR A CG  
6326 C CD1 . TYR A 414 ? 1.6394 2.4525 1.6000 -0.0706 0.1700  -0.1113 485 TYR A CD1 
6327 C CD2 . TYR A 414 ? 1.6157 2.5293 1.6176 -0.0698 0.1761  -0.1459 485 TYR A CD2 
6328 C CE1 . TYR A 414 ? 1.7270 2.5924 1.6851 -0.0675 0.1747  -0.1266 485 TYR A CE1 
6329 C CE2 . TYR A 414 ? 1.7025 2.6716 1.7029 -0.0663 0.1808  -0.1625 485 TYR A CE2 
6330 C CZ  . TYR A 414 ? 1.7640 2.7080 1.7419 -0.0654 0.1803  -0.1522 485 TYR A CZ  
6331 O OH  . TYR A 414 ? 1.8186 2.8177 1.7941 -0.0617 0.1849  -0.1688 485 TYR A OH  
6341 N N   . LYS A 415 ? 1.3326 2.1142 1.3794 -0.0028 0.1399  -0.1481 486 LYS A N   
6342 C CA  . LYS A 415 ? 1.3611 2.1683 1.4317 0.0292  0.1288  -0.1754 486 LYS A CA  
6343 C C   . LYS A 415 ? 1.2294 1.9743 1.3053 0.0532  0.1135  -0.1714 486 LYS A C   
6344 O O   . LYS A 415 ? 1.1954 1.9424 1.2783 0.0764  0.1039  -0.1855 486 LYS A O   
6345 C CB  . LYS A 415 ? 1.4582 2.3164 1.5547 0.0362  0.1269  -0.1988 486 LYS A CB  
6346 C CG  . LYS A 415 ? 1.4958 2.3186 1.6020 0.0352  0.1219  -0.1910 486 LYS A CG  
6347 C CD  . LYS A 415 ? 1.5094 2.3887 1.6379 0.0360  0.1227  -0.2124 486 LYS A CD  
6348 C CE  . LYS A 415 ? 1.5360 2.4640 1.6541 0.0026  0.1406  -0.2068 486 LYS A CE  
6349 N NZ  . LYS A 415 ? 1.5417 2.5173 1.6810 -0.0001 0.1419  -0.2238 486 LYS A NZ  
6363 N N   . ALA A 416 ? 1.1031 1.7932 1.1750 0.0471  0.1109  -0.1526 487 ALA A N   
6364 C CA  . ALA A 416 ? 0.9578 1.5921 1.0348 0.0671  0.0970  -0.1487 487 ALA A CA  
6365 C C   . ALA A 416 ? 0.8430 1.4464 0.9034 0.0705  0.0957  -0.1382 487 ALA A C   
6366 O O   . ALA A 416 ? 0.7682 1.3577 0.8361 0.0927  0.0840  -0.1479 487 ALA A O   
6367 C CB  . ALA A 416 ? 0.9420 1.5304 1.0173 0.0574  0.0962  -0.1312 487 ALA A CB  
6373 N N   . SER A 417 ? 0.8645 1.4550 0.9012 0.0487  0.1062  -0.1185 488 SER A N   
6374 C CA  . SER A 417 ? 0.9302 1.4892 0.9503 0.0521  0.1042  -0.1083 488 SER A CA  
6375 C C   . SER A 417 ? 0.9624 1.5607 0.9843 0.0646  0.1034  -0.1255 488 SER A C   
6376 O O   . SER A 417 ? 0.9280 1.5033 0.9472 0.0795  0.0959  -0.1263 488 SER A O   
6377 C CB  . SER A 417 ? 1.0005 1.5354 0.9925 0.0262  0.1136  -0.0842 488 SER A CB  
6378 O OG  . SER A 417 ? 1.0646 1.6426 1.0464 0.0036  0.1255  -0.0837 488 SER A OG  
6384 N N   . LEU A 418 ? 0.9736 1.6332 1.0003 0.0588  0.1108  -0.1403 489 LEU A N   
6385 C CA  . LEU A 418 ? 1.0185 1.7218 1.0477 0.0712  0.1102  -0.1591 489 LEU A CA  
6386 C C   . LEU A 418 ? 0.9465 1.6513 0.9996 0.1039  0.0940  -0.1816 489 LEU A C   
6387 O O   . LEU A 418 ? 0.8988 1.6069 0.9517 0.1207  0.0872  -0.1916 489 LEU A O   
6388 C CB  . LEU A 418 ? 1.1129 1.8863 1.1418 0.0551  0.1228  -0.1703 489 LEU A CB  
6389 C CG  . LEU A 418 ? 1.1964 2.0221 1.2231 0.0621  0.1255  -0.1879 489 LEU A CG  
6390 C CD1 . LEU A 418 ? 1.2582 2.1295 1.2658 0.0307  0.1428  -0.1816 489 LEU A CD1 
6391 C CD2 . LEU A 418 ? 1.1957 2.0672 1.2519 0.0905  0.1152  -0.2212 489 LEU A CD2 
6403 N N   . ASN A 419 ? 1.0052 1.7050 1.0776 0.1132  0.0861  -0.1897 490 ASN A N   
6404 C CA  . ASN A 419 ? 1.0369 1.7261 1.1282 0.1430  0.0674  -0.2084 490 ASN A CA  
6405 C C   . ASN A 419 ? 1.0507 1.6785 1.1341 0.1529  0.0574  -0.1958 490 ASN A C   
6406 O O   . ASN A 419 ? 1.0535 1.6790 1.1423 0.1744  0.0447  -0.2095 490 ASN A O   
6407 C CB  . ASN A 419 ? 1.0737 1.7596 1.1824 0.1477  0.0605  -0.2152 490 ASN A CB  
6408 C CG  . ASN A 419 ? 1.1170 1.7756 1.2399 0.1758  0.0385  -0.2295 490 ASN A CG  
6409 O OD1 . ASN A 419 ? 1.1560 1.8490 1.2932 0.1968  0.0273  -0.2558 490 ASN A OD1 
6410 N ND2 . ASN A 419 ? 1.1125 1.7091 1.2304 0.1760  0.0313  -0.2126 490 ASN A ND2 
6417 N N   . LEU A 420 ? 1.0176 1.5967 1.0883 0.1374  0.0622  -0.1707 491 LEU A N   
6418 C CA  . LEU A 420 ? 0.9539 1.4782 1.0182 0.1453  0.0533  -0.1592 491 LEU A CA  
6419 C C   . LEU A 420 ? 0.9039 1.4323 0.9553 0.1485  0.0552  -0.1587 491 LEU A C   
6420 O O   . LEU A 420 ? 0.9119 1.4182 0.9658 0.1654  0.0432  -0.1637 491 LEU A O   
6421 C CB  . LEU A 420 ? 0.8831 1.3614 0.9364 0.1279  0.0589  -0.1343 491 LEU A CB  
6422 C CG  . LEU A 420 ? 0.7951 1.2535 0.8593 0.1261  0.0548  -0.1312 491 LEU A CG  
6423 C CD1 . LEU A 420 ? 0.7685 1.1883 0.8191 0.1074  0.0624  -0.1070 491 LEU A CD1 
6424 C CD2 . LEU A 420 ? 0.7528 1.1851 0.8297 0.1467  0.0370  -0.1408 491 LEU A CD2 
6436 N N   . ILE A 421 ? 0.8555 1.4097 0.8912 0.1309  0.0696  -0.1517 492 ILE A N   
6437 C CA  . ILE A 421 ? 0.8394 1.3960 0.8597 0.1318  0.0720  -0.1495 492 ILE A CA  
6438 C C   . ILE A 421 ? 0.8907 1.4863 0.9228 0.1536  0.0641  -0.1748 492 ILE A C   
6439 O O   . ILE A 421 ? 0.8437 1.4231 0.8732 0.1679  0.0557  -0.1782 492 ILE A O   
6440 C CB  . ILE A 421 ? 0.8331 1.4075 0.8307 0.1054  0.0882  -0.1356 492 ILE A CB  
6441 C CG1 . ILE A 421 ? 0.8839 1.4052 0.8649 0.0887  0.0913  -0.1096 492 ILE A CG1 
6442 C CG2 . ILE A 421 ? 0.7945 1.3917 0.7779 0.1072  0.0913  -0.1403 492 ILE A CG2 
6443 C CD1 . ILE A 421 ? 0.9358 1.4659 0.8933 0.0605  0.1045  -0.0941 492 ILE A CD1 
6455 N N   . GLU A 422 ? 1.0171 1.6660 1.0628 0.1571  0.0658  -0.1943 493 GLU A N   
6456 C CA  . GLU A 422 ? 1.1534 1.8428 1.2109 0.1798  0.0569  -0.2212 493 GLU A CA  
6457 C C   . GLU A 422 ? 1.0961 1.7526 1.1690 0.2066  0.0355  -0.2327 493 GLU A C   
6458 O O   . GLU A 422 ? 1.0806 1.7425 1.1564 0.2266  0.0243  -0.2474 493 GLU A O   
6459 C CB  . GLU A 422 ? 1.3358 2.0941 1.4056 0.1781  0.0630  -0.2417 493 GLU A CB  
6460 C CG  . GLU A 422 ? 1.5045 2.3077 1.5572 0.1523  0.0831  -0.2351 493 GLU A CG  
6461 C CD  . GLU A 422 ? 1.6319 2.5164 1.6979 0.1556  0.0877  -0.2623 493 GLU A CD  
6462 O OE1 . GLU A 422 ? 1.6904 2.5967 1.7791 0.1816  0.0737  -0.2885 493 GLU A OE1 
6463 O OE2 . GLU A 422 ? 1.6619 2.5893 1.7145 0.1317  0.1045  -0.2581 493 GLU A OE2 
6470 N N   . LYS A 423 ? 1.0668 1.6866 1.1476 0.2064  0.0288  -0.2255 494 LYS A N   
6471 C CA  . LYS A 423 ? 1.0437 1.6348 1.1377 0.2296  0.0071  -0.2374 494 LYS A CA  
6472 C C   . LYS A 423 ? 1.0036 1.5372 1.0884 0.2332  -0.0014 -0.2231 494 LYS A C   
6473 O O   . LYS A 423 ? 0.9871 1.5050 1.0775 0.2537  -0.0195 -0.2355 494 LYS A O   
6474 C CB  . LYS A 423 ? 1.0766 1.6557 1.1818 0.2269  0.0030  -0.2367 494 LYS A CB  
6475 C CG  . LYS A 423 ? 1.1271 1.6888 1.2460 0.2510  -0.0210 -0.2545 494 LYS A CG  
6476 C CD  . LYS A 423 ? 1.1756 1.7383 1.3054 0.2480  -0.0234 -0.2571 494 LYS A CD  
6477 C CE  . LYS A 423 ? 1.2337 1.7618 1.3715 0.2685  -0.0491 -0.2686 494 LYS A CE  
6478 N NZ  . LYS A 423 ? 1.2780 1.8308 1.4242 0.2959  -0.0677 -0.2976 494 LYS A NZ  
6492 N N   . TYR A 424 ? 1.0176 1.5201 1.0881 0.2140  0.0103  -0.1982 495 TYR A N   
6493 C CA  . TYR A 424 ? 0.9889 1.4388 1.0526 0.2163  0.0026  -0.1850 495 TYR A CA  
6494 C C   . TYR A 424 ? 1.0391 1.4808 1.0856 0.2073  0.0124  -0.1717 495 TYR A C   
6495 O O   . TYR A 424 ? 0.9767 1.3800 1.0186 0.2107  0.0057  -0.1633 495 TYR A O   
6496 C CB  . TYR A 424 ? 0.9219 1.3299 0.9862 0.2050  0.0025  -0.1681 495 TYR A CB  
6497 C CG  . TYR A 424 ? 0.8821 1.2942 0.9607 0.2108  -0.0061 -0.1783 495 TYR A CG  
6498 C CD1 . TYR A 424 ? 0.8656 1.2576 0.9530 0.2287  -0.0268 -0.1906 495 TYR A CD1 
6499 C CD2 . TYR A 424 ? 0.8754 1.3092 0.9571 0.1979  0.0051  -0.1756 495 TYR A CD2 
6500 C CE1 . TYR A 424 ? 0.8574 1.2498 0.9558 0.2346  -0.0367 -0.2002 495 TYR A CE1 
6501 C CE2 . TYR A 424 ? 0.8693 1.3065 0.9641 0.2040  -0.0035 -0.1856 495 TYR A CE2 
6502 C CZ  . TYR A 424 ? 0.8579 1.2739 0.9607 0.2228  -0.0246 -0.1980 495 TYR A CZ  
6503 O OH  . TYR A 424 ? 0.8516 1.2680 0.9652 0.2293  -0.0348 -0.2080 495 TYR A OH  
6513 N N   . PHE A 425 ? 1.0664 1.5428 1.1023 0.1955  0.0271  -0.1697 496 PHE A N   
6514 C CA  . PHE A 425 ? 1.1777 1.6435 1.1938 0.1853  0.0358  -0.1557 496 PHE A CA  
6515 C C   . PHE A 425 ? 1.2673 1.7789 1.2770 0.1896  0.0403  -0.1688 496 PHE A C   
6516 O O   . PHE A 425 ? 1.3294 1.8572 1.3214 0.1729  0.0535  -0.1595 496 PHE A O   
6517 C CB  . PHE A 425 ? 1.1546 1.6064 1.1561 0.1606  0.0497  -0.1341 496 PHE A CB  
6518 C CG  . PHE A 425 ? 1.1030 1.5124 1.1097 0.1561  0.0461  -0.1216 496 PHE A CG  
6519 C CD1 . PHE A 425 ? 1.0643 1.4809 1.0842 0.1535  0.0459  -0.1249 496 PHE A CD1 
6520 C CD2 . PHE A 425 ? 1.0781 1.4429 1.0768 0.1545  0.0430  -0.1075 496 PHE A CD2 
6521 C CE1 . PHE A 425 ? 1.0203 1.3989 1.0441 0.1489  0.0427  -0.1134 496 PHE A CE1 
6522 C CE2 . PHE A 425 ? 1.0353 1.3655 1.0389 0.1500  0.0402  -0.0972 496 PHE A CE2 
6523 C CZ  . PHE A 425 ? 1.0076 1.3443 1.0232 0.1469  0.0402  -0.0997 496 PHE A CZ  
6533 N N   . SER A 426 ? 1.3357 1.8676 1.3584 0.2119  0.0281  -0.1907 497 SER A N   
6534 C CA  . SER A 426 ? 1.3950 1.9765 1.4148 0.2191  0.0309  -0.2075 497 SER A CA  
6535 C C   . SER A 426 ? 1.5140 2.0798 1.5324 0.2383  0.0183  -0.2151 497 SER A C   
6536 O O   . SER A 426 ? 1.4946 2.0146 1.5172 0.2474  0.0058  -0.2103 497 SER A O   
6537 C CB  . SER A 426 ? 1.3683 2.0008 1.4064 0.2303  0.0273  -0.2322 497 SER A CB  
6538 O OG  . SER A 426 ? 1.3506 2.0053 1.3889 0.2106  0.0407  -0.2259 497 SER A OG  
6544 N N   . VAL A 427 ? 1.6682 2.2750 1.6803 0.2436  0.0218  -0.2277 498 VAL A N   
6545 C CA  . VAL A 427 ? 1.7043 2.3032 1.7136 0.2616  0.0110  -0.2364 498 VAL A CA  
6546 C C   . VAL A 427 ? 1.7131 2.2644 1.7044 0.2506  0.0146  -0.2130 498 VAL A C   
6547 O O   . VAL A 427 ? 1.6910 2.2297 1.6683 0.2284  0.0278  -0.1930 498 VAL A O   
6548 C CB  . VAL A 427 ? 1.6664 2.2481 1.6948 0.2881  -0.0118 -0.2542 498 VAL A CB  
6549 C CG1 . VAL A 427 ? 1.6420 2.2302 1.6685 0.3082  -0.0232 -0.2689 498 VAL A CG1 
6550 C CG2 . VAL A 427 ? 1.6624 2.2804 1.7091 0.2979  -0.0174 -0.2749 498 VAL A CG2 
6560 N N   . THR B 1   ? 1.0586 1.3466 1.2483 -0.2466 0.0616  -0.0523 13  THR B N   
6561 C CA  . THR B 1   ? 1.1213 1.3357 1.2806 -0.2686 0.0776  -0.0642 13  THR B CA  
6562 C C   . THR B 1   ? 1.2137 1.3754 1.3127 -0.2425 0.0655  -0.0597 13  THR B C   
6563 O O   . THR B 1   ? 1.2835 1.3791 1.3525 -0.2561 0.0782  -0.0674 13  THR B O   
6564 C CB  . THR B 1   ? 1.0692 1.2876 1.2118 -0.2999 0.0707  -0.0929 13  THR B CB  
6565 O OG1 . THR B 1   ? 1.0446 1.1908 1.1680 -0.3266 0.0941  -0.1043 13  THR B OG1 
6566 C CG2 . THR B 1   ? 1.0783 1.3194 1.1687 -0.2817 0.0322  -0.1042 13  THR B CG2 
6573 N N   . ASN B 2   ? 1.2672 1.4569 1.3483 -0.2057 0.0419  -0.0482 14  ASN B N   
6574 C CA  . ASN B 2   ? 1.1994 1.3408 1.2255 -0.1792 0.0309  -0.0428 14  ASN B CA  
6575 C C   . ASN B 2   ? 1.0683 1.1603 1.1060 -0.1756 0.0569  -0.0229 14  ASN B C   
6576 O O   . ASN B 2   ? 0.9720 1.0889 1.0587 -0.1760 0.0729  -0.0054 14  ASN B O   
6577 C CB  . ASN B 2   ? 1.3010 1.4865 1.3083 -0.1411 0.0008  -0.0359 14  ASN B CB  
6578 C CG  . ASN B 2   ? 1.3888 1.5428 1.3299 -0.1236 -0.0233 -0.0455 14  ASN B CG  
6579 O OD1 . ASN B 2   ? 1.4008 1.4876 1.3047 -0.1238 -0.0153 -0.0459 14  ASN B OD1 
6580 N ND2 . ASN B 2   ? 1.4329 1.6364 1.3612 -0.1087 -0.0527 -0.0523 14  ASN B ND2 
6587 N N   . LYS B 3   ? 1.0117 1.0337 1.0049 -0.1735 0.0615  -0.0248 15  LYS B N   
6588 C CA  . LYS B 3   ? 0.8949 0.8675 0.8982 -0.1710 0.0858  -0.0051 15  LYS B CA  
6589 C C   . LYS B 3   ? 0.7266 0.7235 0.7333 -0.1371 0.0768  0.0177  15  LYS B C   
6590 O O   . LYS B 3   ? 0.6429 0.6452 0.6904 -0.1389 0.0961  0.0385  15  LYS B O   
6591 C CB  . LYS B 3   ? 0.9476 0.8405 0.9001 -0.1746 0.0911  -0.0128 15  LYS B CB  
6592 C CG  . LYS B 3   ? 1.0107 0.8932 0.8979 -0.1499 0.0603  -0.0231 15  LYS B CG  
6593 C CD  . LYS B 3   ? 1.0502 0.8546 0.8921 -0.1406 0.0670  -0.0185 15  LYS B CD  
6594 C CE  . LYS B 3   ? 1.0735 0.8703 0.8527 -0.1131 0.0360  -0.0263 15  LYS B CE  
6595 N NZ  . LYS B 3   ? 1.0658 0.8108 0.8109 -0.0877 0.0370  -0.0116 15  LYS B NZ  
6609 N N   . LYS B 4   ? 0.7397 0.7555 0.7066 -0.1073 0.0481  0.0143  16  LYS B N   
6610 C CA  . LYS B 4   ? 0.7149 0.7453 0.6751 -0.0744 0.0396  0.0330  16  LYS B CA  
6611 C C   . LYS B 4   ? 0.7549 0.8525 0.7139 -0.0523 0.0129  0.0282  16  LYS B C   
6612 O O   . LYS B 4   ? 0.7751 0.8959 0.7206 -0.0558 -0.0053 0.0102  16  LYS B O   
6613 C CB  . LYS B 4   ? 0.6784 0.6443 0.5833 -0.0555 0.0355  0.0367  16  LYS B CB  
6614 C CG  . LYS B 4   ? 0.6486 0.5512 0.5612 -0.0719 0.0638  0.0485  16  LYS B CG  
6615 C CD  . LYS B 4   ? 0.6565 0.4924 0.5110 -0.0562 0.0586  0.0481  16  LYS B CD  
6616 C CE  . LYS B 4   ? 0.6771 0.4462 0.5366 -0.0755 0.0860  0.0559  16  LYS B CE  
6617 N NZ  . LYS B 4   ? 0.7362 0.4398 0.5348 -0.0609 0.0789  0.0521  16  LYS B NZ  
6631 N N   . MET B 5   ? 0.7145 0.8427 0.6879 -0.0297 0.0115  0.0453  17  MET B N   
6632 C CA  . MET B 5   ? 0.7430 0.9395 0.7282 -0.0090 -0.0076 0.0448  17  MET B CA  
6633 C C   . MET B 5   ? 0.6276 0.8189 0.5896 0.0239  -0.0133 0.0591  17  MET B C   
6634 O O   . MET B 5   ? 0.5813 0.7661 0.5621 0.0240  0.0037  0.0773  17  MET B O   
6635 C CB  . MET B 5   ? 0.8670 1.1227 0.9157 -0.0251 0.0045  0.0514  17  MET B CB  
6636 C CG  . MET B 5   ? 1.0852 1.3855 1.1598 -0.0444 -0.0026 0.0350  17  MET B CG  
6637 S SD  . MET B 5   ? 1.2440 1.5893 1.3953 -0.0721 0.0222  0.0450  17  MET B SD  
6638 C CE  . MET B 5   ? 1.1553 1.5435 1.3288 -0.0460 0.0238  0.0679  17  MET B CE  
6648 N N   . ARG B 6   ? 0.6253 0.8226 0.5493 0.0507  -0.0364 0.0517  18  ARG B N   
6649 C CA  . ARG B 6   ? 0.6274 0.8313 0.5343 0.0826  -0.0422 0.0629  18  ARG B CA  
6650 C C   . ARG B 6   ? 0.5793 0.8578 0.5277 0.0909  -0.0447 0.0678  18  ARG B C   
6651 O O   . ARG B 6   ? 0.5689 0.8960 0.5481 0.0795  -0.0509 0.0590  18  ARG B O   
6652 C CB  . ARG B 6   ? 0.7399 0.9202 0.5928 0.1079  -0.0645 0.0531  18  ARG B CB  
6653 C CG  . ARG B 6   ? 0.8537 1.0651 0.6946 0.1434  -0.0785 0.0570  18  ARG B CG  
6654 C CD  . ARG B 6   ? 1.0501 1.2399 0.8422 0.1655  -0.1012 0.0466  18  ARG B CD  
6655 N NE  . ARG B 6   ? 1.2841 1.4024 1.0359 0.1558  -0.0980 0.0427  18  ARG B NE  
6656 C CZ  . ARG B 6   ? 1.5277 1.6265 1.2715 0.1325  -0.1010 0.0305  18  ARG B CZ  
6657 N NH1 . ARG B 6   ? 1.6120 1.7584 1.3842 0.1157  -0.1086 0.0205  18  ARG B NH1 
6658 N NH2 . ARG B 6   ? 1.6277 1.6584 1.3340 0.1249  -0.0957 0.0277  18  ARG B NH2 
6672 N N   . ARG B 7   ? 0.5551 0.8426 0.5044 0.1092  -0.0390 0.0819  19  ARG B N   
6673 C CA  . ARG B 7   ? 0.5552 0.9109 0.5374 0.1208  -0.0419 0.0856  19  ARG B CA  
6674 C C   . ARG B 7   ? 0.5748 0.9432 0.5262 0.1557  -0.0604 0.0807  19  ARG B C   
6675 O O   . ARG B 7   ? 0.5945 0.9270 0.5105 0.1748  -0.0592 0.0867  19  ARG B O   
6676 C CB  . ARG B 7   ? 0.5136 0.8806 0.5233 0.1149  -0.0215 0.1046  19  ARG B CB  
6677 C CG  . ARG B 7   ? 0.5025 0.9407 0.5455 0.1257  -0.0237 0.1071  19  ARG B CG  
6678 C CD  . ARG B 7   ? 0.4823 0.9397 0.5569 0.1156  -0.0036 0.1260  19  ARG B CD  
6679 N NE  . ARG B 7   ? 0.4831 1.0031 0.5797 0.1300  -0.0066 0.1267  19  ARG B NE  
6680 C CZ  . ARG B 7   ? 0.4874 1.0417 0.6156 0.1228  0.0080  0.1409  19  ARG B CZ  
6681 N NH1 . ARG B 7   ? 0.5032 1.1126 0.6488 0.1365  0.0050  0.1392  19  ARG B NH1 
6682 N NH2 . ARG B 7   ? 0.4665 1.0003 0.6096 0.1016  0.0260  0.1576  19  ARG B NH2 
6696 N N   . ASN B 8   ? 0.6061 1.0272 0.5742 0.1637  -0.0762 0.0708  20  ASN B N   
6697 C CA  . ASN B 8   ? 0.7070 1.1423 0.6509 0.1959  -0.0947 0.0655  20  ASN B CA  
6698 C C   . ASN B 8   ? 0.7265 1.2103 0.6940 0.2143  -0.0895 0.0729  20  ASN B C   
6699 O O   . ASN B 8   ? 0.6233 1.1444 0.6319 0.2004  -0.0759 0.0799  20  ASN B O   
6700 C CB  . ASN B 8   ? 0.8645 1.3308 0.8138 0.1945  -0.1160 0.0521  20  ASN B CB  
6701 C CG  . ASN B 8   ? 1.0431 1.4556 0.9496 0.1881  -0.1270 0.0429  20  ASN B CG  
6702 O OD1 . ASN B 8   ? 1.1170 1.4795 0.9786 0.2053  -0.1304 0.0441  20  ASN B OD1 
6703 N ND2 . ASN B 8   ? 1.1105 1.5332 1.0300 0.1625  -0.1323 0.0330  20  ASN B ND2 
6710 N N   . ARG B 9   ? 0.8956 1.3781 0.8369 0.2456  -0.0996 0.0712  21  ARG B N   
6711 C CA  . ARG B 9   ? 1.0615 1.5894 1.0231 0.2644  -0.0945 0.0759  21  ARG B CA  
6712 C C   . ARG B 9   ? 1.1590 1.7598 1.1709 0.2591  -0.1003 0.0719  21  ARG B C   
6713 O O   . ARG B 9   ? 1.2247 1.8428 1.2462 0.2514  -0.1155 0.0635  21  ARG B O   
6714 C CB  . ARG B 9   ? 1.1338 1.6461 1.0598 0.2994  -0.1044 0.0731  21  ARG B CB  
6715 C CG  . ARG B 9   ? 1.1970 1.6443 1.0767 0.3077  -0.0952 0.0786  21  ARG B CG  
6716 C CD  . ARG B 9   ? 1.2376 1.6894 1.1279 0.3015  -0.0732 0.0900  21  ARG B CD  
6717 N NE  . ARG B 9   ? 1.2728 1.7713 1.1829 0.3182  -0.0681 0.0890  21  ARG B NE  
6718 C CZ  . ARG B 9   ? 1.2604 1.8202 1.2163 0.3102  -0.0610 0.0928  21  ARG B CZ  
6719 N NH1 . ARG B 9   ? 1.2880 1.8832 1.2561 0.3270  -0.0555 0.0908  21  ARG B NH1 
6720 N NH2 . ARG B 9   ? 1.2133 1.7922 1.2031 0.2813  -0.0557 0.0968  21  ARG B NH2 
6734 N N   . PHE B 10  ? 1.0772 1.7212 1.1208 0.2617  -0.0875 0.0782  22  PHE B N   
6735 C CA  . PHE B 10  ? 1.1553 1.8711 1.2468 0.2615  -0.0920 0.0752  22  PHE B CA  
6736 C C   . PHE B 10  ? 1.2754 2.0122 1.3594 0.2899  -0.1115 0.0679  22  PHE B C   
6737 O O   . PHE B 10  ? 1.2461 1.9629 1.3049 0.3140  -0.1089 0.0679  22  PHE B O   
6738 C CB  . PHE B 10  ? 1.1584 1.9107 1.2788 0.2616  -0.0732 0.0838  22  PHE B CB  
6739 C CG  . PHE B 10  ? 1.1878 2.0135 1.3629 0.2557  -0.0741 0.0820  22  PHE B CG  
6740 C CD1 . PHE B 10  ? 1.1729 2.0222 1.3860 0.2255  -0.0665 0.0849  22  PHE B CD1 
6741 C CD2 . PHE B 10  ? 1.2237 2.0858 1.4106 0.2776  -0.0801 0.0772  22  PHE B CD2 
6742 C CE1 . PHE B 10  ? 1.1604 2.0770 1.4239 0.2198  -0.0672 0.0833  22  PHE B CE1 
6743 C CE2 . PHE B 10  ? 1.2181 2.1329 1.4498 0.2680  -0.0787 0.0749  22  PHE B CE2 
6744 C CZ  . PHE B 10  ? 1.1812 2.1263 1.4514 0.2404  -0.0733 0.0780  22  PHE B CZ  
6754 N N   . LYS B 11  ? 1.4394 2.2080 1.5435 0.2829  -0.1284 0.0610  23  LYS B N   
6755 C CA  . LYS B 11  ? 1.5666 2.3481 1.6660 0.3027  -0.1453 0.0552  23  LYS B CA  
6756 C C   . LYS B 11  ? 1.6831 2.5235 1.8287 0.3046  -0.1413 0.0550  23  LYS B C   
6757 O O   . LYS B 11  ? 1.7038 2.5453 1.8469 0.3245  -0.1390 0.0544  23  LYS B O   
6758 C CB  . LYS B 11  ? 1.5129 2.2899 1.6008 0.2929  -0.1681 0.0486  23  LYS B CB  
6759 C CG  . LYS B 11  ? 1.4180 2.1261 1.4522 0.2932  -0.1725 0.0472  23  LYS B CG  
6760 C CD  . LYS B 11  ? 1.3028 1.9852 1.3341 0.2573  -0.1697 0.0425  23  LYS B CD  
6761 C CE  . LYS B 11  ? 1.2202 1.8247 1.1977 0.2553  -0.1685 0.0412  23  LYS B CE  
6762 N NZ  . LYS B 11  ? 1.1685 1.7460 1.1421 0.2210  -0.1661 0.0351  23  LYS B NZ  
6763 O OXT . LYS B 11  ? 1.7324 2.6189 1.9194 0.2855  -0.1388 0.0557  23  LYS B OXT 
6777 N N   . THR C 1   ? 1.3523 2.1346 1.4465 0.0290  0.0773  -0.0144 9   THR C N   
6778 C CA  . THR C 1   ? 1.3771 2.1331 1.4742 0.0332  0.0939  -0.0267 9   THR C CA  
6779 C C   . THR C 1   ? 1.4692 2.2171 1.6051 0.0330  0.0959  -0.0251 9   THR C C   
6780 O O   . THR C 1   ? 1.4486 2.2109 1.6082 0.0294  0.0843  -0.0149 9   THR C O   
6781 C CB  . THR C 1   ? 1.3220 2.0549 1.4033 0.0268  0.1015  -0.0425 9   THR C CB  
6782 O OG1 . THR C 1   ? 1.2969 2.0041 1.3823 0.0310  0.1178  -0.0543 9   THR C OG1 
6783 C CG2 . THR C 1   ? 1.3043 2.0342 1.4034 0.0148  0.0928  -0.0441 9   THR C CG2 
6790 N N   . ASN C 2   ? 1.6106 2.3354 1.7525 0.0372  0.1107  -0.0352 10  ASN C N   
6791 C CA  . ASN C 2   ? 1.5253 2.2391 1.7028 0.0374  0.1146  -0.0355 10  ASN C CA  
6792 C C   . ASN C 2   ? 1.5752 2.2647 1.7657 0.0292  0.1201  -0.0481 10  ASN C C   
6793 O O   . ASN C 2   ? 1.6451 2.3292 1.8680 0.0260  0.1187  -0.0468 10  ASN C O   
6794 C CB  . ASN C 2   ? 1.3255 2.0307 1.5034 0.0483  0.1276  -0.0373 10  ASN C CB  
6795 C CG  . ASN C 2   ? 1.1001 1.8112 1.3121 0.0516  0.1254  -0.0281 10  ASN C CG  
6796 O OD1 . ASN C 2   ? 1.0353 1.7429 1.2765 0.0454  0.1209  -0.0271 10  ASN C OD1 
6797 N ND2 . ASN C 2   ? 0.9964 1.7163 1.2047 0.0616  0.1286  -0.0214 10  ASN C ND2 
6804 N N   . LYS C 3   ? 1.3986 2.0737 1.5646 0.0257  0.1260  -0.0600 11  LYS C N   
6805 C CA  . LYS C 3   ? 1.2138 1.8647 1.3893 0.0182  0.1319  -0.0728 11  LYS C CA  
6806 C C   . LYS C 3   ? 1.2205 1.8791 1.4037 0.0069  0.1185  -0.0701 11  LYS C C   
6807 O O   . LYS C 3   ? 1.3510 2.0292 1.5179 0.0041  0.1072  -0.0630 11  LYS C O   
6808 C CB  . LYS C 3   ? 0.9686 1.5998 1.1140 0.0195  0.1446  -0.0871 11  LYS C CB  
6809 C CG  . LYS C 3   ? 0.7063 1.3314 0.8399 0.0308  0.1574  -0.0896 11  LYS C CG  
6810 C CD  . LYS C 3   ? 0.5479 1.1475 0.6618 0.0316  0.1721  -0.1055 11  LYS C CD  
6811 C CE  . LYS C 3   ? 0.4838 1.0755 0.5930 0.0425  0.1851  -0.1079 11  LYS C CE  
6812 N NZ  . LYS C 3   ? 0.5068 1.0700 0.6049 0.0429  0.2007  -0.1241 11  LYS C NZ  
6826 N N   . LYS C 4   ? 1.1034 1.7462 1.3119 0.0003  0.1201  -0.0758 12  LYS C N   
6827 C CA  . LYS C 4   ? 0.9718 1.6185 1.1912 -0.0109 0.1086  -0.0745 12  LYS C CA  
6828 C C   . LYS C 4   ? 1.0728 1.6944 1.2815 -0.0175 0.1164  -0.0901 12  LYS C C   
6829 O O   . LYS C 4   ? 1.0247 1.6226 1.2455 -0.0166 0.1285  -0.1001 12  LYS C O   
6830 C CB  . LYS C 4   ? 0.8107 1.4606 1.0702 -0.0136 0.1028  -0.0675 12  LYS C CB  
6831 C CG  . LYS C 4   ? 0.7295 1.3817 1.0025 -0.0254 0.0913  -0.0666 12  LYS C CG  
6832 C CD  . LYS C 4   ? 0.6558 1.3063 0.9693 -0.0281 0.0880  -0.0619 12  LYS C CD  
6833 C CE  . LYS C 4   ? 0.6255 1.2462 0.9540 -0.0284 0.1022  -0.0750 12  LYS C CE  
6834 N NZ  . LYS C 4   ? 0.5880 1.2075 0.9517 -0.0244 0.1045  -0.0696 12  LYS C NZ  
6848 N N   . MET C 5   ? 1.2918 1.9186 1.4778 -0.0240 0.1095  -0.0919 13  MET C N   
6849 C CA  . MET C 5   ? 1.4335 2.0384 1.6092 -0.0317 0.1148  -0.1058 13  MET C CA  
6850 C C   . MET C 5   ? 1.5450 2.1461 1.7468 -0.0423 0.1067  -0.1057 13  MET C C   
6851 O O   . MET C 5   ? 1.4778 2.0555 1.6837 -0.0477 0.1137  -0.1177 13  MET C O   
6852 C CB  . MET C 5   ? 1.4923 2.1047 1.6307 -0.0340 0.1109  -0.1078 13  MET C CB  
6853 C CG  . MET C 5   ? 1.5786 2.2169 1.7161 -0.0402 0.0930  -0.0959 13  MET C CG  
6854 S SD  . MET C 5   ? 1.6843 2.3382 1.7788 -0.0410 0.0867  -0.0944 13  MET C SD  
6855 C CE  . MET C 5   ? 1.6366 2.3115 1.7205 -0.0280 0.0873  -0.0830 13  MET C CE  
6865 N N   . ARG C 6   ? 1.5897 2.2134 1.8092 -0.0452 0.0921  -0.0923 14  ARG C N   
6866 C CA  . ARG C 6   ? 1.6594 2.2839 1.8990 -0.0561 0.0818  -0.0908 14  ARG C CA  
6867 C C   . ARG C 6   ? 1.6402 2.2587 1.9195 -0.0560 0.0828  -0.0880 14  ARG C C   
6868 O O   . ARG C 6   ? 1.6329 2.2694 1.9345 -0.0578 0.0712  -0.0761 14  ARG C O   
6869 C CB  . ARG C 6   ? 1.6302 2.2833 1.8632 -0.0602 0.0644  -0.0780 14  ARG C CB  
6870 C CG  . ARG C 6   ? 1.6301 2.2864 1.8282 -0.0646 0.0609  -0.0820 14  ARG C CG  
6871 C CD  . ARG C 6   ? 1.6644 2.2994 1.8602 -0.0747 0.0633  -0.0945 14  ARG C CD  
6872 N NE  . ARG C 6   ? 1.7221 2.3551 1.8814 -0.0771 0.0641  -0.1011 14  ARG C NE  
6873 C CZ  . ARG C 6   ? 1.7740 2.4276 1.9154 -0.0810 0.0516  -0.0938 14  ARG C CZ  
6874 N NH1 . ARG C 6   ? 1.7771 2.4554 1.9337 -0.0828 0.0372  -0.0796 14  ARG C NH1 
6875 N NH2 . ARG C 6   ? 1.8116 2.4615 1.9199 -0.0830 0.0536  -0.1007 14  ARG C NH2 
6889 N N   . ARG C 7   ? 1.5086 2.1012 1.7965 -0.0539 0.0972  -0.0994 15  ARG C N   
6890 C CA  . ARG C 7   ? 1.3886 1.9711 1.7138 -0.0556 0.0991  -0.0993 15  ARG C CA  
6891 C C   . ARG C 7   ? 1.4627 2.0434 1.8033 -0.0674 0.0894  -0.0999 15  ARG C C   
6892 O O   . ARG C 7   ? 1.5633 2.1500 1.9351 -0.0702 0.0825  -0.0928 15  ARG C O   
6893 C CB  . ARG C 7   ? 1.1760 1.7300 1.5044 -0.0513 0.1170  -0.1125 15  ARG C CB  
6894 C CG  . ARG C 7   ? 1.0257 1.5570 1.3322 -0.0563 0.1251  -0.1277 15  ARG C CG  
6895 C CD  . ARG C 7   ? 0.9472 1.4501 1.2589 -0.0520 0.1428  -0.1404 15  ARG C CD  
6896 N NE  . ARG C 7   ? 0.9570 1.4364 1.2740 -0.0605 0.1471  -0.1525 15  ARG C NE  
6897 C CZ  . ARG C 7   ? 1.0057 1.4686 1.2967 -0.0639 0.1535  -0.1648 15  ARG C CZ  
6898 N NH1 . ARG C 7   ? 1.0310 1.4980 1.2882 -0.0595 0.1567  -0.1671 15  ARG C NH1 
6899 N NH2 . ARG C 7   ? 1.0322 1.4741 1.3314 -0.0717 0.1569  -0.1750 15  ARG C NH2 
6913 N N   . ASN C 8   ? 1.4367 2.0093 1.7553 -0.0747 0.0883  -0.1081 16  ASN C N   
6914 C CA  . ASN C 8   ? 1.3660 1.9347 1.6976 -0.0863 0.0798  -0.1098 16  ASN C CA  
6915 C C   . ASN C 8   ? 1.4115 2.0085 1.7540 -0.0904 0.0617  -0.0948 16  ASN C C   
6916 O O   . ASN C 8   ? 1.3826 1.9817 1.7544 -0.0959 0.0547  -0.0904 16  ASN C O   
6917 C CB  . ASN C 8   ? 1.2922 1.8469 1.5952 -0.0927 0.0826  -0.1216 16  ASN C CB  
6918 C CG  . ASN C 8   ? 1.2401 1.7874 1.5560 -0.1049 0.0753  -0.1250 16  ASN C CG  
6919 O OD1 . ASN C 8   ? 1.2735 1.8262 1.6198 -0.1086 0.0681  -0.1184 16  ASN C OD1 
6920 N ND2 . ASN C 8   ? 1.1809 1.7153 1.4735 -0.1111 0.0774  -0.1353 16  ASN C ND2 
6927 N N   . ARG C 9   ? 1.5483 2.1676 1.8677 -0.0878 0.0540  -0.0867 17  ARG C N   
6928 C CA  . ARG C 9   ? 1.5724 2.2198 1.9018 -0.0908 0.0370  -0.0716 17  ARG C CA  
6929 C C   . ARG C 9   ? 1.6776 2.3353 2.0390 -0.0853 0.0349  -0.0611 17  ARG C C   
6930 O O   . ARG C 9   ? 1.5502 2.2208 1.9353 -0.0904 0.0231  -0.0520 17  ARG C O   
6931 C CB  . ARG C 9   ? 1.5625 2.2315 1.8604 -0.0876 0.0305  -0.0648 17  ARG C CB  
6932 C CG  . ARG C 9   ? 1.5761 2.2432 1.8452 -0.0953 0.0266  -0.0711 17  ARG C CG  
6933 C CD  . ARG C 9   ? 1.5825 2.2499 1.8672 -0.1074 0.0156  -0.0703 17  ARG C CD  
6934 N NE  . ARG C 9   ? 1.5948 2.2730 1.8543 -0.1144 0.0058  -0.0694 17  ARG C NE  
6935 C CZ  . ARG C 9   ? 1.6048 2.2693 1.8564 -0.1241 0.0048  -0.0785 17  ARG C CZ  
6936 N NH1 . ARG C 9   ? 1.6564 2.2952 1.9230 -0.1283 0.0131  -0.0896 17  ARG C NH1 
6937 N NH2 . ARG C 9   ? 1.5618 2.2387 1.7903 -0.1299 -0.0048 -0.0763 17  ARG C NH2 
6951 N N   . PHE C 10  ? 1.8655 2.5175 2.2281 -0.0751 0.0462  -0.0623 18  PHE C N   
6952 C CA  . PHE C 10  ? 1.8349 2.4944 2.2280 -0.0697 0.0453  -0.0532 18  PHE C CA  
6953 C C   . PHE C 10  ? 1.7914 2.4379 2.2191 -0.0763 0.0448  -0.0557 18  PHE C C   
6954 O O   . PHE C 10  ? 1.8335 2.4942 2.2881 -0.0776 0.0353  -0.0450 18  PHE C O   
6955 C CB  . PHE C 10  ? 1.7331 2.3835 2.1211 -0.0584 0.0596  -0.0566 18  PHE C CB  
6956 C CG  . PHE C 10  ? 1.5834 2.2408 2.0014 -0.0523 0.0596  -0.0476 18  PHE C CG  
6957 C CD1 . PHE C 10  ? 1.5047 2.1891 1.9260 -0.0480 0.0493  -0.0327 18  PHE C CD1 
6958 C CD2 . PHE C 10  ? 1.5031 2.1401 1.9458 -0.0509 0.0701  -0.0541 18  PHE C CD2 
6959 C CE1 . PHE C 10  ? 1.4253 2.1161 1.8740 -0.0425 0.0492  -0.0243 18  PHE C CE1 
6960 C CE2 . PHE C 10  ? 1.4219 2.0653 1.8923 -0.0454 0.0701  -0.0457 18  PHE C CE2 
6961 C CZ  . PHE C 10  ? 1.3884 2.0588 1.8618 -0.0412 0.0596  -0.0309 18  PHE C CZ  
6971 N N   . LYS C 11  ? 1.6414 2.2611 2.0689 -0.0804 0.0548  -0.0699 19  LYS C N   
6972 C CA  . LYS C 11  ? 1.4555 2.0614 1.9127 -0.0879 0.0541  -0.0736 19  LYS C CA  
6973 C C   . LYS C 11  ? 1.4357 2.0420 1.9282 -0.0832 0.0563  -0.0676 19  LYS C C   
6974 O O   . LYS C 11  ? 1.4024 1.9927 1.9202 -0.0873 0.0597  -0.0725 19  LYS C O   
6975 C CB  . LYS C 11  ? 1.3491 1.9691 1.8100 -0.0985 0.0379  -0.0676 19  LYS C CB  
6976 C CG  . LYS C 11  ? 1.2080 1.8244 1.7055 -0.1054 0.0321  -0.0651 19  LYS C CG  
6977 C CD  . LYS C 11  ? 1.0675 1.7027 1.5672 -0.1147 0.0148  -0.0567 19  LYS C CD  
6978 C CE  . LYS C 11  ? 0.9345 1.6012 1.4371 -0.1105 0.0025  -0.0401 19  LYS C CE  
6979 N NZ  . LYS C 11  ? 0.8547 1.5277 1.3931 -0.1072 0.0004  -0.0313 19  LYS C NZ  
6980 O OXT . LYS C 11  ? 1.4444 2.0665 1.9413 -0.0752 0.0548  -0.0578 19  LYS C OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   72  ?   ?   ?   A . n 
A 1 2   THR 2   73  ?   ?   ?   A . n 
A 1 3   VAL 3   74  74  VAL VAL A . n 
A 1 4   ASN 4   75  75  ASN ASN A . n 
A 1 5   TRP 5   76  76  TRP TRP A . n 
A 1 6   SER 6   77  77  SER SER A . n 
A 1 7   VAL 7   78  78  VAL VAL A . n 
A 1 8   GLU 8   79  79  GLU GLU A . n 
A 1 9   ASP 9   80  80  ASP ASP A . n 
A 1 10  ILE 10  81  81  ILE ILE A . n 
A 1 11  VAL 11  82  82  VAL VAL A . n 
A 1 12  LYS 12  83  83  LYS LYS A . n 
A 1 13  GLY 13  84  84  GLY GLY A . n 
A 1 14  ILE 14  85  85  ILE ILE A . n 
A 1 15  ASN 15  86  86  ASN ASN A . n 
A 1 16  SER 16  87  87  SER SER A . n 
A 1 17  ASN 17  88  88  ASN ASN A . n 
A 1 18  ASN 18  89  89  ASN ASN A . n 
A 1 19  LEU 19  90  90  LEU LEU A . n 
A 1 20  GLU 20  91  91  GLU GLU A . n 
A 1 21  SER 21  92  92  SER SER A . n 
A 1 22  GLN 22  93  93  GLN GLN A . n 
A 1 23  LEU 23  94  94  LEU LEU A . n 
A 1 24  GLN 24  95  95  GLN GLN A . n 
A 1 25  ALA 25  96  96  ALA ALA A . n 
A 1 26  THR 26  97  97  THR THR A . n 
A 1 27  GLN 27  98  98  GLN GLN A . n 
A 1 28  ALA 28  99  99  ALA ALA A . n 
A 1 29  ALA 29  100 100 ALA ALA A . n 
A 1 30  ARG 30  101 101 ARG ARG A . n 
A 1 31  LYS 31  102 102 LYS LYS A . n 
A 1 32  LEU 32  103 103 LEU LEU A . n 
A 1 33  LEU 33  104 104 LEU LEU A . n 
A 1 34  SER 34  105 105 SER SER A . n 
A 1 35  ARG 35  106 106 ARG ARG A . n 
A 1 36  GLU 36  107 107 GLU GLU A . n 
A 1 37  LYS 37  108 108 LYS LYS A . n 
A 1 38  GLN 38  109 109 GLN GLN A . n 
A 1 39  PRO 39  110 110 PRO PRO A . n 
A 1 40  PRO 40  111 111 PRO PRO A . n 
A 1 41  ILE 41  112 112 ILE ILE A . n 
A 1 42  ASP 42  113 113 ASP ASP A . n 
A 1 43  ASN 43  114 114 ASN ASN A . n 
A 1 44  ILE 44  115 115 ILE ILE A . n 
A 1 45  ILE 45  116 116 ILE ILE A . n 
A 1 46  ARG 46  117 117 ARG ARG A . n 
A 1 47  ALA 47  118 118 ALA ALA A . n 
A 1 48  GLY 48  119 119 GLY GLY A . n 
A 1 49  LEU 49  120 120 LEU LEU A . n 
A 1 50  ILE 50  121 121 ILE ILE A . n 
A 1 51  PRO 51  122 122 PRO PRO A . n 
A 1 52  LYS 52  123 123 LYS LYS A . n 
A 1 53  PHE 53  124 124 PHE PHE A . n 
A 1 54  VAL 54  125 125 VAL VAL A . n 
A 1 55  SER 55  126 126 SER SER A . n 
A 1 56  PHE 56  127 127 PHE PHE A . n 
A 1 57  LEU 57  128 128 LEU LEU A . n 
A 1 58  GLY 58  129 129 GLY GLY A . n 
A 1 59  LYS 59  130 130 LYS LYS A . n 
A 1 60  THR 60  131 131 THR THR A . n 
A 1 61  ASP 61  132 132 ASP ASP A . n 
A 1 62  CYS 62  133 133 CYS CYS A . n 
A 1 63  SER 63  134 134 SER SER A . n 
A 1 64  PRO 64  135 135 PRO PRO A . n 
A 1 65  ILE 65  136 136 ILE ILE A . n 
A 1 66  GLN 66  137 137 GLN GLN A . n 
A 1 67  PHE 67  138 138 PHE PHE A . n 
A 1 68  GLU 68  139 139 GLU GLU A . n 
A 1 69  SER 69  140 140 SER SER A . n 
A 1 70  ALA 70  141 141 ALA ALA A . n 
A 1 71  TRP 71  142 142 TRP TRP A . n 
A 1 72  ALA 72  143 143 ALA ALA A . n 
A 1 73  LEU 73  144 144 LEU LEU A . n 
A 1 74  THR 74  145 145 THR THR A . n 
A 1 75  ASN 75  146 146 ASN ASN A . n 
A 1 76  ILE 76  147 147 ILE ILE A . n 
A 1 77  ALA 77  148 148 ALA ALA A . n 
A 1 78  SER 78  149 149 SER SER A . n 
A 1 79  GLY 79  150 150 GLY GLY A . n 
A 1 80  THR 80  151 151 THR THR A . n 
A 1 81  SER 81  152 152 SER SER A . n 
A 1 82  GLU 82  153 153 GLU GLU A . n 
A 1 83  GLN 83  154 154 GLN GLN A . n 
A 1 84  THR 84  155 155 THR THR A . n 
A 1 85  LYS 85  156 156 LYS LYS A . n 
A 1 86  ALA 86  157 157 ALA ALA A . n 
A 1 87  VAL 87  158 158 VAL VAL A . n 
A 1 88  VAL 88  159 159 VAL VAL A . n 
A 1 89  ASP 89  160 160 ASP ASP A . n 
A 1 90  GLY 90  161 161 GLY GLY A . n 
A 1 91  GLY 91  162 162 GLY GLY A . n 
A 1 92  ALA 92  163 163 ALA ALA A . n 
A 1 93  ILE 93  164 164 ILE ILE A . n 
A 1 94  PRO 94  165 165 PRO PRO A . n 
A 1 95  ALA 95  166 166 ALA ALA A . n 
A 1 96  PHE 96  167 167 PHE PHE A . n 
A 1 97  ILE 97  168 168 ILE ILE A . n 
A 1 98  SER 98  169 169 SER SER A . n 
A 1 99  LEU 99  170 170 LEU LEU A . n 
A 1 100 LEU 100 171 171 LEU LEU A . n 
A 1 101 ALA 101 172 172 ALA ALA A . n 
A 1 102 SER 102 173 173 SER SER A . n 
A 1 103 PRO 103 174 174 PRO PRO A . n 
A 1 104 HIS 104 175 175 HIS HIS A . n 
A 1 105 ALA 105 176 176 ALA ALA A . n 
A 1 106 HIS 106 177 177 HIS HIS A . n 
A 1 107 ILE 107 178 178 ILE ILE A . n 
A 1 108 SER 108 179 179 SER SER A . n 
A 1 109 GLU 109 180 180 GLU GLU A . n 
A 1 110 GLN 110 181 181 GLN GLN A . n 
A 1 111 ALA 111 182 182 ALA ALA A . n 
A 1 112 VAL 112 183 183 VAL VAL A . n 
A 1 113 TRP 113 184 184 TRP TRP A . n 
A 1 114 ALA 114 185 185 ALA ALA A . n 
A 1 115 LEU 115 186 186 LEU LEU A . n 
A 1 116 GLY 116 187 187 GLY GLY A . n 
A 1 117 ASN 117 188 188 ASN ASN A . n 
A 1 118 ILE 118 189 189 ILE ILE A . n 
A 1 119 ALA 119 190 190 ALA ALA A . n 
A 1 120 GLY 120 191 191 GLY GLY A . n 
A 1 121 ASP 121 192 192 ASP ASP A . n 
A 1 122 GLY 122 193 193 GLY GLY A . n 
A 1 123 SER 123 194 194 SER SER A . n 
A 1 124 ALA 124 195 195 ALA ALA A . n 
A 1 125 PHE 125 196 196 PHE PHE A . n 
A 1 126 ARG 126 197 197 ARG ARG A . n 
A 1 127 ASP 127 198 198 ASP ASP A . n 
A 1 128 LEU 128 199 199 LEU LEU A . n 
A 1 129 VAL 129 200 200 VAL VAL A . n 
A 1 130 ILE 130 201 201 ILE ILE A . n 
A 1 131 LYS 131 202 202 LYS LYS A . n 
A 1 132 HIS 132 203 203 HIS HIS A . n 
A 1 133 GLY 133 204 204 GLY GLY A . n 
A 1 134 ALA 134 205 205 ALA ALA A . n 
A 1 135 ILE 135 206 206 ILE ILE A . n 
A 1 136 ASP 136 207 207 ASP ASP A . n 
A 1 137 PRO 137 208 208 PRO PRO A . n 
A 1 138 LEU 138 209 209 LEU LEU A . n 
A 1 139 LEU 139 210 210 LEU LEU A . n 
A 1 140 ALA 140 211 211 ALA ALA A . n 
A 1 141 LEU 141 212 212 LEU LEU A . n 
A 1 142 LEU 142 213 213 LEU LEU A . n 
A 1 143 ALA 143 214 214 ALA ALA A . n 
A 1 144 VAL 144 215 215 VAL VAL A . n 
A 1 145 PRO 145 216 216 PRO PRO A . n 
A 1 146 ASP 146 217 217 ASP ASP A . n 
A 1 147 LEU 147 218 218 LEU LEU A . n 
A 1 148 SER 148 219 219 SER SER A . n 
A 1 149 THR 149 220 220 THR THR A . n 
A 1 150 LEU 150 221 221 LEU LEU A . n 
A 1 151 ALA 151 222 222 ALA ALA A . n 
A 1 152 CYS 152 223 223 CYS CYS A . n 
A 1 153 GLY 153 224 224 GLY GLY A . n 
A 1 154 TYR 154 225 225 TYR TYR A . n 
A 1 155 LEU 155 226 226 LEU LEU A . n 
A 1 156 ARG 156 227 227 ARG ARG A . n 
A 1 157 ASN 157 228 228 ASN ASN A . n 
A 1 158 LEU 158 229 229 LEU LEU A . n 
A 1 159 THR 159 230 230 THR THR A . n 
A 1 160 TRP 160 231 231 TRP TRP A . n 
A 1 161 THR 161 232 232 THR THR A . n 
A 1 162 LEU 162 233 233 LEU LEU A . n 
A 1 163 SER 163 234 234 SER SER A . n 
A 1 164 ASN 164 235 235 ASN ASN A . n 
A 1 165 LEU 165 236 236 LEU LEU A . n 
A 1 166 CYS 166 237 237 CYS CYS A . n 
A 1 167 ARG 167 238 238 ARG ARG A . n 
A 1 168 ASN 168 239 239 ASN ASN A . n 
A 1 169 LYS 169 240 240 LYS LYS A . n 
A 1 170 ASN 170 241 241 ASN ASN A . n 
A 1 171 PRO 171 242 242 PRO PRO A . n 
A 1 172 ALA 172 243 243 ALA ALA A . n 
A 1 173 PRO 173 244 244 PRO PRO A . n 
A 1 174 PRO 174 245 245 PRO PRO A . n 
A 1 175 LEU 175 246 246 LEU LEU A . n 
A 1 176 ASP 176 247 247 ASP ASP A . n 
A 1 177 ALA 177 248 248 ALA ALA A . n 
A 1 178 VAL 178 249 249 VAL VAL A . n 
A 1 179 GLU 179 250 250 GLU GLU A . n 
A 1 180 GLN 180 251 251 GLN GLN A . n 
A 1 181 ILE 181 252 252 ILE ILE A . n 
A 1 182 LEU 182 253 253 LEU LEU A . n 
A 1 183 PRO 183 254 254 PRO PRO A . n 
A 1 184 THR 184 255 255 THR THR A . n 
A 1 185 LEU 185 256 256 LEU LEU A . n 
A 1 186 VAL 186 257 257 VAL VAL A . n 
A 1 187 ARG 187 258 258 ARG ARG A . n 
A 1 188 LEU 188 259 259 LEU LEU A . n 
A 1 189 LEU 189 260 260 LEU LEU A . n 
A 1 190 HIS 190 261 261 HIS HIS A . n 
A 1 191 HIS 191 262 262 HIS HIS A . n 
A 1 192 ASN 192 263 263 ASN ASN A . n 
A 1 193 ASP 193 264 264 ASP ASP A . n 
A 1 194 PRO 194 265 265 PRO PRO A . n 
A 1 195 GLU 195 266 266 GLU GLU A . n 
A 1 196 VAL 196 267 267 VAL VAL A . n 
A 1 197 LEU 197 268 268 LEU LEU A . n 
A 1 198 ALA 198 269 269 ALA ALA A . n 
A 1 199 ASP 199 270 270 ASP ASP A . n 
A 1 200 SER 200 271 271 SER SER A . n 
A 1 201 CYS 201 272 272 CYS CYS A . n 
A 1 202 TRP 202 273 273 TRP TRP A . n 
A 1 203 ALA 203 274 274 ALA ALA A . n 
A 1 204 ILE 204 275 275 ILE ILE A . n 
A 1 205 SER 205 276 276 SER SER A . n 
A 1 206 TYR 206 277 277 TYR TYR A . n 
A 1 207 LEU 207 278 278 LEU LEU A . n 
A 1 208 THR 208 279 279 THR THR A . n 
A 1 209 ASP 209 280 280 ASP ASP A . n 
A 1 210 GLY 210 281 281 GLY GLY A . n 
A 1 211 PRO 211 282 282 PRO PRO A . n 
A 1 212 ASN 212 283 283 ASN ASN A . n 
A 1 213 GLU 213 284 284 GLU GLU A . n 
A 1 214 ARG 214 285 285 ARG ARG A . n 
A 1 215 ILE 215 286 286 ILE ILE A . n 
A 1 216 GLU 216 287 287 GLU GLU A . n 
A 1 217 MET 217 288 288 MET MET A . n 
A 1 218 VAL 218 289 289 VAL VAL A . n 
A 1 219 VAL 219 290 290 VAL VAL A . n 
A 1 220 LYS 220 291 291 LYS LYS A . n 
A 1 221 LYS 221 292 292 LYS LYS A . n 
A 1 222 GLY 222 293 293 GLY GLY A . n 
A 1 223 VAL 223 294 294 VAL VAL A . n 
A 1 224 VAL 224 295 295 VAL VAL A . n 
A 1 225 PRO 225 296 296 PRO PRO A . n 
A 1 226 GLN 226 297 297 GLN GLN A . n 
A 1 227 LEU 227 298 298 LEU LEU A . n 
A 1 228 VAL 228 299 299 VAL VAL A . n 
A 1 229 LYS 229 300 300 LYS LYS A . n 
A 1 230 LEU 230 301 301 LEU LEU A . n 
A 1 231 LEU 231 302 302 LEU LEU A . n 
A 1 232 GLY 232 303 303 GLY GLY A . n 
A 1 233 ALA 233 304 304 ALA ALA A . n 
A 1 234 THR 234 305 305 THR THR A . n 
A 1 235 GLU 235 306 306 GLU GLU A . n 
A 1 236 LEU 236 307 307 LEU LEU A . n 
A 1 237 PRO 237 308 308 PRO PRO A . n 
A 1 238 ILE 238 309 309 ILE ILE A . n 
A 1 239 VAL 239 310 310 VAL VAL A . n 
A 1 240 THR 240 311 311 THR THR A . n 
A 1 241 PRO 241 312 312 PRO PRO A . n 
A 1 242 ALA 242 313 313 ALA ALA A . n 
A 1 243 LEU 243 314 314 LEU LEU A . n 
A 1 244 ARG 244 315 315 ARG ARG A . n 
A 1 245 ALA 245 316 316 ALA ALA A . n 
A 1 246 ILE 246 317 317 ILE ILE A . n 
A 1 247 GLY 247 318 318 GLY GLY A . n 
A 1 248 ASN 248 319 319 ASN ASN A . n 
A 1 249 ILE 249 320 320 ILE ILE A . n 
A 1 250 VAL 250 321 321 VAL VAL A . n 
A 1 251 THR 251 322 322 THR THR A . n 
A 1 252 GLY 252 323 323 GLY GLY A . n 
A 1 253 THR 253 324 324 THR THR A . n 
A 1 254 ASP 254 325 325 ASP ASP A . n 
A 1 255 GLU 255 326 326 GLU GLU A . n 
A 1 256 GLN 256 327 327 GLN GLN A . n 
A 1 257 THR 257 328 328 THR THR A . n 
A 1 258 GLN 258 329 329 GLN GLN A . n 
A 1 259 LYS 259 330 330 LYS LYS A . n 
A 1 260 VAL 260 331 331 VAL VAL A . n 
A 1 261 ILE 261 332 332 ILE ILE A . n 
A 1 262 ASP 262 333 333 ASP ASP A . n 
A 1 263 ALA 263 334 334 ALA ALA A . n 
A 1 264 GLY 264 335 335 GLY GLY A . n 
A 1 265 ALA 265 336 336 ALA ALA A . n 
A 1 266 LEU 266 337 337 LEU LEU A . n 
A 1 267 ALA 267 338 338 ALA ALA A . n 
A 1 268 VAL 268 339 339 VAL VAL A . n 
A 1 269 PHE 269 340 340 PHE PHE A . n 
A 1 270 PRO 270 341 341 PRO PRO A . n 
A 1 271 SER 271 342 342 SER SER A . n 
A 1 272 LEU 272 343 343 LEU LEU A . n 
A 1 273 LEU 273 344 344 LEU LEU A . n 
A 1 274 THR 274 345 345 THR THR A . n 
A 1 275 ASN 275 346 346 ASN ASN A . n 
A 1 276 PRO 276 347 347 PRO PRO A . n 
A 1 277 LYS 277 348 348 LYS LYS A . n 
A 1 278 THR 278 349 349 THR THR A . n 
A 1 279 ASN 279 350 350 ASN ASN A . n 
A 1 280 ILE 280 351 351 ILE ILE A . n 
A 1 281 GLN 281 352 352 GLN GLN A . n 
A 1 282 LYS 282 353 353 LYS LYS A . n 
A 1 283 GLU 283 354 354 GLU GLU A . n 
A 1 284 ALA 284 355 355 ALA ALA A . n 
A 1 285 THR 285 356 356 THR THR A . n 
A 1 286 TRP 286 357 357 TRP TRP A . n 
A 1 287 THR 287 358 358 THR THR A . n 
A 1 288 MET 288 359 359 MET MET A . n 
A 1 289 SER 289 360 360 SER SER A . n 
A 1 290 ASN 290 361 361 ASN ASN A . n 
A 1 291 ILE 291 362 362 ILE ILE A . n 
A 1 292 THR 292 363 363 THR THR A . n 
A 1 293 ALA 293 364 364 ALA ALA A . n 
A 1 294 GLY 294 365 365 GLY GLY A . n 
A 1 295 ARG 295 366 366 ARG ARG A . n 
A 1 296 GLN 296 367 367 GLN GLN A . n 
A 1 297 ASP 297 368 368 ASP ASP A . n 
A 1 298 GLN 298 369 369 GLN GLN A . n 
A 1 299 ILE 299 370 370 ILE ILE A . n 
A 1 300 GLN 300 371 371 GLN GLN A . n 
A 1 301 GLN 301 372 372 GLN GLN A . n 
A 1 302 VAL 302 373 373 VAL VAL A . n 
A 1 303 VAL 303 374 374 VAL VAL A . n 
A 1 304 ASN 304 375 375 ASN ASN A . n 
A 1 305 HIS 305 376 376 HIS HIS A . n 
A 1 306 GLY 306 377 377 GLY GLY A . n 
A 1 307 LEU 307 378 378 LEU LEU A . n 
A 1 308 VAL 308 379 379 VAL VAL A . n 
A 1 309 PRO 309 380 380 PRO PRO A . n 
A 1 310 PHE 310 381 381 PHE PHE A . n 
A 1 311 LEU 311 382 382 LEU LEU A . n 
A 1 312 VAL 312 383 383 VAL VAL A . n 
A 1 313 GLY 313 384 384 GLY GLY A . n 
A 1 314 VAL 314 385 385 VAL VAL A . n 
A 1 315 LEU 315 386 386 LEU LEU A . n 
A 1 316 SER 316 387 387 SER SER A . n 
A 1 317 LYS 317 388 388 LYS LYS A . n 
A 1 318 ALA 318 389 389 ALA ALA A . n 
A 1 319 ASP 319 390 390 ASP ASP A . n 
A 1 320 PHE 320 391 391 PHE PHE A . n 
A 1 321 LYS 321 392 392 LYS LYS A . n 
A 1 322 THR 322 393 393 THR THR A . n 
A 1 323 GLN 323 394 394 GLN GLN A . n 
A 1 324 LYS 324 395 395 LYS LYS A . n 
A 1 325 GLU 325 396 396 GLU GLU A . n 
A 1 326 ALA 326 397 397 ALA ALA A . n 
A 1 327 ALA 327 398 398 ALA ALA A . n 
A 1 328 TRP 328 399 399 TRP TRP A . n 
A 1 329 ALA 329 400 400 ALA ALA A . n 
A 1 330 ILE 330 401 401 ILE ILE A . n 
A 1 331 THR 331 402 402 THR THR A . n 
A 1 332 ASN 332 403 403 ASN ASN A . n 
A 1 333 TYR 333 404 404 TYR TYR A . n 
A 1 334 THR 334 405 405 THR THR A . n 
A 1 335 SER 335 406 406 SER SER A . n 
A 1 336 GLY 336 407 407 GLY GLY A . n 
A 1 337 GLY 337 408 408 GLY GLY A . n 
A 1 338 THR 338 409 409 THR THR A . n 
A 1 339 VAL 339 410 410 VAL VAL A . n 
A 1 340 GLU 340 411 411 GLU GLU A . n 
A 1 341 GLN 341 412 412 GLN GLN A . n 
A 1 342 ILE 342 413 413 ILE ILE A . n 
A 1 343 VAL 343 414 414 VAL VAL A . n 
A 1 344 TYR 344 415 415 TYR TYR A . n 
A 1 345 LEU 345 416 416 LEU LEU A . n 
A 1 346 VAL 346 417 417 VAL VAL A . n 
A 1 347 HIS 347 418 418 HIS HIS A . n 
A 1 348 CYS 348 419 419 CYS CYS A . n 
A 1 349 GLY 349 420 420 GLY GLY A . n 
A 1 350 ILE 350 421 421 ILE ILE A . n 
A 1 351 ILE 351 422 422 ILE ILE A . n 
A 1 352 GLU 352 423 423 GLU GLU A . n 
A 1 353 PRO 353 424 424 PRO PRO A . n 
A 1 354 LEU 354 425 425 LEU LEU A . n 
A 1 355 MET 355 426 426 MET MET A . n 
A 1 356 ASN 356 427 427 ASN ASN A . n 
A 1 357 LEU 357 428 428 LEU LEU A . n 
A 1 358 LEU 358 429 429 LEU LEU A . n 
A 1 359 SER 359 430 430 SER SER A . n 
A 1 360 ALA 360 431 431 ALA ALA A . n 
A 1 361 LYS 361 432 432 LYS LYS A . n 
A 1 362 ASP 362 433 433 ASP ASP A . n 
A 1 363 THR 363 434 434 THR THR A . n 
A 1 364 LYS 364 435 435 LYS LYS A . n 
A 1 365 ILE 365 436 436 ILE ILE A . n 
A 1 366 ILE 366 437 437 ILE ILE A . n 
A 1 367 GLN 367 438 438 GLN GLN A . n 
A 1 368 VAL 368 439 439 VAL VAL A . n 
A 1 369 ILE 369 440 440 ILE ILE A . n 
A 1 370 LEU 370 441 441 LEU LEU A . n 
A 1 371 ASP 371 442 442 ASP ASP A . n 
A 1 372 ALA 372 443 443 ALA ALA A . n 
A 1 373 ILE 373 444 444 ILE ILE A . n 
A 1 374 SER 374 445 445 SER SER A . n 
A 1 375 ASN 375 446 446 ASN ASN A . n 
A 1 376 ILE 376 447 447 ILE ILE A . n 
A 1 377 PHE 377 448 448 PHE PHE A . n 
A 1 378 GLN 378 449 449 GLN GLN A . n 
A 1 379 ALA 379 450 450 ALA ALA A . n 
A 1 380 ALA 380 451 451 ALA ALA A . n 
A 1 381 GLU 381 452 452 GLU GLU A . n 
A 1 382 LYS 382 453 453 LYS LYS A . n 
A 1 383 LEU 383 454 454 LEU LEU A . n 
A 1 384 GLY 384 455 455 GLY GLY A . n 
A 1 385 GLU 385 456 456 GLU GLU A . n 
A 1 386 THR 386 457 457 THR THR A . n 
A 1 387 GLU 387 458 458 GLU GLU A . n 
A 1 388 LYS 388 459 459 LYS LYS A . n 
A 1 389 LEU 389 460 460 LEU LEU A . n 
A 1 390 SER 390 461 461 SER SER A . n 
A 1 391 ILE 391 462 462 ILE ILE A . n 
A 1 392 MET 392 463 463 MET MET A . n 
A 1 393 ILE 393 464 464 ILE ILE A . n 
A 1 394 GLU 394 465 465 GLU GLU A . n 
A 1 395 GLU 395 466 466 GLU GLU A . n 
A 1 396 CYS 396 467 467 CYS CYS A . n 
A 1 397 GLY 397 468 468 GLY GLY A . n 
A 1 398 GLY 398 469 469 GLY GLY A . n 
A 1 399 LEU 399 470 470 LEU LEU A . n 
A 1 400 ASP 400 471 471 ASP ASP A . n 
A 1 401 LYS 401 472 472 LYS LYS A . n 
A 1 402 ILE 402 473 473 ILE ILE A . n 
A 1 403 GLU 403 474 474 GLU GLU A . n 
A 1 404 ALA 404 475 475 ALA ALA A . n 
A 1 405 LEU 405 476 476 LEU LEU A . n 
A 1 406 GLN 406 477 477 GLN GLN A . n 
A 1 407 ARG 407 478 478 ARG ARG A . n 
A 1 408 HIS 408 479 479 HIS HIS A . n 
A 1 409 GLU 409 480 480 GLU GLU A . n 
A 1 410 ASN 410 481 481 ASN ASN A . n 
A 1 411 GLU 411 482 482 GLU GLU A . n 
A 1 412 SER 412 483 483 SER SER A . n 
A 1 413 VAL 413 484 484 VAL VAL A . n 
A 1 414 TYR 414 485 485 TYR TYR A . n 
A 1 415 LYS 415 486 486 LYS LYS A . n 
A 1 416 ALA 416 487 487 ALA ALA A . n 
A 1 417 SER 417 488 488 SER SER A . n 
A 1 418 LEU 418 489 489 LEU LEU A . n 
A 1 419 ASN 419 490 490 ASN ASN A . n 
A 1 420 LEU 420 491 491 LEU LEU A . n 
A 1 421 ILE 421 492 492 ILE ILE A . n 
A 1 422 GLU 422 493 493 GLU GLU A . n 
A 1 423 LYS 423 494 494 LYS LYS A . n 
A 1 424 TYR 424 495 495 TYR TYR A . n 
A 1 425 PHE 425 496 496 PHE PHE A . n 
A 1 426 SER 426 497 497 SER SER A . n 
A 1 427 VAL 427 498 498 VAL VAL A . n 
A 1 428 GLU 428 499 ?   ?   ?   A . n 
A 1 429 GLU 429 500 ?   ?   ?   A . n 
A 1 430 GLU 430 501 ?   ?   ?   A . n 
A 1 431 GLU 431 502 ?   ?   ?   A . n 
A 1 432 ASP 432 503 ?   ?   ?   A . n 
A 1 433 GLN 433 504 ?   ?   ?   A . n 
A 1 434 ASN 434 505 ?   ?   ?   A . n 
A 1 435 VAL 435 506 ?   ?   ?   A . n 
A 1 436 VAL 436 507 ?   ?   ?   A . n 
A 1 437 PRO 437 508 ?   ?   ?   A . n 
A 1 438 GLU 438 509 ?   ?   ?   A . n 
A 1 439 THR 439 510 ?   ?   ?   A . n 
A 1 440 THR 440 511 ?   ?   ?   A . n 
A 1 441 SER 441 512 ?   ?   ?   A . n 
A 1 442 GLU 442 513 ?   ?   ?   A . n 
A 1 443 GLY 443 514 ?   ?   ?   A . n 
A 1 444 PHE 444 515 ?   ?   ?   A . n 
A 1 445 ALA 445 516 ?   ?   ?   A . n 
A 1 446 PHE 446 517 ?   ?   ?   A . n 
A 1 447 GLN 447 518 ?   ?   ?   A . n 
A 1 448 VAL 448 519 ?   ?   ?   A . n 
A 1 449 GLN 449 520 ?   ?   ?   A . n 
A 1 450 ASP 450 521 ?   ?   ?   A . n 
A 1 451 GLY 451 522 ?   ?   ?   A . n 
A 1 452 ALA 452 523 ?   ?   ?   A . n 
A 1 453 PRO 453 524 ?   ?   ?   A . n 
A 1 454 GLY 454 525 ?   ?   ?   A . n 
A 1 455 THR 455 526 ?   ?   ?   A . n 
A 1 456 PHE 456 527 ?   ?   ?   A . n 
A 1 457 ASN 457 528 ?   ?   ?   A . n 
A 1 458 PHE 458 529 ?   ?   ?   A . n 
B 2 1   THR 1   13  13  THR THR B . n 
B 2 2   ASN 2   14  14  ASN ASN B . n 
B 2 3   LYS 3   15  15  LYS LYS B . n 
B 2 4   LYS 4   16  16  LYS LYS B . n 
B 2 5   MET 5   17  17  MET MET B . n 
B 2 6   ARG 6   18  18  ARG ARG B . n 
B 2 7   ARG 7   19  19  ARG ARG B . n 
B 2 8   ASN 8   20  20  ASN ASN B . n 
B 2 9   ARG 9   21  21  ARG ARG B . n 
B 2 10  PHE 10  22  22  PHE PHE B . n 
B 2 11  LYS 11  23  23  LYS LYS B . n 
C 2 1   THR 1   9   9   THR THR C . n 
C 2 2   ASN 2   10  10  ASN ASN C . n 
C 2 3   LYS 3   11  11  LYS LYS C . n 
C 2 4   LYS 4   12  12  LYS LYS C . n 
C 2 5   MET 5   13  13  MET MET C . n 
C 2 6   ARG 6   14  14  ARG ARG C . n 
C 2 7   ARG 7   15  15  ARG ARG C . n 
C 2 8   ASN 8   16  16  ASN ASN C . n 
C 2 9   ARG 9   17  17  ARG ARG C . n 
C 2 10  PHE 10  18  18  PHE PHE C . n 
C 2 11  LYS 11  19  19  LYS LYS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 HOH 1  601 13 HOH HOH A . 
D 3 HOH 2  602 20 HOH HOH A . 
D 3 HOH 3  603 32 HOH HOH A . 
D 3 HOH 4  604 52 HOH HOH A . 
D 3 HOH 5  605 31 HOH HOH A . 
D 3 HOH 6  606 28 HOH HOH A . 
D 3 HOH 7  607 11 HOH HOH A . 
D 3 HOH 8  608 33 HOH HOH A . 
D 3 HOH 9  609 29 HOH HOH A . 
D 3 HOH 10 610 5  HOH HOH A . 
D 3 HOH 11 611 26 HOH HOH A . 
D 3 HOH 12 612 47 HOH HOH A . 
D 3 HOH 13 613 42 HOH HOH A . 
D 3 HOH 14 614 21 HOH HOH A . 
D 3 HOH 15 615 4  HOH HOH A . 
D 3 HOH 16 616 2  HOH HOH A . 
D 3 HOH 17 617 1  HOH HOH A . 
D 3 HOH 18 618 25 HOH HOH A . 
D 3 HOH 19 619 35 HOH HOH A . 
D 3 HOH 20 620 6  HOH HOH A . 
D 3 HOH 21 621 9  HOH HOH A . 
D 3 HOH 22 622 18 HOH HOH A . 
D 3 HOH 23 623 27 HOH HOH A . 
D 3 HOH 24 624 12 HOH HOH A . 
D 3 HOH 25 625 36 HOH HOH A . 
D 3 HOH 26 626 17 HOH HOH A . 
D 3 HOH 27 627 49 HOH HOH A . 
D 3 HOH 28 628 3  HOH HOH A . 
D 3 HOH 29 629 24 HOH HOH A . 
D 3 HOH 30 630 14 HOH HOH A . 
D 3 HOH 31 631 7  HOH HOH A . 
D 3 HOH 32 632 10 HOH HOH A . 
D 3 HOH 33 633 50 HOH HOH A . 
D 3 HOH 34 634 34 HOH HOH A . 
D 3 HOH 35 635 37 HOH HOH A . 
D 3 HOH 36 636 16 HOH HOH A . 
D 3 HOH 37 637 19 HOH HOH A . 
D 3 HOH 38 638 39 HOH HOH A . 
D 3 HOH 39 639 46 HOH HOH A . 
D 3 HOH 40 640 8  HOH HOH A . 
D 3 HOH 41 641 40 HOH HOH A . 
D 3 HOH 42 642 23 HOH HOH A . 
D 3 HOH 43 643 51 HOH HOH A . 
D 3 HOH 44 644 44 HOH HOH A . 
D 3 HOH 45 645 15 HOH HOH A . 
D 3 HOH 46 646 41 HOH HOH A . 
D 3 HOH 47 647 43 HOH HOH A . 
D 3 HOH 48 648 22 HOH HOH A . 
D 3 HOH 49 649 45 HOH HOH A . 
D 3 HOH 50 650 53 HOH HOH A . 
D 3 HOH 51 651 48 HOH HOH A . 
E 3 HOH 1  101 38 HOH HOH B . 
E 3 HOH 2  102 30 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2650  ? 
1 MORE         3     ? 
1 'SSA (A^2)'  19800 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-11-23 
2 'Structure model' 1 1 2017-09-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_audit_support 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    2 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? '(1.10.1_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2    ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.16               3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .                    4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    633 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    647 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.96 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 HH22 A ARG 117 ? ? 1_555 HH22 A ARG 117 ? ? 4_555 1.34 
2 1 NH2  A ARG 117 ? ? 1_555 HH12 A ARG 117 ? ? 4_555 1.56 
3 1 NH1  A ARG 117 ? ? 1_555 NH2  A ARG 117 ? ? 4_555 1.60 
4 1 CZ   A ARG 117 ? ? 1_555 CZ   A ARG 117 ? ? 4_555 1.61 
5 1 NH2  A ARG 117 ? ? 1_555 NH2  A ARG 117 ? ? 4_555 1.79 
6 1 CZ   A ARG 117 ? ? 1_555 NH2  A ARG 117 ? ? 4_555 1.83 
7 1 CZ   A ARG 117 ? ? 1_555 NH1  A ARG 117 ? ? 4_555 1.97 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 203 ? ? -66.87 0.80   
2 1 ASN A 239 ? ? 78.23  162.79 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 72  ? A GLY 1   
2  1 Y 1 A THR 73  ? A THR 2   
3  1 Y 1 A GLU 499 ? A GLU 428 
4  1 Y 1 A GLU 500 ? A GLU 429 
5  1 Y 1 A GLU 501 ? A GLU 430 
6  1 Y 1 A GLU 502 ? A GLU 431 
7  1 Y 1 A ASP 503 ? A ASP 432 
8  1 Y 1 A GLN 504 ? A GLN 433 
9  1 Y 1 A ASN 505 ? A ASN 434 
10 1 Y 1 A VAL 506 ? A VAL 435 
11 1 Y 1 A VAL 507 ? A VAL 436 
12 1 Y 1 A PRO 508 ? A PRO 437 
13 1 Y 1 A GLU 509 ? A GLU 438 
14 1 Y 1 A THR 510 ? A THR 439 
15 1 Y 1 A THR 511 ? A THR 440 
16 1 Y 1 A SER 512 ? A SER 441 
17 1 Y 1 A GLU 513 ? A GLU 442 
18 1 Y 1 A GLY 514 ? A GLY 443 
19 1 Y 1 A PHE 515 ? A PHE 444 
20 1 Y 1 A ALA 516 ? A ALA 445 
21 1 Y 1 A PHE 517 ? A PHE 446 
22 1 Y 1 A GLN 518 ? A GLN 447 
23 1 Y 1 A VAL 519 ? A VAL 448 
24 1 Y 1 A GLN 520 ? A GLN 449 
25 1 Y 1 A ASP 521 ? A ASP 450 
26 1 Y 1 A GLY 522 ? A GLY 451 
27 1 Y 1 A ALA 523 ? A ALA 452 
28 1 Y 1 A PRO 524 ? A PRO 453 
29 1 Y 1 A GLY 525 ? A GLY 454 
30 1 Y 1 A THR 526 ? A THR 455 
31 1 Y 1 A PHE 527 ? A PHE 456 
32 1 Y 1 A ASN 528 ? A ASN 457 
33 1 Y 1 A PHE 529 ? A PHE 458 
# 
_pdbx_audit_support.funding_organization   'Medical Research Council (United Kingdom)' 
_pdbx_audit_support.country                'United Kingdom' 
_pdbx_audit_support.grant_number           U105178939 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#