data_5KAL
# 
_entry.id   5KAL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KAL         
WWPDB D_1000221951 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KAL 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-01 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stagno, J.R.'  1 
'Luecke, H.'    2 
'Afasizhev, R.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            44 
_citation.language                  ? 
_citation.page_first                10862 
_citation.page_last                 10878 
_citation.title                     
'RNA Editing TUTase 1: structural foundation of substrate recognition, complex interactions and drug targeting.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkw917 
_citation.pdbx_database_id_PubMed   27744351 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rajappa-Titu, L.' 1  
primary 'Suematsu, T.'     2  
primary 'Munoz-Tello, P.'  3  
primary 'Long, M.'         4  
primary 'Demir, O.'        5  
primary 'Cheng, K.J.'      6  
primary 'Stagno, J.R.'     7  
primary 'Luecke, H.'       8  
primary 'Amaro, R.E.'      9  
primary 'Aphasizheva, I.'  10 
primary 'Aphasizhev, R.'   11 
primary 'Thore, S.'        12 
# 
_cell.entry_id           5KAL 
_cell.length_a           82.688 
_cell.length_b           42.876 
_cell.length_c           109.618 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.05 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5KAL 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RNA uridylyltransferase 4' 39879.395 2   ? ? ? ? 
2 polymer     syn 
;RNA (5'-R(*UP*U)-3')
;
567.374   2   ? ? ? ? 
3 non-polymer syn 
;URIDINE 5'-TRIPHOSPHATE
;
484.141   2   ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'             24.305    5   ? ? ? ? 
5 water       nat water                       18.015    190 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MGSSHHHHHHSSGLVPRGSHMPPSPAVVGRSLVNSFKQFVSKDLHTRHVDATYRLVLDCVAAVDPLMRLYTFGSTVVYGV
HEKGSDVDFVVLNKTDVEDGKGGDAATQVAKGLQADILAKLARVIRQKHLSWNVEEVRRTRVPVVRVKGGGAVDFDITAY
RRNGVRNSALLRAYFEQNPPCRWLSMSIKRWSKQTGLNASVIGGSITSYGFNLMVVYYLLQRNHLQFVPPSTIDVSRVEP
LPPHLPLEEPADEGLELGTQVLDFLHFFLHEFDSDKQVISLNRPGITTKEELDWTKSAEDFARMNGEKVHYQWCIEDPYE
LNLNVGRNVTPLKRDFLRRHLEKARDTALLTIV
;
;MGSSHHHHHHSSGLVPRGSHMPPSPAVVGRSLVNSFKQFVSKDLHTRHVDATYRLVLDCVAAVDPLMRLYTFGSTVVYGV
HEKGSDVDFVVLNKTDVEDGKGGDAATQVAKGLQADILAKLARVIRQKHLSWNVEEVRRTRVPVVRVKGGGAVDFDITAY
RRNGVRNSALLRAYFEQNPPCRWLSMSIKRWSKQTGLNASVIGGSITSYGFNLMVVYYLLQRNHLQFVPPSTIDVSRVEP
LPPHLPLEEPADEGLELGTQVLDFLHFFLHEFDSDKQVISLNRPGITTKEELDWTKSAEDFARMNGEKVHYQWCIEDPYE
LNLNVGRNVTPLKRDFLRRHLEKARDTALLTIV
;
A,B ? 
2 polyribonucleotide no no UU UU Y,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  PRO n 
1 23  PRO n 
1 24  SER n 
1 25  PRO n 
1 26  ALA n 
1 27  VAL n 
1 28  VAL n 
1 29  GLY n 
1 30  ARG n 
1 31  SER n 
1 32  LEU n 
1 33  VAL n 
1 34  ASN n 
1 35  SER n 
1 36  PHE n 
1 37  LYS n 
1 38  GLN n 
1 39  PHE n 
1 40  VAL n 
1 41  SER n 
1 42  LYS n 
1 43  ASP n 
1 44  LEU n 
1 45  HIS n 
1 46  THR n 
1 47  ARG n 
1 48  HIS n 
1 49  VAL n 
1 50  ASP n 
1 51  ALA n 
1 52  THR n 
1 53  TYR n 
1 54  ARG n 
1 55  LEU n 
1 56  VAL n 
1 57  LEU n 
1 58  ASP n 
1 59  CYS n 
1 60  VAL n 
1 61  ALA n 
1 62  ALA n 
1 63  VAL n 
1 64  ASP n 
1 65  PRO n 
1 66  LEU n 
1 67  MET n 
1 68  ARG n 
1 69  LEU n 
1 70  TYR n 
1 71  THR n 
1 72  PHE n 
1 73  GLY n 
1 74  SER n 
1 75  THR n 
1 76  VAL n 
1 77  VAL n 
1 78  TYR n 
1 79  GLY n 
1 80  VAL n 
1 81  HIS n 
1 82  GLU n 
1 83  LYS n 
1 84  GLY n 
1 85  SER n 
1 86  ASP n 
1 87  VAL n 
1 88  ASP n 
1 89  PHE n 
1 90  VAL n 
1 91  VAL n 
1 92  LEU n 
1 93  ASN n 
1 94  LYS n 
1 95  THR n 
1 96  ASP n 
1 97  VAL n 
1 98  GLU n 
1 99  ASP n 
1 100 GLY n 
1 101 LYS n 
1 102 GLY n 
1 103 GLY n 
1 104 ASP n 
1 105 ALA n 
1 106 ALA n 
1 107 THR n 
1 108 GLN n 
1 109 VAL n 
1 110 ALA n 
1 111 LYS n 
1 112 GLY n 
1 113 LEU n 
1 114 GLN n 
1 115 ALA n 
1 116 ASP n 
1 117 ILE n 
1 118 LEU n 
1 119 ALA n 
1 120 LYS n 
1 121 LEU n 
1 122 ALA n 
1 123 ARG n 
1 124 VAL n 
1 125 ILE n 
1 126 ARG n 
1 127 GLN n 
1 128 LYS n 
1 129 HIS n 
1 130 LEU n 
1 131 SER n 
1 132 TRP n 
1 133 ASN n 
1 134 VAL n 
1 135 GLU n 
1 136 GLU n 
1 137 VAL n 
1 138 ARG n 
1 139 ARG n 
1 140 THR n 
1 141 ARG n 
1 142 VAL n 
1 143 PRO n 
1 144 VAL n 
1 145 VAL n 
1 146 ARG n 
1 147 VAL n 
1 148 LYS n 
1 149 GLY n 
1 150 GLY n 
1 151 GLY n 
1 152 ALA n 
1 153 VAL n 
1 154 ASP n 
1 155 PHE n 
1 156 ASP n 
1 157 ILE n 
1 158 THR n 
1 159 ALA n 
1 160 TYR n 
1 161 ARG n 
1 162 ARG n 
1 163 ASN n 
1 164 GLY n 
1 165 VAL n 
1 166 ARG n 
1 167 ASN n 
1 168 SER n 
1 169 ALA n 
1 170 LEU n 
1 171 LEU n 
1 172 ARG n 
1 173 ALA n 
1 174 TYR n 
1 175 PHE n 
1 176 GLU n 
1 177 GLN n 
1 178 ASN n 
1 179 PRO n 
1 180 PRO n 
1 181 CYS n 
1 182 ARG n 
1 183 TRP n 
1 184 LEU n 
1 185 SER n 
1 186 MET n 
1 187 SER n 
1 188 ILE n 
1 189 LYS n 
1 190 ARG n 
1 191 TRP n 
1 192 SER n 
1 193 LYS n 
1 194 GLN n 
1 195 THR n 
1 196 GLY n 
1 197 LEU n 
1 198 ASN n 
1 199 ALA n 
1 200 SER n 
1 201 VAL n 
1 202 ILE n 
1 203 GLY n 
1 204 GLY n 
1 205 SER n 
1 206 ILE n 
1 207 THR n 
1 208 SER n 
1 209 TYR n 
1 210 GLY n 
1 211 PHE n 
1 212 ASN n 
1 213 LEU n 
1 214 MET n 
1 215 VAL n 
1 216 VAL n 
1 217 TYR n 
1 218 TYR n 
1 219 LEU n 
1 220 LEU n 
1 221 GLN n 
1 222 ARG n 
1 223 ASN n 
1 224 HIS n 
1 225 LEU n 
1 226 GLN n 
1 227 PHE n 
1 228 VAL n 
1 229 PRO n 
1 230 PRO n 
1 231 SER n 
1 232 THR n 
1 233 ILE n 
1 234 ASP n 
1 235 VAL n 
1 236 SER n 
1 237 ARG n 
1 238 VAL n 
1 239 GLU n 
1 240 PRO n 
1 241 LEU n 
1 242 PRO n 
1 243 PRO n 
1 244 HIS n 
1 245 LEU n 
1 246 PRO n 
1 247 LEU n 
1 248 GLU n 
1 249 GLU n 
1 250 PRO n 
1 251 ALA n 
1 252 ASP n 
1 253 GLU n 
1 254 GLY n 
1 255 LEU n 
1 256 GLU n 
1 257 LEU n 
1 258 GLY n 
1 259 THR n 
1 260 GLN n 
1 261 VAL n 
1 262 LEU n 
1 263 ASP n 
1 264 PHE n 
1 265 LEU n 
1 266 HIS n 
1 267 PHE n 
1 268 PHE n 
1 269 LEU n 
1 270 HIS n 
1 271 GLU n 
1 272 PHE n 
1 273 ASP n 
1 274 SER n 
1 275 ASP n 
1 276 LYS n 
1 277 GLN n 
1 278 VAL n 
1 279 ILE n 
1 280 SER n 
1 281 LEU n 
1 282 ASN n 
1 283 ARG n 
1 284 PRO n 
1 285 GLY n 
1 286 ILE n 
1 287 THR n 
1 288 THR n 
1 289 LYS n 
1 290 GLU n 
1 291 GLU n 
1 292 LEU n 
1 293 ASP n 
1 294 TRP n 
1 295 THR n 
1 296 LYS n 
1 297 SER n 
1 298 ALA n 
1 299 GLU n 
1 300 ASP n 
1 301 PHE n 
1 302 ALA n 
1 303 ARG n 
1 304 MET n 
1 305 ASN n 
1 306 GLY n 
1 307 GLU n 
1 308 LYS n 
1 309 VAL n 
1 310 HIS n 
1 311 TYR n 
1 312 GLN n 
1 313 TRP n 
1 314 CYS n 
1 315 ILE n 
1 316 GLU n 
1 317 ASP n 
1 318 PRO n 
1 319 TYR n 
1 320 GLU n 
1 321 LEU n 
1 322 ASN n 
1 323 LEU n 
1 324 ASN n 
1 325 VAL n 
1 326 GLY n 
1 327 ARG n 
1 328 ASN n 
1 329 VAL n 
1 330 THR n 
1 331 PRO n 
1 332 LEU n 
1 333 LYS n 
1 334 ARG n 
1 335 ASP n 
1 336 PHE n 
1 337 LEU n 
1 338 ARG n 
1 339 ARG n 
1 340 HIS n 
1 341 LEU n 
1 342 GLU n 
1 343 LYS n 
1 344 ALA n 
1 345 ARG n 
1 346 ASP n 
1 347 THR n 
1 348 ALA n 
1 349 LEU n 
1 350 LEU n 
1 351 THR n 
1 352 ILE n 
1 353 VAL n 
2 1   U   n 
2 2   U   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   353 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TUT4 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Trypanosoma brucei' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5691 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       2 
_pdbx_entity_src_syn.organism_scientific    'Trypanosoma brucei' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       5691 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP A4UBD5_9TRYP A4UBD5 ? 1 
;MPPSPAVVGRSLVNSFKQFVSKDLHTRHVDATYRLVLDCVAAVDPLMRLYTFGSTVVYGVHEKGSDVDFVVLNKTDVEDG
KGGDAATQVAKGLQADILAKLARVIRQKHLSWNVEEVRRTRVPVVRVKGGGAVDFDITAYRRNGVRNSALLRAYFEQNPP
CRWLSMSIKRWSKQTGLNASVIGGSITSYGFNLMVVYYLLQRNHLQFVPPSTIDVSRVEPLPPHLPLEEPADEGLELGTQ
VLDFLHFFLHEFDSDKQVISLNRPGITTKEELDWTKSAEDFARMNGEKVHYQWCIEDPYELNLNVGRNVTPLKRDFLRRH
LEKARDTALLTIV
;
1 
2 PDB 5KAL         5KAL   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KAL A 21 ? 353 ? A4UBD5 1 ? 333 ? 1 333 
2 1 5KAL B 21 ? 353 ? A4UBD5 1 ? 333 ? 1 333 
3 2 5KAL Y 1  ? 2   ? 5KAL   1 ? 2   ? 1 2   
4 2 5KAL Z 1  ? 2   ? 5KAL   1 ? 2   ? 1 2   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KAL MET A 1  ? UNP A4UBD5 ? ? 'expression tag' -19 1  
1 5KAL GLY A 2  ? UNP A4UBD5 ? ? 'expression tag' -18 2  
1 5KAL SER A 3  ? UNP A4UBD5 ? ? 'expression tag' -17 3  
1 5KAL SER A 4  ? UNP A4UBD5 ? ? 'expression tag' -16 4  
1 5KAL HIS A 5  ? UNP A4UBD5 ? ? 'expression tag' -15 5  
1 5KAL HIS A 6  ? UNP A4UBD5 ? ? 'expression tag' -14 6  
1 5KAL HIS A 7  ? UNP A4UBD5 ? ? 'expression tag' -13 7  
1 5KAL HIS A 8  ? UNP A4UBD5 ? ? 'expression tag' -12 8  
1 5KAL HIS A 9  ? UNP A4UBD5 ? ? 'expression tag' -11 9  
1 5KAL HIS A 10 ? UNP A4UBD5 ? ? 'expression tag' -10 10 
1 5KAL SER A 11 ? UNP A4UBD5 ? ? 'expression tag' -9  11 
1 5KAL SER A 12 ? UNP A4UBD5 ? ? 'expression tag' -8  12 
1 5KAL GLY A 13 ? UNP A4UBD5 ? ? 'expression tag' -7  13 
1 5KAL LEU A 14 ? UNP A4UBD5 ? ? 'expression tag' -6  14 
1 5KAL VAL A 15 ? UNP A4UBD5 ? ? 'expression tag' -5  15 
1 5KAL PRO A 16 ? UNP A4UBD5 ? ? 'expression tag' -4  16 
1 5KAL ARG A 17 ? UNP A4UBD5 ? ? 'expression tag' -3  17 
1 5KAL GLY A 18 ? UNP A4UBD5 ? ? 'expression tag' -2  18 
1 5KAL SER A 19 ? UNP A4UBD5 ? ? 'expression tag' -1  19 
1 5KAL HIS A 20 ? UNP A4UBD5 ? ? 'expression tag' 0   20 
2 5KAL MET B 1  ? UNP A4UBD5 ? ? 'expression tag' -19 21 
2 5KAL GLY B 2  ? UNP A4UBD5 ? ? 'expression tag' -18 22 
2 5KAL SER B 3  ? UNP A4UBD5 ? ? 'expression tag' -17 23 
2 5KAL SER B 4  ? UNP A4UBD5 ? ? 'expression tag' -16 24 
2 5KAL HIS B 5  ? UNP A4UBD5 ? ? 'expression tag' -15 25 
2 5KAL HIS B 6  ? UNP A4UBD5 ? ? 'expression tag' -14 26 
2 5KAL HIS B 7  ? UNP A4UBD5 ? ? 'expression tag' -13 27 
2 5KAL HIS B 8  ? UNP A4UBD5 ? ? 'expression tag' -12 28 
2 5KAL HIS B 9  ? UNP A4UBD5 ? ? 'expression tag' -11 29 
2 5KAL HIS B 10 ? UNP A4UBD5 ? ? 'expression tag' -10 30 
2 5KAL SER B 11 ? UNP A4UBD5 ? ? 'expression tag' -9  31 
2 5KAL SER B 12 ? UNP A4UBD5 ? ? 'expression tag' -8  32 
2 5KAL GLY B 13 ? UNP A4UBD5 ? ? 'expression tag' -7  33 
2 5KAL LEU B 14 ? UNP A4UBD5 ? ? 'expression tag' -6  34 
2 5KAL VAL B 15 ? UNP A4UBD5 ? ? 'expression tag' -5  35 
2 5KAL PRO B 16 ? UNP A4UBD5 ? ? 'expression tag' -4  36 
2 5KAL ARG B 17 ? UNP A4UBD5 ? ? 'expression tag' -3  37 
2 5KAL GLY B 18 ? UNP A4UBD5 ? ? 'expression tag' -2  38 
2 5KAL SER B 19 ? UNP A4UBD5 ? ? 'expression tag' -1  39 
2 5KAL HIS B 20 ? UNP A4UBD5 ? ? 'expression tag' 0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                      ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P'   324.181 
UTP non-polymer         . 
;URIDINE 5'-TRIPHOSPHATE
;
? 'C9 H15 N2 O15 P3' 484.141 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KAL 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.53 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.42 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100mM sodium cacodylate pH 6.5, 200mM calcium acetate, 18% PEG-8000, 5mM UTP, 5mM UpU' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2007-08-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5KAL 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.75 
_reflns.d_resolution_low                 47.13 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       20369 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.52 
_reflns.pdbx_Rmerge_I_obs                0.104 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.75 
_reflns_shell.d_res_low                   2.85 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.374 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.48 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5KAL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     20345 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.129 
_refine.ls_d_res_high                            2.750 
_refine.ls_percent_reflns_obs                    99.43 
_refine.ls_R_factor_obs                          0.2160 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2136 
_refine.ls_R_factor_R_free                       0.2590 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.26 
_refine.ls_number_reflns_R_free                  1070 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2IKF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.46 
_refine.pdbx_overall_phase_error                 29.35 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5115 
_refine_hist.pdbx_number_atoms_nucleic_acid   74 
_refine_hist.pdbx_number_atoms_ligand         63 
_refine_hist.number_atoms_solvent             190 
_refine_hist.number_atoms_total               5442 
_refine_hist.d_res_high                       2.750 
_refine_hist.d_res_low                        47.129 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.014  ? ? 5428 'X-RAY DIFFRACTION' ? 
f_angle_d          0.566  ? ? 7358 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 10.891 ? ? 3246 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.043  ? ? 827  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 931  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.7500 2.8752  2389 0.3328 100.00 0.4429 . . 134 . . 
'X-RAY DIFFRACTION' . 2.8752 3.0267  2403 0.3006 100.00 0.3411 . . 125 . . 
'X-RAY DIFFRACTION' . 3.0267 3.2163  2366 0.2894 100.00 0.3557 . . 142 . . 
'X-RAY DIFFRACTION' . 3.2163 3.4646  2374 0.2407 100.00 0.2984 . . 145 . . 
'X-RAY DIFFRACTION' . 3.4646 3.8131  2411 0.2001 100.00 0.2490 . . 129 . . 
'X-RAY DIFFRACTION' . 3.8131 4.3645  2433 0.1698 100.00 0.2226 . . 133 . . 
'X-RAY DIFFRACTION' . 4.3645 5.4975  2390 0.1593 98.00  0.1824 . . 125 . . 
'X-RAY DIFFRACTION' . 5.4975 47.1356 2509 0.2047 99.00  0.2316 . . 137 . . 
# 
_struct.entry_id                     5KAL 
_struct.title                        'Terminal uridylyl transferase 4 from Trypanosoma brucei with bound UTP and UpU' 
_struct.pdbx_descriptor              'RNA uridylyltransferase 4/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KAL 
_struct_keywords.text            'trypanosoma, RNA editing, TUTase, transferase, Transferase-RNA complex' 
_struct_keywords.pdbx_keywords   Transferase/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 24  ? PHE A 36  ? SER A 4   PHE A 16  1 ? 13 
HELX_P HELX_P2  AA2 VAL A 49  ? ASP A 64  ? VAL A 29  ASP A 44  1 ? 16 
HELX_P HELX_P3  AA3 GLY A 73  ? GLY A 79  ? GLY A 53  GLY A 59  1 ? 7  
HELX_P HELX_P4  AA4 ASN A 93  ? ASP A 99  ? ASN A 73  ASP A 79  1 ? 7  
HELX_P HELX_P5  AA5 THR A 107 ? HIS A 129 ? THR A 87  HIS A 109 1 ? 23 
HELX_P HELX_P6  AA6 ARG A 162 ? ASN A 178 ? ARG A 142 ASN A 158 1 ? 17 
HELX_P HELX_P7  AA7 PRO A 180 ? THR A 195 ? PRO A 160 THR A 175 1 ? 16 
HELX_P HELX_P8  AA8 THR A 207 ? ARG A 222 ? THR A 187 ARG A 202 1 ? 16 
HELX_P HELX_P9  AA9 PRO A 229 ? ILE A 233 ? PRO A 209 ILE A 213 5 ? 5  
HELX_P HELX_P10 AB1 ASP A 234 ? VAL A 238 ? ASP A 214 VAL A 218 5 ? 5  
HELX_P HELX_P11 AB2 GLY A 254 ? GLU A 271 ? GLY A 234 GLU A 251 1 ? 18 
HELX_P HELX_P12 AB3 GLU A 290 ? ASP A 293 ? GLU A 270 ASP A 273 5 ? 4  
HELX_P HELX_P13 AB4 THR A 295 ? ALA A 302 ? THR A 275 ALA A 282 1 ? 8  
HELX_P HELX_P14 AB5 THR A 330 ? ALA A 348 ? THR A 310 ALA A 328 1 ? 19 
HELX_P HELX_P15 AB6 SER B 24  ? PHE B 36  ? SER B 4   PHE B 16  1 ? 13 
HELX_P HELX_P16 AB7 ASP B 50  ? ASP B 64  ? ASP B 30  ASP B 44  1 ? 15 
HELX_P HELX_P17 AB8 GLY B 73  ? GLY B 79  ? GLY B 53  GLY B 59  1 ? 7  
HELX_P HELX_P18 AB9 ASN B 93  ? ASP B 99  ? ASN B 73  ASP B 79  1 ? 7  
HELX_P HELX_P19 AC1 THR B 107 ? HIS B 129 ? THR B 87  HIS B 109 1 ? 23 
HELX_P HELX_P20 AC2 ARG B 162 ? ASN B 178 ? ARG B 142 ASN B 158 1 ? 17 
HELX_P HELX_P21 AC3 CYS B 181 ? THR B 195 ? CYS B 161 THR B 175 1 ? 15 
HELX_P HELX_P22 AC4 THR B 207 ? ARG B 222 ? THR B 187 ARG B 202 1 ? 16 
HELX_P HELX_P23 AC5 PRO B 229 ? ILE B 233 ? PRO B 209 ILE B 213 5 ? 5  
HELX_P HELX_P24 AC6 ASP B 234 ? VAL B 238 ? ASP B 214 VAL B 218 5 ? 5  
HELX_P HELX_P25 AC7 GLY B 254 ? GLU B 271 ? GLY B 234 GLU B 251 1 ? 18 
HELX_P HELX_P26 AC8 GLU B 290 ? ASP B 293 ? GLU B 270 ASP B 273 5 ? 4  
HELX_P HELX_P27 AC9 THR B 295 ? ASN B 305 ? THR B 275 ASN B 285 1 ? 11 
HELX_P HELX_P28 AD1 THR B 330 ? ALA B 348 ? THR B 310 ALA B 328 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 86  OD1   ? ? ? 1_555 F MG  . MG ? ? A ASP 66  A MG  502 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc2  metalc ? ? A ASP 88  OD2   ? ? ? 1_555 F MG  . MG ? ? A ASP 68  A MG  502 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc3  metalc ? ? B ASP 86  OD1   ? ? ? 1_555 H MG  . MG ? ? B ASP 66  B MG  402 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc4  metalc ? ? B ASP 86  OD2   ? ? ? 1_555 I MG  . MG ? ? B ASP 66  B MG  403 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc5  metalc ? ? B ASP 88  OD2   ? ? ? 1_555 H MG  . MG ? ? B ASP 68  B MG  402 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc6  metalc ? ? B ASP 156 OD1   ? ? ? 1_555 I MG  . MG ? ? B ASP 136 B MG  403 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc7  metalc ? ? C U   2   "O3'" ? ? ? 1_555 J MG  . MG ? ? Y U   2   Y MG  101 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc8  metalc ? ? D U   2   "O3'" ? ? ? 1_555 K MG  . MG ? ? Z U   2   Z MG  101 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc9  metalc ? ? E UTP .   O1A   ? ? ? 1_555 F MG  . MG ? ? A UTP 501 A MG  502 1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc10 metalc ? ? E UTP .   O1A   ? ? ? 1_555 J MG  . MG ? ? A UTP 501 Y MG  101 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc11 metalc ? ? E UTP .   O1B   ? ? ? 1_555 F MG  . MG ? ? A UTP 501 A MG  502 1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc12 metalc ? ? E UTP .   O3G   ? ? ? 1_555 F MG  . MG ? ? A UTP 501 A MG  502 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc13 metalc ? ? F MG  .   MG    ? ? ? 1_555 L HOH . O  ? ? A MG  502 A HOH 602 1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc14 metalc ? ? F MG  .   MG    ? ? ? 1_555 L HOH . O  ? ? A MG  502 A HOH 638 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc15 metalc ? ? G UTP .   O1A   ? ? ? 1_555 H MG  . MG ? ? B UTP 401 B MG  402 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc16 metalc ? ? G UTP .   O1A   ? ? ? 1_555 K MG  . MG ? ? B UTP 401 Z MG  101 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc17 metalc ? ? G UTP .   O1B   ? ? ? 1_555 H MG  . MG ? ? B UTP 401 B MG  402 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc18 metalc ? ? G UTP .   O3G   ? ? ? 1_555 H MG  . MG ? ? B UTP 401 B MG  402 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc19 metalc ? ? H MG  .   MG    ? ? ? 1_555 M HOH . O  ? ? B MG  402 B HOH 507 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc20 metalc ? ? H MG  .   MG    ? ? ? 1_555 M HOH . O  ? ? B MG  402 B HOH 508 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc21 metalc ? ? J MG  .   MG    ? ? ? 1_555 L HOH . O  ? ? Y MG  101 A HOH 613 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc22 metalc ? ? J MG  .   MG    ? ? ? 1_555 N HOH . O  ? ? Y MG  101 Y HOH 205 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc23 metalc ? ? J MG  .   MG    ? ? ? 1_555 L HOH . O  ? ? Y MG  101 A HOH 602 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc24 metalc ? ? J MG  .   MG    ? ? ? 1_555 L HOH . O  ? ? Y MG  101 A HOH 649 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc25 metalc ? ? J MG  .   MG    ? ? ? 1_555 L HOH . O  ? ? Y MG  101 A HOH 610 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc26 metalc ? ? K MG  .   MG    ? ? ? 1_555 M HOH . O  ? ? Z MG  101 B HOH 507 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc27 metalc ? ? K MG  .   MG    ? ? ? 1_555 M HOH . O  ? ? Z MG  101 B HOH 505 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc28 metalc ? ? K MG  .   MG    ? ? ? 1_555 M HOH . O  ? ? Z MG  101 B HOH 506 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc29 metalc ? ? K MG  .   MG    ? ? ? 1_555 M HOH . O  ? ? Z MG  101 B HOH 527 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc30 metalc ? ? K MG  .   MG    ? ? ? 1_555 O HOH . O  ? ? Z MG  101 Z HOH 202 1_555 ? ? ? ? ? ? ? 2.211 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? parallel      
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 68  ? PHE A 72  ? ARG A 48  PHE A 52  
AA1 2 VAL A 87  ? LEU A 92  ? VAL A 67  LEU A 72  
AA1 3 VAL A 153 ? ALA A 159 ? VAL A 133 ALA A 139 
AA1 4 VAL A 144 ? GLY A 149 ? VAL A 124 GLY A 129 
AA1 5 ASN A 133 ? VAL A 137 ? ASN A 113 VAL A 117 
AA2 1 GLN A 277 ? VAL A 278 ? GLN A 257 VAL A 258 
AA2 2 THR A 287 ? THR A 288 ? THR A 267 THR A 268 
AA3 1 ARG B 68  ? PHE B 72  ? ARG B 48  PHE B 52  
AA3 2 VAL B 87  ? LEU B 92  ? VAL B 67  LEU B 72  
AA3 3 PHE B 155 ? ALA B 159 ? PHE B 135 ALA B 139 
AA3 4 VAL B 144 ? LYS B 148 ? VAL B 124 LYS B 128 
AA3 5 ASN B 133 ? VAL B 137 ? ASN B 113 VAL B 117 
AA4 1 GLN B 277 ? VAL B 278 ? GLN B 257 VAL B 258 
AA4 2 THR B 287 ? THR B 288 ? THR B 267 THR B 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 68  ? N ARG A 48  O LEU A 92  ? O LEU A 72  
AA1 2 3 N PHE A 89  ? N PHE A 69  O ASP A 156 ? O ASP A 136 
AA1 3 4 O PHE A 155 ? O PHE A 135 N VAL A 147 ? N VAL A 127 
AA1 4 5 O LYS A 148 ? O LYS A 128 N ASN A 133 ? N ASN A 113 
AA2 1 2 N VAL A 278 ? N VAL A 258 O THR A 287 ? O THR A 267 
AA3 1 2 N TYR B 70  ? N TYR B 50  O VAL B 90  ? O VAL B 70  
AA3 2 3 N PHE B 89  ? N PHE B 69  O ASP B 156 ? O ASP B 136 
AA3 3 4 O PHE B 155 ? O PHE B 135 N VAL B 147 ? N VAL B 127 
AA3 4 5 O ARG B 146 ? O ARG B 126 N GLU B 135 ? N GLU B 115 
AA4 1 2 N VAL B 278 ? N VAL B 258 O THR B 287 ? O THR B 267 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A UTP 501 ? 22 'binding site for residue UTP A 501' 
AC2 Software A MG  502 ? 5  'binding site for residue MG A 502'  
AC3 Software B UTP 401 ? 21 'binding site for residue UTP B 401' 
AC4 Software B MG  402 ? 6  'binding site for residue MG B 402'  
AC5 Software B MG  403 ? 3  'binding site for residue MG B 403'  
AC6 Software Y MG  101 ? 7  'binding site for residue MG Y 101'  
AC7 Software Z MG  101 ? 8  'binding site for residue MG Z 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 PHE A 72  ? PHE A 52  . ? 1_555 ? 
2  AC1 22 SER A 74  ? SER A 54  . ? 1_555 ? 
3  AC1 22 SER A 85  ? SER A 65  . ? 1_555 ? 
4  AC1 22 ASP A 86  ? ASP A 66  . ? 1_555 ? 
5  AC1 22 ASP A 88  ? ASP A 68  . ? 1_555 ? 
6  AC1 22 GLY A 164 ? GLY A 144 . ? 1_555 ? 
7  AC1 22 ASN A 167 ? ASN A 147 . ? 1_555 ? 
8  AC1 22 SER A 168 ? SER A 148 . ? 1_555 ? 
9  AC1 22 LYS A 189 ? LYS A 169 . ? 1_555 ? 
10 AC1 22 LYS A 193 ? LYS A 173 . ? 1_555 ? 
11 AC1 22 SER A 208 ? SER A 188 . ? 1_555 ? 
12 AC1 22 TYR A 209 ? TYR A 189 . ? 1_555 ? 
13 AC1 22 MG  F .   ? MG  A 502 . ? 1_555 ? 
14 AC1 22 HOH L .   ? HOH A 602 . ? 1_555 ? 
15 AC1 22 HOH L .   ? HOH A 603 . ? 1_555 ? 
16 AC1 22 HOH L .   ? HOH A 610 . ? 1_555 ? 
17 AC1 22 HOH L .   ? HOH A 613 . ? 1_555 ? 
18 AC1 22 HOH L .   ? HOH A 624 . ? 1_555 ? 
19 AC1 22 HOH L .   ? HOH A 636 . ? 1_555 ? 
20 AC1 22 HOH L .   ? HOH A 638 . ? 1_555 ? 
21 AC1 22 U   C 2   ? U   Y 2   . ? 1_555 ? 
22 AC1 22 MG  J .   ? MG  Y 101 . ? 1_555 ? 
23 AC2 5  ASP A 86  ? ASP A 66  . ? 1_555 ? 
24 AC2 5  ASP A 88  ? ASP A 68  . ? 1_555 ? 
25 AC2 5  UTP E .   ? UTP A 501 . ? 1_555 ? 
26 AC2 5  HOH L .   ? HOH A 602 . ? 1_555 ? 
27 AC2 5  HOH L .   ? HOH A 638 . ? 1_555 ? 
28 AC3 21 PHE B 72  ? PHE B 52  . ? 1_555 ? 
29 AC3 21 SER B 74  ? SER B 54  . ? 1_555 ? 
30 AC3 21 SER B 85  ? SER B 65  . ? 1_555 ? 
31 AC3 21 ASP B 86  ? ASP B 66  . ? 1_555 ? 
32 AC3 21 ASP B 88  ? ASP B 68  . ? 1_555 ? 
33 AC3 21 GLY B 164 ? GLY B 144 . ? 1_555 ? 
34 AC3 21 ASN B 167 ? ASN B 147 . ? 1_555 ? 
35 AC3 21 SER B 168 ? SER B 148 . ? 1_555 ? 
36 AC3 21 LYS B 189 ? LYS B 169 . ? 1_555 ? 
37 AC3 21 LYS B 193 ? LYS B 173 . ? 1_555 ? 
38 AC3 21 SER B 208 ? SER B 188 . ? 1_555 ? 
39 AC3 21 TYR B 209 ? TYR B 189 . ? 1_555 ? 
40 AC3 21 MG  H .   ? MG  B 402 . ? 1_555 ? 
41 AC3 21 HOH M .   ? HOH B 505 . ? 1_555 ? 
42 AC3 21 HOH M .   ? HOH B 506 . ? 1_555 ? 
43 AC3 21 HOH M .   ? HOH B 507 . ? 1_555 ? 
44 AC3 21 HOH M .   ? HOH B 508 . ? 1_555 ? 
45 AC3 21 HOH M .   ? HOH B 524 . ? 1_555 ? 
46 AC3 21 HOH M .   ? HOH B 526 . ? 1_555 ? 
47 AC3 21 U   D 2   ? U   Z 2   . ? 1_555 ? 
48 AC3 21 MG  K .   ? MG  Z 101 . ? 1_555 ? 
49 AC4 6  ASP B 86  ? ASP B 66  . ? 1_555 ? 
50 AC4 6  ASP B 88  ? ASP B 68  . ? 1_555 ? 
51 AC4 6  UTP G .   ? UTP B 401 . ? 1_555 ? 
52 AC4 6  HOH M .   ? HOH B 507 . ? 1_555 ? 
53 AC4 6  HOH M .   ? HOH B 508 . ? 1_555 ? 
54 AC4 6  MG  K .   ? MG  Z 101 . ? 1_555 ? 
55 AC5 3  ASP B 86  ? ASP B 66  . ? 1_555 ? 
56 AC5 3  ARG B 146 ? ARG B 126 . ? 1_555 ? 
57 AC5 3  ASP B 156 ? ASP B 136 . ? 1_555 ? 
58 AC6 7  UTP E .   ? UTP A 501 . ? 1_555 ? 
59 AC6 7  HOH L .   ? HOH A 602 . ? 1_555 ? 
60 AC6 7  HOH L .   ? HOH A 610 . ? 1_555 ? 
61 AC6 7  HOH L .   ? HOH A 613 . ? 1_555 ? 
62 AC6 7  HOH L .   ? HOH A 649 . ? 1_555 ? 
63 AC6 7  U   C 2   ? U   Y 2   . ? 1_555 ? 
64 AC6 7  HOH N .   ? HOH Y 205 . ? 1_555 ? 
65 AC7 8  UTP G .   ? UTP B 401 . ? 1_555 ? 
66 AC7 8  MG  H .   ? MG  B 402 . ? 1_555 ? 
67 AC7 8  HOH M .   ? HOH B 505 . ? 1_555 ? 
68 AC7 8  HOH M .   ? HOH B 506 . ? 1_555 ? 
69 AC7 8  HOH M .   ? HOH B 507 . ? 1_555 ? 
70 AC7 8  HOH M .   ? HOH B 527 . ? 1_555 ? 
71 AC7 8  U   D 2   ? U   Z 2   . ? 1_555 ? 
72 AC7 8  HOH O .   ? HOH Z 202 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KAL 
_atom_sites.fract_transf_matrix[1][1]   0.012094 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000856 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023323 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009145 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N      . PRO A 1 22  ? 34.556  41.433 -21.718  1.00 81.07  ? 2   PRO A N      1 
ATOM   2     C  CA     . PRO A 1 22  ? 34.850  40.011 -21.926  1.00 79.43  ? 2   PRO A CA     1 
ATOM   3     C  C      . PRO A 1 22  ? 33.742  39.112 -21.375  1.00 75.93  ? 2   PRO A C      1 
ATOM   4     O  O      . PRO A 1 22  ? 33.863  38.607 -20.258  1.00 76.91  ? 2   PRO A O      1 
ATOM   5     C  CB     . PRO A 1 22  ? 36.168  39.808 -21.165  1.00 80.74  ? 2   PRO A CB     1 
ATOM   6     C  CG     . PRO A 1 22  ? 36.781  41.165 -21.093  1.00 81.60  ? 2   PRO A CG     1 
ATOM   7     C  CD     . PRO A 1 22  ? 35.635  42.121 -20.989  1.00 81.84  ? 2   PRO A CD     1 
ATOM   8     H  HA     . PRO A 1 22  ? 34.986  39.823 -22.868  1.00 95.44  ? 2   PRO A HA     1 
ATOM   9     H  HB2    . PRO A 1 22  ? 35.983  39.467 -20.276  1.00 97.01  ? 2   PRO A HB2    1 
ATOM   10    H  HB3    . PRO A 1 22  ? 36.740  39.198 -21.657  1.00 97.01  ? 2   PRO A HB3    1 
ATOM   11    H  HG2    . PRO A 1 22  ? 37.348  41.225 -20.308  1.00 98.03  ? 2   PRO A HG2    1 
ATOM   12    H  HG3    . PRO A 1 22  ? 37.295  41.333 -21.898  1.00 98.03  ? 2   PRO A HG3    1 
ATOM   13    H  HD2    . PRO A 1 22  ? 35.387  42.253 -20.061  1.00 98.33  ? 2   PRO A HD2    1 
ATOM   14    H  HD3    . PRO A 1 22  ? 35.855  42.961 -21.423  1.00 98.33  ? 2   PRO A HD3    1 
ATOM   15    N  N      . PRO A 1 23  ? 32.672  38.922 -22.147  1.00 73.49  ? 3   PRO A N      1 
ATOM   16    C  CA     . PRO A 1 23  ? 31.542  38.130 -21.646  1.00 68.33  ? 3   PRO A CA     1 
ATOM   17    C  C      . PRO A 1 23  ? 31.958  36.715 -21.277  1.00 62.56  ? 3   PRO A C      1 
ATOM   18    O  O      . PRO A 1 23  ? 32.897  36.147 -21.841  1.00 63.40  ? 3   PRO A O      1 
ATOM   19    C  CB     . PRO A 1 23  ? 30.557  38.130 -22.822  1.00 67.97  ? 3   PRO A CB     1 
ATOM   20    C  CG     . PRO A 1 23  ? 30.935  39.309 -23.648  1.00 71.26  ? 3   PRO A CG     1 
ATOM   21    C  CD     . PRO A 1 23  ? 32.417  39.459 -23.494  1.00 73.64  ? 3   PRO A CD     1 
ATOM   22    H  HA     . PRO A 1 23  ? 31.135  38.563 -20.879  1.00 82.11  ? 3   PRO A HA     1 
ATOM   23    H  HB2    . PRO A 1 23  ? 30.656  37.310 -23.330  1.00 81.68  ? 3   PRO A HB2    1 
ATOM   24    H  HB3    . PRO A 1 23  ? 29.651  38.221 -22.489  1.00 81.68  ? 3   PRO A HB3    1 
ATOM   25    H  HG2    . PRO A 1 23  ? 30.703  39.143 -24.575  1.00 85.63  ? 3   PRO A HG2    1 
ATOM   26    H  HG3    . PRO A 1 23  ? 30.476  40.097 -23.317  1.00 85.63  ? 3   PRO A HG3    1 
ATOM   27    H  HD2    . PRO A 1 23  ? 32.882  38.932 -24.163  1.00 88.48  ? 3   PRO A HD2    1 
ATOM   28    H  HD3    . PRO A 1 23  ? 32.670  40.395 -23.539  1.00 88.48  ? 3   PRO A HD3    1 
ATOM   29    N  N      . SER A 1 24  ? 31.239  36.148 -20.317  1.00 58.38  ? 4   SER A N      1 
ATOM   30    C  CA     . SER A 1 24  ? 31.446  34.776 -19.890  1.00 51.91  ? 4   SER A CA     1 
ATOM   31    C  C      . SER A 1 24  ? 30.612  33.829 -20.739  1.00 46.94  ? 4   SER A C      1 
ATOM   32    O  O      . SER A 1 24  ? 29.686  34.254 -21.436  1.00 46.42  ? 4   SER A O      1 
ATOM   33    C  CB     . SER A 1 24  ? 31.075  34.624 -18.417  1.00 54.66  ? 4   SER A CB     1 
ATOM   34    O  OG     . SER A 1 24  ? 29.721  34.978 -18.195  1.00 54.78  ? 4   SER A OG     1 
ATOM   35    H  H      . SER A 1 24  ? 30.610  36.549 -19.889  1.00 70.18  ? 4   SER A H      1 
ATOM   36    H  HA     . SER A 1 24  ? 32.382  34.542 -19.997  1.00 62.42  ? 4   SER A HA     1 
ATOM   37    H  HB2    . SER A 1 24  ? 31.207  33.701 -18.152  1.00 65.71  ? 4   SER A HB2    1 
ATOM   38    H  HB3    . SER A 1 24  ? 31.643  35.206 -17.887  1.00 65.71  ? 4   SER A HB3    1 
ATOM   39    H  HG     . SER A 1 24  ? 29.530  34.890 -17.382  1.00 65.85  ? 4   SER A HG     1 
ATOM   40    N  N      . PRO A 1 25  ? 30.917  32.528 -20.708  1.00 43.56  ? 5   PRO A N      1 
ATOM   41    C  CA     . PRO A 1 25  ? 30.091  31.578 -21.474  1.00 44.99  ? 5   PRO A CA     1 
ATOM   42    C  C      . PRO A 1 25  ? 28.616  31.651 -21.119  1.00 48.12  ? 5   PRO A C      1 
ATOM   43    O  O      . PRO A 1 25  ? 27.757  31.495 -21.999  1.00 51.67  ? 5   PRO A O      1 
ATOM   44    C  CB     . PRO A 1 25  ? 30.703  30.217 -21.113  1.00 42.76  ? 5   PRO A CB     1 
ATOM   45    C  CG     . PRO A 1 25  ? 32.107  30.525 -20.710  1.00 42.64  ? 5   PRO A CG     1 
ATOM   46    C  CD     . PRO A 1 25  ? 32.056  31.868 -20.048  1.00 43.34  ? 5   PRO A CD     1 
ATOM   47    H  HA     . PRO A 1 25  ? 30.198  31.734 -22.426  1.00 54.11  ? 5   PRO A HA     1 
ATOM   48    H  HB2    . PRO A 1 25  ? 30.212  29.822 -20.376  1.00 51.43  ? 5   PRO A HB2    1 
ATOM   49    H  HB3    . PRO A 1 25  ? 30.688  29.634 -21.889  1.00 51.43  ? 5   PRO A HB3    1 
ATOM   50    H  HG2    . PRO A 1 25  ? 32.422  29.850 -20.089  1.00 51.29  ? 5   PRO A HG2    1 
ATOM   51    H  HG3    . PRO A 1 25  ? 32.672  30.555 -21.498  1.00 51.29  ? 5   PRO A HG3    1 
ATOM   52    H  HD2    . PRO A 1 25  ? 31.886  31.770 -19.098  1.00 52.13  ? 5   PRO A HD2    1 
ATOM   53    H  HD3    . PRO A 1 25  ? 32.875  32.360 -20.215  1.00 52.13  ? 5   PRO A HD3    1 
ATOM   54    N  N      . ALA A 1 26  ? 28.298  31.904 -19.847  1.00 46.32  ? 6   ALA A N      1 
ATOM   55    C  CA     . ALA A 1 26  ? 26.902  31.940 -19.423  1.00 45.28  ? 6   ALA A CA     1 
ATOM   56    C  C      . ALA A 1 26  ? 26.151  33.088 -20.083  1.00 45.95  ? 6   ALA A C      1 
ATOM   57    O  O      . ALA A 1 26  ? 25.004  32.919 -20.514  1.00 44.57  ? 6   ALA A O      1 
ATOM   58    C  CB     . ALA A 1 26  ? 26.822  32.053 -17.902  1.00 47.08  ? 6   ALA A CB     1 
ATOM   59    H  H      . ALA A 1 26  ? 28.866  32.055 -19.220  1.00 55.71  ? 6   ALA A H      1 
ATOM   60    H  HA     . ALA A 1 26  ? 26.472  31.111 -19.685  1.00 54.45  ? 6   ALA A HA     1 
ATOM   61    H  HB1    . ALA A 1 26  ? 25.889  32.076 -17.636  1.00 56.61  ? 6   ALA A HB1    1 
ATOM   62    H  HB2    . ALA A 1 26  ? 27.260  31.284 -17.505  1.00 56.61  ? 6   ALA A HB2    1 
ATOM   63    H  HB3    . ALA A 1 26  ? 27.266  32.869 -17.622  1.00 56.61  ? 6   ALA A HB3    1 
ATOM   64    N  N      . VAL A 1 27  ? 26.777  34.263 -20.173  1.00 50.00  ? 7   VAL A N      1 
ATOM   65    C  CA     . VAL A 1 27  ? 26.113  35.414 -20.778  1.00 52.04  ? 7   VAL A CA     1 
ATOM   66    C  C      . VAL A 1 27  ? 25.859  35.160 -22.260  1.00 47.91  ? 7   VAL A C      1 
ATOM   67    O  O      . VAL A 1 27  ? 24.760  35.410 -22.770  1.00 48.56  ? 7   VAL A O      1 
ATOM   68    C  CB     . VAL A 1 27  ? 26.950  36.688 -20.556  1.00 54.12  ? 7   VAL A CB     1 
ATOM   69    C  CG1    . VAL A 1 27  ? 26.263  37.902 -21.170  1.00 55.85  ? 7   VAL A CG1    1 
ATOM   70    C  CG2    . VAL A 1 27  ? 27.194  36.913 -19.068  1.00 54.08  ? 7   VAL A CG2    1 
ATOM   71    H  H      . VAL A 1 27  ? 27.576  34.417 -19.894  1.00 60.12  ? 7   VAL A H      1 
ATOM   72    H  HA     . VAL A 1 27  ? 25.254  35.544 -20.347  1.00 62.56  ? 7   VAL A HA     1 
ATOM   73    H  HB     . VAL A 1 27  ? 27.811  36.580 -20.988  1.00 65.06  ? 7   VAL A HB     1 
ATOM   74    H  HG11   . VAL A 1 27  ? 26.811  38.687 -21.015  1.00 67.13  ? 7   VAL A HG11   1 
ATOM   75    H  HG12   . VAL A 1 27  ? 26.156  37.756 -22.123  1.00 67.13  ? 7   VAL A HG12   1 
ATOM   76    H  HG13   . VAL A 1 27  ? 25.394  38.017 -20.754  1.00 67.13  ? 7   VAL A HG13   1 
ATOM   77    H  HG21   . VAL A 1 27  ? 27.721  37.719 -18.953  1.00 65.01  ? 7   VAL A HG21   1 
ATOM   78    H  HG22   . VAL A 1 27  ? 26.339  37.010 -18.619  1.00 65.01  ? 7   VAL A HG22   1 
ATOM   79    H  HG23   . VAL A 1 27  ? 27.672  36.150 -18.708  1.00 65.01  ? 7   VAL A HG23   1 
ATOM   80    N  N      . VAL A 1 28  ? 26.870  34.655 -22.971  1.00 42.93  ? 8   VAL A N      1 
ATOM   81    C  CA     . VAL A 1 28  ? 26.701  34.316 -24.383  1.00 43.16  ? 8   VAL A CA     1 
ATOM   82    C  C      . VAL A 1 28  ? 25.553  33.326 -24.556  1.00 45.06  ? 8   VAL A C      1 
ATOM   83    O  O      . VAL A 1 28  ? 24.674  33.504 -25.412  1.00 44.67  ? 8   VAL A O      1 
ATOM   84    C  CB     . VAL A 1 28  ? 28.018  33.760 -24.956  1.00 42.53  ? 8   VAL A CB     1 
ATOM   85    C  CG1    . VAL A 1 28  ? 27.847  33.336 -26.409  1.00 41.69  ? 8   VAL A CG1    1 
ATOM   86    C  CG2    . VAL A 1 28  ? 29.131  34.794 -24.831  1.00 42.99  ? 8   VAL A CG2    1 
ATOM   87    H  H      . VAL A 1 28  ? 27.657  34.500 -22.661  1.00 51.64  ? 8   VAL A H      1 
ATOM   88    H  HA     . VAL A 1 28  ? 26.477  35.121 -24.875  1.00 51.91  ? 8   VAL A HA     1 
ATOM   89    H  HB     . VAL A 1 28  ? 28.278  32.978 -24.446  1.00 51.15  ? 8   VAL A HB     1 
ATOM   90    H  HG11   . VAL A 1 28  ? 28.692  32.992 -26.738  1.00 50.14  ? 8   VAL A HG11   1 
ATOM   91    H  HG12   . VAL A 1 28  ? 27.166  32.647 -26.458  1.00 50.14  ? 8   VAL A HG12   1 
ATOM   92    H  HG13   . VAL A 1 28  ? 27.576  34.107 -26.932  1.00 50.14  ? 8   VAL A HG13   1 
ATOM   93    H  HG21   . VAL A 1 28  ? 29.949  34.422 -25.198  1.00 51.70  ? 8   VAL A HG21   1 
ATOM   94    H  HG22   . VAL A 1 28  ? 28.879  35.590 -25.324  1.00 51.70  ? 8   VAL A HG22   1 
ATOM   95    H  HG23   . VAL A 1 28  ? 29.257  35.010 -23.894  1.00 51.70  ? 8   VAL A HG23   1 
ATOM   96    N  N      . GLY A 1 29  ? 25.536  32.276 -23.731  1.00 44.03  ? 9   GLY A N      1 
ATOM   97    C  CA     . GLY A 1 29  ? 24.465  31.295 -23.816  1.00 46.92  ? 9   GLY A CA     1 
ATOM   98    C  C      . GLY A 1 29  ? 23.097  31.917 -23.615  1.00 50.42  ? 9   GLY A C      1 
ATOM   99    O  O      . GLY A 1 29  ? 22.171  31.693 -24.401  1.00 53.64  ? 9   GLY A O      1 
ATOM   100   H  H      . GLY A 1 29  ? 26.124  32.115 -23.124  1.00 52.95  ? 9   GLY A H      1 
ATOM   101   H  HA2    . GLY A 1 29  ? 24.484  30.871 -24.688  1.00 56.43  ? 9   GLY A HA2    1 
ATOM   102   H  HA3    . GLY A 1 29  ? 24.596  30.614 -23.139  1.00 56.43  ? 9   GLY A HA3    1 
ATOM   103   N  N      . ARG A 1 30  ? 22.956  32.716 -22.556  1.00 52.58  ? 10  ARG A N      1 
ATOM   104   C  CA     . ARG A 1 30  ? 21.682  33.368 -22.279  1.00 54.70  ? 10  ARG A CA     1 
ATOM   105   C  C      . ARG A 1 30  ? 21.246  34.230 -23.456  1.00 42.15  ? 10  ARG A C      1 
ATOM   106   O  O      . ARG A 1 30  ? 20.068  34.232 -23.834  1.00 36.69  ? 10  ARG A O      1 
ATOM   107   C  CB     . ARG A 1 30  ? 21.804  34.204 -21.005  1.00 74.72  ? 10  ARG A CB     1 
ATOM   108   C  CG     . ARG A 1 30  ? 20.493  34.467 -20.284  1.00 93.41  ? 10  ARG A CG     1 
ATOM   109   C  CD     . ARG A 1 30  ? 20.627  34.179 -18.795  1.00 108.06 ? 10  ARG A CD     1 
ATOM   110   N  NE     . ARG A 1 30  ? 19.625  34.882 -17.999  1.00 119.80 ? 10  ARG A NE     1 
ATOM   111   C  CZ     . ARG A 1 30  ? 19.785  36.101 -17.489  1.00 127.89 ? 10  ARG A CZ     1 
ATOM   112   N  NH1    . ARG A 1 30  ? 20.910  36.775 -17.687  1.00 130.16 ? 10  ARG A NH1    1 
ATOM   113   N  NH2    . ARG A 1 30  ? 18.811  36.652 -16.776  1.00 131.16 ? 10  ARG A NH2    1 
ATOM   114   H  H      . ARG A 1 30  ? 23.578  32.894 -21.990  1.00 63.21  ? 10  ARG A H      1 
ATOM   115   H  HA     . ARG A 1 30  ? 21.004  32.690 -22.132  1.00 65.76  ? 10  ARG A HA     1 
ATOM   116   H  HB2    . ARG A 1 30  ? 22.390  33.740 -20.387  1.00 89.79  ? 10  ARG A HB2    1 
ATOM   117   H  HB3    . ARG A 1 30  ? 22.189  35.063 -21.236  1.00 89.79  ? 10  ARG A HB3    1 
ATOM   118   H  HG2    . ARG A 1 30  ? 20.246  35.399 -20.394  1.00 112.21 ? 10  ARG A HG2    1 
ATOM   119   H  HG3    . ARG A 1 30  ? 19.804  33.889 -20.646  1.00 112.21 ? 10  ARG A HG3    1 
ATOM   120   H  HD2    . ARG A 1 30  ? 20.517  33.227 -18.644  1.00 129.79 ? 10  ARG A HD2    1 
ATOM   121   H  HD3    . ARG A 1 30  ? 21.504  34.465 -18.494  1.00 129.79 ? 10  ARG A HD3    1 
ATOM   122   H  HE     . ARG A 1 30  ? 18.880  34.481 -17.849  1.00 143.88 ? 10  ARG A HE     1 
ATOM   123   H  HH11   . ARG A 1 30  ? 21.546  36.424 -18.148  1.00 156.31 ? 10  ARG A HH11   1 
ATOM   124   H  HH12   . ARG A 1 30  ? 21.005  37.562 -17.354  1.00 156.31 ? 10  ARG A HH12   1 
ATOM   125   H  HH21   . ARG A 1 30  ? 18.078  36.221 -16.644  1.00 157.51 ? 10  ARG A HH21   1 
ATOM   126   H  HH22   . ARG A 1 30  ? 18.912  37.440 -16.447  1.00 157.51 ? 10  ARG A HH22   1 
ATOM   127   N  N      . SER A 1 31  ? 22.185  34.963 -24.056  1.00 40.98  ? 11  SER A N      1 
ATOM   128   C  CA     . SER A 1 31  ? 21.856  35.786 -25.214  1.00 43.74  ? 11  SER A CA     1 
ATOM   129   C  C      . SER A 1 31  ? 21.330  34.931 -26.361  1.00 41.92  ? 11  SER A C      1 
ATOM   130   O  O      . SER A 1 31  ? 20.311  35.260 -26.979  1.00 40.74  ? 11  SER A O      1 
ATOM   131   C  CB     . SER A 1 31  ? 23.088  36.578 -25.656  1.00 48.68  ? 11  SER A CB     1 
ATOM   132   O  OG     . SER A 1 31  ? 23.704  37.226 -24.557  1.00 54.87  ? 11  SER A OG     1 
ATOM   133   H  H      . SER A 1 31  ? 23.010  34.999 -23.814  1.00 49.30  ? 11  SER A H      1 
ATOM   134   H  HA     . SER A 1 31  ? 21.163  36.419 -24.967  1.00 52.60  ? 11  SER A HA     1 
ATOM   135   H  HB2    . SER A 1 31  ? 23.725  35.969 -26.060  1.00 58.53  ? 11  SER A HB2    1 
ATOM   136   H  HB3    . SER A 1 31  ? 22.815  37.248 -26.303  1.00 58.53  ? 11  SER A HB3    1 
ATOM   137   H  HG     . SER A 1 31  ? 23.947  36.657 -23.988  1.00 65.96  ? 11  SER A HG     1 
ATOM   138   N  N      . LEU A 1 32  ? 22.014  33.822 -26.657  1.00 40.86  ? 12  LEU A N      1 
ATOM   139   C  CA     . LEU A 1 32  ? 21.621  32.984 -27.787  1.00 40.38  ? 12  LEU A CA     1 
ATOM   140   C  C      . LEU A 1 32  ? 20.238  32.371 -27.568  1.00 47.15  ? 12  LEU A C      1 
ATOM   141   O  O      . LEU A 1 32  ? 19.332  32.509 -28.410  1.00 40.18  ? 12  LEU A O      1 
ATOM   142   C  CB     . LEU A 1 32  ? 22.681  31.900 -27.999  1.00 36.53  ? 12  LEU A CB     1 
ATOM   143   C  CG     . LEU A 1 32  ? 24.029  32.425 -28.510  1.00 34.76  ? 12  LEU A CG     1 
ATOM   144   C  CD1    . LEU A 1 32  ? 25.131  31.384 -28.357  1.00 33.19  ? 12  LEU A CD1    1 
ATOM   145   C  CD2    . LEU A 1 32  ? 23.932  32.877 -29.959  1.00 32.83  ? 12  LEU A CD2    1 
ATOM   146   H  H      . LEU A 1 32  ? 22.700  33.538 -26.223  1.00 49.16  ? 12  LEU A H      1 
ATOM   147   H  HA     . LEU A 1 32  ? 21.585  33.530 -28.589  1.00 48.57  ? 12  LEU A HA     1 
ATOM   148   H  HB2    . LEU A 1 32  ? 22.840  31.451 -27.154  1.00 43.96  ? 12  LEU A HB2    1 
ATOM   149   H  HB3    . LEU A 1 32  ? 22.347  31.262 -28.650  1.00 43.96  ? 12  LEU A HB3    1 
ATOM   150   H  HG     . LEU A 1 32  ? 24.280  33.197 -27.979  1.00 41.83  ? 12  LEU A HG     1 
ATOM   151   H  HD11   . LEU A 1 32  ? 25.963  31.755 -28.690  1.00 39.94  ? 12  LEU A HD11   1 
ATOM   152   H  HD12   . LEU A 1 32  ? 25.222  31.156 -27.419  1.00 39.94  ? 12  LEU A HD12   1 
ATOM   153   H  HD13   . LEU A 1 32  ? 24.892  30.595 -28.868  1.00 39.94  ? 12  LEU A HD13   1 
ATOM   154   H  HD21   . LEU A 1 32  ? 24.800  33.201 -30.246  1.00 39.52  ? 12  LEU A HD21   1 
ATOM   155   H  HD22   . LEU A 1 32  ? 23.662  32.123 -30.507  1.00 39.52  ? 12  LEU A HD22   1 
ATOM   156   H  HD23   . LEU A 1 32  ? 23.275  33.587 -30.024  1.00 39.52  ? 12  LEU A HD23   1 
ATOM   157   N  N      . VAL A 1 33  ? 20.048  31.707 -26.423  1.00 61.09  ? 13  VAL A N      1 
ATOM   158   C  CA     . VAL A 1 33  ? 18.749  31.112 -26.123  1.00 66.51  ? 13  VAL A CA     1 
ATOM   159   C  C      . VAL A 1 33  ? 17.664  32.177 -26.177  1.00 60.49  ? 13  VAL A C      1 
ATOM   160   O  O      . VAL A 1 33  ? 16.555  31.934 -26.668  1.00 57.02  ? 13  VAL A O      1 
ATOM   161   C  CB     . VAL A 1 33  ? 18.781  30.409 -24.752  1.00 69.85  ? 13  VAL A CB     1 
ATOM   162   C  CG1    . VAL A 1 33  ? 17.411  29.831 -24.415  1.00 71.49  ? 13  VAL A CG1    1 
ATOM   163   C  CG2    . VAL A 1 33  ? 19.838  29.315 -24.732  1.00 68.92  ? 13  VAL A CG2    1 
ATOM   164   H  H      . VAL A 1 33  ? 20.645  31.590 -25.816  1.00 73.43  ? 13  VAL A H      1 
ATOM   165   H  HA     . VAL A 1 33  ? 18.545  30.444 -26.797  1.00 79.93  ? 13  VAL A HA     1 
ATOM   166   H  HB     . VAL A 1 33  ? 19.008  31.059 -24.069  1.00 83.94  ? 13  VAL A HB     1 
ATOM   167   H  HG11   . VAL A 1 33  ? 17.457  29.395 -23.550  1.00 85.91  ? 13  VAL A HG11   1 
ATOM   168   H  HG12   . VAL A 1 33  ? 16.762  30.552 -24.389  1.00 85.91  ? 13  VAL A HG12   1 
ATOM   169   H  HG13   . VAL A 1 33  ? 17.163  29.188 -25.098  1.00 85.91  ? 13  VAL A HG13   1 
ATOM   170   H  HG21   . VAL A 1 33  ? 19.835  28.891 -23.859  1.00 82.83  ? 13  VAL A HG21   1 
ATOM   171   H  HG22   . VAL A 1 33  ? 19.629  28.662 -25.418  1.00 82.83  ? 13  VAL A HG22   1 
ATOM   172   H  HG23   . VAL A 1 33  ? 20.706  29.712 -24.904  1.00 82.83  ? 13  VAL A HG23   1 
ATOM   173   N  N      . ASN A 1 34  ? 17.968  33.375 -25.675  1.00 60.70  ? 14  ASN A N      1 
ATOM   174   C  CA     . ASN A 1 34  ? 17.007  34.468 -25.749  1.00 63.47  ? 14  ASN A CA     1 
ATOM   175   C  C      . ASN A 1 34  ? 16.706  34.851 -27.189  1.00 62.83  ? 14  ASN A C      1 
ATOM   176   O  O      . ASN A 1 34  ? 15.584  35.265 -27.499  1.00 63.71  ? 14  ASN A O      1 
ATOM   177   C  CB     . ASN A 1 34  ? 17.535  35.684 -24.990  1.00 68.73  ? 14  ASN A CB     1 
ATOM   178   C  CG     . ASN A 1 34  ? 16.615  36.882 -25.104  1.00 75.48  ? 14  ASN A CG     1 
ATOM   179   O  OD1    . ASN A 1 34  ? 15.588  36.959 -24.430  1.00 78.71  ? 14  ASN A OD1    1 
ATOM   180   N  ND2    . ASN A 1 34  ? 16.975  37.823 -25.972  1.00 77.38  ? 14  ASN A ND2    1 
ATOM   181   H  H      . ASN A 1 34  ? 18.712  33.576 -25.294  1.00 72.96  ? 14  ASN A H      1 
ATOM   182   H  HA     . ASN A 1 34  ? 16.177  34.189 -25.332  1.00 76.29  ? 14  ASN A HA     1 
ATOM   183   H  HB2    . ASN A 1 34  ? 17.620  35.458 -24.050  1.00 82.59  ? 14  ASN A HB2    1 
ATOM   184   H  HB3    . ASN A 1 34  ? 18.400  35.933 -25.352  1.00 82.59  ? 14  ASN A HB3    1 
ATOM   185   H  HD21   . ASN A 1 34  ? 16.487  38.523 -26.074  1.00 92.97  ? 14  ASN A HD21   1 
ATOM   186   H  HD22   . ASN A 1 34  ? 17.697  37.731 -26.431  1.00 92.97  ? 14  ASN A HD22   1 
ATOM   187   N  N      . SER A 1 35  ? 17.685  34.713 -28.085  1.00 62.04  ? 15  SER A N      1 
ATOM   188   C  CA     . SER A 1 35  ? 17.481  35.107 -29.471  1.00 63.39  ? 15  SER A CA     1 
ATOM   189   C  C      . SER A 1 35  ? 16.692  34.075 -30.261  1.00 61.82  ? 15  SER A C      1 
ATOM   190   O  O      . SER A 1 35  ? 16.128  34.419 -31.306  1.00 57.88  ? 15  SER A O      1 
ATOM   191   C  CB     . SER A 1 35  ? 18.826  35.349 -30.162  1.00 63.40  ? 15  SER A CB     1 
ATOM   192   O  OG     . SER A 1 35  ? 19.583  34.155 -30.246  1.00 63.45  ? 15  SER A OG     1 
ATOM   193   H  H      . SER A 1 35  ? 18.466  34.397 -27.914  1.00 74.56  ? 15  SER A H      1 
ATOM   194   H  HA     . SER A 1 35  ? 16.983  35.939 -29.490  1.00 76.19  ? 15  SER A HA     1 
ATOM   195   H  HB2    . SER A 1 35  ? 18.663  35.681 -31.059  1.00 76.20  ? 15  SER A HB2    1 
ATOM   196   H  HB3    . SER A 1 35  ? 19.328  36.004 -29.653  1.00 76.20  ? 15  SER A HB3    1 
ATOM   197   H  HG     . SER A 1 35  ? 19.733  33.855 -29.476  1.00 76.25  ? 15  SER A HG     1 
ATOM   198   N  N      . PHE A 1 36  ? 16.637  32.825 -29.802  1.00 64.87  ? 16  PHE A N      1 
ATOM   199   C  CA     . PHE A 1 36  ? 15.893  31.799 -30.528  1.00 67.45  ? 16  PHE A CA     1 
ATOM   200   C  C      . PHE A 1 36  ? 14.461  31.587 -30.036  1.00 79.80  ? 16  PHE A C      1 
ATOM   201   O  O      . PHE A 1 36  ? 13.785  30.692 -30.552  1.00 77.60  ? 16  PHE A O      1 
ATOM   202   C  CB     . PHE A 1 36  ? 16.637  30.461 -30.471  1.00 62.53  ? 16  PHE A CB     1 
ATOM   203   C  CG     . PHE A 1 36  ? 17.753  30.350 -31.465  1.00 58.17  ? 16  PHE A CG     1 
ATOM   204   C  CD1    . PHE A 1 36  ? 17.487  30.184 -32.814  1.00 56.23  ? 16  PHE A CD1    1 
ATOM   205   C  CD2    . PHE A 1 36  ? 19.071  30.394 -31.047  1.00 55.60  ? 16  PHE A CD2    1 
ATOM   206   C  CE1    . PHE A 1 36  ? 18.517  30.079 -33.731  1.00 52.86  ? 16  PHE A CE1    1 
ATOM   207   C  CE2    . PHE A 1 36  ? 20.103  30.287 -31.956  1.00 53.02  ? 16  PHE A CE2    1 
ATOM   208   C  CZ     . PHE A 1 36  ? 19.827  30.128 -33.299  1.00 51.59  ? 16  PHE A CZ     1 
ATOM   209   H  H      . PHE A 1 36  ? 17.017  32.548 -29.082  1.00 77.96  ? 16  PHE A H      1 
ATOM   210   H  HA     . PHE A 1 36  ? 15.842  32.063 -31.461  1.00 81.06  ? 16  PHE A HA     1 
ATOM   211   H  HB2    . PHE A 1 36  ? 17.016  30.352 -29.585  1.00 75.15  ? 16  PHE A HB2    1 
ATOM   212   H  HB3    . PHE A 1 36  ? 16.008  29.745 -30.650  1.00 75.15  ? 16  PHE A HB3    1 
ATOM   213   H  HD1    . PHE A 1 36  ? 16.605  30.152 -33.108  1.00 67.60  ? 16  PHE A HD1    1 
ATOM   214   H  HD2    . PHE A 1 36  ? 19.263  30.501 -30.144  1.00 66.84  ? 16  PHE A HD2    1 
ATOM   215   H  HE1    . PHE A 1 36  ? 18.327  29.971 -34.635  1.00 63.55  ? 16  PHE A HE1    1 
ATOM   216   H  HE2    . PHE A 1 36  ? 20.985  30.321 -31.663  1.00 63.74  ? 16  PHE A HE2    1 
ATOM   217   H  HZ     . PHE A 1 36  ? 20.523  30.056 -33.913  1.00 62.03  ? 16  PHE A HZ     1 
ATOM   218   N  N      . LYS A 1 37  ? 13.964  32.378 -29.079  1.00 80.56  ? 17  LYS A N      1 
ATOM   219   C  CA     . LYS A 1 37  ? 12.646  32.080 -28.517  1.00 93.26  ? 17  LYS A CA     1 
ATOM   220   C  C      . LYS A 1 37  ? 11.559  32.095 -29.589  1.00 101.61 ? 17  LYS A C      1 
ATOM   221   O  O      . LYS A 1 37  ? 10.637  31.272 -29.557  1.00 103.46 ? 17  LYS A O      1 
ATOM   222   C  CB     . LYS A 1 37  ? 12.279  33.061 -27.400  1.00 95.28  ? 17  LYS A CB     1 
ATOM   223   C  CG     . LYS A 1 37  ? 11.971  34.484 -27.850  1.00 96.26  ? 17  LYS A CG     1 
ATOM   224   C  CD     . LYS A 1 37  ? 11.635  35.369 -26.657  1.00 97.37  ? 17  LYS A CD     1 
ATOM   225   C  CE     . LYS A 1 37  ? 11.355  36.802 -27.078  1.00 98.21  ? 17  LYS A CE     1 
ATOM   226   N  NZ     . LYS A 1 37  ? 11.109  37.693 -25.909  1.00 100.87 ? 17  LYS A NZ     1 
ATOM   227   H  H      . LYS A 1 37  ? 14.356  33.069 -28.749  1.00 96.79  ? 17  LYS A H      1 
ATOM   228   H  HA     . LYS A 1 37  ? 12.667  31.190 -28.132  1.00 112.03 ? 17  LYS A HA     1 
ATOM   229   H  HB2    . LYS A 1 37  ? 11.493  32.725 -26.942  1.00 114.45 ? 17  LYS A HB2    1 
ATOM   230   H  HB3    . LYS A 1 37  ? 13.022  33.108 -26.777  1.00 114.45 ? 17  LYS A HB3    1 
ATOM   231   H  HG2    . LYS A 1 37  ? 12.748  34.855 -28.298  1.00 115.63 ? 17  LYS A HG2    1 
ATOM   232   H  HG3    . LYS A 1 37  ? 11.208  34.474 -28.449  1.00 115.63 ? 17  LYS A HG3    1 
ATOM   233   H  HD2    . LYS A 1 37  ? 10.844  35.023 -26.215  1.00 116.96 ? 17  LYS A HD2    1 
ATOM   234   H  HD3    . LYS A 1 37  ? 12.386  35.375 -26.043  1.00 116.96 ? 17  LYS A HD3    1 
ATOM   235   H  HE2    . LYS A 1 37  ? 12.120  37.147 -27.564  1.00 117.96 ? 17  LYS A HE2    1 
ATOM   236   H  HE3    . LYS A 1 37  ? 10.566  36.820 -27.643  1.00 117.96 ? 17  LYS A HE3    1 
ATOM   237   H  HZ1    . LYS A 1 37  ? 10.948  38.523 -26.188  1.00 121.16 ? 17  LYS A HZ1    1 
ATOM   238   H  HZ2    . LYS A 1 37  ? 10.406  37.401 -25.448  1.00 121.16 ? 17  LYS A HZ2    1 
ATOM   239   H  HZ3    . LYS A 1 37  ? 11.822  37.699 -25.377  1.00 121.16 ? 17  LYS A HZ3    1 
ATOM   240   N  N      . GLN A 1 38  ? 11.642  33.027 -30.542  1.00 98.28  ? 18  GLN A N      1 
ATOM   241   C  CA     . GLN A 1 38  ? 10.583  33.153 -31.540  1.00 104.28 ? 18  GLN A CA     1 
ATOM   242   C  C      . GLN A 1 38  ? 10.521  31.928 -32.444  1.00 105.25 ? 18  GLN A C      1 
ATOM   243   O  O      . GLN A 1 38  ? 9.431   31.447 -32.774  1.00 107.93 ? 18  GLN A O      1 
ATOM   244   C  CB     . GLN A 1 38  ? 10.792  34.419 -32.372  1.00 106.52 ? 18  GLN A CB     1 
ATOM   245   C  CG     . GLN A 1 38  ? 9.754   34.624 -33.471  1.00 107.28 ? 18  GLN A CG     1 
ATOM   246   C  CD     . GLN A 1 38  ? 10.011  35.870 -34.294  1.00 107.10 ? 18  GLN A CD     1 
ATOM   247   O  OE1    . GLN A 1 38  ? 10.713  36.784 -33.858  1.00 106.63 ? 18  GLN A OE1    1 
ATOM   248   N  NE2    . GLN A 1 38  ? 9.448   35.911 -35.496  1.00 107.17 ? 18  GLN A NE2    1 
ATOM   249   H  H      . GLN A 1 38  ? 12.288  33.588 -30.630  1.00 118.05 ? 18  GLN A H      1 
ATOM   250   H  HA     . GLN A 1 38  ? 9.730   33.232 -31.085  1.00 125.26 ? 18  GLN A HA     1 
ATOM   251   H  HB2    . GLN A 1 38  ? 10.753  35.189 -31.783  1.00 127.94 ? 18  GLN A HB2    1 
ATOM   252   H  HB3    . GLN A 1 38  ? 11.664  34.374 -32.794  1.00 127.94 ? 18  GLN A HB3    1 
ATOM   253   H  HG2    . GLN A 1 38  ? 9.773   33.860 -34.069  1.00 128.86 ? 18  GLN A HG2    1 
ATOM   254   H  HG3    . GLN A 1 38  ? 8.877   34.707 -33.066  1.00 128.86 ? 18  GLN A HG3    1 
ATOM   255   H  HE21   . GLN A 1 38  ? 8.968   35.252 -35.769  1.00 128.73 ? 18  GLN A HE21   1 
ATOM   256   H  HE22   . GLN A 1 38  ? 9.564   36.597 -36.002  1.00 128.73 ? 18  GLN A HE22   1 
ATOM   257   N  N      . PHE A 1 39  ? 11.679  31.412 -32.858  1.00 101.22 ? 19  PHE A N      1 
ATOM   258   C  CA     . PHE A 1 39  ? 11.700  30.273 -33.770  1.00 98.60  ? 19  PHE A CA     1 
ATOM   259   C  C      . PHE A 1 39  ? 11.139  29.014 -33.121  1.00 98.31  ? 19  PHE A C      1 
ATOM   260   O  O      . PHE A 1 39  ? 10.583  28.157 -33.817  1.00 90.88  ? 19  PHE A O      1 
ATOM   261   C  CB     . PHE A 1 39  ? 13.127  30.029 -34.261  1.00 99.51  ? 19  PHE A CB     1 
ATOM   262   C  CG     . PHE A 1 39  ? 13.315  28.706 -34.947  1.00 100.58 ? 19  PHE A CG     1 
ATOM   263   C  CD1    . PHE A 1 39  ? 12.849  28.505 -36.236  1.00 100.68 ? 19  PHE A CD1    1 
ATOM   264   C  CD2    . PHE A 1 39  ? 13.965  27.665 -34.305  1.00 100.40 ? 19  PHE A CD2    1 
ATOM   265   C  CE1    . PHE A 1 39  ? 13.024  27.288 -36.869  1.00 99.03  ? 19  PHE A CE1    1 
ATOM   266   C  CE2    . PHE A 1 39  ? 14.143  26.447 -34.933  1.00 98.44  ? 19  PHE A CE2    1 
ATOM   267   C  CZ     . PHE A 1 39  ? 13.672  26.258 -36.216  1.00 97.62  ? 19  PHE A CZ     1 
ATOM   268   H  H      . PHE A 1 39  ? 12.456  31.699 -32.628  1.00 121.58 ? 19  PHE A H      1 
ATOM   269   H  HA     . PHE A 1 39  ? 11.150  30.480 -34.543  1.00 118.44 ? 19  PHE A HA     1 
ATOM   270   H  HB2    . PHE A 1 39  ? 13.364  30.726 -34.892  1.00 119.53 ? 19  PHE A HB2    1 
ATOM   271   H  HB3    . PHE A 1 39  ? 13.728  30.056 -33.500  1.00 119.53 ? 19  PHE A HB3    1 
ATOM   272   H  HD1    . PHE A 1 39  ? 12.412  29.195 -36.680  1.00 120.94 ? 19  PHE A HD1    1 
ATOM   273   H  HD2    . PHE A 1 39  ? 14.284  27.787 -33.440  1.00 120.59 ? 19  PHE A HD2    1 
ATOM   274   H  HE1    . PHE A 1 39  ? 12.706  27.164 -37.734  1.00 118.96 ? 19  PHE A HE1    1 
ATOM   275   H  HE2    . PHE A 1 39  ? 14.579  25.755 -34.491  1.00 118.25 ? 19  PHE A HE2    1 
ATOM   276   H  HZ     . PHE A 1 39  ? 13.791  25.439 -36.640  1.00 117.26 ? 19  PHE A HZ     1 
ATOM   277   N  N      . VAL A 1 40  ? 11.268  28.884 -31.802  1.00 101.19 ? 20  VAL A N      1 
ATOM   278   C  CA     . VAL A 1 40  ? 10.813  27.691 -31.097  1.00 107.55 ? 20  VAL A CA     1 
ATOM   279   C  C      . VAL A 1 40  ? 9.325   27.820 -30.797  1.00 113.65 ? 20  VAL A C      1 
ATOM   280   O  O      . VAL A 1 40  ? 8.925   27.988 -29.640  1.00 115.52 ? 20  VAL A O      1 
ATOM   281   C  CB     . VAL A 1 40  ? 11.619  27.466 -29.803  1.00 105.96 ? 20  VAL A CB     1 
ATOM   282   C  CG1    . VAL A 1 40  ? 11.263  26.125 -29.177  1.00 105.35 ? 20  VAL A CG1    1 
ATOM   283   C  CG2    . VAL A 1 40  ? 13.113  27.542 -30.083  1.00 104.51 ? 20  VAL A CG2    1 
ATOM   284   H  H      . VAL A 1 40  ? 11.618  29.479 -31.289  1.00 121.54 ? 20  VAL A H      1 
ATOM   285   H  HA     . VAL A 1 40  ? 10.940  26.917 -31.668  1.00 129.18 ? 20  VAL A HA     1 
ATOM   286   H  HB     . VAL A 1 40  ? 11.397  28.164 -29.167  1.00 127.27 ? 20  VAL A HB     1 
ATOM   287   H  HG11   . VAL A 1 40  ? 11.783  26.008 -28.366  1.00 126.54 ? 20  VAL A HG11   1 
ATOM   288   H  HG12   . VAL A 1 40  ? 10.316  26.115 -28.968  1.00 126.54 ? 20  VAL A HG12   1 
ATOM   289   H  HG13   . VAL A 1 40  ? 11.471  25.417 -29.808  1.00 126.54 ? 20  VAL A HG13   1 
ATOM   290   H  HG21   . VAL A 1 40  ? 13.596  27.398 -29.255  1.00 125.53 ? 20  VAL A HG21   1 
ATOM   291   H  HG22   . VAL A 1 40  ? 13.348  26.856 -30.728  1.00 125.53 ? 20  VAL A HG22   1 
ATOM   292   H  HG23   . VAL A 1 40  ? 13.323  28.419 -30.441  1.00 125.53 ? 20  VAL A HG23   1 
ATOM   293   N  N      . SER A 1 41  ? 8.499   27.742 -31.835  1.00 108.62 ? 21  SER A N      1 
ATOM   294   C  CA     . SER A 1 41  ? 7.052   27.821 -31.670  1.00 112.12 ? 21  SER A CA     1 
ATOM   295   C  C      . SER A 1 41  ? 6.337   27.124 -32.824  1.00 111.57 ? 21  SER A C      1 
ATOM   296   O  O      . SER A 1 41  ? 6.310   27.628 -33.946  1.00 110.64 ? 21  SER A O      1 
ATOM   297   C  CB     . SER A 1 41  ? 6.601   29.280 -31.577  1.00 115.33 ? 21  SER A CB     1 
ATOM   298   O  OG     . SER A 1 41  ? 6.947   29.996 -32.750  1.00 116.34 ? 21  SER A OG     1 
ATOM   299   H  H      . SER A 1 41  ? 8.753   27.642 -32.651  1.00 130.47 ? 21  SER A H      1 
ATOM   300   H  HA     . SER A 1 41  ? 6.801   27.375 -30.846  1.00 134.66 ? 21  SER A HA     1 
ATOM   301   H  HB2    . SER A 1 41  ? 5.638   29.306 -31.465  1.00 138.52 ? 21  SER A HB2    1 
ATOM   302   H  HB3    . SER A 1 41  ? 7.034   29.696 -30.815  1.00 138.52 ? 21  SER A HB3    1 
ATOM   303   H  HG     . SER A 1 41  ? 7.779   29.982 -32.860  1.00 139.73 ? 21  SER A HG     1 
ATOM   304   N  N      . HIS A 1 48  ? 5.805   19.873 -42.941  1.00 132.10 ? 28  HIS A N      1 
ATOM   305   C  CA     . HIS A 1 48  ? 5.158   20.805 -43.859  1.00 130.81 ? 28  HIS A CA     1 
ATOM   306   C  C      . HIS A 1 48  ? 5.730   20.673 -45.272  1.00 115.76 ? 28  HIS A C      1 
ATOM   307   O  O      . HIS A 1 48  ? 5.216   21.264 -46.222  1.00 126.96 ? 28  HIS A O      1 
ATOM   308   C  CB     . HIS A 1 48  ? 5.315   22.241 -43.354  1.00 137.22 ? 28  HIS A CB     1 
ATOM   309   C  CG     . HIS A 1 48  ? 4.590   23.254 -44.183  1.00 142.39 ? 28  HIS A CG     1 
ATOM   310   N  ND1    . HIS A 1 48  ? 5.226   24.045 -45.116  1.00 142.56 ? 28  HIS A ND1    1 
ATOM   311   C  CD2    . HIS A 1 48  ? 3.282   23.601 -44.224  1.00 144.84 ? 28  HIS A CD2    1 
ATOM   312   C  CE1    . HIS A 1 48  ? 4.341   24.838 -45.694  1.00 143.39 ? 28  HIS A CE1    1 
ATOM   313   N  NE2    . HIS A 1 48  ? 3.154   24.588 -45.170  1.00 144.60 ? 28  HIS A NE2    1 
ATOM   314   H  HA     . HIS A 1 48  ? 4.210   20.603 -43.899  1.00 157.09 ? 28  HIS A HA     1 
ATOM   315   H  HB2    . HIS A 1 48  ? 4.969   22.294 -42.450  1.00 164.78 ? 28  HIS A HB2    1 
ATOM   316   H  HB3    . HIS A 1 48  ? 6.257   22.472 -43.359  1.00 164.78 ? 28  HIS A HB3    1 
ATOM   317   H  HD2    . HIS A 1 48  ? 2.599   23.239 -43.707  1.00 173.93 ? 28  HIS A HD2    1 
ATOM   318   H  HE1    . HIS A 1 48  ? 4.522   25.465 -46.356  1.00 172.19 ? 28  HIS A HE1    1 
ATOM   319   H  HE2    . HIS A 1 48  ? 2.420   24.980 -45.387  1.00 173.64 ? 28  HIS A HE2    1 
ATOM   320   N  N      . VAL A 1 49  ? 6.801   19.886 -45.399  1.00 73.36  ? 29  VAL A N      1 
ATOM   321   C  CA     . VAL A 1 49  ? 7.447   19.679 -46.692  1.00 52.31  ? 29  VAL A CA     1 
ATOM   322   C  C      . VAL A 1 49  ? 6.673   18.707 -47.577  1.00 49.54  ? 29  VAL A C      1 
ATOM   323   O  O      . VAL A 1 49  ? 6.898   18.676 -48.793  1.00 43.27  ? 29  VAL A O      1 
ATOM   324   C  CB     . VAL A 1 49  ? 8.895   19.196 -46.488  1.00 49.16  ? 29  VAL A CB     1 
ATOM   325   C  CG1    . VAL A 1 49  ? 9.559   18.843 -47.819  1.00 47.75  ? 29  VAL A CG1    1 
ATOM   326   C  CG2    . VAL A 1 49  ? 9.711   20.259 -45.761  1.00 47.22  ? 29  VAL A CG2    1 
ATOM   327   H  H      . VAL A 1 49  ? 7.171   19.461 -44.749  1.00 88.15  ? 29  VAL A H      1 
ATOM   328   H  HA     . VAL A 1 49  ? 7.486   20.530 -47.156  1.00 62.89  ? 29  VAL A HA     1 
ATOM   329   H  HB     . VAL A 1 49  ? 8.886   18.397 -45.937  1.00 59.12  ? 29  VAL A HB     1 
ATOM   330   H  HG11   . VAL A 1 49  ? 10.466  18.544 -47.650  1.00 57.42  ? 29  VAL A HG11   1 
ATOM   331   H  HG12   . VAL A 1 49  ? 9.052   18.135 -48.247  1.00 57.42  ? 29  VAL A HG12   1 
ATOM   332   H  HG13   . VAL A 1 49  ? 9.570   19.631 -48.385  1.00 57.42  ? 29  VAL A HG13   1 
ATOM   333   H  HG21   . VAL A 1 49  ? 10.617  19.935 -45.644  1.00 56.78  ? 29  VAL A HG21   1 
ATOM   334   H  HG22   . VAL A 1 49  ? 9.715   21.070 -46.293  1.00 56.78  ? 29  VAL A HG22   1 
ATOM   335   H  HG23   . VAL A 1 49  ? 9.306   20.431 -44.897  1.00 56.78  ? 29  VAL A HG23   1 
ATOM   336   N  N      . ASP A 1 50  ? 5.752   17.925 -47.011  1.00 60.59  ? 30  ASP A N      1 
ATOM   337   C  CA     . ASP A 1 50  ? 5.059   16.910 -47.799  1.00 62.08  ? 30  ASP A CA     1 
ATOM   338   C  C      . ASP A 1 50  ? 4.314   17.528 -48.977  1.00 58.65  ? 30  ASP A C      1 
ATOM   339   O  O      . ASP A 1 50  ? 4.377   17.011 -50.100  1.00 52.65  ? 30  ASP A O      1 
ATOM   340   C  CB     . ASP A 1 50  ? 4.080   16.144 -46.908  1.00 65.17  ? 30  ASP A CB     1 
ATOM   341   C  CG     . ASP A 1 50  ? 4.750   15.524 -45.697  1.00 63.79  ? 30  ASP A CG     1 
ATOM   342   O  OD1    . ASP A 1 50  ? 5.945   15.807 -45.462  1.00 61.82  ? 30  ASP A OD1    1 
ATOM   343   O  OD2    . ASP A 1 50  ? 4.075   14.762 -44.971  1.00 63.50  ? 30  ASP A OD2    1 
ATOM   344   H  H      . ASP A 1 50  ? 5.514   17.962 -46.185  1.00 72.83  ? 30  ASP A H      1 
ATOM   345   H  HA     . ASP A 1 50  ? 5.708   16.280 -48.149  1.00 74.62  ? 30  ASP A HA     1 
ATOM   346   H  HB2    . ASP A 1 50  ? 3.396   16.754 -46.592  1.00 78.32  ? 30  ASP A HB2    1 
ATOM   347   H  HB3    . ASP A 1 50  ? 3.675   15.430 -47.425  1.00 78.32  ? 30  ASP A HB3    1 
ATOM   348   N  N      . ALA A 1 51  ? 3.606   18.636 -48.744  1.00 66.04  ? 31  ALA A N      1 
ATOM   349   C  CA     . ALA A 1 51  ? 2.838   19.259 -49.817  1.00 67.14  ? 31  ALA A CA     1 
ATOM   350   C  C      . ALA A 1 51  ? 3.746   19.749 -50.939  1.00 59.48  ? 31  ALA A C      1 
ATOM   351   O  O      . ALA A 1 51  ? 3.446   19.552 -52.122  1.00 60.91  ? 31  ALA A O      1 
ATOM   352   C  CB     . ALA A 1 51  ? 2.001   20.410 -49.261  1.00 70.78  ? 31  ALA A CB     1 
ATOM   353   H  H      . ALA A 1 51  ? 3.555   19.038 -47.986  1.00 79.36  ? 31  ALA A H      1 
ATOM   354   H  HA     . ALA A 1 51  ? 2.230   18.602 -50.191  1.00 80.69  ? 31  ALA A HA     1 
ATOM   355   H  HB1    . ALA A 1 51  ? 1.498   20.813 -49.986  1.00 85.05  ? 31  ALA A HB1    1 
ATOM   356   H  HB2    . ALA A 1 51  ? 1.394   20.063 -48.589  1.00 85.05  ? 31  ALA A HB2    1 
ATOM   357   H  HB3    . ALA A 1 51  ? 2.594   21.068 -48.864  1.00 85.05  ? 31  ALA A HB3    1 
ATOM   358   N  N      . THR A 1 52  ? 4.864   20.391 -50.588  1.00 51.45  ? 32  THR A N      1 
ATOM   359   C  CA     . THR A 1 52  ? 5.807   20.842 -51.607  1.00 43.10  ? 32  THR A CA     1 
ATOM   360   C  C      . THR A 1 52  ? 6.387   19.662 -52.377  1.00 43.51  ? 32  THR A C      1 
ATOM   361   O  O      . THR A 1 52  ? 6.487   19.699 -53.611  1.00 42.34  ? 32  THR A O      1 
ATOM   362   C  CB     . THR A 1 52  ? 6.925   21.658 -50.957  1.00 37.78  ? 32  THR A CB     1 
ATOM   363   O  OG1    . THR A 1 52  ? 6.362   22.576 -50.014  1.00 37.76  ? 32  THR A OG1    1 
ATOM   364   C  CG2    . THR A 1 52  ? 7.702   22.441 -52.008  1.00 35.28  ? 32  THR A CG2    1 
ATOM   365   H  H      . THR A 1 52  ? 5.094   20.573 -49.780  1.00 61.85  ? 32  THR A H      1 
ATOM   366   H  HA     . THR A 1 52  ? 5.343   21.415 -52.238  1.00 51.84  ? 32  THR A HA     1 
ATOM   367   H  HB     . THR A 1 52  ? 7.539   21.061 -50.502  1.00 45.45  ? 32  THR A HB     1 
ATOM   368   H  HG1    . THR A 1 52  ? 6.972   23.028 -49.653  1.00 45.43  ? 32  THR A HG1    1 
ATOM   369   H  HG21   . THR A 1 52  ? 8.408   22.954 -51.584  1.00 42.45  ? 32  THR A HG21   1 
ATOM   370   H  HG22   . THR A 1 52  ? 8.098   21.831 -52.651  1.00 42.45  ? 32  THR A HG22   1 
ATOM   371   H  HG23   . THR A 1 52  ? 7.108   23.049 -52.475  1.00 42.45  ? 32  THR A HG23   1 
ATOM   372   N  N      . TYR A 1 53  ? 6.762   18.598 -51.663  1.00 42.79  ? 33  TYR A N      1 
ATOM   373   C  CA     . TYR A 1 53  ? 7.305   17.412 -52.316  1.00 41.64  ? 33  TYR A CA     1 
ATOM   374   C  C      . TYR A 1 53  ? 6.314   16.857 -53.332  1.00 39.94  ? 33  TYR A C      1 
ATOM   375   O  O      . TYR A 1 53  ? 6.685   16.537 -54.468  1.00 39.06  ? 33  TYR A O      1 
ATOM   376   C  CB     . TYR A 1 53  ? 7.660   16.356 -51.267  1.00 40.50  ? 33  TYR A CB     1 
ATOM   377   C  CG     . TYR A 1 53  ? 8.270   15.096 -51.842  1.00 38.52  ? 33  TYR A CG     1 
ATOM   378   C  CD1    . TYR A 1 53  ? 7.472   14.099 -52.390  1.00 37.31  ? 33  TYR A CD1    1 
ATOM   379   C  CD2    . TYR A 1 53  ? 9.646   14.903 -51.833  1.00 35.31  ? 33  TYR A CD2    1 
ATOM   380   C  CE1    . TYR A 1 53  ? 8.026   12.950 -52.917  1.00 33.83  ? 33  TYR A CE1    1 
ATOM   381   C  CE2    . TYR A 1 53  ? 10.209  13.755 -52.356  1.00 33.68  ? 33  TYR A CE2    1 
ATOM   382   C  CZ     . TYR A 1 53  ? 9.393   12.782 -52.897  1.00 33.77  ? 33  TYR A CZ     1 
ATOM   383   O  OH     . TYR A 1 53  ? 9.947   11.637 -53.419  1.00 34.49  ? 33  TYR A OH     1 
ATOM   384   H  H      . TYR A 1 53  ? 6.713   18.541 -50.806  1.00 51.47  ? 33  TYR A H      1 
ATOM   385   H  HA     . TYR A 1 53  ? 8.117   17.653 -52.787  1.00 50.09  ? 33  TYR A HA     1 
ATOM   386   H  HB2    . TYR A 1 53  ? 8.299   16.737 -50.645  1.00 48.71  ? 33  TYR A HB2    1 
ATOM   387   H  HB3    . TYR A 1 53  ? 6.852   16.103 -50.793  1.00 48.71  ? 33  TYR A HB3    1 
ATOM   388   H  HD1    . TYR A 1 53  ? 6.549   14.210 -52.406  1.00 44.89  ? 33  TYR A HD1    1 
ATOM   389   H  HD2    . TYR A 1 53  ? 10.197  15.558 -51.470  1.00 42.49  ? 33  TYR A HD2    1 
ATOM   390   H  HE1    . TYR A 1 53  ? 7.479   12.292 -53.281  1.00 40.71  ? 33  TYR A HE1    1 
ATOM   391   H  HE2    . TYR A 1 53  ? 11.132  13.640 -52.344  1.00 40.53  ? 33  TYR A HE2    1 
ATOM   392   H  HH     . TYR A 1 53  ? 10.784  11.662 -53.344  1.00 41.51  ? 33  TYR A HH     1 
ATOM   393   N  N      . ARG A 1 54  ? 5.043   16.737 -52.940  1.00 43.34  ? 34  ARG A N      1 
ATOM   394   C  CA     . ARG A 1 54  ? 4.036   16.237 -53.871  1.00 44.45  ? 34  ARG A CA     1 
ATOM   395   C  C      . ARG A 1 54  ? 3.866   17.181 -55.056  1.00 41.33  ? 34  ARG A C      1 
ATOM   396   O  O      . ARG A 1 54  ? 3.778   16.735 -56.208  1.00 42.48  ? 34  ARG A O      1 
ATOM   397   C  CB     . ARG A 1 54  ? 2.706   16.023 -53.143  1.00 47.71  ? 34  ARG A CB     1 
ATOM   398   C  CG     . ARG A 1 54  ? 2.720   14.845 -52.168  1.00 48.89  ? 34  ARG A CG     1 
ATOM   399   C  CD     . ARG A 1 54  ? 1.329   14.536 -51.622  1.00 50.42  ? 34  ARG A CD     1 
ATOM   400   N  NE     . ARG A 1 54  ? 0.841   15.551 -50.690  1.00 51.65  ? 34  ARG A NE     1 
ATOM   401   C  CZ     . ARG A 1 54  ? 0.956   15.484 -49.364  1.00 51.61  ? 34  ARG A CZ     1 
ATOM   402   N  NH1    . ARG A 1 54  ? 1.541   14.444 -48.785  1.00 48.79  ? 34  ARG A NH1    1 
ATOM   403   N  NH2    . ARG A 1 54  ? 0.477   16.463 -48.609  1.00 54.45  ? 34  ARG A NH2    1 
ATOM   404   H  H      . ARG A 1 54  ? 4.745   16.934 -52.158  1.00 52.12  ? 34  ARG A H      1 
ATOM   405   H  HA     . ARG A 1 54  ? 4.327   15.378 -54.216  1.00 53.46  ? 34  ARG A HA     1 
ATOM   406   H  HB2    . ARG A 1 54  ? 2.494   16.824 -52.638  1.00 57.37  ? 34  ARG A HB2    1 
ATOM   407   H  HB3    . ARG A 1 54  ? 2.013   15.855 -53.801  1.00 57.37  ? 34  ARG A HB3    1 
ATOM   408   H  HG2    . ARG A 1 54  ? 3.047   14.055 -52.627  1.00 58.78  ? 34  ARG A HG2    1 
ATOM   409   H  HG3    . ARG A 1 54  ? 3.298   15.059 -51.419  1.00 58.78  ? 34  ARG A HG3    1 
ATOM   410   H  HD2    . ARG A 1 54  ? 0.704   14.485 -52.363  1.00 60.62  ? 34  ARG A HD2    1 
ATOM   411   H  HD3    . ARG A 1 54  ? 1.356   13.687 -51.153  1.00 60.62  ? 34  ARG A HD3    1 
ATOM   412   H  HE     . ARG A 1 54  ? 0.452   16.243 -51.021  1.00 62.09  ? 34  ARG A HE     1 
ATOM   413   H  HH11   . ARG A 1 54  ? 1.854   13.803 -49.266  1.00 58.67  ? 34  ARG A HH11   1 
ATOM   414   H  HH12   . ARG A 1 54  ? 1.608   14.411 -47.928  1.00 58.67  ? 34  ARG A HH12   1 
ATOM   415   H  HH21   . ARG A 1 54  ? 0.095   17.141 -48.975  1.00 65.46  ? 34  ARG A HH21   1 
ATOM   416   H  HH22   . ARG A 1 54  ? 0.549   16.421 -47.753  1.00 65.46  ? 34  ARG A HH22   1 
ATOM   417   N  N      . LEU A 1 55  ? 3.826   18.491 -54.797  1.00 35.93  ? 35  LEU A N      1 
ATOM   418   C  CA     . LEU A 1 55  ? 3.667   19.457 -55.880  1.00 32.70  ? 35  LEU A CA     1 
ATOM   419   C  C      . LEU A 1 55  ? 4.774   19.321 -56.919  1.00 32.23  ? 35  LEU A C      1 
ATOM   420   O  O      . LEU A 1 55  ? 4.506   19.341 -58.126  1.00 31.90  ? 35  LEU A O      1 
ATOM   421   C  CB     . LEU A 1 55  ? 3.642   20.878 -55.318  1.00 32.01  ? 35  LEU A CB     1 
ATOM   422   C  CG     . LEU A 1 55  ? 2.346   21.358 -54.661  1.00 34.91  ? 35  LEU A CG     1 
ATOM   423   C  CD1    . LEU A 1 55  ? 2.544   22.757 -54.106  1.00 33.47  ? 35  LEU A CD1    1 
ATOM   424   C  CD2    . LEU A 1 55  ? 1.177   21.332 -55.644  1.00 38.37  ? 35  LEU A CD2    1 
ATOM   425   H  H      . LEU A 1 55  ? 3.887   18.839 -54.013  1.00 43.23  ? 35  LEU A H      1 
ATOM   426   H  HA     . LEU A 1 55  ? 2.820   19.296 -56.324  1.00 39.36  ? 35  LEU A HA     1 
ATOM   427   H  HB2    . LEU A 1 55  ? 4.341   20.949 -54.649  1.00 38.53  ? 35  LEU A HB2    1 
ATOM   428   H  HB3    . LEU A 1 55  ? 3.835   21.491 -56.045  1.00 38.53  ? 35  LEU A HB3    1 
ATOM   429   H  HG     . LEU A 1 55  ? 2.129   20.769 -53.922  1.00 42.02  ? 35  LEU A HG     1 
ATOM   430   H  HD11   . LEU A 1 55  ? 1.718   23.052 -53.692  1.00 40.29  ? 35  LEU A HD11   1 
ATOM   431   H  HD12   . LEU A 1 55  ? 3.256   22.737 -53.447  1.00 40.29  ? 35  LEU A HD12   1 
ATOM   432   H  HD13   . LEU A 1 55  ? 2.782   23.354 -54.832  1.00 40.29  ? 35  LEU A HD13   1 
ATOM   433   H  HD21   . LEU A 1 55  ? 0.378   21.642 -55.190  1.00 46.17  ? 35  LEU A HD21   1 
ATOM   434   H  HD22   . LEU A 1 55  ? 1.381   21.915 -56.392  1.00 46.17  ? 35  LEU A HD22   1 
ATOM   435   H  HD23   . LEU A 1 55  ? 1.049   20.423 -55.958  1.00 46.17  ? 35  LEU A HD23   1 
ATOM   436   N  N      . VAL A 1 56  ? 6.027   19.194 -56.476  1.00 29.84  ? 36  VAL A N      1 
ATOM   437   C  CA     . VAL A 1 56  ? 7.124   19.026 -57.425  1.00 29.79  ? 36  VAL A CA     1 
ATOM   438   C  C      . VAL A 1 56  ? 7.019   17.676 -58.128  1.00 32.15  ? 36  VAL A C      1 
ATOM   439   O  O      . VAL A 1 56  ? 7.224   17.570 -59.348  1.00 33.42  ? 36  VAL A O      1 
ATOM   440   C  CB     . VAL A 1 56  ? 8.474   19.190 -56.702  1.00 31.07  ? 36  VAL A CB     1 
ATOM   441   C  CG1    . VAL A 1 56  ? 9.637   18.949 -57.653  1.00 30.60  ? 36  VAL A CG1    1 
ATOM   442   C  CG2    . VAL A 1 56  ? 8.577   20.578 -56.083  1.00 32.44  ? 36  VAL A CG2    1 
ATOM   443   H  H      . VAL A 1 56  ? 6.263   19.201 -55.649  1.00 35.93  ? 36  VAL A H      1 
ATOM   444   H  HA     . VAL A 1 56  ? 7.062   19.719 -58.102  1.00 35.86  ? 36  VAL A HA     1 
ATOM   445   H  HB     . VAL A 1 56  ? 8.531   18.538 -55.987  1.00 37.41  ? 36  VAL A HB     1 
ATOM   446   H  HG11   . VAL A 1 56  ? 10.469  19.060 -57.168  1.00 36.84  ? 36  VAL A HG11   1 
ATOM   447   H  HG12   . VAL A 1 56  ? 9.575   18.046 -58.003  1.00 36.84  ? 36  VAL A HG12   1 
ATOM   448   H  HG13   . VAL A 1 56  ? 9.589   19.590 -58.380  1.00 36.84  ? 36  VAL A HG13   1 
ATOM   449   H  HG21   . VAL A 1 56  ? 9.432   20.660 -55.633  1.00 39.04  ? 36  VAL A HG21   1 
ATOM   450   H  HG22   . VAL A 1 56  ? 8.506   21.243 -56.785  1.00 39.04  ? 36  VAL A HG22   1 
ATOM   451   H  HG23   . VAL A 1 56  ? 7.855   20.693 -55.445  1.00 39.04  ? 36  VAL A HG23   1 
ATOM   452   N  N      . LEU A 1 57  ? 6.689   16.625 -57.373  1.00 33.09  ? 37  LEU A N      1 
ATOM   453   C  CA     . LEU A 1 57  ? 6.587   15.298 -57.965  1.00 34.47  ? 37  LEU A CA     1 
ATOM   454   C  C      . LEU A 1 57  ? 5.551   15.263 -59.079  1.00 36.42  ? 37  LEU A C      1 
ATOM   455   O  O      . LEU A 1 57  ? 5.701   14.498 -60.037  1.00 32.96  ? 37  LEU A O      1 
ATOM   456   C  CB     . LEU A 1 57  ? 6.259   14.258 -56.893  1.00 35.88  ? 37  LEU A CB     1 
ATOM   457   C  CG     . LEU A 1 57  ? 6.137   12.810 -57.380  1.00 33.75  ? 37  LEU A CG     1 
ATOM   458   C  CD1    . LEU A 1 57  ? 7.381   12.378 -58.150  1.00 30.06  ? 37  LEU A CD1    1 
ATOM   459   C  CD2    . LEU A 1 57  ? 5.897   11.873 -56.210  1.00 33.90  ? 37  LEU A CD2    1 
ATOM   460   H  H      . LEU A 1 57  ? 6.523   16.656 -56.530  1.00 39.83  ? 37  LEU A H      1 
ATOM   461   H  HA     . LEU A 1 57  ? 7.445   15.062 -58.352  1.00 41.48  ? 37  LEU A HA     1 
ATOM   462   H  HB2    . LEU A 1 57  ? 6.959   14.280 -56.222  1.00 43.17  ? 37  LEU A HB2    1 
ATOM   463   H  HB3    . LEU A 1 57  ? 5.413   14.498 -56.484  1.00 43.17  ? 37  LEU A HB3    1 
ATOM   464   H  HG     . LEU A 1 57  ? 5.377   12.742 -57.979  1.00 40.61  ? 37  LEU A HG     1 
ATOM   465   H  HD11   . LEU A 1 57  ? 7.268   11.460 -58.441  1.00 36.19  ? 37  LEU A HD11   1 
ATOM   466   H  HD12   . LEU A 1 57  ? 7.494   12.958 -58.919  1.00 36.19  ? 37  LEU A HD12   1 
ATOM   467   H  HD13   . LEU A 1 57  ? 8.153   12.448 -57.566  1.00 36.19  ? 37  LEU A HD13   1 
ATOM   468   H  HD21   . LEU A 1 57  ? 5.824   10.965 -56.543  1.00 40.79  ? 37  LEU A HD21   1 
ATOM   469   H  HD22   . LEU A 1 57  ? 6.644   11.941 -55.594  1.00 40.79  ? 37  LEU A HD22   1 
ATOM   470   H  HD23   . LEU A 1 57  ? 5.075   12.130 -55.764  1.00 40.79  ? 37  LEU A HD23   1 
ATOM   471   N  N      . ASP A 1 58  ? 4.488   16.064 -58.969  1.00 43.67  ? 38  ASP A N      1 
ATOM   472   C  CA     . ASP A 1 58  ? 3.492   16.109 -60.036  1.00 50.15  ? 38  ASP A CA     1 
ATOM   473   C  C      . ASP A 1 58  ? 4.131   16.509 -61.361  1.00 50.64  ? 38  ASP A C      1 
ATOM   474   O  O      . ASP A 1 58  ? 3.955   15.830 -62.380  1.00 53.47  ? 38  ASP A O      1 
ATOM   475   C  CB     . ASP A 1 58  ? 2.374   17.087 -59.670  1.00 53.83  ? 38  ASP A CB     1 
ATOM   476   C  CG     . ASP A 1 58  ? 1.419   16.525 -58.634  1.00 59.33  ? 38  ASP A CG     1 
ATOM   477   O  OD1    . ASP A 1 58  ? 1.229   15.290 -58.598  1.00 61.82  ? 38  ASP A OD1    1 
ATOM   478   O  OD2    . ASP A 1 58  ? 0.852   17.322 -57.858  1.00 61.72  ? 38  ASP A OD2    1 
ATOM   479   H  H      . ASP A 1 58  ? 4.324   16.580 -58.301  1.00 52.52  ? 38  ASP A H      1 
ATOM   480   H  HA     . ASP A 1 58  ? 3.100   15.228 -60.143  1.00 60.30  ? 38  ASP A HA     1 
ATOM   481   H  HB2    . ASP A 1 58  ? 2.767   17.896 -59.307  1.00 64.71  ? 38  ASP A HB2    1 
ATOM   482   H  HB3    . ASP A 1 58  ? 1.862   17.295 -60.467  1.00 64.71  ? 38  ASP A HB3    1 
ATOM   483   N  N      . CYS A 1 59  ? 4.890   17.608 -61.363  1.00 48.39  ? 39  CYS A N      1 
ATOM   484   C  CA     . CYS A 1 59  ? 5.577   18.040 -62.576  1.00 46.16  ? 39  CYS A CA     1 
ATOM   485   C  C      . CYS A 1 59  ? 6.567   16.982 -63.050  1.00 45.26  ? 39  CYS A C      1 
ATOM   486   O  O      . CYS A 1 59  ? 6.594   16.618 -64.236  1.00 46.07  ? 39  CYS A O      1 
ATOM   487   C  CB     . CYS A 1 59  ? 6.290   19.369 -62.324  1.00 44.20  ? 39  CYS A CB     1 
ATOM   488   S  SG     . CYS A 1 59  ? 5.230   20.661 -61.637  1.00 46.41  ? 39  CYS A SG     1 
ATOM   489   H  H      . CYS A 1 59  ? 5.021   18.114 -60.680  1.00 58.18  ? 39  CYS A H      1 
ATOM   490   H  HA     . CYS A 1 59  ? 4.923   18.177 -63.280  1.00 55.50  ? 39  CYS A HA     1 
ATOM   491   H  HB2    . CYS A 1 59  ? 7.015   19.219 -61.698  1.00 53.16  ? 39  CYS A HB2    1 
ATOM   492   H  HB3    . CYS A 1 59  ? 6.645   19.696 -63.165  1.00 53.16  ? 39  CYS A HB3    1 
ATOM   493   H  HG     . CYS A 1 59  ? 5.880   21.656 -61.477  1.00 55.81  ? 39  CYS A HG     1 
ATOM   494   N  N      . VAL A 1 60  ? 7.394   16.474 -62.130  1.00 40.29  ? 40  VAL A N      1 
ATOM   495   C  CA     . VAL A 1 60  ? 8.370   15.450 -62.499  1.00 35.73  ? 40  VAL A CA     1 
ATOM   496   C  C      . VAL A 1 60  ? 7.680   14.315 -63.245  1.00 32.71  ? 40  VAL A C      1 
ATOM   497   O  O      . VAL A 1 60  ? 8.142   13.864 -64.300  1.00 27.78  ? 40  VAL A O      1 
ATOM   498   C  CB     . VAL A 1 60  ? 9.109   14.937 -61.250  1.00 35.24  ? 40  VAL A CB     1 
ATOM   499   C  CG1    . VAL A 1 60  ? 10.057  13.798 -61.613  1.00 34.31  ? 40  VAL A CG1    1 
ATOM   500   C  CG2    . VAL A 1 60  ? 9.875   16.071 -60.584  1.00 34.06  ? 40  VAL A CG2    1 
ATOM   501   H  H      . VAL A 1 60  ? 7.409   16.702 -61.300  1.00 48.47  ? 40  VAL A H      1 
ATOM   502   H  HA     . VAL A 1 60  ? 9.028   15.842 -63.095  1.00 42.99  ? 40  VAL A HA     1 
ATOM   503   H  HB     . VAL A 1 60  ? 8.460   14.597 -60.614  1.00 42.40  ? 40  VAL A HB     1 
ATOM   504   H  HG11   . VAL A 1 60  ? 10.508  13.495 -60.810  1.00 41.29  ? 40  VAL A HG11   1 
ATOM   505   H  HG12   . VAL A 1 60  ? 9.543   13.071 -61.999  1.00 41.29  ? 40  VAL A HG12   1 
ATOM   506   H  HG13   . VAL A 1 60  ? 10.707  14.121 -62.256  1.00 41.29  ? 40  VAL A HG13   1 
ATOM   507   H  HG21   . VAL A 1 60  ? 10.333  15.726 -59.802  1.00 40.99  ? 40  VAL A HG21   1 
ATOM   508   H  HG22   . VAL A 1 60  ? 10.521  16.428 -61.214  1.00 40.99  ? 40  VAL A HG22   1 
ATOM   509   H  HG23   . VAL A 1 60  ? 9.249   16.764 -60.323  1.00 40.99  ? 40  VAL A HG23   1 
ATOM   510   N  N      . ALA A 1 61  ? 6.559   13.839 -62.701  1.00 36.94  ? 41  ALA A N      1 
ATOM   511   C  CA     . ALA A 1 61  ? 5.804   12.777 -63.357  1.00 37.99  ? 41  ALA A CA     1 
ATOM   512   C  C      . ALA A 1 61  ? 5.277   13.235 -64.709  1.00 37.77  ? 41  ALA A C      1 
ATOM   513   O  O      . ALA A 1 61  ? 5.233   12.452 -65.664  1.00 35.40  ? 41  ALA A O      1 
ATOM   514   C  CB     . ALA A 1 61  ? 4.656   12.321 -62.459  1.00 38.98  ? 41  ALA A CB     1 
ATOM   515   H  H      . ALA A 1 61  ? 6.219   14.113 -61.960  1.00 44.45  ? 41  ALA A H      1 
ATOM   516   H  HA     . ALA A 1 61  ? 6.390   12.018 -63.505  1.00 45.71  ? 41  ALA A HA     1 
ATOM   517   H  HB1    . ALA A 1 61  ? 4.165   11.616 -62.909  1.00 46.89  ? 41  ALA A HB1    1 
ATOM   518   H  HB2    . ALA A 1 61  ? 5.021   11.989 -61.624  1.00 46.89  ? 41  ALA A HB2    1 
ATOM   519   H  HB3    . ALA A 1 61  ? 4.070   13.075 -62.288  1.00 46.89  ? 41  ALA A HB3    1 
ATOM   520   N  N      . ALA A 1 62  ? 4.869   14.503 -64.810  1.00 41.25  ? 42  ALA A N      1 
ATOM   521   C  CA     . ALA A 1 62  ? 4.396   15.022 -66.089  1.00 41.99  ? 42  ALA A CA     1 
ATOM   522   C  C      . ALA A 1 62  ? 5.469   14.889 -67.161  1.00 42.58  ? 42  ALA A C      1 
ATOM   523   O  O      . ALA A 1 62  ? 5.157   14.642 -68.332  1.00 38.97  ? 42  ALA A O      1 
ATOM   524   C  CB     . ALA A 1 62  ? 3.964   16.481 -65.944  1.00 42.13  ? 42  ALA A CB     1 
ATOM   525   H  H      . ALA A 1 62  ? 4.857   15.071 -64.165  1.00 49.62  ? 42  ALA A H      1 
ATOM   526   H  HA     . ALA A 1 62  ? 3.624   14.507 -66.372  1.00 50.51  ? 42  ALA A HA     1 
ATOM   527   H  HB1    . ALA A 1 62  ? 3.654   16.805 -66.804  1.00 50.67  ? 42  ALA A HB1    1 
ATOM   528   H  HB2    . ALA A 1 62  ? 3.248   16.534 -65.292  1.00 50.67  ? 42  ALA A HB2    1 
ATOM   529   H  HB3    . ALA A 1 62  ? 4.723   17.006 -65.645  1.00 50.67  ? 42  ALA A HB3    1 
ATOM   530   N  N      . VAL A 1 63  ? 6.738   15.052 -66.787  1.00 44.87  ? 43  VAL A N      1 
ATOM   531   C  CA     . VAL A 1 63  ? 7.811   14.814 -67.750  1.00 44.46  ? 43  VAL A CA     1 
ATOM   532   C  C      . VAL A 1 63  ? 8.017   13.320 -67.971  1.00 42.30  ? 43  VAL A C      1 
ATOM   533   O  O      . VAL A 1 63  ? 8.092   12.851 -69.112  1.00 32.01  ? 43  VAL A O      1 
ATOM   534   C  CB     . VAL A 1 63  ? 9.114   15.499 -67.297  1.00 44.09  ? 43  VAL A CB     1 
ATOM   535   C  CG1    . VAL A 1 63  ? 10.229  15.247 -68.308  1.00 43.77  ? 43  VAL A CG1    1 
ATOM   536   C  CG2    . VAL A 1 63  ? 8.897   16.993 -67.135  1.00 43.85  ? 43  VAL A CG2    1 
ATOM   537   H  H      . VAL A 1 63  ? 6.999   15.294 -66.004  1.00 53.96  ? 43  VAL A H      1 
ATOM   538   H  HA     . VAL A 1 63  ? 7.556   15.204 -68.601  1.00 53.47  ? 43  VAL A HA     1 
ATOM   539   H  HB     . VAL A 1 63  ? 9.388   15.135 -66.441  1.00 53.02  ? 43  VAL A HB     1 
ATOM   540   H  HG11   . VAL A 1 63  ? 11.038  15.687 -68.001  1.00 52.64  ? 43  VAL A HG11   1 
ATOM   541   H  HG12   . VAL A 1 63  ? 10.379  14.291 -68.380  1.00 52.64  ? 43  VAL A HG12   1 
ATOM   542   H  HG13   . VAL A 1 63  ? 9.962   15.606 -69.168  1.00 52.64  ? 43  VAL A HG13   1 
ATOM   543   H  HG21   . VAL A 1 63  ? 9.729   17.403 -66.850  1.00 52.73  ? 43  VAL A HG21   1 
ATOM   544   H  HG22   . VAL A 1 63  ? 8.620   17.365 -67.987  1.00 52.73  ? 43  VAL A HG22   1 
ATOM   545   H  HG23   . VAL A 1 63  ? 8.209   17.141 -66.469  1.00 52.73  ? 43  VAL A HG23   1 
ATOM   546   N  N      . ASP A 1 64  ? 8.106   12.550 -66.889  1.00 52.30  ? 44  ASP A N      1 
ATOM   547   C  CA     . ASP A 1 64  ? 8.363   11.118 -66.980  1.00 55.28  ? 44  ASP A CA     1 
ATOM   548   C  C      . ASP A 1 64  ? 7.863   10.430 -65.713  1.00 54.95  ? 44  ASP A C      1 
ATOM   549   O  O      . ASP A 1 64  ? 8.319   10.765 -64.613  1.00 61.80  ? 44  ASP A O      1 
ATOM   550   C  CB     . ASP A 1 64  ? 9.858   10.854 -67.175  1.00 53.26  ? 44  ASP A CB     1 
ATOM   551   C  CG     . ASP A 1 64  ? 10.162  9.404  -67.512  1.00 55.63  ? 44  ASP A CG     1 
ATOM   552   O  OD1    . ASP A 1 64  ? 9.418   8.509  -67.063  1.00 57.82  ? 44  ASP A OD1    1 
ATOM   553   O  OD2    . ASP A 1 64  ? 11.157  9.160  -68.226  1.00 56.38  ? 44  ASP A OD2    1 
ATOM   554   H  H      . ASP A 1 64  ? 8.019   12.837 -66.083  1.00 62.88  ? 44  ASP A H      1 
ATOM   555   H  HA     . ASP A 1 64  ? 7.884   10.750 -67.739  1.00 66.46  ? 44  ASP A HA     1 
ATOM   556   H  HB2    . ASP A 1 64  ? 10.184  11.406 -67.904  1.00 64.03  ? 44  ASP A HB2    1 
ATOM   557   H  HB3    . ASP A 1 64  ? 10.328  11.076 -66.356  1.00 64.03  ? 44  ASP A HB3    1 
ATOM   558   N  N      . PRO A 1 65  ? 6.937   9.468  -65.810  1.00 48.00  ? 45  PRO A N      1 
ATOM   559   C  CA     . PRO A 1 65  ? 6.422   8.830  -64.586  1.00 44.61  ? 45  PRO A CA     1 
ATOM   560   C  C      . PRO A 1 65  ? 7.407   7.873  -63.939  1.00 44.05  ? 45  PRO A C      1 
ATOM   561   O  O      . PRO A 1 65  ? 7.145   7.410  -62.821  1.00 45.96  ? 45  PRO A O      1 
ATOM   562   C  CB     . PRO A 1 65  ? 5.164   8.095  -65.066  1.00 44.37  ? 45  PRO A CB     1 
ATOM   563   C  CG     . PRO A 1 65  ? 5.342   7.896  -66.528  1.00 44.94  ? 45  PRO A CG     1 
ATOM   564   C  CD     . PRO A 1 65  ? 6.375   8.866  -67.034  1.00 44.02  ? 45  PRO A CD     1 
ATOM   565   H  HA     . PRO A 1 65  ? 6.166   9.507  -63.940  1.00 53.65  ? 45  PRO A HA     1 
ATOM   566   H  HB2    . PRO A 1 65  ? 5.095   7.240  -64.612  1.00 53.36  ? 45  PRO A HB2    1 
ATOM   567   H  HB3    . PRO A 1 65  ? 4.382   8.640  -64.889  1.00 53.36  ? 45  PRO A HB3    1 
ATOM   568   H  HG2    . PRO A 1 65  ? 5.637   6.986  -66.689  1.00 54.05  ? 45  PRO A HG2    1 
ATOM   569   H  HG3    . PRO A 1 65  ? 4.495   8.054  -66.973  1.00 54.05  ? 45  PRO A HG3    1 
ATOM   570   H  HD2    . PRO A 1 65  ? 7.067   8.395  -67.524  1.00 52.94  ? 45  PRO A HD2    1 
ATOM   571   H  HD3    . PRO A 1 65  ? 5.956   9.548  -67.581  1.00 52.94  ? 45  PRO A HD3    1 
ATOM   572   N  N      . LEU A 1 66  ? 8.523   7.563  -64.597  1.00 38.32  ? 46  LEU A N      1 
ATOM   573   C  CA     . LEU A 1 66  ? 9.513   6.647  -64.052  1.00 34.58  ? 46  LEU A CA     1 
ATOM   574   C  C      . LEU A 1 66  ? 10.637  7.349  -63.299  1.00 32.47  ? 46  LEU A C      1 
ATOM   575   O  O      . LEU A 1 66  ? 11.441  6.669  -62.653  1.00 30.97  ? 46  LEU A O      1 
ATOM   576   C  CB     . LEU A 1 66  ? 10.117  5.803  -65.182  1.00 35.13  ? 46  LEU A CB     1 
ATOM   577   C  CG     . LEU A 1 66  ? 9.574   4.385  -65.386  1.00 36.27  ? 46  LEU A CG     1 
ATOM   578   C  CD1    . LEU A 1 66  ? 8.052   4.331  -65.304  1.00 36.62  ? 46  LEU A CD1    1 
ATOM   579   C  CD2    . LEU A 1 66  ? 10.055  3.842  -66.726  1.00 35.78  ? 46  LEU A CD2    1 
ATOM   580   H  H      . LEU A 1 66  ? 8.729   7.877  -65.371  1.00 46.10  ? 46  LEU A H      1 
ATOM   581   H  HA     . LEU A 1 66  ? 9.073   6.044  -63.433  1.00 41.62  ? 46  LEU A HA     1 
ATOM   582   H  HB2    . LEU A 1 66  ? 9.983   6.280  -66.015  1.00 42.28  ? 46  LEU A HB2    1 
ATOM   583   H  HB3    . LEU A 1 66  ? 11.069  5.719  -65.015  1.00 42.28  ? 46  LEU A HB3    1 
ATOM   584   H  HG     . LEU A 1 66  ? 9.929   3.811  -64.689  1.00 43.64  ? 46  LEU A HG     1 
ATOM   585   H  HD11   . LEU A 1 66  ? 7.761   3.416  -65.439  1.00 44.06  ? 46  LEU A HD11   1 
ATOM   586   H  HD12   . LEU A 1 66  ? 7.772   4.641  -64.428  1.00 44.06  ? 46  LEU A HD12   1 
ATOM   587   H  HD13   . LEU A 1 66  ? 7.678   4.903  -65.993  1.00 44.06  ? 46  LEU A HD13   1 
ATOM   588   H  HD21   . LEU A 1 66  ? 9.707   2.945  -66.847  1.00 43.05  ? 46  LEU A HD21   1 
ATOM   589   H  HD22   . LEU A 1 66  ? 9.733   4.421  -67.435  1.00 43.05  ? 46  LEU A HD22   1 
ATOM   590   H  HD23   . LEU A 1 66  ? 11.025  3.824  -66.729  1.00 43.05  ? 46  LEU A HD23   1 
ATOM   591   N  N      . MET A 1 67  ? 10.725  8.675  -63.367  1.00 35.18  ? 47  MET A N      1 
ATOM   592   C  CA     . MET A 1 67  ? 11.757  9.386  -62.627  1.00 41.50  ? 47  MET A CA     1 
ATOM   593   C  C      . MET A 1 67  ? 11.374  9.526  -61.156  1.00 41.67  ? 47  MET A C      1 
ATOM   594   O  O      . MET A 1 67  ? 10.195  9.612  -60.799  1.00 41.66  ? 47  MET A O      1 
ATOM   595   C  CB     . MET A 1 67  ? 12.020  10.760 -63.245  1.00 46.04  ? 47  MET A CB     1 
ATOM   596   C  CG     . MET A 1 67  ? 12.886  10.691 -64.498  1.00 50.82  ? 47  MET A CG     1 
ATOM   597   S  SD     . MET A 1 67  ? 13.633  12.266 -64.961  1.00 50.24  ? 47  MET A SD     1 
ATOM   598   C  CE     . MET A 1 67  ? 12.180  13.233 -65.350  1.00 51.58  ? 47  MET A CE     1 
ATOM   599   H  H      . MET A 1 67  ? 10.205  9.179  -63.830  1.00 42.34  ? 47  MET A H      1 
ATOM   600   H  HA     . MET A 1 67  ? 12.581  8.878  -62.683  1.00 49.92  ? 47  MET A HA     1 
ATOM   601   H  HB2    . MET A 1 67  ? 11.173  11.164 -63.489  1.00 55.36  ? 47  MET A HB2    1 
ATOM   602   H  HB3    . MET A 1 67  ? 12.478  11.316 -62.595  1.00 55.36  ? 47  MET A HB3    1 
ATOM   603   H  HG2    . MET A 1 67  ? 13.604  10.057 -64.347  1.00 61.11  ? 47  MET A HG2    1 
ATOM   604   H  HG3    . MET A 1 67  ? 12.337  10.395 -65.241  1.00 61.11  ? 47  MET A HG3    1 
ATOM   605   H  HE1    . MET A 1 67  ? 12.457  14.123 -65.620  1.00 62.01  ? 47  MET A HE1    1 
ATOM   606   H  HE2    . MET A 1 67  ? 11.699  12.802 -66.074  1.00 62.01  ? 47  MET A HE2    1 
ATOM   607   H  HE3    . MET A 1 67  ? 11.617  13.285 -64.563  1.00 62.01  ? 47  MET A HE3    1 
ATOM   608   N  N      . ARG A 1 68  ? 12.395  9.550  -60.305  1.00 42.20  ? 48  ARG A N      1 
ATOM   609   C  CA     . ARG A 1 68  ? 12.243  9.627  -58.861  1.00 41.83  ? 48  ARG A CA     1 
ATOM   610   C  C      . ARG A 1 68  ? 12.767  10.959 -58.337  1.00 38.85  ? 48  ARG A C      1 
ATOM   611   O  O      . ARG A 1 68  ? 13.690  11.550 -58.907  1.00 35.42  ? 48  ARG A O      1 
ATOM   612   C  CB     . ARG A 1 68  ? 12.979  8.465  -58.193  1.00 47.13  ? 48  ARG A CB     1 
ATOM   613   C  CG     . ARG A 1 68  ? 12.323  7.122  -58.464  1.00 54.30  ? 48  ARG A CG     1 
ATOM   614   C  CD     . ARG A 1 68  ? 13.227  5.953  -58.123  1.00 59.76  ? 48  ARG A CD     1 
ATOM   615   N  NE     . ARG A 1 68  ? 12.585  4.680  -58.432  1.00 65.58  ? 48  ARG A NE     1 
ATOM   616   C  CZ     . ARG A 1 68  ? 12.390  4.218  -59.664  1.00 70.94  ? 48  ARG A CZ     1 
ATOM   617   N  NH1    . ARG A 1 68  ? 12.775  4.927  -60.717  1.00 72.80  ? 48  ARG A NH1    1 
ATOM   618   N  NH2    . ARG A 1 68  ? 11.794  3.048  -59.847  1.00 73.86  ? 48  ARG A NH2    1 
ATOM   619   H  H      . ARG A 1 68  ? 13.217  9.521  -60.554  1.00 50.76  ? 48  ARG A H      1 
ATOM   620   H  HA     . ARG A 1 68  ? 11.302  9.561  -58.634  1.00 50.31  ? 48  ARG A HA     1 
ATOM   621   H  HB2    . ARG A 1 68  ? 13.887  8.429  -58.531  1.00 56.67  ? 48  ARG A HB2    1 
ATOM   622   H  HB3    . ARG A 1 68  ? 12.988  8.606  -57.233  1.00 56.67  ? 48  ARG A HB3    1 
ATOM   623   H  HG2    . ARG A 1 68  ? 11.520  7.048  -57.925  1.00 65.28  ? 48  ARG A HG2    1 
ATOM   624   H  HG3    . ARG A 1 68  ? 12.098  7.064  -59.406  1.00 65.28  ? 48  ARG A HG3    1 
ATOM   625   H  HD2    . ARG A 1 68  ? 14.044  6.017  -58.644  1.00 71.83  ? 48  ARG A HD2    1 
ATOM   626   H  HD3    . ARG A 1 68  ? 13.430  5.970  -57.175  1.00 71.83  ? 48  ARG A HD3    1 
ATOM   627   H  HE     . ARG A 1 68  ? 12.315  4.196  -57.775  1.00 78.82  ? 48  ARG A HE     1 
ATOM   628   H  HH11   . ARG A 1 68  ? 13.161  5.688  -60.605  1.00 87.48  ? 48  ARG A HH11   1 
ATOM   629   H  HH12   . ARG A 1 68  ? 12.644  4.625  -61.511  1.00 87.48  ? 48  ARG A HH12   1 
ATOM   630   H  HH21   . ARG A 1 68  ? 11.540  2.584  -59.169  1.00 88.75  ? 48  ARG A HH21   1 
ATOM   631   H  HH22   . ARG A 1 68  ? 11.666  2.751  -60.644  1.00 88.75  ? 48  ARG A HH22   1 
ATOM   632   N  N      . LEU A 1 69  ? 12.173  11.414 -57.235  1.00 39.74  ? 49  LEU A N      1 
ATOM   633   C  CA     . LEU A 1 69  ? 12.492  12.698 -56.621  1.00 35.74  ? 49  LEU A CA     1 
ATOM   634   C  C      . LEU A 1 69  ? 13.127  12.477 -55.255  1.00 29.69  ? 49  LEU A C      1 
ATOM   635   O  O      . LEU A 1 69  ? 12.595  11.721 -54.436  1.00 26.91  ? 49  LEU A O      1 
ATOM   636   C  CB     . LEU A 1 69  ? 11.229  13.550 -56.478  1.00 34.79  ? 49  LEU A CB     1 
ATOM   637   C  CG     . LEU A 1 69  ? 11.421  14.948 -55.885  1.00 33.80  ? 49  LEU A CG     1 
ATOM   638   C  CD1    . LEU A 1 69  ? 12.246  15.820 -56.812  1.00 33.83  ? 49  LEU A CD1    1 
ATOM   639   C  CD2    . LEU A 1 69  ? 10.075  15.593 -55.589  1.00 32.37  ? 49  LEU A CD2    1 
ATOM   640   H  H      . LEU A 1 69  ? 11.562  10.981 -56.813  1.00 47.81  ? 49  LEU A H      1 
ATOM   641   H  HA     . LEU A 1 69  ? 13.124  13.176 -57.181  1.00 43.01  ? 49  LEU A HA     1 
ATOM   642   H  HB2    . LEU A 1 69  ? 10.836  13.662 -57.357  1.00 41.87  ? 49  LEU A HB2    1 
ATOM   643   H  HB3    . LEU A 1 69  ? 10.606  13.077 -55.905  1.00 41.87  ? 49  LEU A HB3    1 
ATOM   644   H  HG     . LEU A 1 69  ? 11.903  14.868 -55.046  1.00 40.68  ? 49  LEU A HG     1 
ATOM   645   H  HD11   . LEU A 1 69  ? 12.351  16.697 -56.410  1.00 40.71  ? 49  LEU A HD11   1 
ATOM   646   H  HD12   . LEU A 1 69  ? 13.116  15.409 -56.941  1.00 40.71  ? 49  LEU A HD12   1 
ATOM   647   H  HD13   . LEU A 1 69  ? 11.787  15.898 -57.663  1.00 40.71  ? 49  LEU A HD13   1 
ATOM   648   H  HD21   . LEU A 1 69  ? 10.225  16.476 -55.214  1.00 38.96  ? 49  LEU A HD21   1 
ATOM   649   H  HD22   . LEU A 1 69  ? 9.571   15.664 -56.414  1.00 38.96  ? 49  LEU A HD22   1 
ATOM   650   H  HD23   . LEU A 1 69  ? 9.594   15.041 -54.953  1.00 38.96  ? 49  LEU A HD23   1 
ATOM   651   N  N      . TYR A 1 70  ? 14.255  13.146 -55.010  1.00 26.91  ? 50  TYR A N      1 
ATOM   652   C  CA     . TYR A 1 70  ? 14.990  13.003 -53.759  1.00 26.23  ? 50  TYR A CA     1 
ATOM   653   C  C      . TYR A 1 70  ? 15.267  14.370 -53.146  1.00 27.49  ? 50  TYR A C      1 
ATOM   654   O  O      . TYR A 1 70  ? 15.544  15.343 -53.858  1.00 29.38  ? 50  TYR A O      1 
ATOM   655   C  CB     . TYR A 1 70  ? 16.307  12.244 -53.976  1.00 24.89  ? 50  TYR A CB     1 
ATOM   656   C  CG     . TYR A 1 70  ? 16.153  10.739 -53.927  1.00 28.74  ? 50  TYR A CG     1 
ATOM   657   C  CD1    . TYR A 1 70  ? 15.556  10.044 -54.972  1.00 30.18  ? 50  TYR A CD1    1 
ATOM   658   C  CD2    . TYR A 1 70  ? 16.611  10.013 -52.837  1.00 32.43  ? 50  TYR A CD2    1 
ATOM   659   C  CE1    . TYR A 1 70  ? 15.413  8.669  -54.928  1.00 31.40  ? 50  TYR A CE1    1 
ATOM   660   C  CE2    . TYR A 1 70  ? 16.474  8.638  -52.784  1.00 34.71  ? 50  TYR A CE2    1 
ATOM   661   C  CZ     . TYR A 1 70  ? 15.875  7.971  -53.832  1.00 34.49  ? 50  TYR A CZ     1 
ATOM   662   O  OH     . TYR A 1 70  ? 15.738  6.602  -53.780  1.00 36.06  ? 50  TYR A OH     1 
ATOM   663   H  H      . TYR A 1 70  ? 14.618  13.697 -55.562  1.00 32.41  ? 50  TYR A H      1 
ATOM   664   H  HA     . TYR A 1 70  ? 14.451  12.496 -53.132  1.00 31.60  ? 50  TYR A HA     1 
ATOM   665   H  HB2    . TYR A 1 70  ? 16.663  12.478 -54.848  1.00 29.99  ? 50  TYR A HB2    1 
ATOM   666   H  HB3    . TYR A 1 70  ? 16.935  12.501 -53.283  1.00 29.99  ? 50  TYR A HB3    1 
ATOM   667   H  HD1    . TYR A 1 70  ? 15.242  10.513 -55.712  1.00 36.33  ? 50  TYR A HD1    1 
ATOM   668   H  HD2    . TYR A 1 70  ? 17.014  10.459 -52.127  1.00 39.03  ? 50  TYR A HD2    1 
ATOM   669   H  HE1    . TYR A 1 70  ? 15.010  8.218  -55.634  1.00 37.80  ? 50  TYR A HE1    1 
ATOM   670   H  HE2    . TYR A 1 70  ? 16.784  8.165  -52.046  1.00 41.78  ? 50  TYR A HE2    1 
ATOM   671   H  HH     . TYR A 1 70  ? 15.359  6.325  -54.477  1.00 43.39  ? 50  TYR A HH     1 
ATOM   672   N  N      . THR A 1 71  ? 15.208  14.420 -51.816  1.00 27.81  ? 51  THR A N      1 
ATOM   673   C  CA     . THR A 1 71  ? 15.392  15.635 -51.035  1.00 28.83  ? 51  THR A CA     1 
ATOM   674   C  C      . THR A 1 71  ? 16.773  15.646 -50.390  1.00 26.68  ? 51  THR A C      1 
ATOM   675   O  O      . THR A 1 71  ? 17.303  14.602 -50.000  1.00 27.27  ? 51  THR A O      1 
ATOM   676   C  CB     . THR A 1 71  ? 14.326  15.732 -49.937  1.00 32.11  ? 51  THR A CB     1 
ATOM   677   O  OG1    . THR A 1 71  ? 13.025  15.520 -50.499  1.00 32.16  ? 51  THR A OG1    1 
ATOM   678   C  CG2    . THR A 1 71  ? 14.362  17.095 -49.257  1.00 36.15  ? 51  THR A CG2    1 
ATOM   679   H  H      . THR A 1 71  ? 15.055  13.730 -51.326  1.00 33.49  ? 51  THR A H      1 
ATOM   680   H  HA     . THR A 1 71  ? 15.314  16.410 -51.613  1.00 34.71  ? 51  THR A HA     1 
ATOM   681   H  HB     . THR A 1 71  ? 14.498  15.054 -49.265  1.00 38.66  ? 51  THR A HB     1 
ATOM   682   H  HG1    . THR A 1 71  ? 12.867  16.100 -51.085  1.00 38.71  ? 51  THR A HG1    1 
ATOM   683   H  HG21   . THR A 1 71  ? 13.682  17.139 -48.567  1.00 43.50  ? 51  THR A HG21   1 
ATOM   684   H  HG22   . THR A 1 71  ? 15.232  17.241 -48.853  1.00 43.50  ? 51  THR A HG22   1 
ATOM   685   H  HG23   . THR A 1 71  ? 14.196  17.794 -49.908  1.00 43.50  ? 51  THR A HG23   1 
ATOM   686   N  N      . PHE A 1 72  ? 17.354  16.837 -50.270  1.00 23.80  ? 52  PHE A N      1 
ATOM   687   C  CA     . PHE A 1 72  ? 18.599  16.981 -49.523  1.00 26.23  ? 52  PHE A CA     1 
ATOM   688   C  C      . PHE A 1 72  ? 18.723  18.428 -49.057  1.00 30.50  ? 52  PHE A C      1 
ATOM   689   O  O      . PHE A 1 72  ? 17.812  19.241 -49.236  1.00 32.99  ? 52  PHE A O      1 
ATOM   690   C  CB     . PHE A 1 72  ? 19.803  16.525 -50.357  1.00 24.18  ? 52  PHE A CB     1 
ATOM   691   C  CG     . PHE A 1 72  ? 20.047  17.343 -51.594  1.00 24.86  ? 52  PHE A CG     1 
ATOM   692   C  CD1    . PHE A 1 72  ? 19.235  17.207 -52.708  1.00 25.00  ? 52  PHE A CD1    1 
ATOM   693   C  CD2    . PHE A 1 72  ? 21.123  18.215 -51.658  1.00 25.02  ? 52  PHE A CD2    1 
ATOM   694   C  CE1    . PHE A 1 72  ? 19.472  17.953 -53.852  1.00 23.68  ? 52  PHE A CE1    1 
ATOM   695   C  CE2    . PHE A 1 72  ? 21.366  18.959 -52.799  1.00 22.78  ? 52  PHE A CE2    1 
ATOM   696   C  CZ     . PHE A 1 72  ? 20.543  18.827 -53.897  1.00 21.33  ? 52  PHE A CZ     1 
ATOM   697   H  H      . PHE A 1 72  ? 17.052  17.568 -50.608  1.00 28.68  ? 52  PHE A H      1 
ATOM   698   H  HA     . PHE A 1 72  ? 18.556  16.419 -48.734  1.00 31.59  ? 52  PHE A HA     1 
ATOM   699   H  HB2    . PHE A 1 72  ? 20.600  16.579 -49.807  1.00 29.14  ? 52  PHE A HB2    1 
ATOM   700   H  HB3    . PHE A 1 72  ? 19.659  15.607 -50.635  1.00 29.14  ? 52  PHE A HB3    1 
ATOM   701   H  HD1    . PHE A 1 72  ? 18.513  16.622 -52.683  1.00 30.12  ? 52  PHE A HD1    1 
ATOM   702   H  HD2    . PHE A 1 72  ? 21.681  18.309 -50.920  1.00 30.14  ? 52  PHE A HD2    1 
ATOM   703   H  HE1    . PHE A 1 72  ? 18.916  17.861 -54.591  1.00 28.53  ? 52  PHE A HE1    1 
ATOM   704   H  HE2    . PHE A 1 72  ? 22.086  19.547 -52.826  1.00 27.45  ? 52  PHE A HE2    1 
ATOM   705   H  HZ     . PHE A 1 72  ? 20.704  19.327 -54.664  1.00 25.72  ? 52  PHE A HZ     1 
ATOM   706   N  N      . GLY A 1 73  ? 19.855  18.736 -48.436  1.00 29.43  ? 53  GLY A N      1 
ATOM   707   C  CA     . GLY A 1 73  ? 20.099  20.052 -47.884  1.00 27.98  ? 53  GLY A CA     1 
ATOM   708   C  C      . GLY A 1 73  ? 19.878  20.106 -46.385  1.00 27.01  ? 53  GLY A C      1 
ATOM   709   O  O      . GLY A 1 73  ? 19.831  19.090 -45.688  1.00 23.61  ? 53  GLY A O      1 
ATOM   710   H  H      . GLY A 1 73  ? 20.506  18.186 -48.322  1.00 35.44  ? 53  GLY A H      1 
ATOM   711   H  HA2    . GLY A 1 73  ? 21.015  20.314 -48.068  1.00 33.70  ? 53  GLY A HA2    1 
ATOM   712   H  HA3    . GLY A 1 73  ? 19.506  20.694 -48.304  1.00 33.70  ? 53  GLY A HA3    1 
ATOM   713   N  N      . SER A 1 74  ? 19.733  21.337 -45.885  1.00 29.74  ? 54  SER A N      1 
ATOM   714   C  CA     . SER A 1 74  ? 19.598  21.546 -44.446  1.00 29.57  ? 54  SER A CA     1 
ATOM   715   C  C      . SER A 1 74  ? 18.391  20.813 -43.877  1.00 24.71  ? 54  SER A C      1 
ATOM   716   O  O      . SER A 1 74  ? 18.415  20.392 -42.714  1.00 21.79  ? 54  SER A O      1 
ATOM   717   C  CB     . SER A 1 74  ? 19.494  23.041 -44.137  1.00 30.84  ? 54  SER A CB     1 
ATOM   718   O  OG     . SER A 1 74  ? 18.361  23.618 -44.761  1.00 29.61  ? 54  SER A OG     1 
ATOM   719   H  H      . SER A 1 74  ? 19.709  22.058 -46.353  1.00 35.81  ? 54  SER A H      1 
ATOM   720   H  HA     . SER A 1 74  ? 20.391  21.204 -44.003  1.00 35.60  ? 54  SER A HA     1 
ATOM   721   H  HB2    . SER A 1 74  ? 19.418  23.158 -43.177  1.00 37.12  ? 54  SER A HB2    1 
ATOM   722   H  HB3    . SER A 1 74  ? 20.293  23.485 -44.462  1.00 37.12  ? 54  SER A HB3    1 
ATOM   723   H  HG     . SER A 1 74  ? 18.414  23.525 -45.595  1.00 35.66  ? 54  SER A HG     1 
ATOM   724   N  N      . THR A 1 75  ? 17.332  20.650 -44.675  1.00 20.58  ? 55  THR A N      1 
ATOM   725   C  CA     . THR A 1 75  ? 16.160  19.912 -44.212  1.00 23.24  ? 55  THR A CA     1 
ATOM   726   C  C      . THR A 1 75  ? 16.542  18.509 -43.760  1.00 23.83  ? 55  THR A C      1 
ATOM   727   O  O      . THR A 1 75  ? 16.009  18.000 -42.766  1.00 19.83  ? 55  THR A O      1 
ATOM   728   C  CB     . THR A 1 75  ? 15.109  19.847 -45.323  1.00 26.61  ? 55  THR A CB     1 
ATOM   729   O  OG1    . THR A 1 75  ? 14.697  21.173 -45.678  1.00 29.90  ? 55  THR A OG1    1 
ATOM   730   C  CG2    . THR A 1 75  ? 13.886  19.048 -44.877  1.00 28.06  ? 55  THR A CG2    1 
ATOM   731   H  H      . THR A 1 75  ? 17.269  20.954 -45.478  1.00 24.81  ? 55  THR A H      1 
ATOM   732   H  HA     . THR A 1 75  ? 15.771  20.378 -43.455  1.00 28.00  ? 55  THR A HA     1 
ATOM   733   H  HB     . THR A 1 75  ? 15.491  19.411 -46.101  1.00 32.05  ? 55  THR A HB     1 
ATOM   734   H  HG1    . THR A 1 75  ? 15.358  21.615 -45.950  1.00 36.00  ? 55  THR A HG1    1 
ATOM   735   H  HG21   . THR A 1 75  ? 13.231  19.017 -45.592  1.00 33.79  ? 55  THR A HG21   1 
ATOM   736   H  HG22   . THR A 1 75  ? 14.147  18.142 -44.649  1.00 33.79  ? 55  THR A HG22   1 
ATOM   737   H  HG23   . THR A 1 75  ? 13.483  19.465 -44.099  1.00 33.79  ? 55  THR A HG23   1 
ATOM   738   N  N      . VAL A 1 76  ? 17.468  17.873 -44.471  1.00 33.09  ? 56  VAL A N      1 
ATOM   739   C  CA     . VAL A 1 76  ? 17.909  16.527 -44.125  1.00 35.53  ? 56  VAL A CA     1 
ATOM   740   C  C      . VAL A 1 76  ? 19.012  16.561 -43.075  1.00 34.50  ? 56  VAL A C      1 
ATOM   741   O  O      . VAL A 1 76  ? 19.050  15.713 -42.181  1.00 32.21  ? 56  VAL A O      1 
ATOM   742   C  CB     . VAL A 1 76  ? 18.364  15.788 -45.401  1.00 36.27  ? 56  VAL A CB     1 
ATOM   743   C  CG1    . VAL A 1 76  ? 18.894  14.397 -45.066  1.00 36.90  ? 56  VAL A CG1    1 
ATOM   744   C  CG2    . VAL A 1 76  ? 17.219  15.702 -46.402  1.00 36.55  ? 56  VAL A CG2    1 
ATOM   745   H  H      . VAL A 1 76  ? 17.859  18.202 -45.163  1.00 39.83  ? 56  VAL A H      1 
ATOM   746   H  HA     . VAL A 1 76  ? 17.159  16.039 -43.750  1.00 42.75  ? 56  VAL A HA     1 
ATOM   747   H  HB     . VAL A 1 76  ? 19.084  16.289 -45.814  1.00 43.64  ? 56  VAL A HB     1 
ATOM   748   H  HG11   . VAL A 1 76  ? 19.171  13.960 -45.886  1.00 44.40  ? 56  VAL A HG11   1 
ATOM   749   H  HG12   . VAL A 1 76  ? 19.650  14.484 -44.465  1.00 44.40  ? 56  VAL A HG12   1 
ATOM   750   H  HG13   . VAL A 1 76  ? 18.189  13.886 -44.639  1.00 44.40  ? 56  VAL A HG13   1 
ATOM   751   H  HG21   . VAL A 1 76  ? 17.527  15.235 -47.194  1.00 43.98  ? 56  VAL A HG21   1 
ATOM   752   H  HG22   . VAL A 1 76  ? 16.482  15.218 -45.997  1.00 43.98  ? 56  VAL A HG22   1 
ATOM   753   H  HG23   . VAL A 1 76  ? 16.937  16.600 -46.635  1.00 43.98  ? 56  VAL A HG23   1 
ATOM   754   N  N      . VAL A 1 77  ? 19.921  17.535 -43.167  1.00 35.33  ? 57  VAL A N      1 
ATOM   755   C  CA     . VAL A 1 77  ? 21.052  17.591 -42.243  1.00 35.71  ? 57  VAL A CA     1 
ATOM   756   C  C      . VAL A 1 77  ? 20.562  17.812 -40.816  1.00 35.76  ? 57  VAL A C      1 
ATOM   757   O  O      . VAL A 1 77  ? 21.012  17.144 -39.877  1.00 37.27  ? 57  VAL A O      1 
ATOM   758   C  CB     . VAL A 1 77  ? 22.045  18.685 -42.679  1.00 33.12  ? 57  VAL A CB     1 
ATOM   759   C  CG1    . VAL A 1 77  ? 23.190  18.808 -41.681  1.00 29.10  ? 57  VAL A CG1    1 
ATOM   760   C  CG2    . VAL A 1 77  ? 22.588  18.387 -44.069  1.00 33.77  ? 57  VAL A CG2    1 
ATOM   761   H  H      . VAL A 1 77  ? 19.905  18.167 -43.750  1.00 42.52  ? 57  VAL A H      1 
ATOM   762   H  HA     . VAL A 1 77  ? 21.519  16.741 -42.268  1.00 42.97  ? 57  VAL A HA     1 
ATOM   763   H  HB     . VAL A 1 77  ? 21.583  19.538 -42.713  1.00 39.86  ? 57  VAL A HB     1 
ATOM   764   H  HG11   . VAL A 1 77  ? 23.797  19.502 -41.982  1.00 35.04  ? 57  VAL A HG11   1 
ATOM   765   H  HG12   . VAL A 1 77  ? 22.828  19.038 -40.812  1.00 35.04  ? 57  VAL A HG12   1 
ATOM   766   H  HG13   . VAL A 1 77  ? 23.657  17.959 -41.632  1.00 35.04  ? 57  VAL A HG13   1 
ATOM   767   H  HG21   . VAL A 1 77  ? 23.210  19.088 -44.322  1.00 40.65  ? 57  VAL A HG21   1 
ATOM   768   H  HG22   . VAL A 1 77  ? 23.043  17.530 -44.053  1.00 40.65  ? 57  VAL A HG22   1 
ATOM   769   H  HG23   . VAL A 1 77  ? 21.849  18.358 -44.697  1.00 40.65  ? 57  VAL A HG23   1 
ATOM   770   N  N      . TYR A 1 78  ? 19.634  18.751 -40.631  1.00 33.24  ? 58  TYR A N      1 
ATOM   771   C  CA     . TYR A 1 78  ? 19.111  19.035 -39.300  1.00 32.39  ? 58  TYR A CA     1 
ATOM   772   C  C      . TYR A 1 78  ? 17.885  18.205 -38.948  1.00 34.47  ? 58  TYR A C      1 
ATOM   773   O  O      . TYR A 1 78  ? 17.639  17.952 -37.763  1.00 38.96  ? 58  TYR A O      1 
ATOM   774   C  CB     . TYR A 1 78  ? 18.745  20.518 -39.170  1.00 31.29  ? 58  TYR A CB     1 
ATOM   775   C  CG     . TYR A 1 78  ? 19.903  21.488 -39.268  1.00 27.92  ? 58  TYR A CG     1 
ATOM   776   C  CD1    . TYR A 1 78  ? 21.206  21.089 -38.997  1.00 26.95  ? 58  TYR A CD1    1 
ATOM   777   C  CD2    . TYR A 1 78  ? 19.686  22.815 -39.614  1.00 24.56  ? 58  TYR A CD2    1 
ATOM   778   C  CE1    . TYR A 1 78  ? 22.258  21.983 -39.079  1.00 26.93  ? 58  TYR A CE1    1 
ATOM   779   C  CE2    . TYR A 1 78  ? 20.728  23.714 -39.697  1.00 24.39  ? 58  TYR A CE2    1 
ATOM   780   C  CZ     . TYR A 1 78  ? 22.012  23.295 -39.429  1.00 27.35  ? 58  TYR A CZ     1 
ATOM   781   O  OH     . TYR A 1 78  ? 23.052  24.193 -39.512  1.00 29.05  ? 58  TYR A OH     1 
ATOM   782   H  H      . TYR A 1 78  ? 19.293  19.233 -41.256  1.00 40.01  ? 58  TYR A H      1 
ATOM   783   H  HA     . TYR A 1 78  ? 19.800  18.840 -38.645  1.00 38.99  ? 58  TYR A HA     1 
ATOM   784   H  HB2    . TYR A 1 78  ? 18.118  20.742 -39.876  1.00 37.67  ? 58  TYR A HB2    1 
ATOM   785   H  HB3    . TYR A 1 78  ? 18.323  20.655 -38.308  1.00 37.67  ? 58  TYR A HB3    1 
ATOM   786   H  HD1    . TYR A 1 78  ? 21.374  20.206 -38.761  1.00 32.46  ? 58  TYR A HD1    1 
ATOM   787   H  HD2    . TYR A 1 78  ? 18.820  23.103 -39.795  1.00 29.59  ? 58  TYR A HD2    1 
ATOM   788   H  HE1    . TYR A 1 78  ? 23.126  21.702 -38.898  1.00 32.44  ? 58  TYR A HE1    1 
ATOM   789   H  HE2    . TYR A 1 78  ? 20.564  24.599 -39.933  1.00 29.39  ? 58  TYR A HE2    1 
ATOM   790   H  HH     . TYR A 1 78  ? 23.776  23.811 -39.326  1.00 34.98  ? 58  TYR A HH     1 
ATOM   791   N  N      . GLY A 1 79  ? 17.112  17.775 -39.939  1.00 31.72  ? 59  GLY A N      1 
ATOM   792   C  CA     . GLY A 1 79  ? 15.839  17.142 -39.667  1.00 32.61  ? 59  GLY A CA     1 
ATOM   793   C  C      . GLY A 1 79  ? 14.718  18.097 -39.326  1.00 32.71  ? 59  GLY A C      1 
ATOM   794   O  O      . GLY A 1 79  ? 13.647  17.644 -38.905  1.00 33.24  ? 59  GLY A O      1 
ATOM   795   H  H      . GLY A 1 79  ? 17.305  17.840 -40.775  1.00 38.18  ? 59  GLY A H      1 
ATOM   796   H  HA2    . GLY A 1 79  ? 15.569  16.629 -40.444  1.00 39.25  ? 59  GLY A HA2    1 
ATOM   797   H  HA3    . GLY A 1 79  ? 15.946  16.527 -38.924  1.00 39.25  ? 59  GLY A HA3    1 
ATOM   798   N  N      . VAL A 1 80  ? 14.931  19.405 -39.488  1.00 33.21  ? 60  VAL A N      1 
ATOM   799   C  CA     . VAL A 1 80  ? 13.897  20.412 -39.285  1.00 35.31  ? 60  VAL A CA     1 
ATOM   800   C  C      . VAL A 1 80  ? 14.003  21.431 -40.413  1.00 34.93  ? 60  VAL A C      1 
ATOM   801   O  O      . VAL A 1 80  ? 15.039  21.566 -41.067  1.00 31.20  ? 60  VAL A O      1 
ATOM   802   C  CB     . VAL A 1 80  ? 14.000  21.115 -37.909  1.00 36.56  ? 60  VAL A CB     1 
ATOM   803   C  CG1    . VAL A 1 80  ? 13.839  20.107 -36.778  1.00 37.84  ? 60  VAL A CG1    1 
ATOM   804   C  CG2    . VAL A 1 80  ? 15.318  21.865 -37.769  1.00 37.45  ? 60  VAL A CG2    1 
ATOM   805   H  H      . VAL A 1 80  ? 15.688  19.739 -39.723  1.00 39.97  ? 60  VAL A H      1 
ATOM   806   H  HA     . VAL A 1 80  ? 13.026  19.989 -39.342  1.00 42.49  ? 60  VAL A HA     1 
ATOM   807   H  HB     . VAL A 1 80  ? 13.281  21.763 -37.834  1.00 43.99  ? 60  VAL A HB     1 
ATOM   808   H  HG11   . VAL A 1 80  ? 13.907  20.571 -35.929  1.00 45.52  ? 60  VAL A HG11   1 
ATOM   809   H  HG12   . VAL A 1 80  ? 12.970  19.683 -36.855  1.00 45.52  ? 60  VAL A HG12   1 
ATOM   810   H  HG13   . VAL A 1 80  ? 14.540  19.440 -36.848  1.00 45.52  ? 60  VAL A HG13   1 
ATOM   811   H  HG21   . VAL A 1 80  ? 15.348  22.291 -36.898  1.00 45.06  ? 60  VAL A HG21   1 
ATOM   812   H  HG22   . VAL A 1 80  ? 16.050  21.234 -37.854  1.00 45.06  ? 60  VAL A HG22   1 
ATOM   813   H  HG23   . VAL A 1 80  ? 15.376  22.535 -38.468  1.00 45.06  ? 60  VAL A HG23   1 
ATOM   814   N  N      . HIS A 1 81  ? 12.908  22.153 -40.634  1.00 37.11  ? 61  HIS A N      1 
ATOM   815   C  CA     . HIS A 1 81  ? 12.823  23.156 -41.688  1.00 40.18  ? 61  HIS A CA     1 
ATOM   816   C  C      . HIS A 1 81  ? 12.828  24.537 -41.046  1.00 44.14  ? 61  HIS A C      1 
ATOM   817   O  O      . HIS A 1 81  ? 11.941  24.857 -40.248  1.00 39.96  ? 61  HIS A O      1 
ATOM   818   C  CB     . HIS A 1 81  ? 11.562  22.952 -42.528  1.00 47.08  ? 61  HIS A CB     1 
ATOM   819   C  CG     . HIS A 1 81  ? 11.467  23.867 -43.708  1.00 56.74  ? 61  HIS A CG     1 
ATOM   820   N  ND1    . HIS A 1 81  ? 12.257  23.719 -44.829  1.00 59.05  ? 61  HIS A ND1    1 
ATOM   821   C  CD2    . HIS A 1 81  ? 10.674  24.939 -43.946  1.00 60.09  ? 61  HIS A CD2    1 
ATOM   822   C  CE1    . HIS A 1 81  ? 11.955  24.662 -45.705  1.00 59.55  ? 61  HIS A CE1    1 
ATOM   823   N  NE2    . HIS A 1 81  ? 10.998  25.415 -45.193  1.00 59.49  ? 61  HIS A NE2    1 
ATOM   824   H  H      . HIS A 1 81  ? 12.185  22.077 -40.174  1.00 44.65  ? 61  HIS A H      1 
ATOM   825   H  HA     . HIS A 1 81  ? 13.596  23.083 -42.269  1.00 48.33  ? 61  HIS A HA     1 
ATOM   826   H  HB2    . HIS A 1 81  ? 11.551  22.040 -42.858  1.00 56.61  ? 61  HIS A HB2    1 
ATOM   827   H  HB3    . HIS A 1 81  ? 10.785  23.109 -41.968  1.00 56.61  ? 61  HIS A HB3    1 
ATOM   828   H  HD2    . HIS A 1 81  ? 10.031  25.288 -43.371  1.00 72.23  ? 61  HIS A HD2    1 
ATOM   829   H  HE1    . HIS A 1 81  ? 12.350  24.775 -46.539  1.00 71.58  ? 61  HIS A HE1    1 
ATOM   830   H  HE2    . HIS A 1 81  ? 10.636  26.093 -45.579  1.00 71.50  ? 61  HIS A HE2    1 
ATOM   831   N  N      . GLU A 1 82  ? 13.817  25.352 -41.402  1.00 55.30  ? 62  GLU A N      1 
ATOM   832   C  CA     . GLU A 1 82  ? 13.958  26.684 -40.833  1.00 63.03  ? 62  GLU A CA     1 
ATOM   833   C  C      . GLU A 1 82  ? 13.256  27.713 -41.705  1.00 72.41  ? 62  GLU A C      1 
ATOM   834   O  O      . GLU A 1 82  ? 13.339  27.666 -42.936  1.00 71.80  ? 62  GLU A O      1 
ATOM   835   C  CB     . GLU A 1 82  ? 15.434  27.062 -40.698  1.00 56.08  ? 62  GLU A CB     1 
ATOM   836   C  CG     . GLU A 1 82  ? 16.273  26.086 -39.892  1.00 51.30  ? 62  GLU A CG     1 
ATOM   837   C  CD     . GLU A 1 82  ? 17.754  26.414 -39.944  1.00 45.91  ? 62  GLU A CD     1 
ATOM   838   O  OE1    . GLU A 1 82  ? 18.133  27.541 -39.561  1.00 45.29  ? 62  GLU A OE1    1 
ATOM   839   O  OE2    . GLU A 1 82  ? 18.540  25.549 -40.379  1.00 44.05  ? 62  GLU A OE2    1 
ATOM   840   H  H      . GLU A 1 82  ? 14.425  25.153 -41.977  1.00 66.48  ? 62  GLU A H      1 
ATOM   841   H  HA     . GLU A 1 82  ? 13.554  26.702 -39.951  1.00 75.75  ? 62  GLU A HA     1 
ATOM   842   H  HB2    . GLU A 1 82  ? 15.821  27.117 -41.586  1.00 67.42  ? 62  GLU A HB2    1 
ATOM   843   H  HB3    . GLU A 1 82  ? 15.493  27.927 -40.264  1.00 67.42  ? 62  GLU A HB3    1 
ATOM   844   H  HG2    . GLU A 1 82  ? 15.991  26.116 -38.964  1.00 61.67  ? 62  GLU A HG2    1 
ATOM   845   H  HG3    . GLU A 1 82  ? 16.150  25.192 -40.249  1.00 61.67  ? 62  GLU A HG3    1 
ATOM   846   N  N      . LYS A 1 83  ? 12.556  28.642 -41.056  1.00 69.72  ? 63  LYS A N      1 
ATOM   847   C  CA     . LYS A 1 83  ? 11.930  29.738 -41.779  1.00 73.76  ? 63  LYS A CA     1 
ATOM   848   C  C      . LYS A 1 83  ? 13.004  30.561 -42.477  1.00 64.16  ? 63  LYS A C      1 
ATOM   849   O  O      . LYS A 1 83  ? 14.009  30.938 -41.866  1.00 58.83  ? 63  LYS A O      1 
ATOM   850   C  CB     . LYS A 1 83  ? 11.120  30.611 -40.820  1.00 88.28  ? 63  LYS A CB     1 
ATOM   851   C  CG     . LYS A 1 83  ? 10.387  31.762 -41.494  1.00 100.57 ? 63  LYS A CG     1 
ATOM   852   C  CD     . LYS A 1 83  ? 11.168  33.065 -41.388  1.00 108.85 ? 63  LYS A CD     1 
ATOM   853   C  CE     . LYS A 1 83  ? 10.391  34.226 -41.984  1.00 114.25 ? 63  LYS A CE     1 
ATOM   854   N  NZ     . LYS A 1 83  ? 10.269  34.112 -43.464  1.00 115.46 ? 63  LYS A NZ     1 
ATOM   855   H  H      . LYS A 1 83  ? 12.431  28.658 -40.205  1.00 83.78  ? 63  LYS A H      1 
ATOM   856   H  HA     . LYS A 1 83  ? 11.329  29.381 -42.453  1.00 88.63  ? 63  LYS A HA     1 
ATOM   857   H  HB2    . LYS A 1 83  ? 10.457  30.057 -40.380  1.00 106.05 ? 63  LYS A HB2    1 
ATOM   858   H  HB3    . LYS A 1 83  ? 11.721  30.989 -40.161  1.00 106.05 ? 63  LYS A HB3    1 
ATOM   859   H  HG2    . LYS A 1 83  ? 10.265  31.557 -42.434  1.00 120.80 ? 63  LYS A HG2    1 
ATOM   860   H  HG3    . LYS A 1 83  ? 9.527   31.888 -41.064  1.00 120.80 ? 63  LYS A HG3    1 
ATOM   861   H  HD2    . LYS A 1 83  ? 11.340  33.261 -40.454  1.00 130.74 ? 63  LYS A HD2    1 
ATOM   862   H  HD3    . LYS A 1 83  ? 12.004  32.978 -41.873  1.00 130.74 ? 63  LYS A HD3    1 
ATOM   863   H  HE2    . LYS A 1 83  ? 9.497   34.239 -41.606  1.00 137.22 ? 63  LYS A HE2    1 
ATOM   864   H  HE3    . LYS A 1 83  ? 10.851  35.055 -41.781  1.00 137.22 ? 63  LYS A HE3    1 
ATOM   865   H  HZ1    . LYS A 1 83  ? 9.810   34.804 -43.785  1.00 138.67 ? 63  LYS A HZ1    1 
ATOM   866   H  HZ2    . LYS A 1 83  ? 11.077  34.103 -43.835  1.00 138.67 ? 63  LYS A HZ2    1 
ATOM   867   H  HZ3    . LYS A 1 83  ? 9.844   33.360 -43.676  1.00 138.67 ? 63  LYS A HZ3    1 
ATOM   868   N  N      . GLY A 1 84  ? 12.796  30.834 -43.761  1.00 67.39  ? 64  GLY A N      1 
ATOM   869   C  CA     . GLY A 1 84  ? 13.777  31.565 -44.536  1.00 64.38  ? 64  GLY A CA     1 
ATOM   870   C  C      . GLY A 1 84  ? 14.805  30.700 -45.226  1.00 58.75  ? 64  GLY A C      1 
ATOM   871   O  O      . GLY A 1 84  ? 15.857  31.213 -45.626  1.00 57.66  ? 64  GLY A O      1 
ATOM   872   H  H      . GLY A 1 84  ? 12.094  30.606 -44.202  1.00 80.99  ? 64  GLY A H      1 
ATOM   873   H  HA2    . GLY A 1 84  ? 13.319  32.085 -45.215  1.00 77.38  ? 64  GLY A HA2    1 
ATOM   874   H  HA3    . GLY A 1 84  ? 14.247  32.180 -43.952  1.00 77.38  ? 64  GLY A HA3    1 
ATOM   875   N  N      . SER A 1 85  ? 14.543  29.403 -45.372  1.00 55.11  ? 65  SER A N      1 
ATOM   876   C  CA     . SER A 1 85  ? 15.437  28.488 -46.065  1.00 46.09  ? 65  SER A CA     1 
ATOM   877   C  C      . SER A 1 85  ? 14.689  27.804 -47.200  1.00 36.84  ? 65  SER A C      1 
ATOM   878   O  O      . SER A 1 85  ? 13.488  27.535 -47.103  1.00 30.81  ? 65  SER A O      1 
ATOM   879   C  CB     . SER A 1 85  ? 16.007  27.434 -45.108  1.00 45.67  ? 65  SER A CB     1 
ATOM   880   O  OG     . SER A 1 85  ? 16.906  28.016 -44.181  1.00 45.04  ? 65  SER A OG     1 
ATOM   881   H  H      . SER A 1 85  ? 13.833  29.023 -45.070  1.00 66.25  ? 65  SER A H      1 
ATOM   882   H  HA     . SER A 1 85  ? 16.176  28.988 -46.444  1.00 55.43  ? 65  SER A HA     1 
ATOM   883   H  HB2    . SER A 1 85  ? 15.276  27.022 -44.621  1.00 54.92  ? 65  SER A HB2    1 
ATOM   884   H  HB3    . SER A 1 85  ? 16.480  26.762 -45.625  1.00 54.92  ? 65  SER A HB3    1 
ATOM   885   H  HG     . SER A 1 85  ? 17.546  28.376 -44.588  1.00 54.17  ? 65  SER A HG     1 
ATOM   886   N  N      . ASP A 1 86  ? 15.413  27.521 -48.279  1.00 35.79  ? 66  ASP A N      1 
ATOM   887   C  CA     . ASP A 1 86  ? 14.821  26.911 -49.461  1.00 34.12  ? 66  ASP A CA     1 
ATOM   888   C  C      . ASP A 1 86  ? 14.733  25.400 -49.266  1.00 31.27  ? 66  ASP A C      1 
ATOM   889   O  O      . ASP A 1 86  ? 14.912  24.878 -48.163  1.00 28.25  ? 66  ASP A O      1 
ATOM   890   C  CB     . ASP A 1 86  ? 15.636  27.263 -50.704  1.00 34.17  ? 66  ASP A CB     1 
ATOM   891   C  CG     . ASP A 1 86  ? 17.048  26.684 -50.674  1.00 31.97  ? 66  ASP A CG     1 
ATOM   892   O  OD1    . ASP A 1 86  ? 17.443  26.057 -49.663  1.00 30.83  ? 66  ASP A OD1    1 
ATOM   893   O  OD2    . ASP A 1 86  ? 17.765  26.849 -51.682  1.00 31.02  ? 66  ASP A OD2    1 
ATOM   894   H  H      . ASP A 1 86  ? 16.257  27.674 -48.350  1.00 43.07  ? 66  ASP A H      1 
ATOM   895   H  HA     . ASP A 1 86  ? 13.922  27.254 -49.581  1.00 41.06  ? 66  ASP A HA     1 
ATOM   896   H  HB2    . ASP A 1 86  ? 15.184  26.912 -51.487  1.00 41.12  ? 66  ASP A HB2    1 
ATOM   897   H  HB3    . ASP A 1 86  ? 15.710  28.228 -50.770  1.00 41.12  ? 66  ASP A HB3    1 
ATOM   898   N  N      . VAL A 1 87  ? 14.443  24.680 -50.347  1.00 31.94  ? 67  VAL A N      1 
ATOM   899   C  CA     . VAL A 1 87  ? 14.502  23.223 -50.353  1.00 28.31  ? 67  VAL A CA     1 
ATOM   900   C  C      . VAL A 1 87  ? 15.316  22.780 -51.564  1.00 23.59  ? 67  VAL A C      1 
ATOM   901   O  O      . VAL A 1 87  ? 15.253  23.402 -52.633  1.00 23.14  ? 67  VAL A O      1 
ATOM   902   C  CB     . VAL A 1 87  ? 13.094  22.590 -50.367  1.00 26.67  ? 67  VAL A CB     1 
ATOM   903   C  CG1    . VAL A 1 87  ? 13.188  21.073 -50.284  1.00 29.07  ? 67  VAL A CG1    1 
ATOM   904   C  CG2    . VAL A 1 87  ? 12.259  23.123 -49.213  1.00 22.02  ? 67  VAL A CG2    1 
ATOM   905   H  H      . VAL A 1 87  ? 14.207  25.019 -51.101  1.00 38.44  ? 67  VAL A H      1 
ATOM   906   H  HA     . VAL A 1 87  ? 14.960  22.920 -49.554  1.00 34.08  ? 67  VAL A HA     1 
ATOM   907   H  HB     . VAL A 1 87  ? 12.647  22.821 -51.197  1.00 32.13  ? 67  VAL A HB     1 
ATOM   908   H  HG11   . VAL A 1 87  ? 12.293  20.700 -50.294  1.00 35.00  ? 67  VAL A HG11   1 
ATOM   909   H  HG12   . VAL A 1 87  ? 13.692  20.746 -51.046  1.00 35.00  ? 67  VAL A HG12   1 
ATOM   910   H  HG13   . VAL A 1 87  ? 13.639  20.830 -49.460  1.00 35.00  ? 67  VAL A HG13   1 
ATOM   911   H  HG21   . VAL A 1 87  ? 11.381  22.712 -49.243  1.00 26.55  ? 67  VAL A HG21   1 
ATOM   912   H  HG22   . VAL A 1 87  ? 12.700  22.903 -48.377  1.00 26.55  ? 67  VAL A HG22   1 
ATOM   913   H  HG23   . VAL A 1 87  ? 12.177  24.085 -49.301  1.00 26.55  ? 67  VAL A HG23   1 
ATOM   914   N  N      . ASP A 1 88  ? 16.092  21.712 -51.390  1.00 21.98  ? 68  ASP A N      1 
ATOM   915   C  CA     . ASP A 1 88  ? 16.981  21.200 -52.427  1.00 25.24  ? 68  ASP A CA     1 
ATOM   916   C  C      . ASP A 1 88  ? 16.469  19.849 -52.912  1.00 27.34  ? 68  ASP A C      1 
ATOM   917   O  O      . ASP A 1 88  ? 16.368  18.898 -52.125  1.00 27.53  ? 68  ASP A O      1 
ATOM   918   C  CB     . ASP A 1 88  ? 18.414  21.074 -51.908  1.00 26.44  ? 68  ASP A CB     1 
ATOM   919   C  CG     . ASP A 1 88  ? 19.036  22.416 -51.573  1.00 28.11  ? 68  ASP A CG     1 
ATOM   920   O  OD1    . ASP A 1 88  ? 19.552  23.077 -52.499  1.00 27.77  ? 68  ASP A OD1    1 
ATOM   921   O  OD2    . ASP A 1 88  ? 19.019  22.808 -50.387  1.00 29.69  ? 68  ASP A OD2    1 
ATOM   922   H  H      . ASP A 1 88  ? 16.121  21.257 -50.661  1.00 26.50  ? 68  ASP A H      1 
ATOM   923   H  HA     . ASP A 1 88  ? 16.982  21.813 -53.179  1.00 30.41  ? 68  ASP A HA     1 
ATOM   924   H  HB2    . ASP A 1 88  ? 18.413  20.535 -51.102  1.00 31.85  ? 68  ASP A HB2    1 
ATOM   925   H  HB3    . ASP A 1 88  ? 18.961  20.652 -52.589  1.00 31.85  ? 68  ASP A HB3    1 
ATOM   926   N  N      . PHE A 1 89  ? 16.181  19.764 -54.211  1.00 27.03  ? 69  PHE A N      1 
ATOM   927   C  CA     . PHE A 1 89  ? 15.659  18.559 -54.837  1.00 24.86  ? 69  PHE A CA     1 
ATOM   928   C  C      . PHE A 1 89  ? 16.573  18.101 -55.969  1.00 22.19  ? 69  PHE A C      1 
ATOM   929   O  O      . PHE A 1 89  ? 17.222  18.915 -56.643  1.00 23.78  ? 69  PHE A O      1 
ATOM   930   C  CB     . PHE A 1 89  ? 14.247  18.784 -55.402  1.00 26.50  ? 69  PHE A CB     1 
ATOM   931   C  CG     . PHE A 1 89  ? 13.187  19.021 -54.357  1.00 30.09  ? 69  PHE A CG     1 
ATOM   932   C  CD1    . PHE A 1 89  ? 12.762  17.990 -53.535  1.00 34.25  ? 69  PHE A CD1    1 
ATOM   933   C  CD2    . PHE A 1 89  ? 12.588  20.265 -54.225  1.00 30.14  ? 69  PHE A CD2    1 
ATOM   934   C  CE1    . PHE A 1 89  ? 11.777  18.202 -52.584  1.00 35.60  ? 69  PHE A CE1    1 
ATOM   935   C  CE2    . PHE A 1 89  ? 11.603  20.482 -53.276  1.00 29.88  ? 69  PHE A CE2    1 
ATOM   936   C  CZ     . PHE A 1 89  ? 11.196  19.448 -52.458  1.00 33.59  ? 69  PHE A CZ     1 
ATOM   937   H  H      . PHE A 1 89  ? 16.284  20.415 -54.764  1.00 32.56  ? 69  PHE A H      1 
ATOM   938   H  HA     . PHE A 1 89  ? 15.613  17.850 -54.177  1.00 29.95  ? 69  PHE A HA     1 
ATOM   939   H  HB2    . PHE A 1 89  ? 14.265  19.560 -55.984  1.00 31.92  ? 69  PHE A HB2    1 
ATOM   940   H  HB3    . PHE A 1 89  ? 13.988  18.000 -55.911  1.00 31.92  ? 69  PHE A HB3    1 
ATOM   941   H  HD1    . PHE A 1 89  ? 13.149  17.148 -53.615  1.00 41.22  ? 69  PHE A HD1    1 
ATOM   942   H  HD2    . PHE A 1 89  ? 12.858  20.965 -54.774  1.00 36.28  ? 69  PHE A HD2    1 
ATOM   943   H  HE1    . PHE A 1 89  ? 11.505  17.504 -52.033  1.00 42.84  ? 69  PHE A HE1    1 
ATOM   944   H  HE2    . PHE A 1 89  ? 11.214  21.322 -53.193  1.00 35.97  ? 69  PHE A HE2    1 
ATOM   945   H  HZ     . PHE A 1 89  ? 10.536  19.592 -51.819  1.00 40.42  ? 69  PHE A HZ     1 
ATOM   946   N  N      . VAL A 1 90  ? 16.585  16.788 -56.202  1.00 19.19  ? 70  VAL A N      1 
ATOM   947   C  CA     . VAL A 1 90  ? 17.303  16.205 -57.331  1.00 21.18  ? 70  VAL A CA     1 
ATOM   948   C  C      . VAL A 1 90  ? 16.454  15.091 -57.929  1.00 25.01  ? 70  VAL A C      1 
ATOM   949   O  O      . VAL A 1 90  ? 15.748  14.374 -57.210  1.00 26.23  ? 70  VAL A O      1 
ATOM   950   C  CB     . VAL A 1 90  ? 18.694  15.674 -56.922  1.00 22.22  ? 70  VAL A CB     1 
ATOM   951   C  CG1    . VAL A 1 90  ? 18.573  14.549 -55.900  1.00 22.05  ? 70  VAL A CG1    1 
ATOM   952   C  CG2    . VAL A 1 90  ? 19.471  15.210 -58.149  1.00 23.87  ? 70  VAL A CG2    1 
ATOM   953   H  H      . VAL A 1 90  ? 16.179  16.209 -55.713  1.00 23.15  ? 70  VAL A H      1 
ATOM   954   H  HA     . VAL A 1 90  ? 17.429  16.885 -58.011  1.00 25.54  ? 70  VAL A HA     1 
ATOM   955   H  HB     . VAL A 1 90  ? 19.195  16.396 -56.510  1.00 26.78  ? 70  VAL A HB     1 
ATOM   956   H  HG11   . VAL A 1 90  ? 19.462  14.240 -55.665  1.00 26.57  ? 70  VAL A HG11   1 
ATOM   957   H  HG12   . VAL A 1 90  ? 18.121  14.888 -55.111  1.00 26.57  ? 70  VAL A HG12   1 
ATOM   958   H  HG13   . VAL A 1 90  ? 18.061  13.823 -56.289  1.00 26.57  ? 70  VAL A HG13   1 
ATOM   959   H  HG21   . VAL A 1 90  ? 20.339  14.882 -57.868  1.00 28.76  ? 70  VAL A HG21   1 
ATOM   960   H  HG22   . VAL A 1 90  ? 18.974  14.501 -58.587  1.00 28.76  ? 70  VAL A HG22   1 
ATOM   961   H  HG23   . VAL A 1 90  ? 19.581  15.960 -58.755  1.00 28.76  ? 70  VAL A HG23   1 
ATOM   962   N  N      . VAL A 1 91  ? 16.524  14.951 -59.255  1.00 25.48  ? 71  VAL A N      1 
ATOM   963   C  CA     . VAL A 1 91  ? 15.786  13.925 -59.987  1.00 25.88  ? 71  VAL A CA     1 
ATOM   964   C  C      . VAL A 1 91  ? 16.744  12.809 -60.378  1.00 25.17  ? 71  VAL A C      1 
ATOM   965   O  O      . VAL A 1 91  ? 17.861  13.071 -60.843  1.00 24.96  ? 71  VAL A O      1 
ATOM   966   C  CB     . VAL A 1 91  ? 15.098  14.519 -61.231  1.00 28.64  ? 71  VAL A CB     1 
ATOM   967   C  CG1    . VAL A 1 91  ? 14.359  13.439 -62.001  1.00 33.90  ? 71  VAL A CG1    1 
ATOM   968   C  CG2    . VAL A 1 91  ? 14.143  15.632 -60.834  1.00 28.33  ? 71  VAL A CG2    1 
ATOM   969   H  H      . VAL A 1 91  ? 17.004  15.453 -59.763  1.00 30.69  ? 71  VAL A H      1 
ATOM   970   H  HA     . VAL A 1 91  ? 15.101  13.550 -59.411  1.00 31.18  ? 71  VAL A HA     1 
ATOM   971   H  HB     . VAL A 1 91  ? 15.773  14.897 -61.816  1.00 34.49  ? 71  VAL A HB     1 
ATOM   972   H  HG11   . VAL A 1 91  ? 13.936  13.838 -62.777  1.00 40.79  ? 71  VAL A HG11   1 
ATOM   973   H  HG12   . VAL A 1 91  ? 14.993  12.761 -62.281  1.00 40.79  ? 71  VAL A HG12   1 
ATOM   974   H  HG13   . VAL A 1 91  ? 13.687  13.044 -61.423  1.00 40.79  ? 71  VAL A HG13   1 
ATOM   975   H  HG21   . VAL A 1 91  ? 13.724  15.988 -61.633  1.00 34.11  ? 71  VAL A HG21   1 
ATOM   976   H  HG22   . VAL A 1 91  ? 13.467  15.270 -60.239  1.00 34.11  ? 71  VAL A HG22   1 
ATOM   977   H  HG23   . VAL A 1 91  ? 14.642  16.330 -60.382  1.00 34.11  ? 71  VAL A HG23   1 
ATOM   978   N  N      . LEU A 1 92  ? 16.311  11.559 -60.196  1.00 28.11  ? 72  LEU A N      1 
ATOM   979   C  CA     . LEU A 1 92  ? 17.175  10.409 -60.429  1.00 35.87  ? 72  LEU A CA     1 
ATOM   980   C  C      . LEU A 1 92  ? 16.400  9.287  -61.109  1.00 40.41  ? 72  LEU A C      1 
ATOM   981   O  O      . LEU A 1 92  ? 15.190  9.140  -60.920  1.00 44.88  ? 72  LEU A O      1 
ATOM   982   C  CB     . LEU A 1 92  ? 17.779  9.889  -59.113  1.00 34.27  ? 72  LEU A CB     1 
ATOM   983   C  CG     . LEU A 1 92  ? 18.712  10.842 -58.358  1.00 29.86  ? 72  LEU A CG     1 
ATOM   984   C  CD1    . LEU A 1 92  ? 19.118  10.248 -57.018  1.00 26.79  ? 72  LEU A CD1    1 
ATOM   985   C  CD2    . LEU A 1 92  ? 19.945  11.175 -59.183  1.00 28.17  ? 72  LEU A CD2    1 
ATOM   986   H  H      . LEU A 1 92  ? 15.517  11.354 -59.938  1.00 33.85  ? 72  LEU A H      1 
ATOM   987   H  HA     . LEU A 1 92  ? 17.904  10.671 -61.013  1.00 43.16  ? 72  LEU A HA     1 
ATOM   988   H  HB2    . LEU A 1 92  ? 17.050  9.667  -58.513  1.00 41.25  ? 72  LEU A HB2    1 
ATOM   989   H  HB3    . LEU A 1 92  ? 18.287  9.087  -59.309  1.00 41.25  ? 72  LEU A HB3    1 
ATOM   990   H  HG     . LEU A 1 92  ? 18.239  11.671 -58.184  1.00 35.95  ? 72  LEU A HG     1 
ATOM   991   H  HD11   . LEU A 1 92  ? 19.707  10.870 -56.562  1.00 32.27  ? 72  LEU A HD11   1 
ATOM   992   H  HD12   . LEU A 1 92  ? 18.321  10.096 -56.486  1.00 32.27  ? 72  LEU A HD12   1 
ATOM   993   H  HD13   . LEU A 1 92  ? 19.579  9.408  -57.172  1.00 32.27  ? 72  LEU A HD13   1 
ATOM   994   H  HD21   . LEU A 1 92  ? 20.511  11.778 -58.676  1.00 33.92  ? 72  LEU A HD21   1 
ATOM   995   H  HD22   . LEU A 1 92  ? 20.425  10.355 -59.378  1.00 33.92  ? 72  LEU A HD22   1 
ATOM   996   H  HD23   . LEU A 1 92  ? 19.666  11.600 -60.010  1.00 33.92  ? 72  LEU A HD23   1 
ATOM   997   N  N      . ASN A 1 93  ? 17.120  8.492  -61.899  1.00 40.50  ? 73  ASN A N      1 
ATOM   998   C  CA     . ASN A 1 93  ? 16.574  7.304  -62.538  1.00 42.83  ? 73  ASN A CA     1 
ATOM   999   C  C      . ASN A 1 93  ? 16.827  6.067  -61.677  1.00 40.91  ? 73  ASN A C      1 
ATOM   1000  O  O      . ASN A 1 93  ? 17.555  6.102  -60.683  1.00 42.05  ? 73  ASN A O      1 
ATOM   1001  C  CB     . ASN A 1 93  ? 17.176  7.107  -63.932  1.00 51.20  ? 73  ASN A CB     1 
ATOM   1002  C  CG     . ASN A 1 93  ? 16.697  8.144  -64.930  1.00 56.99  ? 73  ASN A CG     1 
ATOM   1003  O  OD1    . ASN A 1 93  ? 15.511  8.475  -64.978  1.00 56.89  ? 73  ASN A OD1    1 
ATOM   1004  N  ND2    . ASN A 1 93  ? 17.616  8.653  -65.744  1.00 58.72  ? 73  ASN A ND2    1 
ATOM   1005  H  H      . ASN A 1 93  ? 17.949  8.627  -62.082  1.00 48.72  ? 73  ASN A H      1 
ATOM   1006  H  HA     . ASN A 1 93  ? 15.615  7.410  -62.637  1.00 51.51  ? 73  ASN A HA     1 
ATOM   1007  H  HB2    . ASN A 1 93  ? 18.142  7.172  -63.871  1.00 61.56  ? 73  ASN A HB2    1 
ATOM   1008  H  HB3    . ASN A 1 93  ? 16.923  6.231  -64.265  1.00 61.56  ? 73  ASN A HB3    1 
ATOM   1009  H  HD21   . ASN A 1 93  ? 17.394  9.245  -66.327  1.00 70.58  ? 73  ASN A HD21   1 
ATOM   1010  H  HD22   . ASN A 1 93  ? 18.433  8.391  -65.687  1.00 70.58  ? 73  ASN A HD22   1 
ATOM   1011  N  N      . LYS A 1 94  ? 16.215  4.954  -62.084  1.00 40.10  ? 74  LYS A N      1 
ATOM   1012  C  CA     . LYS A 1 94  ? 16.376  3.701  -61.354  1.00 41.97  ? 74  LYS A CA     1 
ATOM   1013  C  C      . LYS A 1 94  ? 17.840  3.275  -61.315  1.00 36.36  ? 74  LYS A C      1 
ATOM   1014  O  O      . LYS A 1 94  ? 18.390  2.985  -60.244  1.00 34.38  ? 74  LYS A O      1 
ATOM   1015  C  CB     . LYS A 1 94  ? 15.523  2.615  -62.012  1.00 49.11  ? 74  LYS A CB     1 
ATOM   1016  C  CG     . LYS A 1 94  ? 15.432  1.317  -61.233  1.00 55.32  ? 74  LYS A CG     1 
ATOM   1017  C  CD     . LYS A 1 94  ? 14.742  0.240  -62.055  1.00 61.22  ? 74  LYS A CD     1 
ATOM   1018  C  CE     . LYS A 1 94  ? 14.649  -1.065 -61.288  1.00 67.48  ? 74  LYS A CE     1 
ATOM   1019  N  NZ     . LYS A 1 94  ? 14.313  -2.210 -62.175  1.00 73.09  ? 74  LYS A NZ     1 
ATOM   1020  H  H      . LYS A 1 94  ? 15.705  4.900  -62.775  1.00 48.24  ? 74  LYS A H      1 
ATOM   1021  H  HA     . LYS A 1 94  ? 16.069  3.819  -60.442  1.00 50.48  ? 74  LYS A HA     1 
ATOM   1022  H  HB2    . LYS A 1 94  ? 14.621  2.955  -62.121  1.00 59.05  ? 74  LYS A HB2    1 
ATOM   1023  H  HB3    . LYS A 1 94  ? 15.901  2.409  -62.881  1.00 59.05  ? 74  LYS A HB3    1 
ATOM   1024  H  HG2    . LYS A 1 94  ? 16.325  1.010  -61.014  1.00 66.50  ? 74  LYS A HG2    1 
ATOM   1025  H  HG3    . LYS A 1 94  ? 14.916  1.462  -60.424  1.00 66.50  ? 74  LYS A HG3    1 
ATOM   1026  H  HD2    . LYS A 1 94  ? 13.842  0.530  -62.272  1.00 73.58  ? 74  LYS A HD2    1 
ATOM   1027  H  HD3    . LYS A 1 94  ? 15.250  0.081  -62.866  1.00 73.58  ? 74  LYS A HD3    1 
ATOM   1028  H  HE2    . LYS A 1 94  ? 15.503  -1.249 -60.867  1.00 81.10  ? 74  LYS A HE2    1 
ATOM   1029  H  HE3    . LYS A 1 94  ? 13.954  -0.990 -60.615  1.00 81.10  ? 74  LYS A HE3    1 
ATOM   1030  H  HZ1    . LYS A 1 94  ? 14.265  -2.960 -61.698  1.00 87.83  ? 74  LYS A HZ1    1 
ATOM   1031  H  HZ2    . LYS A 1 94  ? 13.528  -2.068 -62.570  1.00 87.83  ? 74  LYS A HZ2    1 
ATOM   1032  H  HZ3    . LYS A 1 94  ? 14.939  -2.304 -62.800  1.00 87.83  ? 74  LYS A HZ3    1 
ATOM   1033  N  N      . THR A 1 95  ? 18.491  3.235  -62.481  1.00 28.37  ? 75  THR A N      1 
ATOM   1034  C  CA     . THR A 1 95  ? 19.898  2.858  -62.537  1.00 28.55  ? 75  THR A CA     1 
ATOM   1035  C  C      . THR A 1 95  ? 20.772  3.808  -61.727  1.00 27.83  ? 75  THR A C      1 
ATOM   1036  O  O      . THR A 1 95  ? 21.789  3.385  -61.165  1.00 28.32  ? 75  THR A O      1 
ATOM   1037  C  CB     . THR A 1 95  ? 20.372  2.810  -63.990  1.00 34.71  ? 75  THR A CB     1 
ATOM   1038  O  OG1    . THR A 1 95  ? 20.097  4.064  -64.628  1.00 37.66  ? 75  THR A OG1    1 
ATOM   1039  C  CG2    . THR A 1 95  ? 19.673  1.684  -64.744  1.00 36.75  ? 75  THR A CG2    1 
ATOM   1040  H  H      . THR A 1 95  ? 18.141  3.420  -63.245  1.00 34.17  ? 75  THR A H      1 
ATOM   1041  H  HA     . THR A 1 95  ? 19.999  1.969  -62.162  1.00 34.38  ? 75  THR A HA     1 
ATOM   1042  H  HB     . THR A 1 95  ? 21.327  2.643  -64.010  1.00 41.77  ? 75  THR A HB     1 
ATOM   1043  H  HG1    . THR A 1 95  ? 19.272  4.220  -64.613  1.00 45.31  ? 75  THR A HG1    1 
ATOM   1044  H  HG21   . THR A 1 95  ? 19.980  1.662  -65.665  1.00 44.22  ? 75  THR A HG21   1 
ATOM   1045  H  HG22   . THR A 1 95  ? 19.872  0.832  -64.326  1.00 44.22  ? 75  THR A HG22   1 
ATOM   1046  H  HG23   . THR A 1 95  ? 18.714  1.824  -64.735  1.00 44.22  ? 75  THR A HG23   1 
ATOM   1047  N  N      . ASP A 1 96  ? 20.403  5.090  -61.657  1.00 28.47  ? 76  ASP A N      1 
ATOM   1048  C  CA     . ASP A 1 96  ? 21.170  6.027  -60.842  1.00 30.58  ? 76  ASP A CA     1 
ATOM   1049  C  C      . ASP A 1 96  ? 21.114  5.645  -59.368  1.00 34.06  ? 76  ASP A C      1 
ATOM   1050  O  O      . ASP A 1 96  ? 22.124  5.727  -58.658  1.00 34.69  ? 76  ASP A O      1 
ATOM   1051  C  CB     . ASP A 1 96  ? 20.649  7.450  -61.044  1.00 30.39  ? 76  ASP A CB     1 
ATOM   1052  C  CG     . ASP A 1 96  ? 20.876  7.962  -62.453  1.00 29.95  ? 76  ASP A CG     1 
ATOM   1053  O  OD1    . ASP A 1 96  ? 21.867  7.541  -63.085  1.00 30.40  ? 76  ASP A OD1    1 
ATOM   1054  O  OD2    . ASP A 1 96  ? 20.065  8.784  -62.929  1.00 28.25  ? 76  ASP A OD2    1 
ATOM   1055  H  H      . ASP A 1 96  ? 19.728  5.434  -62.064  1.00 34.29  ? 76  ASP A H      1 
ATOM   1056  H  HA     . ASP A 1 96  ? 22.098  6.004  -61.123  1.00 36.81  ? 76  ASP A HA     1 
ATOM   1057  H  HB2    . ASP A 1 96  ? 19.695  7.465  -60.869  1.00 36.58  ? 76  ASP A HB2    1 
ATOM   1058  H  HB3    . ASP A 1 96  ? 21.108  8.045  -60.430  1.00 36.58  ? 76  ASP A HB3    1 
ATOM   1059  N  N      . VAL A 1 97  ? 19.942  5.223  -58.889  1.00 35.22  ? 77  VAL A N      1 
ATOM   1060  C  CA     . VAL A 1 97  ? 19.799  4.858  -57.483  1.00 34.59  ? 77  VAL A CA     1 
ATOM   1061  C  C      . VAL A 1 97  ? 20.473  3.521  -57.201  1.00 32.72  ? 77  VAL A C      1 
ATOM   1062  O  O      . VAL A 1 97  ? 21.057  3.321  -56.129  1.00 31.89  ? 77  VAL A O      1 
ATOM   1063  C  CB     . VAL A 1 97  ? 18.311  4.837  -57.085  1.00 35.67  ? 77  VAL A CB     1 
ATOM   1064  C  CG1    . VAL A 1 97  ? 18.139  4.342  -55.650  1.00 36.84  ? 77  VAL A CG1    1 
ATOM   1065  C  CG2    . VAL A 1 97  ? 17.695  6.223  -57.243  1.00 33.04  ? 77  VAL A CG2    1 
ATOM   1066  H  H      . VAL A 1 97  ? 19.223  5.141  -59.354  1.00 42.38  ? 77  VAL A H      1 
ATOM   1067  H  HA     . VAL A 1 97  ? 20.240  5.530  -56.940  1.00 41.63  ? 77  VAL A HA     1 
ATOM   1068  H  HB     . VAL A 1 97  ? 17.835  4.229  -57.672  1.00 42.93  ? 77  VAL A HB     1 
ATOM   1069  H  HG11   . VAL A 1 97  ? 17.195  4.340  -55.428  1.00 44.33  ? 77  VAL A HG11   1 
ATOM   1070  H  HG12   . VAL A 1 97  ? 18.498  3.443  -55.581  1.00 44.33  ? 77  VAL A HG12   1 
ATOM   1071  H  HG13   . VAL A 1 97  ? 18.619  4.936  -55.052  1.00 44.33  ? 77  VAL A HG13   1 
ATOM   1072  H  HG21   . VAL A 1 97  ? 16.760  6.184  -56.987  1.00 39.76  ? 77  VAL A HG21   1 
ATOM   1073  H  HG22   . VAL A 1 97  ? 18.169  6.846  -56.671  1.00 39.76  ? 77  VAL A HG22   1 
ATOM   1074  H  HG23   . VAL A 1 97  ? 17.773  6.499  -58.170  1.00 39.76  ? 77  VAL A HG23   1 
ATOM   1075  N  N      . GLU A 1 98  ? 20.403  2.582  -58.149  1.00 32.45  ? 78  GLU A N      1 
ATOM   1076  C  CA     . GLU A 1 98  ? 20.970  1.258  -57.908  1.00 37.28  ? 78  GLU A CA     1 
ATOM   1077  C  C      . GLU A 1 98  ? 22.490  1.299  -57.792  1.00 31.23  ? 78  GLU A C      1 
ATOM   1078  O  O      . GLU A 1 98  ? 23.075  0.491  -57.061  1.00 27.96  ? 78  GLU A O      1 
ATOM   1079  C  CB     . GLU A 1 98  ? 20.555  0.299  -59.022  1.00 46.44  ? 78  GLU A CB     1 
ATOM   1080  C  CG     . GLU A 1 98  ? 19.093  -0.103 -58.976  1.00 53.47  ? 78  GLU A CG     1 
ATOM   1081  C  CD     . GLU A 1 98  ? 18.733  -1.098 -60.060  1.00 57.86  ? 78  GLU A CD     1 
ATOM   1082  O  OE1    . GLU A 1 98  ? 19.602  -1.402 -60.906  1.00 59.01  ? 78  GLU A OE1    1 
ATOM   1083  O  OE2    . GLU A 1 98  ? 17.590  -1.595 -60.055  1.00 58.74  ? 78  GLU A OE2    1 
ATOM   1084  H  H      . GLU A 1 98  ? 20.040  2.685  -58.922  1.00 39.06  ? 78  GLU A H      1 
ATOM   1085  H  HA     . GLU A 1 98  ? 20.617  0.914  -57.073  1.00 44.86  ? 78  GLU A HA     1 
ATOM   1086  H  HB2    . GLU A 1 98  ? 20.717  0.726  -59.878  1.00 55.84  ? 78  GLU A HB2    1 
ATOM   1087  H  HB3    . GLU A 1 98  ? 21.086  -0.509 -58.952  1.00 55.84  ? 78  GLU A HB3    1 
ATOM   1088  H  HG2    . GLU A 1 98  ? 18.904  -0.511 -58.117  1.00 64.29  ? 78  GLU A HG2    1 
ATOM   1089  H  HG3    . GLU A 1 98  ? 18.543  0.687  -59.098  1.00 64.29  ? 78  GLU A HG3    1 
ATOM   1090  N  N      . ASP A 1 99  ? 23.144  2.223  -58.498  1.00 25.69  ? 79  ASP A N      1 
ATOM   1091  C  CA     . ASP A 1 99  ? 24.589  2.424  -58.377  1.00 23.84  ? 79  ASP A CA     1 
ATOM   1092  C  C      . ASP A 1 99  ? 24.862  3.321  -57.167  1.00 25.42  ? 79  ASP A C      1 
ATOM   1093  O  O      . ASP A 1 99  ? 25.213  4.498  -57.278  1.00 23.24  ? 79  ASP A O      1 
ATOM   1094  C  CB     . ASP A 1 99  ? 25.146  3.013  -59.666  1.00 24.28  ? 79  ASP A CB     1 
ATOM   1095  C  CG     . ASP A 1 99  ? 26.657  3.118  -59.656  1.00 31.60  ? 79  ASP A CG     1 
ATOM   1096  O  OD1    . ASP A 1 99  ? 27.314  2.293  -58.986  1.00 35.21  ? 79  ASP A OD1    1 
ATOM   1097  O  OD2    . ASP A 1 99  ? 27.189  4.025  -60.328  1.00 35.09  ? 79  ASP A OD2    1 
ATOM   1098  H  H      . ASP A 1 99  ? 22.768  2.753  -59.061  1.00 30.95  ? 79  ASP A H      1 
ATOM   1099  H  HA     . ASP A 1 99  ? 25.019  1.568  -58.224  1.00 28.73  ? 79  ASP A HA     1 
ATOM   1100  H  HB2    . ASP A 1 99  ? 24.890  2.445  -60.409  1.00 29.25  ? 79  ASP A HB2    1 
ATOM   1101  H  HB3    . ASP A 1 99  ? 24.784  3.904  -59.788  1.00 29.25  ? 79  ASP A HB3    1 
ATOM   1102  N  N      . GLY A 1 100 ? 24.700  2.725  -55.982  1.00 30.19  ? 80  GLY A N      1 
ATOM   1103  C  CA     . GLY A 1 100 ? 24.565  3.510  -54.766  1.00 29.09  ? 80  GLY A CA     1 
ATOM   1104  C  C      . GLY A 1 100 ? 25.809  4.281  -54.369  1.00 26.12  ? 80  GLY A C      1 
ATOM   1105  O  O      . GLY A 1 100 ? 25.709  5.309  -53.693  1.00 20.13  ? 80  GLY A O      1 
ATOM   1106  H  H      . GLY A 1 100 ? 24.666  1.874  -55.862  1.00 36.35  ? 80  GLY A H      1 
ATOM   1107  H  HA2    . GLY A 1 100 ? 23.842  4.147  -54.881  1.00 35.03  ? 80  GLY A HA2    1 
ATOM   1108  H  HA3    . GLY A 1 100 ? 24.332  2.919  -54.034  1.00 35.03  ? 80  GLY A HA3    1 
ATOM   1109  N  N      . LYS A 1 101 ? 26.992  3.804  -54.765  1.00 29.60  ? 81  LYS A N      1 
ATOM   1110  C  CA     . LYS A 1 101 ? 28.250  4.420  -54.349  1.00 30.09  ? 81  LYS A CA     1 
ATOM   1111  C  C      . LYS A 1 101 ? 29.073  4.924  -55.531  1.00 24.52  ? 81  LYS A C      1 
ATOM   1112  O  O      . LYS A 1 101 ? 30.278  5.156  -55.386  1.00 22.97  ? 81  LYS A O      1 
ATOM   1113  C  CB     . LYS A 1 101 ? 29.077  3.443  -53.510  1.00 36.24  ? 81  LYS A CB     1 
ATOM   1114  C  CG     . LYS A 1 101 ? 28.414  3.024  -52.206  1.00 39.85  ? 81  LYS A CG     1 
ATOM   1115  C  CD     . LYS A 1 101 ? 29.367  2.227  -51.324  1.00 42.72  ? 81  LYS A CD     1 
ATOM   1116  C  CE     . LYS A 1 101 ? 28.685  1.760  -50.045  1.00 47.17  ? 81  LYS A CE     1 
ATOM   1117  N  NZ     . LYS A 1 101 ? 29.611  1.019  -49.142  1.00 50.73  ? 81  LYS A NZ     1 
ATOM   1118  H  H      . LYS A 1 101 ? 27.091  3.121  -55.278  1.00 35.64  ? 81  LYS A H      1 
ATOM   1119  H  HA     . LYS A 1 101 ? 28.046  5.185  -53.789  1.00 36.23  ? 81  LYS A HA     1 
ATOM   1120  H  HB2    . LYS A 1 101 ? 29.235  2.641  -54.032  1.00 43.61  ? 81  LYS A HB2    1 
ATOM   1121  H  HB3    . LYS A 1 101 ? 29.924  3.862  -53.289  1.00 43.61  ? 81  LYS A HB3    1 
ATOM   1122  H  HG2    . LYS A 1 101 ? 28.138  3.816  -51.718  1.00 47.94  ? 81  LYS A HG2    1 
ATOM   1123  H  HG3    . LYS A 1 101 ? 27.645  2.467  -52.403  1.00 47.94  ? 81  LYS A HG3    1 
ATOM   1124  H  HD2    . LYS A 1 101 ? 29.674  1.445  -51.809  1.00 51.39  ? 81  LYS A HD2    1 
ATOM   1125  H  HD3    . LYS A 1 101 ? 30.121  2.787  -51.080  1.00 51.39  ? 81  LYS A HD3    1 
ATOM   1126  H  HE2    . LYS A 1 101 ? 28.350  2.533  -49.564  1.00 56.72  ? 81  LYS A HE2    1 
ATOM   1127  H  HE3    . LYS A 1 101 ? 27.952  1.168  -50.275  1.00 56.72  ? 81  LYS A HE3    1 
ATOM   1128  H  HZ1    . LYS A 1 101 ? 29.929  0.299  -49.557  1.00 61.00  ? 81  LYS A HZ1    1 
ATOM   1129  H  HZ2    . LYS A 1 101 ? 30.292  1.543  -48.909  1.00 61.00  ? 81  LYS A HZ2    1 
ATOM   1130  H  HZ3    . LYS A 1 101 ? 29.179  0.763  -48.407  1.00 61.00  ? 81  LYS A HZ3    1 
ATOM   1131  N  N      . GLY A 1 102 ? 28.455  5.103  -56.696  1.00 21.35  ? 82  GLY A N      1 
ATOM   1132  C  CA     . GLY A 1 102 ? 29.178  5.624  -57.837  1.00 21.51  ? 82  GLY A CA     1 
ATOM   1133  C  C      . GLY A 1 102 ? 29.448  7.113  -57.725  1.00 24.01  ? 82  GLY A C      1 
ATOM   1134  O  O      . GLY A 1 102 ? 28.850  7.830  -56.921  1.00 22.76  ? 82  GLY A O      1 
ATOM   1135  H  H      . GLY A 1 102 ? 27.626  4.931  -56.845  1.00 25.74  ? 82  GLY A H      1 
ATOM   1136  H  HA2    . GLY A 1 102 ? 30.028  5.163  -57.918  1.00 25.93  ? 82  GLY A HA2    1 
ATOM   1137  H  HA3    . GLY A 1 102 ? 28.664  5.465  -58.644  1.00 25.93  ? 82  GLY A HA3    1 
ATOM   1138  N  N      . GLY A 1 103 ? 30.383  7.584  -58.559  1.00 22.52  ? 83  GLY A N      1 
ATOM   1139  C  CA     . GLY A 1 103 ? 30.732  8.988  -58.606  1.00 19.82  ? 83  GLY A CA     1 
ATOM   1140  C  C      . GLY A 1 103 ? 29.906  9.762  -59.622  1.00 18.48  ? 83  GLY A C      1 
ATOM   1141  O  O      . GLY A 1 103 ? 29.072  9.215  -60.342  1.00 18.68  ? 83  GLY A O      1 
ATOM   1142  H  H      . GLY A 1 103 ? 30.829  7.096  -59.109  1.00 27.14  ? 83  GLY A H      1 
ATOM   1143  H  HA2    . GLY A 1 103 ? 30.593  9.385  -57.732  1.00 23.90  ? 83  GLY A HA2    1 
ATOM   1144  H  HA3    . GLY A 1 103 ? 31.669  9.080  -58.839  1.00 23.90  ? 83  GLY A HA3    1 
ATOM   1145  N  N      . ASP A 1 104 ? 30.157  11.069 -59.671  1.00 24.39  ? 84  ASP A N      1 
ATOM   1146  C  CA     . ASP A 1 104 ? 29.485  11.975 -60.596  1.00 27.45  ? 84  ASP A CA     1 
ATOM   1147  C  C      . ASP A 1 104 ? 30.475  12.477 -61.639  1.00 27.97  ? 84  ASP A C      1 
ATOM   1148  O  O      . ASP A 1 104 ? 31.542  12.993 -61.292  1.00 28.65  ? 84  ASP A O      1 
ATOM   1149  C  CB     . ASP A 1 104 ? 28.864  13.158 -59.849  1.00 27.55  ? 84  ASP A CB     1 
ATOM   1150  C  CG     . ASP A 1 104 ? 27.729  12.741 -58.932  1.00 27.84  ? 84  ASP A CG     1 
ATOM   1151  O  OD1    . ASP A 1 104 ? 27.076  11.715 -59.215  1.00 28.22  ? 84  ASP A OD1    1 
ATOM   1152  O  OD2    . ASP A 1 104 ? 27.487  13.442 -57.927  1.00 27.42  ? 84  ASP A OD2    1 
ATOM   1153  H  H      . ASP A 1 104 ? 30.728  11.463 -59.163  1.00 29.39  ? 84  ASP A H      1 
ATOM   1154  H  HA     . ASP A 1 104 ? 28.775  11.497 -61.054  1.00 33.05  ? 84  ASP A HA     1 
ATOM   1155  H  HB2    . ASP A 1 104 ? 29.547  13.584 -59.307  1.00 33.18  ? 84  ASP A HB2    1 
ATOM   1156  H  HB3    . ASP A 1 104 ? 28.511  13.790 -60.495  1.00 33.18  ? 84  ASP A HB3    1 
ATOM   1157  N  N      . ALA A 1 105 ? 30.114  12.329 -62.911  1.00 29.05  ? 85  ALA A N      1 
ATOM   1158  C  CA     . ALA A 1 105 ? 30.987  12.723 -64.006  1.00 29.63  ? 85  ALA A CA     1 
ATOM   1159  C  C      . ALA A 1 105 ? 31.063  14.244 -64.126  1.00 29.94  ? 85  ALA A C      1 
ATOM   1160  O  O      . ALA A 1 105 ? 30.161  14.977 -63.709  1.00 31.84  ? 85  ALA A O      1 
ATOM   1161  C  CB     . ALA A 1 105 ? 30.500  12.122 -65.323  1.00 32.05  ? 85  ALA A CB     1 
ATOM   1162  H  H      . ALA A 1 105 ? 29.361  11.999 -63.166  1.00 34.98  ? 85  ALA A H      1 
ATOM   1163  H  HA     . ALA A 1 105 ? 31.882  12.389 -63.834  1.00 35.68  ? 85  ALA A HA     1 
ATOM   1164  H  HB1    . ALA A 1 105 ? 31.097  12.398 -66.036  1.00 38.58  ? 85  ALA A HB1    1 
ATOM   1165  H  HB2    . ALA A 1 105 ? 30.499  11.154 -65.247  1.00 38.58  ? 85  ALA A HB2    1 
ATOM   1166  H  HB3    . ALA A 1 105 ? 29.601  12.440 -65.501  1.00 38.58  ? 85  ALA A HB3    1 
ATOM   1167  N  N      . ALA A 1 106 ? 32.166  14.713 -64.715  1.00 30.22  ? 86  ALA A N      1 
ATOM   1168  C  CA     . ALA A 1 106 ? 32.427  16.137 -64.897  1.00 35.49  ? 86  ALA A CA     1 
ATOM   1169  C  C      . ALA A 1 106 ? 32.538  16.533 -66.367  1.00 37.31  ? 86  ALA A C      1 
ATOM   1170  O  O      . ALA A 1 106 ? 32.981  17.648 -66.666  1.00 40.11  ? 86  ALA A O      1 
ATOM   1171  C  CB     . ALA A 1 106 ? 33.703  16.538 -64.151  1.00 37.64  ? 86  ALA A CB     1 
ATOM   1172  H  H      . ALA A 1 106 ? 32.791  14.210 -65.023  1.00 36.38  ? 86  ALA A H      1 
ATOM   1173  H  HA     . ALA A 1 106 ? 31.691  16.639 -64.513  1.00 42.71  ? 86  ALA A HA     1 
ATOM   1174  H  HB1    . ALA A 1 106 ? 33.861  17.486 -64.283  1.00 45.28  ? 86  ALA A HB1    1 
ATOM   1175  H  HB2    . ALA A 1 106 ? 33.588  16.350 -63.206  1.00 45.28  ? 86  ALA A HB2    1 
ATOM   1176  H  HB3    . ALA A 1 106 ? 34.448  16.025 -64.502  1.00 45.28  ? 86  ALA A HB3    1 
ATOM   1177  N  N      . THR A 1 107 ? 32.153  15.652 -67.287  1.00 33.99  ? 87  THR A N      1 
ATOM   1178  C  CA     . THR A 1 107 ? 32.277  15.887 -68.718  1.00 30.41  ? 87  THR A CA     1 
ATOM   1179  C  C      . THR A 1 107 ? 31.185  16.827 -69.229  1.00 30.09  ? 87  THR A C      1 
ATOM   1180  O  O      . THR A 1 107 ? 30.159  17.049 -68.581  1.00 32.86  ? 87  THR A O      1 
ATOM   1181  C  CB     . THR A 1 107 ? 32.203  14.563 -69.479  1.00 32.90  ? 87  THR A CB     1 
ATOM   1182  O  OG1    . THR A 1 107 ? 30.934  13.942 -69.238  1.00 35.02  ? 87  THR A OG1    1 
ATOM   1183  C  CG2    . THR A 1 107 ? 33.310  13.623 -69.028  1.00 34.43  ? 87  THR A CG2    1 
ATOM   1184  H  H      . THR A 1 107 ? 31.806  14.888 -67.097  1.00 40.91  ? 87  THR A H      1 
ATOM   1185  H  HA     . THR A 1 107 ? 33.138  16.294 -68.900  1.00 36.60  ? 87  THR A HA     1 
ATOM   1186  H  HB     . THR A 1 107 ? 32.307  14.729 -70.429  1.00 39.60  ? 87  THR A HB     1 
ATOM   1187  H  HG1    . THR A 1 107 ? 30.887  13.214 -69.654  1.00 42.15  ? 87  THR A HG1    1 
ATOM   1188  H  HG21   . THR A 1 107 ? 33.254  12.787 -69.517  1.00 41.43  ? 87  THR A HG21   1 
ATOM   1189  H  HG22   . THR A 1 107 ? 34.176  14.028 -69.194  1.00 41.43  ? 87  THR A HG22   1 
ATOM   1190  H  HG23   . THR A 1 107 ? 33.223  13.440 -68.080  1.00 41.43  ? 87  THR A HG23   1 
ATOM   1191  N  N      . GLN A 1 108 ? 31.427  17.385 -70.420  1.00 31.45  ? 88  GLN A N      1 
ATOM   1192  C  CA     . GLN A 1 108 ? 30.444  18.258 -71.057  1.00 35.86  ? 88  GLN A CA     1 
ATOM   1193  C  C      . GLN A 1 108 ? 29.190  17.492 -71.464  1.00 32.63  ? 88  GLN A C      1 
ATOM   1194  O  O      . GLN A 1 108 ? 28.085  18.048 -71.425  1.00 34.66  ? 88  GLN A O      1 
ATOM   1195  C  CB     . GLN A 1 108 ? 31.059  18.931 -72.287  1.00 42.55  ? 88  GLN A CB     1 
ATOM   1196  C  CG     . GLN A 1 108 ? 32.042  20.055 -71.981  1.00 49.93  ? 88  GLN A CG     1 
ATOM   1197  C  CD     . GLN A 1 108 ? 31.371  21.293 -71.413  1.00 55.52  ? 88  GLN A CD     1 
ATOM   1198  O  OE1    . GLN A 1 108 ? 31.838  21.869 -70.429  1.00 57.23  ? 88  GLN A OE1    1 
ATOM   1199  N  NE2    . GLN A 1 108 ? 30.278  21.718 -72.040  1.00 56.27  ? 88  GLN A NE2    1 
ATOM   1200  H  H      . GLN A 1 108 ? 32.149  17.274 -70.875  1.00 37.86  ? 88  GLN A H      1 
ATOM   1201  H  HA     . GLN A 1 108 ? 30.184  18.952 -70.432  1.00 43.15  ? 88  GLN A HA     1 
ATOM   1202  H  HB2    . GLN A 1 108 ? 31.534  18.259 -72.801  1.00 51.17  ? 88  GLN A HB2    1 
ATOM   1203  H  HB3    . GLN A 1 108 ? 30.344  19.306 -72.824  1.00 51.17  ? 88  GLN A HB3    1 
ATOM   1204  H  HG2    . GLN A 1 108 ? 32.688  19.739 -71.329  1.00 60.04  ? 88  GLN A HG2    1 
ATOM   1205  H  HG3    . GLN A 1 108 ? 32.495  20.309 -72.800  1.00 60.04  ? 88  GLN A HG3    1 
ATOM   1206  H  HE21   . GLN A 1 108 ? 29.987  21.295 -72.729  1.00 67.64  ? 88  GLN A HE21   1 
ATOM   1207  H  HE22   . GLN A 1 108 ? 29.863  22.415 -71.755  1.00 67.64  ? 88  GLN A HE22   1 
ATOM   1208  N  N      . VAL A 1 109 ? 29.339  16.225 -71.856  1.00 30.47  ? 89  VAL A N      1 
ATOM   1209  C  CA     . VAL A 1 109 ? 28.185  15.418 -72.253  1.00 34.45  ? 89  VAL A CA     1 
ATOM   1210  C  C      . VAL A 1 109 ? 27.184  15.317 -71.104  1.00 34.52  ? 89  VAL A C      1 
ATOM   1211  O  O      . VAL A 1 109 ? 25.970  15.500 -71.289  1.00 33.71  ? 89  VAL A O      1 
ATOM   1212  C  CB     . VAL A 1 109 ? 28.647  14.025 -72.722  1.00 39.83  ? 89  VAL A CB     1 
ATOM   1213  C  CG1    . VAL A 1 109 ? 27.467  13.201 -73.217  1.00 43.18  ? 89  VAL A CG1    1 
ATOM   1214  C  CG2    . VAL A 1 109 ? 29.703  14.149 -73.818  1.00 42.27  ? 89  VAL A CG2    1 
ATOM   1215  H  H      . VAL A 1 109 ? 30.092  15.813 -71.902  1.00 36.69  ? 89  VAL A H      1 
ATOM   1216  H  HA     . VAL A 1 109 ? 27.740  15.851 -72.998  1.00 41.46  ? 89  VAL A HA     1 
ATOM   1217  H  HB     . VAL A 1 109 ? 29.047  13.556 -71.973  1.00 47.91  ? 89  VAL A HB     1 
ATOM   1218  H  HG11   . VAL A 1 109 ? 27.788  12.332 -73.505  1.00 51.94  ? 89  VAL A HG11   1 
ATOM   1219  H  HG12   . VAL A 1 109 ? 26.831  13.095 -72.492  1.00 51.94  ? 89  VAL A HG12   1 
ATOM   1220  H  HG13   . VAL A 1 109 ? 27.049  13.663 -73.960  1.00 51.94  ? 89  VAL A HG13   1 
ATOM   1221  H  HG21   . VAL A 1 109 ? 29.976  13.260 -74.095  1.00 50.84  ? 89  VAL A HG21   1 
ATOM   1222  H  HG22   . VAL A 1 109 ? 29.322  14.628 -74.571  1.00 50.84  ? 89  VAL A HG22   1 
ATOM   1223  H  HG23   . VAL A 1 109 ? 30.466  14.636 -73.468  1.00 50.84  ? 89  VAL A HG23   1 
ATOM   1224  N  N      . ALA A 1 110 ? 27.685  15.058 -69.892  1.00 34.28  ? 90  ALA A N      1 
ATOM   1225  C  CA     . ALA A 1 110 ? 26.799  14.937 -68.741  1.00 34.57  ? 90  ALA A CA     1 
ATOM   1226  C  C      . ALA A 1 110 ? 26.055  16.240 -68.483  1.00 32.95  ? 90  ALA A C      1 
ATOM   1227  O  O      . ALA A 1 110 ? 24.836  16.235 -68.250  1.00 34.62  ? 90  ALA A O      1 
ATOM   1228  C  CB     . ALA A 1 110 ? 27.603  14.526 -67.507  1.00 34.62  ? 90  ALA A CB     1 
ATOM   1229  H  H      . ALA A 1 110 ? 28.520  14.951 -69.716  1.00 41.25  ? 90  ALA A H      1 
ATOM   1230  H  HA     . ALA A 1 110 ? 26.142  14.245 -68.917  1.00 41.60  ? 90  ALA A HA     1 
ATOM   1231  H  HB1    . ALA A 1 110 ? 27.002  14.449 -66.749  1.00 41.66  ? 90  ALA A HB1    1 
ATOM   1232  H  HB2    . ALA A 1 110 ? 28.030  13.672 -67.679  1.00 41.66  ? 90  ALA A HB2    1 
ATOM   1233  H  HB3    . ALA A 1 110 ? 28.276  15.202 -67.329  1.00 41.66  ? 90  ALA A HB3    1 
ATOM   1234  N  N      . LYS A 1 111 ? 26.760  17.373 -68.559  1.00 30.33  ? 91  LYS A N      1 
ATOM   1235  C  CA     . LYS A 1 111 ? 26.085  18.648 -68.365  1.00 32.00  ? 91  LYS A CA     1 
ATOM   1236  C  C      . LYS A 1 111 ? 25.071  18.896 -69.472  1.00 28.02  ? 91  LYS A C      1 
ATOM   1237  O  O      . LYS A 1 111 ? 24.072  19.594 -69.255  1.00 30.35  ? 91  LYS A O      1 
ATOM   1238  C  CB     . LYS A 1 111 ? 27.100  19.792 -68.300  1.00 37.69  ? 91  LYS A CB     1 
ATOM   1239  C  CG     . LYS A 1 111 ? 28.027  19.737 -67.091  1.00 42.60  ? 91  LYS A CG     1 
ATOM   1240  C  CD     . LYS A 1 111 ? 28.722  21.074 -66.851  1.00 48.32  ? 91  LYS A CD     1 
ATOM   1241  C  CE     . LYS A 1 111 ? 29.977  21.242 -67.686  1.00 55.91  ? 91  LYS A CE     1 
ATOM   1242  N  NZ     . LYS A 1 111 ? 30.644  22.541 -67.390  1.00 60.73  ? 91  LYS A NZ     1 
ATOM   1243  H  H      . LYS A 1 111 ? 27.604  17.426 -68.717  1.00 36.52  ? 91  LYS A H      1 
ATOM   1244  H  HA     . LYS A 1 111 ? 25.607  18.626 -67.521  1.00 38.51  ? 91  LYS A HA     1 
ATOM   1245  H  HB2    . LYS A 1 111 ? 27.652  19.764 -69.097  1.00 45.34  ? 91  LYS A HB2    1 
ATOM   1246  H  HB3    . LYS A 1 111 ? 26.619  20.633 -68.264  1.00 45.34  ? 91  LYS A HB3    1 
ATOM   1247  H  HG2    . LYS A 1 111 ? 27.509  19.518 -66.301  1.00 51.24  ? 91  LYS A HG2    1 
ATOM   1248  H  HG3    . LYS A 1 111 ? 28.709  19.063 -67.242  1.00 51.24  ? 91  LYS A HG3    1 
ATOM   1249  H  HD2    . LYS A 1 111 ? 28.112  21.792 -67.079  1.00 58.11  ? 91  LYS A HD2    1 
ATOM   1250  H  HD3    . LYS A 1 111 ? 28.974  21.136 -65.917  1.00 58.11  ? 91  LYS A HD3    1 
ATOM   1251  H  HE2    . LYS A 1 111 ? 30.598  20.525 -67.482  1.00 67.22  ? 91  LYS A HE2    1 
ATOM   1252  H  HE3    . LYS A 1 111 ? 29.742  21.226 -68.627  1.00 67.22  ? 91  LYS A HE3    1 
ATOM   1253  H  HZ1    . LYS A 1 111 ? 31.378  22.626 -67.886  1.00 72.99  ? 91  LYS A HZ1    1 
ATOM   1254  H  HZ2    . LYS A 1 111 ? 30.092  23.215 -67.572  1.00 72.99  ? 91  LYS A HZ2    1 
ATOM   1255  H  HZ3    . LYS A 1 111 ? 30.871  22.577 -66.530  1.00 72.99  ? 91  LYS A HZ3    1 
ATOM   1256  N  N      . GLY A 1 112 ? 25.284  18.297 -70.646  1.00 21.20  ? 92  GLY A N      1 
ATOM   1257  C  CA     . GLY A 1 112 ? 24.313  18.438 -71.716  1.00 20.81  ? 92  GLY A CA     1 
ATOM   1258  C  C      . GLY A 1 112 ? 23.025  17.699 -71.407  1.00 23.46  ? 92  GLY A C      1 
ATOM   1259  O  O      . GLY A 1 112 ? 21.934  18.278 -71.477  1.00 25.89  ? 92  GLY A O      1 
ATOM   1260  H  H      . GLY A 1 112 ? 25.970  17.815 -70.840  1.00 25.56  ? 92  GLY A H      1 
ATOM   1261  H  HA2    . GLY A 1 112 ? 24.107  19.377 -71.847  1.00 25.09  ? 92  GLY A HA2    1 
ATOM   1262  H  HA3    . GLY A 1 112 ? 24.682  18.084 -72.540  1.00 25.09  ? 92  GLY A HA3    1 
ATOM   1263  N  N      . LEU A 1 113 ? 23.128  16.412 -71.046  1.00 23.08  ? 93  LEU A N      1 
ATOM   1264  C  CA     . LEU A 1 113 ? 21.920  15.672 -70.684  1.00 25.45  ? 93  LEU A CA     1 
ATOM   1265  C  C      . LEU A 1 113 ? 21.180  16.367 -69.544  1.00 26.00  ? 93  LEU A C      1 
ATOM   1266  O  O      . LEU A 1 113 ? 19.955  16.572 -69.605  1.00 28.07  ? 93  LEU A O      1 
ATOM   1267  C  CB     . LEU A 1 113 ? 22.255  14.223 -70.305  1.00 26.12  ? 93  LEU A CB     1 
ATOM   1268  C  CG     . LEU A 1 113 ? 22.811  13.221 -71.333  1.00 29.73  ? 93  LEU A CG     1 
ATOM   1269  C  CD1    . LEU A 1 113 ? 22.784  13.773 -72.750  1.00 34.35  ? 93  LEU A CD1    1 
ATOM   1270  C  CD2    . LEU A 1 113 ? 24.204  12.707 -70.980  1.00 30.97  ? 93  LEU A CD2    1 
ATOM   1271  H  H      . LEU A 1 113 ? 23.859  15.962 -71.005  1.00 27.81  ? 93  LEU A H      1 
ATOM   1272  H  HA     . LEU A 1 113 ? 21.327  15.649 -71.451  1.00 30.66  ? 93  LEU A HA     1 
ATOM   1273  H  HB2    . LEU A 1 113 ? 22.907  14.261 -69.588  1.00 31.46  ? 93  LEU A HB2    1 
ATOM   1274  H  HB3    . LEU A 1 113 ? 21.441  13.826 -69.958  1.00 31.46  ? 93  LEU A HB3    1 
ATOM   1275  H  HG     . LEU A 1 113 ? 22.226  12.447 -71.329  1.00 35.79  ? 93  LEU A HG     1 
ATOM   1276  H  HD11   . LEU A 1 113 ? 23.144  13.106 -73.356  1.00 41.34  ? 93  LEU A HD11   1 
ATOM   1277  H  HD12   . LEU A 1 113 ? 21.867  13.979 -72.991  1.00 41.34  ? 93  LEU A HD12   1 
ATOM   1278  H  HD13   . LEU A 1 113 ? 23.324  14.578 -72.785  1.00 41.34  ? 93  LEU A HD13   1 
ATOM   1279  H  HD21   . LEU A 1 113 ? 24.493  12.083 -71.664  1.00 37.28  ? 93  LEU A HD21   1 
ATOM   1280  H  HD22   . LEU A 1 113 ? 24.816  13.458 -70.937  1.00 37.28  ? 93  LEU A HD22   1 
ATOM   1281  H  HD23   . LEU A 1 113 ? 24.167  12.260 -70.119  1.00 37.28  ? 93  LEU A HD23   1 
ATOM   1282  N  N      . GLN A 1 114 ? 21.919  16.771 -68.507  1.00 23.15  ? 94  GLN A N      1 
ATOM   1283  C  CA     . GLN A 1 114 ? 21.288  17.428 -67.367  1.00 25.35  ? 94  GLN A CA     1 
ATOM   1284  C  C      . GLN A 1 114 ? 20.543  18.684 -67.809  1.00 23.62  ? 94  GLN A C      1 
ATOM   1285  O  O      . GLN A 1 114 ? 19.376  18.891 -67.446  1.00 17.95  ? 94  GLN A O      1 
ATOM   1286  C  CB     . GLN A 1 114 ? 22.344  17.758 -66.310  1.00 24.00  ? 94  GLN A CB     1 
ATOM   1287  C  CG     . GLN A 1 114 ? 22.989  16.524 -65.689  1.00 23.16  ? 94  GLN A CG     1 
ATOM   1288  C  CD     . GLN A 1 114 ? 24.174  16.856 -64.799  1.00 27.21  ? 94  GLN A CD     1 
ATOM   1289  O  OE1    . GLN A 1 114 ? 24.611  18.004 -64.727  1.00 31.72  ? 94  GLN A OE1    1 
ATOM   1290  N  NE2    . GLN A 1 114 ? 24.717  15.841 -64.138  1.00 26.81  ? 94  GLN A NE2    1 
ATOM   1291  H  H      . GLN A 1 114 ? 22.771  16.678 -68.442  1.00 27.89  ? 94  GLN A H      1 
ATOM   1292  H  HA     . GLN A 1 114 ? 20.644  16.822 -66.969  1.00 30.54  ? 94  GLN A HA     1 
ATOM   1293  H  HB2    . GLN A 1 114 ? 23.047  18.285 -66.722  1.00 28.92  ? 94  GLN A HB2    1 
ATOM   1294  H  HB3    . GLN A 1 114 ? 21.926  18.266 -65.597  1.00 28.92  ? 94  GLN A HB3    1 
ATOM   1295  H  HG2    . GLN A 1 114 ? 22.329  16.063 -65.147  1.00 27.91  ? 94  GLN A HG2    1 
ATOM   1296  H  HG3    . GLN A 1 114 ? 23.301  15.941 -66.398  1.00 27.91  ? 94  GLN A HG3    1 
ATOM   1297  H  HE21   . GLN A 1 114 ? 24.395  15.049 -64.226  1.00 32.29  ? 94  GLN A HE21   1 
ATOM   1298  H  HE22   . GLN A 1 114 ? 25.391  15.976 -63.621  1.00 32.29  ? 94  GLN A HE22   1 
ATOM   1299  N  N      . ALA A 1 115 ? 21.198  19.526 -68.613  1.00 24.04  ? 95  ALA A N      1 
ATOM   1300  C  CA     . ALA A 1 115 ? 20.559  20.754 -69.071  1.00 24.36  ? 95  ALA A CA     1 
ATOM   1301  C  C      . ALA A 1 115 ? 19.296  20.453 -69.869  1.00 24.69  ? 95  ALA A C      1 
ATOM   1302  O  O      . ALA A 1 115 ? 18.289  21.159 -69.742  1.00 27.27  ? 95  ALA A O      1 
ATOM   1303  C  CB     . ALA A 1 115 ? 21.536  21.575 -69.909  1.00 24.42  ? 95  ALA A CB     1 
ATOM   1304  H  H      . ALA A 1 115 ? 22.000  19.409 -68.901  1.00 28.96  ? 95  ALA A H      1 
ATOM   1305  H  HA     . ALA A 1 115 ? 20.306  21.285 -68.300  1.00 29.35  ? 95  ALA A HA     1 
ATOM   1306  H  HB1    . ALA A 1 115 ? 21.094  22.386 -70.205  1.00 29.42  ? 95  ALA A HB1    1 
ATOM   1307  H  HB2    . ALA A 1 115 ? 22.308  21.798 -69.365  1.00 29.42  ? 95  ALA A HB2    1 
ATOM   1308  H  HB3    . ALA A 1 115 ? 21.812  21.050 -70.677  1.00 29.42  ? 95  ALA A HB3    1 
ATOM   1309  N  N      . ASP A 1 116 ? 19.328  19.412 -70.704  1.00 20.94  ? 96  ASP A N      1 
ATOM   1310  C  CA     . ASP A 1 116 ? 18.179  19.116 -71.554  1.00 21.34  ? 96  ASP A CA     1 
ATOM   1311  C  C      . ASP A 1 116 ? 16.969  18.706 -70.718  1.00 19.30  ? 96  ASP A C      1 
ATOM   1312  O  O      . ASP A 1 116 ? 15.868  19.271 -70.863  1.00 17.29  ? 96  ASP A O      1 
ATOM   1313  C  CB     . ASP A 1 116 ? 18.563  18.012 -72.544  1.00 28.85  ? 96  ASP A CB     1 
ATOM   1314  C  CG     . ASP A 1 116 ? 17.627  17.932 -73.735  1.00 39.86  ? 96  ASP A CG     1 
ATOM   1315  O  OD1    . ASP A 1 116 ? 17.091  18.981 -74.153  1.00 43.73  ? 96  ASP A OD1    1 
ATOM   1316  O  OD2    . ASP A 1 116 ? 17.440  16.816 -74.265  1.00 43.26  ? 96  ASP A OD2    1 
ATOM   1317  H  H      . ASP A 1 116 ? 19.992  18.873 -70.795  1.00 25.25  ? 96  ASP A H      1 
ATOM   1318  H  HA     . ASP A 1 116 ? 17.943  19.909 -72.060  1.00 25.73  ? 96  ASP A HA     1 
ATOM   1319  H  HB2    . ASP A 1 116 ? 19.457  18.185 -72.877  1.00 34.73  ? 96  ASP A HB2    1 
ATOM   1320  H  HB3    . ASP A 1 116 ? 18.539  17.157 -72.087  1.00 34.73  ? 96  ASP A HB3    1 
ATOM   1321  N  N      . ILE A 1 117 ? 17.166  17.766 -69.787  1.00 19.14  ? 97  ILE A N      1 
ATOM   1322  C  CA     . ILE A 1 117 ? 16.030  17.310 -68.991  1.00 21.16  ? 97  ILE A CA     1 
ATOM   1323  C  C      . ILE A 1 117 ? 15.526  18.430 -68.086  1.00 19.54  ? 97  ILE A C      1 
ATOM   1324  O  O      . ILE A 1 117 ? 14.311  18.608 -67.911  1.00 19.24  ? 97  ILE A O      1 
ATOM   1325  C  CB     . ILE A 1 117 ? 16.403  16.045 -68.191  1.00 26.40  ? 97  ILE A CB     1 
ATOM   1326  C  CG1    . ILE A 1 117 ? 15.152  15.412 -67.572  1.00 30.74  ? 97  ILE A CG1    1 
ATOM   1327  C  CG2    . ILE A 1 117 ? 17.434  16.350 -67.111  1.00 27.53  ? 97  ILE A CG2    1 
ATOM   1328  C  CD1    . ILE A 1 117 ? 14.184  14.822 -68.582  1.00 33.42  ? 97  ILE A CD1    1 
ATOM   1329  H  H      . ILE A 1 117 ? 17.918  17.391 -69.605  1.00 23.08  ? 97  ILE A H      1 
ATOM   1330  H  HA     . ILE A 1 117 ? 15.307  17.073 -69.592  1.00 25.51  ? 97  ILE A HA     1 
ATOM   1331  H  HB     . ILE A 1 117 ? 16.792  15.404 -68.806  1.00 31.80  ? 97  ILE A HB     1 
ATOM   1332  H  HG12   . ILE A 1 117 ? 15.428  14.697 -66.976  1.00 37.00  ? 97  ILE A HG12   1 
ATOM   1333  H  HG13   . ILE A 1 117 ? 14.676  16.091 -67.069  1.00 37.00  ? 97  ILE A HG13   1 
ATOM   1334  H  HG21   . ILE A 1 117 ? 17.641  15.532 -66.633  1.00 33.15  ? 97  ILE A HG21   1 
ATOM   1335  H  HG22   . ILE A 1 117 ? 18.236  16.701 -67.531  1.00 33.15  ? 97  ILE A HG22   1 
ATOM   1336  H  HG23   . ILE A 1 117 ? 17.066  17.007 -66.500  1.00 33.15  ? 97  ILE A HG23   1 
ATOM   1337  H  HD11   . ILE A 1 117 ? 13.426  14.444 -68.109  1.00 40.22  ? 97  ILE A HD11   1 
ATOM   1338  H  HD12   . ILE A 1 117 ? 13.885  15.525 -69.180  1.00 40.22  ? 97  ILE A HD12   1 
ATOM   1339  H  HD13   . ILE A 1 117 ? 14.638  14.129 -69.087  1.00 40.22  ? 97  ILE A HD13   1 
ATOM   1340  N  N      . LEU A 1 118 ? 16.443  19.220 -67.518  1.00 21.37  ? 98  LEU A N      1 
ATOM   1341  C  CA     . LEU A 1 118 ? 16.020  20.348 -66.696  1.00 21.82  ? 98  LEU A CA     1 
ATOM   1342  C  C      . LEU A 1 118 ? 15.250  21.379 -67.510  1.00 23.61  ? 98  LEU A C      1 
ATOM   1343  O  O      . LEU A 1 118 ? 14.355  22.046 -66.978  1.00 25.28  ? 98  LEU A O      1 
ATOM   1344  C  CB     . LEU A 1 118 ? 17.231  20.994 -66.024  1.00 25.16  ? 98  LEU A CB     1 
ATOM   1345  C  CG     . LEU A 1 118 ? 17.913  20.150 -64.942  1.00 33.98  ? 98  LEU A CG     1 
ATOM   1346  C  CD1    . LEU A 1 118 ? 19.196  20.821 -64.467  1.00 38.13  ? 98  LEU A CD1    1 
ATOM   1347  C  CD2    . LEU A 1 118 ? 16.983  19.878 -63.765  1.00 34.99  ? 98  LEU A CD2    1 
ATOM   1348  H  H      . LEU A 1 118 ? 17.295  19.126 -67.593  1.00 25.76  ? 98  LEU A H      1 
ATOM   1349  H  HA     . LEU A 1 118 ? 15.432  20.022 -65.997  1.00 26.30  ? 98  LEU A HA     1 
ATOM   1350  H  HB2    . LEU A 1 118 ? 17.894  21.185 -66.706  1.00 30.31  ? 98  LEU A HB2    1 
ATOM   1351  H  HB3    . LEU A 1 118 ? 16.946  21.823 -65.610  1.00 30.31  ? 98  LEU A HB3    1 
ATOM   1352  H  HG     . LEU A 1 118 ? 18.156  19.294 -65.327  1.00 40.90  ? 98  LEU A HG     1 
ATOM   1353  H  HD11   . LEU A 1 118 ? 19.607  20.268 -63.785  1.00 45.88  ? 98  LEU A HD11   1 
ATOM   1354  H  HD12   . LEU A 1 118 ? 19.799  20.918 -65.222  1.00 45.88  ? 98  LEU A HD12   1 
ATOM   1355  H  HD13   . LEU A 1 118 ? 18.980  21.693 -64.102  1.00 45.88  ? 98  LEU A HD13   1 
ATOM   1356  H  HD21   . LEU A 1 118 ? 17.455  19.343 -63.107  1.00 42.10  ? 98  LEU A HD21   1 
ATOM   1357  H  HD22   . LEU A 1 118 ? 16.715  20.724 -63.373  1.00 42.10  ? 98  LEU A HD22   1 
ATOM   1358  H  HD23   . LEU A 1 118 ? 16.203  19.398 -64.084  1.00 42.10  ? 98  LEU A HD23   1 
ATOM   1359  N  N      . ALA A 1 119 ? 15.573  21.525 -68.796  1.00 24.12  ? 99  ALA A N      1 
ATOM   1360  C  CA     . ALA A 1 119 ? 14.814  22.436 -69.646  1.00 26.80  ? 99  ALA A CA     1 
ATOM   1361  C  C      . ALA A 1 119 ? 13.378  21.958 -69.811  1.00 29.01  ? 99  ALA A C      1 
ATOM   1362  O  O      . ALA A 1 119 ? 12.427  22.730 -69.620  1.00 29.72  ? 99  ALA A O      1 
ATOM   1363  C  CB     . ALA A 1 119 ? 15.496  22.578 -71.006  1.00 26.93  ? 99  ALA A CB     1 
ATOM   1364  H  H      . ALA A 1 119 ? 16.216  21.114 -69.193  1.00 29.06  ? 99  ALA A H      1 
ATOM   1365  H  HA     . ALA A 1 119 ? 14.792  23.312 -69.229  1.00 32.28  ? 99  ALA A HA     1 
ATOM   1366  H  HB1    . ALA A 1 119 ? 14.978  23.186 -71.556  1.00 32.43  ? 99  ALA A HB1    1 
ATOM   1367  H  HB2    . ALA A 1 119 ? 16.391  22.930 -70.875  1.00 32.43  ? 99  ALA A HB2    1 
ATOM   1368  H  HB3    . ALA A 1 119 ? 15.541  21.706 -71.429  1.00 32.43  ? 99  ALA A HB3    1 
ATOM   1369  N  N      . LYS A 1 120 ? 13.195  20.679 -70.152  1.00 29.88  ? 100 LYS A N      1 
ATOM   1370  C  CA     . LYS A 1 120 ? 11.834  20.156 -70.259  1.00 31.47  ? 100 LYS A CA     1 
ATOM   1371  C  C      . LYS A 1 120 ? 11.064  20.362 -68.954  1.00 34.62  ? 100 LYS A C      1 
ATOM   1372  O  O      . LYS A 1 120 ? 9.938   20.890 -68.948  1.00 39.36  ? 100 LYS A O      1 
ATOM   1373  C  CB     . LYS A 1 120 ? 11.878  18.681 -70.651  1.00 33.72  ? 100 LYS A CB     1 
ATOM   1374  C  CG     . LYS A 1 120 ? 12.415  18.468 -72.056  1.00 39.60  ? 100 LYS A CG     1 
ATOM   1375  C  CD     . LYS A 1 120 ? 12.483  17.004 -72.433  1.00 47.08  ? 100 LYS A CD     1 
ATOM   1376  C  CE     . LYS A 1 120 ? 13.050  16.837 -73.831  1.00 52.15  ? 100 LYS A CE     1 
ATOM   1377  N  NZ     . LYS A 1 120 ? 13.179  15.405 -74.205  1.00 55.71  ? 100 LYS A NZ     1 
ATOM   1378  H  H      . LYS A 1 120 ? 13.820  20.113 -70.322  1.00 35.97  ? 100 LYS A H      1 
ATOM   1379  H  HA     . LYS A 1 120 ? 11.366  20.637 -70.960  1.00 37.88  ? 100 LYS A HA     1 
ATOM   1380  H  HB2    . LYS A 1 120 ? 12.456  18.206 -70.033  1.00 40.58  ? 100 LYS A HB2    1 
ATOM   1381  H  HB3    . LYS A 1 120 ? 10.980  18.315 -70.613  1.00 40.58  ? 100 LYS A HB3    1 
ATOM   1382  H  HG2    . LYS A 1 120 ? 11.833  18.915 -72.689  1.00 47.64  ? 100 LYS A HG2    1 
ATOM   1383  H  HG3    . LYS A 1 120 ? 13.312  18.835 -72.111  1.00 47.64  ? 100 LYS A HG3    1 
ATOM   1384  H  HD2    . LYS A 1 120 ? 13.061  16.536 -71.810  1.00 56.62  ? 100 LYS A HD2    1 
ATOM   1385  H  HD3    . LYS A 1 120 ? 11.591  16.625 -72.417  1.00 56.62  ? 100 LYS A HD3    1 
ATOM   1386  H  HE2    . LYS A 1 120 ? 12.457  17.264 -74.469  1.00 62.69  ? 100 LYS A HE2    1 
ATOM   1387  H  HE3    . LYS A 1 120 ? 13.931  17.241 -73.869  1.00 62.69  ? 100 LYS A HE3    1 
ATOM   1388  H  HZ1    . LYS A 1 120 ? 13.513  15.335 -75.027  1.00 66.97  ? 100 LYS A HZ1    1 
ATOM   1389  H  HZ2    . LYS A 1 120 ? 13.723  14.991 -73.635  1.00 66.97  ? 100 LYS A HZ2    1 
ATOM   1390  H  HZ3    . LYS A 1 120 ? 12.382  15.012 -74.181  1.00 66.97  ? 100 LYS A HZ3    1 
ATOM   1391  N  N      . LEU A 1 121 ? 11.670  19.968 -67.830  1.00 33.40  ? 101 LEU A N      1 
ATOM   1392  C  CA     . LEU A 1 121 ? 10.991  20.091 -66.543  1.00 32.82  ? 101 LEU A CA     1 
ATOM   1393  C  C      . LEU A 1 121 ? 10.602  21.538 -66.260  1.00 32.06  ? 101 LEU A C      1 
ATOM   1394  O  O      . LEU A 1 121 ? 9.471   21.819 -65.843  1.00 26.74  ? 101 LEU A O      1 
ATOM   1395  C  CB     . LEU A 1 121 ? 11.885  19.545 -65.431  1.00 34.34  ? 101 LEU A CB     1 
ATOM   1396  C  CG     . LEU A 1 121 ? 11.294  19.524 -64.020  1.00 37.63  ? 101 LEU A CG     1 
ATOM   1397  C  CD1    . LEU A 1 121 ? 9.997   18.730 -63.962  1.00 40.15  ? 101 LEU A CD1    1 
ATOM   1398  C  CD2    . LEU A 1 121 ? 12.314  18.958 -63.046  1.00 38.73  ? 101 LEU A CD2    1 
ATOM   1399  H  H      . LEU A 1 121 ? 12.460  19.632 -67.788  1.00 40.20  ? 101 LEU A H      1 
ATOM   1400  H  HA     . LEU A 1 121 ? 10.178  19.561 -66.562  1.00 39.50  ? 101 LEU A HA     1 
ATOM   1401  H  HB2    . LEU A 1 121 ? 12.124  18.632 -65.655  1.00 41.33  ? 101 LEU A HB2    1 
ATOM   1402  H  HB3    . LEU A 1 121 ? 12.689  20.087 -65.396  1.00 41.33  ? 101 LEU A HB3    1 
ATOM   1403  H  HG     . LEU A 1 121 ? 11.097  20.434 -63.749  1.00 45.27  ? 101 LEU A HG     1 
ATOM   1404  H  HD11   . LEU A 1 121 ? 9.659   18.743 -63.053  1.00 48.30  ? 101 LEU A HD11   1 
ATOM   1405  H  HD12   . LEU A 1 121 ? 9.351   19.136 -64.561  1.00 48.30  ? 101 LEU A HD12   1 
ATOM   1406  H  HD13   . LEU A 1 121 ? 10.174  17.816 -64.237  1.00 48.30  ? 101 LEU A HD13   1 
ATOM   1407  H  HD21   . LEU A 1 121 ? 11.929  18.949 -62.155  1.00 46.59  ? 101 LEU A HD21   1 
ATOM   1408  H  HD22   . LEU A 1 121 ? 12.543  18.055 -63.317  1.00 46.59  ? 101 LEU A HD22   1 
ATOM   1409  H  HD23   . LEU A 1 121 ? 13.107  19.518 -63.058  1.00 46.59  ? 101 LEU A HD23   1 
ATOM   1410  N  N      . ALA A 1 122 ? 11.529  22.473 -66.487  1.00 36.02  ? 102 ALA A N      1 
ATOM   1411  C  CA     . ALA A 1 122 ? 11.216  23.885 -66.291  1.00 35.35  ? 102 ALA A CA     1 
ATOM   1412  C  C      . ALA A 1 122 ? 10.015  24.294 -67.130  1.00 35.63  ? 102 ALA A C      1 
ATOM   1413  O  O      . ALA A 1 122 ? 9.129   25.017 -66.655  1.00 33.71  ? 102 ALA A O      1 
ATOM   1414  C  CB     . ALA A 1 122 ? 12.430  24.743 -66.641  1.00 31.26  ? 102 ALA A CB     1 
ATOM   1415  H  H      . ALA A 1 122 ? 12.332  22.316 -66.749  1.00 43.34  ? 102 ALA A H      1 
ATOM   1416  H  HA     . ALA A 1 122 ? 10.999  24.036 -65.358  1.00 42.54  ? 102 ALA A HA     1 
ATOM   1417  H  HB1    . ALA A 1 122 ? 12.205  25.677 -66.506  1.00 37.63  ? 102 ALA A HB1    1 
ATOM   1418  H  HB2    . ALA A 1 122 ? 13.170  24.494 -66.065  1.00 37.63  ? 102 ALA A HB2    1 
ATOM   1419  H  HB3    . ALA A 1 122 ? 12.667  24.591 -67.570  1.00 37.63  ? 102 ALA A HB3    1 
ATOM   1420  N  N      . ARG A 1 123 ? 9.965   23.829 -68.378  1.00 38.50  ? 103 ARG A N      1 
ATOM   1421  C  CA     . ARG A 1 123 ? 8.825   24.125 -69.239  1.00 36.82  ? 103 ARG A CA     1 
ATOM   1422  C  C      . ARG A 1 123 ? 7.521   23.705 -68.568  1.00 34.44  ? 103 ARG A C      1 
ATOM   1423  O  O      . ARG A 1 123 ? 6.593   24.513 -68.413  1.00 34.31  ? 103 ARG A O      1 
ATOM   1424  C  CB     . ARG A 1 123 ? 9.010   23.398 -70.569  1.00 39.39  ? 103 ARG A CB     1 
ATOM   1425  C  CG     . ARG A 1 123 ? 8.092   23.805 -71.704  1.00 45.14  ? 103 ARG A CG     1 
ATOM   1426  C  CD     . ARG A 1 123 ? 8.441   22.964 -72.922  1.00 49.69  ? 103 ARG A CD     1 
ATOM   1427  N  NE     . ARG A 1 123 ? 9.822   23.175 -73.348  1.00 49.66  ? 103 ARG A NE     1 
ATOM   1428  C  CZ     . ARG A 1 123 ? 10.489  22.364 -74.164  1.00 46.46  ? 103 ARG A CZ     1 
ATOM   1429  N  NH1    . ARG A 1 123 ? 9.911   21.271 -74.643  1.00 47.59  ? 103 ARG A NH1    1 
ATOM   1430  N  NH2    . ARG A 1 123 ? 11.743  22.638 -74.492  1.00 43.50  ? 103 ARG A NH2    1 
ATOM   1431  H  H      . ARG A 1 123 ? 10.573  23.344 -68.746  1.00 46.32  ? 103 ARG A H      1 
ATOM   1432  H  HA     . ARG A 1 123 ? 8.789   25.078 -69.411  1.00 44.31  ? 103 ARG A HA     1 
ATOM   1433  H  HB2    . ARG A 1 123 ? 9.920   23.547 -70.871  1.00 47.38  ? 103 ARG A HB2    1 
ATOM   1434  H  HB3    . ARG A 1 123 ? 8.874   22.450 -70.418  1.00 47.38  ? 103 ARG A HB3    1 
ATOM   1435  H  HG2    . ARG A 1 123 ? 7.169   23.636 -71.459  1.00 54.28  ? 103 ARG A HG2    1 
ATOM   1436  H  HG3    . ARG A 1 123 ? 8.227   24.741 -71.919  1.00 54.28  ? 103 ARG A HG3    1 
ATOM   1437  H  HD2    . ARG A 1 123 ? 8.331   22.026 -72.703  1.00 59.74  ? 103 ARG A HD2    1 
ATOM   1438  H  HD3    . ARG A 1 123 ? 7.856   23.208 -73.656  1.00 59.74  ? 103 ARG A HD3    1 
ATOM   1439  H  HE     . ARG A 1 123 ? 10.231  23.871 -73.052  1.00 59.71  ? 103 ARG A HE     1 
ATOM   1440  H  HH11   . ARG A 1 123 ? 9.097   21.088 -74.432  1.00 57.22  ? 103 ARG A HH11   1 
ATOM   1441  H  HH12   . ARG A 1 123 ? 10.347  20.749 -75.169  1.00 57.22  ? 103 ARG A HH12   1 
ATOM   1442  H  HH21   . ARG A 1 123 ? 12.124  23.344 -74.183  1.00 52.32  ? 103 ARG A HH21   1 
ATOM   1443  H  HH22   . ARG A 1 123 ? 12.175  22.112 -75.018  1.00 52.32  ? 103 ARG A HH22   1 
ATOM   1444  N  N      . VAL A 1 124 ? 7.440   22.440 -68.141  1.00 33.01  ? 104 VAL A N      1 
ATOM   1445  C  CA     . VAL A 1 124 ? 6.216   21.964 -67.493  1.00 30.92  ? 104 VAL A CA     1 
ATOM   1446  C  C      . VAL A 1 124 ? 5.885   22.810 -66.264  1.00 31.30  ? 104 VAL A C      1 
ATOM   1447  O  O      . VAL A 1 124 ? 4.728   23.209 -66.058  1.00 29.15  ? 104 VAL A O      1 
ATOM   1448  C  CB     . VAL A 1 124 ? 6.346   20.470 -67.141  1.00 27.42  ? 104 VAL A CB     1 
ATOM   1449  C  CG1    . VAL A 1 124 ? 5.147   19.996 -66.325  1.00 24.92  ? 104 VAL A CG1    1 
ATOM   1450  C  CG2    . VAL A 1 124 ? 6.483   19.640 -68.410  1.00 26.49  ? 104 VAL A CG2    1 
ATOM   1451  H  H      . VAL A 1 124 ? 8.064   21.852 -68.212  1.00 39.73  ? 104 VAL A H      1 
ATOM   1452  H  HA     . VAL A 1 124 ? 5.480   22.055 -68.119  1.00 37.22  ? 104 VAL A HA     1 
ATOM   1453  H  HB     . VAL A 1 124 ? 7.144   20.339 -66.607  1.00 33.02  ? 104 VAL A HB     1 
ATOM   1454  H  HG11   . VAL A 1 124 ? 5.258   19.054 -66.120  1.00 30.03  ? 104 VAL A HG11   1 
ATOM   1455  H  HG12   . VAL A 1 124 ? 5.100   20.511 -65.504  1.00 30.03  ? 104 VAL A HG12   1 
ATOM   1456  H  HG13   . VAL A 1 124 ? 4.339   20.129 -66.845  1.00 30.03  ? 104 VAL A HG13   1 
ATOM   1457  H  HG21   . VAL A 1 124 ? 6.564   18.705 -68.167  1.00 31.91  ? 104 VAL A HG21   1 
ATOM   1458  H  HG22   . VAL A 1 124 ? 5.696   19.774 -68.961  1.00 31.91  ? 104 VAL A HG22   1 
ATOM   1459  H  HG23   . VAL A 1 124 ? 7.276   19.927 -68.890  1.00 31.91  ? 104 VAL A HG23   1 
ATOM   1460  N  N      . ILE A 1 125 ? 6.889   23.104 -65.431  1.00 32.11  ? 105 ILE A N      1 
ATOM   1461  C  CA     . ILE A 1 125 ? 6.642   23.889 -64.222  1.00 32.58  ? 105 ILE A CA     1 
ATOM   1462  C  C      . ILE A 1 125 ? 5.996   25.221 -64.580  1.00 30.84  ? 105 ILE A C      1 
ATOM   1463  O  O      . ILE A 1 125 ? 4.981   25.617 -63.993  1.00 23.53  ? 105 ILE A O      1 
ATOM   1464  C  CB     . ILE A 1 125 ? 7.945   24.090 -63.426  1.00 31.45  ? 105 ILE A CB     1 
ATOM   1465  C  CG1    . ILE A 1 125 ? 8.454   22.748 -62.895  1.00 32.09  ? 105 ILE A CG1    1 
ATOM   1466  C  CG2    . ILE A 1 125 ? 7.721   25.066 -62.266  1.00 29.15  ? 105 ILE A CG2    1 
ATOM   1467  C  CD1    . ILE A 1 125 ? 9.830   22.810 -62.261  1.00 29.96  ? 105 ILE A CD1    1 
ATOM   1468  H  H      . ILE A 1 125 ? 7.708   22.865 -65.543  1.00 38.65  ? 105 ILE A H      1 
ATOM   1469  H  HA     . ILE A 1 125 ? 6.022   23.403 -63.656  1.00 39.21  ? 105 ILE A HA     1 
ATOM   1470  H  HB     . ILE A 1 125 ? 8.616   24.462 -64.019  1.00 37.85  ? 105 ILE A HB     1 
ATOM   1471  H  HG12   . ILE A 1 125 ? 7.834   22.424 -62.222  1.00 38.63  ? 105 ILE A HG12   1 
ATOM   1472  H  HG13   . ILE A 1 125 ? 8.497   22.118 -63.631  1.00 38.63  ? 105 ILE A HG13   1 
ATOM   1473  H  HG21   . ILE A 1 125 ? 8.554   25.175 -61.781  1.00 35.10  ? 105 ILE A HG21   1 
ATOM   1474  H  HG22   . ILE A 1 125 ? 7.432   25.920 -62.624  1.00 35.10  ? 105 ILE A HG22   1 
ATOM   1475  H  HG23   . ILE A 1 125 ? 7.040   24.705 -61.677  1.00 35.10  ? 105 ILE A HG23   1 
ATOM   1476  H  HD11   . ILE A 1 125 ? 10.075  21.924 -61.953  1.00 36.07  ? 105 ILE A HD11   1 
ATOM   1477  H  HD12   . ILE A 1 125 ? 10.468  23.120 -62.923  1.00 36.07  ? 105 ILE A HD12   1 
ATOM   1478  H  HD13   . ILE A 1 125 ? 9.804   23.426 -61.512  1.00 36.07  ? 105 ILE A HD13   1 
ATOM   1479  N  N      . ARG A 1 126 ? 6.581   25.942 -65.540  1.00 33.51  ? 106 ARG A N      1 
ATOM   1480  C  CA     . ARG A 1 126 ? 5.987   27.209 -65.950  1.00 34.91  ? 106 ARG A CA     1 
ATOM   1481  C  C      . ARG A 1 126 ? 4.566   27.011 -66.454  1.00 42.32  ? 106 ARG A C      1 
ATOM   1482  O  O      . ARG A 1 126 ? 3.712   27.884 -66.256  1.00 34.34  ? 106 ARG A O      1 
ATOM   1483  C  CB     . ARG A 1 126 ? 6.840   27.892 -67.019  1.00 32.67  ? 106 ARG A CB     1 
ATOM   1484  C  CG     . ARG A 1 126 ? 8.113   28.524 -66.481  1.00 33.65  ? 106 ARG A CG     1 
ATOM   1485  C  CD     . ARG A 1 126 ? 8.790   29.390 -67.534  1.00 35.50  ? 106 ARG A CD     1 
ATOM   1486  N  NE     . ARG A 1 126 ? 9.534   28.592 -68.505  1.00 36.71  ? 106 ARG A NE     1 
ATOM   1487  C  CZ     . ARG A 1 126 ? 10.849  28.388 -68.479  1.00 37.04  ? 106 ARG A CZ     1 
ATOM   1488  N  NH1    . ARG A 1 126 ? 11.603  28.923 -67.529  1.00 33.91  ? 106 ARG A NH1    1 
ATOM   1489  N  NH2    . ARG A 1 126 ? 11.414  27.639 -69.415  1.00 41.17  ? 106 ARG A NH2    1 
ATOM   1490  H  H      . ARG A 1 126 ? 7.301   25.725 -65.957  1.00 40.33  ? 106 ARG A H      1 
ATOM   1491  H  HA     . ARG A 1 126 ? 5.949   27.798 -65.180  1.00 42.01  ? 106 ARG A HA     1 
ATOM   1492  H  HB2    . ARG A 1 126 ? 7.095   27.233 -67.683  1.00 39.32  ? 106 ARG A HB2    1 
ATOM   1493  H  HB3    . ARG A 1 126 ? 6.315   28.593 -67.436  1.00 39.32  ? 106 ARG A HB3    1 
ATOM   1494  H  HG2    . ARG A 1 126 ? 7.896   29.085 -65.720  1.00 40.50  ? 106 ARG A HG2    1 
ATOM   1495  H  HG3    . ARG A 1 126 ? 8.732   27.825 -66.218  1.00 40.50  ? 106 ARG A HG3    1 
ATOM   1496  H  HD2    . ARG A 1 126 ? 8.114   29.895 -68.013  1.00 42.72  ? 106 ARG A HD2    1 
ATOM   1497  H  HD3    . ARG A 1 126 ? 9.412   29.994 -67.099  1.00 42.72  ? 106 ARG A HD3    1 
ATOM   1498  H  HE     . ARG A 1 126 ? 9.088   28.226 -69.143  1.00 44.16  ? 106 ARG A HE     1 
ATOM   1499  H  HH11   . ARG A 1 126 ? 11.244  29.409 -66.917  1.00 40.80  ? 106 ARG A HH11   1 
ATOM   1500  H  HH12   . ARG A 1 126 ? 12.452  28.783 -67.524  1.00 40.80  ? 106 ARG A HH12   1 
ATOM   1501  H  HH21   . ARG A 1 126 ? 10.931  27.290 -70.035  1.00 49.52  ? 106 ARG A HH21   1 
ATOM   1502  H  HH22   . ARG A 1 126 ? 12.263  27.505 -69.404  1.00 49.52  ? 106 ARG A HH22   1 
ATOM   1503  N  N      . GLN A 1 127 ? 4.284   25.876 -67.101  1.00 60.49  ? 107 GLN A N      1 
ATOM   1504  C  CA     . GLN A 1 127 ? 2.934   25.664 -67.614  1.00 71.16  ? 107 GLN A CA     1 
ATOM   1505  C  C      . GLN A 1 127 ? 1.924   25.482 -66.485  1.00 63.97  ? 107 GLN A C      1 
ATOM   1506  O  O      . GLN A 1 127 ? 0.790   25.965 -66.582  1.00 67.76  ? 107 GLN A O      1 
ATOM   1507  C  CB     . GLN A 1 127 ? 2.899   24.448 -68.539  1.00 79.87  ? 107 GLN A CB     1 
ATOM   1508  C  CG     . GLN A 1 127 ? 1.509   24.137 -69.097  1.00 88.47  ? 107 GLN A CG     1 
ATOM   1509  C  CD     . GLN A 1 127 ? 1.429   22.776 -69.752  1.00 95.82  ? 107 GLN A CD     1 
ATOM   1510  O  OE1    . GLN A 1 127 ? 2.400   22.019 -69.762  1.00 97.61  ? 107 GLN A OE1    1 
ATOM   1511  N  NE2    . GLN A 1 127 ? 0.262   22.453 -70.300  1.00 99.14  ? 107 GLN A NE2    1 
ATOM   1512  H  H      . GLN A 1 127 ? 4.838   25.235 -67.251  1.00 72.71  ? 107 GLN A H      1 
ATOM   1513  H  HA     . GLN A 1 127 ? 2.668   26.441 -68.131  1.00 85.51  ? 107 GLN A HA     1 
ATOM   1514  H  HB2    . GLN A 1 127 ? 3.491   24.610 -69.290  1.00 95.97  ? 107 GLN A HB2    1 
ATOM   1515  H  HB3    . GLN A 1 127 ? 3.201   23.670 -68.044  1.00 95.97  ? 107 GLN A HB3    1 
ATOM   1516  H  HG2    . GLN A 1 127 ? 0.866   24.158 -68.371  1.00 106.28 ? 107 GLN A HG2    1 
ATOM   1517  H  HG3    . GLN A 1 127 ? 1.280   24.804 -69.763  1.00 106.28 ? 107 GLN A HG3    1 
ATOM   1518  H  HE21   . GLN A 1 127 ? -0.395  23.007 -70.269  1.00 119.08 ? 107 GLN A HE21   1 
ATOM   1519  H  HE22   . GLN A 1 127 ? 0.164   21.690 -70.685  1.00 119.08 ? 107 GLN A HE22   1 
ATOM   1520  N  N      . LYS A 1 128 ? 2.307   24.798 -65.406  1.00 52.69  ? 108 LYS A N      1 
ATOM   1521  C  CA     . LYS A 1 128 ? 1.340   24.515 -64.348  1.00 48.54  ? 108 LYS A CA     1 
ATOM   1522  C  C      . LYS A 1 128 ? 1.221   25.616 -63.302  1.00 48.04  ? 108 LYS A C      1 
ATOM   1523  O  O      . LYS A 1 128 ? 0.226   25.640 -62.568  1.00 45.72  ? 108 LYS A O      1 
ATOM   1524  C  CB     . LYS A 1 128 ? 1.671   23.195 -63.645  1.00 50.17  ? 108 LYS A CB     1 
ATOM   1525  C  CG     . LYS A 1 128 ? 1.466   21.973 -64.526  1.00 53.17  ? 108 LYS A CG     1 
ATOM   1526  C  CD     . LYS A 1 128 ? 1.328   20.703 -63.702  1.00 57.08  ? 108 LYS A CD     1 
ATOM   1527  C  CE     . LYS A 1 128 ? 0.824   19.548 -64.554  1.00 61.54  ? 108 LYS A CE     1 
ATOM   1528  N  NZ     . LYS A 1 128 ? 0.213   18.465 -63.734  1.00 64.92  ? 108 LYS A NZ     1 
ATOM   1529  H  H      . LYS A 1 128 ? 3.099   24.494 -65.265  1.00 63.35  ? 108 LYS A H      1 
ATOM   1530  H  HA     . LYS A 1 128 ? 0.466   24.412 -64.757  1.00 58.37  ? 108 LYS A HA     1 
ATOM   1531  H  HB2    . LYS A 1 128 ? 2.601   23.211 -63.370  1.00 60.32  ? 108 LYS A HB2    1 
ATOM   1532  H  HB3    . LYS A 1 128 ? 1.099   23.101 -62.868  1.00 60.32  ? 108 LYS A HB3    1 
ATOM   1533  H  HG2    . LYS A 1 128 ? 0.655   22.087 -65.046  1.00 63.93  ? 108 LYS A HG2    1 
ATOM   1534  H  HG3    . LYS A 1 128 ? 2.230   21.872 -65.115  1.00 63.93  ? 108 LYS A HG3    1 
ATOM   1535  H  HD2    . LYS A 1 128 ? 2.195   20.460 -63.340  1.00 68.61  ? 108 LYS A HD2    1 
ATOM   1536  H  HD3    . LYS A 1 128 ? 0.693   20.853 -62.984  1.00 68.61  ? 108 LYS A HD3    1 
ATOM   1537  H  HE2    . LYS A 1 128 ? 0.149   19.878 -65.168  1.00 73.96  ? 108 LYS A HE2    1 
ATOM   1538  H  HE3    . LYS A 1 128 ? 1.567   19.169 -65.048  1.00 73.96  ? 108 LYS A HE3    1 
ATOM   1539  H  HZ1    . LYS A 1 128 ? -0.071  17.807 -64.261  1.00 78.02  ? 108 LYS A HZ1    1 
ATOM   1540  H  HZ2    . LYS A 1 128 ? 0.814   18.140 -63.164  1.00 78.02  ? 108 LYS A HZ2    1 
ATOM   1541  H  HZ3    . LYS A 1 128 ? -0.479  18.786 -63.274  1.00 78.02  ? 108 LYS A HZ3    1 
ATOM   1542  N  N      . HIS A 1 129 ? 2.195   26.519 -63.201  1.00 48.32  ? 109 HIS A N      1 
ATOM   1543  C  CA     . HIS A 1 129 ? 2.137   27.602 -62.222  1.00 46.24  ? 109 HIS A CA     1 
ATOM   1544  C  C      . HIS A 1 129 ? 2.595   28.878 -62.912  1.00 53.86  ? 109 HIS A C      1 
ATOM   1545  O  O      . HIS A 1 129 ? 3.775   29.011 -63.251  1.00 54.81  ? 109 HIS A O      1 
ATOM   1546  C  CB     . HIS A 1 129 ? 3.011   27.293 -61.006  1.00 41.09  ? 109 HIS A CB     1 
ATOM   1547  C  CG     . HIS A 1 129 ? 2.614   26.045 -60.279  1.00 37.10  ? 109 HIS A CG     1 
ATOM   1548  N  ND1    . HIS A 1 129 ? 1.753   26.048 -59.201  1.00 36.55  ? 109 HIS A ND1    1 
ATOM   1549  C  CD2    . HIS A 1 129 ? 2.962   24.752 -60.479  1.00 34.74  ? 109 HIS A CD2    1 
ATOM   1550  C  CE1    . HIS A 1 129 ? 1.589   24.810 -58.770  1.00 35.56  ? 109 HIS A CE1    1 
ATOM   1551  N  NE2    . HIS A 1 129 ? 2.311   24.005 -59.527  1.00 35.82  ? 109 HIS A NE2    1 
ATOM   1552  H  H      . HIS A 1 129 ? 2.902   26.526 -63.690  1.00 58.10  ? 109 HIS A H      1 
ATOM   1553  H  HA     . HIS A 1 129 ? 1.222   27.723 -61.923  1.00 55.61  ? 109 HIS A HA     1 
ATOM   1554  H  HB2    . HIS A 1 129 ? 3.929   27.186 -61.300  1.00 49.42  ? 109 HIS A HB2    1 
ATOM   1555  H  HB3    . HIS A 1 129 ? 2.950   28.033 -60.381  1.00 49.42  ? 109 HIS A HB3    1 
ATOM   1556  H  HD2    . HIS A 1 129 ? 3.534   24.430 -61.137  1.00 41.81  ? 109 HIS A HD2    1 
ATOM   1557  H  HE1    . HIS A 1 129 ? 1.055   24.550 -58.054  1.00 42.79  ? 109 HIS A HE1    1 
ATOM   1558  H  HE2    . HIS A 1 129 ? 2.365   23.151 -59.439  1.00 43.11  ? 109 HIS A HE2    1 
ATOM   1559  N  N      . LEU A 1 130 ? 1.673   29.819 -63.105  1.00 65.35  ? 110 LEU A N      1 
ATOM   1560  C  CA     . LEU A 1 130 ? 1.978   31.012 -63.884  1.00 73.95  ? 110 LEU A CA     1 
ATOM   1561  C  C      . LEU A 1 130 ? 2.589   32.117 -63.037  1.00 67.37  ? 110 LEU A C      1 
ATOM   1562  O  O      . LEU A 1 130 ? 3.335   32.950 -63.566  1.00 70.42  ? 110 LEU A O      1 
ATOM   1563  C  CB     . LEU A 1 130 ? 0.718   31.540 -64.577  1.00 85.19  ? 110 LEU A CB     1 
ATOM   1564  C  CG     . LEU A 1 130 ? 0.925   32.749 -65.497  1.00 92.95  ? 110 LEU A CG     1 
ATOM   1565  C  CD1    . LEU A 1 130 ? 2.044   32.506 -66.508  1.00 94.07  ? 110 LEU A CD1    1 
ATOM   1566  C  CD2    . LEU A 1 130 ? -0.369  33.104 -66.209  1.00 96.38  ? 110 LEU A CD2    1 
ATOM   1567  H  H      . LEU A 1 130 ? 0.871   29.790 -62.797  1.00 78.53  ? 110 LEU A H      1 
ATOM   1568  H  HA     . LEU A 1 130 ? 2.620   30.778 -64.573  1.00 88.85  ? 110 LEU A HA     1 
ATOM   1569  H  HB2    . LEU A 1 130 ? 0.343   30.826 -65.116  1.00 102.35 ? 110 LEU A HB2    1 
ATOM   1570  H  HB3    . LEU A 1 130 ? 0.080   31.800 -63.895  1.00 102.35 ? 110 LEU A HB3    1 
ATOM   1571  H  HG     . LEU A 1 130 ? 1.180   33.511 -64.954  1.00 111.66 ? 110 LEU A HG     1 
ATOM   1572  H  HD11   . LEU A 1 130 ? 2.140   33.293 -67.067  1.00 113.00 ? 110 LEU A HD11   1 
ATOM   1573  H  HD12   . LEU A 1 130 ? 2.871   32.337 -66.029  1.00 113.00 ? 110 LEU A HD12   1 
ATOM   1574  H  HD13   . LEU A 1 130 ? 1.815   31.738 -67.054  1.00 113.00 ? 110 LEU A HD13   1 
ATOM   1575  H  HD21   . LEU A 1 130 ? -0.213  33.870 -66.784  1.00 115.78 ? 110 LEU A HD21   1 
ATOM   1576  H  HD22   . LEU A 1 130 ? -0.655  32.344 -66.740  1.00 115.78 ? 110 LEU A HD22   1 
ATOM   1577  H  HD23   . LEU A 1 130 ? -1.045  33.319 -65.547  1.00 115.78 ? 110 LEU A HD23   1 
ATOM   1578  N  N      . SER A 1 131 ? 2.291   32.150 -61.738  1.00 57.51  ? 111 SER A N      1 
ATOM   1579  C  CA     . SER A 1 131 ? 2.839   33.181 -60.870  1.00 54.16  ? 111 SER A CA     1 
ATOM   1580  C  C      . SER A 1 131 ? 4.225   32.830 -60.345  1.00 51.13  ? 111 SER A C      1 
ATOM   1581  O  O      . SER A 1 131 ? 4.878   33.693 -59.748  1.00 53.92  ? 111 SER A O      1 
ATOM   1582  C  CB     . SER A 1 131 ? 1.897   33.427 -59.688  1.00 58.44  ? 111 SER A CB     1 
ATOM   1583  O  OG     . SER A 1 131 ? 1.625   32.222 -58.993  1.00 61.50  ? 111 SER A OG     1 
ATOM   1584  H  H      . SER A 1 131 ? 1.776   31.588 -61.341  1.00 69.13  ? 111 SER A H      1 
ATOM   1585  H  HA     . SER A 1 131 ? 2.911   34.009 -61.372  1.00 65.11  ? 111 SER A HA     1 
ATOM   1586  H  HB2    . SER A 1 131 ? 2.315   34.055 -59.077  1.00 70.24  ? 111 SER A HB2    1 
ATOM   1587  H  HB3    . SER A 1 131 ? 1.064   33.795 -60.020  1.00 70.24  ? 111 SER A HB3    1 
ATOM   1588  H  HG     . SER A 1 131 ? 1.262   31.669 -59.510  1.00 73.92  ? 111 SER A HG     1 
ATOM   1589  N  N      . TRP A 1 132 ? 4.689   31.600 -60.553  1.00 44.84  ? 112 TRP A N      1 
ATOM   1590  C  CA     . TRP A 1 132 ? 6.012   31.211 -60.095  1.00 39.66  ? 112 TRP A CA     1 
ATOM   1591  C  C      . TRP A 1 132 ? 7.067   31.732 -61.063  1.00 36.69  ? 112 TRP A C      1 
ATOM   1592  O  O      . TRP A 1 132 ? 6.833   31.838 -62.271  1.00 27.89  ? 112 TRP A O      1 
ATOM   1593  C  CB     . TRP A 1 132 ? 6.129   29.687 -59.984  1.00 39.83  ? 112 TRP A CB     1 
ATOM   1594  C  CG     . TRP A 1 132 ? 5.274   29.066 -58.913  1.00 40.00  ? 112 TRP A CG     1 
ATOM   1595  C  CD1    . TRP A 1 132 ? 4.305   29.679 -58.176  1.00 40.54  ? 112 TRP A CD1    1 
ATOM   1596  C  CD2    . TRP A 1 132 ? 5.321   27.706 -58.461  1.00 40.91  ? 112 TRP A CD2    1 
ATOM   1597  N  NE1    . TRP A 1 132 ? 3.741   28.787 -57.297  1.00 41.02  ? 112 TRP A NE1    1 
ATOM   1598  C  CE2    . TRP A 1 132 ? 4.348   27.569 -57.450  1.00 41.96  ? 112 TRP A CE2    1 
ATOM   1599  C  CE3    . TRP A 1 132 ? 6.091   26.592 -58.812  1.00 41.92  ? 112 TRP A CE3    1 
ATOM   1600  C  CZ2    . TRP A 1 132 ? 4.124   26.362 -56.787  1.00 44.41  ? 112 TRP A CZ2    1 
ATOM   1601  C  CZ3    . TRP A 1 132 ? 5.867   25.394 -58.152  1.00 43.28  ? 112 TRP A CZ3    1 
ATOM   1602  C  CH2    . TRP A 1 132 ? 4.891   25.290 -57.151  1.00 44.49  ? 112 TRP A CH2    1 
ATOM   1603  H  H      . TRP A 1 132 ? 4.256   30.976 -60.957  1.00 53.93  ? 112 TRP A H      1 
ATOM   1604  H  HA     . TRP A 1 132 ? 6.179   31.597 -59.221  1.00 47.71  ? 112 TRP A HA     1 
ATOM   1605  H  HB2    . TRP A 1 132 ? 5.869   29.295 -60.832  1.00 47.91  ? 112 TRP A HB2    1 
ATOM   1606  H  HB3    . TRP A 1 132 ? 7.052   29.461 -59.790  1.00 47.91  ? 112 TRP A HB3    1 
ATOM   1607  H  HD1    . TRP A 1 132 ? 4.057   30.572 -58.260  1.00 48.77  ? 112 TRP A HD1    1 
ATOM   1608  H  HE1    . TRP A 1 132 ? 3.111   28.964 -56.739  1.00 49.35  ? 112 TRP A HE1    1 
ATOM   1609  H  HE3    . TRP A 1 132 ? 6.739   26.654 -59.475  1.00 50.43  ? 112 TRP A HE3    1 
ATOM   1610  H  HZ2    . TRP A 1 132 ? 3.478   26.290 -56.122  1.00 53.41  ? 112 TRP A HZ2    1 
ATOM   1611  H  HZ3    . TRP A 1 132 ? 6.372   24.647 -58.378  1.00 52.05  ? 112 TRP A HZ3    1 
ATOM   1612  H  HH2    . TRP A 1 132 ? 4.762   24.473 -56.725  1.00 53.51  ? 112 TRP A HH2    1 
ATOM   1613  N  N      . ASN A 1 133 ? 8.238   32.057 -60.522  1.00 46.41  ? 113 ASN A N      1 
ATOM   1614  C  CA     . ASN A 1 133 ? 9.387   32.451 -61.327  1.00 49.64  ? 113 ASN A CA     1 
ATOM   1615  C  C      . ASN A 1 133 ? 10.345  31.267 -61.407  1.00 49.41  ? 113 ASN A C      1 
ATOM   1616  O  O      . ASN A 1 133 ? 10.780  30.742 -60.372  1.00 52.10  ? 113 ASN A O      1 
ATOM   1617  C  CB     . ASN A 1 133 ? 10.081  33.682 -60.744  1.00 51.83  ? 113 ASN A CB     1 
ATOM   1618  C  CG     . ASN A 1 133 ? 11.125  34.261 -61.683  1.00 54.87  ? 113 ASN A CG     1 
ATOM   1619  O  OD1    . ASN A 1 133 ? 10.807  35.065 -62.559  1.00 57.09  ? 113 ASN A OD1    1 
ATOM   1620  N  ND2    . ASN A 1 133 ? 12.376  33.854 -61.506  1.00 55.55  ? 113 ASN A ND2    1 
ATOM   1621  H  H      . ASN A 1 133 ? 8.393   32.057 -59.676  1.00 55.81  ? 113 ASN A H      1 
ATOM   1622  H  HA     . ASN A 1 133 ? 9.091   32.665 -62.226  1.00 59.69  ? 113 ASN A HA     1 
ATOM   1623  H  HB2    . ASN A 1 133 ? 9.417   34.368 -60.572  1.00 62.32  ? 113 ASN A HB2    1 
ATOM   1624  H  HB3    . ASN A 1 133 ? 10.524  33.434 -59.917  1.00 62.32  ? 113 ASN A HB3    1 
ATOM   1625  H  HD21   . ASN A 1 133 ? 13.001  34.155 -62.014  1.00 66.78  ? 113 ASN A HD21   1 
ATOM   1626  H  HD22   . ASN A 1 133 ? 12.560  33.290 -60.883  1.00 66.78  ? 113 ASN A HD22   1 
ATOM   1627  N  N      . VAL A 1 134 ? 10.669  30.857 -62.632  1.00 43.87  ? 114 VAL A N      1 
ATOM   1628  C  CA     . VAL A 1 134 ? 11.477  29.671 -62.900  1.00 40.15  ? 114 VAL A CA     1 
ATOM   1629  C  C      . VAL A 1 134 ? 12.675  30.108 -63.731  1.00 35.61  ? 114 VAL A C      1 
ATOM   1630  O  O      . VAL A 1 134 ? 12.521  30.527 -64.886  1.00 34.25  ? 114 VAL A O      1 
ATOM   1631  C  CB     . VAL A 1 134 ? 10.673  28.583 -63.624  1.00 41.62  ? 114 VAL A CB     1 
ATOM   1632  C  CG1    . VAL A 1 134 ? 11.539  27.357 -63.880  1.00 42.34  ? 114 VAL A CG1    1 
ATOM   1633  C  CG2    . VAL A 1 134 ? 9.437   28.210 -62.817  1.00 42.98  ? 114 VAL A CG2    1 
ATOM   1634  H  H      . VAL A 1 134 ? 10.423  31.266 -63.348  1.00 52.76  ? 114 VAL A H      1 
ATOM   1635  H  HA     . VAL A 1 134 ? 11.801  29.306 -62.062  1.00 48.30  ? 114 VAL A HA     1 
ATOM   1636  H  HB     . VAL A 1 134 ? 10.378  28.926 -64.482  1.00 50.07  ? 114 VAL A HB     1 
ATOM   1637  H  HG11   . VAL A 1 134 ? 11.009  26.686 -64.338  1.00 50.93  ? 114 VAL A HG11   1 
ATOM   1638  H  HG12   . VAL A 1 134 ? 12.295  27.614 -64.431  1.00 50.93  ? 114 VAL A HG12   1 
ATOM   1639  H  HG13   . VAL A 1 134 ? 11.852  27.009 -63.030  1.00 50.93  ? 114 VAL A HG13   1 
ATOM   1640  H  HG21   . VAL A 1 134 ? 8.945   27.522 -63.293  1.00 51.69  ? 114 VAL A HG21   1 
ATOM   1641  H  HG22   . VAL A 1 134 ? 9.715   27.878 -61.950  1.00 51.69  ? 114 VAL A HG22   1 
ATOM   1642  H  HG23   . VAL A 1 134 ? 8.882   28.998 -62.708  1.00 51.69  ? 114 VAL A HG23   1 
ATOM   1643  N  N      . GLU A 1 135 ? 13.866  30.000 -63.152  1.00 33.21  ? 115 GLU A N      1 
ATOM   1644  C  CA     . GLU A 1 135 ? 15.103  30.410 -63.798  1.00 34.20  ? 115 GLU A CA     1 
ATOM   1645  C  C      . GLU A 1 135 ? 15.970  29.196 -64.102  1.00 29.99  ? 115 GLU A C      1 
ATOM   1646  O  O      . GLU A 1 135 ? 16.115  28.297 -63.267  1.00 27.73  ? 115 GLU A O      1 
ATOM   1647  C  CB     . GLU A 1 135 ? 15.880  31.389 -62.911  1.00 39.83  ? 115 GLU A CB     1 
ATOM   1648  C  CG     . GLU A 1 135 ? 17.164  31.925 -63.534  1.00 45.54  ? 115 GLU A CG     1 
ATOM   1649  C  CD     . GLU A 1 135 ? 17.977  32.763 -62.566  1.00 49.21  ? 115 GLU A CD     1 
ATOM   1650  O  OE1    . GLU A 1 135 ? 17.517  32.971 -61.424  1.00 51.26  ? 115 GLU A OE1    1 
ATOM   1651  O  OE2    . GLU A 1 135 ? 19.079  33.211 -62.945  1.00 49.78  ? 115 GLU A OE2    1 
ATOM   1652  H  H      . GLU A 1 135 ? 13.984  29.683 -62.361  1.00 39.96  ? 115 GLU A H      1 
ATOM   1653  H  HA     . GLU A 1 135 ? 14.897  30.854 -64.635  1.00 41.16  ? 115 GLU A HA     1 
ATOM   1654  H  HB2    . GLU A 1 135 ? 15.310  32.148 -62.713  1.00 47.92  ? 115 GLU A HB2    1 
ATOM   1655  H  HB3    . GLU A 1 135 ? 16.120  30.938 -62.086  1.00 47.92  ? 115 GLU A HB3    1 
ATOM   1656  H  HG2    . GLU A 1 135 ? 17.713  31.178 -63.820  1.00 54.77  ? 115 GLU A HG2    1 
ATOM   1657  H  HG3    . GLU A 1 135 ? 16.937  32.481 -64.296  1.00 54.77  ? 115 GLU A HG3    1 
ATOM   1658  N  N      . GLU A 1 136 ? 16.547  29.180 -65.300  1.00 29.59  ? 116 GLU A N      1 
ATOM   1659  C  CA     . GLU A 1 136 ? 17.482  28.143 -65.718  1.00 32.97  ? 116 GLU A CA     1 
ATOM   1660  C  C      . GLU A 1 136 ? 18.879  28.737 -65.596  1.00 35.93  ? 116 GLU A C      1 
ATOM   1661  O  O      . GLU A 1 136 ? 19.165  29.779 -66.195  1.00 28.83  ? 116 GLU A O      1 
ATOM   1662  C  CB     . GLU A 1 136 ? 17.190  27.676 -67.145  1.00 33.19  ? 116 GLU A CB     1 
ATOM   1663  C  CG     . GLU A 1 136 ? 15.832  26.993 -67.297  1.00 34.48  ? 116 GLU A CG     1 
ATOM   1664  C  CD     . GLU A 1 136 ? 15.467  26.697 -68.742  1.00 31.12  ? 116 GLU A CD     1 
ATOM   1665  O  OE1    . GLU A 1 136 ? 16.211  25.943 -69.404  1.00 29.32  ? 116 GLU A OE1    1 
ATOM   1666  O  OE2    . GLU A 1 136 ? 14.436  27.221 -69.216  1.00 27.67  ? 116 GLU A OE2    1 
ATOM   1667  H  H      . GLU A 1 136 ? 16.407  29.776 -65.904  1.00 35.63  ? 116 GLU A H      1 
ATOM   1668  H  HA     . GLU A 1 136 ? 17.414  27.381 -65.121  1.00 39.68  ? 116 GLU A HA     1 
ATOM   1669  H  HB2    . GLU A 1 136 ? 17.204  28.445 -67.736  1.00 39.95  ? 116 GLU A HB2    1 
ATOM   1670  H  HB3    . GLU A 1 136 ? 17.873  27.042 -67.414  1.00 39.95  ? 116 GLU A HB3    1 
ATOM   1671  H  HG2    . GLU A 1 136 ? 15.848  26.151 -66.815  1.00 41.49  ? 116 GLU A HG2    1 
ATOM   1672  H  HG3    . GLU A 1 136 ? 15.147  27.572 -66.928  1.00 41.49  ? 116 GLU A HG3    1 
ATOM   1673  N  N      . VAL A 1 137 ? 19.749  28.074 -64.835  1.00 46.33  ? 117 VAL A N      1 
ATOM   1674  C  CA     . VAL A 1 137 ? 21.073  28.603 -64.518  1.00 45.01  ? 117 VAL A CA     1 
ATOM   1675  C  C      . VAL A 1 137 ? 22.127  27.829 -65.295  1.00 44.76  ? 117 VAL A C      1 
ATOM   1676  O  O      . VAL A 1 137 ? 22.194  26.596 -65.214  1.00 41.82  ? 117 VAL A O      1 
ATOM   1677  C  CB     . VAL A 1 137 ? 21.354  28.550 -63.006  1.00 37.84  ? 117 VAL A CB     1 
ATOM   1678  C  CG1    . VAL A 1 137 ? 22.704  29.183 -62.689  1.00 34.53  ? 117 VAL A CG1    1 
ATOM   1679  C  CG2    . VAL A 1 137 ? 20.244  29.256 -62.233  1.00 33.18  ? 117 VAL A CG2    1 
ATOM   1680  H  H      . VAL A 1 137 ? 19.593  27.303 -64.486  1.00 55.71  ? 117 VAL A H      1 
ATOM   1681  H  HA     . VAL A 1 137 ? 21.117  29.531 -64.798  1.00 54.13  ? 117 VAL A HA     1 
ATOM   1682  H  HB     . VAL A 1 137 ? 21.380  27.624 -62.720  1.00 45.53  ? 117 VAL A HB     1 
ATOM   1683  H  HG11   . VAL A 1 137 ? 22.857  29.137 -61.733  1.00 41.56  ? 117 VAL A HG11   1 
ATOM   1684  H  HG12   . VAL A 1 137 ? 23.398  28.696 -63.160  1.00 41.56  ? 117 VAL A HG12   1 
ATOM   1685  H  HG13   . VAL A 1 137 ? 22.694  30.108 -62.979  1.00 41.56  ? 117 VAL A HG13   1 
ATOM   1686  H  HG21   . VAL A 1 137 ? 20.441  29.209 -61.285  1.00 39.94  ? 117 VAL A HG21   1 
ATOM   1687  H  HG22   . VAL A 1 137 ? 20.201  30.182 -62.518  1.00 39.94  ? 117 VAL A HG22   1 
ATOM   1688  H  HG23   . VAL A 1 137 ? 19.401  28.813 -62.418  1.00 39.94  ? 117 VAL A HG23   1 
ATOM   1689  N  N      . ARG A 1 138 ? 22.953  28.562 -66.043  1.00 49.84  ? 118 ARG A N      1 
ATOM   1690  C  CA     . ARG A 1 138 ? 24.010  28.005 -66.876  1.00 58.62  ? 118 ARG A CA     1 
ATOM   1691  C  C      . ARG A 1 138 ? 25.334  28.670 -66.507  1.00 63.26  ? 118 ARG A C      1 
ATOM   1692  O  O      . ARG A 1 138 ? 25.396  29.538 -65.631  1.00 64.84  ? 118 ARG A O      1 
ATOM   1693  C  CB     . ARG A 1 138 ? 23.696  28.209 -68.366  1.00 58.45  ? 118 ARG A CB     1 
ATOM   1694  C  CG     . ARG A 1 138 ? 22.391  27.575 -68.829  1.00 56.22  ? 118 ARG A CG     1 
ATOM   1695  C  CD     . ARG A 1 138 ? 21.502  28.580 -69.553  1.00 52.52  ? 118 ARG A CD     1 
ATOM   1696  N  NE     . ARG A 1 138 ? 20.260  27.973 -70.029  1.00 46.17  ? 118 ARG A NE     1 
ATOM   1697  C  CZ     . ARG A 1 138 ? 19.222  28.655 -70.504  1.00 38.93  ? 118 ARG A CZ     1 
ATOM   1698  N  NH1    . ARG A 1 138 ? 19.261  29.981 -70.570  1.00 37.68  ? 118 ARG A NH1    1 
ATOM   1699  N  NH2    . ARG A 1 138 ? 18.139  28.010 -70.912  1.00 35.03  ? 118 ARG A NH2    1 
ATOM   1700  H  H      . ARG A 1 138 ? 22.914  29.420 -66.082  1.00 59.93  ? 118 ARG A H      1 
ATOM   1701  H  HA     . ARG A 1 138 ? 24.087  27.053 -66.707  1.00 70.46  ? 118 ARG A HA     1 
ATOM   1702  H  HB2    . ARG A 1 138 ? 23.639  29.161 -68.544  1.00 70.25  ? 118 ARG A HB2    1 
ATOM   1703  H  HB3    . ARG A 1 138 ? 24.414  27.821 -68.890  1.00 70.25  ? 118 ARG A HB3    1 
ATOM   1704  H  HG2    . ARG A 1 138 ? 22.588  26.848 -69.440  1.00 67.58  ? 118 ARG A HG2    1 
ATOM   1705  H  HG3    . ARG A 1 138 ? 21.906  27.242 -68.058  1.00 67.58  ? 118 ARG A HG3    1 
ATOM   1706  H  HD2    . ARG A 1 138 ? 21.273  29.299 -68.944  1.00 63.14  ? 118 ARG A HD2    1 
ATOM   1707  H  HD3    . ARG A 1 138 ? 21.980  28.932 -70.321  1.00 63.14  ? 118 ARG A HD3    1 
ATOM   1708  H  HE     . ARG A 1 138 ? 20.196  27.116 -70.000  1.00 55.52  ? 118 ARG A HE     1 
ATOM   1709  H  HH11   . ARG A 1 138 ? 19.962  30.404 -70.306  1.00 45.33  ? 118 ARG A HH11   1 
ATOM   1710  H  HH12   . ARG A 1 138 ? 18.586  30.416 -70.877  1.00 45.33  ? 118 ARG A HH12   1 
ATOM   1711  H  HH21   . ARG A 1 138 ? 18.108  27.152 -70.871  1.00 42.16  ? 118 ARG A HH21   1 
ATOM   1712  H  HH22   . ARG A 1 138 ? 17.466  28.450 -71.219  1.00 42.16  ? 118 ARG A HH22   1 
ATOM   1713  N  N      . ARG A 1 139 ? 26.406  28.253 -67.188  1.00 57.89  ? 119 ARG A N      1 
ATOM   1714  C  CA     . ARG A 1 139 ? 27.759  28.750 -66.910  1.00 63.79  ? 119 ARG A CA     1 
ATOM   1715  C  C      . ARG A 1 139 ? 28.204  28.447 -65.482  1.00 56.01  ? 119 ARG A C      1 
ATOM   1716  O  O      . ARG A 1 139 ? 28.902  29.241 -64.847  1.00 53.30  ? 119 ARG A O      1 
ATOM   1717  C  CB     . ARG A 1 139 ? 27.904  30.245 -67.219  1.00 81.55  ? 119 ARG A CB     1 
ATOM   1718  C  CG     . ARG A 1 139 ? 28.276  30.540 -68.658  1.00 96.79  ? 119 ARG A CG     1 
ATOM   1719  C  CD     . ARG A 1 139 ? 29.698  30.020 -68.920  1.00 109.89 ? 119 ARG A CD     1 
ATOM   1720  N  NE     . ARG A 1 139 ? 30.694  31.080 -69.065  1.00 119.92 ? 119 ARG A NE     1 
ATOM   1721  C  CZ     . ARG A 1 139 ? 31.165  31.531 -70.224  1.00 126.52 ? 119 ARG A CZ     1 
ATOM   1722  N  NH1    . ARG A 1 139 ? 30.735  31.024 -71.369  1.00 128.53 ? 119 ARG A NH1    1 
ATOM   1723  N  NH2    . ARG A 1 139 ? 32.076  32.496 -70.237  1.00 128.83 ? 119 ARG A NH2    1 
ATOM   1724  H  H      . ARG A 1 139 ? 26.376  27.675 -67.824  1.00 69.58  ? 119 ARG A H      1 
ATOM   1725  H  HA     . ARG A 1 139 ? 28.372  28.282 -67.499  1.00 76.67  ? 119 ARG A HA     1 
ATOM   1726  H  HB2    . ARG A 1 139 ? 27.059  30.685 -67.035  1.00 97.98  ? 119 ARG A HB2    1 
ATOM   1727  H  HB3    . ARG A 1 139 ? 28.597  30.616 -66.651  1.00 97.98  ? 119 ARG A HB3    1 
ATOM   1728  H  HG2    . ARG A 1 139 ? 27.662  30.085 -69.256  1.00 116.27 ? 119 ARG A HG2    1 
ATOM   1729  H  HG3    . ARG A 1 139 ? 28.260  31.498 -68.812  1.00 116.27 ? 119 ARG A HG3    1 
ATOM   1730  H  HD2    . ARG A 1 139 ? 29.968  29.459 -68.176  1.00 131.98 ? 119 ARG A HD2    1 
ATOM   1731  H  HD3    . ARG A 1 139 ? 29.696  29.502 -69.739  1.00 131.98 ? 119 ARG A HD3    1 
ATOM   1732  H  HE     . ARG A 1 139 ? 30.999  31.439 -68.345  1.00 144.02 ? 119 ARG A HE     1 
ATOM   1733  H  HH11   . ARG A 1 139 ? 30.146  30.397 -71.367  1.00 154.36 ? 119 ARG A HH11   1 
ATOM   1734  H  HH12   . ARG A 1 139 ? 31.044  31.321 -72.114  1.00 154.36 ? 119 ARG A HH12   1 
ATOM   1735  H  HH21   . ARG A 1 139 ? 32.359  32.830 -69.497  1.00 154.71 ? 119 ARG A HH21   1 
ATOM   1736  H  HH22   . ARG A 1 139 ? 32.380  32.790 -70.986  1.00 154.71 ? 119 ARG A HH22   1 
ATOM   1737  N  N      . THR A 1 140 ? 27.798  27.292 -64.967  1.00 58.45  ? 120 THR A N      1 
ATOM   1738  C  CA     . THR A 1 140 ? 28.252  26.845 -63.662  1.00 48.82  ? 120 THR A CA     1 
ATOM   1739  C  C      . THR A 1 140 ? 28.657  25.381 -63.758  1.00 43.01  ? 120 THR A C      1 
ATOM   1740  O  O      . THR A 1 140 ? 28.385  24.699 -64.750  1.00 40.42  ? 120 THR A O      1 
ATOM   1741  C  CB     . THR A 1 140 ? 27.168  27.042 -62.592  1.00 47.55  ? 120 THR A CB     1 
ATOM   1742  O  OG1    . THR A 1 140 ? 27.654  26.579 -61.325  1.00 49.61  ? 120 THR A OG1    1 
ATOM   1743  C  CG2    . THR A 1 140 ? 25.893  26.293 -62.960  1.00 46.24  ? 120 THR A CG2    1 
ATOM   1744  H  H      . THR A 1 140 ? 27.257  26.748 -65.357  1.00 70.26  ? 120 THR A H      1 
ATOM   1745  H  HA     . THR A 1 140 ? 29.032  27.360 -63.402  1.00 58.70  ? 120 THR A HA     1 
ATOM   1746  H  HB     . THR A 1 140 ? 26.955  27.986 -62.525  1.00 57.17  ? 120 THR A HB     1 
ATOM   1747  H  HG1    . THR A 1 140 ? 28.339  27.012 -61.105  1.00 59.65  ? 120 THR A HG1    1 
ATOM   1748  H  HG21   . THR A 1 140 ? 25.220  26.428 -62.274  1.00 55.60  ? 120 THR A HG21   1 
ATOM   1749  H  HG22   . THR A 1 140 ? 25.549  26.619 -63.806  1.00 55.60  ? 120 THR A HG22   1 
ATOM   1750  H  HG23   . THR A 1 140 ? 26.077  25.344 -63.039  1.00 55.60  ? 120 THR A HG23   1 
ATOM   1751  N  N      . ARG A 1 141 ? 29.318  24.899 -62.705  1.00 41.20  ? 121 ARG A N      1 
ATOM   1752  C  CA     . ARG A 1 141 ? 29.775  23.514 -62.693  1.00 39.08  ? 121 ARG A CA     1 
ATOM   1753  C  C      . ARG A 1 141 ? 28.607  22.537 -62.633  1.00 34.30  ? 121 ARG A C      1 
ATOM   1754  O  O      . ARG A 1 141 ? 28.699  21.430 -63.176  1.00 31.48  ? 121 ARG A O      1 
ATOM   1755  C  CB     . ARG A 1 141 ? 30.735  23.290 -61.524  1.00 39.72  ? 121 ARG A CB     1 
ATOM   1756  C  CG     . ARG A 1 141 ? 31.316  21.883 -61.455  1.00 39.68  ? 121 ARG A CG     1 
ATOM   1757  C  CD     . ARG A 1 141 ? 32.304  21.742 -60.307  1.00 39.07  ? 121 ARG A CD     1 
ATOM   1758  N  NE     . ARG A 1 141 ? 31.680  21.957 -59.004  1.00 39.27  ? 121 ARG A NE     1 
ATOM   1759  C  CZ     . ARG A 1 141 ? 31.055  21.019 -58.299  1.00 39.53  ? 121 ARG A CZ     1 
ATOM   1760  N  NH1    . ARG A 1 141 ? 30.956  19.780 -58.762  1.00 37.03  ? 121 ARG A NH1    1 
ATOM   1761  N  NH2    . ARG A 1 141 ? 30.524  21.324 -57.122  1.00 41.89  ? 121 ARG A NH2    1 
ATOM   1762  H  H      . ARG A 1 141 ? 29.510  25.346 -61.997  1.00 49.56  ? 121 ARG A H      1 
ATOM   1763  H  HA     . ARG A 1 141 ? 30.263  23.340 -63.513  1.00 47.02  ? 121 ARG A HA     1 
ATOM   1764  H  HB2    . ARG A 1 141 ? 31.476  23.912 -61.606  1.00 47.78  ? 121 ARG A HB2    1 
ATOM   1765  H  HB3    . ARG A 1 141 ? 30.260  23.455 -60.695  1.00 47.78  ? 121 ARG A HB3    1 
ATOM   1766  H  HG2    . ARG A 1 141 ? 30.597  21.247 -61.317  1.00 47.73  ? 121 ARG A HG2    1 
ATOM   1767  H  HG3    . ARG A 1 141 ? 31.782  21.689 -62.283  1.00 47.73  ? 121 ARG A HG3    1 
ATOM   1768  H  HD2    . ARG A 1 141 ? 32.676  20.847 -60.318  1.00 47.00  ? 121 ARG A HD2    1 
ATOM   1769  H  HD3    . ARG A 1 141 ? 33.010  22.398 -60.415  1.00 47.00  ? 121 ARG A HD3    1 
ATOM   1770  H  HE     . ARG A 1 141 ? 31.719  22.748 -58.669  1.00 47.24  ? 121 ARG A HE     1 
ATOM   1771  H  HH11   . ARG A 1 141 ? 31.299  19.577 -59.524  1.00 44.56  ? 121 ARG A HH11   1 
ATOM   1772  H  HH12   . ARG A 1 141 ? 30.549  19.179 -58.300  1.00 44.56  ? 121 ARG A HH12   1 
ATOM   1773  H  HH21   . ARG A 1 141 ? 30.585  22.126 -56.818  1.00 50.39  ? 121 ARG A HH21   1 
ATOM   1774  H  HH22   . ARG A 1 141 ? 30.118  20.720 -56.664  1.00 50.39  ? 121 ARG A HH22   1 
ATOM   1775  N  N      . VAL A 1 142 ? 27.510  22.928 -61.990  1.00 31.92  ? 122 VAL A N      1 
ATOM   1776  C  CA     . VAL A 1 142 ? 26.346  22.061 -61.819  1.00 28.28  ? 122 VAL A CA     1 
ATOM   1777  C  C      . VAL A 1 142 ? 25.096  22.774 -62.325  1.00 25.59  ? 122 VAL A C      1 
ATOM   1778  O  O      . VAL A 1 142 ? 24.609  23.702 -61.663  1.00 24.38  ? 122 VAL A O      1 
ATOM   1779  C  CB     . VAL A 1 142 ? 26.176  21.646 -60.348  1.00 24.79  ? 122 VAL A CB     1 
ATOM   1780  C  CG1    . VAL A 1 142 ? 24.996  20.699 -60.192  1.00 22.39  ? 122 VAL A CG1    1 
ATOM   1781  C  CG2    . VAL A 1 142 ? 27.454  21.001 -59.824  1.00 24.22  ? 122 VAL A CG2    1 
ATOM   1782  H  H      . VAL A 1 142 ? 27.413  23.706 -61.638  1.00 38.43  ? 122 VAL A H      1 
ATOM   1783  H  HA     . VAL A 1 142 ? 26.469  21.256 -62.346  1.00 34.06  ? 122 VAL A HA     1 
ATOM   1784  H  HB     . VAL A 1 142 ? 25.999  22.437 -59.815  1.00 29.87  ? 122 VAL A HB     1 
ATOM   1785  H  HG11   . VAL A 1 142 ? 24.911  20.452 -59.258  1.00 26.98  ? 122 VAL A HG11   1 
ATOM   1786  H  HG12   . VAL A 1 142 ? 24.190  21.147 -60.492  1.00 26.98  ? 122 VAL A HG12   1 
ATOM   1787  H  HG13   . VAL A 1 142 ? 25.154  19.907 -60.730  1.00 26.98  ? 122 VAL A HG13   1 
ATOM   1788  H  HG21   . VAL A 1 142 ? 27.323  20.749 -58.897  1.00 29.18  ? 122 VAL A HG21   1 
ATOM   1789  H  HG22   . VAL A 1 142 ? 27.652  20.215 -60.356  1.00 29.18  ? 122 VAL A HG22   1 
ATOM   1790  H  HG23   . VAL A 1 142 ? 28.181  21.640 -59.894  1.00 29.18  ? 122 VAL A HG23   1 
ATOM   1791  N  N      . PRO A 1 143 ? 24.549  22.389 -63.481  1.00 22.77  ? 123 PRO A N      1 
ATOM   1792  C  CA     . PRO A 1 143 ? 23.300  23.007 -63.943  1.00 20.71  ? 123 PRO A CA     1 
ATOM   1793  C  C      . PRO A 1 143 ? 22.190  22.832 -62.919  1.00 20.04  ? 123 PRO A C      1 
ATOM   1794  O  O      . PRO A 1 143 ? 22.133  21.835 -62.197  1.00 14.80  ? 123 PRO A O      1 
ATOM   1795  C  CB     . PRO A 1 143 ? 22.988  22.255 -65.242  1.00 19.12  ? 123 PRO A CB     1 
ATOM   1796  C  CG     . PRO A 1 143 ? 24.303  21.725 -65.701  1.00 19.46  ? 123 PRO A CG     1 
ATOM   1797  C  CD     . PRO A 1 143 ? 25.085  21.427 -64.461  1.00 20.54  ? 123 PRO A CD     1 
ATOM   1798  H  HA     . PRO A 1 143 ? 23.430  23.950 -64.131  1.00 24.97  ? 123 PRO A HA     1 
ATOM   1799  H  HB2    . PRO A 1 143 ? 22.370  21.530 -65.061  1.00 23.06  ? 123 PRO A HB2    1 
ATOM   1800  H  HB3    . PRO A 1 143 ? 22.618  22.869 -65.896  1.00 23.06  ? 123 PRO A HB3    1 
ATOM   1801  H  HG2    . PRO A 1 143 ? 24.164  20.916 -66.218  1.00 23.47  ? 123 PRO A HG2    1 
ATOM   1802  H  HG3    . PRO A 1 143 ? 24.755  22.397 -66.235  1.00 23.47  ? 123 PRO A HG3    1 
ATOM   1803  H  HD2    . PRO A 1 143 ? 24.919  20.518 -64.167  1.00 24.77  ? 123 PRO A HD2    1 
ATOM   1804  H  HD3    . PRO A 1 143 ? 26.030  21.587 -64.610  1.00 24.77  ? 123 PRO A HD3    1 
ATOM   1805  N  N      . VAL A 1 144 ? 21.294  23.817 -62.864  1.00 27.70  ? 124 VAL A N      1 
ATOM   1806  C  CA     . VAL A 1 144 ? 20.269  23.851 -61.828  1.00 28.76  ? 124 VAL A CA     1 
ATOM   1807  C  C      . VAL A 1 144 ? 19.130  24.746 -62.290  1.00 27.93  ? 124 VAL A C      1 
ATOM   1808  O  O      . VAL A 1 144 ? 19.332  25.697 -63.061  1.00 26.58  ? 124 VAL A O      1 
ATOM   1809  C  CB     . VAL A 1 144 ? 20.865  24.335 -60.480  1.00 29.47  ? 124 VAL A CB     1 
ATOM   1810  C  CG1    . VAL A 1 144 ? 21.400  25.758 -60.612  1.00 27.84  ? 124 VAL A CG1    1 
ATOM   1811  C  CG2    . VAL A 1 144 ? 19.839  24.230 -59.357  1.00 29.17  ? 124 VAL A CG2    1 
ATOM   1812  H  H      . VAL A 1 144 ? 21.260  24.477 -63.415  1.00 33.35  ? 124 VAL A H      1 
ATOM   1813  H  HA     . VAL A 1 144 ? 19.917  22.956 -61.699  1.00 34.63  ? 124 VAL A HA     1 
ATOM   1814  H  HB     . VAL A 1 144 ? 21.612  23.761 -60.249  1.00 35.48  ? 124 VAL A HB     1 
ATOM   1815  H  HG11   . VAL A 1 144 ? 21.766  26.037 -59.758  1.00 33.53  ? 124 VAL A HG11   1 
ATOM   1816  H  HG12   . VAL A 1 144 ? 22.093  25.773 -61.290  1.00 33.53  ? 124 VAL A HG12   1 
ATOM   1817  H  HG13   . VAL A 1 144 ? 20.673  26.346 -60.868  1.00 33.53  ? 124 VAL A HG13   1 
ATOM   1818  H  HG21   . VAL A 1 144 ? 20.243  24.540 -58.531  1.00 35.12  ? 124 VAL A HG21   1 
ATOM   1819  H  HG22   . VAL A 1 144 ? 19.072  24.782 -59.578  1.00 35.12  ? 124 VAL A HG22   1 
ATOM   1820  H  HG23   . VAL A 1 144 ? 19.565  23.304 -59.265  1.00 35.12  ? 124 VAL A HG23   1 
ATOM   1821  N  N      . VAL A 1 145 ? 17.927  24.445 -61.803  1.00 26.95  ? 125 VAL A N      1 
ATOM   1822  C  CA     . VAL A 1 145 ? 16.747  25.273 -62.025  1.00 27.27  ? 125 VAL A CA     1 
ATOM   1823  C  C      . VAL A 1 145 ? 16.309  25.827 -60.677  1.00 29.24  ? 125 VAL A C      1 
ATOM   1824  O  O      . VAL A 1 145 ? 16.106  25.068 -59.721  1.00 29.69  ? 125 VAL A O      1 
ATOM   1825  C  CB     . VAL A 1 145 ? 15.614  24.478 -62.698  1.00 24.92  ? 125 VAL A CB     1 
ATOM   1826  C  CG1    . VAL A 1 145 ? 14.364  25.342 -62.858  1.00 23.66  ? 125 VAL A CG1    1 
ATOM   1827  C  CG2    . VAL A 1 145 ? 16.071  23.950 -64.047  1.00 24.05  ? 125 VAL A CG2    1 
ATOM   1828  H  H      . VAL A 1 145 ? 17.767  23.746 -61.327  1.00 32.46  ? 125 VAL A H      1 
ATOM   1829  H  HA     . VAL A 1 145 ? 16.981  26.018 -62.600  1.00 32.84  ? 125 VAL A HA     1 
ATOM   1830  H  HB     . VAL A 1 145 ? 15.385  23.719 -62.139  1.00 30.02  ? 125 VAL A HB     1 
ATOM   1831  H  HG11   . VAL A 1 145 ? 13.669  24.815 -63.283  1.00 28.51  ? 125 VAL A HG11   1 
ATOM   1832  H  HG12   . VAL A 1 145 ? 14.068  25.634 -61.982  1.00 28.51  ? 125 VAL A HG12   1 
ATOM   1833  H  HG13   . VAL A 1 145 ? 14.580  26.111 -63.408  1.00 28.51  ? 125 VAL A HG13   1 
ATOM   1834  H  HG21   . VAL A 1 145 ? 15.344  23.453 -64.454  1.00 28.98  ? 125 VAL A HG21   1 
ATOM   1835  H  HG22   . VAL A 1 145 ? 16.317  24.698 -64.612  1.00 28.98  ? 125 VAL A HG22   1 
ATOM   1836  H  HG23   . VAL A 1 145 ? 16.836  23.368 -63.915  1.00 28.98  ? 125 VAL A HG23   1 
ATOM   1837  N  N      . ARG A 1 146 ? 16.160  27.146 -60.606  1.00 33.01  ? 126 ARG A N      1 
ATOM   1838  C  CA     . ARG A 1 146 ? 15.820  27.846 -59.376  1.00 38.28  ? 126 ARG A CA     1 
ATOM   1839  C  C      . ARG A 1 146 ? 14.392  28.359 -59.461  1.00 35.66  ? 126 ARG A C      1 
ATOM   1840  O  O      . ARG A 1 146 ? 14.037  29.073 -60.405  1.00 36.75  ? 126 ARG A O      1 
ATOM   1841  C  CB     . ARG A 1 146 ? 16.807  28.988 -59.129  1.00 49.42  ? 126 ARG A CB     1 
ATOM   1842  C  CG     . ARG A 1 146 ? 16.658  29.690 -57.792  1.00 59.94  ? 126 ARG A CG     1 
ATOM   1843  C  CD     . ARG A 1 146 ? 17.911  30.490 -57.475  1.00 66.60  ? 126 ARG A CD     1 
ATOM   1844  N  NE     . ARG A 1 146 ? 18.980  29.615 -56.999  1.00 69.49  ? 126 ARG A NE     1 
ATOM   1845  C  CZ     . ARG A 1 146 ? 20.254  29.973 -56.875  1.00 72.22  ? 126 ARG A CZ     1 
ATOM   1846  N  NH1    . ARG A 1 146 ? 20.644  31.197 -57.203  1.00 74.64  ? 126 ARG A NH1    1 
ATOM   1847  N  NH2    . ARG A 1 146 ? 21.143  29.099 -56.421  1.00 72.45  ? 126 ARG A NH2    1 
ATOM   1848  H  H      . ARG A 1 146 ? 16.253  27.671 -61.281  1.00 39.72  ? 126 ARG A H      1 
ATOM   1849  H  HA     . ARG A 1 146 ? 15.877  27.228 -58.630  1.00 46.05  ? 126 ARG A HA     1 
ATOM   1850  H  HB2    . ARG A 1 146 ? 17.708  28.632 -59.173  1.00 59.42  ? 126 ARG A HB2    1 
ATOM   1851  H  HB3    . ARG A 1 146 ? 16.687  29.654 -59.824  1.00 59.42  ? 126 ARG A HB3    1 
ATOM   1852  H  HG2    . ARG A 1 146 ? 15.905  30.301 -57.828  1.00 72.05  ? 126 ARG A HG2    1 
ATOM   1853  H  HG3    . ARG A 1 146 ? 16.528  29.031 -57.092  1.00 72.05  ? 126 ARG A HG3    1 
ATOM   1854  H  HD2    . ARG A 1 146 ? 18.219  30.938 -58.279  1.00 80.04  ? 126 ARG A HD2    1 
ATOM   1855  H  HD3    . ARG A 1 146 ? 17.713  31.137 -56.781  1.00 80.04  ? 126 ARG A HD3    1 
ATOM   1856  H  HE     . ARG A 1 146 ? 18.769  28.809 -56.783  1.00 83.51  ? 126 ARG A HE     1 
ATOM   1857  H  HH11   . ARG A 1 146 ? 20.071  31.767 -57.495  1.00 89.68  ? 126 ARG A HH11   1 
ATOM   1858  H  HH12   . ARG A 1 146 ? 21.471  31.421 -57.122  1.00 89.68  ? 126 ARG A HH12   1 
ATOM   1859  H  HH21   . ARG A 1 146 ? 20.895  28.303 -56.210  1.00 87.06  ? 126 ARG A HH21   1 
ATOM   1860  H  HH22   . ARG A 1 146 ? 21.969  29.326 -56.345  1.00 87.06  ? 126 ARG A HH22   1 
ATOM   1861  N  N      . VAL A 1 147 ? 13.582  27.997 -58.470  1.00 34.65  ? 127 VAL A N      1 
ATOM   1862  C  CA     . VAL A 1 147 ? 12.153  28.284 -58.464  1.00 36.69  ? 127 VAL A CA     1 
ATOM   1863  C  C      . VAL A 1 147 ? 11.842  29.131 -57.241  1.00 46.96  ? 127 VAL A C      1 
ATOM   1864  O  O      . VAL A 1 147 ? 12.136  28.729 -56.104  1.00 43.39  ? 127 VAL A O      1 
ATOM   1865  C  CB     . VAL A 1 147 ? 11.315  26.997 -58.464  1.00 32.48  ? 127 VAL A CB     1 
ATOM   1866  C  CG1    . VAL A 1 147 ? 9.826   27.323 -58.527  1.00 32.81  ? 127 VAL A CG1    1 
ATOM   1867  C  CG2    . VAL A 1 147 ? 11.722  26.105 -59.629  1.00 30.90  ? 127 VAL A CG2    1 
ATOM   1868  H  H      . VAL A 1 147 ? 13.846  27.572 -57.770  1.00 41.69  ? 127 VAL A H      1 
ATOM   1869  H  HA     . VAL A 1 147 ? 11.925  28.796 -59.256  1.00 44.15  ? 127 VAL A HA     1 
ATOM   1870  H  HB     . VAL A 1 147 ? 11.481  26.511 -57.642  1.00 39.10  ? 127 VAL A HB     1 
ATOM   1871  H  HG11   . VAL A 1 147 ? 9.321   26.495 -58.526  1.00 39.49  ? 127 VAL A HG11   1 
ATOM   1872  H  HG12   . VAL A 1 147 ? 9.588   27.857 -57.753  1.00 39.49  ? 127 VAL A HG12   1 
ATOM   1873  H  HG13   . VAL A 1 147 ? 9.646   27.820 -59.340  1.00 39.49  ? 127 VAL A HG13   1 
ATOM   1874  H  HG21   . VAL A 1 147 ? 11.183  25.299 -59.612  1.00 37.20  ? 127 VAL A HG21   1 
ATOM   1875  H  HG22   . VAL A 1 147 ? 11.575  26.585 -60.459  1.00 37.20  ? 127 VAL A HG22   1 
ATOM   1876  H  HG23   . VAL A 1 147 ? 12.661  25.878 -59.539  1.00 37.20  ? 127 VAL A HG23   1 
ATOM   1877  N  N      . LYS A 1 148 ? 11.228  30.292 -57.480  1.00 59.58  ? 128 LYS A N      1 
ATOM   1878  C  CA     . LYS A 1 148 ? 10.815  31.216 -56.434  1.00 68.73  ? 128 LYS A CA     1 
ATOM   1879  C  C      . LYS A 1 148 ? 9.336   31.528 -56.594  1.00 73.16  ? 128 LYS A C      1 
ATOM   1880  O  O      . LYS A 1 148 ? 8.848   31.714 -57.712  1.00 73.35  ? 128 LYS A O      1 
ATOM   1881  C  CB     . LYS A 1 148 ? 11.610  32.526 -56.466  1.00 70.44  ? 128 LYS A CB     1 
ATOM   1882  C  CG     . LYS A 1 148 ? 13.080  32.385 -56.125  1.00 74.33  ? 128 LYS A CG     1 
ATOM   1883  C  CD     . LYS A 1 148 ? 13.667  33.720 -55.684  1.00 79.51  ? 128 LYS A CD     1 
ATOM   1884  C  CE     . LYS A 1 148 ? 13.620  34.760 -56.796  1.00 82.89  ? 128 LYS A CE     1 
ATOM   1885  N  NZ     . LYS A 1 148 ? 14.161  36.075 -56.353  1.00 83.97  ? 128 LYS A NZ     1 
ATOM   1886  H  H      . LYS A 1 148 ? 11.036  30.571 -58.271  1.00 71.62  ? 128 LYS A H      1 
ATOM   1887  H  HA     . LYS A 1 148 ? 10.947  30.799 -55.568  1.00 82.59  ? 128 LYS A HA     1 
ATOM   1888  H  HB2    . LYS A 1 148 ? 11.551  32.902 -57.358  1.00 84.64  ? 128 LYS A HB2    1 
ATOM   1889  H  HB3    . LYS A 1 148 ? 11.218  33.141 -55.826  1.00 84.64  ? 128 LYS A HB3    1 
ATOM   1890  H  HG2    . LYS A 1 148 ? 13.183  31.751 -55.398  1.00 89.32  ? 128 LYS A HG2    1 
ATOM   1891  H  HG3    . LYS A 1 148 ? 13.565  32.082 -56.908  1.00 89.32  ? 128 LYS A HG3    1 
ATOM   1892  H  HD2    . LYS A 1 148 ? 13.158  34.059 -54.931  1.00 95.53  ? 128 LYS A HD2    1 
ATOM   1893  H  HD3    . LYS A 1 148 ? 14.595  33.592 -55.430  1.00 95.53  ? 128 LYS A HD3    1 
ATOM   1894  H  HE2    . LYS A 1 148 ? 14.153  34.451 -57.545  1.00 99.59  ? 128 LYS A HE2    1 
ATOM   1895  H  HE3    . LYS A 1 148 ? 12.699  34.889 -57.073  1.00 99.59  ? 128 LYS A HE3    1 
ATOM   1896  H  HZ1    . LYS A 1 148 ? 14.120  36.662 -57.022  1.00 100.89 ? 128 LYS A HZ1    1 
ATOM   1897  H  HZ2    . LYS A 1 148 ? 13.684  36.385 -55.668  1.00 100.89 ? 128 LYS A HZ2    1 
ATOM   1898  H  HZ3    . LYS A 1 148 ? 15.009  35.985 -56.098  1.00 100.89 ? 128 LYS A HZ3    1 
ATOM   1899  N  N      . GLY A 1 149 ? 8.631   31.587 -55.476  1.00 70.60  ? 129 GLY A N      1 
ATOM   1900  C  CA     . GLY A 1 149 ? 7.220   31.925 -55.497  1.00 74.16  ? 129 GLY A CA     1 
ATOM   1901  C  C      . GLY A 1 149 ? 6.831   32.636 -54.224  1.00 71.66  ? 129 GLY A C      1 
ATOM   1902  O  O      . GLY A 1 149 ? 7.401   32.397 -53.154  1.00 79.17  ? 129 GLY A O      1 
ATOM   1903  H  H      . GLY A 1 149 ? 8.947   31.435 -54.691  1.00 84.84  ? 129 GLY A H      1 
ATOM   1904  H  HA2    . GLY A 1 149 ? 7.030   32.504 -56.251  1.00 89.11  ? 129 GLY A HA2    1 
ATOM   1905  H  HA3    . GLY A 1 149 ? 6.688   31.117 -55.580  1.00 89.11  ? 129 GLY A HA3    1 
ATOM   1906  N  N      . GLY A 1 150 ? 5.861   33.538 -54.350  1.00 59.99  ? 130 GLY A N      1 
ATOM   1907  C  CA     . GLY A 1 150 ? 5.439   34.373 -53.244  1.00 53.94  ? 130 GLY A CA     1 
ATOM   1908  C  C      . GLY A 1 150 ? 5.216   33.604 -51.960  1.00 53.39  ? 130 GLY A C      1 
ATOM   1909  O  O      . GLY A 1 150 ? 4.666   32.498 -51.974  1.00 48.49  ? 130 GLY A O      1 
ATOM   1910  H  H      . GLY A 1 150 ? 5.428   33.682 -55.079  1.00 72.10  ? 130 GLY A H      1 
ATOM   1911  H  HA2    . GLY A 1 150 ? 6.115   35.050 -53.079  1.00 64.85  ? 130 GLY A HA2    1 
ATOM   1912  H  HA3    . GLY A 1 150 ? 4.611   34.820 -53.479  1.00 64.85  ? 130 GLY A HA3    1 
ATOM   1913  N  N      . GLY A 1 151 ? 5.650   34.175 -50.845  1.00 58.58  ? 131 GLY A N      1 
ATOM   1914  C  CA     . GLY A 1 151 ? 5.447   33.529 -49.558  1.00 68.88  ? 131 GLY A CA     1 
ATOM   1915  C  C      . GLY A 1 151 ? 6.467   32.438 -49.324  1.00 80.24  ? 131 GLY A C      1 
ATOM   1916  O  O      . GLY A 1 151 ? 7.672   32.648 -49.491  1.00 69.95  ? 131 GLY A O      1 
ATOM   1917  H  H      . GLY A 1 151 ? 6.062   34.929 -50.807  1.00 70.41  ? 131 GLY A H      1 
ATOM   1918  H  HA2    . GLY A 1 151 ? 5.524   34.185 -48.848  1.00 82.77  ? 131 GLY A HA2    1 
ATOM   1919  H  HA3    . GLY A 1 151 ? 4.560   33.138 -49.526  1.00 82.77  ? 131 GLY A HA3    1 
ATOM   1920  N  N      . ALA A 1 152 ? 5.984   31.258 -48.940  1.00 118.76 ? 132 ALA A N      1 
ATOM   1921  C  CA     . ALA A 1 152 ? 6.853   30.161 -48.519  1.00 123.41 ? 132 ALA A CA     1 
ATOM   1922  C  C      . ALA A 1 152 ? 6.955   29.114 -49.628  1.00 117.48 ? 132 ALA A C      1 
ATOM   1923  O  O      . ALA A 1 152 ? 6.399   28.018 -49.551  1.00 127.69 ? 132 ALA A O      1 
ATOM   1924  C  CB     . ALA A 1 152 ? 6.334   29.553 -47.219  1.00 122.39 ? 132 ALA A CB     1 
ATOM   1925  H  H      . ALA A 1 152 ? 5.146   31.066 -48.915  1.00 142.63 ? 132 ALA A H      1 
ATOM   1926  H  HA     . ALA A 1 152 ? 7.743   30.509 -48.353  1.00 148.21 ? 132 ALA A HA     1 
ATOM   1927  H  HB1    . ALA A 1 152 ? 6.921   28.828 -46.954  1.00 146.98 ? 132 ALA A HB1    1 
ATOM   1928  H  HB2    . ALA A 1 152 ? 6.322   30.238 -46.533  1.00 146.98 ? 132 ALA A HB2    1 
ATOM   1929  H  HB3    . ALA A 1 152 ? 5.436   29.216 -47.366  1.00 146.98 ? 132 ALA A HB3    1 
ATOM   1930  N  N      . VAL A 1 153 ? 7.700   29.475 -50.673  1.00 75.99  ? 133 VAL A N      1 
ATOM   1931  C  CA     . VAL A 1 153 ? 7.986   28.563 -51.778  1.00 63.71  ? 133 VAL A CA     1 
ATOM   1932  C  C      . VAL A 1 153 ? 9.299   28.979 -52.434  1.00 57.36  ? 133 VAL A C      1 
ATOM   1933  O  O      . VAL A 1 153 ? 9.364   29.994 -53.139  1.00 51.97  ? 133 VAL A O      1 
ATOM   1934  C  CB     . VAL A 1 153 ? 6.818   28.530 -52.788  1.00 66.97  ? 133 VAL A CB     1 
ATOM   1935  C  CG1    . VAL A 1 153 ? 7.304   28.390 -54.236  1.00 67.42  ? 133 VAL A CG1    1 
ATOM   1936  C  CG2    . VAL A 1 153 ? 5.878   27.369 -52.470  1.00 68.48  ? 133 VAL A CG2    1 
ATOM   1937  H  H      . VAL A 1 153 ? 8.055   30.253 -50.765  1.00 91.30  ? 133 VAL A H      1 
ATOM   1938  H  HA     . VAL A 1 153 ? 8.100   27.667 -51.425  1.00 76.57  ? 133 VAL A HA     1 
ATOM   1939  H  HB     . VAL A 1 153 ? 6.313   29.355 -52.718  1.00 80.48  ? 133 VAL A HB     1 
ATOM   1940  H  HG11   . VAL A 1 153 ? 6.535   28.374 -54.827  1.00 81.03  ? 133 VAL A HG11   1 
ATOM   1941  H  HG12   . VAL A 1 153 ? 7.872   29.146 -54.452  1.00 81.03  ? 133 VAL A HG12   1 
ATOM   1942  H  HG13   . VAL A 1 153 ? 7.805   27.564 -54.322  1.00 81.03  ? 133 VAL A HG13   1 
ATOM   1943  H  HG21   . VAL A 1 153 ? 5.153   27.365 -53.114  1.00 82.29  ? 133 VAL A HG21   1 
ATOM   1944  H  HG22   . VAL A 1 153 ? 6.374   26.537 -52.525  1.00 82.29  ? 133 VAL A HG22   1 
ATOM   1945  H  HG23   . VAL A 1 153 ? 5.525   27.486 -51.574  1.00 82.29  ? 133 VAL A HG23   1 
ATOM   1946  N  N      . ASP A 1 154 ? 10.357  28.205 -52.186  1.00 68.87  ? 134 ASP A N      1 
ATOM   1947  C  CA     . ASP A 1 154 ? 11.668  28.441 -52.781  1.00 61.44  ? 134 ASP A CA     1 
ATOM   1948  C  C      . ASP A 1 154 ? 12.424  27.121 -52.830  1.00 46.96  ? 134 ASP A C      1 
ATOM   1949  O  O      . ASP A 1 154 ? 12.583  26.461 -51.796  1.00 40.59  ? 134 ASP A O      1 
ATOM   1950  C  CB     . ASP A 1 154 ? 12.475  29.468 -51.976  1.00 64.21  ? 134 ASP A CB     1 
ATOM   1951  C  CG     . ASP A 1 154 ? 11.878  30.861 -52.026  1.00 67.13  ? 134 ASP A CG     1 
ATOM   1952  O  OD1    . ASP A 1 154 ? 11.508  31.318 -53.128  1.00 68.69  ? 134 ASP A OD1    1 
ATOM   1953  O  OD2    . ASP A 1 154 ? 11.785  31.504 -50.959  1.00 67.97  ? 134 ASP A OD2    1 
ATOM   1954  H  H      . ASP A 1 154 ? 10.336  27.522 -51.663  1.00 82.76  ? 134 ASP A H      1 
ATOM   1955  H  HA     . ASP A 1 154 ? 11.560  28.771 -53.687  1.00 73.85  ? 134 ASP A HA     1 
ATOM   1956  H  HB2    . ASP A 1 154 ? 12.505  29.189 -51.047  1.00 77.17  ? 134 ASP A HB2    1 
ATOM   1957  H  HB3    . ASP A 1 154 ? 13.374  29.515 -52.336  1.00 77.17  ? 134 ASP A HB3    1 
ATOM   1958  N  N      . PHE A 1 155 ? 12.913  26.745 -54.011  1.00 39.74  ? 135 PHE A N      1 
ATOM   1959  C  CA     . PHE A 1 155 ? 13.666  25.500 -54.089  1.00 35.69  ? 135 PHE A CA     1 
ATOM   1960  C  C      . PHE A 1 155 ? 14.517  25.462 -55.349  1.00 30.20  ? 135 PHE A C      1 
ATOM   1961  O  O      . PHE A 1 155 ? 14.232  26.137 -56.341  1.00 29.13  ? 135 PHE A O      1 
ATOM   1962  C  CB     . PHE A 1 155 ? 12.738  24.279 -54.026  1.00 37.93  ? 135 PHE A CB     1 
ATOM   1963  C  CG     . PHE A 1 155 ? 11.610  24.312 -55.018  1.00 39.51  ? 135 PHE A CG     1 
ATOM   1964  C  CD1    . PHE A 1 155 ? 11.787  23.854 -56.312  1.00 38.78  ? 135 PHE A CD1    1 
ATOM   1965  C  CD2    . PHE A 1 155 ? 10.365  24.789 -54.647  1.00 42.60  ? 135 PHE A CD2    1 
ATOM   1966  C  CE1    . PHE A 1 155 ? 10.742  23.881 -57.220  1.00 39.94  ? 135 PHE A CE1    1 
ATOM   1967  C  CE2    . PHE A 1 155 ? 9.319   24.818 -55.549  1.00 44.08  ? 135 PHE A CE2    1 
ATOM   1968  C  CZ     . PHE A 1 155 ? 9.509   24.362 -56.836  1.00 42.73  ? 135 PHE A CZ     1 
ATOM   1969  H  H      . PHE A 1 155 ? 12.827  27.174 -54.752  1.00 47.81  ? 135 PHE A H      1 
ATOM   1970  H  HA     . PHE A 1 155 ? 14.266  25.453 -53.328  1.00 42.94  ? 135 PHE A HA     1 
ATOM   1971  H  HB2    . PHE A 1 155 ? 13.261  23.481 -54.200  1.00 45.63  ? 135 PHE A HB2    1 
ATOM   1972  H  HB3    . PHE A 1 155 ? 12.350  24.229 -53.138  1.00 45.63  ? 135 PHE A HB3    1 
ATOM   1973  H  HD1    . PHE A 1 155 ? 12.617  23.528 -56.576  1.00 46.66  ? 135 PHE A HD1    1 
ATOM   1974  H  HD2    . PHE A 1 155 ? 10.232  25.097 -53.780  1.00 51.24  ? 135 PHE A HD2    1 
ATOM   1975  H  HE1    . PHE A 1 155 ? 10.872  23.573 -58.088  1.00 48.05  ? 135 PHE A HE1    1 
ATOM   1976  H  HE2    . PHE A 1 155 ? 8.488   25.143 -55.289  1.00 53.02  ? 135 PHE A HE2    1 
ATOM   1977  H  HZ     . PHE A 1 155 ? 8.806   24.381 -57.445  1.00 51.40  ? 135 PHE A HZ     1 
ATOM   1978  N  N      . ASP A 1 156 ? 15.574  24.653 -55.283  1.00 26.74  ? 136 ASP A N      1 
ATOM   1979  C  CA     . ASP A 1 156 ? 16.454  24.378 -56.409  1.00 27.76  ? 136 ASP A CA     1 
ATOM   1980  C  C      . ASP A 1 156 ? 16.309  22.921 -56.830  1.00 29.12  ? 136 ASP A C      1 
ATOM   1981  O  O      . ASP A 1 156 ? 16.037  22.046 -56.003  1.00 32.04  ? 136 ASP A O      1 
ATOM   1982  C  CB     . ASP A 1 156 ? 17.917  24.671 -56.055  1.00 31.40  ? 136 ASP A CB     1 
ATOM   1983  C  CG     . ASP A 1 156 ? 18.144  26.116 -55.643  1.00 37.51  ? 136 ASP A CG     1 
ATOM   1984  O  OD1    . ASP A 1 156 ? 17.151  26.862 -55.504  1.00 41.41  ? 136 ASP A OD1    1 
ATOM   1985  O  OD2    . ASP A 1 156 ? 19.317  26.504 -55.449  1.00 37.36  ? 136 ASP A OD2    1 
ATOM   1986  H  H      . ASP A 1 156 ? 15.806  24.239 -54.566  1.00 32.20  ? 136 ASP A H      1 
ATOM   1987  H  HA     . ASP A 1 156 ? 16.202  24.940 -57.159  1.00 33.43  ? 136 ASP A HA     1 
ATOM   1988  H  HB2    . ASP A 1 156 ? 18.182  24.103 -55.315  1.00 37.79  ? 136 ASP A HB2    1 
ATOM   1989  H  HB3    . ASP A 1 156 ? 18.472  24.489 -56.829  1.00 37.79  ? 136 ASP A HB3    1 
ATOM   1990  N  N      . ILE A 1 157 ? 16.505  22.660 -58.121  1.00 29.12  ? 137 ILE A N      1 
ATOM   1991  C  CA     . ILE A 1 157 ? 16.351  21.318 -58.672  1.00 29.54  ? 137 ILE A CA     1 
ATOM   1992  C  C      . ILE A 1 157 ? 17.554  21.004 -59.548  1.00 23.45  ? 137 ILE A C      1 
ATOM   1993  O  O      . ILE A 1 157 ? 17.956  21.829 -60.379  1.00 18.88  ? 137 ILE A O      1 
ATOM   1994  C  CB     . ILE A 1 157 ? 15.053  21.171 -59.490  1.00 34.76  ? 137 ILE A CB     1 
ATOM   1995  C  CG1    . ILE A 1 157 ? 13.850  21.688 -58.698  1.00 40.10  ? 137 ILE A CG1    1 
ATOM   1996  C  CG2    . ILE A 1 157 ? 14.843  19.707 -59.876  1.00 35.65  ? 137 ILE A CG2    1 
ATOM   1997  C  CD1    . ILE A 1 157 ? 12.556  21.700 -59.489  1.00 44.25  ? 137 ILE A CD1    1 
ATOM   1998  H  H      . ILE A 1 157 ? 16.730  23.250 -58.704  1.00 35.06  ? 137 ILE A H      1 
ATOM   1999  H  HA     . ILE A 1 157 ? 16.327  20.675 -57.946  1.00 35.56  ? 137 ILE A HA     1 
ATOM   2000  H  HB     . ILE A 1 157 ? 15.138  21.696 -60.302  1.00 41.83  ? 137 ILE A HB     1 
ATOM   2001  H  HG12   . ILE A 1 157 ? 13.718  21.120 -57.923  1.00 48.23  ? 137 ILE A HG12   1 
ATOM   2002  H  HG13   . ILE A 1 157 ? 14.031  22.597 -58.412  1.00 48.23  ? 137 ILE A HG13   1 
ATOM   2003  H  HG21   . ILE A 1 157 ? 14.024  19.631 -60.390  1.00 42.90  ? 137 ILE A HG21   1 
ATOM   2004  H  HG22   . ILE A 1 157 ? 15.597  19.410 -60.409  1.00 42.90  ? 137 ILE A HG22   1 
ATOM   2005  H  HG23   . ILE A 1 157 ? 14.778  19.174 -59.068  1.00 42.90  ? 137 ILE A HG23   1 
ATOM   2006  H  HD11   . ILE A 1 157 ? 11.844  22.038 -58.924  1.00 53.22  ? 137 ILE A HD11   1 
ATOM   2007  H  HD12   . ILE A 1 157 ? 12.665  22.274 -60.264  1.00 53.22  ? 137 ILE A HD12   1 
ATOM   2008  H  HD13   . ILE A 1 157 ? 12.352  20.795 -59.773  1.00 53.22  ? 137 ILE A HD13   1 
ATOM   2009  N  N      . THR A 1 158 ? 18.120  19.807 -59.360  1.00 23.81  ? 138 THR A N      1 
ATOM   2010  C  CA     . THR A 1 158 ? 19.203  19.291 -60.193  1.00 23.15  ? 138 THR A CA     1 
ATOM   2011  C  C      . THR A 1 158 ? 18.828  17.899 -60.704  1.00 26.26  ? 138 THR A C      1 
ATOM   2012  O  O      . THR A 1 158 ? 17.739  17.379 -60.427  1.00 24.91  ? 138 THR A O      1 
ATOM   2013  C  CB     . THR A 1 158 ? 20.529  19.249 -59.421  1.00 22.75  ? 138 THR A CB     1 
ATOM   2014  O  OG1    . THR A 1 158 ? 20.365  18.495 -58.212  1.00 21.81  ? 138 THR A OG1    1 
ATOM   2015  C  CG2    . THR A 1 158 ? 21.010  20.656 -59.095  1.00 23.37  ? 138 THR A CG2    1 
ATOM   2016  H  H      . THR A 1 158 ? 17.883  19.263 -58.737  1.00 28.68  ? 138 THR A H      1 
ATOM   2017  H  HA     . THR A 1 158 ? 19.318  19.873 -60.960  1.00 27.90  ? 138 THR A HA     1 
ATOM   2018  H  HB     . THR A 1 158 ? 21.203  18.821 -59.972  1.00 27.42  ? 138 THR A HB     1 
ATOM   2019  H  HG1    . THR A 1 158 ? 21.090  18.471 -57.788  1.00 26.29  ? 138 THR A HG1    1 
ATOM   2020  H  HG21   . THR A 1 158 ? 21.848  20.615 -58.608  1.00 28.17  ? 138 THR A HG21   1 
ATOM   2021  H  HG22   . THR A 1 158 ? 21.146  21.158 -59.913  1.00 28.17  ? 138 THR A HG22   1 
ATOM   2022  H  HG23   . THR A 1 158 ? 20.351  21.113 -58.550  1.00 28.17  ? 138 THR A HG23   1 
ATOM   2023  N  N      . ALA A 1 159 ? 19.756  17.272 -61.431  1.00 29.99  ? 139 ALA A N      1 
ATOM   2024  C  CA     . ALA A 1 159 ? 19.471  15.995 -62.070  1.00 32.07  ? 139 ALA A CA     1 
ATOM   2025  C  C      . ALA A 1 159 ? 20.732  15.151 -62.219  1.00 34.19  ? 139 ALA A C      1 
ATOM   2026  O  O      . ALA A 1 159 ? 21.815  15.670 -62.504  1.00 30.57  ? 139 ALA A O      1 
ATOM   2027  C  CB     . ALA A 1 159 ? 18.839  16.213 -63.449  1.00 30.28  ? 139 ALA A CB     1 
ATOM   2028  H  H      . ALA A 1 159 ? 20.553  17.566 -61.567  1.00 36.11  ? 139 ALA A H      1 
ATOM   2029  H  HA     . ALA A 1 159 ? 18.840  15.501 -61.524  1.00 38.60  ? 139 ALA A HA     1 
ATOM   2030  H  HB1    . ALA A 1 159 ? 18.659  15.350 -63.853  1.00 36.46  ? 139 ALA A HB1    1 
ATOM   2031  H  HB2    . ALA A 1 159 ? 18.012  16.708 -63.342  1.00 36.46  ? 139 ALA A HB2    1 
ATOM   2032  H  HB3    . ALA A 1 159 ? 19.456  16.716 -64.003  1.00 36.46  ? 139 ALA A HB3    1 
ATOM   2033  N  N      . TYR A 1 160 ? 20.568  13.840 -62.020  1.00 36.86  ? 140 TYR A N      1 
ATOM   2034  C  CA     . TYR A 1 160 ? 21.568  12.834 -62.387  1.00 33.96  ? 140 TYR A CA     1 
ATOM   2035  C  C      . TYR A 1 160 ? 22.840  12.948 -61.545  1.00 33.48  ? 140 TYR A C      1 
ATOM   2036  O  O      . TYR A 1 160 ? 23.944  12.739 -62.049  1.00 39.42  ? 140 TYR A O      1 
ATOM   2037  C  CB     . TYR A 1 160 ? 21.916  12.928 -63.877  1.00 30.38  ? 140 TYR A CB     1 
ATOM   2038  C  CG     . TYR A 1 160 ? 20.738  12.796 -64.823  1.00 26.96  ? 140 TYR A CG     1 
ATOM   2039  C  CD1    . TYR A 1 160 ? 19.560  12.175 -64.431  1.00 27.76  ? 140 TYR A CD1    1 
ATOM   2040  C  CD2    . TYR A 1 160 ? 20.811  13.301 -66.115  1.00 25.49  ? 140 TYR A CD2    1 
ATOM   2041  C  CE1    . TYR A 1 160 ? 18.488  12.061 -65.301  1.00 29.26  ? 140 TYR A CE1    1 
ATOM   2042  C  CE2    . TYR A 1 160 ? 19.747  13.193 -66.989  1.00 26.27  ? 140 TYR A CE2    1 
ATOM   2043  C  CZ     . TYR A 1 160 ? 18.588  12.572 -66.578  1.00 26.85  ? 140 TYR A CZ     1 
ATOM   2044  O  OH     . TYR A 1 160 ? 17.526  12.463 -67.446  1.00 23.62  ? 140 TYR A OH     1 
ATOM   2045  H  H      . TYR A 1 160 ? 19.864  13.500 -61.661  1.00 44.35  ? 140 TYR A H      1 
ATOM   2046  H  HA     . TYR A 1 160 ? 21.192  11.954 -62.230  1.00 40.87  ? 140 TYR A HA     1 
ATOM   2047  H  HB2    . TYR A 1 160 ? 22.329  13.790 -64.043  1.00 36.57  ? 140 TYR A HB2    1 
ATOM   2048  H  HB3    . TYR A 1 160 ? 22.544  12.221 -64.092  1.00 36.57  ? 140 TYR A HB3    1 
ATOM   2049  H  HD1    . TYR A 1 160 ? 19.490  11.830 -63.570  1.00 33.43  ? 140 TYR A HD1    1 
ATOM   2050  H  HD2    . TYR A 1 160 ? 21.591  13.722 -66.397  1.00 30.71  ? 140 TYR A HD2    1 
ATOM   2051  H  HE1    . TYR A 1 160 ? 17.705  11.642 -65.025  1.00 35.23  ? 140 TYR A HE1    1 
ATOM   2052  H  HE2    . TYR A 1 160 ? 19.813  13.537 -67.850  1.00 31.64  ? 140 TYR A HE2    1 
ATOM   2053  H  HH     . TYR A 1 160 ? 17.721  12.814 -68.184  1.00 28.46  ? 140 TYR A HH     1 
ATOM   2054  N  N      . ARG A 1 161 ? 22.697  13.257 -60.256  1.00 23.55  ? 141 ARG A N      1 
ATOM   2055  C  CA     . ARG A 1 161 ? 23.853  13.400 -59.379  1.00 19.85  ? 141 ARG A CA     1 
ATOM   2056  C  C      . ARG A 1 161 ? 23.527  12.854 -57.995  1.00 20.16  ? 141 ARG A C      1 
ATOM   2057  O  O      . ARG A 1 161 ? 22.395  12.981 -57.518  1.00 16.48  ? 141 ARG A O      1 
ATOM   2058  C  CB     . ARG A 1 161 ? 24.291  14.869 -59.285  1.00 17.49  ? 141 ARG A CB     1 
ATOM   2059  C  CG     . ARG A 1 161 ? 24.982  15.398 -60.544  1.00 17.44  ? 141 ARG A CG     1 
ATOM   2060  C  CD     . ARG A 1 161 ? 25.263  16.896 -60.442  1.00 21.18  ? 141 ARG A CD     1 
ATOM   2061  N  NE     . ARG A 1 161 ? 25.837  17.448 -61.669  1.00 25.03  ? 141 ARG A NE     1 
ATOM   2062  C  CZ     . ARG A 1 161 ? 27.139  17.541 -61.931  1.00 30.15  ? 141 ARG A CZ     1 
ATOM   2063  N  NH1    . ARG A 1 161 ? 28.041  17.118 -61.053  1.00 34.29  ? 141 ARG A NH1    1 
ATOM   2064  N  NH2    . ARG A 1 161 ? 27.543  18.061 -63.083  1.00 28.98  ? 141 ARG A NH2    1 
ATOM   2065  H  H      . ARG A 1 161 ? 21.941  13.388 -59.868  1.00 28.38  ? 141 ARG A H      1 
ATOM   2066  H  HA     . ARG A 1 161 ? 24.592  12.887 -59.741  1.00 23.94  ? 141 ARG A HA     1 
ATOM   2067  H  HB2    . ARG A 1 161 ? 23.507  15.418 -59.126  1.00 21.11  ? 141 ARG A HB2    1 
ATOM   2068  H  HB3    . ARG A 1 161 ? 24.912  14.962 -58.546  1.00 21.11  ? 141 ARG A HB3    1 
ATOM   2069  H  HG2    . ARG A 1 161 ? 25.828  14.938 -60.662  1.00 21.05  ? 141 ARG A HG2    1 
ATOM   2070  H  HG3    . ARG A 1 161 ? 24.408  15.248 -61.311  1.00 21.05  ? 141 ARG A HG3    1 
ATOM   2071  H  HD2    . ARG A 1 161 ? 24.431  17.362 -60.264  1.00 25.53  ? 141 ARG A HD2    1 
ATOM   2072  H  HD3    . ARG A 1 161 ? 25.891  17.052 -59.720  1.00 25.53  ? 141 ARG A HD3    1 
ATOM   2073  H  HE     . ARG A 1 161 ? 25.291  17.734 -62.269  1.00 30.15  ? 141 ARG A HE     1 
ATOM   2074  H  HH11   . ARG A 1 161 ? 27.786  16.779 -60.305  1.00 41.27  ? 141 ARG A HH11   1 
ATOM   2075  H  HH12   . ARG A 1 161 ? 28.879  17.182 -61.233  1.00 41.27  ? 141 ARG A HH12   1 
ATOM   2076  H  HH21   . ARG A 1 161 ? 26.964  18.337 -63.657  1.00 34.89  ? 141 ARG A HH21   1 
ATOM   2077  H  HH22   . ARG A 1 161 ? 28.383  18.122 -63.257  1.00 34.89  ? 141 ARG A HH22   1 
ATOM   2078  N  N      . ARG A 1 162 ? 24.531  12.244 -57.355  1.00 28.67  ? 142 ARG A N      1 
ATOM   2079  C  CA     . ARG A 1 162 ? 24.364  11.592 -56.062  1.00 25.46  ? 142 ARG A CA     1 
ATOM   2080  C  C      . ARG A 1 162 ? 25.101  12.268 -54.915  1.00 22.48  ? 142 ARG A C      1 
ATOM   2081  O  O      . ARG A 1 162 ? 24.743  12.033 -53.757  1.00 29.04  ? 142 ARG A O      1 
ATOM   2082  C  CB     . ARG A 1 162 ? 24.847  10.135 -56.137  1.00 25.44  ? 142 ARG A CB     1 
ATOM   2083  C  CG     . ARG A 1 162 ? 23.960  9.199  -56.940  1.00 29.56  ? 142 ARG A CG     1 
ATOM   2084  C  CD     . ARG A 1 162 ? 24.592  7.816  -57.024  1.00 34.89  ? 142 ARG A CD     1 
ATOM   2085  N  NE     . ARG A 1 162 ? 25.804  7.846  -57.841  1.00 38.93  ? 142 ARG A NE     1 
ATOM   2086  C  CZ     . ARG A 1 162 ? 25.878  7.470  -59.117  1.00 38.50  ? 142 ARG A CZ     1 
ATOM   2087  N  NH1    . ARG A 1 162 ? 24.811  7.011  -59.755  1.00 38.30  ? 142 ARG A NH1    1 
ATOM   2088  N  NH2    . ARG A 1 162 ? 27.033  7.556  -59.759  1.00 37.16  ? 142 ARG A NH2    1 
ATOM   2089  H  H      . ARG A 1 162 ? 25.333  12.196 -57.661  1.00 34.52  ? 142 ARG A H      1 
ATOM   2090  H  HA     . ARG A 1 162 ? 23.420  11.579 -55.840  1.00 30.67  ? 142 ARG A HA     1 
ATOM   2091  H  HB2    . ARG A 1 162 ? 25.727  10.124 -56.544  1.00 30.65  ? 142 ARG A HB2    1 
ATOM   2092  H  HB3    . ARG A 1 162 ? 24.902  9.783  -55.235  1.00 30.65  ? 142 ARG A HB3    1 
ATOM   2093  H  HG2    . ARG A 1 162 ? 23.097  9.117  -56.504  1.00 35.59  ? 142 ARG A HG2    1 
ATOM   2094  H  HG3    . ARG A 1 162 ? 23.855  9.545  -57.840  1.00 35.59  ? 142 ARG A HG3    1 
ATOM   2095  H  HD2    . ARG A 1 162 ? 24.831  7.517  -56.133  1.00 41.99  ? 142 ARG A HD2    1 
ATOM   2096  H  HD3    . ARG A 1 162 ? 23.964  7.199  -57.431  1.00 41.99  ? 142 ARG A HD3    1 
ATOM   2097  H  HE     . ARG A 1 162 ? 26.527  8.128  -57.469  1.00 46.83  ? 142 ARG A HE     1 
ATOM   2098  H  HH11   . ARG A 1 162 ? 24.056  6.955  -59.346  1.00 46.08  ? 142 ARG A HH11   1 
ATOM   2099  H  HH12   . ARG A 1 162 ? 24.873  6.770  -60.578  1.00 46.08  ? 142 ARG A HH12   1 
ATOM   2100  H  HH21   . ARG A 1 162 ? 27.731  7.850  -59.352  1.00 44.71  ? 142 ARG A HH21   1 
ATOM   2101  H  HH22   . ARG A 1 162 ? 27.088  7.309  -60.581  1.00 44.71  ? 142 ARG A HH22   1 
ATOM   2102  N  N      . ASN A 1 163 ? 26.110  13.096 -55.197  1.00 16.28  ? 143 ASN A N      1 
ATOM   2103  C  CA     . ASN A 1 163 ? 27.003  13.564 -54.140  1.00 18.69  ? 143 ASN A CA     1 
ATOM   2104  C  C      . ASN A 1 163 ? 26.263  14.401 -53.100  1.00 21.23  ? 143 ASN A C      1 
ATOM   2105  O  O      . ASN A 1 163 ? 26.548  14.307 -51.899  1.00 24.36  ? 143 ASN A O      1 
ATOM   2106  C  CB     . ASN A 1 163 ? 28.158  14.351 -54.755  1.00 23.36  ? 143 ASN A CB     1 
ATOM   2107  C  CG     . ASN A 1 163 ? 29.169  13.450 -55.449  1.00 26.95  ? 143 ASN A CG     1 
ATOM   2108  O  OD1    . ASN A 1 163 ? 29.038  12.225 -55.437  1.00 26.95  ? 143 ASN A OD1    1 
ATOM   2109  N  ND2    . ASN A 1 163 ? 30.173  14.055 -56.069  1.00 26.91  ? 143 ASN A ND2    1 
ATOM   2110  H  H      . ASN A 1 163 ? 26.296  13.396 -55.982  1.00 18.95  ? 143 ASN A H      1 
ATOM   2111  H  HA     . ASN A 1 163 ? 27.378  12.794 -53.685  1.00 22.54  ? 143 ASN A HA     1 
ATOM   2112  H  HB2    . ASN A 1 163 ? 27.805  14.970 -55.413  1.00 28.15  ? 143 ASN A HB2    1 
ATOM   2113  H  HB3    . ASN A 1 163 ? 28.620  14.837 -54.054  1.00 28.15  ? 143 ASN A HB3    1 
ATOM   2114  H  HD21   . ASN A 1 163 ? 30.770  13.588 -56.476  1.00 32.41  ? 143 ASN A HD21   1 
ATOM   2115  H  HD22   . ASN A 1 163 ? 30.228  14.913 -56.064  1.00 32.41  ? 143 ASN A HD22   1 
ATOM   2116  N  N      . GLY A 1 164 ? 25.309  15.224 -53.537  1.00 22.80  ? 144 GLY A N      1 
ATOM   2117  C  CA     . GLY A 1 164 ? 24.557  16.035 -52.590  1.00 21.09  ? 144 GLY A CA     1 
ATOM   2118  C  C      . GLY A 1 164 ? 23.804  15.195 -51.575  1.00 22.91  ? 144 GLY A C      1 
ATOM   2119  O  O      . GLY A 1 164 ? 23.949  15.380 -50.362  1.00 25.37  ? 144 GLY A O      1 
ATOM   2120  H  H      . GLY A 1 164 ? 25.083  15.328 -54.360  1.00 27.48  ? 144 GLY A H      1 
ATOM   2121  H  HA2    . GLY A 1 164 ? 25.166  16.620 -52.113  1.00 25.43  ? 144 GLY A HA2    1 
ATOM   2122  H  HA3    . GLY A 1 164 ? 23.918  16.582 -53.071  1.00 25.43  ? 144 GLY A HA3    1 
ATOM   2123  N  N      . VAL A 1 165 ? 22.994  14.250 -52.061  1.00 18.56  ? 145 VAL A N      1 
ATOM   2124  C  CA     . VAL A 1 165 ? 22.264  13.352 -51.168  1.00 22.34  ? 145 VAL A CA     1 
ATOM   2125  C  C      . VAL A 1 165 ? 23.229  12.658 -50.217  1.00 20.89  ? 145 VAL A C      1 
ATOM   2126  O  O      . VAL A 1 165 ? 22.951  12.499 -49.019  1.00 17.93  ? 145 VAL A O      1 
ATOM   2127  C  CB     . VAL A 1 165 ? 21.461  12.326 -51.995  1.00 24.22  ? 145 VAL A CB     1 
ATOM   2128  C  CG1    . VAL A 1 165 ? 20.772  11.305 -51.095  1.00 30.55  ? 145 VAL A CG1    1 
ATOM   2129  C  CG2    . VAL A 1 165 ? 20.438  13.022 -52.884  1.00 16.99  ? 145 VAL A CG2    1 
ATOM   2130  H  H      . VAL A 1 165 ? 22.852  14.110 -52.898  1.00 22.39  ? 145 VAL A H      1 
ATOM   2131  H  HA     . VAL A 1 165 ? 21.638  13.870 -50.638  1.00 26.92  ? 145 VAL A HA     1 
ATOM   2132  H  HB     . VAL A 1 165 ? 22.074  11.844 -52.572  1.00 29.18  ? 145 VAL A HB     1 
ATOM   2133  H  HG11   . VAL A 1 165 ? 20.279  10.679 -51.649  1.00 36.78  ? 145 VAL A HG11   1 
ATOM   2134  H  HG12   . VAL A 1 165 ? 21.445  10.833 -50.581  1.00 36.78  ? 145 VAL A HG12   1 
ATOM   2135  H  HG13   . VAL A 1 165 ? 20.165  11.769 -50.499  1.00 36.78  ? 145 VAL A HG13   1 
ATOM   2136  H  HG21   . VAL A 1 165 ? 19.952  12.352 -53.389  1.00 19.79  ? 145 VAL A HG21   1 
ATOM   2137  H  HG22   . VAL A 1 165 ? 19.826  13.525 -52.326  1.00 19.79  ? 145 VAL A HG22   1 
ATOM   2138  H  HG23   . VAL A 1 165 ? 20.903  13.621 -53.490  1.00 19.79  ? 145 VAL A HG23   1 
ATOM   2139  N  N      . ARG A 1 166 ? 24.395  12.272 -50.730  1.00 26.80  ? 146 ARG A N      1 
ATOM   2140  C  CA     . ARG A 1 166 ? 25.350  11.504 -49.941  1.00 26.99  ? 146 ARG A CA     1 
ATOM   2141  C  C      . ARG A 1 166 ? 25.923  12.331 -48.793  1.00 23.60  ? 146 ARG A C      1 
ATOM   2142  O  O      . ARG A 1 166 ? 25.809  11.949 -47.622  1.00 24.94  ? 146 ARG A O      1 
ATOM   2143  C  CB     . ARG A 1 166 ? 26.457  10.974 -50.852  1.00 27.49  ? 146 ARG A CB     1 
ATOM   2144  C  CG     . ARG A 1 166 ? 26.814  9.529  -50.579  1.00 31.38  ? 146 ARG A CG     1 
ATOM   2145  C  CD     . ARG A 1 166 ? 27.835  9.010  -51.569  1.00 31.55  ? 146 ARG A CD     1 
ATOM   2146  N  NE     . ARG A 1 166 ? 28.493  7.800  -51.089  1.00 29.28  ? 146 ARG A NE     1 
ATOM   2147  C  CZ     . ARG A 1 166 ? 29.486  7.188  -51.723  1.00 31.14  ? 146 ARG A CZ     1 
ATOM   2148  N  NH1    . ARG A 1 166 ? 29.940  7.667  -52.874  1.00 34.53  ? 146 ARG A NH1    1 
ATOM   2149  N  NH2    . ARG A 1 166 ? 30.026  6.093  -51.208  1.00 31.66  ? 146 ARG A NH2    1 
ATOM   2150  H  H      . ARG A 1 166 ? 24.656  12.443 -51.532  1.00 32.28  ? 146 ARG A H      1 
ATOM   2151  H  HA     . ARG A 1 166 ? 24.893  10.740 -49.555  1.00 32.51  ? 146 ARG A HA     1 
ATOM   2152  H  HB2    . ARG A 1 166 ? 26.163  11.040 -51.775  1.00 33.10  ? 146 ARG A HB2    1 
ATOM   2153  H  HB3    . ARG A 1 166 ? 27.255  11.509 -50.721  1.00 33.10  ? 146 ARG A HB3    1 
ATOM   2154  H  HG2    . ARG A 1 166 ? 27.191  9.456  -49.688  1.00 37.77  ? 146 ARG A HG2    1 
ATOM   2155  H  HG3    . ARG A 1 166 ? 26.016  8.983  -50.651  1.00 37.77  ? 146 ARG A HG3    1 
ATOM   2156  H  HD2    . ARG A 1 166 ? 27.390  8.801  -52.406  1.00 37.98  ? 146 ARG A HD2    1 
ATOM   2157  H  HD3    . ARG A 1 166 ? 28.514  9.688  -51.712  1.00 37.98  ? 146 ARG A HD3    1 
ATOM   2158  H  HE     . ARG A 1 166 ? 28.221  7.461  -50.347  1.00 35.25  ? 146 ARG A HE     1 
ATOM   2159  H  HH11   . ARG A 1 166 ? 29.592  8.378  -53.211  1.00 41.55  ? 146 ARG A HH11   1 
ATOM   2160  H  HH12   . ARG A 1 166 ? 30.583  7.268  -53.283  1.00 41.55  ? 146 ARG A HH12   1 
ATOM   2161  H  HH21   . ARG A 1 166 ? 29.734  5.779  -50.463  1.00 38.11  ? 146 ARG A HH21   1 
ATOM   2162  H  HH22   . ARG A 1 166 ? 30.668  5.695  -51.620  1.00 38.11  ? 146 ARG A HH22   1 
ATOM   2163  N  N      . ASN A 1 167 ? 26.549  13.473 -49.103  1.00 16.55  ? 147 ASN A N      1 
ATOM   2164  C  CA     . ASN A 1 167 ? 27.143  14.268 -48.030  1.00 18.70  ? 147 ASN A CA     1 
ATOM   2165  C  C      . ASN A 1 167 ? 26.079  14.802 -47.075  1.00 21.20  ? 147 ASN A C      1 
ATOM   2166  O  O      . ASN A 1 167 ? 26.339  14.943 -45.872  1.00 19.51  ? 147 ASN A O      1 
ATOM   2167  C  CB     . ASN A 1 167 ? 27.998  15.405 -48.606  1.00 19.12  ? 147 ASN A CB     1 
ATOM   2168  C  CG     . ASN A 1 167 ? 27.194  16.430 -49.385  1.00 20.97  ? 147 ASN A CG     1 
ATOM   2169  O  OD1    . ASN A 1 167 ? 26.107  16.837 -48.978  1.00 23.80  ? 147 ASN A OD1    1 
ATOM   2170  N  ND2    . ASN A 1 167 ? 27.752  16.878 -50.506  1.00 18.92  ? 147 ASN A ND2    1 
ATOM   2171  H  H      . ASN A 1 167 ? 26.640  13.796 -49.894  1.00 19.72  ? 147 ASN A H      1 
ATOM   2172  H  HA     . ASN A 1 167 ? 27.732  13.695 -47.515  1.00 22.56  ? 147 ASN A HA     1 
ATOM   2173  H  HB2    . ASN A 1 167 ? 28.439  15.866 -47.875  1.00 23.06  ? 147 ASN A HB2    1 
ATOM   2174  H  HB3    . ASN A 1 167 ? 28.660  15.027 -49.205  1.00 23.06  ? 147 ASN A HB3    1 
ATOM   2175  H  HD21   . ASN A 1 167 ? 27.341  17.460 -50.988  1.00 22.82  ? 147 ASN A HD21   1 
ATOM   2176  H  HD22   . ASN A 1 167 ? 28.524  16.586 -50.749  1.00 22.82  ? 147 ASN A HD22   1 
ATOM   2177  N  N      . SER A 1 168 ? 24.872  15.081 -47.577  1.00 25.11  ? 148 SER A N      1 
ATOM   2178  C  CA     . SER A 1 168 ? 23.782  15.448 -46.678  1.00 27.84  ? 148 SER A CA     1 
ATOM   2179  C  C      . SER A 1 168 ? 23.487  14.325 -45.690  1.00 28.26  ? 148 SER A C      1 
ATOM   2180  O  O      . SER A 1 168 ? 23.305  14.574 -44.491  1.00 27.78  ? 148 SER A O      1 
ATOM   2181  C  CB     . SER A 1 168 ? 22.531  15.805 -47.480  1.00 26.94  ? 148 SER A CB     1 
ATOM   2182  O  OG     . SER A 1 168 ? 22.740  16.970 -48.258  1.00 24.17  ? 148 SER A OG     1 
ATOM   2183  H  H      . SER A 1 168 ? 24.666  15.065 -48.412  1.00 30.25  ? 148 SER A H      1 
ATOM   2184  H  HA     . SER A 1 168 ? 24.044  16.231 -46.170  1.00 33.53  ? 148 SER A HA     1 
ATOM   2185  H  HB2    . SER A 1 168 ? 22.314  15.066 -48.071  1.00 32.45  ? 148 SER A HB2    1 
ATOM   2186  H  HB3    . SER A 1 168 ? 21.797  15.964 -46.866  1.00 32.45  ? 148 SER A HB3    1 
ATOM   2187  H  HG     . SER A 1 168 ? 23.373  16.847 -48.796  1.00 29.12  ? 148 SER A HG     1 
ATOM   2188  N  N      . ALA A 1 169 ? 23.452  13.077 -46.171  1.00 26.15  ? 149 ALA A N      1 
ATOM   2189  C  CA     . ALA A 1 169 ? 23.240  11.947 -45.269  1.00 22.63  ? 149 ALA A CA     1 
ATOM   2190  C  C      . ALA A 1 169 ? 24.375  11.824 -44.259  1.00 24.27  ? 149 ALA A C      1 
ATOM   2191  O  O      . ALA A 1 169 ? 24.138  11.558 -43.073  1.00 28.20  ? 149 ALA A O      1 
ATOM   2192  C  CB     . ALA A 1 169 ? 23.100  10.654 -46.072  1.00 19.23  ? 149 ALA A CB     1 
ATOM   2193  H  H      . ALA A 1 169 ? 23.546  12.864 -46.998  1.00 31.50  ? 149 ALA A H      1 
ATOM   2194  H  HA     . ALA A 1 169 ? 22.415  12.086 -44.778  1.00 27.27  ? 149 ALA A HA     1 
ATOM   2195  H  HB1    . ALA A 1 169 ? 22.960  9.916  -45.459  1.00 23.19  ? 149 ALA A HB1    1 
ATOM   2196  H  HB2    . ALA A 1 169 ? 22.342  10.736 -46.672  1.00 23.19  ? 149 ALA A HB2    1 
ATOM   2197  H  HB3    . ALA A 1 169 ? 23.912  10.511 -46.583  1.00 23.19  ? 149 ALA A HB3    1 
ATOM   2198  N  N      . LEU A 1 170 ? 25.617  12.024 -44.708  1.00 21.78  ? 150 LEU A N      1 
ATOM   2199  C  CA     . LEU A 1 170 ? 26.757  11.956 -43.798  1.00 25.65  ? 150 LEU A CA     1 
ATOM   2200  C  C      . LEU A 1 170 ? 26.610  12.962 -42.660  1.00 23.28  ? 150 LEU A C      1 
ATOM   2201  O  O      . LEU A 1 170 ? 26.697  12.606 -41.474  1.00 21.78  ? 150 LEU A O      1 
ATOM   2202  C  CB     . LEU A 1 170 ? 28.049  12.209 -44.579  1.00 27.51  ? 150 LEU A CB     1 
ATOM   2203  C  CG     . LEU A 1 170 ? 29.365  12.156 -43.801  1.00 27.68  ? 150 LEU A CG     1 
ATOM   2204  C  CD1    . LEU A 1 170 ? 29.627  10.749 -43.283  1.00 28.61  ? 150 LEU A CD1    1 
ATOM   2205  C  CD2    . LEU A 1 170 ? 30.519  12.636 -44.668  1.00 26.43  ? 150 LEU A CD2    1 
ATOM   2206  H  H      . LEU A 1 170 ? 25.822  12.199 -45.525  1.00 26.26  ? 150 LEU A H      1 
ATOM   2207  H  HA     . LEU A 1 170 ? 26.806  11.067 -43.412  1.00 30.90  ? 150 LEU A HA     1 
ATOM   2208  H  HB2    . LEU A 1 170 ? 28.108  11.546 -45.284  1.00 33.13  ? 150 LEU A HB2    1 
ATOM   2209  H  HB3    . LEU A 1 170 ? 27.990  13.092 -44.977  1.00 33.13  ? 150 LEU A HB3    1 
ATOM   2210  H  HG     . LEU A 1 170 ? 29.302  12.748 -43.036  1.00 33.33  ? 150 LEU A HG     1 
ATOM   2211  H  HD11   . LEU A 1 170 ? 30.466  10.744 -42.795  1.00 34.45  ? 150 LEU A HD11   1 
ATOM   2212  H  HD12   . LEU A 1 170 ? 28.901  10.489 -42.695  1.00 34.45  ? 150 LEU A HD12   1 
ATOM   2213  H  HD13   . LEU A 1 170 ? 29.678  10.140 -44.035  1.00 34.45  ? 150 LEU A HD13   1 
ATOM   2214  H  HD21   . LEU A 1 170 ? 31.339  12.592 -44.153  1.00 31.84  ? 150 LEU A HD21   1 
ATOM   2215  H  HD22   . LEU A 1 170 ? 30.586  12.064 -45.448  1.00 31.84  ? 150 LEU A HD22   1 
ATOM   2216  H  HD23   . LEU A 1 170 ? 30.348  13.551 -44.941  1.00 31.84  ? 150 LEU A HD23   1 
ATOM   2217  N  N      . LEU A 1 171 ? 26.366  14.230 -43.006  1.00 18.27  ? 151 LEU A N      1 
ATOM   2218  C  CA     . LEU A 1 171 ? 26.192  15.250 -41.978  1.00 17.57  ? 151 LEU A CA     1 
ATOM   2219  C  C      . LEU A 1 171 ? 25.024  14.906 -41.059  1.00 18.41  ? 151 LEU A C      1 
ATOM   2220  O  O      . LEU A 1 171 ? 25.116  15.066 -39.833  1.00 18.39  ? 151 LEU A O      1 
ATOM   2221  C  CB     . LEU A 1 171 ? 25.987  16.616 -42.635  1.00 17.17  ? 151 LEU A CB     1 
ATOM   2222  C  CG     . LEU A 1 171 ? 27.140  17.098 -43.526  1.00 16.81  ? 151 LEU A CG     1 
ATOM   2223  C  CD1    . LEU A 1 171 ? 26.731  18.312 -44.350  1.00 17.93  ? 151 LEU A CD1    1 
ATOM   2224  C  CD2    . LEU A 1 171 ? 28.384  17.411 -42.707  1.00 16.98  ? 151 LEU A CD2    1 
ATOM   2225  H  H      . LEU A 1 171 ? 26.298  14.517 -43.814  1.00 22.04  ? 151 LEU A H      1 
ATOM   2226  H  HA     . LEU A 1 171 ? 26.997  15.295 -41.437  1.00 20.86  ? 151 LEU A HA     1 
ATOM   2227  H  HB2    . LEU A 1 171 ? 25.190  16.574 -43.187  1.00 20.01  ? 151 LEU A HB2    1 
ATOM   2228  H  HB3    . LEU A 1 171 ? 25.862  17.278 -41.936  1.00 20.01  ? 151 LEU A HB3    1 
ATOM   2229  H  HG     . LEU A 1 171 ? 27.368  16.387 -44.145  1.00 20.20  ? 151 LEU A HG     1 
ATOM   2230  H  HD11   . LEU A 1 171 ? 27.481  18.588 -44.899  1.00 21.63  ? 151 LEU A HD11   1 
ATOM   2231  H  HD12   . LEU A 1 171 ? 25.979  18.072 -44.914  1.00 21.63  ? 151 LEU A HD12   1 
ATOM   2232  H  HD13   . LEU A 1 171 ? 26.478  19.030 -43.750  1.00 21.63  ? 151 LEU A HD13   1 
ATOM   2233  H  HD21   . LEU A 1 171 ? 29.087  17.711 -43.304  1.00 19.79  ? 151 LEU A HD21   1 
ATOM   2234  H  HD22   . LEU A 1 171 ? 28.173  18.108 -42.067  1.00 19.79  ? 151 LEU A HD22   1 
ATOM   2235  H  HD23   . LEU A 1 171 ? 28.665  16.608 -42.241  1.00 19.79  ? 151 LEU A HD23   1 
ATOM   2236  N  N      . ARG A 1 172 ? 23.921  14.415 -41.634  1.00 20.95  ? 152 ARG A N      1 
ATOM   2237  C  CA     . ARG A 1 172 ? 22.770  14.021 -40.826  1.00 21.23  ? 152 ARG A CA     1 
ATOM   2238  C  C      . ARG A 1 172 ? 23.164  12.990 -39.775  1.00 21.63  ? 152 ARG A C      1 
ATOM   2239  O  O      . ARG A 1 172 ? 22.780  13.104 -38.605  1.00 19.75  ? 152 ARG A O      1 
ATOM   2240  C  CB     . ARG A 1 172 ? 21.661  13.468 -41.723  1.00 22.16  ? 152 ARG A CB     1 
ATOM   2241  C  CG     . ARG A 1 172 ? 20.380  13.101 -40.978  1.00 25.07  ? 152 ARG A CG     1 
ATOM   2242  C  CD     . ARG A 1 172 ? 19.361  12.468 -41.915  1.00 31.29  ? 152 ARG A CD     1 
ATOM   2243  N  NE     . ARG A 1 172 ? 18.127  12.085 -41.229  1.00 33.58  ? 152 ARG A NE     1 
ATOM   2244  C  CZ     . ARG A 1 172 ? 17.036  12.843 -41.143  1.00 33.36  ? 152 ARG A CZ     1 
ATOM   2245  N  NH1    . ARG A 1 172 ? 16.999  14.045 -41.700  1.00 34.21  ? 152 ARG A NH1    1 
ATOM   2246  N  NH2    . ARG A 1 172 ? 15.971  12.394 -40.495  1.00 34.89  ? 152 ARG A NH2    1 
ATOM   2247  H  H      . ARG A 1 172 ? 23.817  14.302 -42.480  1.00 25.26  ? 152 ARG A H      1 
ATOM   2248  H  HA     . ARG A 1 172 ? 22.424  14.802 -40.366  1.00 25.59  ? 152 ARG A HA     1 
ATOM   2249  H  HB2    . ARG A 1 172 ? 21.435  14.138 -42.387  1.00 26.71  ? 152 ARG A HB2    1 
ATOM   2250  H  HB3    . ARG A 1 172 ? 21.987  12.668 -42.163  1.00 26.71  ? 152 ARG A HB3    1 
ATOM   2251  H  HG2    . ARG A 1 172 ? 20.588  12.463 -40.278  1.00 30.20  ? 152 ARG A HG2    1 
ATOM   2252  H  HG3    . ARG A 1 172 ? 19.989  13.903 -40.599  1.00 30.20  ? 152 ARG A HG3    1 
ATOM   2253  H  HD2    . ARG A 1 172 ? 19.133  13.104 -42.611  1.00 37.67  ? 152 ARG A HD2    1 
ATOM   2254  H  HD3    . ARG A 1 172 ? 19.746  11.669 -42.308  1.00 37.67  ? 152 ARG A HD3    1 
ATOM   2255  H  HE     . ARG A 1 172 ? 18.105  11.312 -40.852  1.00 40.41  ? 152 ARG A HE     1 
ATOM   2256  H  HH11   . ARG A 1 172 ? 17.686  14.344 -42.122  1.00 41.17  ? 152 ARG A HH11   1 
ATOM   2257  H  HH12   . ARG A 1 172 ? 16.289  14.525 -41.638  1.00 41.17  ? 152 ARG A HH12   1 
ATOM   2258  H  HH21   . ARG A 1 172 ? 15.987  11.615 -40.131  1.00 41.99  ? 152 ARG A HH21   1 
ATOM   2259  H  HH22   . ARG A 1 172 ? 15.265  12.881 -40.438  1.00 41.99  ? 152 ARG A HH22   1 
ATOM   2260  N  N      . ALA A 1 173 ? 23.926  11.968 -40.173  1.00 24.61  ? 153 ALA A N      1 
ATOM   2261  C  CA     . ALA A 1 173 ? 24.360  10.961 -39.208  1.00 25.74  ? 153 ALA A CA     1 
ATOM   2262  C  C      . ALA A 1 173 ? 25.222  11.590 -38.118  1.00 31.65  ? 153 ALA A C      1 
ATOM   2263  O  O      . ALA A 1 173 ? 24.985  11.383 -36.915  1.00 34.74  ? 153 ALA A O      1 
ATOM   2264  C  CB     . ALA A 1 173 ? 25.120  9.843  -39.922  1.00 21.38  ? 153 ALA A CB     1 
ATOM   2265  H  H      . ALA A 1 173 ? 24.199  11.838 -40.978  1.00 29.65  ? 153 ALA A H      1 
ATOM   2266  H  HA     . ALA A 1 173 ? 23.579  10.571 -38.785  1.00 31.00  ? 153 ALA A HA     1 
ATOM   2267  H  HB1    . ALA A 1 173 ? 25.401  9.184  -39.268  1.00 25.78  ? 153 ALA A HB1    1 
ATOM   2268  H  HB2    . ALA A 1 173 ? 24.534  9.431  -40.576  1.00 25.78  ? 153 ALA A HB2    1 
ATOM   2269  H  HB3    . ALA A 1 173 ? 25.896  10.221 -40.364  1.00 25.78  ? 153 ALA A HB3    1 
ATOM   2270  N  N      . TYR A 1 174 ? 26.220  12.383 -38.522  1.00 29.54  ? 154 TYR A N      1 
ATOM   2271  C  CA     . TYR A 1 174 ? 27.079  13.034 -37.537  1.00 25.94  ? 154 TYR A CA     1 
ATOM   2272  C  C      . TYR A 1 174 ? 26.253  13.774 -36.493  1.00 26.43  ? 154 TYR A C      1 
ATOM   2273  O  O      . TYR A 1 174 ? 26.501  13.651 -35.289  1.00 27.41  ? 154 TYR A O      1 
ATOM   2274  C  CB     . TYR A 1 174 ? 28.056  13.992 -38.221  1.00 24.74  ? 154 TYR A CB     1 
ATOM   2275  C  CG     . TYR A 1 174 ? 29.387  13.363 -38.581  1.00 27.02  ? 154 TYR A CG     1 
ATOM   2276  C  CD1    . TYR A 1 174 ? 30.158  12.719 -37.619  1.00 27.47  ? 154 TYR A CD1    1 
ATOM   2277  C  CD2    . TYR A 1 174 ? 29.876  13.421 -39.879  1.00 27.41  ? 154 TYR A CD2    1 
ATOM   2278  C  CE1    . TYR A 1 174 ? 31.371  12.144 -37.942  1.00 25.31  ? 154 TYR A CE1    1 
ATOM   2279  C  CE2    . TYR A 1 174 ? 31.090  12.851 -40.211  1.00 25.80  ? 154 TYR A CE2    1 
ATOM   2280  C  CZ     . TYR A 1 174 ? 31.833  12.214 -39.240  1.00 23.16  ? 154 TYR A CZ     1 
ATOM   2281  O  OH     . TYR A 1 174 ? 33.042  11.646 -39.565  1.00 19.56  ? 154 TYR A OH     1 
ATOM   2282  H  H      . TYR A 1 174 ? 26.415  12.556 -39.341  1.00 35.56  ? 154 TYR A H      1 
ATOM   2283  H  HA     . TYR A 1 174 ? 27.599  12.356 -37.078  1.00 31.24  ? 154 TYR A HA     1 
ATOM   2284  H  HB2    . TYR A 1 174 ? 27.652  14.317 -39.040  1.00 29.81  ? 154 TYR A HB2    1 
ATOM   2285  H  HB3    . TYR A 1 174 ? 28.233  14.736 -37.625  1.00 29.81  ? 154 TYR A HB3    1 
ATOM   2286  H  HD1    . TYR A 1 174 ? 29.848  12.669 -36.743  1.00 33.08  ? 154 TYR A HD1    1 
ATOM   2287  H  HD2    . TYR A 1 174 ? 29.377  13.849 -40.537  1.00 33.02  ? 154 TYR A HD2    1 
ATOM   2288  H  HE1    . TYR A 1 174 ? 31.875  11.716 -37.289  1.00 30.49  ? 154 TYR A HE1    1 
ATOM   2289  H  HE2    . TYR A 1 174 ? 31.404  12.896 -41.085  1.00 31.08  ? 154 TYR A HE2    1 
ATOM   2290  H  HH     . TYR A 1 174 ? 33.387  11.295 -38.885  1.00 23.59  ? 154 TYR A HH     1 
ATOM   2291  N  N      . PHE A 1 175 ? 25.257  14.549 -36.934  1.00 28.53  ? 155 PHE A N      1 
ATOM   2292  C  CA     . PHE A 1 175 ? 24.459  15.301 -35.969  1.00 29.28  ? 155 PHE A CA     1 
ATOM   2293  C  C      . PHE A 1 175 ? 23.516  14.402 -35.180  1.00 29.68  ? 155 PHE A C      1 
ATOM   2294  O  O      . PHE A 1 175 ? 23.134  14.748 -34.056  1.00 28.80  ? 155 PHE A O      1 
ATOM   2295  C  CB     . PHE A 1 175 ? 23.672  16.407 -36.669  1.00 29.99  ? 155 PHE A CB     1 
ATOM   2296  C  CG     . PHE A 1 175 ? 24.497  17.616 -36.987  1.00 29.25  ? 155 PHE A CG     1 
ATOM   2297  C  CD1    . PHE A 1 175 ? 25.031  18.387 -35.968  1.00 28.91  ? 155 PHE A CD1    1 
ATOM   2298  C  CD2    . PHE A 1 175 ? 24.740  17.984 -38.300  1.00 28.72  ? 155 PHE A CD2    1 
ATOM   2299  C  CE1    . PHE A 1 175 ? 25.795  19.497 -36.249  1.00 30.88  ? 155 PHE A CE1    1 
ATOM   2300  C  CE2    . PHE A 1 175 ? 25.504  19.096 -38.589  1.00 29.68  ? 155 PHE A CE2    1 
ATOM   2301  C  CZ     . PHE A 1 175 ? 26.032  19.855 -37.562  1.00 31.63  ? 155 PHE A CZ     1 
ATOM   2302  H  H      . PHE A 1 175 ? 25.031  14.653 -37.757  1.00 34.36  ? 155 PHE A H      1 
ATOM   2303  H  HA     . PHE A 1 175 ? 25.059  15.724 -35.336  1.00 35.26  ? 155 PHE A HA     1 
ATOM   2304  H  HB2    . PHE A 1 175 ? 23.318  16.060 -37.503  1.00 36.11  ? 155 PHE A HB2    1 
ATOM   2305  H  HB3    . PHE A 1 175 ? 22.944  16.687 -36.092  1.00 36.11  ? 155 PHE A HB3    1 
ATOM   2306  H  HD1    . PHE A 1 175 ? 24.876  18.149 -35.083  1.00 34.81  ? 155 PHE A HD1    1 
ATOM   2307  H  HD2    . PHE A 1 175 ? 24.388  17.475 -38.994  1.00 34.58  ? 155 PHE A HD2    1 
ATOM   2308  H  HE1    . PHE A 1 175 ? 26.149  20.007 -35.557  1.00 37.18  ? 155 PHE A HE1    1 
ATOM   2309  H  HE2    . PHE A 1 175 ? 25.662  19.335 -39.473  1.00 35.74  ? 155 PHE A HE2    1 
ATOM   2310  H  HZ     . PHE A 1 175 ? 26.545  20.606 -37.755  1.00 38.08  ? 155 PHE A HZ     1 
ATOM   2311  N  N      . GLU A 1 176 ? 23.123  13.255 -35.735  1.00 33.47  ? 156 GLU A N      1 
ATOM   2312  C  CA     . GLU A 1 176 ? 22.332  12.315 -34.949  1.00 36.88  ? 156 GLU A CA     1 
ATOM   2313  C  C      . GLU A 1 176 ? 23.143  11.725 -33.806  1.00 39.14  ? 156 GLU A C      1 
ATOM   2314  O  O      . GLU A 1 176 ? 22.568  11.312 -32.793  1.00 37.54  ? 156 GLU A O      1 
ATOM   2315  C  CB     . GLU A 1 176 ? 21.773  11.198 -35.830  1.00 38.46  ? 156 GLU A CB     1 
ATOM   2316  C  CG     . GLU A 1 176 ? 20.514  11.590 -36.585  1.00 42.88  ? 156 GLU A CG     1 
ATOM   2317  C  CD     . GLU A 1 176 ? 19.956  10.461 -37.426  1.00 47.37  ? 156 GLU A CD     1 
ATOM   2318  O  OE1    . GLU A 1 176 ? 20.755  9.672  -37.972  1.00 50.05  ? 156 GLU A OE1    1 
ATOM   2319  O  OE2    . GLU A 1 176 ? 18.716  10.357 -37.532  1.00 49.32  ? 156 GLU A OE2    1 
ATOM   2320  H  H      . GLU A 1 176 ? 23.296  13.005 -36.540  1.00 40.28  ? 156 GLU A H      1 
ATOM   2321  H  HA     . GLU A 1 176 ? 21.579  12.790 -34.562  1.00 44.37  ? 156 GLU A HA     1 
ATOM   2322  H  HB2    . GLU A 1 176 ? 22.445  10.947 -36.483  1.00 46.27  ? 156 GLU A HB2    1 
ATOM   2323  H  HB3    . GLU A 1 176 ? 21.558  10.435 -35.270  1.00 46.27  ? 156 GLU A HB3    1 
ATOM   2324  H  HG2    . GLU A 1 176 ? 19.833  11.854 -35.947  1.00 51.57  ? 156 GLU A HG2    1 
ATOM   2325  H  HG3    . GLU A 1 176 ? 20.719  12.332 -37.176  1.00 51.57  ? 156 GLU A HG3    1 
ATOM   2326  N  N      . GLN A 1 177 ? 24.472  11.669 -33.943  1.00 42.91  ? 157 GLN A N      1 
ATOM   2327  C  CA     . GLN A 1 177 ? 25.291  11.217 -32.818  1.00 43.82  ? 157 GLN A CA     1 
ATOM   2328  C  C      . GLN A 1 177 ? 25.107  12.109 -31.591  1.00 44.26  ? 157 GLN A C      1 
ATOM   2329  O  O      . GLN A 1 177 ? 25.139  11.623 -30.454  1.00 44.41  ? 157 GLN A O      1 
ATOM   2330  C  CB     . GLN A 1 177 ? 26.768  11.177 -33.212  1.00 41.99  ? 157 GLN A CB     1 
ATOM   2331  C  CG     . GLN A 1 177 ? 27.141  10.056 -34.161  1.00 40.32  ? 157 GLN A CG     1 
ATOM   2332  C  CD     . GLN A 1 177 ? 28.635  9.983  -34.398  1.00 39.65  ? 157 GLN A CD     1 
ATOM   2333  O  OE1    . GLN A 1 177 ? 29.422  10.543 -33.636  1.00 35.27  ? 157 GLN A OE1    1 
ATOM   2334  N  NE2    . GLN A 1 177 ? 29.035  9.297  -35.462  1.00 44.93  ? 157 GLN A NE2    1 
ATOM   2335  H  H      . GLN A 1 177 ? 24.910  11.880 -34.653  1.00 51.61  ? 157 GLN A H      1 
ATOM   2336  H  HA     . GLN A 1 177 ? 25.022  10.317 -32.576  1.00 52.70  ? 157 GLN A HA     1 
ATOM   2337  H  HB2    . GLN A 1 177 ? 26.996  12.015 -33.644  1.00 50.51  ? 157 GLN A HB2    1 
ATOM   2338  H  HB3    . GLN A 1 177 ? 27.299  11.070 -32.407  1.00 50.51  ? 157 GLN A HB3    1 
ATOM   2339  H  HG2    . GLN A 1 177 ? 26.854  9.210  -33.783  1.00 48.51  ? 157 GLN A HG2    1 
ATOM   2340  H  HG3    . GLN A 1 177 ? 26.707  10.205 -35.015  1.00 48.51  ? 157 GLN A HG3    1 
ATOM   2341  H  HE21   . GLN A 1 177 ? 28.455  8.923  -35.975  1.00 54.03  ? 157 GLN A HE21   1 
ATOM   2342  H  HE22   . GLN A 1 177 ? 29.873  9.227  -35.638  1.00 54.03  ? 157 GLN A HE22   1 
ATOM   2343  N  N      . ASN A 1 178 ? 24.908  13.411 -31.794  1.00 43.98  ? 158 ASN A N      1 
ATOM   2344  C  CA     . ASN A 1 178 ? 24.862  14.376 -30.692  1.00 44.24  ? 158 ASN A CA     1 
ATOM   2345  C  C      . ASN A 1 178 ? 23.890  15.492 -31.055  1.00 38.21  ? 158 ASN A C      1 
ATOM   2346  O  O      . ASN A 1 178 ? 24.289  16.563 -31.528  1.00 38.40  ? 158 ASN A O      1 
ATOM   2347  C  CB     . ASN A 1 178 ? 26.255  14.935 -30.398  1.00 48.07  ? 158 ASN A CB     1 
ATOM   2348  C  CG     . ASN A 1 178 ? 26.367  15.531 -29.006  1.00 51.51  ? 158 ASN A CG     1 
ATOM   2349  O  OD1    . ASN A 1 178 ? 25.377  15.963 -28.419  1.00 51.90  ? 158 ASN A OD1    1 
ATOM   2350  N  ND2    . ASN A 1 178 ? 27.584  15.557 -28.473  1.00 52.35  ? 158 ASN A ND2    1 
ATOM   2351  H  H      . ASN A 1 178 ? 24.797  13.766 -32.569  1.00 52.90  ? 158 ASN A H      1 
ATOM   2352  H  HA     . ASN A 1 178 ? 24.535  13.935 -29.892  1.00 53.20  ? 158 ASN A HA     1 
ATOM   2353  H  HB2    . ASN A 1 178 ? 26.905  14.219 -30.471  1.00 57.80  ? 158 ASN A HB2    1 
ATOM   2354  H  HB3    . ASN A 1 178 ? 26.457  15.634 -31.040  1.00 57.80  ? 158 ASN A HB3    1 
ATOM   2355  H  HD21   . ASN A 1 178 ? 27.702  15.884 -27.686  1.00 62.94  ? 158 ASN A HD21   1 
ATOM   2356  H  HD22   . ASN A 1 178 ? 28.254  15.246 -28.914  1.00 62.94  ? 158 ASN A HD22   1 
ATOM   2357  N  N      . PRO A 1 179 ? 22.594  15.277 -30.832  1.00 29.10  ? 159 PRO A N      1 
ATOM   2358  C  CA     . PRO A 1 179 ? 21.568  16.189 -31.377  1.00 25.43  ? 159 PRO A CA     1 
ATOM   2359  C  C      . PRO A 1 179 ? 21.775  17.633 -30.951  1.00 27.23  ? 159 PRO A C      1 
ATOM   2360  O  O      . PRO A 1 179 ? 21.711  18.538 -31.797  1.00 26.66  ? 159 PRO A O      1 
ATOM   2361  C  CB     . PRO A 1 179 ? 20.255  15.622 -30.819  1.00 24.29  ? 159 PRO A CB     1 
ATOM   2362  C  CG     . PRO A 1 179 ? 20.551  14.182 -30.548  1.00 24.02  ? 159 PRO A CG     1 
ATOM   2363  C  CD     . PRO A 1 179 ? 21.994  14.117 -30.149  1.00 23.69  ? 159 PRO A CD     1 
ATOM   2364  H  HA     . PRO A 1 179 ? 21.553  16.139 -32.346  1.00 30.64  ? 159 PRO A HA     1 
ATOM   2365  H  HB2    . PRO A 1 179 ? 20.018  16.085 -30.000  1.00 29.27  ? 159 PRO A HB2    1 
ATOM   2366  H  HB3    . PRO A 1 179 ? 19.551  15.710 -31.481  1.00 29.27  ? 159 PRO A HB3    1 
ATOM   2367  H  HG2    . PRO A 1 179 ? 19.984  13.865 -29.828  1.00 28.51  ? 159 PRO A HG2    1 
ATOM   2368  H  HG3    . PRO A 1 179 ? 20.398  13.664 -31.354  1.00 28.51  ? 159 PRO A HG3    1 
ATOM   2369  H  HD2    . PRO A 1 179 ? 22.082  14.209 -29.187  1.00 28.12  ? 159 PRO A HD2    1 
ATOM   2370  H  HD3    . PRO A 1 179 ? 22.395  13.293 -30.466  1.00 28.12  ? 159 PRO A HD3    1 
ATOM   2371  N  N      . PRO A 1 180 ? 22.009  17.908 -29.663  1.00 32.19  ? 160 PRO A N      1 
ATOM   2372  C  CA     . PRO A 1 180 ? 22.087  19.319 -29.237  1.00 32.07  ? 160 PRO A CA     1 
ATOM   2373  C  C      . PRO A 1 180 ? 23.090  20.149 -30.023  1.00 28.02  ? 160 PRO A C      1 
ATOM   2374  O  O      . PRO A 1 180 ? 22.862  21.350 -30.233  1.00 23.00  ? 160 PRO A O      1 
ATOM   2375  C  CB     . PRO A 1 180 ? 22.483  19.213 -27.757  1.00 31.75  ? 160 PRO A CB     1 
ATOM   2376  C  CG     . PRO A 1 180 ? 21.997  17.880 -27.329  1.00 31.37  ? 160 PRO A CG     1 
ATOM   2377  C  CD     . PRO A 1 180 ? 22.171  16.987 -28.523  1.00 34.49  ? 160 PRO A CD     1 
ATOM   2378  H  HA     . PRO A 1 180 ? 21.213  19.735 -29.302  1.00 38.61  ? 160 PRO A HA     1 
ATOM   2379  H  HB2    . PRO A 1 180 ? 23.447  19.272 -27.670  1.00 38.22  ? 160 PRO A HB2    1 
ATOM   2380  H  HB3    . PRO A 1 180 ? 22.047  19.917 -27.250  1.00 38.22  ? 160 PRO A HB3    1 
ATOM   2381  H  HG2    . PRO A 1 180 ? 22.530  17.562 -26.584  1.00 37.77  ? 160 PRO A HG2    1 
ATOM   2382  H  HG3    . PRO A 1 180 ? 21.061  17.938 -27.080  1.00 37.77  ? 160 PRO A HG3    1 
ATOM   2383  H  HD2    . PRO A 1 180 ? 23.059  16.597 -28.527  1.00 41.51  ? 160 PRO A HD2    1 
ATOM   2384  H  HD3    . PRO A 1 180 ? 21.482  16.305 -28.539  1.00 41.51  ? 160 PRO A HD3    1 
ATOM   2385  N  N      . CYS A 1 181 ? 24.184  19.541 -30.492  1.00 31.03  ? 161 CYS A N      1 
ATOM   2386  C  CA     . CYS A 1 181 ? 25.186  20.291 -31.241  1.00 34.81  ? 161 CYS A CA     1 
ATOM   2387  C  C      . CYS A 1 181 ? 24.574  21.043 -32.414  1.00 36.91  ? 161 CYS A C      1 
ATOM   2388  O  O      . CYS A 1 181 ? 25.109  22.077 -32.836  1.00 38.09  ? 161 CYS A O      1 
ATOM   2389  C  CB     . CYS A 1 181 ? 26.285  19.347 -31.731  1.00 34.92  ? 161 CYS A CB     1 
ATOM   2390  S  SG     . CYS A 1 181 ? 27.408  18.785 -30.421  1.00 33.56  ? 161 CYS A SG     1 
ATOM   2391  H  H      . CYS A 1 181 ? 24.364  18.706 -30.389  1.00 37.35  ? 161 CYS A H      1 
ATOM   2392  H  HA     . CYS A 1 181 ? 25.596  20.943 -30.651  1.00 41.89  ? 161 CYS A HA     1 
ATOM   2393  H  HB2    . CYS A 1 181 ? 25.871  18.562 -32.123  1.00 42.03  ? 161 CYS A HB2    1 
ATOM   2394  H  HB3    . CYS A 1 181 ? 26.816  19.806 -32.400  1.00 42.03  ? 161 CYS A HB3    1 
ATOM   2395  H  HG     . CYS A 1 181 ? 28.231  18.053 -30.898  1.00 40.39  ? 161 CYS A HG     1 
ATOM   2396  N  N      . ARG A 1 182 ? 23.450  20.554 -32.946  1.00 35.90  ? 162 ARG A N      1 
ATOM   2397  C  CA     . ARG A 1 182 ? 22.762  21.262 -34.021  1.00 34.48  ? 162 ARG A CA     1 
ATOM   2398  C  C      . ARG A 1 182 ? 22.681  22.755 -33.728  1.00 34.43  ? 162 ARG A C      1 
ATOM   2399  O  O      . ARG A 1 182 ? 23.036  23.586 -34.572  1.00 31.55  ? 162 ARG A O      1 
ATOM   2400  C  CB     . ARG A 1 182 ? 21.360  20.680 -34.227  1.00 31.90  ? 162 ARG A CB     1 
ATOM   2401  C  CG     . ARG A 1 182 ? 21.332  19.364 -34.993  1.00 31.93  ? 162 ARG A CG     1 
ATOM   2402  C  CD     . ARG A 1 182 ? 19.918  18.810 -35.111  1.00 32.17  ? 162 ARG A CD     1 
ATOM   2403  N  NE     . ARG A 1 182 ? 19.364  18.445 -33.810  1.00 34.60  ? 162 ARG A NE     1 
ATOM   2404  C  CZ     . ARG A 1 182 ? 18.128  17.997 -33.616  1.00 34.21  ? 162 ARG A CZ     1 
ATOM   2405  N  NH1    . ARG A 1 182 ? 17.294  17.854 -34.639  1.00 32.72  ? 162 ARG A NH1    1 
ATOM   2406  N  NH2    . ARG A 1 182 ? 17.722  17.693 -32.390  1.00 34.41  ? 162 ARG A NH2    1 
ATOM   2407  H  H      . ARG A 1 182 ? 23.070  19.822 -32.703  1.00 43.20  ? 162 ARG A H      1 
ATOM   2408  H  HA     . ARG A 1 182 ? 23.260  21.145 -34.845  1.00 41.49  ? 162 ARG A HA     1 
ATOM   2409  H  HB2    . ARG A 1 182 ? 20.958  20.523 -33.358  1.00 38.40  ? 162 ARG A HB2    1 
ATOM   2410  H  HB3    . ARG A 1 182 ? 20.827  21.321 -34.723  1.00 38.40  ? 162 ARG A HB3    1 
ATOM   2411  H  HG2    . ARG A 1 182 ? 21.678  19.508 -35.888  1.00 38.44  ? 162 ARG A HG2    1 
ATOM   2412  H  HG3    . ARG A 1 182 ? 21.875  18.710 -34.525  1.00 38.44  ? 162 ARG A HG3    1 
ATOM   2413  H  HD2    . ARG A 1 182 ? 19.344  19.485 -35.506  1.00 38.72  ? 162 ARG A HD2    1 
ATOM   2414  H  HD3    . ARG A 1 182 ? 19.932  18.016 -35.668  1.00 38.72  ? 162 ARG A HD3    1 
ATOM   2415  H  HE     . ARG A 1 182 ? 19.873  18.526 -33.122  1.00 41.64  ? 162 ARG A HE     1 
ATOM   2416  H  HH11   . ARG A 1 182 ? 17.552  18.050 -35.435  1.00 39.38  ? 162 ARG A HH11   1 
ATOM   2417  H  HH12   . ARG A 1 182 ? 16.495  17.564 -34.505  1.00 39.38  ? 162 ARG A HH12   1 
ATOM   2418  H  HH21   . ARG A 1 182 ? 18.259  17.785 -31.724  1.00 41.41  ? 162 ARG A HH21   1 
ATOM   2419  H  HH22   . ARG A 1 182 ? 16.923  17.403 -32.261  1.00 41.41  ? 162 ARG A HH22   1 
ATOM   2420  N  N      . TRP A 1 183 ? 22.250  23.109 -32.513  1.00 36.49  ? 163 TRP A N      1 
ATOM   2421  C  CA     . TRP A 1 183 ? 22.134  24.513 -32.139  1.00 39.38  ? 163 TRP A CA     1 
ATOM   2422  C  C      . TRP A 1 183 ? 23.366  25.293 -32.584  1.00 41.16  ? 163 TRP A C      1 
ATOM   2423  O  O      . TRP A 1 183 ? 23.266  26.251 -33.363  1.00 42.66  ? 163 TRP A O      1 
ATOM   2424  C  CB     . TRP A 1 183 ? 21.926  24.643 -30.626  1.00 38.33  ? 163 TRP A CB     1 
ATOM   2425  C  CG     . TRP A 1 183 ? 20.530  24.316 -30.180  1.00 37.76  ? 163 TRP A CG     1 
ATOM   2426  C  CD1    . TRP A 1 183 ? 20.150  23.290 -29.362  1.00 38.40  ? 163 TRP A CD1    1 
ATOM   2427  C  CD2    . TRP A 1 183 ? 19.328  25.016 -30.528  1.00 36.08  ? 163 TRP A CD2    1 
ATOM   2428  N  NE1    . TRP A 1 183 ? 18.789  23.309 -29.179  1.00 37.42  ? 163 TRP A NE1    1 
ATOM   2429  C  CE2    . TRP A 1 183 ? 18.260  24.358 -29.884  1.00 36.96  ? 163 TRP A CE2    1 
ATOM   2430  C  CE3    . TRP A 1 183 ? 19.051  26.133 -31.322  1.00 33.48  ? 163 TRP A CE3    1 
ATOM   2431  C  CZ2    . TRP A 1 183 ? 16.938  24.780 -30.010  1.00 35.88  ? 163 TRP A CZ2    1 
ATOM   2432  C  CZ3    . TRP A 1 183 ? 17.736  26.551 -31.445  1.00 32.93  ? 163 TRP A CZ3    1 
ATOM   2433  C  CH2    . TRP A 1 183 ? 16.697  25.875 -30.793  1.00 34.57  ? 163 TRP A CH2    1 
ATOM   2434  H  H      . TRP A 1 183 ? 22.022  22.557 -31.894  1.00 43.91  ? 163 TRP A H      1 
ATOM   2435  H  HA     . TRP A 1 183 ? 21.360  24.896 -32.582  1.00 47.37  ? 163 TRP A HA     1 
ATOM   2436  H  HB2    . TRP A 1 183 ? 22.533  24.035 -30.174  1.00 46.11  ? 163 TRP A HB2    1 
ATOM   2437  H  HB3    . TRP A 1 183 ? 22.117  25.556 -30.361  1.00 46.11  ? 163 TRP A HB3    1 
ATOM   2438  H  HD1    . TRP A 1 183 ? 20.730  22.670 -28.982  1.00 46.20  ? 163 TRP A HD1    1 
ATOM   2439  H  HE1    . TRP A 1 183 ? 18.341  22.752 -28.700  1.00 45.02  ? 163 TRP A HE1    1 
ATOM   2440  H  HE3    . TRP A 1 183 ? 19.735  26.587 -31.759  1.00 40.29  ? 163 TRP A HE3    1 
ATOM   2441  H  HZ2    . TRP A 1 183 ? 16.246  24.334 -29.578  1.00 43.17  ? 163 TRP A HZ2    1 
ATOM   2442  H  HZ3    . TRP A 1 183 ? 17.540  27.293 -31.970  1.00 39.64  ? 163 TRP A HZ3    1 
ATOM   2443  H  HH2    . TRP A 1 183 ? 15.824  26.179 -30.893  1.00 41.61  ? 163 TRP A HH2    1 
ATOM   2444  N  N      . LEU A 1 184 ? 24.545  24.863 -32.124  1.00 40.48  ? 164 LEU A N      1 
ATOM   2445  C  CA     . LEU A 1 184 ? 25.791  25.510 -32.514  1.00 37.45  ? 164 LEU A CA     1 
ATOM   2446  C  C      . LEU A 1 184 ? 25.801  25.801 -34.008  1.00 37.60  ? 164 LEU A C      1 
ATOM   2447  O  O      . LEU A 1 184 ? 25.825  26.964 -34.432  1.00 41.17  ? 164 LEU A O      1 
ATOM   2448  C  CB     . LEU A 1 184 ? 26.983  24.628 -32.127  1.00 36.02  ? 164 LEU A CB     1 
ATOM   2449  C  CG     . LEU A 1 184 ? 28.369  25.111 -32.574  1.00 34.71  ? 164 LEU A CG     1 
ATOM   2450  C  CD1    . LEU A 1 184 ? 28.677  26.498 -32.028  1.00 34.24  ? 164 LEU A CD1    1 
ATOM   2451  C  CD2    . LEU A 1 184 ? 29.445  24.118 -32.149  1.00 32.15  ? 164 LEU A CD2    1 
ATOM   2452  H  H      . LEU A 1 184 ? 24.645  24.200 -31.585  1.00 48.69  ? 164 LEU A H      1 
ATOM   2453  H  HA     . LEU A 1 184 ? 25.873  26.353 -32.042  1.00 45.06  ? 164 LEU A HA     1 
ATOM   2454  H  HB2    . LEU A 1 184 ? 27.003  24.554 -31.160  1.00 43.34  ? 164 LEU A HB2    1 
ATOM   2455  H  HB3    . LEU A 1 184 ? 26.847  23.749 -32.513  1.00 43.34  ? 164 LEU A HB3    1 
ATOM   2456  H  HG     . LEU A 1 184 ? 28.382  25.165 -33.543  1.00 41.78  ? 164 LEU A HG     1 
ATOM   2457  H  HD11   . LEU A 1 184 ? 29.558  26.768 -32.331  1.00 41.21  ? 164 LEU A HD11   1 
ATOM   2458  H  HD12   . LEU A 1 184 ? 28.009  27.121 -32.355  1.00 41.21  ? 164 LEU A HD12   1 
ATOM   2459  H  HD13   . LEU A 1 184 ? 28.655  26.467 -31.059  1.00 41.21  ? 164 LEU A HD13   1 
ATOM   2460  H  HD21   . LEU A 1 184 ? 30.310  24.446 -32.443  1.00 38.70  ? 164 LEU A HD21   1 
ATOM   2461  H  HD22   . LEU A 1 184 ? 29.433  24.035 -31.183  1.00 38.70  ? 164 LEU A HD22   1 
ATOM   2462  H  HD23   . LEU A 1 184 ? 29.260  23.259 -32.558  1.00 38.70  ? 164 LEU A HD23   1 
ATOM   2463  N  N      . SER A 1 185 ? 25.740  24.741 -34.817  1.00 31.60  ? 165 SER A N      1 
ATOM   2464  C  CA     . SER A 1 185 ? 25.756  24.909 -36.264  1.00 29.89  ? 165 SER A CA     1 
ATOM   2465  C  C      . SER A 1 185 ? 24.789  26.007 -36.685  1.00 29.87  ? 165 SER A C      1 
ATOM   2466  O  O      . SER A 1 185 ? 25.186  26.990 -37.325  1.00 28.26  ? 165 SER A O      1 
ATOM   2467  C  CB     . SER A 1 185 ? 25.413  23.582 -36.945  1.00 31.95  ? 165 SER A CB     1 
ATOM   2468  O  OG     . SER A 1 185 ? 25.542  23.675 -38.354  1.00 32.38  ? 165 SER A OG     1 
ATOM   2469  H  H      . SER A 1 185 ? 25.690  23.924 -34.553  1.00 38.04  ? 165 SER A H      1 
ATOM   2470  H  HA     . SER A 1 185 ? 26.648  25.169 -36.544  1.00 35.99  ? 165 SER A HA     1 
ATOM   2471  H  HB2    . SER A 1 185 ? 26.018  22.897 -36.619  1.00 38.46  ? 165 SER A HB2    1 
ATOM   2472  H  HB3    . SER A 1 185 ? 24.498  23.345 -36.728  1.00 38.46  ? 165 SER A HB3    1 
ATOM   2473  H  HG     . SER A 1 185 ? 25.350  22.938 -38.709  1.00 38.97  ? 165 SER A HG     1 
ATOM   2474  N  N      . MET A 1 186 ? 23.521  25.881 -36.286  1.00 35.60  ? 166 MET A N      1 
ATOM   2475  C  CA     . MET A 1 186 ? 22.520  26.875 -36.659  1.00 41.25  ? 166 MET A CA     1 
ATOM   2476  C  C      . MET A 1 186 ? 23.047  28.283 -36.424  1.00 40.78  ? 166 MET A C      1 
ATOM   2477  O  O      . MET A 1 186 ? 23.123  29.098 -37.352  1.00 41.55  ? 166 MET A O      1 
ATOM   2478  C  CB     . MET A 1 186 ? 21.228  26.648 -35.870  1.00 45.07  ? 166 MET A CB     1 
ATOM   2479  C  CG     . MET A 1 186 ? 20.456  25.409 -36.283  1.00 46.65  ? 166 MET A CG     1 
ATOM   2480  S  SD     . MET A 1 186 ? 18.975  25.142 -35.287  1.00 46.24  ? 166 MET A SD     1 
ATOM   2481  C  CE     . MET A 1 186 ? 18.115  23.932 -36.288  1.00 45.32  ? 166 MET A CE     1 
ATOM   2482  H  H      . MET A 1 186 ? 23.220  25.235 -35.804  1.00 42.84  ? 166 MET A H      1 
ATOM   2483  H  HA     . MET A 1 186 ? 22.314  26.772 -37.601  1.00 49.62  ? 166 MET A HA     1 
ATOM   2484  H  HB2    . MET A 1 186 ? 21.449  26.559 -34.930  1.00 54.21  ? 166 MET A HB2    1 
ATOM   2485  H  HB3    . MET A 1 186 ? 20.647  27.414 -35.998  1.00 54.21  ? 166 MET A HB3    1 
ATOM   2486  H  HG2    . MET A 1 186 ? 20.181  25.501 -37.209  1.00 56.09  ? 166 MET A HG2    1 
ATOM   2487  H  HG3    . MET A 1 186 ? 21.028  24.632 -36.183  1.00 56.09  ? 166 MET A HG3    1 
ATOM   2488  H  HE1    . MET A 1 186 ? 17.281  23.698 -35.852  1.00 54.50  ? 166 MET A HE1    1 
ATOM   2489  H  HE2    . MET A 1 186 ? 17.936  24.315 -37.161  1.00 54.50  ? 166 MET A HE2    1 
ATOM   2490  H  HE3    . MET A 1 186 ? 18.673  23.144 -36.380  1.00 54.50  ? 166 MET A HE3    1 
ATOM   2491  N  N      . SER A 1 187 ? 23.462  28.567 -35.188  1.00 40.58  ? 167 SER A N      1 
ATOM   2492  C  CA     . SER A 1 187 ? 23.977  29.891 -34.864  1.00 43.78  ? 167 SER A CA     1 
ATOM   2493  C  C      . SER A 1 187 ? 24.972  30.349 -35.921  1.00 41.78  ? 167 SER A C      1 
ATOM   2494  O  O      . SER A 1 187 ? 24.768  31.371 -36.589  1.00 45.17  ? 167 SER A O      1 
ATOM   2495  C  CB     . SER A 1 187 ? 24.620  29.877 -33.475  1.00 46.09  ? 167 SER A CB     1 
ATOM   2496  O  OG     . SER A 1 187 ? 23.675  29.515 -32.482  1.00 45.13  ? 167 SER A OG     1 
ATOM   2497  H  H      . SER A 1 187 ? 23.455  28.015 -34.528  1.00 48.81  ? 167 SER A H      1 
ATOM   2498  H  HA     . SER A 1 187 ? 23.241  30.523 -34.849  1.00 52.65  ? 167 SER A HA     1 
ATOM   2499  H  HB2    . SER A 1 187 ? 25.345  29.233 -33.470  1.00 55.43  ? 167 SER A HB2    1 
ATOM   2500  H  HB3    . SER A 1 187 ? 24.962  30.763 -33.277  1.00 55.43  ? 167 SER A HB3    1 
ATOM   2501  H  HG     . SER A 1 187 ? 24.041  29.511 -31.725  1.00 54.27  ? 167 SER A HG     1 
ATOM   2502  N  N      . ILE A 1 188 ? 26.033  29.565 -36.122  1.00 37.62  ? 168 ILE A N      1 
ATOM   2503  C  CA     . ILE A 1 188 ? 27.077  29.960 -37.063  1.00 33.33  ? 168 ILE A CA     1 
ATOM   2504  C  C      . ILE A 1 188 ? 26.454  30.358 -38.392  1.00 28.36  ? 168 ILE A C      1 
ATOM   2505  O  O      . ILE A 1 188 ? 26.700  31.454 -38.913  1.00 30.99  ? 168 ILE A O      1 
ATOM   2506  C  CB     . ILE A 1 188 ? 28.105  28.826 -37.235  1.00 33.15  ? 168 ILE A CB     1 
ATOM   2507  C  CG1    . ILE A 1 188 ? 28.720  28.438 -35.884  1.00 32.98  ? 168 ILE A CG1    1 
ATOM   2508  C  CG2    . ILE A 1 188 ? 29.197  29.233 -38.222  1.00 32.45  ? 168 ILE A CG2    1 
ATOM   2509  C  CD1    . ILE A 1 188 ? 29.454  29.565 -35.176  1.00 30.05  ? 168 ILE A CD1    1 
ATOM   2510  H  H      . ILE A 1 188 ? 26.169  28.810 -35.731  1.00 45.26  ? 168 ILE A H      1 
ATOM   2511  H  HA     . ILE A 1 188 ? 27.544  30.734 -36.708  1.00 40.11  ? 168 ILE A HA     1 
ATOM   2512  H  HB     . ILE A 1 188 ? 27.645  28.051 -37.594  1.00 39.90  ? 168 ILE A HB     1 
ATOM   2513  H  HG12   . ILE A 1 188 ? 28.010  28.135 -35.297  1.00 39.69  ? 168 ILE A HG12   1 
ATOM   2514  H  HG13   . ILE A 1 188 ? 29.355  27.719 -36.028  1.00 39.69  ? 168 ILE A HG13   1 
ATOM   2515  H  HG21   . ILE A 1 188 ? 29.829  28.503 -38.312  1.00 39.05  ? 168 ILE A HG21   1 
ATOM   2516  H  HG22   . ILE A 1 188 ? 28.790  29.427 -39.081  1.00 39.05  ? 168 ILE A HG22   1 
ATOM   2517  H  HG23   . ILE A 1 188 ? 29.649  30.022 -37.884  1.00 39.05  ? 168 ILE A HG23   1 
ATOM   2518  H  HD11   . ILE A 1 188 ? 29.808  29.232 -34.336  1.00 36.18  ? 168 ILE A HD11   1 
ATOM   2519  H  HD12   . ILE A 1 188 ? 30.179  29.874 -35.741  1.00 36.18  ? 168 ILE A HD12   1 
ATOM   2520  H  HD13   . ILE A 1 188 ? 28.832  30.291 -35.008  1.00 36.18  ? 168 ILE A HD13   1 
ATOM   2521  N  N      . LYS A 1 189 ? 25.595  29.492 -38.937  1.00 19.92  ? 169 LYS A N      1 
ATOM   2522  C  CA     . LYS A 1 189 ? 24.989  29.783 -40.230  1.00 19.56  ? 169 LYS A CA     1 
ATOM   2523  C  C      . LYS A 1 189 ? 24.368  31.173 -40.220  1.00 20.20  ? 169 LYS A C      1 
ATOM   2524  O  O      . LYS A 1 189 ? 24.710  32.028 -41.045  1.00 20.19  ? 169 LYS A O      1 
ATOM   2525  C  CB     . LYS A 1 189 ? 23.942  28.726 -40.579  1.00 21.85  ? 169 LYS A CB     1 
ATOM   2526  C  CG     . LYS A 1 189 ? 23.432  28.817 -42.011  1.00 27.18  ? 169 LYS A CG     1 
ATOM   2527  C  CD     . LYS A 1 189 ? 22.031  28.250 -42.152  1.00 33.48  ? 169 LYS A CD     1 
ATOM   2528  C  CE     . LYS A 1 189 ? 22.031  26.735 -42.112  1.00 38.63  ? 169 LYS A CE     1 
ATOM   2529  N  NZ     . LYS A 1 189 ? 20.669  26.188 -42.349  1.00 42.54  ? 169 LYS A NZ     1 
ATOM   2530  H  H      . LYS A 1 189 ? 25.354  28.745 -38.584  1.00 23.31  ? 169 LYS A H      1 
ATOM   2531  H  HA     . LYS A 1 189 ? 25.676  29.765 -40.915  1.00 22.88  ? 169 LYS A HA     1 
ATOM   2532  H  HB2    . LYS A 1 189 ? 24.333  27.846 -40.458  1.00 26.34  ? 169 LYS A HB2    1 
ATOM   2533  H  HB3    . LYS A 1 189 ? 23.181  28.832 -39.986  1.00 26.34  ? 169 LYS A HB3    1 
ATOM   2534  H  HG2    . LYS A 1 189 ? 23.411  29.748 -42.283  1.00 32.74  ? 169 LYS A HG2    1 
ATOM   2535  H  HG3    . LYS A 1 189 ? 24.023  28.313 -42.592  1.00 32.74  ? 169 LYS A HG3    1 
ATOM   2536  H  HD2    . LYS A 1 189 ? 21.481  28.572 -41.421  1.00 40.30  ? 169 LYS A HD2    1 
ATOM   2537  H  HD3    . LYS A 1 189 ? 21.657  28.531 -43.002  1.00 40.30  ? 169 LYS A HD3    1 
ATOM   2538  H  HE2    . LYS A 1 189 ? 22.620  26.396 -42.805  1.00 46.48  ? 169 LYS A HE2    1 
ATOM   2539  H  HE3    . LYS A 1 189 ? 22.332  26.437 -41.240  1.00 46.48  ? 169 LYS A HE3    1 
ATOM   2540  H  HZ1    . LYS A 1 189 ? 20.690  25.298 -42.322  1.00 51.17  ? 169 LYS A HZ1    1 
ATOM   2541  H  HZ2    . LYS A 1 189 ? 20.110  26.483 -41.723  1.00 51.17  ? 169 LYS A HZ2    1 
ATOM   2542  H  HZ3    . LYS A 1 189 ? 20.372  26.446 -43.147  1.00 51.17  ? 169 LYS A HZ3    1 
ATOM   2543  N  N      . ARG A 1 190 ? 23.479  31.429 -39.256  1.00 24.07  ? 170 ARG A N      1 
ATOM   2544  C  CA     . ARG A 1 190 ? 22.845  32.738 -39.169  1.00 26.75  ? 170 ARG A CA     1 
ATOM   2545  C  C      . ARG A 1 190 ? 23.899  33.833 -39.135  1.00 27.20  ? 170 ARG A C      1 
ATOM   2546  O  O      . ARG A 1 190 ? 23.867  34.779 -39.933  1.00 27.26  ? 170 ARG A O      1 
ATOM   2547  C  CB     . ARG A 1 190 ? 21.964  32.802 -37.921  1.00 28.03  ? 170 ARG A CB     1 
ATOM   2548  C  CG     . ARG A 1 190 ? 21.059  34.019 -37.838  1.00 31.37  ? 170 ARG A CG     1 
ATOM   2549  C  CD     . ARG A 1 190 ? 20.138  33.934 -36.627  1.00 38.26  ? 170 ARG A CD     1 
ATOM   2550  N  NE     . ARG A 1 190 ? 20.890  33.904 -35.375  1.00 43.67  ? 170 ARG A NE     1 
ATOM   2551  C  CZ     . ARG A 1 190 ? 20.344  33.779 -34.168  1.00 46.27  ? 170 ARG A CZ     1 
ATOM   2552  N  NH1    . ARG A 1 190 ? 19.029  33.669 -34.032  1.00 45.31  ? 170 ARG A NH1    1 
ATOM   2553  N  NH2    . ARG A 1 190 ? 21.117  33.763 -33.090  1.00 47.75  ? 170 ARG A NH2    1 
ATOM   2554  H  H      . ARG A 1 190 ? 23.232  30.870 -38.652  1.00 29.01  ? 170 ARG A H      1 
ATOM   2555  H  HA     . ARG A 1 190 ? 22.283  32.878 -39.948  1.00 32.22  ? 170 ARG A HA     1 
ATOM   2556  H  HB2    . ARG A 1 190 ? 21.397  32.015 -37.902  1.00 33.75  ? 170 ARG A HB2    1 
ATOM   2557  H  HB3    . ARG A 1 190 ? 22.537  32.810 -37.138  1.00 33.75  ? 170 ARG A HB3    1 
ATOM   2558  H  HG2    . ARG A 1 190 ? 21.602  34.818 -37.753  1.00 37.76  ? 170 ARG A HG2    1 
ATOM   2559  H  HG3    . ARG A 1 190 ? 20.511  34.067 -38.636  1.00 37.76  ? 170 ARG A HG3    1 
ATOM   2560  H  HD2    . ARG A 1 190 ? 19.556  34.710 -36.613  1.00 46.03  ? 170 ARG A HD2    1 
ATOM   2561  H  HD3    . ARG A 1 190 ? 19.611  33.121 -36.684  1.00 46.03  ? 170 ARG A HD3    1 
ATOM   2562  H  HE     . ARG A 1 190 ? 21.746  33.973 -35.421  1.00 52.53  ? 170 ARG A HE     1 
ATOM   2563  H  HH11   . ARG A 1 190 ? 18.522  33.679 -34.727  1.00 54.49  ? 170 ARG A HH11   1 
ATOM   2564  H  HH12   . ARG A 1 190 ? 18.683  33.589 -33.249  1.00 54.49  ? 170 ARG A HH12   1 
ATOM   2565  H  HH21   . ARG A 1 190 ? 21.970  33.834 -33.172  1.00 57.42  ? 170 ARG A HH21   1 
ATOM   2566  H  HH22   . ARG A 1 190 ? 20.765  33.682 -32.310  1.00 57.42  ? 170 ARG A HH22   1 
ATOM   2567  N  N      . TRP A 1 191 ? 24.878  33.685 -38.242  1.00 26.64  ? 171 TRP A N      1 
ATOM   2568  C  CA     . TRP A 1 191 ? 25.945  34.671 -38.133  1.00 30.05  ? 171 TRP A CA     1 
ATOM   2569  C  C      . TRP A 1 191 ? 26.624  34.885 -39.478  1.00 29.32  ? 171 TRP A C      1 
ATOM   2570  O  O      . TRP A 1 191 ? 26.848  36.028 -39.894  1.00 34.49  ? 171 TRP A O      1 
ATOM   2571  C  CB     . TRP A 1 191 ? 26.939  34.216 -37.062  1.00 33.61  ? 171 TRP A CB     1 
ATOM   2572  C  CG     . TRP A 1 191 ? 28.221  34.986 -36.994  1.00 36.57  ? 171 TRP A CG     1 
ATOM   2573  C  CD1    . TRP A 1 191 ? 28.406  36.235 -36.472  1.00 35.08  ? 171 TRP A CD1    1 
ATOM   2574  C  CD2    . TRP A 1 191 ? 29.507  34.542 -37.435  1.00 38.88  ? 171 TRP A CD2    1 
ATOM   2575  N  NE1    . TRP A 1 191 ? 29.727  36.599 -36.571  1.00 33.29  ? 171 TRP A NE1    1 
ATOM   2576  C  CE2    . TRP A 1 191 ? 30.425  35.576 -37.160  1.00 38.64  ? 171 TRP A CE2    1 
ATOM   2577  C  CE3    . TRP A 1 191 ? 29.972  33.371 -38.042  1.00 39.94  ? 171 TRP A CE3    1 
ATOM   2578  C  CZ2    . TRP A 1 191 ? 31.779  35.476 -37.472  1.00 42.43  ? 171 TRP A CZ2    1 
ATOM   2579  C  CZ3    . TRP A 1 191 ? 31.316  33.273 -38.352  1.00 42.37  ? 171 TRP A CZ3    1 
ATOM   2580  C  CH2    . TRP A 1 191 ? 32.205  34.319 -38.066  1.00 43.12  ? 171 TRP A CH2    1 
ATOM   2581  H  H      . TRP A 1 191 ? 24.945  33.027 -37.692  1.00 32.08  ? 171 TRP A H      1 
ATOM   2582  H  HA     . TRP A 1 191 ? 25.565  35.517 -37.850  1.00 36.18  ? 171 TRP A HA     1 
ATOM   2583  H  HB2    . TRP A 1 191 ? 26.509  34.290 -36.195  1.00 40.45  ? 171 TRP A HB2    1 
ATOM   2584  H  HB3    . TRP A 1 191 ? 27.166  33.288 -37.230  1.00 40.45  ? 171 TRP A HB3    1 
ATOM   2585  H  HD1    . TRP A 1 191 ? 27.734  36.762 -36.104  1.00 42.22  ? 171 TRP A HD1    1 
ATOM   2586  H  HE1    . TRP A 1 191 ? 30.061  37.346 -36.309  1.00 40.06  ? 171 TRP A HE1    1 
ATOM   2587  H  HE3    . TRP A 1 191 ? 29.389  32.673 -38.234  1.00 48.05  ? 171 TRP A HE3    1 
ATOM   2588  H  HZ2    . TRP A 1 191 ? 32.371  36.169 -37.285  1.00 51.04  ? 171 TRP A HZ2    1 
ATOM   2589  H  HZ3    . TRP A 1 191 ? 31.637  32.499 -38.756  1.00 50.96  ? 171 TRP A HZ3    1 
ATOM   2590  H  HH2    . TRP A 1 191 ? 33.103  34.225 -38.286  1.00 51.86  ? 171 TRP A HH2    1 
ATOM   2591  N  N      . SER A 1 192 ? 26.916  33.796 -40.198  1.00 21.49  ? 172 SER A N      1 
ATOM   2592  C  CA     . SER A 1 192 ? 27.639  33.927 -41.457  1.00 20.81  ? 172 SER A CA     1 
ATOM   2593  C  C      . SER A 1 192 ? 26.852  34.748 -42.469  1.00 20.88  ? 172 SER A C      1 
ATOM   2594  O  O      . SER A 1 192 ? 27.447  35.386 -43.344  1.00 20.93  ? 172 SER A O      1 
ATOM   2595  C  CB     . SER A 1 192 ? 27.960  32.545 -42.031  1.00 19.91  ? 172 SER A CB     1 
ATOM   2596  O  OG     . SER A 1 192 ? 26.803  31.933 -42.572  1.00 19.48  ? 172 SER A OG     1 
ATOM   2597  H  H      . SER A 1 192 ? 26.710  32.989 -39.981  1.00 25.90  ? 172 SER A H      1 
ATOM   2598  H  HA     . SER A 1 192 ? 28.478  34.383 -41.291  1.00 24.38  ? 172 SER A HA     1 
ATOM   2599  H  HB2    . SER A 1 192 ? 28.622  32.643 -42.733  1.00 23.30  ? 172 SER A HB2    1 
ATOM   2600  H  HB3    . SER A 1 192 ? 28.311  31.984 -41.322  1.00 23.30  ? 172 SER A HB3    1 
ATOM   2601  H  HG     . SER A 1 192 ? 26.221  31.841 -41.974  1.00 23.49  ? 172 SER A HG     1 
ATOM   2602  N  N      . LYS A 1 193 ? 25.521  34.750 -42.371  1.00 24.53  ? 173 LYS A N      1 
ATOM   2603  C  CA     . LYS A 1 193 ? 24.707  35.548 -43.278  1.00 29.68  ? 173 LYS A CA     1 
ATOM   2604  C  C      . LYS A 1 193 ? 24.535  36.983 -42.798  1.00 38.10  ? 173 LYS A C      1 
ATOM   2605  O  O      . LYS A 1 193 ? 24.243  37.863 -43.616  1.00 43.52  ? 173 LYS A O      1 
ATOM   2606  C  CB     . LYS A 1 193 ? 23.337  34.892 -43.480  1.00 27.56  ? 173 LYS A CB     1 
ATOM   2607  C  CG     . LYS A 1 193 ? 23.389  33.641 -44.349  1.00 26.27  ? 173 LYS A CG     1 
ATOM   2608  C  CD     . LYS A 1 193 ? 22.076  32.880 -44.337  1.00 28.11  ? 173 LYS A CD     1 
ATOM   2609  C  CE     . LYS A 1 193 ? 22.171  31.605 -45.161  1.00 33.19  ? 173 LYS A CE     1 
ATOM   2610  N  NZ     . LYS A 1 193 ? 20.998  30.710 -44.960  1.00 38.16  ? 173 LYS A NZ     1 
ATOM   2611  H  H      . LYS A 1 193 ? 25.072  34.301 -41.791  1.00 29.55  ? 173 LYS A H      1 
ATOM   2612  H  HA     . LYS A 1 193 ? 25.148  35.579 -44.141  1.00 35.74  ? 173 LYS A HA     1 
ATOM   2613  H  HB2    . LYS A 1 193 ? 22.979  34.639 -42.615  1.00 33.19  ? 173 LYS A HB2    1 
ATOM   2614  H  HB3    . LYS A 1 193 ? 22.744  35.529 -43.909  1.00 33.19  ? 173 LYS A HB3    1 
ATOM   2615  H  HG2    . LYS A 1 193 ? 23.581  33.897 -45.265  1.00 31.64  ? 173 LYS A HG2    1 
ATOM   2616  H  HG3    . LYS A 1 193 ? 24.083  33.051 -44.015  1.00 31.64  ? 173 LYS A HG3    1 
ATOM   2617  H  HD2    . LYS A 1 193 ? 21.854  32.637 -43.424  1.00 33.85  ? 173 LYS A HD2    1 
ATOM   2618  H  HD3    . LYS A 1 193 ? 21.379  33.437 -44.716  1.00 33.85  ? 173 LYS A HD3    1 
ATOM   2619  H  HE2    . LYS A 1 193 ? 22.215  31.838 -46.102  1.00 39.95  ? 173 LYS A HE2    1 
ATOM   2620  H  HE3    . LYS A 1 193 ? 22.969  31.118 -44.901  1.00 39.95  ? 173 LYS A HE3    1 
ATOM   2621  H  HZ1    . LYS A 1 193 ? 20.938  30.476 -44.104  1.00 45.91  ? 173 LYS A HZ1    1 
ATOM   2622  H  HZ2    . LYS A 1 193 ? 20.250  31.132 -45.198  1.00 45.91  ? 173 LYS A HZ2    1 
ATOM   2623  H  HZ3    . LYS A 1 193 ? 21.086  29.977 -45.456  1.00 45.91  ? 173 LYS A HZ3    1 
ATOM   2624  N  N      . GLN A 1 194 ? 24.713  37.239 -41.500  1.00 43.51  ? 174 GLN A N      1 
ATOM   2625  C  CA     . GLN A 1 194 ? 24.609  38.594 -40.972  1.00 49.58  ? 174 GLN A CA     1 
ATOM   2626  C  C      . GLN A 1 194 ? 25.888  39.400 -41.147  1.00 51.32  ? 174 GLN A C      1 
ATOM   2627  O  O      . GLN A 1 194 ? 25.826  40.633 -41.152  1.00 50.75  ? 174 GLN A O      1 
ATOM   2628  C  CB     . GLN A 1 194 ? 24.242  38.563 -39.486  1.00 58.82  ? 174 GLN A CB     1 
ATOM   2629  C  CG     . GLN A 1 194 ? 22.768  38.757 -39.171  1.00 67.35  ? 174 GLN A CG     1 
ATOM   2630  C  CD     . GLN A 1 194 ? 22.468  38.583 -37.691  1.00 74.30  ? 174 GLN A CD     1 
ATOM   2631  O  OE1    . GLN A 1 194 ? 23.281  38.041 -36.942  1.00 75.81  ? 174 GLN A OE1    1 
ATOM   2632  N  NE2    . GLN A 1 194 ? 21.337  39.120 -37.249  1.00 77.59  ? 174 GLN A NE2    1 
ATOM   2633  H  H      . GLN A 1 194 ? 24.894  36.643 -40.906  1.00 52.33  ? 174 GLN A H      1 
ATOM   2634  H  HA     . GLN A 1 194 ? 23.900  39.058 -41.444  1.00 59.61  ? 174 GLN A HA     1 
ATOM   2635  H  HB2    . GLN A 1 194 ? 24.505  37.703 -39.123  1.00 70.71  ? 174 GLN A HB2    1 
ATOM   2636  H  HB3    . GLN A 1 194 ? 24.731  39.268 -39.034  1.00 70.71  ? 174 GLN A HB3    1 
ATOM   2637  H  HG2    . GLN A 1 194 ? 22.503  39.654 -39.429  1.00 80.94  ? 174 GLN A HG2    1 
ATOM   2638  H  HG3    . GLN A 1 194 ? 22.249  38.102 -39.663  1.00 80.94  ? 174 GLN A HG3    1 
ATOM   2639  H  HE21   . GLN A 1 194 ? 20.819  39.540 -37.792  1.00 93.23  ? 174 GLN A HE21   1 
ATOM   2640  H  HE22   . GLN A 1 194 ? 21.123  39.048 -36.419  1.00 93.23  ? 174 GLN A HE22   1 
ATOM   2641  N  N      . THR A 1 195 ? 27.034  38.741 -41.295  1.00 53.74  ? 175 THR A N      1 
ATOM   2642  C  CA     . THR A 1 195 ? 28.308  39.433 -41.429  1.00 54.63  ? 175 THR A CA     1 
ATOM   2643  C  C      . THR A 1 195 ? 28.765  39.589 -42.874  1.00 50.90  ? 175 THR A C      1 
ATOM   2644  O  O      . THR A 1 195 ? 29.722  40.329 -43.124  1.00 45.93  ? 175 THR A O      1 
ATOM   2645  C  CB     . THR A 1 195 ? 29.393  38.693 -40.639  1.00 57.39  ? 175 THR A CB     1 
ATOM   2646  O  OG1    . THR A 1 195 ? 29.487  37.340 -41.102  1.00 58.19  ? 175 THR A OG1    1 
ATOM   2647  C  CG2    . THR A 1 195 ? 29.066  38.699 -39.152  1.00 58.26  ? 175 THR A CG2    1 
ATOM   2648  H  H      . THR A 1 195 ? 27.099  37.884 -41.320  1.00 64.60  ? 175 THR A H      1 
ATOM   2649  H  HA     . THR A 1 195 ? 28.220  40.321 -41.050  1.00 65.67  ? 175 THR A HA     1 
ATOM   2650  H  HB     . THR A 1 195 ? 30.245  39.137 -40.767  1.00 68.98  ? 175 THR A HB     1 
ATOM   2651  H  HG1    . THR A 1 195 ? 28.752  36.947 -40.995  1.00 69.95  ? 175 THR A HG1    1 
ATOM   2652  H  HG21   . THR A 1 195 ? 29.757  38.229 -38.659  1.00 70.03  ? 175 THR A HG21   1 
ATOM   2653  H  HG22   . THR A 1 195 ? 29.013  39.611 -38.828  1.00 70.03  ? 175 THR A HG22   1 
ATOM   2654  H  HG23   . THR A 1 195 ? 28.215  38.260 -38.998  1.00 70.03  ? 175 THR A HG23   1 
ATOM   2655  N  N      . GLY A 1 196 ? 28.117  38.921 -43.824  1.00 51.73  ? 176 GLY A N      1 
ATOM   2656  C  CA     . GLY A 1 196 ? 28.528  38.989 -45.210  1.00 51.92  ? 176 GLY A CA     1 
ATOM   2657  C  C      . GLY A 1 196 ? 29.498  37.913 -45.639  1.00 46.89  ? 176 GLY A C      1 
ATOM   2658  O  O      . GLY A 1 196 ? 30.000  37.970 -46.768  1.00 48.99  ? 176 GLY A O      1 
ATOM   2659  H  H      . GLY A 1 196 ? 27.432  38.420 -43.684  1.00 62.19  ? 176 GLY A H      1 
ATOM   2660  H  HA2    . GLY A 1 196 ? 27.742  38.926 -45.774  1.00 62.42  ? 176 GLY A HA2    1 
ATOM   2661  H  HA3    . GLY A 1 196 ? 28.945  39.850 -45.372  1.00 62.42  ? 176 GLY A HA3    1 
ATOM   2662  N  N      . LEU A 1 197 ? 29.784  36.936 -44.776  1.00 39.35  ? 177 LEU A N      1 
ATOM   2663  C  CA     . LEU A 1 197 ? 30.703  35.862 -45.133  1.00 32.52  ? 177 LEU A CA     1 
ATOM   2664  C  C      . LEU A 1 197 ? 30.052  34.833 -46.046  1.00 30.35  ? 177 LEU A C      1 
ATOM   2665  O  O      . LEU A 1 197 ? 30.726  34.261 -46.909  1.00 27.97  ? 177 LEU A O      1 
ATOM   2666  C  CB     . LEU A 1 197 ? 31.210  35.165 -43.870  1.00 32.41  ? 177 LEU A CB     1 
ATOM   2667  C  CG     . LEU A 1 197 ? 31.976  36.018 -42.857  1.00 36.17  ? 177 LEU A CG     1 
ATOM   2668  C  CD1    . LEU A 1 197 ? 32.201  35.219 -41.581  1.00 35.65  ? 177 LEU A CD1    1 
ATOM   2669  C  CD2    . LEU A 1 197 ? 33.296  36.514 -43.425  1.00 39.80  ? 177 LEU A CD2    1 
ATOM   2670  H  H      . LEU A 1 197 ? 29.458  36.874 -43.982  1.00 47.34  ? 177 LEU A H      1 
ATOM   2671  H  HA     . LEU A 1 197 ? 31.466  36.239 -45.598  1.00 39.14  ? 177 LEU A HA     1 
ATOM   2672  H  HB2    . LEU A 1 197 ? 30.445  34.791 -43.405  1.00 39.01  ? 177 LEU A HB2    1 
ATOM   2673  H  HB3    . LEU A 1 197 ? 31.801  34.445 -44.140  1.00 39.01  ? 177 LEU A HB3    1 
ATOM   2674  H  HG     . LEU A 1 197 ? 31.440  36.794 -42.631  1.00 43.52  ? 177 LEU A HG     1 
ATOM   2675  H  HD11   . LEU A 1 197 ? 32.687  35.768 -40.946  1.00 42.90  ? 177 LEU A HD11   1 
ATOM   2676  H  HD12   . LEU A 1 197 ? 31.340  34.968 -41.211  1.00 42.90  ? 177 LEU A HD12   1 
ATOM   2677  H  HD13   . LEU A 1 197 ? 32.714  34.424 -41.793  1.00 42.90  ? 177 LEU A HD13   1 
ATOM   2678  H  HD21   . LEU A 1 197 ? 33.748  37.048 -42.753  1.00 47.88  ? 177 LEU A HD21   1 
ATOM   2679  H  HD22   . LEU A 1 197 ? 33.844  35.750 -43.664  1.00 47.88  ? 177 LEU A HD22   1 
ATOM   2680  H  HD23   . LEU A 1 197 ? 33.118  37.053 -44.212  1.00 47.88  ? 177 LEU A HD23   1 
ATOM   2681  N  N      . ASN A 1 198 ? 28.756  34.586 -45.873  1.00 33.34  ? 178 ASN A N      1 
ATOM   2682  C  CA     . ASN A 1 198 ? 28.073  33.561 -46.648  1.00 31.39  ? 178 ASN A CA     1 
ATOM   2683  C  C      . ASN A 1 198 ? 28.012  33.948 -48.122  1.00 28.46  ? 178 ASN A C      1 
ATOM   2684  O  O      . ASN A 1 198 ? 27.741  35.100 -48.470  1.00 29.45  ? 178 ASN A O      1 
ATOM   2685  C  CB     . ASN A 1 198 ? 26.664  33.344 -46.099  1.00 30.36  ? 178 ASN A CB     1 
ATOM   2686  C  CG     . ASN A 1 198 ? 26.039  32.053 -46.588  1.00 27.41  ? 178 ASN A CG     1 
ATOM   2687  O  OD1    . ASN A 1 198 ? 25.647  31.937 -47.748  1.00 24.30  ? 178 ASN A OD1    1 
ATOM   2688  N  ND2    . ASN A 1 198 ? 25.938  31.074 -45.698  1.00 28.95  ? 178 ASN A ND2    1 
ATOM   2689  H  H      . ASN A 1 198 ? 28.252  35.000 -45.313  1.00 40.13  ? 178 ASN A H      1 
ATOM   2690  H  HA     . ASN A 1 198 ? 28.560  32.726 -46.574  1.00 37.78  ? 178 ASN A HA     1 
ATOM   2691  H  HB2    . ASN A 1 198 ? 26.704  33.309 -45.131  1.00 36.55  ? 178 ASN A HB2    1 
ATOM   2692  H  HB3    . ASN A 1 198 ? 26.097  34.078 -46.382  1.00 36.55  ? 178 ASN A HB3    1 
ATOM   2693  H  HD21   . ASN A 1 198 ? 25.591  30.321 -45.924  1.00 34.86  ? 178 ASN A HD21   1 
ATOM   2694  H  HD22   . ASN A 1 198 ? 26.220  31.194 -44.894  1.00 34.86  ? 178 ASN A HD22   1 
ATOM   2695  N  N      . ALA A 1 199 ? 28.260  32.965 -48.991  1.00 25.66  ? 179 ALA A N      1 
ATOM   2696  C  CA     . ALA A 1 199 ? 28.278  33.201 -50.430  1.00 29.87  ? 179 ALA A CA     1 
ATOM   2697  C  C      . ALA A 1 199 ? 26.919  33.614 -50.983  1.00 35.32  ? 179 ALA A C      1 
ATOM   2698  O  O      . ALA A 1 199 ? 26.833  33.959 -52.166  1.00 32.54  ? 179 ALA A O      1 
ATOM   2699  C  CB     . ALA A 1 199 ? 28.768  31.945 -51.154  1.00 34.41  ? 179 ALA A CB     1 
ATOM   2700  H  H      . ALA A 1 199 ? 28.422  32.150 -48.769  1.00 30.91  ? 179 ALA A H      1 
ATOM   2701  H  HA     . ALA A 1 199 ? 28.904  33.916 -50.621  1.00 35.97  ? 179 ALA A HA     1 
ATOM   2702  H  HB1    . ALA A 1 199 ? 28.775  32.114 -52.109  1.00 41.41  ? 179 ALA A HB1    1 
ATOM   2703  H  HB2    . ALA A 1 199 ? 29.664  31.734 -50.848  1.00 41.41  ? 179 ALA A HB2    1 
ATOM   2704  H  HB3    . ALA A 1 199 ? 28.168  31.210 -50.952  1.00 41.41  ? 179 ALA A HB3    1 
ATOM   2705  N  N      . SER A 1 200 ? 25.860  33.574 -50.174  1.00 43.86  ? 180 SER A N      1 
ATOM   2706  C  CA     . SER A 1 200 ? 24.564  34.088 -50.597  1.00 46.64  ? 180 SER A CA     1 
ATOM   2707  C  C      . SER A 1 200 ? 24.506  35.612 -50.584  1.00 42.67  ? 180 SER A C      1 
ATOM   2708  O  O      . SER A 1 200 ? 23.531  36.184 -51.084  1.00 46.11  ? 180 SER A O      1 
ATOM   2709  C  CB     . SER A 1 200 ? 23.461  33.524 -49.699  1.00 45.30  ? 180 SER A CB     1 
ATOM   2710  O  OG     . SER A 1 200 ? 23.635  33.944 -48.357  1.00 45.00  ? 180 SER A OG     1 
ATOM   2711  H  H      . SER A 1 200 ? 25.868  33.253 -49.376  1.00 52.75  ? 180 SER A H      1 
ATOM   2712  H  HA     . SER A 1 200 ? 24.390  33.792 -51.504  1.00 56.09  ? 180 SER A HA     1 
ATOM   2713  H  HB2    . SER A 1 200 ? 22.601  33.840 -50.019  1.00 54.48  ? 180 SER A HB2    1 
ATOM   2714  H  HB3    . SER A 1 200 ? 23.492  32.555 -49.733  1.00 54.48  ? 180 SER A HB3    1 
ATOM   2715  H  HG     . SER A 1 200 ? 24.376  33.677 -48.066  1.00 54.12  ? 180 SER A HG     1 
ATOM   2716  N  N      . VAL A 1 201 ? 25.518  36.273 -50.027  1.00 36.23  ? 181 VAL A N      1 
ATOM   2717  C  CA     . VAL A 1 201 ? 25.579  37.727 -49.952  1.00 32.49  ? 181 VAL A CA     1 
ATOM   2718  C  C      . VAL A 1 201 ? 26.679  38.231 -50.876  1.00 31.98  ? 181 VAL A C      1 
ATOM   2719  O  O      . VAL A 1 201 ? 27.694  37.560 -51.096  1.00 35.17  ? 181 VAL A O      1 
ATOM   2720  C  CB     . VAL A 1 201 ? 25.821  38.207 -48.504  1.00 34.11  ? 181 VAL A CB     1 
ATOM   2721  C  CG1    . VAL A 1 201 ? 25.881  39.728 -48.438  1.00 38.61  ? 181 VAL A CG1    1 
ATOM   2722  C  CG2    . VAL A 1 201 ? 24.738  37.677 -47.578  1.00 34.76  ? 181 VAL A CG2    1 
ATOM   2723  H  H      . VAL A 1 201 ? 26.201  35.886 -49.676  1.00 43.60  ? 181 VAL A H      1 
ATOM   2724  H  HA     . VAL A 1 201 ? 24.735  38.098 -50.256  1.00 39.11  ? 181 VAL A HA     1 
ATOM   2725  H  HB     . VAL A 1 201 ? 26.674  37.860 -48.196  1.00 41.05  ? 181 VAL A HB     1 
ATOM   2726  H  HG11   . VAL A 1 201 ? 26.034  39.998 -47.519  1.00 46.44  ? 181 VAL A HG11   1 
ATOM   2727  H  HG12   . VAL A 1 201 ? 26.607  40.040 -49.000  1.00 46.44  ? 181 VAL A HG12   1 
ATOM   2728  H  HG13   . VAL A 1 201 ? 25.038  40.091 -48.754  1.00 46.44  ? 181 VAL A HG13   1 
ATOM   2729  H  HG21   . VAL A 1 201 ? 24.912  37.991 -46.677  1.00 41.83  ? 181 VAL A HG21   1 
ATOM   2730  H  HG22   . VAL A 1 201 ? 23.876  38.003 -47.881  1.00 41.83  ? 181 VAL A HG22   1 
ATOM   2731  H  HG23   . VAL A 1 201 ? 24.751  36.707 -47.599  1.00 41.83  ? 181 VAL A HG23   1 
ATOM   2732  N  N      . ILE A 1 202 ? 26.462  39.426 -51.426  1.00 27.51  ? 182 ILE A N      1 
ATOM   2733  C  CA     . ILE A 1 202 ? 27.464  40.059 -52.276  1.00 25.86  ? 182 ILE A CA     1 
ATOM   2734  C  C      . ILE A 1 202 ? 28.748  40.227 -51.476  1.00 27.10  ? 182 ILE A C      1 
ATOM   2735  O  O      . ILE A 1 202 ? 28.774  40.914 -50.446  1.00 25.81  ? 182 ILE A O      1 
ATOM   2736  C  CB     . ILE A 1 202 ? 26.946  41.403 -52.805  1.00 27.56  ? 182 ILE A CB     1 
ATOM   2737  C  CG1    . ILE A 1 202 ? 25.732  41.179 -53.713  1.00 27.99  ? 182 ILE A CG1    1 
ATOM   2738  C  CG2    . ILE A 1 202 ? 28.049  42.161 -53.544  1.00 27.99  ? 182 ILE A CG2    1 
ATOM   2739  C  CD1    . ILE A 1 202 ? 25.019  42.454 -54.123  1.00 30.79  ? 182 ILE A CD1    1 
ATOM   2740  H  H      . ILE A 1 202 ? 25.744  39.888 -51.322  1.00 33.13  ? 182 ILE A H      1 
ATOM   2741  H  HA     . ILE A 1 202 ? 27.651  39.485 -53.035  1.00 31.15  ? 182 ILE A HA     1 
ATOM   2742  H  HB     . ILE A 1 202 ? 26.664  41.939 -52.048  1.00 33.19  ? 182 ILE A HB     1 
ATOM   2743  H  HG12   . ILE A 1 202 ? 26.027  40.733 -54.522  1.00 33.71  ? 182 ILE A HG12   1 
ATOM   2744  H  HG13   . ILE A 1 202 ? 25.092  40.620 -53.245  1.00 33.71  ? 182 ILE A HG13   1 
ATOM   2745  H  HG21   . ILE A 1 202 ? 27.691  43.004 -53.865  1.00 33.71  ? 182 ILE A HG21   1 
ATOM   2746  H  HG22   . ILE A 1 202 ? 28.783  42.325 -52.932  1.00 33.71  ? 182 ILE A HG22   1 
ATOM   2747  H  HG23   . ILE A 1 202 ? 28.354  41.625 -54.292  1.00 33.71  ? 182 ILE A HG23   1 
ATOM   2748  H  HD11   . ILE A 1 202 ? 24.268  42.226 -54.693  1.00 37.07  ? 182 ILE A HD11   1 
ATOM   2749  H  HD12   . ILE A 1 202 ? 24.704  42.909 -53.326  1.00 37.07  ? 182 ILE A HD12   1 
ATOM   2750  H  HD13   . ILE A 1 202 ? 25.640  43.022 -54.606  1.00 37.07  ? 182 ILE A HD13   1 
ATOM   2751  N  N      . GLY A 1 203 ? 29.822  39.591 -51.943  1.00 27.73  ? 183 GLY A N      1 
ATOM   2752  C  CA     . GLY A 1 203 ? 31.097  39.615 -51.262  1.00 26.89  ? 183 GLY A CA     1 
ATOM   2753  C  C      . GLY A 1 203 ? 31.428  38.348 -50.502  1.00 30.01  ? 183 GLY A C      1 
ATOM   2754  O  O      . GLY A 1 203 ? 32.588  38.165 -50.115  1.00 31.47  ? 183 GLY A O      1 
ATOM   2755  H  H      . GLY A 1 203 ? 29.828  39.132 -52.670  1.00 33.39  ? 183 GLY A H      1 
ATOM   2756  H  HA2    . GLY A 1 203 ? 31.800  39.766 -51.913  1.00 32.39  ? 183 GLY A HA2    1 
ATOM   2757  H  HA3    . GLY A 1 203 ? 31.106  40.353 -50.633  1.00 32.39  ? 183 GLY A HA3    1 
ATOM   2758  N  N      . GLY A 1 204 ? 30.450  37.470 -50.281  1.00 32.93  ? 184 GLY A N      1 
ATOM   2759  C  CA     . GLY A 1 204 ? 30.705  36.249 -49.548  1.00 36.32  ? 184 GLY A CA     1 
ATOM   2760  C  C      . GLY A 1 204 ? 31.580  35.281 -50.322  1.00 39.27  ? 184 GLY A C      1 
ATOM   2761  O  O      . GLY A 1 204 ? 31.738  35.367 -51.540  1.00 39.84  ? 184 GLY A O      1 
ATOM   2762  H  H      . GLY A 1 204 ? 29.637  37.564 -50.545  1.00 39.64  ? 184 GLY A H      1 
ATOM   2763  H  HA2    . GLY A 1 204 ? 31.147  36.460 -48.711  1.00 43.70  ? 184 GLY A HA2    1 
ATOM   2764  H  HA3    . GLY A 1 204 ? 29.863  35.810 -49.349  1.00 43.70  ? 184 GLY A HA3    1 
ATOM   2765  N  N      . SER A 1 205 ? 32.163  34.335 -49.586  1.00 39.54  ? 185 SER A N      1 
ATOM   2766  C  CA     . SER A 1 205 ? 33.103  33.380 -50.160  1.00 37.46  ? 185 SER A CA     1 
ATOM   2767  C  C      . SER A 1 205 ? 32.865  31.929 -49.770  1.00 30.29  ? 185 SER A C      1 
ATOM   2768  O  O      . SER A 1 205 ? 33.414  31.044 -50.436  1.00 29.05  ? 185 SER A O      1 
ATOM   2769  C  CB     . SER A 1 205 ? 34.540  33.749 -49.767  1.00 36.12  ? 185 SER A CB     1 
ATOM   2770  O  OG     . SER A 1 205 ? 34.666  33.900 -48.365  1.00 33.53  ? 185 SER A OG     1 
ATOM   2771  H  H      . SER A 1 205 ? 32.028  34.226 -48.743  1.00 47.57  ? 185 SER A H      1 
ATOM   2772  H  HA     . SER A 1 205 ? 33.042  33.434 -51.127  1.00 45.07  ? 185 SER A HA     1 
ATOM   2773  H  HB2    . SER A 1 205 ? 35.137  33.044 -50.062  1.00 43.46  ? 185 SER A HB2    1 
ATOM   2774  H  HB3    . SER A 1 205 ? 34.778  34.586 -50.196  1.00 43.46  ? 185 SER A HB3    1 
ATOM   2775  H  HG     . SER A 1 205 ? 34.155  34.509 -48.094  1.00 40.36  ? 185 SER A HG     1 
ATOM   2776  N  N      . ILE A 1 206 ? 32.085  31.648 -48.729  1.00 25.37  ? 186 ILE A N      1 
ATOM   2777  C  CA     . ILE A 1 206 ? 31.900  30.288 -48.237  1.00 24.04  ? 186 ILE A CA     1 
ATOM   2778  C  C      . ILE A 1 206 ? 30.411  30.008 -48.099  1.00 22.71  ? 186 ILE A C      1 
ATOM   2779  O  O      . ILE A 1 206 ? 29.683  30.786 -47.473  1.00 22.81  ? 186 ILE A O      1 
ATOM   2780  C  CB     . ILE A 1 206 ? 32.623  30.074 -46.892  1.00 22.85  ? 186 ILE A CB     1 
ATOM   2781  C  CG1    . ILE A 1 206 ? 34.111  30.420 -47.040  1.00 21.27  ? 186 ILE A CG1    1 
ATOM   2782  C  CG2    . ILE A 1 206 ? 32.441  28.637 -46.413  1.00 23.00  ? 186 ILE A CG2    1 
ATOM   2783  C  CD1    . ILE A 1 206 ? 34.900  30.345 -45.751  1.00 23.92  ? 186 ILE A CD1    1 
ATOM   2784  H  H      . ILE A 1 206 ? 31.645  32.238 -48.284  1.00 30.57  ? 186 ILE A H      1 
ATOM   2785  H  HA     . ILE A 1 206 ? 32.268  29.663 -48.881  1.00 28.97  ? 186 ILE A HA     1 
ATOM   2786  H  HB     . ILE A 1 206 ? 32.232  30.670 -46.234  1.00 27.53  ? 186 ILE A HB     1 
ATOM   2787  H  HG12   . ILE A 1 206 ? 34.513  29.800 -47.668  1.00 25.65  ? 186 ILE A HG12   1 
ATOM   2788  H  HG13   . ILE A 1 206 ? 34.187  31.326 -47.379  1.00 25.65  ? 186 ILE A HG13   1 
ATOM   2789  H  HG21   . ILE A 1 206 ? 32.903  28.526 -45.567  1.00 27.71  ? 186 ILE A HG21   1 
ATOM   2790  H  HG22   . ILE A 1 206 ? 31.494  28.461 -46.299  1.00 27.71  ? 186 ILE A HG22   1 
ATOM   2791  H  HG23   . ILE A 1 206 ? 32.812  28.034 -47.076  1.00 27.71  ? 186 ILE A HG23   1 
ATOM   2792  H  HD11   . ILE A 1 206 ? 35.824  30.577 -45.932  1.00 28.82  ? 186 ILE A HD11   1 
ATOM   2793  H  HD12   . ILE A 1 206 ? 34.521  30.969 -45.112  1.00 28.82  ? 186 ILE A HD12   1 
ATOM   2794  H  HD13   . ILE A 1 206 ? 34.848  29.442 -45.401  1.00 28.82  ? 186 ILE A HD13   1 
ATOM   2795  N  N      . THR A 1 207 ? 29.963  28.897 -48.679  1.00 20.07  ? 187 THR A N      1 
ATOM   2796  C  CA     . THR A 1 207 ? 28.570  28.492 -48.590  1.00 21.78  ? 187 THR A CA     1 
ATOM   2797  C  C      . THR A 1 207 ? 28.264  27.909 -47.212  1.00 20.94  ? 187 THR A C      1 
ATOM   2798  O  O      . THR A 1 207 ? 29.156  27.617 -46.411  1.00 21.16  ? 187 THR A O      1 
ATOM   2799  C  CB     . THR A 1 207 ? 28.236  27.455 -49.664  1.00 21.50  ? 187 THR A CB     1 
ATOM   2800  O  OG1    . THR A 1 207 ? 29.028  26.277 -49.461  1.00 18.70  ? 187 THR A OG1    1 
ATOM   2801  C  CG2    . THR A 1 207 ? 28.498  28.006 -51.057  1.00 21.80  ? 187 THR A CG2    1 
ATOM   2802  H  H      . THR A 1 207 ? 30.455  28.357 -49.133  1.00 24.20  ? 187 THR A H      1 
ATOM   2803  H  HA     . THR A 1 207 ? 28.002  29.267 -48.726  1.00 26.25  ? 187 THR A HA     1 
ATOM   2804  H  HB     . THR A 1 207 ? 27.296  27.223 -49.602  1.00 25.92  ? 187 THR A HB     1 
ATOM   2805  H  HG1    . THR A 1 207 ? 29.845  26.468 -49.509  1.00 22.56  ? 187 THR A HG1    1 
ATOM   2806  H  HG21   . THR A 1 207 ? 28.281  27.336 -51.724  1.00 26.27  ? 187 THR A HG21   1 
ATOM   2807  H  HG22   . THR A 1 207 ? 27.951  28.793 -51.210  1.00 26.27  ? 187 THR A HG22   1 
ATOM   2808  H  HG23   . THR A 1 207 ? 29.432  28.249 -51.146  1.00 26.27  ? 187 THR A HG23   1 
ATOM   2809  N  N      . SER A 1 208 ? 26.968  27.736 -46.942  1.00 21.99  ? 188 SER A N      1 
ATOM   2810  C  CA     . SER A 1 208 ? 26.547  27.105 -45.695  1.00 22.48  ? 188 SER A CA     1 
ATOM   2811  C  C      . SER A 1 208 ? 27.103  25.690 -45.587  1.00 22.56  ? 188 SER A C      1 
ATOM   2812  O  O      . SER A 1 208 ? 27.458  25.231 -44.495  1.00 19.61  ? 188 SER A O      1 
ATOM   2813  C  CB     . SER A 1 208 ? 25.021  27.093 -45.611  1.00 19.89  ? 188 SER A CB     1 
ATOM   2814  O  OG     . SER A 1 208 ? 24.493  28.401 -45.755  1.00 17.24  ? 188 SER A OG     1 
ATOM   2815  H  H      . SER A 1 208 ? 26.322  27.972 -47.459  1.00 26.50  ? 188 SER A H      1 
ATOM   2816  H  HA     . SER A 1 208 ? 26.887  27.620 -44.947  1.00 27.09  ? 188 SER A HA     1 
ATOM   2817  H  HB2    . SER A 1 208 ? 24.671  26.532 -46.321  1.00 23.99  ? 188 SER A HB2    1 
ATOM   2818  H  HB3    . SER A 1 208 ? 24.756  26.739 -44.748  1.00 23.99  ? 188 SER A HB3    1 
ATOM   2819  H  HG     . SER A 1 208 ? 23.655  28.379 -45.707  1.00 20.75  ? 188 SER A HG     1 
ATOM   2820  N  N      . TYR A 1 209 ? 27.182  24.985 -46.717  1.00 22.80  ? 189 TYR A N      1 
ATOM   2821  C  CA     . TYR A 1 209 ? 27.764  23.647 -46.737  1.00 24.79  ? 189 TYR A CA     1 
ATOM   2822  C  C      . TYR A 1 209 ? 29.177  23.658 -46.159  1.00 24.32  ? 189 TYR A C      1 
ATOM   2823  O  O      . TYR A 1 209 ? 29.526  22.828 -45.306  1.00 22.93  ? 189 TYR A O      1 
ATOM   2824  C  CB     . TYR A 1 209 ? 27.741  23.124 -48.177  1.00 26.66  ? 189 TYR A CB     1 
ATOM   2825  C  CG     . TYR A 1 209 ? 28.434  21.802 -48.415  1.00 28.89  ? 189 TYR A CG     1 
ATOM   2826  C  CD1    . TYR A 1 209 ? 28.046  20.659 -47.734  1.00 29.64  ? 189 TYR A CD1    1 
ATOM   2827  C  CD2    . TYR A 1 209 ? 29.453  21.692 -49.354  1.00 29.80  ? 189 TYR A CD2    1 
ATOM   2828  C  CE1    . TYR A 1 209 ? 28.673  19.449 -47.958  1.00 31.47  ? 189 TYR A CE1    1 
ATOM   2829  C  CE2    . TYR A 1 209 ? 30.082  20.488 -49.587  1.00 29.94  ? 189 TYR A CE2    1 
ATOM   2830  C  CZ     . TYR A 1 209 ? 29.689  19.370 -48.888  1.00 29.94  ? 189 TYR A CZ     1 
ATOM   2831  O  OH     . TYR A 1 209 ? 30.315  18.168 -49.119  1.00 28.33  ? 189 TYR A OH     1 
ATOM   2832  H  H      . TYR A 1 209 ? 26.906  25.260 -47.483  1.00 27.48  ? 189 TYR A H      1 
ATOM   2833  H  HA     . TYR A 1 209 ? 27.220  23.055 -46.193  1.00 29.86  ? 189 TYR A HA     1 
ATOM   2834  H  HB2    . TYR A 1 209 ? 26.816  23.018 -48.449  1.00 32.12  ? 189 TYR A HB2    1 
ATOM   2835  H  HB3    . TYR A 1 209 ? 28.171  23.781 -48.747  1.00 32.12  ? 189 TYR A HB3    1 
ATOM   2836  H  HD1    . TYR A 1 209 ? 27.364  20.711 -47.104  1.00 35.68  ? 189 TYR A HD1    1 
ATOM   2837  H  HD2    . TYR A 1 209 ? 29.722  22.447 -49.825  1.00 35.88  ? 189 TYR A HD2    1 
ATOM   2838  H  HE1    . TYR A 1 209 ? 28.409  18.691 -47.489  1.00 37.88  ? 189 TYR A HE1    1 
ATOM   2839  H  HE2    . TYR A 1 209 ? 30.768  20.432 -50.213  1.00 36.05  ? 189 TYR A HE2    1 
ATOM   2840  H  HH     . TYR A 1 209 ? 30.909  18.262 -49.705  1.00 34.11  ? 189 TYR A HH     1 
ATOM   2841  N  N      . GLY A 1 210 ? 29.999  24.615 -46.594  1.00 25.15  ? 190 GLY A N      1 
ATOM   2842  C  CA     . GLY A 1 210 ? 31.353  24.708 -46.072  1.00 25.13  ? 190 GLY A CA     1 
ATOM   2843  C  C      . GLY A 1 210 ? 31.389  24.955 -44.576  1.00 21.87  ? 190 GLY A C      1 
ATOM   2844  O  O      . GLY A 1 210 ? 32.213  24.378 -43.861  1.00 18.77  ? 190 GLY A O      1 
ATOM   2845  H  H      . GLY A 1 210 ? 29.798  25.210 -47.181  1.00 30.30  ? 190 GLY A H      1 
ATOM   2846  H  HA2    . GLY A 1 210 ? 31.827  23.883 -46.258  1.00 30.28  ? 190 GLY A HA2    1 
ATOM   2847  H  HA3    . GLY A 1 210 ? 31.819  25.435 -46.514  1.00 30.28  ? 190 GLY A HA3    1 
ATOM   2848  N  N      . PHE A 1 211 ? 30.492  25.811 -44.079  1.00 21.48  ? 191 PHE A N      1 
ATOM   2849  C  CA     . PHE A 1 211 ? 30.445  26.073 -42.645  1.00 20.71  ? 191 PHE A CA     1 
ATOM   2850  C  C      . PHE A 1 211 ? 30.036  24.826 -41.871  1.00 24.87  ? 191 PHE A C      1 
ATOM   2851  O  O      . PHE A 1 211 ? 30.564  24.566 -40.783  1.00 27.67  ? 191 PHE A O      1 
ATOM   2852  C  CB     . PHE A 1 211 ? 29.501  27.238 -42.354  1.00 18.41  ? 191 PHE A CB     1 
ATOM   2853  C  CG     . PHE A 1 211 ? 30.121  28.586 -42.597  1.00 20.08  ? 191 PHE A CG     1 
ATOM   2854  C  CD1    . PHE A 1 211 ? 31.041  29.109 -41.702  1.00 20.26  ? 191 PHE A CD1    1 
ATOM   2855  C  CD2    . PHE A 1 211 ? 29.786  29.329 -43.718  1.00 22.77  ? 191 PHE A CD2    1 
ATOM   2856  C  CE1    . PHE A 1 211 ? 31.618  30.348 -41.921  1.00 19.70  ? 191 PHE A CE1    1 
ATOM   2857  C  CE2    . PHE A 1 211 ? 30.359  30.568 -43.941  1.00 22.42  ? 191 PHE A CE2    1 
ATOM   2858  C  CZ     . PHE A 1 211 ? 31.276  31.078 -43.041  1.00 20.65  ? 191 PHE A CZ     1 
ATOM   2859  H  H      . PHE A 1 211 ? 29.912  26.243 -44.543  1.00 25.89  ? 191 PHE A H      1 
ATOM   2860  H  HA     . PHE A 1 211 ? 31.332  26.329 -42.346  1.00 24.98  ? 191 PHE A HA     1 
ATOM   2861  H  HB2    . PHE A 1 211 ? 28.722  27.161 -42.927  1.00 22.22  ? 191 PHE A HB2    1 
ATOM   2862  H  HB3    . PHE A 1 211 ? 29.231  27.198 -41.424  1.00 22.22  ? 191 PHE A HB3    1 
ATOM   2863  H  HD1    . PHE A 1 211 ? 31.275  28.621 -40.947  1.00 24.42  ? 191 PHE A HD1    1 
ATOM   2864  H  HD2    . PHE A 1 211 ? 29.171  28.991 -44.327  1.00 27.44  ? 191 PHE A HD2    1 
ATOM   2865  H  HE1    . PHE A 1 211 ? 32.234  30.689 -41.313  1.00 23.75  ? 191 PHE A HE1    1 
ATOM   2866  H  HE2    . PHE A 1 211 ? 30.127  31.058 -44.697  1.00 27.02  ? 191 PHE A HE2    1 
ATOM   2867  H  HZ     . PHE A 1 211 ? 31.662  31.911 -43.189  1.00 24.90  ? 191 PHE A HZ     1 
ATOM   2868  N  N      . ASN A 1 212 ? 29.104  24.039 -42.412  1.00 24.92  ? 192 ASN A N      1 
ATOM   2869  C  CA     . ASN A 1 212 ? 28.786  22.755 -41.794  1.00 26.22  ? 192 ASN A CA     1 
ATOM   2870  C  C      . ASN A 1 212 ? 30.027  21.877 -41.715  1.00 22.27  ? 192 ASN A C      1 
ATOM   2871  O  O      . ASN A 1 212 ? 30.316  21.276 -40.670  1.00 19.74  ? 192 ASN A O      1 
ATOM   2872  C  CB     . ASN A 1 212 ? 27.675  22.047 -42.572  1.00 30.91  ? 192 ASN A CB     1 
ATOM   2873  C  CG     . ASN A 1 212 ? 26.293  22.314 -41.998  1.00 33.09  ? 192 ASN A CG     1 
ATOM   2874  O  OD1    . ASN A 1 212 ? 26.152  22.716 -40.841  1.00 28.32  ? 192 ASN A OD1    1 
ATOM   2875  N  ND2    . ASN A 1 212 ? 25.263  22.077 -42.804  1.00 37.75  ? 192 ASN A ND2    1 
ATOM   2876  H  H      . ASN A 1 212 ? 28.652  24.220 -43.121  1.00 30.02  ? 192 ASN A H      1 
ATOM   2877  H  HA     . ASN A 1 212 ? 28.469  22.909 -40.890  1.00 31.58  ? 192 ASN A HA     1 
ATOM   2878  H  HB2    . ASN A 1 212 ? 27.684  22.360 -43.490  1.00 37.21  ? 192 ASN A HB2    1 
ATOM   2879  H  HB3    . ASN A 1 212 ? 27.831  21.090 -42.546  1.00 37.21  ? 192 ASN A HB3    1 
ATOM   2880  H  HD21   . ASN A 1 212 ? 24.460  22.212 -42.527  1.00 45.41  ? 192 ASN A HD21   1 
ATOM   2881  H  HD22   . ASN A 1 212 ? 25.399  21.789 -43.603  1.00 45.41  ? 192 ASN A HD22   1 
ATOM   2882  N  N      . LEU A 1 213 ? 30.787  21.807 -42.811  1.00 22.70  ? 193 LEU A N      1 
ATOM   2883  C  CA     . LEU A 1 213 ? 32.020  21.026 -42.798  1.00 22.15  ? 193 LEU A CA     1 
ATOM   2884  C  C      . LEU A 1 213 ? 32.973  21.512 -41.709  1.00 21.37  ? 193 LEU A C      1 
ATOM   2885  O  O      . LEU A 1 213 ? 33.566  20.702 -40.983  1.00 18.36  ? 193 LEU A O      1 
ATOM   2886  C  CB     . LEU A 1 213 ? 32.685  21.089 -44.172  1.00 21.91  ? 193 LEU A CB     1 
ATOM   2887  C  CG     . LEU A 1 213 ? 31.890  20.445 -45.314  1.00 19.27  ? 193 LEU A CG     1 
ATOM   2888  C  CD1    . LEU A 1 213 ? 32.507  20.790 -46.659  1.00 16.70  ? 193 LEU A CD1    1 
ATOM   2889  C  CD2    . LEU A 1 213 ? 31.808  18.934 -45.141  1.00 19.32  ? 193 LEU A CD2    1 
ATOM   2890  H  H      . LEU A 1 213 ? 30.614  22.195 -43.559  1.00 27.36  ? 193 LEU A H      1 
ATOM   2891  H  HA     . LEU A 1 213 ? 31.803  20.098 -42.613  1.00 26.70  ? 193 LEU A HA     1 
ATOM   2892  H  HB2    . LEU A 1 213 ? 32.825  22.021 -44.403  1.00 26.41  ? 193 LEU A HB2    1 
ATOM   2893  H  HB3    . LEU A 1 213 ? 33.541  20.636 -44.121  1.00 26.41  ? 193 LEU A HB3    1 
ATOM   2894  H  HG     . LEU A 1 213 ? 30.986  20.796 -45.303  1.00 23.24  ? 193 LEU A HG     1 
ATOM   2895  H  HD11   . LEU A 1 213 ? 31.986  20.371 -47.361  1.00 20.16  ? 193 LEU A HD11   1 
ATOM   2896  H  HD12   . LEU A 1 213 ? 32.500  21.753 -46.771  1.00 20.16  ? 193 LEU A HD12   1 
ATOM   2897  H  HD13   . LEU A 1 213 ? 33.419  20.460 -46.681  1.00 20.16  ? 193 LEU A HD13   1 
ATOM   2898  H  HD21   . LEU A 1 213 ? 31.300  18.560 -45.878  1.00 23.30  ? 193 LEU A HD21   1 
ATOM   2899  H  HD22   . LEU A 1 213 ? 32.706  18.568 -45.137  1.00 23.30  ? 193 LEU A HD22   1 
ATOM   2900  H  HD23   . LEU A 1 213 ? 31.366  18.737 -44.300  1.00 23.30  ? 193 LEU A HD23   1 
ATOM   2901  N  N      . MET A 1 214 ? 33.118  22.831 -41.565  1.00 25.66  ? 194 MET A N      1 
ATOM   2902  C  CA     . MET A 1 214 ? 33.979  23.369 -40.515  1.00 30.97  ? 194 MET A CA     1 
ATOM   2903  C  C      . MET A 1 214 ? 33.491  22.951 -39.131  1.00 30.12  ? 194 MET A C      1 
ATOM   2904  O  O      . MET A 1 214 ? 34.284  22.522 -38.284  1.00 28.50  ? 194 MET A O      1 
ATOM   2905  C  CB     . MET A 1 214 ? 34.055  24.893 -40.622  1.00 31.56  ? 194 MET A CB     1 
ATOM   2906  C  CG     . MET A 1 214 ? 34.905  25.382 -41.783  1.00 31.52  ? 194 MET A CG     1 
ATOM   2907  S  SD     . MET A 1 214 ? 35.017  27.180 -41.899  1.00 33.77  ? 194 MET A SD     1 
ATOM   2908  C  CE     . MET A 1 214 ? 34.038  27.495 -43.360  1.00 34.88  ? 194 MET A CE     1 
ATOM   2909  H  H      . MET A 1 214 ? 32.735  23.426 -42.055  1.00 30.91  ? 194 MET A H      1 
ATOM   2910  H  HA     . MET A 1 214 ? 34.875  23.022 -40.644  1.00 37.28  ? 194 MET A HA     1 
ATOM   2911  H  HB2    . MET A 1 214 ? 33.159  25.244 -40.742  1.00 37.99  ? 194 MET A HB2    1 
ATOM   2912  H  HB3    . MET A 1 214 ? 34.440  25.245 -39.804  1.00 37.99  ? 194 MET A HB3    1 
ATOM   2913  H  HG2    . MET A 1 214 ? 35.804  25.035 -41.680  1.00 37.94  ? 194 MET A HG2    1 
ATOM   2914  H  HG3    . MET A 1 214 ? 34.520  25.056 -42.611  1.00 37.94  ? 194 MET A HG3    1 
ATOM   2915  H  HE1    . MET A 1 214 ? 34.023  28.450 -43.530  1.00 41.97  ? 194 MET A HE1    1 
ATOM   2916  H  HE2    . MET A 1 214 ? 34.437  27.031 -44.113  1.00 41.97  ? 194 MET A HE2    1 
ATOM   2917  H  HE3    . MET A 1 214 ? 33.136  27.171 -43.212  1.00 41.97  ? 194 MET A HE3    1 
ATOM   2918  N  N      . VAL A 1 215 ? 32.185  23.074 -38.879  1.00 29.18  ? 195 VAL A N      1 
ATOM   2919  C  CA     . VAL A 1 215 ? 31.649  22.721 -37.566  1.00 29.10  ? 195 VAL A CA     1 
ATOM   2920  C  C      . VAL A 1 215 ? 31.942  21.258 -37.252  1.00 26.39  ? 195 VAL A C      1 
ATOM   2921  O  O      . VAL A 1 215 ? 32.419  20.921 -36.159  1.00 22.62  ? 195 VAL A O      1 
ATOM   2922  C  CB     . VAL A 1 215 ? 30.140  23.026 -37.500  1.00 26.94  ? 195 VAL A CB     1 
ATOM   2923  C  CG1    . VAL A 1 215 ? 29.529  22.484 -36.209  1.00 24.73  ? 195 VAL A CG1    1 
ATOM   2924  C  CG2    . VAL A 1 215 ? 29.895  24.524 -37.602  1.00 27.79  ? 195 VAL A CG2    1 
ATOM   2925  H  H      . VAL A 1 215 ? 31.599  23.355 -39.442  1.00 35.13  ? 195 VAL A H      1 
ATOM   2926  H  HA     . VAL A 1 215 ? 32.090  23.263 -36.892  1.00 35.04  ? 195 VAL A HA     1 
ATOM   2927  H  HB     . VAL A 1 215 ? 29.696  22.596 -38.248  1.00 32.45  ? 195 VAL A HB     1 
ATOM   2928  H  HG11   . VAL A 1 215 ? 28.582  22.690 -36.198  1.00 29.80  ? 195 VAL A HG11   1 
ATOM   2929  H  HG12   . VAL A 1 215 ? 29.659  21.523 -36.178  1.00 29.80  ? 195 VAL A HG12   1 
ATOM   2930  H  HG13   . VAL A 1 215 ? 29.969  22.902 -35.453  1.00 29.80  ? 195 VAL A HG13   1 
ATOM   2931  H  HG21   . VAL A 1 215 ? 28.940  24.691 -37.559  1.00 33.47  ? 195 VAL A HG21   1 
ATOM   2932  H  HG22   . VAL A 1 215 ? 30.342  24.968 -36.864  1.00 33.47  ? 195 VAL A HG22   1 
ATOM   2933  H  HG23   . VAL A 1 215 ? 30.249  24.845 -38.446  1.00 33.47  ? 195 VAL A HG23   1 
ATOM   2934  N  N      . VAL A 1 216 ? 31.668  20.366 -38.207  1.00 24.56  ? 196 VAL A N      1 
ATOM   2935  C  CA     . VAL A 1 216 ? 31.893  18.945 -37.957  1.00 21.31  ? 196 VAL A CA     1 
ATOM   2936  C  C      . VAL A 1 216 ? 33.376  18.668 -37.731  1.00 22.39  ? 196 VAL A C      1 
ATOM   2937  O  O      . VAL A 1 216 ? 33.741  17.837 -36.893  1.00 23.85  ? 196 VAL A O      1 
ATOM   2938  C  CB     . VAL A 1 216 ? 31.320  18.093 -39.105  1.00 20.49  ? 196 VAL A CB     1 
ATOM   2939  C  CG1    . VAL A 1 216 ? 31.715  16.625 -38.937  1.00 23.93  ? 196 VAL A CG1    1 
ATOM   2940  C  CG2    . VAL A 1 216 ? 29.804  18.227 -39.154  1.00 18.01  ? 196 VAL A CG2    1 
ATOM   2941  H  H      . VAL A 1 216 ? 31.360  20.553 -38.988  1.00 29.59  ? 196 VAL A H      1 
ATOM   2942  H  HA     . VAL A 1 216 ? 31.422  18.696 -37.146  1.00 25.69  ? 196 VAL A HA     1 
ATOM   2943  H  HB     . VAL A 1 216 ? 31.680  18.410 -39.949  1.00 24.70  ? 196 VAL A HB     1 
ATOM   2944  H  HG11   . VAL A 1 216 ? 31.342  16.113 -39.672  1.00 28.83  ? 196 VAL A HG11   1 
ATOM   2945  H  HG12   . VAL A 1 216 ? 32.682  16.556 -38.943  1.00 28.83  ? 196 VAL A HG12   1 
ATOM   2946  H  HG13   . VAL A 1 216 ? 31.364  16.299 -38.094  1.00 28.83  ? 196 VAL A HG13   1 
ATOM   2947  H  HG21   . VAL A 1 216 ? 29.463  17.684 -39.882  1.00 21.02  ? 196 VAL A HG21   1 
ATOM   2948  H  HG22   . VAL A 1 216 ? 29.433  17.921 -38.312  1.00 21.02  ? 196 VAL A HG22   1 
ATOM   2949  H  HG23   . VAL A 1 216 ? 29.574  19.158 -39.299  1.00 21.02  ? 196 VAL A HG23   1 
ATOM   2950  N  N      . TYR A 1 217 ? 34.254  19.347 -38.474  1.00 22.76  ? 197 TYR A N      1 
ATOM   2951  C  CA     . TYR A 1 217 ? 35.688  19.146 -38.270  1.00 24.87  ? 197 TYR A CA     1 
ATOM   2952  C  C      . TYR A 1 217 ? 36.099  19.550 -36.858  1.00 22.05  ? 197 TYR A C      1 
ATOM   2953  O  O      . TYR A 1 217 ? 36.767  18.785 -36.147  1.00 20.36  ? 197 TYR A O      1 
ATOM   2954  C  CB     . TYR A 1 217 ? 36.488  19.934 -39.309  1.00 30.12  ? 197 TYR A CB     1 
ATOM   2955  C  CG     . TYR A 1 217 ? 37.993  19.829 -39.135  1.00 30.09  ? 197 TYR A CG     1 
ATOM   2956  C  CD1    . TYR A 1 217 ? 38.687  18.716 -39.593  1.00 30.12  ? 197 TYR A CD1    1 
ATOM   2957  C  CD2    . TYR A 1 217 ? 38.717  20.843 -38.518  1.00 25.47  ? 197 TYR A CD2    1 
ATOM   2958  C  CE1    . TYR A 1 217 ? 40.058  18.614 -39.440  1.00 29.58  ? 197 TYR A CE1    1 
ATOM   2959  C  CE2    . TYR A 1 217 ? 40.088  20.750 -38.360  1.00 23.61  ? 197 TYR A CE2    1 
ATOM   2960  C  CZ     . TYR A 1 217 ? 40.753  19.632 -38.822  1.00 25.83  ? 197 TYR A CZ     1 
ATOM   2961  O  OH     . TYR A 1 217 ? 42.119  19.530 -38.669  1.00 22.64  ? 197 TYR A OH     1 
ATOM   2962  H  H      . TYR A 1 217 ? 34.052  19.916 -39.087  1.00 27.43  ? 197 TYR A H      1 
ATOM   2963  H  HA     . TYR A 1 217 ? 35.894  18.205 -38.384  1.00 29.96  ? 197 TYR A HA     1 
ATOM   2964  H  HB2    . TYR A 1 217 ? 36.268  19.599 -40.193  1.00 36.27  ? 197 TYR A HB2    1 
ATOM   2965  H  HB3    . TYR A 1 217 ? 36.247  20.871 -39.244  1.00 36.27  ? 197 TYR A HB3    1 
ATOM   2966  H  HD1    . TYR A 1 217 ? 38.222  18.027 -40.010  1.00 36.27  ? 197 TYR A HD1    1 
ATOM   2967  H  HD2    . TYR A 1 217 ? 38.271  21.597 -38.205  1.00 30.69  ? 197 TYR A HD2    1 
ATOM   2968  H  HE1    . TYR A 1 217 ? 40.508  17.862 -39.751  1.00 35.61  ? 197 TYR A HE1    1 
ATOM   2969  H  HE2    . TYR A 1 217 ? 40.558  21.436 -37.944  1.00 28.45  ? 197 TYR A HE2    1 
ATOM   2970  H  HH     . TYR A 1 217 ? 42.416  20.213 -38.281  1.00 27.28  ? 197 TYR A HH     1 
ATOM   2971  N  N      . TYR A 1 218 ? 35.701  20.751 -36.432  1.00 22.80  ? 198 TYR A N      1 
ATOM   2972  C  CA     . TYR A 1 218 ? 36.009  21.202 -35.078  1.00 26.88  ? 198 TYR A CA     1 
ATOM   2973  C  C      . TYR A 1 218 ? 35.507  20.202 -34.044  1.00 26.68  ? 198 TYR A C      1 
ATOM   2974  O  O      . TYR A 1 218 ? 36.259  19.774 -33.160  1.00 22.07  ? 198 TYR A O      1 
ATOM   2975  C  CB     . TYR A 1 218 ? 35.397  22.582 -34.832  1.00 29.26  ? 198 TYR A CB     1 
ATOM   2976  C  CG     . TYR A 1 218 ? 35.115  22.869 -33.374  1.00 31.92  ? 198 TYR A CG     1 
ATOM   2977  C  CD1    . TYR A 1 218 ? 36.129  23.266 -32.513  1.00 32.86  ? 198 TYR A CD1    1 
ATOM   2978  C  CD2    . TYR A 1 218 ? 33.830  22.743 -32.860  1.00 34.33  ? 198 TYR A CD2    1 
ATOM   2979  C  CE1    . TYR A 1 218 ? 35.871  23.525 -31.179  1.00 35.29  ? 198 TYR A CE1    1 
ATOM   2980  C  CE2    . TYR A 1 218 ? 33.563  23.002 -31.530  1.00 35.30  ? 198 TYR A CE2    1 
ATOM   2981  C  CZ     . TYR A 1 218 ? 34.585  23.392 -30.694  1.00 35.88  ? 198 TYR A CZ     1 
ATOM   2982  O  OH     . TYR A 1 218 ? 34.320  23.649 -29.368  1.00 34.98  ? 198 TYR A OH     1 
ATOM   2983  H  H      . TYR A 1 218 ? 35.256  21.316 -36.904  1.00 27.48  ? 198 TYR A H      1 
ATOM   2984  H  HA     . TYR A 1 218 ? 36.971  21.277 -34.981  1.00 32.37  ? 198 TYR A HA     1 
ATOM   2985  H  HB2    . TYR A 1 218 ? 36.012  23.259 -35.155  1.00 35.24  ? 198 TYR A HB2    1 
ATOM   2986  H  HB3    . TYR A 1 218 ? 34.557  22.643 -35.315  1.00 35.24  ? 198 TYR A HB3    1 
ATOM   2987  H  HD1    . TYR A 1 218 ? 36.996  23.355 -32.837  1.00 39.55  ? 198 TYR A HD1    1 
ATOM   2988  H  HD2    . TYR A 1 218 ? 33.138  22.479 -33.421  1.00 41.31  ? 198 TYR A HD2    1 
ATOM   2989  H  HE1    . TYR A 1 218 ? 36.559  23.790 -30.612  1.00 42.46  ? 198 TYR A HE1    1 
ATOM   2990  H  HE2    . TYR A 1 218 ? 32.698  22.912 -31.201  1.00 42.48  ? 198 TYR A HE2    1 
ATOM   2991  H  HH     . TYR A 1 218 ? 35.026  23.876 -28.973  1.00 42.09  ? 198 TYR A HH     1 
ATOM   2992  N  N      . LEU A 1 219 ? 34.230  19.821 -34.135  1.00 31.32  ? 199 LEU A N      1 
ATOM   2993  C  CA     . LEU A 1 219 ? 33.696  18.834 -33.202  1.00 34.95  ? 199 LEU A CA     1 
ATOM   2994  C  C      . LEU A 1 219 ? 34.486  17.535 -33.255  1.00 35.92  ? 199 LEU A C      1 
ATOM   2995  O  O      . LEU A 1 219 ? 34.581  16.824 -32.249  1.00 30.72  ? 199 LEU A O      1 
ATOM   2996  C  CB     . LEU A 1 219 ? 32.223  18.556 -33.507  1.00 36.92  ? 199 LEU A CB     1 
ATOM   2997  C  CG     . LEU A 1 219 ? 31.230  19.688 -33.243  1.00 37.01  ? 199 LEU A CG     1 
ATOM   2998  C  CD1    . LEU A 1 219 ? 29.850  19.298 -33.747  1.00 35.22  ? 199 LEU A CD1    1 
ATOM   2999  C  CD2    . LEU A 1 219 ? 31.179  20.032 -31.763  1.00 37.52  ? 199 LEU A CD2    1 
ATOM   3000  H  H      . LEU A 1 219 ? 33.666  20.112 -34.715  1.00 37.70  ? 199 LEU A H      1 
ATOM   3001  H  HA     . LEU A 1 219 ? 33.755  19.186 -32.300  1.00 42.06  ? 199 LEU A HA     1 
ATOM   3002  H  HB2    . LEU A 1 219 ? 32.149  18.324 -34.446  1.00 44.42  ? 199 LEU A HB2    1 
ATOM   3003  H  HB3    . LEU A 1 219 ? 31.942  17.800 -32.968  1.00 44.42  ? 199 LEU A HB3    1 
ATOM   3004  H  HG     . LEU A 1 219 ? 31.515  20.480 -33.727  1.00 44.53  ? 199 LEU A HG     1 
ATOM   3005  H  HD11   . LEU A 1 219 ? 29.233  20.026 -33.573  1.00 42.38  ? 199 LEU A HD11   1 
ATOM   3006  H  HD12   . LEU A 1 219 ? 29.899  19.127 -34.701  1.00 42.38  ? 199 LEU A HD12   1 
ATOM   3007  H  HD13   . LEU A 1 219 ? 29.559  18.499 -33.281  1.00 42.38  ? 199 LEU A HD13   1 
ATOM   3008  H  HD21   . LEU A 1 219 ? 30.543  20.752 -31.628  1.00 45.14  ? 199 LEU A HD21   1 
ATOM   3009  H  HD22   . LEU A 1 219 ? 30.902  19.247 -31.266  1.00 45.14  ? 199 LEU A HD22   1 
ATOM   3010  H  HD23   . LEU A 1 219 ? 32.062  20.312 -31.473  1.00 45.14  ? 199 LEU A HD23   1 
ATOM   3011  N  N      . LEU A 1 220 ? 35.062  17.211 -34.414  1.00 40.39  ? 200 LEU A N      1 
ATOM   3012  C  CA     . LEU A 1 220 ? 35.784  15.952 -34.553  1.00 42.01  ? 200 LEU A CA     1 
ATOM   3013  C  C      . LEU A 1 220 ? 37.117  16.012 -33.822  1.00 42.21  ? 200 LEU A C      1 
ATOM   3014  O  O      . LEU A 1 220 ? 37.525  15.039 -33.179  1.00 37.02  ? 200 LEU A O      1 
ATOM   3015  C  CB     . LEU A 1 220 ? 36.026  15.637 -36.029  1.00 44.34  ? 200 LEU A CB     1 
ATOM   3016  C  CG     . LEU A 1 220 ? 35.607  14.257 -36.540  1.00 49.33  ? 200 LEU A CG     1 
ATOM   3017  C  CD1    . LEU A 1 220 ? 34.113  14.046 -36.332  1.00 51.09  ? 200 LEU A CD1    1 
ATOM   3018  C  CD2    . LEU A 1 220 ? 35.999  14.060 -37.994  1.00 52.49  ? 200 LEU A CD2    1 
ATOM   3019  H  H      . LEU A 1 220 ? 35.048  17.696 -35.124  1.00 48.59  ? 200 LEU A H      1 
ATOM   3020  H  HA     . LEU A 1 220 ? 35.256  15.235 -34.169  1.00 50.53  ? 200 LEU A HA     1 
ATOM   3021  H  HB2    . LEU A 1 220 ? 35.544  16.292 -36.558  1.00 53.32  ? 200 LEU A HB2    1 
ATOM   3022  H  HB3    . LEU A 1 220 ? 36.976  15.726 -36.202  1.00 53.32  ? 200 LEU A HB3    1 
ATOM   3023  H  HG     . LEU A 1 220 ? 36.072  13.583 -36.020  1.00 59.32  ? 200 LEU A HG     1 
ATOM   3024  H  HD11   . LEU A 1 220 ? 33.870  13.166 -36.662  1.00 61.43  ? 200 LEU A HD11   1 
ATOM   3025  H  HD12   . LEU A 1 220 ? 33.914  14.110 -35.385  1.00 61.43  ? 200 LEU A HD12   1 
ATOM   3026  H  HD13   . LEU A 1 220 ? 33.627  14.729 -36.820  1.00 61.43  ? 200 LEU A HD13   1 
ATOM   3027  H  HD21   . LEU A 1 220 ? 35.718  13.177 -38.279  1.00 63.10  ? 200 LEU A HD21   1 
ATOM   3028  H  HD22   . LEU A 1 220 ? 35.562  14.738 -38.533  1.00 63.10  ? 200 LEU A HD22   1 
ATOM   3029  H  HD23   . LEU A 1 220 ? 36.962  14.143 -38.075  1.00 63.10  ? 200 LEU A HD23   1 
ATOM   3030  N  N      . GLN A 1 221 ? 37.808  17.152 -33.910  1.00 48.72  ? 201 GLN A N      1 
ATOM   3031  C  CA     . GLN A 1 221 ? 39.105  17.282 -33.255  1.00 50.38  ? 201 GLN A CA     1 
ATOM   3032  C  C      . GLN A 1 221 ? 38.980  17.254 -31.735  1.00 50.07  ? 201 GLN A C      1 
ATOM   3033  O  O      . GLN A 1 221 ? 39.916  16.830 -31.049  1.00 52.67  ? 201 GLN A O      1 
ATOM   3034  C  CB     . GLN A 1 221 ? 39.791  18.568 -33.712  1.00 49.89  ? 201 GLN A CB     1 
ATOM   3035  C  CG     . GLN A 1 221 ? 40.126  18.587 -35.198  1.00 49.25  ? 201 GLN A CG     1 
ATOM   3036  C  CD     . GLN A 1 221 ? 41.169  17.553 -35.580  1.00 49.10  ? 201 GLN A CD     1 
ATOM   3037  O  OE1    . GLN A 1 221 ? 42.269  17.529 -35.029  1.00 51.68  ? 201 GLN A OE1    1 
ATOM   3038  N  NE2    . GLN A 1 221 ? 40.824  16.687 -36.527  1.00 46.75  ? 201 GLN A NE2    1 
ATOM   3039  H  H      . GLN A 1 221 ? 37.550  17.852 -34.337  1.00 58.58  ? 201 GLN A H      1 
ATOM   3040  H  HA     . GLN A 1 221 ? 39.665  16.536 -33.520  1.00 60.58  ? 201 GLN A HA     1 
ATOM   3041  H  HB2    . GLN A 1 221 ? 39.203  19.318 -33.530  1.00 59.98  ? 201 GLN A HB2    1 
ATOM   3042  H  HB3    . GLN A 1 221 ? 40.620  18.672 -33.219  1.00 59.98  ? 201 GLN A HB3    1 
ATOM   3043  H  HG2    . GLN A 1 221 ? 39.321  18.402 -35.705  1.00 59.21  ? 201 GLN A HG2    1 
ATOM   3044  H  HG3    . GLN A 1 221 ? 40.472  19.462 -35.432  1.00 59.21  ? 201 GLN A HG3    1 
ATOM   3045  H  HE21   . GLN A 1 221 ? 40.045  16.732 -36.888  1.00 56.22  ? 201 GLN A HE21   1 
ATOM   3046  H  HE22   . GLN A 1 221 ? 41.380  16.081 -36.779  1.00 56.22  ? 201 GLN A HE22   1 
ATOM   3047  N  N      . ARG A 1 222 ? 37.846  17.695 -31.192  1.00 45.07  ? 202 ARG A N      1 
ATOM   3048  C  CA     . ARG A 1 222 ? 37.633  17.715 -29.751  1.00 46.76  ? 202 ARG A CA     1 
ATOM   3049  C  C      . ARG A 1 222 ? 37.085  16.396 -29.218  1.00 50.40  ? 202 ARG A C      1 
ATOM   3050  O  O      . ARG A 1 222 ? 36.757  16.309 -28.030  1.00 45.99  ? 202 ARG A O      1 
ATOM   3051  C  CB     . ARG A 1 222 ? 36.682  18.858 -29.380  1.00 47.31  ? 202 ARG A CB     1 
ATOM   3052  C  CG     . ARG A 1 222 ? 37.295  20.240 -29.523  1.00 44.71  ? 202 ARG A CG     1 
ATOM   3053  C  CD     . ARG A 1 222 ? 38.209  20.562 -28.352  1.00 40.77  ? 202 ARG A CD     1 
ATOM   3054  N  NE     . ARG A 1 222 ? 38.629  21.961 -28.355  1.00 37.04  ? 202 ARG A NE     1 
ATOM   3055  C  CZ     . ARG A 1 222 ? 39.747  22.415 -28.916  1.00 37.85  ? 202 ARG A CZ     1 
ATOM   3056  N  NH1    . ARG A 1 222 ? 40.582  21.587 -29.528  1.00 36.90  ? 202 ARG A NH1    1 
ATOM   3057  N  NH2    . ARG A 1 222 ? 40.033  23.709 -28.861  1.00 41.02  ? 202 ARG A NH2    1 
ATOM   3058  H  H      . ARG A 1 222 ? 37.179  17.992 -31.646  1.00 54.21  ? 202 ARG A H      1 
ATOM   3059  H  HA     . ARG A 1 222 ? 38.482  17.881 -29.312  1.00 56.23  ? 202 ARG A HA     1 
ATOM   3060  H  HB2    . ARG A 1 222 ? 35.905  18.817 -29.958  1.00 56.89  ? 202 ARG A HB2    1 
ATOM   3061  H  HB3    . ARG A 1 222 ? 36.410  18.749 -28.455  1.00 56.89  ? 202 ARG A HB3    1 
ATOM   3062  H  HG2    . ARG A 1 222 ? 37.820  20.275 -30.338  1.00 53.77  ? 202 ARG A HG2    1 
ATOM   3063  H  HG3    . ARG A 1 222 ? 36.588  20.903 -29.550  1.00 53.77  ? 202 ARG A HG3    1 
ATOM   3064  H  HD2    . ARG A 1 222 ? 37.736  20.390 -27.523  1.00 49.04  ? 202 ARG A HD2    1 
ATOM   3065  H  HD3    . ARG A 1 222 ? 39.003  20.008 -28.406  1.00 49.04  ? 202 ARG A HD3    1 
ATOM   3066  H  HE     . ARG A 1 222 ? 38.117  22.533 -27.967  1.00 44.56  ? 202 ARG A HE     1 
ATOM   3067  H  HH11   . ARG A 1 222 ? 40.403  20.747 -29.567  1.00 44.39  ? 202 ARG A HH11   1 
ATOM   3068  H  HH12   . ARG A 1 222 ? 41.302  21.890 -29.887  1.00 44.39  ? 202 ARG A HH12   1 
ATOM   3069  H  HH21   . ARG A 1 222 ? 39.497  24.252 -28.465  1.00 49.34  ? 202 ARG A HH21   1 
ATOM   3070  H  HH22   . ARG A 1 222 ? 40.756  24.005 -29.222  1.00 49.34  ? 202 ARG A HH22   1 
ATOM   3071  N  N      . ASN A 1 223 ? 36.979  15.374 -30.066  1.00 59.22  ? 203 ASN A N      1 
ATOM   3072  C  CA     . ASN A 1 223 ? 36.562  14.036 -29.650  1.00 60.58  ? 203 ASN A CA     1 
ATOM   3073  C  C      . ASN A 1 223 ? 35.151  14.036 -29.066  1.00 53.65  ? 203 ASN A C      1 
ATOM   3074  O  O      . ASN A 1 223 ? 34.803  13.179 -28.250  1.00 55.75  ? 203 ASN A O      1 
ATOM   3075  C  CB     . ASN A 1 223 ? 37.562  13.430 -28.659  1.00 64.69  ? 203 ASN A CB     1 
ATOM   3076  C  CG     . ASN A 1 223 ? 38.697  12.699 -29.356  1.00 69.87  ? 203 ASN A CG     1 
ATOM   3077  O  OD1    . ASN A 1 223 ? 39.871  12.999 -29.139  1.00 73.03  ? 203 ASN A OD1    1 
ATOM   3078  N  ND2    . ASN A 1 223 ? 38.349  11.740 -30.207  1.00 70.64  ? 203 ASN A ND2    1 
ATOM   3079  H  H      . ASN A 1 223 ? 37.148  15.433 -30.908  1.00 71.18  ? 203 ASN A H      1 
ATOM   3080  H  HA     . ASN A 1 223 ? 36.550  13.464 -30.433  1.00 72.81  ? 203 ASN A HA     1 
ATOM   3081  H  HB2    . ASN A 1 223 ? 37.947  14.140 -28.122  1.00 77.75  ? 203 ASN A HB2    1 
ATOM   3082  H  HB3    . ASN A 1 223 ? 37.100  12.795 -28.090  1.00 77.75  ? 203 ASN A HB3    1 
ATOM   3083  H  HD21   . ASN A 1 223 ? 38.954  11.297 -30.626  1.00 84.89  ? 203 ASN A HD21   1 
ATOM   3084  H  HD22   . ASN A 1 223 ? 37.517  11.563 -30.338  1.00 84.89  ? 203 ASN A HD22   1 
ATOM   3085  N  N      . HIS A 1 224 ? 34.329  14.998 -29.478  1.00 46.58  ? 204 HIS A N      1 
ATOM   3086  C  CA     . HIS A 1 224 ? 32.913  15.000 -29.140  1.00 45.40  ? 204 HIS A CA     1 
ATOM   3087  C  C      . HIS A 1 224 ? 32.082  14.209 -30.144  1.00 38.87  ? 204 HIS A C      1 
ATOM   3088  O  O      . HIS A 1 224 ? 30.876  14.037 -29.935  1.00 34.68  ? 204 HIS A O      1 
ATOM   3089  C  CB     . HIS A 1 224 ? 32.396  16.441 -29.041  1.00 51.57  ? 204 HIS A CB     1 
ATOM   3090  C  CG     . HIS A 1 224 ? 33.046  17.240 -27.951  1.00 59.13  ? 204 HIS A CG     1 
ATOM   3091  N  ND1    . HIS A 1 224 ? 32.760  18.570 -27.728  1.00 60.95  ? 204 HIS A ND1    1 
ATOM   3092  C  CD2    . HIS A 1 224 ? 33.968  16.894 -27.022  1.00 61.44  ? 204 HIS A CD2    1 
ATOM   3093  C  CE1    . HIS A 1 224 ? 33.478  19.008 -26.710  1.00 61.75  ? 204 HIS A CE1    1 
ATOM   3094  N  NE2    . HIS A 1 224 ? 34.220  18.011 -26.263  1.00 61.81  ? 204 HIS A NE2    1 
ATOM   3095  H  H      . HIS A 1 224 ? 34.573  15.667 -29.960  1.00 56.02  ? 204 HIS A H      1 
ATOM   3096  H  HA     . HIS A 1 224 ? 32.799  14.584 -28.271  1.00 54.60  ? 204 HIS A HA     1 
ATOM   3097  H  HB2    . HIS A 1 224 ? 32.566  16.893 -29.882  1.00 62.00  ? 204 HIS A HB2    1 
ATOM   3098  H  HB3    . HIS A 1 224 ? 31.442  16.420 -28.866  1.00 62.00  ? 204 HIS A HB3    1 
ATOM   3099  H  HD2    . HIS A 1 224 ? 34.358  16.056 -26.917  1.00 73.85  ? 204 HIS A HD2    1 
ATOM   3100  H  HE1    . HIS A 1 224 ? 33.464  19.872 -26.365  1.00 74.22  ? 204 HIS A HE1    1 
ATOM   3101  H  HE2    . HIS A 1 224 ? 34.771  18.054 -25.604  1.00 74.29  ? 204 HIS A HE2    1 
ATOM   3102  N  N      . LEU A 1 225 ? 32.701  13.738 -31.225  1.00 36.64  ? 205 LEU A N      1 
ATOM   3103  C  CA     . LEU A 1 225 ? 32.069  12.857 -32.193  1.00 36.52  ? 205 LEU A CA     1 
ATOM   3104  C  C      . LEU A 1 225 ? 33.050  11.738 -32.517  1.00 39.48  ? 205 LEU A C      1 
ATOM   3105  O  O      . LEU A 1 225 ? 34.235  11.807 -32.178  1.00 40.76  ? 205 LEU A O      1 
ATOM   3106  C  CB     . LEU A 1 225 ? 31.674  13.612 -33.472  1.00 36.78  ? 205 LEU A CB     1 
ATOM   3107  C  CG     . LEU A 1 225 ? 30.604  14.706 -33.388  1.00 33.78  ? 205 LEU A CG     1 
ATOM   3108  C  CD1    . LEU A 1 225 ? 30.625  15.554 -34.654  1.00 29.16  ? 205 LEU A CD1    1 
ATOM   3109  C  CD2    . LEU A 1 225 ? 29.221  14.114 -33.170  1.00 33.92  ? 205 LEU A CD2    1 
ATOM   3110  H  H      . LEU A 1 225 ? 33.517  13.925 -31.421  1.00 44.09  ? 205 LEU A H      1 
ATOM   3111  H  HA     . LEU A 1 225 ? 31.271  12.466 -31.805  1.00 43.94  ? 205 LEU A HA     1 
ATOM   3112  H  HB2    . LEU A 1 225 ? 32.473  14.031 -33.826  1.00 44.25  ? 205 LEU A HB2    1 
ATOM   3113  H  HB3    . LEU A 1 225 ? 31.353  12.958 -34.113  1.00 44.25  ? 205 LEU A HB3    1 
ATOM   3114  H  HG     . LEU A 1 225 ? 30.804  15.285 -32.636  1.00 40.65  ? 205 LEU A HG     1 
ATOM   3115  H  HD11   . LEU A 1 225 ? 29.943  16.241 -34.584  1.00 35.11  ? 205 LEU A HD11   1 
ATOM   3116  H  HD12   . LEU A 1 225 ? 31.499  15.963 -34.745  1.00 35.11  ? 205 LEU A HD12   1 
ATOM   3117  H  HD13   . LEU A 1 225 ? 30.445  14.984 -35.418  1.00 35.11  ? 205 LEU A HD13   1 
ATOM   3118  H  HD21   . LEU A 1 225 ? 28.574  14.835 -33.122  1.00 40.82  ? 205 LEU A HD21   1 
ATOM   3119  H  HD22   . LEU A 1 225 ? 29.009  13.527 -33.913  1.00 40.82  ? 205 LEU A HD22   1 
ATOM   3120  H  HD23   . LEU A 1 225 ? 29.220  13.612 -32.340  1.00 40.82  ? 205 LEU A HD23   1 
ATOM   3121  N  N      . GLN A 1 226 ? 32.553  10.701 -33.187  1.00 45.16  ? 206 GLN A N      1 
ATOM   3122  C  CA     . GLN A 1 226 ? 33.374  9.577  -33.620  1.00 53.56  ? 206 GLN A CA     1 
ATOM   3123  C  C      . GLN A 1 226 ? 33.380  9.497  -35.138  1.00 44.49  ? 206 GLN A C      1 
ATOM   3124  O  O      . GLN A 1 226 ? 32.351  9.702  -35.789  1.00 43.14  ? 206 GLN A O      1 
ATOM   3125  C  CB     . GLN A 1 226 ? 32.885  8.251  -33.020  1.00 72.12  ? 206 GLN A CB     1 
ATOM   3126  C  CG     . GLN A 1 226 ? 33.121  8.116  -31.524  1.00 90.73  ? 206 GLN A CG     1 
ATOM   3127  C  CD     . GLN A 1 226 ? 34.597  8.197  -31.171  1.00 104.46 ? 206 GLN A CD     1 
ATOM   3128  O  OE1    . GLN A 1 226 ? 35.039  9.125  -30.493  1.00 108.54 ? 206 GLN A OE1    1 
ATOM   3129  N  NE2    . GLN A 1 226 ? 35.368  7.218  -31.636  1.00 109.00 ? 206 GLN A NE2    1 
ATOM   3130  H  H      . GLN A 1 226 ? 31.725  10.625 -33.406  1.00 54.31  ? 206 GLN A H      1 
ATOM   3131  H  HA     . GLN A 1 226 ? 34.286  9.721  -33.324  1.00 64.39  ? 206 GLN A HA     1 
ATOM   3132  H  HB2    . GLN A 1 226 ? 31.931  8.171  -33.177  1.00 86.67  ? 206 GLN A HB2    1 
ATOM   3133  H  HB3    . GLN A 1 226 ? 33.351  7.521  -33.459  1.00 86.67  ? 206 GLN A HB3    1 
ATOM   3134  H  HG2    . GLN A 1 226 ? 32.660  8.834  -31.064  1.00 108.99 ? 206 GLN A HG2    1 
ATOM   3135  H  HG3    . GLN A 1 226 ? 32.785  7.257  -31.225  1.00 108.99 ? 206 GLN A HG3    1 
ATOM   3136  H  HE21   . GLN A 1 226 ? 35.024  6.588  -32.109  1.00 130.92 ? 206 GLN A HE21   1 
ATOM   3137  H  HE22   . GLN A 1 226 ? 36.211  7.217  -31.465  1.00 130.92 ? 206 GLN A HE22   1 
ATOM   3138  N  N      . PHE A 1 227 ? 34.550  9.183  -35.688  1.00 31.16  ? 207 PHE A N      1 
ATOM   3139  C  CA     . PHE A 1 227 ? 34.758  9.280  -37.124  1.00 25.94  ? 207 PHE A CA     1 
ATOM   3140  C  C      . PHE A 1 227 ? 33.872  8.292  -37.870  1.00 25.14  ? 207 PHE A C      1 
ATOM   3141  O  O      . PHE A 1 227 ? 33.627  7.174  -37.407  1.00 23.00  ? 207 PHE A O      1 
ATOM   3142  C  CB     . PHE A 1 227 ? 36.230  9.030  -37.458  1.00 24.68  ? 207 PHE A CB     1 
ATOM   3143  C  CG     . PHE A 1 227 ? 36.544  9.137  -38.922  1.00 23.29  ? 207 PHE A CG     1 
ATOM   3144  C  CD1    . PHE A 1 227 ? 36.723  10.376 -39.515  1.00 26.33  ? 207 PHE A CD1    1 
ATOM   3145  C  CD2    . PHE A 1 227 ? 36.670  8.002  -39.701  1.00 21.80  ? 207 PHE A CD2    1 
ATOM   3146  C  CE1    . PHE A 1 227 ? 37.012  10.478 -40.862  1.00 26.75  ? 207 PHE A CE1    1 
ATOM   3147  C  CE2    . PHE A 1 227 ? 36.962  8.098  -41.047  1.00 23.38  ? 207 PHE A CE2    1 
ATOM   3148  C  CZ     . PHE A 1 227 ? 37.134  9.337  -41.628  1.00 26.65  ? 207 PHE A CZ     1 
ATOM   3149  H  H      . PHE A 1 227 ? 35.238  8.912  -35.249  1.00 37.51  ? 207 PHE A H      1 
ATOM   3150  H  HA     . PHE A 1 227 ? 34.529  10.175 -37.420  1.00 31.24  ? 207 PHE A HA     1 
ATOM   3151  H  HB2    . PHE A 1 227 ? 36.772  9.683  -36.989  1.00 29.74  ? 207 PHE A HB2    1 
ATOM   3152  H  HB3    . PHE A 1 227 ? 36.468  8.135  -37.168  1.00 29.74  ? 207 PHE A HB3    1 
ATOM   3153  H  HD1    . PHE A 1 227 ? 36.641  11.147 -39.003  1.00 31.71  ? 207 PHE A HD1    1 
ATOM   3154  H  HD2    . PHE A 1 227 ? 36.555  7.164  -39.315  1.00 25.57  ? 207 PHE A HD2    1 
ATOM   3155  H  HE1    . PHE A 1 227 ? 37.129  11.315 -41.251  1.00 32.22  ? 207 PHE A HE1    1 
ATOM   3156  H  HE2    . PHE A 1 227 ? 37.043  7.327  -41.562  1.00 28.17  ? 207 PHE A HE2    1 
ATOM   3157  H  HZ     . PHE A 1 227 ? 37.330  9.404  -42.535  1.00 32.10  ? 207 PHE A HZ     1 
ATOM   3158  N  N      . VAL A 1 228 ? 33.393  8.721  -39.038  1.00 29.44  ? 208 VAL A N      1 
ATOM   3159  C  CA     . VAL A 1 228 ? 32.545  7.907  -39.893  1.00 25.38  ? 208 VAL A CA     1 
ATOM   3160  C  C      . VAL A 1 228 ? 33.156  7.962  -41.288  1.00 22.04  ? 208 VAL A C      1 
ATOM   3161  O  O      . VAL A 1 228 ? 33.216  9.038  -41.891  1.00 22.31  ? 208 VAL A O      1 
ATOM   3162  C  CB     . VAL A 1 228 ? 31.092  8.412  -39.927  1.00 24.94  ? 208 VAL A CB     1 
ATOM   3163  C  CG1    . VAL A 1 228 ? 30.219  7.496  -40.777  1.00 25.71  ? 208 VAL A CG1    1 
ATOM   3164  C  CG2    . VAL A 1 228 ? 30.536  8.545  -38.514  1.00 24.79  ? 208 VAL A CG2    1 
ATOM   3165  H  H      . VAL A 1 228 ? 33.553  9.501  -39.361  1.00 35.45  ? 208 VAL A H      1 
ATOM   3166  H  HA     . VAL A 1 228 ? 32.550  6.988  -39.585  1.00 30.57  ? 208 VAL A HA     1 
ATOM   3167  H  HB     . VAL A 1 228 ? 31.078  9.293  -40.333  1.00 30.05  ? 208 VAL A HB     1 
ATOM   3168  H  HG11   . VAL A 1 228 ? 29.311  7.838  -40.780  1.00 30.98  ? 208 VAL A HG11   1 
ATOM   3169  H  HG12   . VAL A 1 228 ? 30.569  7.477  -41.682  1.00 30.98  ? 208 VAL A HG12   1 
ATOM   3170  H  HG13   . VAL A 1 228 ? 30.235  6.603  -40.398  1.00 30.98  ? 208 VAL A HG13   1 
ATOM   3171  H  HG21   . VAL A 1 228 ? 29.621  8.864  -38.564  1.00 29.87  ? 208 VAL A HG21   1 
ATOM   3172  H  HG22   . VAL A 1 228 ? 30.560  7.676  -38.083  1.00 29.87  ? 208 VAL A HG22   1 
ATOM   3173  H  HG23   . VAL A 1 228 ? 31.080  9.176  -38.019  1.00 29.87  ? 208 VAL A HG23   1 
ATOM   3174  N  N      . PRO A 1 229 ? 33.622  6.849  -41.849  1.00 21.10  ? 209 PRO A N      1 
ATOM   3175  C  CA     . PRO A 1 229 ? 34.197  6.891  -43.200  1.00 22.88  ? 209 PRO A CA     1 
ATOM   3176  C  C      . PRO A 1 229 ? 33.144  7.262  -44.229  1.00 26.35  ? 209 PRO A C      1 
ATOM   3177  O  O      . PRO A 1 229 ? 32.049  6.680  -44.239  1.00 25.03  ? 209 PRO A O      1 
ATOM   3178  C  CB     . PRO A 1 229 ? 34.715  5.459  -43.415  1.00 21.88  ? 209 PRO A CB     1 
ATOM   3179  C  CG     . PRO A 1 229 ? 34.845  4.882  -42.054  1.00 22.44  ? 209 PRO A CG     1 
ATOM   3180  C  CD     . PRO A 1 229 ? 33.781  5.523  -41.227  1.00 21.95  ? 209 PRO A CD     1 
ATOM   3181  H  HA     . PRO A 1 229 ? 34.936  7.518  -43.241  1.00 27.58  ? 209 PRO A HA     1 
ATOM   3182  H  HB2    . PRO A 1 229 ? 34.074  4.956  -43.941  1.00 25.66  ? 209 PRO A HB2    1 
ATOM   3183  H  HB3    . PRO A 1 229 ? 35.577  5.487  -43.858  1.00 25.66  ? 209 PRO A HB3    1 
ATOM   3184  H  HG2    . PRO A 1 229 ? 34.711  3.922  -42.095  1.00 26.33  ? 209 PRO A HG2    1 
ATOM   3185  H  HG3    . PRO A 1 229 ? 35.723  5.087  -41.697  1.00 26.33  ? 209 PRO A HG3    1 
ATOM   3186  H  HD2    . PRO A 1 229 ? 32.954  5.019  -41.289  1.00 25.75  ? 209 PRO A HD2    1 
ATOM   3187  H  HD3    . PRO A 1 229 ? 34.075  5.614  -40.307  1.00 25.75  ? 209 PRO A HD3    1 
ATOM   3188  N  N      . PRO A 1 230 ? 33.430  8.229  -45.109  1.00 30.07  ? 210 PRO A N      1 
ATOM   3189  C  CA     . PRO A 1 230 ? 32.440  8.584  -46.143  1.00 32.08  ? 210 PRO A CA     1 
ATOM   3190  C  C      . PRO A 1 230 ? 32.035  7.425  -47.038  1.00 33.50  ? 210 PRO A C      1 
ATOM   3191  O  O      . PRO A 1 230 ? 30.914  7.429  -47.562  1.00 31.98  ? 210 PRO A O      1 
ATOM   3192  C  CB     . PRO A 1 230 ? 33.147  9.691  -46.938  1.00 29.63  ? 210 PRO A CB     1 
ATOM   3193  C  CG     . PRO A 1 230 ? 34.101  10.292 -45.974  1.00 27.98  ? 210 PRO A CG     1 
ATOM   3194  C  CD     . PRO A 1 230 ? 34.572  9.161  -45.105  1.00 29.23  ? 210 PRO A CD     1 
ATOM   3195  H  HA     . PRO A 1 230 ? 31.645  8.953  -45.727  1.00 38.61  ? 210 PRO A HA     1 
ATOM   3196  H  HB2    . PRO A 1 230 ? 33.618  9.303  -47.692  1.00 35.67  ? 210 PRO A HB2    1 
ATOM   3197  H  HB3    . PRO A 1 230 ? 32.498  10.347 -47.236  1.00 35.67  ? 210 PRO A HB3    1 
ATOM   3198  H  HG2    . PRO A 1 230 ? 34.845  10.686 -46.455  1.00 33.69  ? 210 PRO A HG2    1 
ATOM   3199  H  HG3    . PRO A 1 230 ? 33.645  10.964 -45.442  1.00 33.69  ? 210 PRO A HG3    1 
ATOM   3200  H  HD2    . PRO A 1 230 ? 35.354  8.739  -45.494  1.00 35.19  ? 210 PRO A HD2    1 
ATOM   3201  H  HD3    . PRO A 1 230 ? 34.749  9.477  -44.205  1.00 35.19  ? 210 PRO A HD3    1 
ATOM   3202  N  N      . SER A 1 231 ? 32.903  6.435  -47.236  1.00 36.90  ? 211 SER A N      1 
ATOM   3203  C  CA     . SER A 1 231 ? 32.556  5.333  -48.135  1.00 41.95  ? 211 SER A CA     1 
ATOM   3204  C  C      . SER A 1 231 ? 31.505  4.382  -47.549  1.00 37.65  ? 211 SER A C      1 
ATOM   3205  O  O      . SER A 1 231 ? 31.211  3.376  -48.206  1.00 41.17  ? 211 SER A O      1 
ATOM   3206  C  CB     . SER A 1 231 ? 33.814  4.549  -48.512  1.00 51.51  ? 211 SER A CB     1 
ATOM   3207  O  OG     . SER A 1 231 ? 34.472  4.052  -47.360  1.00 58.77  ? 211 SER A OG     1 
ATOM   3208  H  H      . SER A 1 231 ? 33.680  6.376  -46.874  1.00 44.40  ? 211 SER A H      1 
ATOM   3209  H  HA     . SER A 1 231 ? 32.189  5.707  -48.951  1.00 50.45  ? 211 SER A HA     1 
ATOM   3210  H  HB2    . SER A 1 231 ? 33.561  3.802  -49.077  1.00 61.93  ? 211 SER A HB2    1 
ATOM   3211  H  HB3    . SER A 1 231 ? 34.419  5.136  -48.991  1.00 61.93  ? 211 SER A HB3    1 
ATOM   3212  H  HG     . SER A 1 231 ? 33.960  3.540  -46.935  1.00 70.64  ? 211 SER A HG     1 
ATOM   3213  N  N      . THR A 1 232 ? 30.921  4.645  -46.379  1.00 30.91  ? 212 THR A N      1 
ATOM   3214  C  CA     . THR A 1 232 ? 29.914  3.758  -45.810  1.00 28.91  ? 212 THR A CA     1 
ATOM   3215  C  C      . THR A 1 232 ? 28.496  4.190  -46.154  1.00 30.99  ? 212 THR A C      1 
ATOM   3216  O  O      . THR A 1 232 ? 27.560  3.407  -45.957  1.00 30.72  ? 212 THR A O      1 
ATOM   3217  C  CB     . THR A 1 232 ? 30.056  3.685  -44.281  1.00 30.23  ? 212 THR A CB     1 
ATOM   3218  O  OG1    . THR A 1 232 ? 29.762  4.962  -43.701  1.00 33.12  ? 212 THR A OG1    1 
ATOM   3219  C  CG2    . THR A 1 232 ? 31.467  3.272  -43.884  1.00 29.42  ? 212 THR A CG2    1 
ATOM   3220  H  H      . THR A 1 232 ? 31.093  5.334  -45.895  1.00 37.21  ? 212 THR A H      1 
ATOM   3221  H  HA     . THR A 1 232 ? 30.047  2.865  -46.164  1.00 34.81  ? 212 THR A HA     1 
ATOM   3222  H  HB     . THR A 1 232 ? 29.436  3.025  -43.933  1.00 36.40  ? 212 THR A HB     1 
ATOM   3223  H  HG1    . THR A 1 232 ? 30.294  5.541  -43.998  1.00 39.86  ? 212 THR A HG1    1 
ATOM   3224  H  HG21   . THR A 1 232 ? 31.540  3.231  -42.918  1.00 35.43  ? 212 THR A HG21   1 
ATOM   3225  H  HG22   . THR A 1 232 ? 31.673  2.400  -44.254  1.00 35.43  ? 212 THR A HG22   1 
ATOM   3226  H  HG23   . THR A 1 232 ? 32.108  3.917  -44.222  1.00 35.43  ? 212 THR A HG23   1 
ATOM   3227  N  N      . ILE A 1 233 ? 28.319  5.407  -46.661  1.00 34.14  ? 213 ILE A N      1 
ATOM   3228  C  CA     . ILE A 1 233 ? 27.004  5.914  -47.037  1.00 31.92  ? 213 ILE A CA     1 
ATOM   3229  C  C      . ILE A 1 233 ? 26.587  5.285  -48.359  1.00 29.48  ? 213 ILE A C      1 
ATOM   3230  O  O      . ILE A 1 233 ? 27.334  5.326  -49.343  1.00 29.97  ? 213 ILE A O      1 
ATOM   3231  C  CB     . ILE A 1 233 ? 27.022  7.449  -47.130  1.00 32.06  ? 213 ILE A CB     1 
ATOM   3232  C  CG1    . ILE A 1 233 ? 27.458  8.066  -45.792  1.00 34.56  ? 213 ILE A CG1    1 
ATOM   3233  C  CG2    . ILE A 1 233 ? 25.665  7.991  -47.571  1.00 28.31  ? 213 ILE A CG2    1 
ATOM   3234  C  CD1    . ILE A 1 233 ? 26.518  7.780  -44.633  1.00 33.55  ? 213 ILE A CD1    1 
ATOM   3235  H  H      . ILE A 1 233 ? 28.957  5.967  -46.798  1.00 41.09  ? 213 ILE A H      1 
ATOM   3236  H  HA     . ILE A 1 233 ? 26.356  5.658  -46.361  1.00 38.43  ? 213 ILE A HA     1 
ATOM   3237  H  HB     . ILE A 1 233 ? 27.676  7.700  -47.801  1.00 38.59  ? 213 ILE A HB     1 
ATOM   3238  H  HG12   . ILE A 1 233 ? 28.331  7.713  -45.558  1.00 41.59  ? 213 ILE A HG12   1 
ATOM   3239  H  HG13   . ILE A 1 233 ? 27.512  9.029  -45.897  1.00 41.59  ? 213 ILE A HG13   1 
ATOM   3240  H  HG21   . ILE A 1 233 ? 25.712  8.959  -47.619  1.00 34.09  ? 213 ILE A HG21   1 
ATOM   3241  H  HG22   . ILE A 1 233 ? 25.449  7.627  -48.444  1.00 34.09  ? 213 ILE A HG22   1 
ATOM   3242  H  HG23   . ILE A 1 233 ? 24.993  7.724  -46.925  1.00 34.09  ? 213 ILE A HG23   1 
ATOM   3243  H  HD11   . ILE A 1 233 ? 26.867  8.203  -43.833  1.00 40.38  ? 213 ILE A HD11   1 
ATOM   3244  H  HD12   . ILE A 1 233 ? 25.641  8.138  -44.843  1.00 40.38  ? 213 ILE A HD12   1 
ATOM   3245  H  HD13   . ILE A 1 233 ? 26.461  6.821  -44.503  1.00 40.38  ? 213 ILE A HD13   1 
ATOM   3246  N  N      . ASP A 1 234 ? 25.389  4.705  -48.383  1.00 32.75  ? 214 ASP A N      1 
ATOM   3247  C  CA     . ASP A 1 234 ? 24.860  4.022  -49.557  1.00 35.33  ? 214 ASP A CA     1 
ATOM   3248  C  C      . ASP A 1 234 ? 23.578  4.724  -49.983  1.00 37.16  ? 214 ASP A C      1 
ATOM   3249  O  O      . ASP A 1 234 ? 22.596  4.739  -49.232  1.00 43.29  ? 214 ASP A O      1 
ATOM   3250  C  CB     . ASP A 1 234 ? 24.596  2.547  -49.248  1.00 33.95  ? 214 ASP A CB     1 
ATOM   3251  C  CG     . ASP A 1 234 ? 24.355  1.720  -50.495  1.00 32.95  ? 214 ASP A CG     1 
ATOM   3252  O  OD1    . ASP A 1 234 ? 23.899  2.284  -51.511  1.00 31.66  ? 214 ASP A OD1    1 
ATOM   3253  O  OD2    . ASP A 1 234 ? 24.617  0.499  -50.455  1.00 33.75  ? 214 ASP A OD2    1 
ATOM   3254  H  H      . ASP A 1 234 ? 24.851  4.695  -47.712  1.00 39.42  ? 214 ASP A H      1 
ATOM   3255  H  HA     . ASP A 1 234 ? 25.500  4.077  -50.284  1.00 42.52  ? 214 ASP A HA     1 
ATOM   3256  H  HB2    . ASP A 1 234 ? 25.365  2.178  -48.788  1.00 40.86  ? 214 ASP A HB2    1 
ATOM   3257  H  HB3    . ASP A 1 234 ? 23.808  2.478  -48.686  1.00 40.86  ? 214 ASP A HB3    1 
ATOM   3258  N  N      . VAL A 1 235 ? 23.587  5.301  -51.188  1.00 30.22  ? 215 VAL A N      1 
ATOM   3259  C  CA     . VAL A 1 235 ? 22.418  6.019  -51.688  1.00 28.04  ? 215 VAL A CA     1 
ATOM   3260  C  C      . VAL A 1 235 ? 21.224  5.098  -51.895  1.00 29.93  ? 215 VAL A C      1 
ATOM   3261  O  O      . VAL A 1 235 ? 20.078  5.557  -51.863  1.00 29.90  ? 215 VAL A O      1 
ATOM   3262  C  CB     . VAL A 1 235 ? 22.779  6.765  -52.993  1.00 23.87  ? 215 VAL A CB     1 
ATOM   3263  C  CG1    . VAL A 1 235 ? 21.532  7.335  -53.668  1.00 22.40  ? 215 VAL A CG1    1 
ATOM   3264  C  CG2    . VAL A 1 235 ? 23.774  7.878  -52.704  1.00 21.12  ? 215 VAL A CG2    1 
ATOM   3265  H  H      . VAL A 1 235 ? 24.254  5.289  -51.731  1.00 36.38  ? 215 VAL A H      1 
ATOM   3266  H  HA     . VAL A 1 235 ? 22.163  6.686  -51.031  1.00 33.77  ? 215 VAL A HA     1 
ATOM   3267  H  HB     . VAL A 1 235 ? 23.196  6.141  -53.608  1.00 28.76  ? 215 VAL A HB     1 
ATOM   3268  H  HG11   . VAL A 1 235 ? 21.796  7.794  -54.481  1.00 27.00  ? 215 VAL A HG11   1 
ATOM   3269  H  HG12   . VAL A 1 235 ? 20.928  6.606  -53.880  1.00 27.00  ? 215 VAL A HG12   1 
ATOM   3270  H  HG13   . VAL A 1 235 ? 21.101  7.957  -53.061  1.00 27.00  ? 215 VAL A HG13   1 
ATOM   3271  H  HG21   . VAL A 1 235 ? 23.988  8.333  -53.533  1.00 25.47  ? 215 VAL A HG21   1 
ATOM   3272  H  HG22   . VAL A 1 235 ? 23.375  8.502  -52.077  1.00 25.47  ? 215 VAL A HG22   1 
ATOM   3273  H  HG23   . VAL A 1 235 ? 24.577  7.492  -52.321  1.00 25.47  ? 215 VAL A HG23   1 
ATOM   3274  N  N      . SER A 1 236 ? 21.457  3.805  -52.104  1.00 32.37  ? 216 SER A N      1 
ATOM   3275  C  CA     . SER A 1 236 ? 20.364  2.863  -52.318  1.00 37.80  ? 216 SER A CA     1 
ATOM   3276  C  C      . SER A 1 236 ? 19.656  2.468  -51.026  1.00 38.54  ? 216 SER A C      1 
ATOM   3277  O  O      . SER A 1 236 ? 18.792  1.585  -51.063  1.00 38.89  ? 216 SER A O      1 
ATOM   3278  C  CB     . SER A 1 236 ? 20.881  1.604  -53.020  1.00 42.41  ? 216 SER A CB     1 
ATOM   3279  O  OG     . SER A 1 236 ? 21.709  0.840  -52.161  1.00 43.84  ? 216 SER A OG     1 
ATOM   3280  H  H      . SER A 1 236 ? 22.239  3.448  -52.128  1.00 38.96  ? 216 SER A H      1 
ATOM   3281  H  HA     . SER A 1 236 ? 19.707  3.277  -52.899  1.00 45.48  ? 216 SER A HA     1 
ATOM   3282  H  HB2    . SER A 1 236 ? 20.124  1.062  -53.292  1.00 51.01  ? 216 SER A HB2    1 
ATOM   3283  H  HB3    . SER A 1 236 ? 21.395  1.868  -53.800  1.00 51.01  ? 216 SER A HB3    1 
ATOM   3284  H  HG     . SER A 1 236 ? 22.371  1.298  -51.918  1.00 52.72  ? 216 SER A HG     1 
ATOM   3285  N  N      . ARG A 1 237 ? 19.997  3.094  -49.895  1.00 38.37  ? 217 ARG A N      1 
ATOM   3286  C  CA     . ARG A 1 237 ? 19.426  2.734  -48.603  1.00 41.80  ? 217 ARG A CA     1 
ATOM   3287  C  C      . ARG A 1 237 ? 18.906  3.942  -47.830  1.00 31.91  ? 217 ARG A C      1 
ATOM   3288  O  O      . ARG A 1 237 ? 18.619  3.817  -46.634  1.00 30.14  ? 217 ARG A O      1 
ATOM   3289  C  CB     . ARG A 1 237 ? 20.471  1.978  -47.770  1.00 54.69  ? 217 ARG A CB     1 
ATOM   3290  C  CG     . ARG A 1 237 ? 20.871  0.648  -48.398  1.00 67.95  ? 217 ARG A CG     1 
ATOM   3291  C  CD     . ARG A 1 237 ? 22.158  0.070  -47.821  1.00 79.32  ? 217 ARG A CD     1 
ATOM   3292  N  NE     . ARG A 1 237 ? 21.965  -0.641 -46.561  1.00 88.68  ? 217 ARG A NE     1 
ATOM   3293  C  CZ     . ARG A 1 237 ? 22.956  -1.172 -45.851  1.00 94.16  ? 217 ARG A CZ     1 
ATOM   3294  N  NH1    . ARG A 1 237 ? 24.210  -1.073 -46.276  1.00 95.75  ? 217 ARG A NH1    1 
ATOM   3295  N  NH2    . ARG A 1 237 ? 22.697  -1.808 -44.716  1.00 95.79  ? 217 ARG A NH2    1 
ATOM   3296  H  H      . ARG A 1 237 ? 20.564  3.739  -49.855  1.00 46.17  ? 217 ARG A H      1 
ATOM   3297  H  HA     . ARG A 1 237 ? 18.678  2.135  -48.751  1.00 50.28  ? 217 ARG A HA     1 
ATOM   3298  H  HB2    . ARG A 1 237 ? 21.268  2.525  -47.691  1.00 65.74  ? 217 ARG A HB2    1 
ATOM   3299  H  HB3    . ARG A 1 237 ? 20.103  1.797  -46.891  1.00 65.74  ? 217 ARG A HB3    1 
ATOM   3300  H  HG2    . ARG A 1 237 ? 20.162  0.003  -48.248  1.00 81.66  ? 217 ARG A HG2    1 
ATOM   3301  H  HG3    . ARG A 1 237 ? 21.004  0.777  -49.350  1.00 81.66  ? 217 ARG A HG3    1 
ATOM   3302  H  HD2    . ARG A 1 237 ? 22.534  -0.555 -48.460  1.00 95.30  ? 217 ARG A HD2    1 
ATOM   3303  H  HD3    . ARG A 1 237 ? 22.782  0.794  -47.662  1.00 95.30  ? 217 ARG A HD3    1 
ATOM   3304  H  HE     . ARG A 1 237 ? 21.176  -0.645 -46.218  1.00 106.54 ? 217 ARG A HE     1 
ATOM   3305  H  HH11   . ARG A 1 237 ? 24.383  -0.663 -47.011  1.00 115.02 ? 217 ARG A HH11   1 
ATOM   3306  H  HH12   . ARG A 1 237 ? 24.849  -1.418 -45.814  1.00 115.02 ? 217 ARG A HH12   1 
ATOM   3307  H  HH21   . ARG A 1 237 ? 21.887  -1.875 -44.436  1.00 115.06 ? 217 ARG A HH21   1 
ATOM   3308  H  HH22   . ARG A 1 237 ? 23.340  -2.150 -44.258  1.00 115.06 ? 217 ARG A HH22   1 
ATOM   3309  N  N      . VAL A 1 238 ? 18.772  5.098  -48.478  1.00 26.68  ? 218 VAL A N      1 
ATOM   3310  C  CA     . VAL A 1 238 ? 18.327  6.326  -47.830  1.00 25.03  ? 218 VAL A CA     1 
ATOM   3311  C  C      . VAL A 1 238 ? 16.888  6.612  -48.235  1.00 28.33  ? 218 VAL A C      1 
ATOM   3312  O  O      . VAL A 1 238 ? 16.420  6.185  -49.297  1.00 24.07  ? 218 VAL A O      1 
ATOM   3313  C  CB     . VAL A 1 238 ? 19.237  7.523  -48.178  1.00 24.74  ? 218 VAL A CB     1 
ATOM   3314  C  CG1    . VAL A 1 238 ? 20.685  7.212  -47.829  1.00 27.13  ? 218 VAL A CG1    1 
ATOM   3315  C  CG2    . VAL A 1 238 ? 19.107  7.896  -49.651  1.00 24.86  ? 218 VAL A CG2    1 
ATOM   3316  H  H      . VAL A 1 238 ? 18.938  5.197  -49.316  1.00 32.14  ? 218 VAL A H      1 
ATOM   3317  H  HA     . VAL A 1 238 ? 18.349  6.202  -46.868  1.00 30.16  ? 218 VAL A HA     1 
ATOM   3318  H  HB     . VAL A 1 238 ? 18.963  8.290  -47.652  1.00 29.80  ? 218 VAL A HB     1 
ATOM   3319  H  HG11   . VAL A 1 238 ? 21.236  7.977  -48.057  1.00 32.68  ? 218 VAL A HG11   1 
ATOM   3320  H  HG12   . VAL A 1 238 ? 20.748  7.029  -46.879  1.00 32.68  ? 218 VAL A HG12   1 
ATOM   3321  H  HG13   . VAL A 1 238 ? 20.971  6.435  -48.335  1.00 32.68  ? 218 VAL A HG13   1 
ATOM   3322  H  HG21   . VAL A 1 238 ? 19.689  8.649  -49.839  1.00 29.95  ? 218 VAL A HG21   1 
ATOM   3323  H  HG22   . VAL A 1 238 ? 19.366  7.135  -50.194  1.00 29.95  ? 218 VAL A HG22   1 
ATOM   3324  H  HG23   . VAL A 1 238 ? 18.185  8.137  -49.835  1.00 29.95  ? 218 VAL A HG23   1 
ATOM   3325  N  N      . GLU A 1 239 ? 16.182  7.344  -47.372  1.00 34.68  ? 219 GLU A N      1 
ATOM   3326  C  CA     . GLU A 1 239 ? 14.795  7.703  -47.631  1.00 39.00  ? 219 GLU A CA     1 
ATOM   3327  C  C      . GLU A 1 239 ? 14.733  8.934  -48.535  1.00 31.43  ? 219 GLU A C      1 
ATOM   3328  O  O      . GLU A 1 239 ? 15.474  9.897  -48.320  1.00 26.88  ? 219 GLU A O      1 
ATOM   3329  C  CB     . GLU A 1 239 ? 14.066  8.003  -46.322  1.00 48.82  ? 219 GLU A CB     1 
ATOM   3330  C  CG     . GLU A 1 239 ? 13.816  6.794  -45.439  1.00 58.72  ? 219 GLU A CG     1 
ATOM   3331  C  CD     . GLU A 1 239 ? 12.638  5.960  -45.908  1.00 69.52  ? 219 GLU A CD     1 
ATOM   3332  O  OE1    . GLU A 1 239 ? 12.365  4.913  -45.283  1.00 74.34  ? 219 GLU A OE1    1 
ATOM   3333  O  OE2    . GLU A 1 239 ? 11.982  6.351  -46.897  1.00 72.45  ? 219 GLU A OE2    1 
ATOM   3334  H  H      . GLU A 1 239 ? 16.488  7.644  -46.626  1.00 41.73  ? 219 GLU A H      1 
ATOM   3335  H  HA     . GLU A 1 239 ? 14.346  6.968  -48.076  1.00 46.92  ? 219 GLU A HA     1 
ATOM   3336  H  HB2    . GLU A 1 239 ? 14.597  8.634  -45.811  1.00 58.70  ? 219 GLU A HB2    1 
ATOM   3337  H  HB3    . GLU A 1 239 ? 13.205  8.396  -46.531  1.00 58.70  ? 219 GLU A HB3    1 
ATOM   3338  H  HG2    . GLU A 1 239 ? 14.605  6.229  -45.446  1.00 70.58  ? 219 GLU A HG2    1 
ATOM   3339  H  HG3    . GLU A 1 239 ? 13.630  7.095  -44.536  1.00 70.58  ? 219 GLU A HG3    1 
ATOM   3340  N  N      . PRO A 1 240 ? 13.870  8.935  -49.556  1.00 30.48  ? 220 PRO A N      1 
ATOM   3341  C  CA     . PRO A 1 240 ? 13.731  10.152 -50.376  1.00 32.63  ? 220 PRO A CA     1 
ATOM   3342  C  C      . PRO A 1 240 ? 13.303  11.359 -49.564  1.00 32.30  ? 220 PRO A C      1 
ATOM   3343  O  O      . PRO A 1 240 ? 13.707  12.486 -49.877  1.00 28.90  ? 220 PRO A O      1 
ATOM   3344  C  CB     . PRO A 1 240 ? 12.669  9.761  -51.415  1.00 31.56  ? 220 PRO A CB     1 
ATOM   3345  C  CG     . PRO A 1 240 ? 12.685  8.277  -51.445  1.00 29.56  ? 220 PRO A CG     1 
ATOM   3346  C  CD     . PRO A 1 240 ? 13.025  7.838  -50.058  1.00 29.19  ? 220 PRO A CD     1 
ATOM   3347  H  HA     . PRO A 1 240 ? 14.566  10.349 -50.829  1.00 39.27  ? 220 PRO A HA     1 
ATOM   3348  H  HB2    . PRO A 1 240 ? 11.801  10.089 -51.134  1.00 37.98  ? 220 PRO A HB2    1 
ATOM   3349  H  HB3    . PRO A 1 240 ? 12.911  10.124 -52.281  1.00 37.98  ? 220 PRO A HB3    1 
ATOM   3350  H  HG2    . PRO A 1 240 ? 11.809  7.948  -51.701  1.00 35.59  ? 220 PRO A HG2    1 
ATOM   3351  H  HG3    . PRO A 1 240 ? 13.359  7.972  -52.073  1.00 35.59  ? 220 PRO A HG3    1 
ATOM   3352  H  HD2    . PRO A 1 240 ? 12.221  7.757  -49.521  1.00 35.15  ? 220 PRO A HD2    1 
ATOM   3353  H  HD3    . PRO A 1 240 ? 13.526  7.008  -50.078  1.00 35.15  ? 220 PRO A HD3    1 
ATOM   3354  N  N      . LEU A 1 241 ? 12.490  11.152 -48.528  1.00 33.72  ? 221 LEU A N      1 
ATOM   3355  C  CA     . LEU A 1 241 ? 12.053  12.213 -47.623  1.00 29.87  ? 221 LEU A CA     1 
ATOM   3356  C  C      . LEU A 1 241 ? 12.247  11.693 -46.206  1.00 30.37  ? 221 LEU A C      1 
ATOM   3357  O  O      . LEU A 1 241 ? 11.331  11.096 -45.620  1.00 28.41  ? 221 LEU A O      1 
ATOM   3358  C  CB     . LEU A 1 241 ? 10.600  12.606 -47.881  1.00 26.02  ? 221 LEU A CB     1 
ATOM   3359  C  CG     . LEU A 1 241 ? 10.095  13.816 -47.090  1.00 25.18  ? 221 LEU A CG     1 
ATOM   3360  C  CD1    . LEU A 1 241 ? 10.797  15.091 -47.533  1.00 23.43  ? 221 LEU A CD1    1 
ATOM   3361  C  CD2    . LEU A 1 241 ? 8.588   13.965 -47.230  1.00 29.22  ? 221 LEU A CD2    1 
ATOM   3362  H  H      . LEU A 1 241 ? 12.170  10.381 -48.325  1.00 40.59  ? 221 LEU A H      1 
ATOM   3363  H  HA     . LEU A 1 241 ? 12.612  12.996 -47.745  1.00 35.96  ? 221 LEU A HA     1 
ATOM   3364  H  HB2    . LEU A 1 241 ? 10.500  12.813 -48.824  1.00 31.34  ? 221 LEU A HB2    1 
ATOM   3365  H  HB3    . LEU A 1 241 ? 10.033  11.853 -47.653  1.00 31.34  ? 221 LEU A HB3    1 
ATOM   3366  H  HG     . LEU A 1 241 ? 10.294  13.680 -46.151  1.00 30.33  ? 221 LEU A HG     1 
ATOM   3367  H  HD11   . LEU A 1 241 ? 10.456  15.836 -47.014  1.00 28.24  ? 221 LEU A HD11   1 
ATOM   3368  H  HD12   . LEU A 1 241 ? 11.751  14.994 -47.385  1.00 28.24  ? 221 LEU A HD12   1 
ATOM   3369  H  HD13   . LEU A 1 241 ? 10.622  15.237 -48.476  1.00 28.24  ? 221 LEU A HD13   1 
ATOM   3370  H  HD21   . LEU A 1 241 ? 8.299   14.737 -46.719  1.00 35.19  ? 221 LEU A HD21   1 
ATOM   3371  H  HD22   . LEU A 1 241 ? 8.368   14.086 -48.167  1.00 35.19  ? 221 LEU A HD22   1 
ATOM   3372  H  HD23   . LEU A 1 241 ? 8.159   13.164 -46.890  1.00 35.19  ? 221 LEU A HD23   1 
ATOM   3373  N  N      . PRO A 1 242 ? 13.428  11.891 -45.626  1.00 31.86  ? 222 PRO A N      1 
ATOM   3374  C  CA     . PRO A 1 242 ? 13.711  11.336 -44.295  1.00 32.01  ? 222 PRO A CA     1 
ATOM   3375  C  C      . PRO A 1 242 ? 12.771  11.900 -43.246  1.00 32.79  ? 222 PRO A C      1 
ATOM   3376  O  O      . PRO A 1 242 ? 12.132  12.940 -43.465  1.00 34.01  ? 222 PRO A O      1 
ATOM   3377  C  CB     . PRO A 1 242 ? 15.164  11.763 -44.035  1.00 31.52  ? 222 PRO A CB     1 
ATOM   3378  C  CG     . PRO A 1 242 ? 15.742  11.985 -45.390  1.00 30.35  ? 222 PRO A CG     1 
ATOM   3379  C  CD     . PRO A 1 242 ? 14.620  12.519 -46.223  1.00 30.09  ? 222 PRO A CD     1 
ATOM   3380  H  HA     . PRO A 1 242 ? 13.651  10.368 -44.306  1.00 38.53  ? 222 PRO A HA     1 
ATOM   3381  H  HB2    . PRO A 1 242 ? 15.178  12.582 -43.516  1.00 37.94  ? 222 PRO A HB2    1 
ATOM   3382  H  HB3    . PRO A 1 242 ? 15.636  11.053 -43.571  1.00 37.94  ? 222 PRO A HB3    1 
ATOM   3383  H  HG2    . PRO A 1 242 ? 16.464  12.631 -45.334  1.00 36.53  ? 222 PRO A HG2    1 
ATOM   3384  H  HG3    . PRO A 1 242 ? 16.064  11.143 -45.749  1.00 36.53  ? 222 PRO A HG3    1 
ATOM   3385  H  HD2    . PRO A 1 242 ? 14.570  13.484 -46.144  1.00 36.23  ? 222 PRO A HD2    1 
ATOM   3386  H  HD3    . PRO A 1 242 ? 14.722  12.241 -47.147  1.00 36.23  ? 222 PRO A HD3    1 
ATOM   3387  N  N      . PRO A 1 243 ? 12.658  11.242 -42.083  1.00 31.99  ? 223 PRO A N      1 
ATOM   3388  C  CA     . PRO A 1 243 ? 11.722  11.719 -41.054  1.00 33.83  ? 223 PRO A CA     1 
ATOM   3389  C  C      . PRO A 1 243 ? 12.181  12.986 -40.349  1.00 40.05  ? 223 PRO A C      1 
ATOM   3390  O  O      . PRO A 1 243 ? 13.264  13.513 -40.622  1.00 41.20  ? 223 PRO A O      1 
ATOM   3391  C  CB     . PRO A 1 243 ? 11.649  10.543 -40.066  1.00 32.61  ? 223 PRO A CB     1 
ATOM   3392  C  CG     . PRO A 1 243 ? 12.366  9.399  -40.721  1.00 32.64  ? 223 PRO A CG     1 
ATOM   3393  C  CD     . PRO A 1 243 ? 13.339  10.005 -41.669  1.00 30.96  ? 223 PRO A CD     1 
ATOM   3394  H  HA     . PRO A 1 243 ? 10.844  11.867 -41.440  1.00 40.71  ? 223 PRO A HA     1 
ATOM   3395  H  HB2    . PRO A 1 243 ? 12.089  10.790 -39.237  1.00 39.24  ? 223 PRO A HB2    1 
ATOM   3396  H  HB3    . PRO A 1 243 ? 10.721  10.314 -39.903  1.00 39.24  ? 223 PRO A HB3    1 
ATOM   3397  H  HG2    . PRO A 1 243 ? 12.829  8.878  -40.046  1.00 39.29  ? 223 PRO A HG2    1 
ATOM   3398  H  HG3    . PRO A 1 243 ? 11.727  8.846  -41.197  1.00 39.29  ? 223 PRO A HG3    1 
ATOM   3399  H  HD2    . PRO A 1 243 ? 14.172  10.210 -41.217  1.00 37.27  ? 223 PRO A HD2    1 
ATOM   3400  H  HD3    . PRO A 1 243 ? 13.479  9.423  -42.432  1.00 37.27  ? 223 PRO A HD3    1 
ATOM   3401  N  N      . HIS A 1 244 ? 11.349  13.473 -39.433  1.00 45.49  ? 224 HIS A N      1 
ATOM   3402  C  CA     . HIS A 1 244 ? 11.624  14.676 -38.663  1.00 49.54  ? 224 HIS A CA     1 
ATOM   3403  C  C      . HIS A 1 244 ? 12.358  14.327 -37.373  1.00 45.96  ? 224 HIS A C      1 
ATOM   3404  O  O      . HIS A 1 244 ? 12.137  13.269 -36.777  1.00 47.70  ? 224 HIS A O      1 
ATOM   3405  C  CB     . HIS A 1 244 ? 10.318  15.406 -38.343  1.00 58.97  ? 224 HIS A CB     1 
ATOM   3406  C  CG     . HIS A 1 244 ? 10.467  16.508 -37.341  1.00 68.62  ? 224 HIS A CG     1 
ATOM   3407  N  ND1    . HIS A 1 244 ? 10.226  16.329 -35.995  1.00 71.98  ? 224 HIS A ND1    1 
ATOM   3408  C  CD2    . HIS A 1 244 ? 10.822  17.806 -37.490  1.00 70.80  ? 224 HIS A CD2    1 
ATOM   3409  C  CE1    . HIS A 1 244 ? 10.432  17.468 -35.359  1.00 72.63  ? 224 HIS A CE1    1 
ATOM   3410  N  NE2    . HIS A 1 244 ? 10.794  18.380 -36.243  1.00 71.24  ? 224 HIS A NE2    1 
ATOM   3411  H  H      . HIS A 1 244 ? 10.595  13.109 -39.236  1.00 54.71  ? 224 HIS A H      1 
ATOM   3412  H  HA     . HIS A 1 244 ? 12.186  15.270 -39.184  1.00 59.56  ? 224 HIS A HA     1 
ATOM   3413  H  HB2    . HIS A 1 244 ? 9.969   15.795 -39.160  1.00 70.89  ? 224 HIS A HB2    1 
ATOM   3414  H  HB3    . HIS A 1 244 ? 9.682   14.766 -37.986  1.00 70.89  ? 224 HIS A HB3    1 
ATOM   3415  H  HD1    . HIS A 1 244 ? 9.983   15.591 -35.628  1.00 86.49  ? 224 HIS A HD1    1 
ATOM   3416  H  HD2    . HIS A 1 244 ? 11.046  18.229 -38.288  1.00 85.07  ? 224 HIS A HD2    1 
ATOM   3417  H  HE1    . HIS A 1 244 ? 10.338  17.605 -34.444  1.00 87.28  ? 224 HIS A HE1    1 
ATOM   3418  N  N      . LEU A 1 245 ? 13.244  15.223 -36.951  1.00 43.99  ? 225 LEU A N      1 
ATOM   3419  C  CA     . LEU A 1 245 ? 14.025  15.035 -35.727  1.00 46.62  ? 225 LEU A CA     1 
ATOM   3420  C  C      . LEU A 1 245 ? 13.708  16.148 -34.733  1.00 46.29  ? 225 LEU A C      1 
ATOM   3421  O  O      . LEU A 1 245 ? 14.030  17.321 -35.003  1.00 47.60  ? 225 LEU A O      1 
ATOM   3422  C  CB     . LEU A 1 245 ? 15.519  15.008 -36.048  1.00 49.56  ? 225 LEU A CB     1 
ATOM   3423  C  CG     . LEU A 1 245 ? 15.950  13.825 -36.919  1.00 53.28  ? 225 LEU A CG     1 
ATOM   3424  C  CD1    . LEU A 1 245 ? 17.374  14.010 -37.420  1.00 54.26  ? 225 LEU A CD1    1 
ATOM   3425  C  CD2    . LEU A 1 245 ? 15.810  12.507 -36.167  1.00 56.11  ? 225 LEU A CD2    1 
ATOM   3426  H  H      . LEU A 1 245 ? 13.415  15.960 -37.361  1.00 52.91  ? 225 LEU A H      1 
ATOM   3427  H  HA     . LEU A 1 245 ? 13.786  14.187 -35.321  1.00 56.06  ? 225 LEU A HA     1 
ATOM   3428  H  HB2    . LEU A 1 245 ? 15.751  15.823 -36.520  1.00 59.59  ? 225 LEU A HB2    1 
ATOM   3429  H  HB3    . LEU A 1 245 ? 16.016  14.959 -35.216  1.00 59.59  ? 225 LEU A HB3    1 
ATOM   3430  H  HG     . LEU A 1 245 ? 15.369  13.783 -37.695  1.00 64.05  ? 225 LEU A HG     1 
ATOM   3431  H  HD11   . LEU A 1 245 ? 17.617  13.247 -37.968  1.00 65.23  ? 225 LEU A HD11   1 
ATOM   3432  H  HD12   . LEU A 1 245 ? 17.420  14.823 -37.947  1.00 65.23  ? 225 LEU A HD12   1 
ATOM   3433  H  HD13   . LEU A 1 245 ? 17.970  14.075 -36.658  1.00 65.23  ? 225 LEU A HD13   1 
ATOM   3434  H  HD21   . LEU A 1 245 ? 16.091  11.782 -36.746  1.00 67.45  ? 225 LEU A HD21   1 
ATOM   3435  H  HD22   . LEU A 1 245 ? 16.370  12.535 -35.375  1.00 67.45  ? 225 LEU A HD22   1 
ATOM   3436  H  HD23   . LEU A 1 245 ? 14.882  12.387 -35.912  1.00 67.45  ? 225 LEU A HD23   1 
ATOM   3437  N  N      . PRO A 1 246 ? 13.089  15.854 -33.584  1.00 45.13  ? 226 PRO A N      1 
ATOM   3438  C  CA     . PRO A 1 246 ? 12.695  16.931 -32.663  1.00 44.94  ? 226 PRO A CA     1 
ATOM   3439  C  C      . PRO A 1 246 ? 13.887  17.709 -32.122  1.00 43.00  ? 226 PRO A C      1 
ATOM   3440  O  O      . PRO A 1 246 ? 14.984  17.173 -31.952  1.00 37.43  ? 226 PRO A O      1 
ATOM   3441  C  CB     . PRO A 1 246 ? 11.966  16.188 -31.536  1.00 46.50  ? 226 PRO A CB     1 
ATOM   3442  C  CG     . PRO A 1 246 ? 11.550  14.891 -32.131  1.00 46.45  ? 226 PRO A CG     1 
ATOM   3443  C  CD     . PRO A 1 246 ? 12.614  14.539 -33.120  1.00 45.19  ? 226 PRO A CD     1 
ATOM   3444  H  HA     . PRO A 1 246 ? 12.080  17.542 -33.098  1.00 54.05  ? 226 PRO A HA     1 
ATOM   3445  H  HB2    . PRO A 1 246 ? 12.573  16.045 -30.793  1.00 55.92  ? 226 PRO A HB2    1 
ATOM   3446  H  HB3    . PRO A 1 246 ? 11.192  16.699 -31.254  1.00 55.92  ? 226 PRO A HB3    1 
ATOM   3447  H  HG2    . PRO A 1 246 ? 11.494  14.217 -31.436  1.00 55.86  ? 226 PRO A HG2    1 
ATOM   3448  H  HG3    . PRO A 1 246 ? 10.694  14.996 -32.574  1.00 55.86  ? 226 PRO A HG3    1 
ATOM   3449  H  HD2    . PRO A 1 246 ? 13.332  14.053 -32.686  1.00 54.35  ? 226 PRO A HD2    1 
ATOM   3450  H  HD3    . PRO A 1 246 ? 12.237  14.035 -33.858  1.00 54.35  ? 226 PRO A HD3    1 
ATOM   3451  N  N      . LEU A 1 247 ? 13.649  18.991 -31.840  1.00 46.22  ? 227 LEU A N      1 
ATOM   3452  C  CA     . LEU A 1 247 ? 14.643  19.875 -31.240  1.00 43.67  ? 227 LEU A CA     1 
ATOM   3453  C  C      . LEU A 1 247 ? 14.210  20.228 -29.822  1.00 46.13  ? 227 LEU A C      1 
ATOM   3454  O  O      . LEU A 1 247 ? 13.126  20.787 -29.621  1.00 42.88  ? 227 LEU A O      1 
ATOM   3455  C  CB     . LEU A 1 247 ? 14.819  21.150 -32.064  1.00 37.04  ? 227 LEU A CB     1 
ATOM   3456  C  CG     . LEU A 1 247 ? 16.186  21.404 -32.701  1.00 38.03  ? 227 LEU A CG     1 
ATOM   3457  C  CD1    . LEU A 1 247 ? 16.154  22.722 -33.452  1.00 39.40  ? 227 LEU A CD1    1 
ATOM   3458  C  CD2    . LEU A 1 247 ? 17.312  21.402 -31.673  1.00 39.04  ? 227 LEU A CD2    1 
ATOM   3459  H  H      . LEU A 1 247 ? 12.897  19.380 -31.993  1.00 55.58  ? 227 LEU A H      1 
ATOM   3460  H  HA     . LEU A 1 247 ? 15.497  19.418 -31.196  1.00 52.53  ? 227 LEU A HA     1 
ATOM   3461  H  HB2    . LEU A 1 247 ? 14.170  21.132 -32.785  1.00 44.56  ? 227 LEU A HB2    1 
ATOM   3462  H  HB3    . LEU A 1 247 ? 14.631  21.907 -31.487  1.00 44.56  ? 227 LEU A HB3    1 
ATOM   3463  H  HG     . LEU A 1 247 ? 16.368  20.700 -33.343  1.00 45.76  ? 227 LEU A HG     1 
ATOM   3464  H  HD11   . LEU A 1 247 ? 17.023  22.877 -33.854  1.00 47.40  ? 227 LEU A HD11   1 
ATOM   3465  H  HD12   . LEU A 1 247 ? 15.474  22.675 -34.142  1.00 47.40  ? 227 LEU A HD12   1 
ATOM   3466  H  HD13   . LEU A 1 247 ? 15.945  23.435 -32.829  1.00 47.40  ? 227 LEU A HD13   1 
ATOM   3467  H  HD21   . LEU A 1 247 ? 18.153  21.567 -32.127  1.00 46.97  ? 227 LEU A HD21   1 
ATOM   3468  H  HD22   . LEU A 1 247 ? 17.145  22.101 -31.021  1.00 46.97  ? 227 LEU A HD22   1 
ATOM   3469  H  HD23   . LEU A 1 247 ? 17.336  20.538 -31.233  1.00 46.97  ? 227 LEU A HD23   1 
ATOM   3470  N  N      . GLU A 1 248 ? 15.055  19.904 -28.849  1.00 51.02  ? 228 GLU A N      1 
ATOM   3471  C  CA     . GLU A 1 248 ? 14.797  20.194 -27.444  1.00 58.20  ? 228 GLU A CA     1 
ATOM   3472  C  C      . GLU A 1 248 ? 15.554  21.450 -27.032  1.00 64.14  ? 228 GLU A C      1 
ATOM   3473  O  O      . GLU A 1 248 ? 16.759  21.562 -27.283  1.00 64.16  ? 228 GLU A O      1 
ATOM   3474  C  CB     . GLU A 1 248 ? 15.216  19.016 -26.562  1.00 60.42  ? 228 GLU A CB     1 
ATOM   3475  C  CG     . GLU A 1 248 ? 14.469  17.720 -26.850  1.00 64.93  ? 228 GLU A CG     1 
ATOM   3476  C  CD     . GLU A 1 248 ? 13.116  17.651 -26.167  1.00 72.70  ? 228 GLU A CD     1 
ATOM   3477  O  OE1    . GLU A 1 248 ? 12.899  18.396 -25.188  1.00 76.43  ? 228 GLU A OE1    1 
ATOM   3478  O  OE2    . GLU A 1 248 ? 12.267  16.847 -26.608  1.00 75.58  ? 228 GLU A OE2    1 
ATOM   3479  H  H      . GLU A 1 248 ? 15.805  19.505 -28.982  1.00 61.35  ? 228 GLU A H      1 
ATOM   3480  H  HA     . GLU A 1 248 ? 13.848  20.351 -27.316  1.00 69.96  ? 228 GLU A HA     1 
ATOM   3481  H  HB2    . GLU A 1 248 ? 16.161  18.847 -26.698  1.00 72.63  ? 228 GLU A HB2    1 
ATOM   3482  H  HB3    . GLU A 1 248 ? 15.055  19.249 -25.635  1.00 72.63  ? 228 GLU A HB3    1 
ATOM   3483  H  HG2    . GLU A 1 248 ? 14.325  17.645 -27.806  1.00 78.04  ? 228 GLU A HG2    1 
ATOM   3484  H  HG3    . GLU A 1 248 ? 15.001  16.973 -26.536  1.00 78.04  ? 228 GLU A HG3    1 
ATOM   3485  N  N      . GLU A 1 249 ? 14.853  22.390 -26.404  1.00 69.97  ? 229 GLU A N      1 
ATOM   3486  C  CA     . GLU A 1 249 ? 15.516  23.585 -25.910  1.00 77.23  ? 229 GLU A CA     1 
ATOM   3487  C  C      . GLU A 1 249 ? 16.500  23.218 -24.798  1.00 75.15  ? 229 GLU A C      1 
ATOM   3488  O  O      . GLU A 1 249 ? 16.274  22.264 -24.049  1.00 81.67  ? 229 GLU A O      1 
ATOM   3489  C  CB     . GLU A 1 249 ? 14.502  24.593 -25.375  1.00 86.37  ? 229 GLU A CB     1 
ATOM   3490  C  CG     . GLU A 1 249 ? 13.738  25.353 -26.443  1.00 94.55  ? 229 GLU A CG     1 
ATOM   3491  C  CD     . GLU A 1 249 ? 13.008  26.558 -25.879  1.00 103.68 ? 229 GLU A CD     1 
ATOM   3492  O  OE1    . GLU A 1 249 ? 12.704  26.557 -24.668  1.00 107.72 ? 229 GLU A OE1    1 
ATOM   3493  O  OE2    . GLU A 1 249 ? 12.743  27.508 -26.645  1.00 106.39 ? 229 GLU A OE2    1 
ATOM   3494  H  H      . GLU A 1 249 ? 14.007  22.359 -26.255  1.00 84.08  ? 229 GLU A H      1 
ATOM   3495  H  HA     . GLU A 1 249 ? 16.011  24.002 -26.632  1.00 92.79  ? 229 GLU A HA     1 
ATOM   3496  H  HB2    . GLU A 1 249 ? 13.853  24.119 -24.831  1.00 103.76 ? 229 GLU A HB2    1 
ATOM   3497  H  HB3    . GLU A 1 249 ? 14.970  25.244 -24.830  1.00 103.76 ? 229 GLU A HB3    1 
ATOM   3498  H  HG2    . GLU A 1 249 ? 14.361  25.666 -27.117  1.00 113.58 ? 229 GLU A HG2    1 
ATOM   3499  H  HG3    . GLU A 1 249 ? 13.081  24.763 -26.844  1.00 113.58 ? 229 GLU A HG3    1 
ATOM   3500  N  N      . PRO A 1 250 ? 17.604  23.957 -24.668  1.00 65.47  ? 230 PRO A N      1 
ATOM   3501  C  CA     . PRO A 1 250 ? 18.545  23.670 -23.578  1.00 60.79  ? 230 PRO A CA     1 
ATOM   3502  C  C      . PRO A 1 250 ? 17.885  23.855 -22.219  1.00 66.15  ? 230 PRO A C      1 
ATOM   3503  O  O      . PRO A 1 250 ? 17.086  24.772 -22.015  1.00 61.93  ? 230 PRO A O      1 
ATOM   3504  C  CB     . PRO A 1 250 ? 19.672  24.688 -23.798  1.00 59.57  ? 230 PRO A CB     1 
ATOM   3505  C  CG     . PRO A 1 250 ? 19.530  25.139 -25.211  1.00 59.25  ? 230 PRO A CG     1 
ATOM   3506  C  CD     . PRO A 1 250 ? 18.074  25.060 -25.524  1.00 60.56  ? 230 PRO A CD     1 
ATOM   3507  H  HA     . PRO A 1 250 ? 18.897  22.770 -23.654  1.00 73.06  ? 230 PRO A HA     1 
ATOM   3508  H  HB2    . PRO A 1 250 ? 19.562  25.434 -23.188  1.00 71.61  ? 230 PRO A HB2    1 
ATOM   3509  H  HB3    . PRO A 1 250 ? 20.531  24.257 -23.661  1.00 71.61  ? 230 PRO A HB3    1 
ATOM   3510  H  HG2    . PRO A 1 250 ? 19.847  26.052 -25.293  1.00 71.21  ? 230 PRO A HG2    1 
ATOM   3511  H  HG3    . PRO A 1 250 ? 20.035  24.549 -25.792  1.00 71.21  ? 230 PRO A HG3    1 
ATOM   3512  H  HD2    . PRO A 1 250 ? 17.630  25.889 -25.282  1.00 72.79  ? 230 PRO A HD2    1 
ATOM   3513  H  HD3    . PRO A 1 250 ? 17.940  24.844 -26.460  1.00 72.79  ? 230 PRO A HD3    1 
ATOM   3514  N  N      . ALA A 1 251 ? 18.229  22.970 -21.283  1.00 84.62  ? 231 ALA A N      1 
ATOM   3515  C  CA     . ALA A 1 251 ? 17.690  23.041 -19.932  1.00 89.93  ? 231 ALA A CA     1 
ATOM   3516  C  C      . ALA A 1 251 ? 18.599  23.791 -18.967  1.00 82.70  ? 231 ALA A C      1 
ATOM   3517  O  O      . ALA A 1 251 ? 18.144  24.180 -17.885  1.00 87.67  ? 231 ALA A O      1 
ATOM   3518  C  CB     . ALA A 1 251 ? 17.435  21.630 -19.391  1.00 91.50  ? 231 ALA A CB     1 
ATOM   3519  H  H      . ALA A 1 251 ? 18.775  22.318 -21.409  1.00 101.67 ? 231 ALA A H      1 
ATOM   3520  H  HA     . ALA A 1 251 ? 16.840  23.507 -19.959  1.00 108.03 ? 231 ALA A HA     1 
ATOM   3521  H  HB1    . ALA A 1 251 ? 17.077  21.697 -18.492  1.00 109.92 ? 231 ALA A HB1    1 
ATOM   3522  H  HB2    . ALA A 1 251 ? 16.797  21.182 -19.969  1.00 109.92 ? 231 ALA A HB2    1 
ATOM   3523  H  HB3    . ALA A 1 251 ? 18.272  21.141 -19.379  1.00 109.92 ? 231 ALA A HB3    1 
ATOM   3524  N  N      . ASP A 1 252 ? 19.865  24.001 -19.330  1.00 62.11  ? 232 ASP A N      1 
ATOM   3525  C  CA     . ASP A 1 252 ? 20.829  24.689 -18.483  1.00 52.01  ? 232 ASP A CA     1 
ATOM   3526  C  C      . ASP A 1 252 ? 20.931  26.184 -18.788  1.00 51.53  ? 232 ASP A C      1 
ATOM   3527  O  O      . ASP A 1 252 ? 21.899  26.827 -18.368  1.00 43.52  ? 232 ASP A O      1 
ATOM   3528  C  CB     . ASP A 1 252 ? 22.203  24.031 -18.624  1.00 53.47  ? 232 ASP A CB     1 
ATOM   3529  C  CG     . ASP A 1 252 ? 22.750  24.120 -20.036  1.00 60.20  ? 232 ASP A CG     1 
ATOM   3530  O  OD1    . ASP A 1 252 ? 21.960  24.411 -20.961  1.00 62.81  ? 232 ASP A OD1    1 
ATOM   3531  O  OD2    . ASP A 1 252 ? 23.965  23.896 -20.222  1.00 62.64  ? 232 ASP A OD2    1 
ATOM   3532  H  H      . ASP A 1 252 ? 20.193  23.745 -20.082  1.00 74.65  ? 232 ASP A H      1 
ATOM   3533  H  HA     . ASP A 1 252 ? 20.552  24.597 -17.559  1.00 62.53  ? 232 ASP A HA     1 
ATOM   3534  H  HB2    . ASP A 1 252 ? 22.829  24.475 -18.031  1.00 64.28  ? 232 ASP A HB2    1 
ATOM   3535  H  HB3    . ASP A 1 252 ? 22.130  23.093 -18.388  1.00 64.28  ? 232 ASP A HB3    1 
ATOM   3536  N  N      . GLU A 1 253 ? 19.965  26.742 -19.518  1.00 62.05  ? 233 GLU A N      1 
ATOM   3537  C  CA     . GLU A 1 253 ? 19.911  28.155 -19.890  1.00 68.79  ? 233 GLU A CA     1 
ATOM   3538  C  C      . GLU A 1 253 ? 20.988  28.560 -20.890  1.00 64.78  ? 233 GLU A C      1 
ATOM   3539  O  O      . GLU A 1 253 ? 21.147  29.759 -21.155  1.00 69.03  ? 233 GLU A O      1 
ATOM   3540  C  CB     . GLU A 1 253 ? 19.990  29.081 -18.669  1.00 72.20  ? 233 GLU A CB     1 
ATOM   3541  C  CG     . GLU A 1 253 ? 18.794  28.987 -17.735  1.00 75.39  ? 233 GLU A CG     1 
ATOM   3542  C  CD     . GLU A 1 253 ? 18.912  29.921 -16.546  1.00 76.93  ? 233 GLU A CD     1 
ATOM   3543  O  OE1    . GLU A 1 253 ? 20.049  30.287 -16.184  1.00 76.72  ? 233 GLU A OE1    1 
ATOM   3544  O  OE2    . GLU A 1 253 ? 17.864  30.299 -15.981  1.00 77.97  ? 233 GLU A OE2    1 
ATOM   3545  H  H      . GLU A 1 253 ? 19.296  26.296 -19.824  1.00 74.58  ? 233 GLU A H      1 
ATOM   3546  H  HA     . GLU A 1 253 ? 19.054  28.318 -20.315  1.00 82.67  ? 233 GLU A HA     1 
ATOM   3547  H  HB2    . GLU A 1 253 ? 20.782  28.855 -18.158  1.00 86.76  ? 233 GLU A HB2    1 
ATOM   3548  H  HB3    . GLU A 1 253 ? 20.051  29.999 -18.979  1.00 86.76  ? 233 GLU A HB3    1 
ATOM   3549  H  HG2    . GLU A 1 253 ? 17.990  29.222 -18.224  1.00 90.59  ? 233 GLU A HG2    1 
ATOM   3550  H  HG3    . GLU A 1 253 ? 18.726  28.080 -17.399  1.00 90.59  ? 233 GLU A HG3    1 
ATOM   3551  N  N      . GLY A 1 254 ? 21.736  27.611 -21.448  1.00 53.69  ? 234 GLY A N      1 
ATOM   3552  C  CA     . GLY A 1 254 ? 22.665  27.903 -22.521  1.00 48.31  ? 234 GLY A CA     1 
ATOM   3553  C  C      . GLY A 1 254 ? 24.138  27.873 -22.170  1.00 49.86  ? 234 GLY A C      1 
ATOM   3554  O  O      . GLY A 1 254 ? 24.951  28.344 -22.973  1.00 49.51  ? 234 GLY A O      1 
ATOM   3555  H  H      . GLY A 1 254 ? 21.720  26.783 -21.216  1.00 64.55  ? 234 GLY A H      1 
ATOM   3556  H  HA2    . GLY A 1 254 ? 22.521  27.264 -23.236  1.00 58.09  ? 234 GLY A HA2    1 
ATOM   3557  H  HA3    . GLY A 1 254 ? 22.465  28.786 -22.870  1.00 58.09  ? 234 GLY A HA3    1 
ATOM   3558  N  N      . LEU A 1 255 ? 24.516  27.335 -21.010  1.00 53.85  ? 235 LEU A N      1 
ATOM   3559  C  CA     . LEU A 1 255 ? 25.925  27.327 -20.628  1.00 58.20  ? 235 LEU A CA     1 
ATOM   3560  C  C      . LEU A 1 255 ? 26.758  26.549 -21.643  1.00 58.15  ? 235 LEU A C      1 
ATOM   3561  O  O      . LEU A 1 255 ? 27.739  27.068 -22.197  1.00 61.01  ? 235 LEU A O      1 
ATOM   3562  C  CB     . LEU A 1 255 ? 26.076  26.725 -19.230  1.00 60.35  ? 235 LEU A CB     1 
ATOM   3563  C  CG     . LEU A 1 255 ? 27.456  26.840 -18.581  1.00 61.53  ? 235 LEU A CG     1 
ATOM   3564  C  CD1    . LEU A 1 255 ? 27.771  28.293 -18.254  1.00 62.46  ? 235 LEU A CD1    1 
ATOM   3565  C  CD2    . LEU A 1 255 ? 27.539  25.973 -17.334  1.00 63.57  ? 235 LEU A CD2    1 
ATOM   3566  H  H      . LEU A 1 255 ? 23.986  26.974 -20.437  1.00 64.73  ? 235 LEU A H      1 
ATOM   3567  H  HA     . LEU A 1 255 ? 26.254  28.239 -20.602  1.00 69.96  ? 235 LEU A HA     1 
ATOM   3568  H  HB2    . LEU A 1 255 ? 25.444  27.166 -18.640  1.00 72.54  ? 235 LEU A HB2    1 
ATOM   3569  H  HB3    . LEU A 1 255 ? 25.861  25.780 -19.281  1.00 72.54  ? 235 LEU A HB3    1 
ATOM   3570  H  HG     . LEU A 1 255 ? 28.125  26.524 -19.209  1.00 73.96  ? 235 LEU A HG     1 
ATOM   3571  H  HD11   . LEU A 1 255 ? 28.649  28.340 -17.845  1.00 75.07  ? 235 LEU A HD11   1 
ATOM   3572  H  HD12   . LEU A 1 255 ? 27.759  28.811 -19.074  1.00 75.07  ? 235 LEU A HD12   1 
ATOM   3573  H  HD13   . LEU A 1 255 ? 27.100  28.630 -17.639  1.00 75.07  ? 235 LEU A HD13   1 
ATOM   3574  H  HD21   . LEU A 1 255 ? 28.422  26.065 -16.945  1.00 76.41  ? 235 LEU A HD21   1 
ATOM   3575  H  HD22   . LEU A 1 255 ? 26.865  26.266 -16.701  1.00 76.41  ? 235 LEU A HD22   1 
ATOM   3576  H  HD23   . LEU A 1 255 ? 27.380  25.048 -17.582  1.00 76.41  ? 235 LEU A HD23   1 
ATOM   3577  N  N      . GLU A 1 256 ? 26.372  25.297 -21.903  1.00 56.88  ? 236 GLU A N      1 
ATOM   3578  C  CA     . GLU A 1 256 ? 27.094  24.473 -22.867  1.00 55.47  ? 236 GLU A CA     1 
ATOM   3579  C  C      . GLU A 1 256 ? 27.193  25.165 -24.221  1.00 47.67  ? 236 GLU A C      1 
ATOM   3580  O  O      . GLU A 1 256 ? 28.244  25.124 -24.871  1.00 48.07  ? 236 GLU A O      1 
ATOM   3581  C  CB     . GLU A 1 256 ? 26.398  23.118 -23.007  1.00 62.32  ? 236 GLU A CB     1 
ATOM   3582  C  CG     . GLU A 1 256 ? 27.057  22.147 -23.980  1.00 67.96  ? 236 GLU A CG     1 
ATOM   3583  C  CD     . GLU A 1 256 ? 28.405  21.646 -23.497  1.00 72.43  ? 236 GLU A CD     1 
ATOM   3584  O  OE1    . GLU A 1 256 ? 28.828  22.043 -22.391  1.00 74.98  ? 236 GLU A OE1    1 
ATOM   3585  O  OE2    . GLU A 1 256 ? 29.039  20.851 -24.223  1.00 72.10  ? 236 GLU A OE2    1 
ATOM   3586  H  H      . GLU A 1 256 ? 25.699  24.906 -21.536  1.00 68.37  ? 236 GLU A H      1 
ATOM   3587  H  HA     . GLU A 1 256 ? 27.994  24.318 -22.541  1.00 66.68  ? 236 GLU A HA     1 
ATOM   3588  H  HB2    . GLU A 1 256 ? 26.378  22.691 -22.137  1.00 74.90  ? 236 GLU A HB2    1 
ATOM   3589  H  HB3    . GLU A 1 256 ? 25.490  23.268 -23.315  1.00 74.90  ? 236 GLU A HB3    1 
ATOM   3590  H  HG2    . GLU A 1 256 ? 26.478  21.378 -24.099  1.00 81.68  ? 236 GLU A HG2    1 
ATOM   3591  H  HG3    . GLU A 1 256 ? 27.192  22.594 -24.830  1.00 81.68  ? 236 GLU A HG3    1 
ATOM   3592  N  N      . LEU A 1 257 ? 26.112  25.813 -24.660  1.00 39.63  ? 237 LEU A N      1 
ATOM   3593  C  CA     . LEU A 1 257 ? 26.120  26.476 -25.960  1.00 35.89  ? 237 LEU A CA     1 
ATOM   3594  C  C      . LEU A 1 257 ? 27.194  27.557 -26.018  1.00 39.43  ? 237 LEU A C      1 
ATOM   3595  O  O      . LEU A 1 257 ? 28.016  27.585 -26.944  1.00 39.37  ? 237 LEU A O      1 
ATOM   3596  C  CB     . LEU A 1 257 ? 24.741  27.072 -26.248  1.00 33.22  ? 237 LEU A CB     1 
ATOM   3597  C  CG     . LEU A 1 257 ? 24.257  27.131 -27.701  1.00 30.48  ? 237 LEU A CG     1 
ATOM   3598  C  CD1    . LEU A 1 257 ? 23.221  28.239 -27.844  1.00 31.67  ? 237 LEU A CD1    1 
ATOM   3599  C  CD2    . LEU A 1 257 ? 25.390  27.319 -28.707  1.00 26.54  ? 237 LEU A CD2    1 
ATOM   3600  H  H      . LEU A 1 257 ? 25.371  25.881 -24.229  1.00 47.67  ? 237 LEU A H      1 
ATOM   3601  H  HA     . LEU A 1 257 ? 26.315  25.821 -26.649  1.00 43.18  ? 237 LEU A HA     1 
ATOM   3602  H  HB2    . LEU A 1 257 ? 24.086  26.554 -25.756  1.00 39.99  ? 237 LEU A HB2    1 
ATOM   3603  H  HB3    . LEU A 1 257 ? 24.737  27.983 -25.915  1.00 39.99  ? 237 LEU A HB3    1 
ATOM   3604  H  HG     . LEU A 1 257 ? 23.817  26.293 -27.912  1.00 36.69  ? 237 LEU A HG     1 
ATOM   3605  H  HD11   . LEU A 1 257 ? 22.918  28.271 -28.765  1.00 38.12  ? 237 LEU A HD11   1 
ATOM   3606  H  HD12   . LEU A 1 257 ? 22.473  28.048 -27.256  1.00 38.12  ? 237 LEU A HD12   1 
ATOM   3607  H  HD13   . LEU A 1 257 ? 23.628  29.084 -27.599  1.00 38.12  ? 237 LEU A HD13   1 
ATOM   3608  H  HD21   . LEU A 1 257 ? 25.016  27.348 -29.602  1.00 31.97  ? 237 LEU A HD21   1 
ATOM   3609  H  HD22   . LEU A 1 257 ? 25.849  28.151 -28.513  1.00 31.97  ? 237 LEU A HD22   1 
ATOM   3610  H  HD23   . LEU A 1 257 ? 26.007  26.575 -28.629  1.00 31.97  ? 237 LEU A HD23   1 
ATOM   3611  N  N      . GLY A 1 258 ? 27.205  28.458 -25.033  1.00 42.03  ? 238 GLY A N      1 
ATOM   3612  C  CA     . GLY A 1 258 ? 28.201  29.518 -25.025  1.00 43.56  ? 238 GLY A CA     1 
ATOM   3613  C  C      . GLY A 1 258 ? 29.617  28.981 -24.955  1.00 43.77  ? 238 GLY A C      1 
ATOM   3614  O  O      . GLY A 1 258 ? 30.502  29.430 -25.694  1.00 53.56  ? 238 GLY A O      1 
ATOM   3615  H  H      . GLY A 1 258 ? 26.655  28.475 -24.371  1.00 50.55  ? 238 GLY A H      1 
ATOM   3616  H  HA2    . GLY A 1 258 ? 28.114  30.049 -25.833  1.00 52.40  ? 238 GLY A HA2    1 
ATOM   3617  H  HA3    . GLY A 1 258 ? 28.053  30.095 -24.260  1.00 52.40  ? 238 GLY A HA3    1 
ATOM   3618  N  N      . THR A 1 259 ? 29.848  28.000 -24.078  1.00 33.28  ? 239 THR A N      1 
ATOM   3619  C  CA     . THR A 1 259 ? 31.157  27.358 -24.019  1.00 32.61  ? 239 THR A CA     1 
ATOM   3620  C  C      . THR A 1 259 ? 31.572  26.853 -25.397  1.00 38.72  ? 239 THR A C      1 
ATOM   3621  O  O      . THR A 1 259 ? 32.702  27.079 -25.847  1.00 37.03  ? 239 THR A O      1 
ATOM   3622  C  CB     . THR A 1 259 ? 31.136  26.211 -23.004  1.00 32.21  ? 239 THR A CB     1 
ATOM   3623  O  OG1    . THR A 1 259 ? 30.736  26.707 -21.720  1.00 30.44  ? 239 THR A OG1    1 
ATOM   3624  C  CG2    . THR A 1 259 ? 32.515  25.574 -22.877  1.00 34.49  ? 239 THR A CG2    1 
ATOM   3625  H  H      . THR A 1 259 ? 29.272  27.694 -23.517  1.00 40.06  ? 239 THR A H      1 
ATOM   3626  H  HA     . THR A 1 259 ? 31.816  28.008 -23.726  1.00 39.25  ? 239 THR A HA     1 
ATOM   3627  H  HB     . THR A 1 259 ? 30.509  25.531 -23.297  1.00 38.77  ? 239 THR A HB     1 
ATOM   3628  H  HG1    . THR A 1 259 ? 29.968  27.045 -21.769  1.00 36.64  ? 239 THR A HG1    1 
ATOM   3629  H  HG21   . THR A 1 259 ? 32.488  24.850 -22.232  1.00 41.51  ? 239 THR A HG21   1 
ATOM   3630  H  HG22   . THR A 1 259 ? 32.797  25.222 -23.735  1.00 41.51  ? 239 THR A HG22   1 
ATOM   3631  H  HG23   . THR A 1 259 ? 33.159  26.236 -22.581  1.00 41.51  ? 239 THR A HG23   1 
ATOM   3632  N  N      . GLN A 1 260 ? 30.653  26.174 -26.090  1.00 46.41  ? 240 GLN A N      1 
ATOM   3633  C  CA     . GLN A 1 260 ? 30.967  25.612 -27.400  1.00 50.99  ? 240 GLN A CA     1 
ATOM   3634  C  C      . GLN A 1 260 ? 31.290  26.704 -28.413  1.00 48.92  ? 240 GLN A C      1 
ATOM   3635  O  O      . GLN A 1 260 ? 32.229  26.566 -29.206  1.00 47.33  ? 240 GLN A O      1 
ATOM   3636  C  CB     . GLN A 1 260 ? 29.796  24.758 -27.886  1.00 53.51  ? 240 GLN A CB     1 
ATOM   3637  C  CG     . GLN A 1 260 ? 29.639  23.444 -27.135  1.00 57.26  ? 240 GLN A CG     1 
ATOM   3638  C  CD     . GLN A 1 260 ? 28.475  22.614 -27.641  1.00 58.65  ? 240 GLN A CD     1 
ATOM   3639  O  OE1    . GLN A 1 260 ? 27.730  23.039 -28.524  1.00 58.18  ? 240 GLN A OE1    1 
ATOM   3640  N  NE2    . GLN A 1 260 ? 28.313  21.421 -27.082  1.00 60.04  ? 240 GLN A NE2    1 
ATOM   3641  H  H      . GLN A 1 260 ? 29.849  26.027 -25.824  1.00 55.80  ? 240 GLN A H      1 
ATOM   3642  H  HA     . GLN A 1 260 ? 31.745  25.038 -27.319  1.00 61.30  ? 240 GLN A HA     1 
ATOM   3643  H  HB2    . GLN A 1 260 ? 28.975  25.263 -27.776  1.00 64.34  ? 240 GLN A HB2    1 
ATOM   3644  H  HB3    . GLN A 1 260 ? 29.930  24.550 -28.824  1.00 64.34  ? 240 GLN A HB3    1 
ATOM   3645  H  HG2    . GLN A 1 260 ? 30.449  22.921 -27.241  1.00 68.83  ? 240 GLN A HG2    1 
ATOM   3646  H  HG3    . GLN A 1 260 ? 29.487  23.633 -26.196  1.00 68.83  ? 240 GLN A HG3    1 
ATOM   3647  H  HE21   . GLN A 1 260 ? 28.854  21.158 -26.467  1.00 72.16  ? 240 GLN A HE21   1 
ATOM   3648  H  HE22   . GLN A 1 260 ? 27.668  20.912 -27.334  1.00 72.16  ? 240 GLN A HE22   1 
ATOM   3649  N  N      . VAL A 1 261 ? 30.528  27.800 -28.402  1.00 44.84  ? 241 VAL A N      1 
ATOM   3650  C  CA     . VAL A 1 261 ? 30.772  28.887 -29.349  1.00 41.81  ? 241 VAL A CA     1 
ATOM   3651  C  C      . VAL A 1 261 ? 32.159  29.482 -29.127  1.00 42.24  ? 241 VAL A C      1 
ATOM   3652  O  O      . VAL A 1 261 ? 32.972  29.582 -30.059  1.00 44.49  ? 241 VAL A O      1 
ATOM   3653  C  CB     . VAL A 1 261 ? 29.667  29.954 -29.227  1.00 39.46  ? 241 VAL A CB     1 
ATOM   3654  C  CG1    . VAL A 1 261 ? 30.015  31.209 -30.023  1.00 41.12  ? 241 VAL A CG1    1 
ATOM   3655  C  CG2    . VAL A 1 261 ? 28.333  29.384 -29.692  1.00 33.92  ? 241 VAL A CG2    1 
ATOM   3656  H  H      . VAL A 1 261 ? 29.871  27.936 -27.863  1.00 53.92  ? 241 VAL A H      1 
ATOM   3657  H  HA     . VAL A 1 261 ? 30.742  28.530 -30.250  1.00 50.29  ? 241 VAL A HA     1 
ATOM   3658  H  HB     . VAL A 1 261 ? 29.575  30.207 -28.295  1.00 47.47  ? 241 VAL A HB     1 
ATOM   3659  H  HG11   . VAL A 1 261 ? 29.299  31.855 -29.923  1.00 49.46  ? 241 VAL A HG11   1 
ATOM   3660  H  HG12   . VAL A 1 261 ? 30.845  31.578 -29.682  1.00 49.46  ? 241 VAL A HG12   1 
ATOM   3661  H  HG13   . VAL A 1 261 ? 30.118  30.971 -30.958  1.00 49.46  ? 241 VAL A HG13   1 
ATOM   3662  H  HG21   . VAL A 1 261 ? 27.651  30.069 -29.608  1.00 40.83  ? 241 VAL A HG21   1 
ATOM   3663  H  HG22   . VAL A 1 261 ? 28.414  29.108 -30.619  1.00 40.83  ? 241 VAL A HG22   1 
ATOM   3664  H  HG23   . VAL A 1 261 ? 28.106  28.621 -29.138  1.00 40.83  ? 241 VAL A HG23   1 
ATOM   3665  N  N      . LEU A 1 262 ? 32.457  29.874 -27.885  1.00 42.00  ? 242 LEU A N      1 
ATOM   3666  C  CA     . LEU A 1 262 ? 33.760  30.468 -27.598  1.00 40.11  ? 242 LEU A CA     1 
ATOM   3667  C  C      . LEU A 1 262 ? 34.900  29.513 -27.942  1.00 36.61  ? 242 LEU A C      1 
ATOM   3668  O  O      . LEU A 1 262 ? 35.891  29.918 -28.564  1.00 35.06  ? 242 LEU A O      1 
ATOM   3669  C  CB     . LEU A 1 262 ? 33.836  30.885 -26.127  1.00 41.65  ? 242 LEU A CB     1 
ATOM   3670  C  CG     . LEU A 1 262 ? 33.274  32.247 -25.687  1.00 43.63  ? 242 LEU A CG     1 
ATOM   3671  C  CD1    . LEU A 1 262 ? 32.472  32.957 -26.776  1.00 42.75  ? 242 LEU A CD1    1 
ATOM   3672  C  CD2    . LEU A 1 262 ? 32.429  32.098 -24.429  1.00 45.08  ? 242 LEU A CD2    1 
ATOM   3673  H  H      . LEU A 1 262 ? 31.933  29.809 -27.206  1.00 50.52  ? 242 LEU A H      1 
ATOM   3674  H  HA     . LEU A 1 262 ? 33.867  31.265 -28.140  1.00 48.25  ? 242 LEU A HA     1 
ATOM   3675  H  HB2    . LEU A 1 262 ? 33.365  30.213 -25.609  1.00 50.10  ? 242 LEU A HB2    1 
ATOM   3676  H  HB3    . LEU A 1 262 ? 34.771  30.877 -25.870  1.00 50.10  ? 242 LEU A HB3    1 
ATOM   3677  H  HG     . LEU A 1 262 ? 34.022  32.823 -25.463  1.00 52.48  ? 242 LEU A HG     1 
ATOM   3678  H  HD11   . LEU A 1 262 ? 32.151  33.804 -26.429  1.00 51.42  ? 242 LEU A HD11   1 
ATOM   3679  H  HD12   . LEU A 1 262 ? 33.047  33.109 -27.542  1.00 51.42  ? 242 LEU A HD12   1 
ATOM   3680  H  HD13   . LEU A 1 262 ? 31.722  32.397 -27.030  1.00 51.42  ? 242 LEU A HD13   1 
ATOM   3681  H  HD21   . LEU A 1 262 ? 32.087  32.969 -24.173  1.00 54.22  ? 242 LEU A HD21   1 
ATOM   3682  H  HD22   . LEU A 1 262 ? 31.693  31.494 -24.613  1.00 54.22  ? 242 LEU A HD22   1 
ATOM   3683  H  HD23   . LEU A 1 262 ? 32.983  31.738 -23.718  1.00 54.22  ? 242 LEU A HD23   1 
ATOM   3684  N  N      . ASP A 1 263 ? 34.774  28.238 -27.566  1.00 37.99  ? 243 ASP A N      1 
ATOM   3685  C  CA     . ASP A 1 263 ? 35.840  27.286 -27.867  1.00 40.41  ? 243 ASP A CA     1 
ATOM   3686  C  C      . ASP A 1 263 ? 36.022  27.126 -29.372  1.00 38.29  ? 243 ASP A C      1 
ATOM   3687  O  O      . ASP A 1 263 ? 37.149  26.987 -29.859  1.00 38.49  ? 243 ASP A O      1 
ATOM   3688  C  CB     . ASP A 1 263 ? 35.543  25.938 -27.216  1.00 42.68  ? 243 ASP A CB     1 
ATOM   3689  C  CG     . ASP A 1 263 ? 36.713  24.977 -27.312  1.00 40.35  ? 243 ASP A CG     1 
ATOM   3690  O  OD1    . ASP A 1 263 ? 37.856  25.406 -27.047  1.00 38.55  ? 243 ASP A OD1    1 
ATOM   3691  O  OD2    . ASP A 1 263 ? 36.490  23.796 -27.656  1.00 38.34  ? 243 ASP A OD2    1 
ATOM   3692  H  H      . ASP A 1 263 ? 34.100  27.908 -27.146  1.00 45.71  ? 243 ASP A H      1 
ATOM   3693  H  HA     . ASP A 1 263 ? 36.673  27.619 -27.499  1.00 48.61  ? 243 ASP A HA     1 
ATOM   3694  H  HB2    . ASP A 1 263 ? 35.344  26.076 -26.277  1.00 51.34  ? 243 ASP A HB2    1 
ATOM   3695  H  HB3    . ASP A 1 263 ? 34.783  25.531 -27.661  1.00 51.34  ? 243 ASP A HB3    1 
ATOM   3696  N  N      . PHE A 1 264 ? 34.919  27.145 -30.121  1.00 35.42  ? 244 PHE A N      1 
ATOM   3697  C  CA     . PHE A 1 264 ? 34.992  27.084 -31.578  1.00 34.17  ? 244 PHE A CA     1 
ATOM   3698  C  C      . PHE A 1 264 ? 35.802  28.251 -32.133  1.00 30.58  ? 244 PHE A C      1 
ATOM   3699  O  O      . PHE A 1 264 ? 36.771  28.057 -32.885  1.00 27.93  ? 244 PHE A O      1 
ATOM   3700  C  CB     . PHE A 1 264 ? 33.567  27.076 -32.140  1.00 37.68  ? 244 PHE A CB     1 
ATOM   3701  C  CG     . PHE A 1 264 ? 33.485  27.172 -33.638  1.00 38.54  ? 244 PHE A CG     1 
ATOM   3702  C  CD1    . PHE A 1 264 ? 33.428  28.407 -34.263  1.00 37.55  ? 244 PHE A CD1    1 
ATOM   3703  C  CD2    . PHE A 1 264 ? 33.422  26.030 -34.417  1.00 39.30  ? 244 PHE A CD2    1 
ATOM   3704  C  CE1    . PHE A 1 264 ? 33.336  28.502 -35.636  1.00 37.26  ? 244 PHE A CE1    1 
ATOM   3705  C  CE2    . PHE A 1 264 ? 33.329  26.118 -35.792  1.00 40.45  ? 244 PHE A CE2    1 
ATOM   3706  C  CZ     . PHE A 1 264 ? 33.285  27.357 -36.402  1.00 39.86  ? 244 PHE A CZ     1 
ATOM   3707  H  H      . PHE A 1 264 ? 34.119  27.193 -29.810  1.00 42.62  ? 244 PHE A H      1 
ATOM   3708  H  HA     . PHE A 1 264 ? 35.427  26.258 -31.842  1.00 41.12  ? 244 PHE A HA     1 
ATOM   3709  H  HB2    . PHE A 1 264 ? 33.134  26.250 -31.874  1.00 45.34  ? 244 PHE A HB2    1 
ATOM   3710  H  HB3    . PHE A 1 264 ? 33.084  27.832 -31.770  1.00 45.34  ? 244 PHE A HB3    1 
ATOM   3711  H  HD1    . PHE A 1 264 ? 33.462  29.183 -33.751  1.00 45.18  ? 244 PHE A HD1    1 
ATOM   3712  H  HD2    . PHE A 1 264 ? 33.452  25.194 -34.011  1.00 47.28  ? 244 PHE A HD2    1 
ATOM   3713  H  HE1    . PHE A 1 264 ? 33.306  29.337 -36.045  1.00 44.83  ? 244 PHE A HE1    1 
ATOM   3714  H  HE2    . PHE A 1 264 ? 33.296  25.344 -36.307  1.00 48.66  ? 244 PHE A HE2    1 
ATOM   3715  H  HZ     . PHE A 1 264 ? 33.224  27.419 -37.328  1.00 47.95  ? 244 PHE A HZ     1 
ATOM   3716  N  N      . LEU A 1 265 ? 35.434  29.475 -31.746  1.00 31.52  ? 245 LEU A N      1 
ATOM   3717  C  CA     . LEU A 1 265 ? 36.148  30.652 -32.234  1.00 33.69  ? 245 LEU A CA     1 
ATOM   3718  C  C      . LEU A 1 265 ? 37.632  30.575 -31.888  1.00 35.92  ? 245 LEU A C      1 
ATOM   3719  O  O      . LEU A 1 265 ? 38.498  30.804 -32.745  1.00 34.27  ? 245 LEU A O      1 
ATOM   3720  C  CB     . LEU A 1 265 ? 35.515  31.915 -31.651  1.00 35.83  ? 245 LEU A CB     1 
ATOM   3721  C  CG     . LEU A 1 265 ? 34.111  32.240 -32.169  1.00 38.17  ? 245 LEU A CG     1 
ATOM   3722  C  CD1    . LEU A 1 265 ? 33.508  33.402 -31.396  1.00 40.96  ? 245 LEU A CD1    1 
ATOM   3723  C  CD2    . LEU A 1 265 ? 34.124  32.542 -33.661  1.00 38.43  ? 245 LEU A CD2    1 
ATOM   3724  H  H      . LEU A 1 265 ? 34.785  29.648 -31.210  1.00 37.94  ? 245 LEU A H      1 
ATOM   3725  H  HA     . LEU A 1 265 ? 36.067  30.693 -33.200  1.00 40.55  ? 245 LEU A HA     1 
ATOM   3726  H  HB2    . LEU A 1 265 ? 35.455  31.813 -30.688  1.00 43.11  ? 245 LEU A HB2    1 
ATOM   3727  H  HB3    . LEU A 1 265 ? 36.086  32.671 -31.861  1.00 43.11  ? 245 LEU A HB3    1 
ATOM   3728  H  HG     . LEU A 1 265 ? 33.542  31.467 -32.030  1.00 45.92  ? 245 LEU A HG     1 
ATOM   3729  H  HD11   . LEU A 1 265 ? 32.621  33.586 -31.744  1.00 49.28  ? 245 LEU A HD11   1 
ATOM   3730  H  HD12   . LEU A 1 265 ? 33.452  33.162 -30.458  1.00 49.28  ? 245 LEU A HD12   1 
ATOM   3731  H  HD13   . LEU A 1 265 ? 34.074  34.182 -31.505  1.00 49.28  ? 245 LEU A HD13   1 
ATOM   3732  H  HD21   . LEU A 1 265 ? 33.220  32.742 -33.950  1.00 46.24  ? 245 LEU A HD21   1 
ATOM   3733  H  HD22   . LEU A 1 265 ? 34.700  33.305 -33.823  1.00 46.24  ? 245 LEU A HD22   1 
ATOM   3734  H  HD23   . LEU A 1 265 ? 34.460  31.766 -34.136  1.00 46.24  ? 245 LEU A HD23   1 
ATOM   3735  N  N      . HIS A 1 266 ? 37.947  30.237 -30.635  1.00 37.78  ? 246 HIS A N      1 
ATOM   3736  C  CA     . HIS A 1 266 ? 39.346  30.087 -30.242  1.00 39.58  ? 246 HIS A CA     1 
ATOM   3737  C  C      . HIS A 1 266 ? 40.059  29.073 -31.127  1.00 36.27  ? 246 HIS A C      1 
ATOM   3738  O  O      . HIS A 1 266 ? 41.182  29.311 -31.588  1.00 31.55  ? 246 HIS A O      1 
ATOM   3739  C  CB     . HIS A 1 266 ? 39.437  29.662 -28.777  1.00 40.46  ? 246 HIS A CB     1 
ATOM   3740  C  CG     . HIS A 1 266 ? 40.840  29.444 -28.299  1.00 39.11  ? 246 HIS A CG     1 
ATOM   3741  N  ND1    . HIS A 1 266 ? 41.662  30.476 -27.899  1.00 39.70  ? 246 HIS A ND1    1 
ATOM   3742  C  CD2    . HIS A 1 266 ? 41.570  28.311 -28.171  1.00 38.61  ? 246 HIS A CD2    1 
ATOM   3743  C  CE1    . HIS A 1 266 ? 42.834  29.986 -27.536  1.00 40.13  ? 246 HIS A CE1    1 
ATOM   3744  N  NE2    . HIS A 1 266 ? 42.805  28.675 -27.693  1.00 39.40  ? 246 HIS A NE2    1 
ATOM   3745  H  H      . HIS A 1 266 ? 37.380  30.091 -30.005  1.00 45.45  ? 246 HIS A H      1 
ATOM   3746  H  HA     . HIS A 1 266 ? 39.796  30.940 -30.338  1.00 47.62  ? 246 HIS A HA     1 
ATOM   3747  H  HB2    . HIS A 1 266 ? 39.040  30.354 -28.225  1.00 48.67  ? 246 HIS A HB2    1 
ATOM   3748  H  HB3    . HIS A 1 266 ? 38.952  28.830 -28.662  1.00 48.67  ? 246 HIS A HB3    1 
ATOM   3749  H  HD2    . HIS A 1 266 ? 41.286  27.447 -28.366  1.00 46.45  ? 246 HIS A HD2    1 
ATOM   3750  H  HE1    . HIS A 1 266 ? 43.558  30.481 -27.226  1.00 48.27  ? 246 HIS A HE1    1 
ATOM   3751  H  HE2    . HIS A 1 266 ? 43.454  28.137 -27.523  1.00 47.40  ? 246 HIS A HE2    1 
ATOM   3752  N  N      . PHE A 1 267 ? 39.417  27.930 -31.376  1.00 37.07  ? 247 PHE A N      1 
ATOM   3753  C  CA     . PHE A 1 267 ? 40.050  26.886 -32.172  1.00 34.71  ? 247 PHE A CA     1 
ATOM   3754  C  C      . PHE A 1 267 ? 40.403  27.401 -33.560  1.00 33.65  ? 247 PHE A C      1 
ATOM   3755  O  O      . PHE A 1 267 ? 41.534  27.231 -34.028  1.00 32.87  ? 247 PHE A O      1 
ATOM   3756  C  CB     . PHE A 1 267 ? 39.142  25.661 -32.265  1.00 32.91  ? 247 PHE A CB     1 
ATOM   3757  C  CG     . PHE A 1 267 ? 39.708  24.559 -33.116  1.00 31.34  ? 247 PHE A CG     1 
ATOM   3758  C  CD1    . PHE A 1 267 ? 40.576  23.628 -32.571  1.00 29.08  ? 247 PHE A CD1    1 
ATOM   3759  C  CD2    . PHE A 1 267 ? 39.377  24.455 -34.457  1.00 32.05  ? 247 PHE A CD2    1 
ATOM   3760  C  CE1    . PHE A 1 267 ? 41.105  22.615 -33.346  1.00 28.97  ? 247 PHE A CE1    1 
ATOM   3761  C  CE2    . PHE A 1 267 ? 39.903  23.443 -35.237  1.00 31.73  ? 247 PHE A CE2    1 
ATOM   3762  C  CZ     . PHE A 1 267 ? 40.768  22.521 -34.679  1.00 30.41  ? 247 PHE A CZ     1 
ATOM   3763  H  H      . PHE A 1 267 ? 38.625  27.739 -31.099  1.00 44.60  ? 247 PHE A H      1 
ATOM   3764  H  HA     . PHE A 1 267 ? 40.874  26.615 -31.737  1.00 41.77  ? 247 PHE A HA     1 
ATOM   3765  H  HB2    . PHE A 1 267 ? 39.002  25.306 -31.374  1.00 39.61  ? 247 PHE A HB2    1 
ATOM   3766  H  HB3    . PHE A 1 267 ? 38.293  25.928 -32.651  1.00 39.61  ? 247 PHE A HB3    1 
ATOM   3767  H  HD1    . PHE A 1 267 ? 40.808  23.686 -31.672  1.00 35.02  ? 247 PHE A HD1    1 
ATOM   3768  H  HD2    . PHE A 1 267 ? 38.796  25.074 -34.837  1.00 38.57  ? 247 PHE A HD2    1 
ATOM   3769  H  HE1    . PHE A 1 267 ? 41.686  21.995 -32.968  1.00 34.88  ? 247 PHE A HE1    1 
ATOM   3770  H  HE2    . PHE A 1 267 ? 39.674  23.382 -36.136  1.00 38.20  ? 247 PHE A HE2    1 
ATOM   3771  H  HZ     . PHE A 1 267 ? 41.122  21.838 -35.202  1.00 36.60  ? 247 PHE A HZ     1 
ATOM   3772  N  N      . PHE A 1 268 ? 39.448  28.035 -34.239  1.00 33.01  ? 248 PHE A N      1 
ATOM   3773  C  CA     . PHE A 1 268 ? 39.738  28.505 -35.589  1.00 33.02  ? 248 PHE A CA     1 
ATOM   3774  C  C      . PHE A 1 268 ? 40.528  29.809 -35.619  1.00 37.44  ? 248 PHE A C      1 
ATOM   3775  O  O      . PHE A 1 268 ? 40.845  30.292 -36.712  1.00 35.46  ? 248 PHE A O      1 
ATOM   3776  C  CB     . PHE A 1 268 ? 38.442  28.662 -36.390  1.00 26.41  ? 248 PHE A CB     1 
ATOM   3777  C  CG     . PHE A 1 268 ? 37.963  27.379 -37.005  1.00 25.37  ? 248 PHE A CG     1 
ATOM   3778  C  CD1    . PHE A 1 268 ? 38.661  26.798 -38.053  1.00 25.88  ? 248 PHE A CD1    1 
ATOM   3779  C  CD2    . PHE A 1 268 ? 36.823  26.749 -36.537  1.00 24.54  ? 248 PHE A CD2    1 
ATOM   3780  C  CE1    . PHE A 1 268 ? 38.233  25.617 -38.620  1.00 25.87  ? 248 PHE A CE1    1 
ATOM   3781  C  CE2    . PHE A 1 268 ? 36.388  25.567 -37.103  1.00 23.32  ? 248 PHE A CE2    1 
ATOM   3782  C  CZ     . PHE A 1 268 ? 37.093  25.001 -38.146  1.00 26.28  ? 248 PHE A CZ     1 
ATOM   3783  H  H      . PHE A 1 268 ? 38.654  28.200 -33.953  1.00 39.73  ? 248 PHE A H      1 
ATOM   3784  H  HA     . PHE A 1 268 ? 40.275  27.832 -36.037  1.00 39.74  ? 248 PHE A HA     1 
ATOM   3785  H  HB2    . PHE A 1 268 ? 37.746  28.987 -35.799  1.00 31.81  ? 248 PHE A HB2    1 
ATOM   3786  H  HB3    . PHE A 1 268 ? 38.591  29.298 -37.106  1.00 31.81  ? 248 PHE A HB3    1 
ATOM   3787  H  HD1    . PHE A 1 268 ? 39.430  27.210 -38.375  1.00 31.17  ? 248 PHE A HD1    1 
ATOM   3788  H  HD2    . PHE A 1 268 ? 36.344  27.126 -35.835  1.00 29.56  ? 248 PHE A HD2    1 
ATOM   3789  H  HE1    . PHE A 1 268 ? 38.709  25.238 -39.323  1.00 31.16  ? 248 PHE A HE1    1 
ATOM   3790  H  HE2    . PHE A 1 268 ? 35.620  25.153 -36.781  1.00 28.10  ? 248 PHE A HE2    1 
ATOM   3791  H  HZ     . PHE A 1 268 ? 36.801  24.206 -38.528  1.00 31.66  ? 248 PHE A HZ     1 
ATOM   3792  N  N      . LEU A 1 269 ? 40.861  30.391 -34.466  1.00 39.03  ? 249 LEU A N      1 
ATOM   3793  C  CA     . LEU A 1 269 ? 41.721  31.570 -34.434  1.00 39.00  ? 249 LEU A CA     1 
ATOM   3794  C  C      . LEU A 1 269 ? 43.170  31.256 -34.082  1.00 39.14  ? 249 LEU A C      1 
ATOM   3795  O  O      . LEU A 1 269 ? 44.082  31.869 -34.645  1.00 33.33  ? 249 LEU A O      1 
ATOM   3796  C  CB     . LEU A 1 269 ? 41.179  32.604 -33.440  1.00 42.95  ? 249 LEU A CB     1 
ATOM   3797  C  CG     . LEU A 1 269 ? 40.074  33.536 -33.947  1.00 45.26  ? 249 LEU A CG     1 
ATOM   3798  C  CD1    . LEU A 1 269 ? 39.554  34.396 -32.806  1.00 47.88  ? 249 LEU A CD1    1 
ATOM   3799  C  CD2    . LEU A 1 269 ? 40.553  34.413 -35.102  1.00 44.63  ? 249 LEU A CD2    1 
ATOM   3800  H  H      . LEU A 1 269 ? 40.603  30.121 -33.691  1.00 46.95  ? 249 LEU A H      1 
ATOM   3801  H  HA     . LEU A 1 269 ? 41.716  31.979 -35.314  1.00 46.92  ? 249 LEU A HA     1 
ATOM   3802  H  HB2    . LEU A 1 269 ? 40.822  32.128 -32.674  1.00 51.66  ? 249 LEU A HB2    1 
ATOM   3803  H  HB3    . LEU A 1 269 ? 41.917  33.164 -33.154  1.00 51.66  ? 249 LEU A HB3    1 
ATOM   3804  H  HG     . LEU A 1 269 ? 39.336  32.997 -34.272  1.00 54.43  ? 249 LEU A HG     1 
ATOM   3805  H  HD11   . LEU A 1 269 ? 38.856  34.980 -33.143  1.00 57.57  ? 249 LEU A HD11   1 
ATOM   3806  H  HD12   . LEU A 1 269 ? 39.196  33.818 -32.114  1.00 57.57  ? 249 LEU A HD12   1 
ATOM   3807  H  HD13   . LEU A 1 269 ? 40.285  34.925 -32.450  1.00 57.57  ? 249 LEU A HD13   1 
ATOM   3808  H  HD21   . LEU A 1 269 ? 39.823  34.984 -35.388  1.00 53.67  ? 249 LEU A HD21   1 
ATOM   3809  H  HD22   . LEU A 1 269 ? 41.298  34.955 -34.799  1.00 53.67  ? 249 LEU A HD22   1 
ATOM   3810  H  HD23   . LEU A 1 269 ? 40.835  33.843 -35.835  1.00 53.67  ? 249 LEU A HD23   1 
ATOM   3811  N  N      . HIS A 1 270 ? 43.413  30.316 -33.163  1.00 45.17  ? 250 HIS A N      1 
ATOM   3812  C  CA     . HIS A 1 270 ? 44.753  30.102 -32.633  1.00 46.57  ? 250 HIS A CA     1 
ATOM   3813  C  C      . HIS A 1 270 ? 45.256  28.672 -32.751  1.00 43.75  ? 250 HIS A C      1 
ATOM   3814  O  O      . HIS A 1 270 ? 46.438  28.437 -32.479  1.00 40.29  ? 250 HIS A O      1 
ATOM   3815  C  CB     . HIS A 1 270 ? 44.809  30.508 -31.151  1.00 47.71  ? 250 HIS A CB     1 
ATOM   3816  C  CG     . HIS A 1 270 ? 44.362  31.912 -30.892  1.00 50.19  ? 250 HIS A CG     1 
ATOM   3817  N  ND1    . HIS A 1 270 ? 45.044  33.012 -31.364  1.00 52.26  ? 250 HIS A ND1    1 
ATOM   3818  C  CD2    . HIS A 1 270 ? 43.297  32.394 -30.209  1.00 50.92  ? 250 HIS A CD2    1 
ATOM   3819  C  CE1    . HIS A 1 270 ? 44.419  34.112 -30.983  1.00 53.33  ? 250 HIS A CE1    1 
ATOM   3820  N  NE2    . HIS A 1 270 ? 43.356  33.765 -30.281  1.00 52.37  ? 250 HIS A NE2    1 
ATOM   3821  H  H      . HIS A 1 270 ? 42.816  29.792 -32.834  1.00 54.32  ? 250 HIS A H      1 
ATOM   3822  H  HA     . HIS A 1 270 ? 45.371  30.671 -33.118  1.00 56.00  ? 250 HIS A HA     1 
ATOM   3823  H  HB2    . HIS A 1 270 ? 44.234  29.915 -30.643  1.00 57.37  ? 250 HIS A HB2    1 
ATOM   3824  H  HB3    . HIS A 1 270 ? 45.724  30.425 -30.839  1.00 57.37  ? 250 HIS A HB3    1 
ATOM   3825  H  HD2    . HIS A 1 270 ? 42.648  31.892 -29.773  1.00 61.22  ? 250 HIS A HD2    1 
ATOM   3826  H  HE1    . HIS A 1 270 ? 44.683  34.983 -31.176  1.00 64.11  ? 250 HIS A HE1    1 
ATOM   3827  H  HE2    . HIS A 1 270 ? 42.792  34.308 -29.926  1.00 62.96  ? 250 HIS A HE2    1 
ATOM   3828  N  N      . GLU A 1 271 ? 44.415  27.715 -33.140  1.00 44.07  ? 251 GLU A N      1 
ATOM   3829  C  CA     . GLU A 1 271 ? 44.814  26.315 -33.223  1.00 42.75  ? 251 GLU A CA     1 
ATOM   3830  C  C      . GLU A 1 271 ? 44.925  25.807 -34.654  1.00 39.57  ? 251 GLU A C      1 
ATOM   3831  O  O      . GLU A 1 271 ? 45.906  25.138 -34.994  1.00 38.68  ? 251 GLU A O      1 
ATOM   3832  C  CB     . GLU A 1 271 ? 43.821  25.460 -32.421  1.00 43.86  ? 251 GLU A CB     1 
ATOM   3833  C  CG     . GLU A 1 271 ? 44.037  25.559 -30.914  1.00 46.12  ? 251 GLU A CG     1 
ATOM   3834  C  CD     . GLU A 1 271 ? 43.059  24.720 -30.115  1.00 47.80  ? 251 GLU A CD     1 
ATOM   3835  O  OE1    . GLU A 1 271 ? 42.152  25.306 -29.488  1.00 48.35  ? 251 GLU A OE1    1 
ATOM   3836  O  OE2    . GLU A 1 271 ? 43.193  23.478 -30.115  1.00 48.17  ? 251 GLU A OE2    1 
ATOM   3837  H  H      . GLU A 1 271 ? 43.597  27.855 -33.364  1.00 53.00  ? 251 GLU A H      1 
ATOM   3838  H  HA     . GLU A 1 271 ? 45.686  26.218 -32.809  1.00 51.41  ? 251 GLU A HA     1 
ATOM   3839  H  HB2    . GLU A 1 271 ? 42.918  25.759 -32.615  1.00 52.76  ? 251 GLU A HB2    1 
ATOM   3840  H  HB3    . GLU A 1 271 ? 43.925  24.531 -32.679  1.00 52.76  ? 251 GLU A HB3    1 
ATOM   3841  H  HG2    . GLU A 1 271 ? 44.933  25.254 -30.704  1.00 55.46  ? 251 GLU A HG2    1 
ATOM   3842  H  HG3    . GLU A 1 271 ? 43.930  26.483 -30.641  1.00 55.46  ? 251 GLU A HG3    1 
ATOM   3843  N  N      . PHE A 1 272 ? 43.947  26.100 -35.508  1.00 38.36  ? 252 PHE A N      1 
ATOM   3844  C  CA     . PHE A 1 272 ? 44.026  25.697 -36.907  1.00 38.83  ? 252 PHE A CA     1 
ATOM   3845  C  C      . PHE A 1 272 ? 45.037  26.560 -37.656  1.00 39.50  ? 252 PHE A C      1 
ATOM   3846  O  O      . PHE A 1 272 ? 44.980  27.792 -37.602  1.00 41.37  ? 252 PHE A O      1 
ATOM   3847  C  CB     . PHE A 1 272 ? 42.649  25.795 -37.563  1.00 37.66  ? 252 PHE A CB     1 
ATOM   3848  C  CG     . PHE A 1 272 ? 42.662  25.541 -39.045  1.00 35.97  ? 252 PHE A CG     1 
ATOM   3849  C  CD1    . PHE A 1 272 ? 42.844  24.260 -39.541  1.00 33.54  ? 252 PHE A CD1    1 
ATOM   3850  C  CD2    . PHE A 1 272 ? 42.483  26.581 -39.941  1.00 35.68  ? 252 PHE A CD2    1 
ATOM   3851  C  CE1    . PHE A 1 272 ? 42.856  24.023 -40.903  1.00 30.69  ? 252 PHE A CE1    1 
ATOM   3852  C  CE2    . PHE A 1 272 ? 42.493  26.349 -41.302  1.00 35.09  ? 252 PHE A CE2    1 
ATOM   3853  C  CZ     . PHE A 1 272 ? 42.679  25.068 -41.783  1.00 32.01  ? 252 PHE A CZ     1 
ATOM   3854  H  H      . PHE A 1 272 ? 43.231  26.530 -35.302  1.00 46.15  ? 252 PHE A H      1 
ATOM   3855  H  HA     . PHE A 1 272 ? 44.320  24.774 -36.957  1.00 46.71  ? 252 PHE A HA     1 
ATOM   3856  H  HB2    . PHE A 1 272 ? 42.061  25.140 -37.156  1.00 45.31  ? 252 PHE A HB2    1 
ATOM   3857  H  HB3    . PHE A 1 272 ? 42.297  26.687 -37.419  1.00 45.31  ? 252 PHE A HB3    1 
ATOM   3858  H  HD1    . PHE A 1 272 ? 42.965  23.552 -38.951  1.00 40.37  ? 252 PHE A HD1    1 
ATOM   3859  H  HD2    . PHE A 1 272 ? 42.358  27.445 -39.622  1.00 42.94  ? 252 PHE A HD2    1 
ATOM   3860  H  HE1    . PHE A 1 272 ? 42.981  23.160 -41.224  1.00 36.95  ? 252 PHE A HE1    1 
ATOM   3861  H  HE2    . PHE A 1 272 ? 42.373  27.056 -41.894  1.00 42.22  ? 252 PHE A HE2    1 
ATOM   3862  H  HZ     . PHE A 1 272 ? 42.685  24.911 -42.700  1.00 38.53  ? 252 PHE A HZ     1 
ATOM   3863  N  N      . ASP A 1 273 ? 45.962  25.908 -38.362  1.00 38.71  ? 253 ASP A N      1 
ATOM   3864  C  CA     . ASP A 1 273 ? 47.018  26.589 -39.113  1.00 37.90  ? 253 ASP A CA     1 
ATOM   3865  C  C      . ASP A 1 273 ? 46.627  26.593 -40.589  1.00 36.99  ? 253 ASP A C      1 
ATOM   3866  O  O      . ASP A 1 273 ? 46.790  25.591 -41.290  1.00 36.58  ? 253 ASP A O      1 
ATOM   3867  C  CB     . ASP A 1 273 ? 48.360  25.899 -38.889  1.00 36.48  ? 253 ASP A CB     1 
ATOM   3868  C  CG     . ASP A 1 273 ? 49.516  26.620 -39.567  1.00 39.52  ? 253 ASP A CG     1 
ATOM   3869  O  OD1    . ASP A 1 273 ? 49.271  27.416 -40.496  1.00 40.17  ? 253 ASP A OD1    1 
ATOM   3870  O  OD2    . ASP A 1 273 ? 50.677  26.385 -39.169  1.00 40.69  ? 253 ASP A OD2    1 
ATOM   3871  H  H      . ASP A 1 273 ? 45.999  25.051 -38.422  1.00 46.57  ? 253 ASP A H      1 
ATOM   3872  H  HA     . ASP A 1 273 ? 47.089  27.508 -38.811  1.00 45.59  ? 253 ASP A HA     1 
ATOM   3873  H  HB2    . ASP A 1 273 ? 48.544  25.869 -37.937  1.00 43.89  ? 253 ASP A HB2    1 
ATOM   3874  H  HB3    . ASP A 1 273 ? 48.317  24.999 -39.247  1.00 43.89  ? 253 ASP A HB3    1 
ATOM   3875  N  N      . SER A 1 274 ? 46.118  27.732 -41.061  1.00 33.92  ? 254 SER A N      1 
ATOM   3876  C  CA     . SER A 1 274 ? 45.641  27.843 -42.435  1.00 33.53  ? 254 SER A CA     1 
ATOM   3877  C  C      . SER A 1 274 ? 46.764  27.813 -43.467  1.00 34.01  ? 254 SER A C      1 
ATOM   3878  O  O      . SER A 1 274 ? 46.475  27.700 -44.663  1.00 30.64  ? 254 SER A O      1 
ATOM   3879  C  CB     . SER A 1 274 ? 44.832  29.130 -42.602  1.00 34.58  ? 254 SER A CB     1 
ATOM   3880  O  OG     . SER A 1 274 ? 45.620  30.270 -42.306  1.00 37.12  ? 254 SER A OG     1 
ATOM   3881  H  H      . SER A 1 274 ? 46.039  28.456 -40.603  1.00 40.82  ? 254 SER A H      1 
ATOM   3882  H  HA     . SER A 1 274 ? 45.051  27.096 -42.621  1.00 40.36  ? 254 SER A HA     1 
ATOM   3883  H  HB2    . SER A 1 274 ? 44.522  29.191 -43.519  1.00 41.61  ? 254 SER A HB2    1 
ATOM   3884  H  HB3    . SER A 1 274 ? 44.073  29.106 -41.998  1.00 41.61  ? 254 SER A HB3    1 
ATOM   3885  H  HG     . SER A 1 274 ? 46.281  30.304 -42.823  1.00 44.66  ? 254 SER A HG     1 
ATOM   3886  N  N      . ASP A 1 275 ? 48.024  27.918 -43.048  1.00 36.21  ? 255 ASP A N      1 
ATOM   3887  C  CA     . ASP A 1 275 ? 49.145  27.860 -43.978  1.00 39.43  ? 255 ASP A CA     1 
ATOM   3888  C  C      . ASP A 1 275 ? 49.663  26.446 -44.208  1.00 36.77  ? 255 ASP A C      1 
ATOM   3889  O  O      . ASP A 1 275 ? 50.493  26.250 -45.102  1.00 34.98  ? 255 ASP A O      1 
ATOM   3890  C  CB     . ASP A 1 275 ? 50.300  28.736 -43.475  1.00 46.27  ? 255 ASP A CB     1 
ATOM   3891  C  CG     . ASP A 1 275 ? 49.964  30.216 -43.491  1.00 51.86  ? 255 ASP A CG     1 
ATOM   3892  O  OD1    . ASP A 1 275 ? 49.160  30.638 -44.349  1.00 52.92  ? 255 ASP A OD1    1 
ATOM   3893  O  OD2    . ASP A 1 275 ? 50.513  30.960 -42.651  1.00 54.18  ? 255 ASP A OD2    1 
ATOM   3894  H  H      . ASP A 1 275 ? 48.255  28.024 -42.226  1.00 43.57  ? 255 ASP A H      1 
ATOM   3895  H  HA     . ASP A 1 275 ? 48.857  28.213 -44.834  1.00 47.44  ? 255 ASP A HA     1 
ATOM   3896  H  HB2    . ASP A 1 275 ? 50.512  28.487 -42.562  1.00 55.64  ? 255 ASP A HB2    1 
ATOM   3897  H  HB3    . ASP A 1 275 ? 51.073  28.598 -44.045  1.00 55.64  ? 255 ASP A HB3    1 
ATOM   3898  N  N      . LYS A 1 276 ? 49.196  25.462 -43.438  1.00 39.75  ? 256 LYS A N      1 
ATOM   3899  C  CA     . LYS A 1 276 ? 49.747  24.112 -43.500  1.00 40.68  ? 256 LYS A CA     1 
ATOM   3900  C  C      . LYS A 1 276 ? 48.665  23.043 -43.591  1.00 38.05  ? 256 LYS A C      1 
ATOM   3901  O  O      . LYS A 1 276 ? 48.877  21.993 -44.207  1.00 34.58  ? 256 LYS A O      1 
ATOM   3902  C  CB     . LYS A 1 276 ? 50.624  23.838 -42.275  1.00 44.78  ? 256 LYS A CB     1 
ATOM   3903  C  CG     . LYS A 1 276 ? 51.855  24.716 -42.164  1.00 50.82  ? 256 LYS A CG     1 
ATOM   3904  C  CD     . LYS A 1 276 ? 52.654  24.367 -40.916  1.00 56.44  ? 256 LYS A CD     1 
ATOM   3905  C  CE     . LYS A 1 276 ? 53.966  25.130 -40.855  1.00 60.35  ? 256 LYS A CE     1 
ATOM   3906  N  NZ     . LYS A 1 276 ? 54.858  24.808 -42.002  1.00 61.95  ? 256 LYS A NZ     1 
ATOM   3907  H  H      . LYS A 1 276 ? 48.557  25.553 -42.869  1.00 47.81  ? 256 LYS A H      1 
ATOM   3908  H  HA     . LYS A 1 276 ? 50.306  24.038 -44.290  1.00 48.93  ? 256 LYS A HA     1 
ATOM   3909  H  HB2    . LYS A 1 276 ? 50.091  23.977 -41.477  1.00 53.86  ? 256 LYS A HB2    1 
ATOM   3910  H  HB3    . LYS A 1 276 ? 50.924  22.916 -42.310  1.00 53.86  ? 256 LYS A HB3    1 
ATOM   3911  H  HG2    . LYS A 1 276 ? 52.422  24.578 -42.939  1.00 61.10  ? 256 LYS A HG2    1 
ATOM   3912  H  HG3    . LYS A 1 276 ? 51.584  25.646 -42.104  1.00 61.10  ? 256 LYS A HG3    1 
ATOM   3913  H  HD2    . LYS A 1 276 ? 52.134  24.596 -40.130  1.00 67.84  ? 256 LYS A HD2    1 
ATOM   3914  H  HD3    . LYS A 1 276 ? 52.855  23.418 -40.921  1.00 67.84  ? 256 LYS A HD3    1 
ATOM   3915  H  HE2    . LYS A 1 276 ? 53.782  26.082 -40.875  1.00 72.54  ? 256 LYS A HE2    1 
ATOM   3916  H  HE3    . LYS A 1 276 ? 54.432  24.897 -40.037  1.00 72.54  ? 256 LYS A HE3    1 
ATOM   3917  H  HZ1    . LYS A 1 276 ? 54.456  25.018 -42.768  1.00 74.46  ? 256 LYS A HZ1    1 
ATOM   3918  H  HZ2    . LYS A 1 276 ? 55.616  25.270 -41.937  1.00 74.46  ? 256 LYS A HZ2    1 
ATOM   3919  H  HZ3    . LYS A 1 276 ? 55.048  23.938 -42.005  1.00 74.46  ? 256 LYS A HZ3    1 
ATOM   3920  N  N      . GLN A 1 277 ? 47.511  23.289 -42.976  1.00 36.85  ? 257 GLN A N      1 
ATOM   3921  C  CA     . GLN A 1 277 ? 46.516  22.256 -42.733  1.00 35.02  ? 257 GLN A CA     1 
ATOM   3922  C  C      . GLN A 1 277 ? 45.307  22.431 -43.643  1.00 31.81  ? 257 GLN A C      1 
ATOM   3923  O  O      . GLN A 1 277 ? 45.088  23.493 -44.231  1.00 28.13  ? 257 GLN A O      1 
ATOM   3924  C  CB     . GLN A 1 277 ? 46.073  22.277 -41.266  1.00 33.66  ? 257 GLN A CB     1 
ATOM   3925  C  CG     . GLN A 1 277 ? 47.226  22.201 -40.279  1.00 33.15  ? 257 GLN A CG     1 
ATOM   3926  C  CD     . GLN A 1 277 ? 46.761  22.200 -38.837  1.00 32.26  ? 257 GLN A CD     1 
ATOM   3927  O  OE1    . GLN A 1 277 ? 45.833  22.922 -38.470  1.00 33.76  ? 257 GLN A OE1    1 
ATOM   3928  N  NE2    . GLN A 1 277 ? 47.396  21.377 -38.012  1.00 28.64  ? 257 GLN A NE2    1 
ATOM   3929  H  H      . GLN A 1 277 ? 47.279  24.065 -42.686  1.00 44.33  ? 257 GLN A H      1 
ATOM   3930  H  HA     . GLN A 1 277 ? 46.909  21.388 -42.916  1.00 42.14  ? 257 GLN A HA     1 
ATOM   3931  H  HB2    . GLN A 1 277 ? 45.591  23.102 -41.097  1.00 40.51  ? 257 GLN A HB2    1 
ATOM   3932  H  HB3    . GLN A 1 277 ? 45.493  21.517 -41.104  1.00 40.51  ? 257 GLN A HB3    1 
ATOM   3933  H  HG2    . GLN A 1 277 ? 47.723  21.383 -40.435  1.00 39.90  ? 257 GLN A HG2    1 
ATOM   3934  H  HG3    . GLN A 1 277 ? 47.804  22.970 -40.408  1.00 39.90  ? 257 GLN A HG3    1 
ATOM   3935  H  HE21   . GLN A 1 277 ? 48.034  20.880 -38.307  1.00 34.48  ? 257 GLN A HE21   1 
ATOM   3936  H  HE22   . GLN A 1 277 ? 47.170  21.339 -37.183  1.00 34.48  ? 257 GLN A HE22   1 
ATOM   3937  N  N      . VAL A 1 278 ? 44.524  21.357 -43.755  1.00 33.42  ? 258 VAL A N      1 
ATOM   3938  C  CA     . VAL A 1 278 ? 43.328  21.322 -44.589  1.00 31.73  ? 258 VAL A CA     1 
ATOM   3939  C  C      . VAL A 1 278 ? 42.174  20.784 -43.754  1.00 31.27  ? 258 VAL A C      1 
ATOM   3940  O  O      . VAL A 1 278 ? 42.319  19.767 -43.066  1.00 35.47  ? 258 VAL A O      1 
ATOM   3941  C  CB     . VAL A 1 278 ? 43.531  20.456 -45.849  1.00 30.15  ? 258 VAL A CB     1 
ATOM   3942  C  CG1    . VAL A 1 278 ? 42.257  20.421 -46.692  1.00 26.43  ? 258 VAL A CG1    1 
ATOM   3943  C  CG2    . VAL A 1 278 ? 44.704  20.973 -46.669  1.00 32.26  ? 258 VAL A CG2    1 
ATOM   3944  H  H      . VAL A 1 278 ? 44.672  20.617 -43.343  1.00 40.23  ? 258 VAL A H      1 
ATOM   3945  H  HA     . VAL A 1 278 ? 43.106  22.223 -44.871  1.00 38.19  ? 258 VAL A HA     1 
ATOM   3946  H  HB     . VAL A 1 278 ? 43.734  19.548 -45.577  1.00 36.30  ? 258 VAL A HB     1 
ATOM   3947  H  HG11   . VAL A 1 278 ? 42.414  19.871 -47.476  1.00 31.83  ? 258 VAL A HG11   1 
ATOM   3948  H  HG12   . VAL A 1 278 ? 41.538  20.044 -46.161  1.00 31.83  ? 258 VAL A HG12   1 
ATOM   3949  H  HG13   . VAL A 1 278 ? 42.032  21.325 -46.961  1.00 31.83  ? 258 VAL A HG13   1 
ATOM   3950  H  HG21   . VAL A 1 278 ? 44.811  20.413 -47.454  1.00 38.83  ? 258 VAL A HG21   1 
ATOM   3951  H  HG22   . VAL A 1 278 ? 44.524  21.888 -46.936  1.00 38.83  ? 258 VAL A HG22   1 
ATOM   3952  H  HG23   . VAL A 1 278 ? 45.507  20.939 -46.126  1.00 38.83  ? 258 VAL A HG23   1 
ATOM   3953  N  N      . ILE A 1 279 ? 41.032  21.464 -43.820  1.00 24.89  ? 259 ILE A N      1 
ATOM   3954  C  CA     . ILE A 1 279 ? 39.811  21.015 -43.155  1.00 22.23  ? 259 ILE A CA     1 
ATOM   3955  C  C      . ILE A 1 279 ? 39.215  19.884 -43.988  1.00 21.33  ? 259 ILE A C      1 
ATOM   3956  O  O      . ILE A 1 279 ? 38.773  20.103 -45.118  1.00 19.05  ? 259 ILE A O      1 
ATOM   3957  C  CB     . ILE A 1 279 ? 38.813  22.166 -42.983  1.00 22.79  ? 259 ILE A CB     1 
ATOM   3958  C  CG1    . ILE A 1 279 ? 39.434  23.288 -42.144  1.00 24.20  ? 259 ILE A CG1    1 
ATOM   3959  C  CG2    . ILE A 1 279 ? 37.522  21.674 -42.341  1.00 21.39  ? 259 ILE A CG2    1 
ATOM   3960  C  CD1    . ILE A 1 279 ? 38.753  24.629 -42.318  1.00 20.78  ? 259 ILE A CD1    1 
ATOM   3961  H  H      . ILE A 1 279 ? 40.938  22.202 -44.252  1.00 29.99  ? 259 ILE A H      1 
ATOM   3962  H  HA     . ILE A 1 279 ? 40.031  20.666 -42.277  1.00 26.80  ? 259 ILE A HA     1 
ATOM   3963  H  HB     . ILE A 1 279 ? 38.602  22.521 -43.861  1.00 27.46  ? 259 ILE A HB     1 
ATOM   3964  H  HG12   . ILE A 1 279 ? 39.377  23.045 -41.207  1.00 29.15  ? 259 ILE A HG12   1 
ATOM   3965  H  HG13   . ILE A 1 279 ? 40.364  23.392 -42.401  1.00 29.15  ? 259 ILE A HG13   1 
ATOM   3966  H  HG21   . ILE A 1 279 ? 36.912  22.423 -42.246  1.00 25.78  ? 259 ILE A HG21   1 
ATOM   3967  H  HG22   . ILE A 1 279 ? 37.126  20.995 -42.908  1.00 25.78  ? 259 ILE A HG22   1 
ATOM   3968  H  HG23   . ILE A 1 279 ? 37.725  21.301 -41.469  1.00 25.78  ? 259 ILE A HG23   1 
ATOM   3969  H  HD11   . ILE A 1 279 ? 39.199  25.284 -41.759  1.00 25.05  ? 259 ILE A HD11   1 
ATOM   3970  H  HD12   . ILE A 1 279 ? 38.810  24.894 -43.249  1.00 25.05  ? 259 ILE A HD12   1 
ATOM   3971  H  HD13   . ILE A 1 279 ? 37.823  24.547 -42.054  1.00 25.05  ? 259 ILE A HD13   1 
ATOM   3972  N  N      . SER A 1 280 ? 39.195  18.675 -43.430  1.00 27.28  ? 260 SER A N      1 
ATOM   3973  C  CA     . SER A 1 280 ? 38.796  17.495 -44.184  1.00 30.51  ? 260 SER A CA     1 
ATOM   3974  C  C      . SER A 1 280 ? 38.066  16.520 -43.272  1.00 34.07  ? 260 SER A C      1 
ATOM   3975  O  O      . SER A 1 280 ? 38.413  16.378 -42.097  1.00 34.24  ? 260 SER A O      1 
ATOM   3976  C  CB     . SER A 1 280 ? 40.013  16.807 -44.816  1.00 27.41  ? 260 SER A CB     1 
ATOM   3977  O  OG     . SER A 1 280 ? 39.639  15.621 -45.495  1.00 24.28  ? 260 SER A OG     1 
ATOM   3978  H  H      . SER A 1 280 ? 39.410  18.513 -42.614  1.00 32.86  ? 260 SER A H      1 
ATOM   3979  H  HA     . SER A 1 280 ? 38.191  17.758 -44.895  1.00 36.73  ? 260 SER A HA     1 
ATOM   3980  H  HB2    . SER A 1 280 ? 40.424  17.416 -45.449  1.00 33.01  ? 260 SER A HB2    1 
ATOM   3981  H  HB3    . SER A 1 280 ? 40.645  16.582 -44.115  1.00 33.01  ? 260 SER A HB3    1 
ATOM   3982  H  HG     . SER A 1 280 ? 40.316  15.258 -45.834  1.00 29.25  ? 260 SER A HG     1 
ATOM   3983  N  N      . LEU A 1 281 ? 37.055  15.850 -43.828  1.00 34.47  ? 261 LEU A N      1 
ATOM   3984  C  CA     . LEU A 1 281 ? 36.372  14.752 -43.155  1.00 32.56  ? 261 LEU A CA     1 
ATOM   3985  C  C      . LEU A 1 281 ? 36.722  13.400 -43.762  1.00 33.99  ? 261 LEU A C      1 
ATOM   3986  O  O      . LEU A 1 281 ? 36.083  12.395 -43.431  1.00 35.75  ? 261 LEU A O      1 
ATOM   3987  C  CB     . LEU A 1 281 ? 34.855  14.954 -43.210  1.00 28.39  ? 261 LEU A CB     1 
ATOM   3988  C  CG     . LEU A 1 281 ? 34.267  16.263 -42.682  1.00 27.87  ? 261 LEU A CG     1 
ATOM   3989  C  CD1    . LEU A 1 281 ? 32.747  16.176 -42.692  1.00 27.47  ? 261 LEU A CD1    1 
ATOM   3990  C  CD2    . LEU A 1 281 ? 34.777  16.602 -41.291  1.00 28.31  ? 261 LEU A CD2    1 
ATOM   3991  H  H      . LEU A 1 281 ? 36.742  16.018 -44.612  1.00 41.49  ? 261 LEU A H      1 
ATOM   3992  H  HA     . LEU A 1 281 ? 36.639  14.740 -42.222  1.00 39.19  ? 261 LEU A HA     1 
ATOM   3993  H  HB2    . LEU A 1 281 ? 34.581  14.879 -44.137  1.00 34.18  ? 261 LEU A HB2    1 
ATOM   3994  H  HB3    . LEU A 1 281 ? 34.444  14.237 -42.702  1.00 34.18  ? 261 LEU A HB3    1 
ATOM   3995  H  HG     . LEU A 1 281 ? 34.526  16.984 -43.276  1.00 33.57  ? 261 LEU A HG     1 
ATOM   3996  H  HD11   . LEU A 1 281 ? 32.381  17.009 -42.356  1.00 33.08  ? 261 LEU A HD11   1 
ATOM   3997  H  HD12   . LEU A 1 281 ? 32.446  16.026 -43.602  1.00 33.08  ? 261 LEU A HD12   1 
ATOM   3998  H  HD13   . LEU A 1 281 ? 32.469  15.440 -42.125  1.00 33.08  ? 261 LEU A HD13   1 
ATOM   3999  H  HD21   . LEU A 1 281 ? 34.376  17.437 -41.003  1.00 34.09  ? 261 LEU A HD21   1 
ATOM   4000  H  HD22   . LEU A 1 281 ? 34.531  15.888 -40.682  1.00 34.09  ? 261 LEU A HD22   1 
ATOM   4001  H  HD23   . LEU A 1 281 ? 35.743  16.692 -41.323  1.00 34.09  ? 261 LEU A HD23   1 
ATOM   4002  N  N      . ASN A 1 282 ? 37.718  13.349 -44.646  1.00 31.41  ? 262 ASN A N      1 
ATOM   4003  C  CA     . ASN A 1 282 ? 38.124  12.097 -45.265  1.00 31.98  ? 262 ASN A CA     1 
ATOM   4004  C  C      . ASN A 1 282 ? 38.998  11.248 -44.356  1.00 35.50  ? 262 ASN A C      1 
ATOM   4005  O  O      . ASN A 1 282 ? 39.194  10.064 -44.644  1.00 33.85  ? 262 ASN A O      1 
ATOM   4006  C  CB     . ASN A 1 282 ? 38.890  12.375 -46.564  1.00 31.57  ? 262 ASN A CB     1 
ATOM   4007  C  CG     . ASN A 1 282 ? 38.022  13.002 -47.640  1.00 27.79  ? 262 ASN A CG     1 
ATOM   4008  O  OD1    . ASN A 1 282 ? 37.689  14.187 -47.578  1.00 26.27  ? 262 ASN A OD1    1 
ATOM   4009  N  ND2    . ASN A 1 282 ? 37.661  12.209 -48.641  1.00 24.39  ? 262 ASN A ND2    1 
ATOM   4010  H  H      . ASN A 1 282 ? 38.174  14.032 -44.902  1.00 37.81  ? 262 ASN A H      1 
ATOM   4011  H  HA     . ASN A 1 282 ? 37.332  11.583 -45.487  1.00 38.50  ? 262 ASN A HA     1 
ATOM   4012  H  HB2    . ASN A 1 282 ? 39.620  12.986 -46.375  1.00 38.00  ? 262 ASN A HB2    1 
ATOM   4013  H  HB3    . ASN A 1 282 ? 39.239  11.539 -46.910  1.00 38.00  ? 262 ASN A HB3    1 
ATOM   4014  H  HD21   . ASN A 1 282 ? 37.169  12.515 -49.276  1.00 29.39  ? 262 ASN A HD21   1 
ATOM   4015  H  HD22   . ASN A 1 282 ? 37.919  11.388 -48.654  1.00 29.39  ? 262 ASN A HD22   1 
ATOM   4016  N  N      . ARG A 1 283 ? 39.517  11.818 -43.271  1.00 41.29  ? 263 ARG A N      1 
ATOM   4017  C  CA     A ARG A 1 283 ? 40.528  11.166 -42.448  0.54 45.07  ? 263 ARG A CA     1 
ATOM   4018  C  CA     B ARG A 1 283 ? 40.510  11.152 -42.447  0.46 45.06  ? 263 ARG A CA     1 
ATOM   4019  C  C      . ARG A 1 283 ? 40.421  11.698 -41.032  1.00 43.94  ? 263 ARG A C      1 
ATOM   4020  O  O      . ARG A 1 283 ? 40.035  12.858 -40.839  1.00 46.84  ? 263 ARG A O      1 
ATOM   4021  C  CB     A ARG A 1 283 ? 41.950  11.432 -42.969  0.54 45.94  ? 263 ARG A CB     1 
ATOM   4022  C  CB     B ARG A 1 283 ? 41.912  11.375 -43.041  0.46 45.93  ? 263 ARG A CB     1 
ATOM   4023  C  CG     A ARG A 1 283 ? 42.185  11.117 -44.434  0.54 46.28  ? 263 ARG A CG     1 
ATOM   4024  C  CG     B ARG A 1 283 ? 43.100  11.062 -42.147  0.46 46.46  ? 263 ARG A CG     1 
ATOM   4025  C  CD     A ARG A 1 283 ? 43.471  11.752 -44.933  0.54 46.77  ? 263 ARG A CD     1 
ATOM   4026  C  CD     B ARG A 1 283 ? 43.870  12.332 -41.817  0.46 46.39  ? 263 ARG A CD     1 
ATOM   4027  N  NE     A ARG A 1 283 ? 43.633  11.576 -46.374  0.54 45.50  ? 263 ARG A NE     1 
ATOM   4028  N  NE     B ARG A 1 283 ? 45.175  12.044 -41.230  0.46 48.78  ? 263 ARG A NE     1 
ATOM   4029  C  CZ     A ARG A 1 283 ? 43.181  12.422 -47.298  0.54 41.66  ? 263 ARG A CZ     1 
ATOM   4030  C  CZ     B ARG A 1 283 ? 46.296  11.879 -41.927  0.46 51.46  ? 263 ARG A CZ     1 
ATOM   4031  N  NH1    A ARG A 1 283 ? 42.533  13.527 -46.949  0.54 35.60  ? 263 ARG A NH1    1 
ATOM   4032  N  NH1    B ARG A 1 283 ? 46.291  11.973 -43.251  0.46 51.46  ? 263 ARG A NH1    1 
ATOM   4033  N  NH2    A ARG A 1 283 ? 43.379  12.161 -48.582  0.54 44.05  ? 263 ARG A NH2    1 
ATOM   4034  N  NH2    B ARG A 1 283 ? 47.432  11.617 -41.296  0.46 53.62  ? 263 ARG A NH2    1 
ATOM   4035  H  H      A ARG A 1 283 ? 39.294  12.599 -42.987  0.54 49.67  ? 263 ARG A H      1 
ATOM   4036  H  H      B ARG A 1 283 ? 39.304  12.603 -42.990  0.46 49.67  ? 263 ARG A H      1 
ATOM   4037  H  HA     A ARG A 1 283 ? 40.373  10.208 -42.436  0.54 54.20  ? 263 ARG A HA     1 
ATOM   4038  H  HA     B ARG A 1 283 ? 40.331  10.199 -42.425  0.46 54.19  ? 263 ARG A HA     1 
ATOM   4039  H  HB2    A ARG A 1 283 ? 42.153  12.371 -42.838  0.54 55.24  ? 263 ARG A HB2    1 
ATOM   4040  H  HB2    B ARG A 1 283 ? 41.996  10.820 -43.832  0.46 55.23  ? 263 ARG A HB2    1 
ATOM   4041  H  HB3    A ARG A 1 283 ? 42.570  10.892 -42.454  0.54 55.24  ? 263 ARG A HB3    1 
ATOM   4042  H  HB3    B ARG A 1 283 ? 41.986  12.308 -43.297  0.46 55.23  ? 263 ARG A HB3    1 
ATOM   4043  H  HG2    A ARG A 1 283 ? 42.254  10.156 -44.550  0.54 55.65  ? 263 ARG A HG2    1 
ATOM   4044  H  HG2    B ARG A 1 283 ? 42.785  10.669 -41.318  0.46 55.86  ? 263 ARG A HG2    1 
ATOM   4045  H  HG3    A ARG A 1 283 ? 41.448  11.467 -44.960  0.54 55.65  ? 263 ARG A HG3    1 
ATOM   4046  H  HG3    B ARG A 1 283 ? 43.697  10.451 -42.606  0.46 55.86  ? 263 ARG A HG3    1 
ATOM   4047  H  HD2    A ARG A 1 283 ? 43.453  12.703 -44.743  0.54 56.25  ? 263 ARG A HD2    1 
ATOM   4048  H  HD2    B ARG A 1 283 ? 44.010  12.840 -42.631  0.46 55.78  ? 263 ARG A HD2    1 
ATOM   4049  H  HD3    A ARG A 1 283 ? 44.226  11.336 -44.490  0.54 56.25  ? 263 ARG A HD3    1 
ATOM   4050  H  HD3    B ARG A 1 283 ? 43.361  12.857 -41.179  0.46 55.78  ? 263 ARG A HD3    1 
ATOM   4051  H  HE     A ARG A 1 283 ? 44.050  10.875 -46.646  0.54 54.71  ? 263 ARG A HE     1 
ATOM   4052  H  HE     B ARG A 1 283 ? 45.222  11.975 -40.374  0.46 58.65  ? 263 ARG A HE     1 
ATOM   4053  H  HH11   A ARG A 1 283 ? 42.400  13.703 -46.118  0.54 42.84  ? 263 ARG A HH11   1 
ATOM   4054  H  HH11   B ARG A 1 283 ? 45.557  12.143 -43.667  0.46 61.87  ? 263 ARG A HH11   1 
ATOM   4055  H  HH12   A ARG A 1 283 ? 42.247  14.066 -47.554  0.54 42.84  ? 263 ARG A HH12   1 
ATOM   4056  H  HH12   B ARG A 1 283 ? 47.021  11.866 -43.693  0.46 61.87  ? 263 ARG A HH12   1 
ATOM   4057  H  HH21   A ARG A 1 283 ? 43.799  11.448 -48.816  0.54 52.98  ? 263 ARG A HH21   1 
ATOM   4058  H  HH21   B ARG A 1 283 ? 47.443  11.555 -40.438  0.46 64.46  ? 263 ARG A HH21   1 
ATOM   4059  H  HH22   A ARG A 1 283 ? 43.090  12.707 -49.181  0.54 52.98  ? 263 ARG A HH22   1 
ATOM   4060  H  HH22   B ARG A 1 283 ? 48.158  11.511 -41.744  0.46 64.46  ? 263 ARG A HH22   1 
ATOM   4061  N  N      . PRO A 1 284 ? 40.750  10.894 -40.019  1.00 39.95  ? 264 PRO A N      1 
ATOM   4062  C  CA     . PRO A 1 284 ? 40.939  11.460 -38.682  1.00 37.46  ? 264 PRO A CA     1 
ATOM   4063  C  C      . PRO A 1 284 ? 42.338  12.039 -38.552  1.00 36.69  ? 264 PRO A C      1 
ATOM   4064  O  O      . PRO A 1 284 ? 43.295  11.560 -39.162  1.00 40.81  ? 264 PRO A O      1 
ATOM   4065  C  CB     . PRO A 1 284 ? 40.751  10.259 -37.743  1.00 34.98  ? 264 PRO A CB     1 
ATOM   4066  C  CG     . PRO A 1 284 ? 40.325  9.114  -38.606  1.00 32.73  ? 264 PRO A CG     1 
ATOM   4067  C  CD     . PRO A 1 284 ? 40.791  9.422  -39.984  1.00 34.68  ? 264 PRO A CD     1 
ATOM   4068  H  HA     . PRO A 1 284 ? 40.274  12.140 -38.492  1.00 45.07  ? 264 PRO A HA     1 
ATOM   4069  H  HB2    . PRO A 1 284 ? 41.592  10.058 -37.303  1.00 42.09  ? 264 PRO A HB2    1 
ATOM   4070  H  HB3    . PRO A 1 284 ? 40.066  10.465 -37.089  1.00 42.09  ? 264 PRO A HB3    1 
ATOM   4071  H  HG2    . PRO A 1 284 ? 40.738  8.297  -38.284  1.00 39.40  ? 264 PRO A HG2    1 
ATOM   4072  H  HG3    . PRO A 1 284 ? 39.359  9.037  -38.585  1.00 39.40  ? 264 PRO A HG3    1 
ATOM   4073  H  HD2    . PRO A 1 284 ? 41.697  9.103  -40.116  1.00 41.74  ? 264 PRO A HD2    1 
ATOM   4074  H  HD3    . PRO A 1 284 ? 40.181  9.049  -40.640  1.00 41.74  ? 264 PRO A HD3    1 
ATOM   4075  N  N      . GLY A 1 285 ? 42.457  13.070 -37.724  1.00 34.26  ? 265 GLY A N      1 
ATOM   4076  C  CA     . GLY A 1 285 ? 43.750  13.699 -37.540  1.00 38.48  ? 265 GLY A CA     1 
ATOM   4077  C  C      . GLY A 1 285 ? 43.981  14.901 -38.434  1.00 38.04  ? 265 GLY A C      1 
ATOM   4078  O  O      . GLY A 1 285 ? 43.052  15.668 -38.705  1.00 40.46  ? 265 GLY A O      1 
ATOM   4079  H  H      . GLY A 1 285 ? 41.816  13.417 -37.268  1.00 41.23  ? 265 GLY A H      1 
ATOM   4080  H  HA2    . GLY A 1 285 ? 43.835  13.987 -36.617  1.00 46.29  ? 265 GLY A HA2    1 
ATOM   4081  H  HA3    . GLY A 1 285 ? 44.448  13.049 -37.719  1.00 46.29  ? 265 GLY A HA3    1 
ATOM   4082  N  N      . ILE A 1 286 ? 45.217  15.073 -38.903  1.00 33.22  ? 266 ILE A N      1 
ATOM   4083  C  CA     . ILE A 1 286 ? 45.630  16.257 -39.651  1.00 29.15  ? 266 ILE A CA     1 
ATOM   4084  C  C      . ILE A 1 286 ? 45.899  15.872 -41.099  1.00 28.78  ? 266 ILE A C      1 
ATOM   4085  O  O      . ILE A 1 286 ? 46.556  14.859 -41.369  1.00 24.94  ? 266 ILE A O      1 
ATOM   4086  C  CB     . ILE A 1 286 ? 46.886  16.896 -39.031  1.00 29.93  ? 266 ILE A CB     1 
ATOM   4087  C  CG1    . ILE A 1 286 ? 46.632  17.323 -37.582  1.00 30.47  ? 266 ILE A CG1    1 
ATOM   4088  C  CG2    . ILE A 1 286 ? 47.343  18.092 -39.861  1.00 30.77  ? 266 ILE A CG2    1 
ATOM   4089  C  CD1    . ILE A 1 286 ? 45.513  18.329 -37.399  1.00 32.21  ? 266 ILE A CD1    1 
ATOM   4090  H  H      . ILE A 1 286 ? 45.850  14.500 -38.797  1.00 39.98  ? 266 ILE A H      1 
ATOM   4091  H  HA     . ILE A 1 286 ? 44.914  16.912 -39.636  1.00 35.10  ? 266 ILE A HA     1 
ATOM   4092  H  HB     . ILE A 1 286 ? 47.595  16.235 -39.033  1.00 36.03  ? 266 ILE A HB     1 
ATOM   4093  H  HG12   . ILE A 1 286 ? 46.405  16.535 -37.063  1.00 36.68  ? 266 ILE A HG12   1 
ATOM   4094  H  HG13   . ILE A 1 286 ? 47.444  17.721 -37.231  1.00 36.68  ? 266 ILE A HG13   1 
ATOM   4095  H  HG21   . ILE A 1 286 ? 48.134  18.476 -39.451  1.00 37.04  ? 266 ILE A HG21   1 
ATOM   4096  H  HG22   . ILE A 1 286 ? 47.549  17.792 -40.760  1.00 37.04  ? 266 ILE A HG22   1 
ATOM   4097  H  HG23   . ILE A 1 286 ? 46.631  18.750 -39.887  1.00 37.04  ? 266 ILE A HG23   1 
ATOM   4098  H  HD11   . ILE A 1 286 ? 45.427  18.538 -36.456  1.00 38.77  ? 266 ILE A HD11   1 
ATOM   4099  H  HD12   . ILE A 1 286 ? 45.727  19.133 -37.898  1.00 38.77  ? 266 ILE A HD12   1 
ATOM   4100  H  HD13   . ILE A 1 286 ? 44.686  17.945 -37.730  1.00 38.77  ? 266 ILE A HD13   1 
ATOM   4101  N  N      . THR A 1 287 ? 45.390  16.682 -42.024  1.00 33.59  ? 267 THR A N      1 
ATOM   4102  C  CA     . THR A 1 287 ? 45.702  16.582 -43.445  1.00 34.28  ? 267 THR A CA     1 
ATOM   4103  C  C      . THR A 1 287 ? 46.483  17.825 -43.857  1.00 30.10  ? 267 THR A C      1 
ATOM   4104  O  O      . THR A 1 287 ? 46.052  18.949 -43.581  1.00 29.38  ? 267 THR A O      1 
ATOM   4105  C  CB     . THR A 1 287 ? 44.429  16.444 -44.285  1.00 34.24  ? 267 THR A CB     1 
ATOM   4106  O  OG1    . THR A 1 287 ? 43.682  15.303 -43.843  1.00 31.61  ? 267 THR A OG1    1 
ATOM   4107  C  CG2    . THR A 1 287 ? 44.769  16.277 -45.762  1.00 36.70  ? 267 THR A CG2    1 
ATOM   4108  H  H      . THR A 1 287 ? 44.841  17.320 -41.844  1.00 40.43  ? 267 THR A H      1 
ATOM   4109  H  HA     . THR A 1 287 ? 46.259  15.803 -43.600  1.00 41.25  ? 267 THR A HA     1 
ATOM   4110  H  HB     . THR A 1 287 ? 43.888  17.243 -44.183  1.00 41.21  ? 267 THR A HB     1 
ATOM   4111  H  HG1    . THR A 1 287 ? 43.471  15.394 -43.035  1.00 38.04  ? 267 THR A HG1    1 
ATOM   4112  H  HG21   . THR A 1 287 ? 43.954  16.191 -46.281  1.00 44.16  ? 267 THR A HG21   1 
ATOM   4113  H  HG22   . THR A 1 287 ? 45.264  17.049 -46.077  1.00 44.16  ? 267 THR A HG22   1 
ATOM   4114  H  HG23   . THR A 1 287 ? 45.309  15.482 -45.889  1.00 44.16  ? 267 THR A HG23   1 
ATOM   4115  N  N      . THR A 1 288 ? 47.626  17.624 -44.509  1.00 27.00  ? 268 THR A N      1 
ATOM   4116  C  CA     . THR A 1 288 ? 48.510  18.719 -44.891  1.00 28.28  ? 268 THR A CA     1 
ATOM   4117  C  C      . THR A 1 288 ? 48.291  19.115 -46.347  1.00 30.93  ? 268 THR A C      1 
ATOM   4118  O  O      . THR A 1 288 ? 47.910  18.293 -47.183  1.00 30.83  ? 268 THR A O      1 
ATOM   4119  C  CB     . THR A 1 288 ? 49.981  18.337 -44.692  1.00 27.94  ? 268 THR A CB     1 
ATOM   4120  O  OG1    . THR A 1 288 ? 50.374  17.388 -45.692  1.00 34.86  ? 268 THR A OG1    1 
ATOM   4121  C  CG2    . THR A 1 288 ? 50.204  17.730 -43.312  1.00 27.61  ? 268 THR A CG2    1 
ATOM   4122  H  H      . THR A 1 288 ? 47.915  16.849 -44.744  1.00 32.52  ? 268 THR A H      1 
ATOM   4123  H  HA     . THR A 1 288 ? 48.320  19.490 -44.335  1.00 34.06  ? 268 THR A HA     1 
ATOM   4124  H  HB     . THR A 1 288 ? 50.532  19.131 -44.769  1.00 33.65  ? 268 THR A HB     1 
ATOM   4125  H  HG1    . THR A 1 288 ? 49.900  16.697 -45.634  1.00 41.95  ? 268 THR A HG1    1 
ATOM   4126  H  HG21   . THR A 1 288 ? 51.138  17.494 -43.201  1.00 32.55  ? 268 THR A HG21   1 
ATOM   4127  H  HG22   . THR A 1 288 ? 49.956  18.369 -42.626  1.00 32.55  ? 268 THR A HG22   1 
ATOM   4128  H  HG23   . THR A 1 288 ? 49.662  16.932 -43.210  1.00 32.55  ? 268 THR A HG23   1 
ATOM   4129  N  N      . LYS A 1 289 ? 48.518  20.400 -46.641  1.00 31.36  ? 269 LYS A N      1 
ATOM   4130  C  CA     . LYS A 1 289 ? 48.458  20.856 -48.027  1.00 30.88  ? 269 LYS A CA     1 
ATOM   4131  C  C      . LYS A 1 289 ? 49.479  20.144 -48.897  1.00 29.72  ? 269 LYS A C      1 
ATOM   4132  O  O      . LYS A 1 289 ? 49.224  19.905 -50.083  1.00 26.60  ? 269 LYS A O      1 
ATOM   4133  C  CB     . LYS A 1 289 ? 48.710  22.361 -48.125  1.00 31.70  ? 269 LYS A CB     1 
ATOM   4134  C  CG     . LYS A 1 289 ? 47.671  23.263 -47.503  1.00 31.96  ? 269 LYS A CG     1 
ATOM   4135  C  CD     . LYS A 1 289 ? 48.210  24.684 -47.467  1.00 34.57  ? 269 LYS A CD     1 
ATOM   4136  C  CE     . LYS A 1 289 ? 47.151  25.700 -47.097  1.00 36.80  ? 269 LYS A CE     1 
ATOM   4137  N  NZ     . LYS A 1 289 ? 47.643  27.087 -47.327  1.00 39.51  ? 269 LYS A NZ     1 
ATOM   4138  H  H      . LYS A 1 289 ? 48.705  21.013 -46.067  1.00 37.74  ? 269 LYS A H      1 
ATOM   4139  H  HA     . LYS A 1 289 ? 47.575  20.673 -48.384  1.00 37.17  ? 269 LYS A HA     1 
ATOM   4140  H  HB2    . LYS A 1 289 ? 49.556  22.555 -47.691  1.00 38.16  ? 269 LYS A HB2    1 
ATOM   4141  H  HB3    . LYS A 1 289 ? 48.771  22.597 -49.064  1.00 38.16  ? 269 LYS A HB3    1 
ATOM   4142  H  HG2    . LYS A 1 289 ? 46.862  23.250 -48.038  1.00 38.47  ? 269 LYS A HG2    1 
ATOM   4143  H  HG3    . LYS A 1 289 ? 47.487  22.975 -46.595  1.00 38.47  ? 269 LYS A HG3    1 
ATOM   4144  H  HD2    . LYS A 1 289 ? 48.920  24.736 -46.807  1.00 41.61  ? 269 LYS A HD2    1 
ATOM   4145  H  HD3    . LYS A 1 289 ? 48.555  24.914 -48.344  1.00 41.61  ? 269 LYS A HD3    1 
ATOM   4146  H  HE2    . LYS A 1 289 ? 46.365  25.559 -47.647  1.00 44.28  ? 269 LYS A HE2    1 
ATOM   4147  H  HE3    . LYS A 1 289 ? 46.929  25.606 -46.158  1.00 44.28  ? 269 LYS A HE3    1 
ATOM   4148  H  HZ1    . LYS A 1 289 ? 47.853  27.197 -48.185  1.00 47.53  ? 269 LYS A HZ1    1 
ATOM   4149  H  HZ2    . LYS A 1 289 ? 47.012  27.674 -47.107  1.00 47.53  ? 269 LYS A HZ2    1 
ATOM   4150  H  HZ3    . LYS A 1 289 ? 48.366  27.240 -46.831  1.00 47.53  ? 269 LYS A HZ3    1 
ATOM   4151  N  N      . GLU A 1 290 ? 50.637  19.801 -48.331  1.00 36.90  ? 270 GLU A N      1 
ATOM   4152  C  CA     . GLU A 1 290 ? 51.707  19.213 -49.129  1.00 43.86  ? 270 GLU A CA     1 
ATOM   4153  C  C      . GLU A 1 290 ? 51.249  17.911 -49.775  1.00 39.35  ? 270 GLU A C      1 
ATOM   4154  O  O      . GLU A 1 290 ? 51.467  17.687 -50.971  1.00 38.91  ? 270 GLU A O      1 
ATOM   4155  C  CB     . GLU A 1 290 ? 52.944  18.988 -48.258  1.00 55.47  ? 270 GLU A CB     1 
ATOM   4156  C  CG     . GLU A 1 290 ? 54.169  18.519 -49.029  1.00 67.86  ? 270 GLU A CG     1 
ATOM   4157  C  CD     . GLU A 1 290 ? 54.682  19.579 -49.987  1.00 76.32  ? 270 GLU A CD     1 
ATOM   4158  O  OE1    . GLU A 1 290 ? 54.300  20.759 -49.826  1.00 78.05  ? 270 GLU A OE1    1 
ATOM   4159  O  OE2    . GLU A 1 290 ? 55.466  19.238 -50.898  1.00 79.63  ? 270 GLU A OE2    1 
ATOM   4160  H  H      . GLU A 1 290 ? 50.824  19.898 -47.497  1.00 44.39  ? 270 GLU A H      1 
ATOM   4161  H  HA     . GLU A 1 290 ? 51.948  19.830 -49.837  1.00 52.75  ? 270 GLU A HA     1 
ATOM   4162  H  HB2    . GLU A 1 290 ? 53.172  19.822 -47.820  1.00 66.69  ? 270 GLU A HB2    1 
ATOM   4163  H  HB3    . GLU A 1 290 ? 52.738  18.313 -47.592  1.00 66.69  ? 270 GLU A HB3    1 
ATOM   4164  H  HG2    . GLU A 1 290 ? 54.879  18.310 -48.401  1.00 81.55  ? 270 GLU A HG2    1 
ATOM   4165  H  HG3    . GLU A 1 290 ? 53.937  17.731 -49.545  1.00 81.55  ? 270 GLU A HG3    1 
ATOM   4166  N  N      . GLU A 1 291 ? 50.608  17.034 -48.996  1.00 35.45  ? 271 GLU A N      1 
ATOM   4167  C  CA     . GLU A 1 291 ? 50.215  15.730 -49.512  1.00 35.73  ? 271 GLU A CA     1 
ATOM   4168  C  C      . GLU A 1 291 ? 49.098  15.814 -50.546  1.00 34.49  ? 271 GLU A C      1 
ATOM   4169  O  O      . GLU A 1 291 ? 48.823  14.810 -51.211  1.00 35.86  ? 271 GLU A O      1 
ATOM   4170  C  CB     . GLU A 1 291 ? 49.784  14.814 -48.362  1.00 39.47  ? 271 GLU A CB     1 
ATOM   4171  C  CG     . GLU A 1 291 ? 48.424  15.137 -47.766  1.00 41.12  ? 271 GLU A CG     1 
ATOM   4172  C  CD     . GLU A 1 291 ? 48.160  14.387 -46.473  1.00 43.02  ? 271 GLU A CD     1 
ATOM   4173  O  OE1    . GLU A 1 291 ? 48.336  14.982 -45.389  1.00 43.38  ? 271 GLU A OE1    1 
ATOM   4174  O  OE2    . GLU A 1 291 ? 47.792  13.194 -46.540  1.00 43.89  ? 271 GLU A OE2    1 
ATOM   4175  H  H      . GLU A 1 291 ? 50.393  17.173 -48.175  1.00 42.66  ? 271 GLU A H      1 
ATOM   4176  H  HA     . GLU A 1 291 ? 50.983  15.322 -49.942  1.00 43.00  ? 271 GLU A HA     1 
ATOM   4177  H  HB2    . GLU A 1 291 ? 49.751  13.901 -48.690  1.00 47.48  ? 271 GLU A HB2    1 
ATOM   4178  H  HB3    . GLU A 1 291 ? 50.440  14.881 -47.651  1.00 47.48  ? 271 GLU A HB3    1 
ATOM   4179  H  HG2    . GLU A 1 291 ? 48.380  16.088 -47.576  1.00 49.47  ? 271 GLU A HG2    1 
ATOM   4180  H  HG3    . GLU A 1 291 ? 47.734  14.893 -48.401  1.00 49.47  ? 271 GLU A HG3    1 
ATOM   4181  N  N      . LEU A 1 292 ? 48.456  16.971 -50.702  1.00 32.13  ? 272 LEU A N      1 
ATOM   4182  C  CA     . LEU A 1 292 ? 47.454  17.173 -51.740  1.00 28.08  ? 272 LEU A CA     1 
ATOM   4183  C  C      . LEU A 1 292 ? 47.967  18.018 -52.898  1.00 27.65  ? 272 LEU A C      1 
ATOM   4184  O  O      . LEU A 1 292 ? 47.243  18.198 -53.882  1.00 25.37  ? 272 LEU A O      1 
ATOM   4185  C  CB     . LEU A 1 292 ? 46.200  17.833 -51.150  1.00 27.54  ? 272 LEU A CB     1 
ATOM   4186  C  CG     . LEU A 1 292 ? 45.385  17.053 -50.111  1.00 27.77  ? 272 LEU A CG     1 
ATOM   4187  C  CD1    . LEU A 1 292 ? 44.194  17.883 -49.637  1.00 22.56  ? 272 LEU A CD1    1 
ATOM   4188  C  CD2    . LEU A 1 292 ? 44.919  15.708 -50.649  1.00 26.48  ? 272 LEU A CD2    1 
ATOM   4189  H  H      . LEU A 1 292 ? 48.588  17.664 -50.210  1.00 38.67  ? 272 LEU A H      1 
ATOM   4190  H  HA     . LEU A 1 292 ? 47.195  16.308 -52.095  1.00 33.81  ? 272 LEU A HA     1 
ATOM   4191  H  HB2    . LEU A 1 292 ? 46.473  18.663 -50.727  1.00 33.17  ? 272 LEU A HB2    1 
ATOM   4192  H  HB3    . LEU A 1 292 ? 45.599  18.036 -51.884  1.00 33.17  ? 272 LEU A HB3    1 
ATOM   4193  H  HG     . LEU A 1 292 ? 45.949  16.881 -49.341  1.00 33.45  ? 272 LEU A HG     1 
ATOM   4194  H  HD11   . LEU A 1 292 ? 43.693  17.371 -48.982  1.00 27.19  ? 272 LEU A HD11   1 
ATOM   4195  H  HD12   . LEU A 1 292 ? 44.521  18.703 -49.236  1.00 27.19  ? 272 LEU A HD12   1 
ATOM   4196  H  HD13   . LEU A 1 292 ? 43.629  18.088 -50.398  1.00 27.19  ? 272 LEU A HD13   1 
ATOM   4197  H  HD21   . LEU A 1 292 ? 44.410  15.252 -49.960  1.00 31.90  ? 272 LEU A HD21   1 
ATOM   4198  H  HD22   . LEU A 1 292 ? 44.362  15.856 -51.429  1.00 31.90  ? 272 LEU A HD22   1 
ATOM   4199  H  HD23   . LEU A 1 292 ? 45.695  15.179 -50.891  1.00 31.90  ? 272 LEU A HD23   1 
ATOM   4200  N  N      . ASP A 1 293 ? 49.199  18.529 -52.813  1.00 30.98  ? 273 ASP A N      1 
ATOM   4201  C  CA     . ASP A 1 293 ? 49.755  19.417 -53.837  1.00 35.46  ? 273 ASP A CA     1 
ATOM   4202  C  C      . ASP A 1 293 ? 48.914  20.684 -53.995  1.00 35.74  ? 273 ASP A C      1 
ATOM   4203  O  O      . ASP A 1 293 ? 48.763  21.218 -55.096  1.00 39.04  ? 273 ASP A O      1 
ATOM   4204  C  CB     . ASP A 1 293 ? 49.908  18.691 -55.178  1.00 38.49  ? 273 ASP A CB     1 
ATOM   4205  C  CG     . ASP A 1 293 ? 51.356  18.588 -55.624  1.00 41.21  ? 273 ASP A CG     1 
ATOM   4206  O  OD1    . ASP A 1 293 ? 52.115  19.560 -55.429  1.00 42.91  ? 273 ASP A OD1    1 
ATOM   4207  O  OD2    . ASP A 1 293 ? 51.734  17.534 -56.175  1.00 42.64  ? 273 ASP A OD2    1 
ATOM   4208  H  H      . ASP A 1 293 ? 49.739  18.373 -52.162  1.00 37.30  ? 273 ASP A H      1 
ATOM   4209  H  HA     . ASP A 1 293 ? 50.641  19.691 -53.554  1.00 42.67  ? 273 ASP A HA     1 
ATOM   4210  H  HB2    . ASP A 1 293 ? 49.555  17.791 -55.093  1.00 46.30  ? 273 ASP A HB2    1 
ATOM   4211  H  HB3    . ASP A 1 293 ? 49.418  19.178 -55.859  1.00 46.30  ? 273 ASP A HB3    1 
ATOM   4212  N  N      . TRP A 1 294 ? 48.364  21.174 -52.886  1.00 27.79  ? 274 TRP A N      1 
ATOM   4213  C  CA     . TRP A 1 294 ? 47.616  22.432 -52.887  1.00 27.76  ? 274 TRP A CA     1 
ATOM   4214  C  C      . TRP A 1 294 ? 48.536  23.580 -52.466  1.00 29.34  ? 274 TRP A C      1 
ATOM   4215  O  O      . TRP A 1 294 ? 48.421  24.170 -51.391  1.00 34.01  ? 274 TRP A O      1 
ATOM   4216  C  CB     . TRP A 1 294 ? 46.385  22.318 -51.988  1.00 24.30  ? 274 TRP A CB     1 
ATOM   4217  C  CG     . TRP A 1 294 ? 45.259  21.529 -52.611  1.00 24.41  ? 274 TRP A CG     1 
ATOM   4218  C  CD1    . TRP A 1 294 ? 45.289  20.860 -53.801  1.00 25.16  ? 274 TRP A CD1    1 
ATOM   4219  C  CD2    . TRP A 1 294 ? 43.937  21.347 -52.085  1.00 22.06  ? 274 TRP A CD2    1 
ATOM   4220  N  NE1    . TRP A 1 294 ? 44.073  20.272 -54.047  1.00 22.32  ? 274 TRP A NE1    1 
ATOM   4221  C  CE2    . TRP A 1 294 ? 43.226  20.554 -53.009  1.00 21.57  ? 274 TRP A CE2    1 
ATOM   4222  C  CE3    . TRP A 1 294 ? 43.286  21.776 -50.924  1.00 21.54  ? 274 TRP A CE3    1 
ATOM   4223  C  CZ2    . TRP A 1 294 ? 41.900  20.180 -52.806  1.00 20.61  ? 274 TRP A CZ2    1 
ATOM   4224  C  CZ3    . TRP A 1 294 ? 41.969  21.403 -50.724  1.00 20.59  ? 274 TRP A CZ3    1 
ATOM   4225  C  CH2    . TRP A 1 294 ? 41.290  20.613 -51.661  1.00 21.68  ? 274 TRP A CH2    1 
ATOM   4226  H  H      . TRP A 1 294 ? 48.409  20.795 -52.116  1.00 33.47  ? 274 TRP A H      1 
ATOM   4227  H  HA     . TRP A 1 294 ? 47.309  22.613 -53.789  1.00 33.43  ? 274 TRP A HA     1 
ATOM   4228  H  HB2    . TRP A 1 294 ? 46.638  21.875 -51.164  1.00 29.28  ? 274 TRP A HB2    1 
ATOM   4229  H  HB3    . TRP A 1 294 ? 46.053  23.209 -51.796  1.00 29.28  ? 274 TRP A HB3    1 
ATOM   4230  H  HD1    . TRP A 1 294 ? 46.027  20.812 -54.365  1.00 30.32  ? 274 TRP A HD1    1 
ATOM   4231  H  HE1    . TRP A 1 294 ? 43.877  19.800 -54.738  1.00 26.19  ? 274 TRP A HE1    1 
ATOM   4232  H  HE3    . TRP A 1 294 ? 43.730  22.301 -50.298  1.00 25.26  ? 274 TRP A HE3    1 
ATOM   4233  H  HZ2    . TRP A 1 294 ? 41.447  19.655 -53.426  1.00 24.14  ? 274 TRP A HZ2    1 
ATOM   4234  H  HZ3    . TRP A 1 294 ? 41.526  21.682 -49.955  1.00 24.12  ? 274 TRP A HZ3    1 
ATOM   4235  H  HH2    . TRP A 1 294 ? 40.405  20.377 -51.500  1.00 26.14  ? 274 TRP A HH2    1 
ATOM   4236  N  N      . THR A 1 295 ? 49.474  23.878 -53.362  1.00 27.34  ? 275 THR A N      1 
ATOM   4237  C  CA     . THR A 1 295 ? 50.549  24.834 -53.137  1.00 28.58  ? 275 THR A CA     1 
ATOM   4238  C  C      . THR A 1 295 ? 50.453  25.973 -54.150  1.00 30.88  ? 275 THR A C      1 
ATOM   4239  O  O      . THR A 1 295 ? 49.652  25.937 -55.088  1.00 28.07  ? 275 THR A O      1 
ATOM   4240  C  CB     . THR A 1 295 ? 51.912  24.140 -53.227  1.00 30.00  ? 275 THR A CB     1 
ATOM   4241  O  OG1    . THR A 1 295 ? 52.058  23.530 -54.517  1.00 30.28  ? 275 THR A OG1    1 
ATOM   4242  C  CG2    . THR A 1 295 ? 52.027  23.071 -52.147  1.00 29.87  ? 275 THR A CG2    1 
ATOM   4243  H  H      . THR A 1 295 ? 49.507  23.520 -54.143  1.00 32.22  ? 275 THR A H      1 
ATOM   4244  H  HA     . THR A 1 295 ? 50.459  25.211 -52.248  1.00 33.71  ? 275 THR A HA     1 
ATOM   4245  H  HB     . THR A 1 295 ? 52.619  24.791 -53.094  1.00 35.40  ? 275 THR A HB     1 
ATOM   4246  H  HG1    . THR A 1 295 ? 52.804  23.148 -54.571  1.00 35.74  ? 275 THR A HG1    1 
ATOM   4247  H  HG21   . THR A 1 295 ? 52.891  22.632 -52.205  1.00 35.25  ? 275 THR A HG21   1 
ATOM   4248  H  HG22   . THR A 1 295 ? 51.938  23.475 -51.270  1.00 35.25  ? 275 THR A HG22   1 
ATOM   4249  H  HG23   . THR A 1 295 ? 51.329  22.408 -52.261  1.00 35.25  ? 275 THR A HG23   1 
ATOM   4250  N  N      . LYS A 1 296 ? 51.291  26.998 -53.958  1.00 42.86  ? 276 LYS A N      1 
ATOM   4251  C  CA     . LYS A 1 296 ? 51.280  28.145 -54.866  1.00 48.58  ? 276 LYS A CA     1 
ATOM   4252  C  C      . LYS A 1 296 ? 51.673  27.748 -56.284  1.00 47.22  ? 276 LYS A C      1 
ATOM   4253  O  O      . LYS A 1 296 ? 51.131  28.288 -57.256  1.00 51.12  ? 276 LYS A O      1 
ATOM   4254  C  CB     . LYS A 1 296 ? 52.186  29.258 -54.330  1.00 50.03  ? 276 LYS A CB     1 
ATOM   4255  C  CG     . LYS A 1 296 ? 52.320  30.456 -55.275  1.00 53.21  ? 276 LYS A CG     1 
ATOM   4256  C  CD     . LYS A 1 296 ? 53.278  31.512 -54.741  1.00 55.39  ? 276 LYS A CD     1 
ATOM   4257  C  CE     . LYS A 1 296 ? 53.581  32.582 -55.785  1.00 57.33  ? 276 LYS A CE     1 
ATOM   4258  N  NZ     . LYS A 1 296 ? 52.457  33.532 -56.024  1.00 58.99  ? 276 LYS A NZ     1 
ATOM   4259  H  H      . LYS A 1 296 ? 51.865  27.051 -53.319  1.00 51.55  ? 276 LYS A H      1 
ATOM   4260  H  HA     . LYS A 1 296 ? 50.378  28.498 -54.903  1.00 58.42  ? 276 LYS A HA     1 
ATOM   4261  H  HB2    . LYS A 1 296 ? 51.822  29.582 -53.492  1.00 60.16  ? 276 LYS A HB2    1 
ATOM   4262  H  HB3    . LYS A 1 296 ? 53.074  28.896 -54.184  1.00 60.16  ? 276 LYS A HB3    1 
ATOM   4263  H  HG2    . LYS A 1 296 ? 52.657  30.149 -56.131  1.00 63.97  ? 276 LYS A HG2    1 
ATOM   4264  H  HG3    . LYS A 1 296 ? 51.450  30.869 -55.389  1.00 63.97  ? 276 LYS A HG3    1 
ATOM   4265  H  HD2    . LYS A 1 296 ? 52.878  31.944 -53.970  1.00 66.59  ? 276 LYS A HD2    1 
ATOM   4266  H  HD3    . LYS A 1 296 ? 54.113  31.087 -54.490  1.00 66.59  ? 276 LYS A HD3    1 
ATOM   4267  H  HE2    . LYS A 1 296 ? 54.347  33.099 -55.488  1.00 68.91  ? 276 LYS A HE2    1 
ATOM   4268  H  HE3    . LYS A 1 296 ? 53.786  32.148 -56.627  1.00 68.91  ? 276 LYS A HE3    1 
ATOM   4269  H  HZ1    . LYS A 1 296 ? 52.690  34.131 -56.640  1.00 70.91  ? 276 LYS A HZ1    1 
ATOM   4270  H  HZ2    . LYS A 1 296 ? 51.740  33.089 -56.310  1.00 70.91  ? 276 LYS A HZ2    1 
ATOM   4271  H  HZ3    . LYS A 1 296 ? 52.252  33.958 -55.270  1.00 70.91  ? 276 LYS A HZ3    1 
ATOM   4272  N  N      . SER A 1 297 ? 52.618  26.819 -56.430  1.00 44.15  ? 277 SER A N      1 
ATOM   4273  C  CA     . SER A 1 297 ? 52.931  26.309 -57.760  1.00 42.77  ? 277 SER A CA     1 
ATOM   4274  C  C      . SER A 1 297 ? 51.682  25.767 -58.447  1.00 40.97  ? 277 SER A C      1 
ATOM   4275  O  O      . SER A 1 297 ? 51.548  25.870 -59.672  1.00 40.02  ? 277 SER A O      1 
ATOM   4276  C  CB     . SER A 1 297 ? 54.007  25.226 -57.666  1.00 47.05  ? 277 SER A CB     1 
ATOM   4277  O  OG     . SER A 1 297 ? 54.217  24.599 -58.919  1.00 50.29  ? 277 SER A OG     1 
ATOM   4278  H  H      . SER A 1 297 ? 53.081  26.476 -55.791  1.00 53.09  ? 277 SER A H      1 
ATOM   4279  H  HA     . SER A 1 297 ? 53.281  27.034 -58.302  1.00 51.44  ? 277 SER A HA     1 
ATOM   4280  H  HB2    . SER A 1 297 ? 54.838  25.633 -57.375  1.00 56.58  ? 277 SER A HB2    1 
ATOM   4281  H  HB3    . SER A 1 297 ? 53.724  24.557 -57.024  1.00 56.58  ? 277 SER A HB3    1 
ATOM   4282  H  HG     . SER A 1 297 ? 54.810  24.009 -58.849  1.00 60.46  ? 277 SER A HG     1 
ATOM   4283  N  N      . ALA A 1 298 ? 50.759  25.191 -57.673  1.00 37.59  ? 278 ALA A N      1 
ATOM   4284  C  CA     . ALA A 1 298 ? 49.530  24.629 -58.221  1.00 35.51  ? 278 ALA A CA     1 
ATOM   4285  C  C      . ALA A 1 298 ? 48.508  25.694 -58.609  1.00 35.19  ? 278 ALA A C      1 
ATOM   4286  O  O      . ALA A 1 298 ? 47.718  25.472 -59.533  1.00 36.28  ? 278 ALA A O      1 
ATOM   4287  C  CB     . ALA A 1 298 ? 48.905  23.666 -57.212  1.00 36.88  ? 278 ALA A CB     1 
ATOM   4288  H  H      . ALA A 1 298 ? 50.825  25.115 -56.819  1.00 45.22  ? 278 ALA A H      1 
ATOM   4289  H  HA     . ALA A 1 298 ? 49.747  24.123 -59.020  1.00 42.74  ? 278 ALA A HA     1 
ATOM   4290  H  HB1    . ALA A 1 298 ? 48.090  23.299 -57.589  1.00 44.37  ? 278 ALA A HB1    1 
ATOM   4291  H  HB2    . ALA A 1 298 ? 49.535  22.951 -57.027  1.00 44.37  ? 278 ALA A HB2    1 
ATOM   4292  H  HB3    . ALA A 1 298 ? 48.705  24.150 -56.396  1.00 44.37  ? 278 ALA A HB3    1 
ATOM   4293  N  N      . GLU A 1 299 ? 48.499  26.842 -57.927  1.00 39.17  ? 279 GLU A N      1 
ATOM   4294  C  CA     . GLU A 1 299 ? 47.544  27.896 -58.266  1.00 45.61  ? 279 GLU A CA     1 
ATOM   4295  C  C      . GLU A 1 299 ? 47.721  28.388 -59.699  1.00 46.68  ? 279 GLU A C      1 
ATOM   4296  O  O      . GLU A 1 299 ? 46.734  28.688 -60.382  1.00 49.91  ? 279 GLU A O      1 
ATOM   4297  C  CB     . GLU A 1 299 ? 47.667  29.063 -57.285  1.00 47.42  ? 279 GLU A CB     1 
ATOM   4298  C  CG     . GLU A 1 299 ? 47.139  28.761 -55.890  1.00 47.29  ? 279 GLU A CG     1 
ATOM   4299  C  CD     . GLU A 1 299 ? 47.199  29.967 -54.970  1.00 48.30  ? 279 GLU A CD     1 
ATOM   4300  O  OE1    . GLU A 1 299 ? 47.978  30.900 -55.258  1.00 51.02  ? 279 GLU A OE1    1 
ATOM   4301  O  OE2    . GLU A 1 299 ? 46.465  29.985 -53.960  1.00 46.16  ? 279 GLU A OE2    1 
ATOM   4302  H  H      . GLU A 1 299 ? 49.027  27.032 -57.275  1.00 47.12  ? 279 GLU A H      1 
ATOM   4303  H  HA     . GLU A 1 299 ? 46.646  27.537 -58.187  1.00 54.85  ? 279 GLU A HA     1 
ATOM   4304  H  HB2    . GLU A 1 299 ? 48.603  29.302 -57.201  1.00 57.02  ? 279 GLU A HB2    1 
ATOM   4305  H  HB3    . GLU A 1 299 ? 47.165  29.816 -57.634  1.00 57.02  ? 279 GLU A HB3    1 
ATOM   4306  H  HG2    . GLU A 1 299 ? 46.213  28.480 -55.956  1.00 56.86  ? 279 GLU A HG2    1 
ATOM   4307  H  HG3    . GLU A 1 299 ? 47.674  28.055 -55.495  1.00 56.86  ? 279 GLU A HG3    1 
ATOM   4308  N  N      . ASP A 1 300 ? 48.965  28.485 -60.177  1.00 42.88  ? 280 ASP A N      1 
ATOM   4309  C  CA     . ASP A 1 300 ? 49.189  29.014 -61.520  1.00 43.45  ? 280 ASP A CA     1 
ATOM   4310  C  C      . ASP A 1 300 ? 48.542  28.136 -62.586  1.00 46.79  ? 280 ASP A C      1 
ATOM   4311  O  O      . ASP A 1 300 ? 47.905  28.645 -63.516  1.00 51.94  ? 280 ASP A O      1 
ATOM   4312  C  CB     . ASP A 1 300 ? 50.689  29.141 -61.788  1.00 44.01  ? 280 ASP A CB     1 
ATOM   4313  C  CG     . ASP A 1 300 ? 51.359  30.171 -60.897  1.00 45.90  ? 280 ASP A CG     1 
ATOM   4314  O  OD1    . ASP A 1 300 ? 50.673  31.118 -60.457  1.00 46.09  ? 280 ASP A OD1    1 
ATOM   4315  O  OD2    . ASP A 1 300 ? 52.575  30.037 -60.640  1.00 47.08  ? 280 ASP A OD2    1 
ATOM   4316  H  H      . ASP A 1 300 ? 49.678  28.256 -59.754  1.00 51.57  ? 280 ASP A H      1 
ATOM   4317  H  HA     . ASP A 1 300 ? 48.796  29.899 -61.581  1.00 52.26  ? 280 ASP A HA     1 
ATOM   4318  H  HB2    . ASP A 1 300 ? 51.112  28.284 -61.626  1.00 52.93  ? 280 ASP A HB2    1 
ATOM   4319  H  HB3    . ASP A 1 300 ? 50.823  29.409 -62.710  1.00 52.93  ? 280 ASP A HB3    1 
ATOM   4320  N  N      . PHE A 1 301 ? 48.695  26.817 -62.471  1.00 41.72  ? 281 PHE A N      1 
ATOM   4321  C  CA     . PHE A 1 301 ? 48.152  25.901 -63.470  1.00 48.93  ? 281 PHE A CA     1 
ATOM   4322  C  C      . PHE A 1 301 ? 46.642  25.723 -63.356  1.00 53.70  ? 281 PHE A C      1 
ATOM   4323  O  O      . PHE A 1 301 ? 45.970  25.542 -64.377  1.00 52.07  ? 281 PHE A O      1 
ATOM   4324  C  CB     . PHE A 1 301 ? 48.866  24.554 -63.375  1.00 57.50  ? 281 PHE A CB     1 
ATOM   4325  C  CG     . PHE A 1 301 ? 50.303  24.614 -63.803  1.00 69.25  ? 281 PHE A CG     1 
ATOM   4326  C  CD1    . PHE A 1 301 ? 51.294  24.951 -62.898  1.00 74.39  ? 281 PHE A CD1    1 
ATOM   4327  C  CD2    . PHE A 1 301 ? 50.660  24.360 -65.117  1.00 74.58  ? 281 PHE A CD2    1 
ATOM   4328  C  CE1    . PHE A 1 301 ? 52.618  25.017 -63.291  1.00 77.70  ? 281 PHE A CE1    1 
ATOM   4329  C  CE2    . PHE A 1 301 ? 51.983  24.424 -65.517  1.00 77.71  ? 281 PHE A CE2    1 
ATOM   4330  C  CZ     . PHE A 1 301 ? 52.962  24.753 -64.603  1.00 78.80  ? 281 PHE A CZ     1 
ATOM   4331  H  H      . PHE A 1 301 ? 49.109  26.429 -61.824  1.00 50.19  ? 281 PHE A H      1 
ATOM   4332  H  HA     . PHE A 1 301 ? 48.335  26.265 -64.350  1.00 58.83  ? 281 PHE A HA     1 
ATOM   4333  H  HB2    . PHE A 1 301 ? 48.841  24.249 -62.455  1.00 69.12  ? 281 PHE A HB2    1 
ATOM   4334  H  HB3    . PHE A 1 301 ? 48.411  23.916 -63.947  1.00 69.12  ? 281 PHE A HB3    1 
ATOM   4335  H  HD1    . PHE A 1 301 ? 51.069  25.128 -62.013  1.00 89.39  ? 281 PHE A HD1    1 
ATOM   4336  H  HD2    . PHE A 1 301 ? 50.003  24.137 -65.736  1.00 89.61  ? 281 PHE A HD2    1 
ATOM   4337  H  HE1    . PHE A 1 301 ? 53.277  25.239 -62.673  1.00 93.36  ? 281 PHE A HE1    1 
ATOM   4338  H  HE2    . PHE A 1 301 ? 52.211  24.246 -66.401  1.00 93.37  ? 281 PHE A HE2    1 
ATOM   4339  H  HZ     . PHE A 1 301 ? 53.852  24.797 -64.870  1.00 94.68  ? 281 PHE A HZ     1 
ATOM   4340  N  N      . ALA A 1 302 ? 46.090  25.765 -62.146  1.00 40.53  ? 282 ALA A N      1 
ATOM   4341  C  CA     . ALA A 1 302 ? 44.658  25.564 -61.973  1.00 52.89  ? 282 ALA A CA     1 
ATOM   4342  C  C      . ALA A 1 302 ? 43.863  26.644 -62.699  1.00 66.78  ? 282 ALA A C      1 
ATOM   4343  O  O      . ALA A 1 302 ? 44.343  27.759 -62.922  1.00 67.31  ? 282 ALA A O      1 
ATOM   4344  C  CB     . ALA A 1 302 ? 44.298  25.566 -60.488  1.00 52.09  ? 282 ALA A CB     1 
ATOM   4345  H  H      . ALA A 1 302 ? 46.521  25.907 -61.415  1.00 48.75  ? 282 ALA A H      1 
ATOM   4346  H  HA     . ALA A 1 302 ? 44.409  24.703 -62.345  1.00 63.58  ? 282 ALA A HA     1 
ATOM   4347  H  HB1    . ALA A 1 302 ? 43.342  25.431 -60.394  1.00 62.63  ? 282 ALA A HB1    1 
ATOM   4348  H  HB2    . ALA A 1 302 ? 44.779  24.849 -60.046  1.00 62.63  ? 282 ALA A HB2    1 
ATOM   4349  H  HB3    . ALA A 1 302 ? 44.551  26.420 -60.104  1.00 62.63  ? 282 ALA A HB3    1 
ATOM   4350  N  N      . ARG A 1 303 ? 42.631  26.295 -63.079  1.00 81.40  ? 283 ARG A N      1 
ATOM   4351  C  CA     . ARG A 1 303 ? 41.753  27.229 -63.776  1.00 92.55  ? 283 ARG A CA     1 
ATOM   4352  C  C      . ARG A 1 303 ? 40.325  26.692 -63.834  1.00 103.24 ? 283 ARG A C      1 
ATOM   4353  O  O      . ARG A 1 303 ? 39.969  25.958 -64.762  1.00 97.22  ? 283 ARG A O      1 
ATOM   4354  C  CB     . ARG A 1 303 ? 42.283  27.501 -65.188  1.00 93.79  ? 283 ARG A CB     1 
ATOM   4355  C  CG     . ARG A 1 303 ? 41.846  28.837 -65.771  1.00 92.46  ? 283 ARG A CG     1 
ATOM   4356  C  CD     . ARG A 1 303 ? 43.021  29.792 -65.967  1.00 93.55  ? 283 ARG A CD     1 
ATOM   4357  N  NE     . ARG A 1 303 ? 44.037  29.255 -66.876  1.00 95.82  ? 283 ARG A NE     1 
ATOM   4358  C  CZ     . ARG A 1 303 ? 45.263  28.869 -66.526  1.00 97.22  ? 283 ARG A CZ     1 
ATOM   4359  N  NH1    . ARG A 1 303 ? 45.678  28.951 -65.270  1.00 97.63  ? 283 ARG A NH1    1 
ATOM   4360  N  NH2    . ARG A 1 303 ? 46.089  28.398 -67.452  1.00 97.63  ? 283 ARG A NH2    1 
ATOM   4361  H  H      . ARG A 1 303 ? 42.282  25.521 -62.942  1.00 97.80  ? 283 ARG A H      1 
ATOM   4362  H  HA     . ARG A 1 303 ? 41.739  28.070 -63.293  1.00 111.17 ? 283 ARG A HA     1 
ATOM   4363  H  HB2    . ARG A 1 303 ? 43.253  27.492 -65.163  1.00 112.66 ? 283 ARG A HB2    1 
ATOM   4364  H  HB3    . ARG A 1 303 ? 41.965  26.802 -65.780  1.00 112.66 ? 283 ARG A HB3    1 
ATOM   4365  H  HG2    . ARG A 1 303 ? 41.432  28.686 -66.634  1.00 111.07 ? 283 ARG A HG2    1 
ATOM   4366  H  HG3    . ARG A 1 303 ? 41.215  29.256 -65.166  1.00 111.07 ? 283 ARG A HG3    1 
ATOM   4367  H  HD2    . ARG A 1 303 ? 42.693  30.624 -66.342  1.00 112.38 ? 283 ARG A HD2    1 
ATOM   4368  H  HD3    . ARG A 1 303 ? 43.442  29.956 -65.109  1.00 112.38 ? 283 ARG A HD3    1 
ATOM   4369  H  HE     . ARG A 1 303 ? 43.823  29.182 -67.706  1.00 115.11 ? 283 ARG A HE     1 
ATOM   4370  H  HH11   . ARG A 1 303 ? 45.151  29.255 -64.662  1.00 117.28 ? 283 ARG A HH11   1 
ATOM   4371  H  HH12   . ARG A 1 303 ? 46.474  28.698 -65.062  1.00 117.28 ? 283 ARG A HH12   1 
ATOM   4372  H  HH21   . ARG A 1 303 ? 45.830  28.342 -68.270  1.00 117.27 ? 283 ARG A HH21   1 
ATOM   4373  H  HH22   . ARG A 1 303 ? 46.882  28.149 -67.233  1.00 117.27 ? 283 ARG A HH22   1 
ATOM   4374  N  N      . MET A 1 304 ? 39.503  27.047 -62.847  1.00 137.45 ? 284 MET A N      1 
ATOM   4375  C  CA     . MET A 1 304 ? 38.120  26.589 -62.771  1.00 148.44 ? 284 MET A CA     1 
ATOM   4376  C  C      . MET A 1 304 ? 37.201  27.510 -63.561  1.00 153.49 ? 284 MET A C      1 
ATOM   4377  O  O      . MET A 1 304 ? 37.344  28.735 -63.513  1.00 160.33 ? 284 MET A O      1 
ATOM   4378  C  CB     . MET A 1 304 ? 37.650  26.543 -61.316  1.00 147.68 ? 284 MET A CB     1 
ATOM   4379  C  CG     . MET A 1 304 ? 37.555  27.926 -60.667  1.00 148.26 ? 284 MET A CG     1 
ATOM   4380  S  SD     . MET A 1 304 ? 36.952  27.927 -58.970  1.00 147.62 ? 284 MET A SD     1 
ATOM   4381  C  CE     . MET A 1 304 ? 35.179  27.982 -59.224  1.00 145.10 ? 284 MET A CE     1 
ATOM   4382  H  H      . MET A 1 304 ? 39.730  27.563 -62.197  1.00 165.05 ? 284 MET A H      1 
ATOM   4383  H  HA     . MET A 1 304 ? 38.062  25.692 -63.136  1.00 178.24 ? 284 MET A HA     1 
ATOM   4384  H  HB2    . MET A 1 304 ? 36.769  26.137 -61.282  1.00 177.33 ? 284 MET A HB2    1 
ATOM   4385  H  HB3    . MET A 1 304 ? 38.277  26.014 -60.799  1.00 177.33 ? 284 MET A HB3    1 
ATOM   4386  H  HG2    . MET A 1 304 ? 38.438  28.327 -60.665  1.00 178.03 ? 284 MET A HG2    1 
ATOM   4387  H  HG3    . MET A 1 304 ? 36.950  28.473 -61.192  1.00 178.03 ? 284 MET A HG3    1 
ATOM   4388  H  HE1    . MET A 1 304 ? 34.737  27.987 -58.361  1.00 174.23 ? 284 MET A HE1    1 
ATOM   4389  H  HE2    . MET A 1 304 ? 34.955  28.788 -59.715  1.00 174.23 ? 284 MET A HE2    1 
ATOM   4390  H  HE3    . MET A 1 304 ? 34.909  27.200 -59.730  1.00 174.23 ? 284 MET A HE3    1 
ATOM   4391  N  N      . ASN A 1 305 ? 36.253  26.914 -64.290  1.00 117.35 ? 285 ASN A N      1 
ATOM   4392  C  CA     . ASN A 1 305 ? 35.218  27.665 -65.008  1.00 112.55 ? 285 ASN A CA     1 
ATOM   4393  C  C      . ASN A 1 305 ? 35.794  28.837 -65.805  1.00 115.16 ? 285 ASN A C      1 
ATOM   4394  O  O      . ASN A 1 305 ? 35.062  29.760 -66.177  1.00 113.17 ? 285 ASN A O      1 
ATOM   4395  C  CB     . ASN A 1 305 ? 34.136  28.164 -64.041  1.00 108.92 ? 285 ASN A CB     1 
ATOM   4396  C  CG     . ASN A 1 305 ? 33.661  27.082 -63.086  1.00 106.78 ? 285 ASN A CG     1 
ATOM   4397  O  OD1    . ASN A 1 305 ? 33.443  27.338 -61.902  1.00 106.55 ? 285 ASN A OD1    1 
ATOM   4398  N  ND2    . ASN A 1 305 ? 33.505  25.864 -63.595  1.00 106.00 ? 285 ASN A ND2    1 
ATOM   4399  H  H      . ASN A 1 305 ? 36.188  26.062 -64.386  1.00 140.94 ? 285 ASN A H      1 
ATOM   4400  H  HA     . ASN A 1 305 ? 34.789  27.067 -65.640  1.00 135.17 ? 285 ASN A HA     1 
ATOM   4401  H  HB2    . ASN A 1 305 ? 34.496  28.893 -63.513  1.00 130.82 ? 285 ASN A HB2    1 
ATOM   4402  H  HB3    . ASN A 1 305 ? 33.371  28.470 -64.553  1.00 130.82 ? 285 ASN A HB3    1 
ATOM   4403  H  HD21   . ASN A 1 305 ? 33.238  25.219 -63.092  1.00 127.31 ? 285 ASN A HD21   1 
ATOM   4404  H  HD22   . ASN A 1 305 ? 33.672  25.721 -64.426  1.00 127.31 ? 285 ASN A HD22   1 
ATOM   4405  N  N      . GLY A 1 306 ? 37.100  28.818 -66.073  1.00 112.38 ? 286 GLY A N      1 
ATOM   4406  C  CA     . GLY A 1 306 ? 37.799  29.922 -66.688  1.00 114.20 ? 286 GLY A CA     1 
ATOM   4407  C  C      . GLY A 1 306 ? 38.481  30.842 -65.696  1.00 111.44 ? 286 GLY A C      1 
ATOM   4408  O  O      . GLY A 1 306 ? 39.425  31.547 -66.070  1.00 114.35 ? 286 GLY A O      1 
ATOM   4409  H  H      . GLY A 1 306 ? 37.611  28.149 -65.897  1.00 134.98 ? 286 GLY A H      1 
ATOM   4410  H  HA2    . GLY A 1 306 ? 38.473  29.575 -67.292  1.00 137.15 ? 286 GLY A HA2    1 
ATOM   4411  H  HA3    . GLY A 1 306 ? 37.169  30.449 -67.205  1.00 137.15 ? 286 GLY A HA3    1 
ATOM   4412  N  N      . GLU A 1 307 ? 38.027  30.845 -64.445  1.00 140.79 ? 287 GLU A N      1 
ATOM   4413  C  CA     . GLU A 1 307 ? 38.647  31.598 -63.369  1.00 128.97 ? 287 GLU A CA     1 
ATOM   4414  C  C      . GLU A 1 307 ? 39.731  30.735 -62.724  1.00 104.60 ? 287 GLU A C      1 
ATOM   4415  O  O      . GLU A 1 307 ? 40.016  29.621 -63.169  1.00 110.85 ? 287 GLU A O      1 
ATOM   4416  C  CB     . GLU A 1 307 ? 37.602  32.068 -62.356  1.00 134.64 ? 287 GLU A CB     1 
ATOM   4417  C  CG     . GLU A 1 307 ? 37.424  33.581 -62.347  1.00 140.03 ? 287 GLU A CG     1 
ATOM   4418  C  CD     . GLU A 1 307 ? 36.334  34.047 -61.403  1.00 142.93 ? 287 GLU A CD     1 
ATOM   4419  O  OE1    . GLU A 1 307 ? 36.060  33.350 -60.405  1.00 143.35 ? 287 GLU A OE1    1 
ATOM   4420  O  OE2    . GLU A 1 307 ? 35.733  35.109 -61.675  1.00 144.21 ? 287 GLU A OE2    1 
ATOM   4421  H  H      . GLU A 1 307 ? 37.335  30.401 -64.191  1.00 169.07 ? 287 GLU A H      1 
ATOM   4422  H  HA     . GLU A 1 307 ? 39.075  32.385 -63.742  1.00 154.88 ? 287 GLU A HA     1 
ATOM   4423  H  HB2    . GLU A 1 307 ? 36.747  31.667 -62.576  1.00 161.68 ? 287 GLU A HB2    1 
ATOM   4424  H  HB3    . GLU A 1 307 ? 37.878  31.793 -61.468  1.00 161.68 ? 287 GLU A HB3    1 
ATOM   4425  H  HG2    . GLU A 1 307 ? 38.257  33.995 -62.070  1.00 168.16 ? 287 GLU A HG2    1 
ATOM   4426  H  HG3    . GLU A 1 307 ? 37.191  33.876 -63.242  1.00 168.16 ? 287 GLU A HG3    1 
ATOM   4427  N  N      . LYS A 1 308 ? 40.332  31.238 -61.649  1.00 83.49  ? 288 LYS A N      1 
ATOM   4428  C  CA     . LYS A 1 308 ? 41.415  30.542 -60.971  1.00 59.40  ? 288 LYS A CA     1 
ATOM   4429  C  C      . LYS A 1 308 ? 41.020  30.191 -59.543  1.00 46.54  ? 288 LYS A C      1 
ATOM   4430  O  O      . LYS A 1 308 ? 40.179  30.852 -58.927  1.00 40.07  ? 288 LYS A O      1 
ATOM   4431  C  CB     . LYS A 1 308 ? 42.694  31.391 -60.936  1.00 58.35  ? 288 LYS A CB     1 
ATOM   4432  C  CG     . LYS A 1 308 ? 42.554  32.719 -60.188  1.00 57.29  ? 288 LYS A CG     1 
ATOM   4433  C  CD     . LYS A 1 308 ? 43.893  33.234 -59.672  1.00 58.93  ? 288 LYS A CD     1 
ATOM   4434  C  CE     . LYS A 1 308 ? 44.393  32.418 -58.482  1.00 58.37  ? 288 LYS A CE     1 
ATOM   4435  N  NZ     . LYS A 1 308 ? 45.632  32.989 -57.878  1.00 57.79  ? 288 LYS A NZ     1 
ATOM   4436  H  H      . LYS A 1 308 ? 40.126  31.992 -61.290  1.00 100.30 ? 288 LYS A H      1 
ATOM   4437  H  HA     . LYS A 1 308 ? 41.610  29.718 -61.443  1.00 71.40  ? 288 LYS A HA     1 
ATOM   4438  H  HB2    . LYS A 1 308 ? 43.394  30.880 -60.500  1.00 70.14  ? 288 LYS A HB2    1 
ATOM   4439  H  HB3    . LYS A 1 308 ? 42.957  31.593 -61.848  1.00 70.14  ? 288 LYS A HB3    1 
ATOM   4440  H  HG2    . LYS A 1 308 ? 42.186  33.386 -60.789  1.00 68.86  ? 288 LYS A HG2    1 
ATOM   4441  H  HG3    . LYS A 1 308 ? 41.965  32.595 -59.427  1.00 68.86  ? 288 LYS A HG3    1 
ATOM   4442  H  HD2    . LYS A 1 308 ? 44.553  33.172 -60.380  1.00 70.84  ? 288 LYS A HD2    1 
ATOM   4443  H  HD3    . LYS A 1 308 ? 43.793  34.155 -59.387  1.00 70.84  ? 288 LYS A HD3    1 
ATOM   4444  H  HE2    . LYS A 1 308 ? 43.705  32.401 -57.798  1.00 70.17  ? 288 LYS A HE2    1 
ATOM   4445  H  HE3    . LYS A 1 308 ? 44.591  31.515 -58.777  1.00 70.17  ? 288 LYS A HE3    1 
ATOM   4446  H  HZ1    . LYS A 1 308 ? 45.893  32.489 -57.189  1.00 69.47  ? 288 LYS A HZ1    1 
ATOM   4447  H  HZ2    . LYS A 1 308 ? 46.284  33.010 -58.483  1.00 69.47  ? 288 LYS A HZ2    1 
ATOM   4448  H  HZ3    . LYS A 1 308 ? 45.477  33.817 -57.591  1.00 69.47  ? 288 LYS A HZ3    1 
ATOM   4449  N  N      . VAL A 1 309 ? 41.623  29.119 -59.041  1.00 44.60  ? 289 VAL A N      1 
ATOM   4450  C  CA     . VAL A 1 309 ? 41.345  28.596 -57.711  1.00 39.68  ? 289 VAL A CA     1 
ATOM   4451  C  C      . VAL A 1 309 ? 42.427  29.086 -56.760  1.00 36.25  ? 289 VAL A C      1 
ATOM   4452  O  O      . VAL A 1 309 ? 43.581  29.304 -57.149  1.00 33.05  ? 289 VAL A O      1 
ATOM   4453  C  CB     . VAL A 1 309 ? 41.243  27.051 -57.716  1.00 37.47  ? 289 VAL A CB     1 
ATOM   4454  C  CG1    . VAL A 1 309 ? 40.771  26.535 -59.073  1.00 35.09  ? 289 VAL A CG1    1 
ATOM   4455  C  CG2    . VAL A 1 309 ? 42.565  26.388 -57.313  1.00 39.22  ? 289 VAL A CG2    1 
ATOM   4456  H  H      . VAL A 1 309 ? 42.216  28.665 -59.467  1.00 53.64  ? 289 VAL A H      1 
ATOM   4457  H  HA     . VAL A 1 309 ? 40.495  28.950 -57.405  1.00 47.74  ? 289 VAL A HA     1 
ATOM   4458  H  HB     . VAL A 1 309 ? 40.578  26.788 -57.060  1.00 45.08  ? 289 VAL A HB     1 
ATOM   4459  H  HG11   . VAL A 1 309 ? 40.718  25.567 -59.041  1.00 42.22  ? 289 VAL A HG11   1 
ATOM   4460  H  HG12   . VAL A 1 309 ? 39.897  26.909 -59.265  1.00 42.22  ? 289 VAL A HG12   1 
ATOM   4461  H  HG13   . VAL A 1 309 ? 41.406  26.811 -59.753  1.00 42.22  ? 289 VAL A HG13   1 
ATOM   4462  H  HG21   . VAL A 1 309 ? 42.452  25.425 -57.330  1.00 47.18  ? 289 VAL A HG21   1 
ATOM   4463  H  HG22   . VAL A 1 309 ? 43.254  26.652 -57.941  1.00 47.18  ? 289 VAL A HG22   1 
ATOM   4464  H  HG23   . VAL A 1 309 ? 42.803  26.678 -56.418  1.00 47.18  ? 289 VAL A HG23   1 
ATOM   4465  N  N      . HIS A 1 310 ? 42.041  29.271 -55.502  1.00 34.08  ? 290 HIS A N      1 
ATOM   4466  C  CA     . HIS A 1 310 ? 42.928  29.729 -54.445  1.00 31.69  ? 290 HIS A CA     1 
ATOM   4467  C  C      . HIS A 1 310 ? 43.109  28.619 -53.417  1.00 30.50  ? 290 HIS A C      1 
ATOM   4468  O  O      . HIS A 1 310 ? 42.235  27.764 -53.244  1.00 30.60  ? 290 HIS A O      1 
ATOM   4469  C  CB     . HIS A 1 310 ? 42.371  30.982 -53.761  1.00 29.08  ? 290 HIS A CB     1 
ATOM   4470  C  CG     . HIS A 1 310 ? 42.223  32.160 -54.675  1.00 25.60  ? 290 HIS A CG     1 
ATOM   4471  N  ND1    . HIS A 1 310 ? 43.250  33.045 -54.921  1.00 25.05  ? 290 HIS A ND1    1 
ATOM   4472  C  CD2    . HIS A 1 310 ? 41.166  32.598 -55.401  1.00 24.22  ? 290 HIS A CD2    1 
ATOM   4473  C  CE1    . HIS A 1 310 ? 42.832  33.979 -55.756  1.00 24.82  ? 290 HIS A CE1    1 
ATOM   4474  N  NE2    . HIS A 1 310 ? 41.572  33.730 -56.065  1.00 24.36  ? 290 HIS A NE2    1 
ATOM   4475  H  H      . HIS A 1 310 ? 41.237  29.131 -55.229  1.00 41.02  ? 290 HIS A H      1 
ATOM   4476  H  HA     . HIS A 1 310 ? 43.796  29.944 -54.822  1.00 38.14  ? 290 HIS A HA     1 
ATOM   4477  H  HB2    . HIS A 1 310 ? 41.495  30.777 -53.399  1.00 35.01  ? 290 HIS A HB2    1 
ATOM   4478  H  HB3    . HIS A 1 310 ? 42.971  31.238 -53.043  1.00 35.01  ? 290 HIS A HB3    1 
ATOM   4479  H  HD1    . HIS A 1 310 ? 44.038  32.999 -54.581  1.00 30.17  ? 290 HIS A HD1    1 
ATOM   4480  H  HD2    . HIS A 1 310 ? 40.324  32.206 -55.442  1.00 29.19  ? 290 HIS A HD2    1 
ATOM   4481  H  HE1    . HIS A 1 310 ? 43.340  34.690 -56.076  1.00 29.90  ? 290 HIS A HE1    1 
ATOM   4482  N  N      . TYR A 1 311 ? 44.254  28.633 -52.738  1.00 26.81  ? 291 TYR A N      1 
ATOM   4483  C  CA     . TYR A 1 311 ? 44.536  27.673 -51.676  1.00 30.83  ? 291 TYR A CA     1 
ATOM   4484  C  C      . TYR A 1 311 ? 44.971  28.386 -50.401  1.00 25.27  ? 291 TYR A C      1 
ATOM   4485  O  O      . TYR A 1 311 ? 45.915  27.971 -49.723  1.00 24.66  ? 291 TYR A O      1 
ATOM   4486  C  CB     . TYR A 1 311 ? 45.599  26.665 -52.114  1.00 38.32  ? 291 TYR A CB     1 
ATOM   4487  C  CG     . TYR A 1 311 ? 45.180  25.760 -53.258  1.00 36.40  ? 291 TYR A CG     1 
ATOM   4488  C  CD1    . TYR A 1 311 ? 44.104  24.890 -53.126  1.00 29.73  ? 291 TYR A CD1    1 
ATOM   4489  C  CD2    . TYR A 1 311 ? 45.877  25.760 -54.461  1.00 35.26  ? 291 TYR A CD2    1 
ATOM   4490  C  CE1    . TYR A 1 311 ? 43.722  24.060 -54.164  1.00 22.20  ? 291 TYR A CE1    1 
ATOM   4491  C  CE2    . TYR A 1 311 ? 45.503  24.931 -55.505  1.00 32.71  ? 291 TYR A CE2    1 
ATOM   4492  C  CZ     . TYR A 1 311 ? 44.426  24.082 -55.351  1.00 25.89  ? 291 TYR A CZ     1 
ATOM   4493  O  OH     . TYR A 1 311 ? 44.050  23.254 -56.386  1.00 22.63  ? 291 TYR A OH     1 
ATOM   4494  H  H      . TYR A 1 311 ? 44.890  29.195 -52.876  1.00 32.29  ? 291 TYR A H      1 
ATOM   4495  H  HA     . TYR A 1 311 ? 43.724  27.180 -51.478  1.00 37.12  ? 291 TYR A HA     1 
ATOM   4496  H  HB2    . TYR A 1 311 ? 46.388  27.151 -52.399  1.00 46.10  ? 291 TYR A HB2    1 
ATOM   4497  H  HB3    . TYR A 1 311 ? 45.819  26.099 -51.358  1.00 46.10  ? 291 TYR A HB3    1 
ATOM   4498  H  HD1    . TYR A 1 311 ? 43.626  24.873 -52.328  1.00 35.79  ? 291 TYR A HD1    1 
ATOM   4499  H  HD2    . TYR A 1 311 ? 46.603  26.331 -54.569  1.00 42.44  ? 291 TYR A HD2    1 
ATOM   4500  H  HE1    . TYR A 1 311 ? 42.997  23.486 -54.062  1.00 26.70  ? 291 TYR A HE1    1 
ATOM   4501  H  HE2    . TYR A 1 311 ? 45.976  24.945 -56.305  1.00 39.37  ? 291 TYR A HE2    1 
ATOM   4502  H  HH     . TYR A 1 311 ? 44.559  23.368 -57.045  1.00 26.56  ? 291 TYR A HH     1 
ATOM   4503  N  N      . GLN A 1 312 ? 44.285  29.478 -50.059  1.00 24.29  ? 292 GLN A N      1 
ATOM   4504  C  CA     . GLN A 1 312 ? 44.530  30.200 -48.814  1.00 28.17  ? 292 GLN A CA     1 
ATOM   4505  C  C      . GLN A 1 312 ? 43.711  29.641 -47.652  1.00 23.55  ? 292 GLN A C      1 
ATOM   4506  O  O      . GLN A 1 312 ? 44.199  29.593 -46.518  1.00 24.00  ? 292 GLN A O      1 
ATOM   4507  C  CB     . GLN A 1 312 ? 44.237  31.690 -49.006  1.00 36.47  ? 292 GLN A CB     1 
ATOM   4508  C  CG     . GLN A 1 312 ? 45.144  32.359 -50.025  1.00 43.24  ? 292 GLN A CG     1 
ATOM   4509  C  CD     . GLN A 1 312 ? 46.570  32.486 -49.520  1.00 52.29  ? 292 GLN A CD     1 
ATOM   4510  O  OE1    . GLN A 1 312 ? 46.804  32.972 -48.412  1.00 57.20  ? 292 GLN A OE1    1 
ATOM   4511  N  NE2    . GLN A 1 312 ? 47.529  32.037 -50.322  1.00 53.42  ? 292 GLN A NE2    1 
ATOM   4512  H  H      . GLN A 1 312 ? 43.663  29.825 -50.542  1.00 29.27  ? 292 GLN A H      1 
ATOM   4513  H  HA     . GLN A 1 312 ? 45.467  30.111 -48.583  1.00 33.92  ? 292 GLN A HA     1 
ATOM   4514  H  HB2    . GLN A 1 312 ? 43.321  31.793 -49.309  1.00 43.88  ? 292 GLN A HB2    1 
ATOM   4515  H  HB3    . GLN A 1 312 ? 44.356  32.145 -48.157  1.00 43.88  ? 292 GLN A HB3    1 
ATOM   4516  H  HG2    . GLN A 1 312 ? 45.157  31.829 -50.837  1.00 52.00  ? 292 GLN A HG2    1 
ATOM   4517  H  HG3    . GLN A 1 312 ? 44.810  33.250 -50.213  1.00 52.00  ? 292 GLN A HG3    1 
ATOM   4518  H  HE21   . GLN A 1 312 ? 47.326  31.695 -51.085  1.00 64.22  ? 292 GLN A HE21   1 
ATOM   4519  H  HE22   . GLN A 1 312 ? 48.352  32.087 -50.078  1.00 64.22  ? 292 GLN A HE22   1 
ATOM   4520  N  N      . TRP A 1 313 ? 42.474  29.219 -47.915  1.00 25.03  ? 293 TRP A N      1 
ATOM   4521  C  CA     . TRP A 1 313 ? 41.605  28.583 -46.922  1.00 23.19  ? 293 TRP A CA     1 
ATOM   4522  C  C      . TRP A 1 313 ? 41.087  27.306 -47.576  1.00 21.70  ? 293 TRP A C      1 
ATOM   4523  O  O      . TRP A 1 313 ? 40.193  27.355 -48.426  1.00 23.65  ? 293 TRP A O      1 
ATOM   4524  C  CB     . TRP A 1 313 ? 40.464  29.508 -46.503  1.00 21.83  ? 293 TRP A CB     1 
ATOM   4525  C  CG     . TRP A 1 313 ? 39.718  29.075 -45.262  1.00 24.41  ? 293 TRP A CG     1 
ATOM   4526  C  CD1    . TRP A 1 313 ? 38.552  28.361 -45.213  1.00 23.53  ? 293 TRP A CD1    1 
ATOM   4527  C  CD2    . TRP A 1 313 ? 40.074  29.348 -43.898  1.00 26.66  ? 293 TRP A CD2    1 
ATOM   4528  N  NE1    . TRP A 1 313 ? 38.167  28.167 -43.909  1.00 22.80  ? 293 TRP A NE1    1 
ATOM   4529  C  CE2    . TRP A 1 313 ? 39.084  28.761 -43.082  1.00 25.79  ? 293 TRP A CE2    1 
ATOM   4530  C  CE3    . TRP A 1 313 ? 41.135  30.026 -43.288  1.00 25.90  ? 293 TRP A CE3    1 
ATOM   4531  C  CZ2    . TRP A 1 313 ? 39.124  28.832 -41.691  1.00 25.25  ? 293 TRP A CZ2    1 
ATOM   4532  C  CZ3    . TRP A 1 313 ? 41.173  30.095 -41.905  1.00 24.56  ? 293 TRP A CZ3    1 
ATOM   4533  C  CH2    . TRP A 1 313 ? 40.172  29.502 -41.123  1.00 24.15  ? 293 TRP A CH2    1 
ATOM   4534  H  H      . TRP A 1 313 ? 42.104  29.293 -48.688  1.00 30.15  ? 293 TRP A H      1 
ATOM   4535  H  HA     . TRP A 1 313 ? 42.122  28.346 -46.136  1.00 27.94  ? 293 TRP A HA     1 
ATOM   4536  H  HB2    . TRP A 1 313 ? 40.828  30.391 -46.332  1.00 26.31  ? 293 TRP A HB2    1 
ATOM   4537  H  HB3    . TRP A 1 313 ? 39.822  29.556 -47.228  1.00 26.31  ? 293 TRP A HB3    1 
ATOM   4538  H  HD1    . TRP A 1 313 ? 38.088  28.050 -45.957  1.00 28.35  ? 293 TRP A HD1    1 
ATOM   4539  H  HE1    . TRP A 1 313 ? 37.465  27.740 -43.653  1.00 27.48  ? 293 TRP A HE1    1 
ATOM   4540  H  HE3    . TRP A 1 313 ? 41.803  30.422 -43.800  1.00 31.20  ? 293 TRP A HE3    1 
ATOM   4541  H  HZ2    . TRP A 1 313 ? 38.462  28.439 -41.168  1.00 30.42  ? 293 TRP A HZ2    1 
ATOM   4542  H  HZ3    . TRP A 1 313 ? 41.873  30.543 -41.488  1.00 29.58  ? 293 TRP A HZ3    1 
ATOM   4543  H  HH2    . TRP A 1 313 ? 40.224  29.563 -40.196  1.00 29.09  ? 293 TRP A HH2    1 
ATOM   4544  N  N      . CYS A 1 314 ? 41.655  26.167 -47.190  1.00 21.27  ? 294 CYS A N      1 
ATOM   4545  C  CA     . CYS A 1 314 ? 41.455  24.910 -47.900  1.00 23.17  ? 294 CYS A CA     1 
ATOM   4546  C  C      . CYS A 1 314 ? 40.421  24.042 -47.194  1.00 22.60  ? 294 CYS A C      1 
ATOM   4547  O  O      . CYS A 1 314 ? 40.537  23.777 -45.992  1.00 20.14  ? 294 CYS A O      1 
ATOM   4548  C  CB     . CYS A 1 314 ? 42.783  24.163 -48.032  1.00 23.45  ? 294 CYS A CB     1 
ATOM   4549  S  SG     . CYS A 1 314 ? 44.013  25.054 -49.035  1.00 22.46  ? 294 CYS A SG     1 
ATOM   4550  H  H      . CYS A 1 314 ? 42.170  26.097 -46.505  1.00 25.64  ? 294 CYS A H      1 
ATOM   4551  H  HA     . CYS A 1 314 ? 41.128  25.100 -48.793  1.00 27.92  ? 294 CYS A HA     1 
ATOM   4552  H  HB2    . CYS A 1 314 ? 43.158  24.031 -47.147  1.00 28.26  ? 294 CYS A HB2    1 
ATOM   4553  H  HB3    . CYS A 1 314 ? 42.620  23.304 -48.453  1.00 28.26  ? 294 CYS A HB3    1 
ATOM   4554  H  HG     . CYS A 1 314 ? 45.020  24.403 -49.088  1.00 26.36  ? 294 CYS A HG     1 
ATOM   4555  N  N      . ILE A 1 315 ? 39.418  23.595 -47.951  1.00 23.49  ? 295 ILE A N      1 
ATOM   4556  C  CA     . ILE A 1 315 ? 38.356  22.723 -47.453  1.00 23.97  ? 295 ILE A CA     1 
ATOM   4557  C  C      . ILE A 1 315 ? 38.171  21.604 -48.471  1.00 20.41  ? 295 ILE A C      1 
ATOM   4558  O  O      . ILE A 1 315 ? 37.613  21.829 -49.551  1.00 18.60  ? 295 ILE A O      1 
ATOM   4559  C  CB     . ILE A 1 315 ? 37.035  23.477 -47.230  1.00 25.15  ? 295 ILE A CB     1 
ATOM   4560  C  CG1    . ILE A 1 315 ? 37.226  24.624 -46.231  1.00 22.21  ? 295 ILE A CG1    1 
ATOM   4561  C  CG2    . ILE A 1 315 ? 35.944  22.515 -46.746  1.00 29.03  ? 295 ILE A CG2    1 
ATOM   4562  C  CD1    . ILE A 1 315 ? 35.998  25.503 -46.050  1.00 18.74  ? 295 ILE A CD1    1 
ATOM   4563  H  H      . ILE A 1 315 ? 39.331  23.792 -48.783  1.00 28.31  ? 295 ILE A H      1 
ATOM   4564  H  HA     . ILE A 1 315 ? 38.631  22.329 -46.611  1.00 28.89  ? 295 ILE A HA     1 
ATOM   4565  H  HB     . ILE A 1 315 ? 36.753  23.855 -48.077  1.00 30.30  ? 295 ILE A HB     1 
ATOM   4566  H  HG12   . ILE A 1 315 ? 37.452  24.249 -45.366  1.00 26.78  ? 295 ILE A HG12   1 
ATOM   4567  H  HG13   . ILE A 1 315 ? 37.951  25.189 -46.542  1.00 26.78  ? 295 ILE A HG13   1 
ATOM   4568  H  HG21   . ILE A 1 315 ? 35.122  23.012 -46.612  1.00 34.95  ? 295 ILE A HG21   1 
ATOM   4569  H  HG22   . ILE A 1 315 ? 35.809  21.827 -47.416  1.00 34.95  ? 295 ILE A HG22   1 
ATOM   4570  H  HG23   . ILE A 1 315 ? 36.227  22.112 -45.910  1.00 34.95  ? 295 ILE A HG23   1 
ATOM   4571  H  HD11   . ILE A 1 315 ? 36.201  26.200 -45.407  1.00 22.60  ? 295 ILE A HD11   1 
ATOM   4572  H  HD12   . ILE A 1 315 ? 35.764  25.899 -46.904  1.00 22.60  ? 295 ILE A HD12   1 
ATOM   4573  H  HD13   . ILE A 1 315 ? 35.264  24.958 -45.726  1.00 22.60  ? 295 ILE A HD13   1 
ATOM   4574  N  N      . GLU A 1 316 ? 38.633  20.403 -48.132  1.00 23.03  ? 296 GLU A N      1 
ATOM   4575  C  CA     . GLU A 1 316 ? 38.528  19.271 -49.045  1.00 28.63  ? 296 GLU A CA     1 
ATOM   4576  C  C      . GLU A 1 316 ? 37.093  18.761 -49.108  1.00 27.82  ? 296 GLU A C      1 
ATOM   4577  O  O      . GLU A 1 316 ? 36.398  18.688 -48.090  1.00 30.71  ? 296 GLU A O      1 
ATOM   4578  C  CB     . GLU A 1 316 ? 39.458  18.141 -48.598  1.00 33.19  ? 296 GLU A CB     1 
ATOM   4579  C  CG     . GLU A 1 316 ? 39.495  16.953 -49.549  1.00 36.58  ? 296 GLU A CG     1 
ATOM   4580  C  CD     . GLU A 1 316 ? 40.401  15.840 -49.057  1.00 38.76  ? 296 GLU A CD     1 
ATOM   4581  O  OE1    . GLU A 1 316 ? 40.921  15.951 -47.927  1.00 38.64  ? 296 GLU A OE1    1 
ATOM   4582  O  OE2    . GLU A 1 316 ? 40.590  14.852 -49.798  1.00 39.71  ? 296 GLU A OE2    1 
ATOM   4583  H  H      . GLU A 1 316 ? 39.011  20.219 -47.382  1.00 27.76  ? 296 GLU A H      1 
ATOM   4584  H  HA     . GLU A 1 316 ? 38.793  19.551 -49.935  1.00 34.47  ? 296 GLU A HA     1 
ATOM   4585  H  HB2    . GLU A 1 316 ? 40.360  18.490 -48.526  1.00 39.95  ? 296 GLU A HB2    1 
ATOM   4586  H  HB3    . GLU A 1 316 ? 39.161  17.819 -47.732  1.00 39.95  ? 296 GLU A HB3    1 
ATOM   4587  H  HG2    . GLU A 1 316 ? 38.599  16.592 -49.640  1.00 44.01  ? 296 GLU A HG2    1 
ATOM   4588  H  HG3    . GLU A 1 316 ? 39.823  17.248 -50.412  1.00 44.01  ? 296 GLU A HG3    1 
ATOM   4589  N  N      . ASP A 1 317 ? 36.633  18.391 -50.358  1.00 24.35  ? 297 ASP A N      1 
ATOM   4590  C  CA     . ASP A 1 317 ? 35.297  17.817 -50.481  1.00 25.63  ? 297 ASP A CA     1 
ATOM   4591  C  C      . ASP A 1 317 ? 35.354  16.305 -50.268  1.00 28.85  ? 297 ASP A C      1 
ATOM   4592  O  O      . ASP A 1 317 ? 36.310  15.654 -50.702  1.00 33.55  ? 297 ASP A O      1 
ATOM   4593  C  CB     . ASP A 1 317 ? 34.694  18.111 -51.851  1.00 25.22  ? 297 ASP A CB     1 
ATOM   4594  C  CG     . ASP A 1 317 ? 33.236  17.689 -51.945  1.00 25.64  ? 297 ASP A CG     1 
ATOM   4595  O  OD1    . ASP A 1 317 ? 32.359  18.455 -51.491  1.00 25.52  ? 297 ASP A OD1    1 
ATOM   4596  O  OD2    . ASP A 1 317 ? 32.965  16.586 -52.465  1.00 25.97  ? 297 ASP A OD2    1 
ATOM   4597  H  H      . ASP A 1 317 ? 37.069  18.467 -51.095  1.00 29.34  ? 297 ASP A H      1 
ATOM   4598  H  HA     . ASP A 1 317 ? 34.719  18.200 -49.803  1.00 30.87  ? 297 ASP A HA     1 
ATOM   4599  H  HB2    . ASP A 1 317 ? 34.743  19.065 -52.020  1.00 30.39  ? 297 ASP A HB2    1 
ATOM   4600  H  HB3    . ASP A 1 317 ? 35.192  17.627 -52.528  1.00 30.39  ? 297 ASP A HB3    1 
ATOM   4601  N  N      . PRO A 1 318 ? 34.361  15.702 -49.606  1.00 28.17  ? 298 PRO A N      1 
ATOM   4602  C  CA     . PRO A 1 318 ? 34.462  14.265 -49.300  1.00 30.67  ? 298 PRO A CA     1 
ATOM   4603  C  C      . PRO A 1 318 ? 34.309  13.355 -50.510  1.00 30.46  ? 298 PRO A C      1 
ATOM   4604  O  O      . PRO A 1 318 ? 34.794  12.218 -50.462  1.00 27.08  ? 298 PRO A O      1 
ATOM   4605  C  CB     . PRO A 1 318 ? 33.318  14.032 -48.299  1.00 28.24  ? 298 PRO A CB     1 
ATOM   4606  C  CG     . PRO A 1 318 ? 32.885  15.387 -47.854  1.00 25.54  ? 298 PRO A CG     1 
ATOM   4607  C  CD     . PRO A 1 318 ? 33.169  16.305 -48.988  1.00 24.55  ? 298 PRO A CD     1 
ATOM   4608  H  HA     . PRO A 1 318 ? 35.308  14.075 -48.865  1.00 36.92  ? 298 PRO A HA     1 
ATOM   4609  H  HB2    . PRO A 1 318 ? 32.589  13.568 -48.741  1.00 34.00  ? 298 PRO A HB2    1 
ATOM   4610  H  HB3    . PRO A 1 318 ? 33.646  13.514 -47.547  1.00 34.00  ? 298 PRO A HB3    1 
ATOM   4611  H  HG2    . PRO A 1 318 ? 31.936  15.375 -47.657  1.00 30.77  ? 298 PRO A HG2    1 
ATOM   4612  H  HG3    . PRO A 1 318 ? 33.393  15.648 -47.070  1.00 30.77  ? 298 PRO A HG3    1 
ATOM   4613  H  HD2    . PRO A 1 318 ? 32.428  16.311 -49.614  1.00 29.58  ? 298 PRO A HD2    1 
ATOM   4614  H  HD3    . PRO A 1 318 ? 33.370  17.196 -48.662  1.00 29.58  ? 298 PRO A HD3    1 
ATOM   4615  N  N      . TYR A 1 319 ? 33.658  13.803 -51.582  1.00 29.58  ? 299 TYR A N      1 
ATOM   4616  C  CA     . TYR A 1 319 ? 33.344  12.932 -52.711  1.00 29.87  ? 299 TYR A CA     1 
ATOM   4617  C  C      . TYR A 1 319 ? 33.844  13.452 -54.051  1.00 32.68  ? 299 TYR A C      1 
ATOM   4618  O  O      . TYR A 1 319 ? 34.281  12.656 -54.885  1.00 34.51  ? 299 TYR A O      1 
ATOM   4619  C  CB     . TYR A 1 319 ? 31.825  12.709 -52.783  1.00 24.94  ? 299 TYR A CB     1 
ATOM   4620  C  CG     . TYR A 1 319 ? 31.270  12.000 -51.566  1.00 23.19  ? 299 TYR A CG     1 
ATOM   4621  C  CD1    . TYR A 1 319 ? 31.540  10.656 -51.337  1.00 21.62  ? 299 TYR A CD1    1 
ATOM   4622  C  CD2    . TYR A 1 319 ? 30.478  12.674 -50.646  1.00 21.21  ? 299 TYR A CD2    1 
ATOM   4623  C  CE1    . TYR A 1 319 ? 31.039  10.005 -50.224  1.00 18.15  ? 299 TYR A CE1    1 
ATOM   4624  C  CE2    . TYR A 1 319 ? 29.972  12.029 -49.531  1.00 18.51  ? 299 TYR A CE2    1 
ATOM   4625  C  CZ     . TYR A 1 319 ? 30.256  10.696 -49.326  1.00 17.78  ? 299 TYR A CZ     1 
ATOM   4626  O  OH     . TYR A 1 319 ? 29.755  10.054 -48.218  1.00 18.07  ? 299 TYR A OH     1 
ATOM   4627  H  H      . TYR A 1 319 ? 33.386  14.612 -51.680  1.00 35.62  ? 299 TYR A H      1 
ATOM   4628  H  HA     . TYR A 1 319 ? 33.760  12.069 -52.559  1.00 35.96  ? 299 TYR A HA     1 
ATOM   4629  H  HB2    . TYR A 1 319 ? 31.384  13.570 -52.854  1.00 30.04  ? 299 TYR A HB2    1 
ATOM   4630  H  HB3    . TYR A 1 319 ? 31.623  12.168 -53.562  1.00 30.04  ? 299 TYR A HB3    1 
ATOM   4631  H  HD1    . TYR A 1 319 ? 32.069  10.187 -51.940  1.00 26.06  ? 299 TYR A HD1    1 
ATOM   4632  H  HD2    . TYR A 1 319 ? 30.286  13.574 -50.780  1.00 25.57  ? 299 TYR A HD2    1 
ATOM   4633  H  HE1    . TYR A 1 319 ? 31.228  9.105  -50.084  1.00 21.36  ? 299 TYR A HE1    1 
ATOM   4634  H  HE2    . TYR A 1 319 ? 29.443  12.493 -48.922  1.00 22.33  ? 299 TYR A HE2    1 
ATOM   4635  H  HH     . TYR A 1 319 ? 30.002  9.251  -48.215  1.00 21.10  ? 299 TYR A HH     1 
ATOM   4636  N  N      . GLU A 1 320 ? 33.768  14.756 -54.302  1.00 30.74  ? 300 GLU A N      1 
ATOM   4637  C  CA     . GLU A 1 320 ? 34.264  15.292 -55.561  1.00 30.32  ? 300 GLU A CA     1 
ATOM   4638  C  C      . GLU A 1 320 ? 35.781  15.133 -55.649  1.00 33.03  ? 300 GLU A C      1 
ATOM   4639  O  O      . GLU A 1 320 ? 36.481  14.991 -54.642  1.00 33.70  ? 300 GLU A O      1 
ATOM   4640  C  CB     . GLU A 1 320 ? 33.878  16.764 -55.709  1.00 31.28  ? 300 GLU A CB     1 
ATOM   4641  C  CG     . GLU A 1 320 ? 32.378  17.013 -55.781  1.00 31.13  ? 300 GLU A CG     1 
ATOM   4642  C  CD     . GLU A 1 320 ? 31.773  16.612 -57.115  1.00 30.00  ? 300 GLU A CD     1 
ATOM   4643  O  OE1    . GLU A 1 320 ? 32.529  16.203 -58.021  1.00 29.42  ? 300 GLU A OE1    1 
ATOM   4644  O  OE2    . GLU A 1 320 ? 30.535  16.708 -57.255  1.00 28.48  ? 300 GLU A OE2    1 
ATOM   4645  H  H      . GLU A 1 320 ? 33.438  15.343 -53.767  1.00 37.00  ? 300 GLU A H      1 
ATOM   4646  H  HA     . GLU A 1 320 ? 33.866  14.800 -56.295  1.00 36.51  ? 300 GLU A HA     1 
ATOM   4647  H  HB2    . GLU A 1 320 ? 34.222  17.254 -54.946  1.00 37.66  ? 300 GLU A HB2    1 
ATOM   4648  H  HB3    . GLU A 1 320 ? 34.274  17.108 -56.525  1.00 37.66  ? 300 GLU A HB3    1 
ATOM   4649  H  HG2    . GLU A 1 320 ? 31.939  16.497 -55.086  1.00 37.47  ? 300 GLU A HG2    1 
ATOM   4650  H  HG3    . GLU A 1 320 ? 32.208  17.959 -55.648  1.00 37.47  ? 300 GLU A HG3    1 
ATOM   4651  N  N      . LEU A 1 321 ? 36.286  15.157 -56.880  1.00 36.05  ? 301 LEU A N      1 
ATOM   4652  C  CA     . LEU A 1 321 ? 37.693  14.887 -57.158  1.00 37.78  ? 301 LEU A CA     1 
ATOM   4653  C  C      . LEU A 1 321 ? 38.488  16.188 -57.219  1.00 30.02  ? 301 LEU A C      1 
ATOM   4654  O  O      . LEU A 1 321 ? 38.268  17.015 -58.111  1.00 21.67  ? 301 LEU A O      1 
ATOM   4655  C  CB     . LEU A 1 321 ? 37.843  14.105 -58.462  1.00 46.77  ? 301 LEU A CB     1 
ATOM   4656  C  CG     . LEU A 1 321 ? 39.283  13.840 -58.914  1.00 59.48  ? 301 LEU A CG     1 
ATOM   4657  C  CD1    . LEU A 1 321 ? 40.090  13.128 -57.835  1.00 62.76  ? 301 LEU A CD1    1 
ATOM   4658  C  CD2    . LEU A 1 321 ? 39.277  13.023 -60.193  1.00 66.47  ? 301 LEU A CD2    1 
ATOM   4659  H  H      . LEU A 1 321 ? 35.823  15.329 -57.584  1.00 43.38  ? 301 LEU A H      1 
ATOM   4660  H  HA     . LEU A 1 321 ? 38.058  14.346 -56.441  1.00 45.45  ? 301 LEU A HA     1 
ATOM   4661  H  HB2    . LEU A 1 321 ? 37.410  13.244 -58.355  1.00 56.24  ? 301 LEU A HB2    1 
ATOM   4662  H  HB3    . LEU A 1 321 ? 37.403  14.602 -59.170  1.00 56.24  ? 301 LEU A HB3    1 
ATOM   4663  H  HG     . LEU A 1 321 ? 39.716  14.688 -59.102  1.00 71.49  ? 301 LEU A HG     1 
ATOM   4664  H  HD11   . LEU A 1 321 ? 40.992  12.981 -58.162  1.00 75.43  ? 301 LEU A HD11   1 
ATOM   4665  H  HD12   . LEU A 1 321 ? 40.112  13.683 -57.040  1.00 75.43  ? 301 LEU A HD12   1 
ATOM   4666  H  HD13   . LEU A 1 321 ? 39.668  12.279 -57.635  1.00 75.43  ? 301 LEU A HD13   1 
ATOM   4667  H  HD21   . LEU A 1 321 ? 40.193  12.862 -60.469  1.00 79.88  ? 301 LEU A HD21   1 
ATOM   4668  H  HD22   . LEU A 1 321 ? 38.828  12.179 -60.027  1.00 79.88  ? 301 LEU A HD22   1 
ATOM   4669  H  HD23   . LEU A 1 321 ? 38.806  13.518 -60.882  1.00 79.88  ? 301 LEU A HD23   1 
ATOM   4670  N  N      . ASN A 1 322 ? 39.414  16.359 -56.274  1.00 32.58  ? 302 ASN A N      1 
ATOM   4671  C  CA     . ASN A 1 322 ? 40.351  17.485 -56.275  1.00 34.04  ? 302 ASN A CA     1 
ATOM   4672  C  C      . ASN A 1 322 ? 39.609  18.822 -56.305  1.00 30.92  ? 302 ASN A C      1 
ATOM   4673  O  O      . ASN A 1 322 ? 39.857  19.680 -57.155  1.00 28.94  ? 302 ASN A O      1 
ATOM   4674  C  CB     . ASN A 1 322 ? 41.322  17.369 -57.455  1.00 37.17  ? 302 ASN A CB     1 
ATOM   4675  C  CG     . ASN A 1 322 ? 42.534  18.273 -57.313  1.00 37.92  ? 302 ASN A CG     1 
ATOM   4676  O  OD1    . ASN A 1 322 ? 43.036  18.491 -56.211  1.00 38.85  ? 302 ASN A OD1    1 
ATOM   4677  N  ND2    . ASN A 1 322 ? 43.011  18.802 -58.433  1.00 37.76  ? 302 ASN A ND2    1 
ATOM   4678  H  H      . ASN A 1 322 ? 39.522  15.825 -55.608  1.00 39.22  ? 302 ASN A H      1 
ATOM   4679  H  HA     . ASN A 1 322 ? 40.874  17.456 -55.458  1.00 40.96  ? 302 ASN A HA     1 
ATOM   4680  H  HB2    . ASN A 1 322 ? 41.636  16.454 -57.517  1.00 44.72  ? 302 ASN A HB2    1 
ATOM   4681  H  HB3    . ASN A 1 322 ? 40.858  17.617 -58.270  1.00 44.72  ? 302 ASN A HB3    1 
ATOM   4682  H  HD21   . ASN A 1 322 ? 43.696  19.321 -58.405  1.00 45.43  ? 302 ASN A HD21   1 
ATOM   4683  H  HD22   . ASN A 1 322 ? 42.634  18.626 -59.186  1.00 45.43  ? 302 ASN A HD22   1 
ATOM   4684  N  N      . LEU A 1 323 ? 38.698  18.999 -55.350  1.00 26.72  ? 303 LEU A N      1 
ATOM   4685  C  CA     . LEU A 1 323 ? 37.848  20.181 -55.276  1.00 26.11  ? 303 LEU A CA     1 
ATOM   4686  C  C      . LEU A 1 323 ? 38.003  20.833 -53.910  1.00 24.92  ? 303 LEU A C      1 
ATOM   4687  O  O      . LEU A 1 323 ? 37.735  20.201 -52.883  1.00 25.14  ? 303 LEU A O      1 
ATOM   4688  C  CB     . LEU A 1 323 ? 36.384  19.807 -55.521  1.00 27.07  ? 303 LEU A CB     1 
ATOM   4689  C  CG     . LEU A 1 323 ? 35.368  20.951 -55.576  1.00 26.17  ? 303 LEU A CG     1 
ATOM   4690  C  CD1    . LEU A 1 323 ? 35.647  21.888 -56.742  1.00 25.02  ? 303 LEU A CD1    1 
ATOM   4691  C  CD2    . LEU A 1 323 ? 33.951  20.399 -55.650  1.00 24.97  ? 303 LEU A CD2    1 
ATOM   4692  H  H      . LEU A 1 323 ? 38.553  18.434 -54.719  1.00 32.19  ? 303 LEU A H      1 
ATOM   4693  H  HA     . LEU A 1 323 ? 38.120  20.819 -55.954  1.00 31.45  ? 303 LEU A HA     1 
ATOM   4694  H  HB2    . LEU A 1 323 ? 36.331  19.339 -56.369  1.00 32.60  ? 303 LEU A HB2    1 
ATOM   4695  H  HB3    . LEU A 1 323 ? 36.103  19.210 -54.810  1.00 32.60  ? 303 LEU A HB3    1 
ATOM   4696  H  HG     . LEU A 1 323 ? 35.440  21.469 -54.758  1.00 31.52  ? 303 LEU A HG     1 
ATOM   4697  H  HD11   . LEU A 1 323 ? 34.985  22.597 -56.742  1.00 30.15  ? 303 LEU A HD11   1 
ATOM   4698  H  HD12   . LEU A 1 323 ? 36.535  22.265 -56.639  1.00 30.15  ? 303 LEU A HD12   1 
ATOM   4699  H  HD13   . LEU A 1 323 ? 35.594  21.386 -57.570  1.00 30.15  ? 303 LEU A HD13   1 
ATOM   4700  H  HD21   . LEU A 1 323 ? 33.326  21.139 -55.684  1.00 30.09  ? 303 LEU A HD21   1 
ATOM   4701  H  HD22   . LEU A 1 323 ? 33.866  19.857 -56.450  1.00 30.09  ? 303 LEU A HD22   1 
ATOM   4702  H  HD23   . LEU A 1 323 ? 33.782  19.857 -54.864  1.00 30.09  ? 303 LEU A HD23   1 
ATOM   4703  N  N      . ASN A 1 324 ? 38.427  22.094 -53.901  1.00 24.87  ? 304 ASN A N      1 
ATOM   4704  C  CA     . ASN A 1 324 ? 38.541  22.876 -52.676  1.00 22.76  ? 304 ASN A CA     1 
ATOM   4705  C  C      . ASN A 1 324 ? 37.274  23.707 -52.515  1.00 20.74  ? 304 ASN A C      1 
ATOM   4706  O  O      . ASN A 1 324 ? 36.969  24.548 -53.368  1.00 19.54  ? 304 ASN A O      1 
ATOM   4707  C  CB     . ASN A 1 324 ? 39.775  23.777 -52.715  1.00 23.85  ? 304 ASN A CB     1 
ATOM   4708  C  CG     . ASN A 1 324 ? 39.890  24.667 -51.489  1.00 23.24  ? 304 ASN A CG     1 
ATOM   4709  O  OD1    . ASN A 1 324 ? 39.253  24.422 -50.463  1.00 19.54  ? 304 ASN A OD1    1 
ATOM   4710  N  ND2    . ASN A 1 324 ? 40.715  25.702 -51.587  1.00 23.86  ? 304 ASN A ND2    1 
ATOM   4711  H  H      . ASN A 1 324 ? 38.660  22.527 -54.607  1.00 29.97  ? 304 ASN A H      1 
ATOM   4712  H  HA     . ASN A 1 324 ? 38.618  22.279 -51.916  1.00 27.43  ? 304 ASN A HA     1 
ATOM   4713  H  HB2    . ASN A 1 324 ? 40.569  23.222 -52.759  1.00 28.74  ? 304 ASN A HB2    1 
ATOM   4714  H  HB3    . ASN A 1 324 ? 39.724  24.348 -53.497  1.00 28.74  ? 304 ASN A HB3    1 
ATOM   4715  H  HD21   . ASN A 1 324 ? 40.816  26.236 -50.921  1.00 28.75  ? 304 ASN A HD21   1 
ATOM   4716  H  HD22   . ASN A 1 324 ? 41.149  25.838 -52.318  1.00 28.75  ? 304 ASN A HD22   1 
ATOM   4717  N  N      . VAL A 1 325 ? 36.539  23.473 -51.424  1.00 20.70  ? 305 VAL A N      1 
ATOM   4718  C  CA     . VAL A 1 325 ? 35.304  24.213 -51.186  1.00 22.37  ? 305 VAL A CA     1 
ATOM   4719  C  C      . VAL A 1 325 ? 35.586  25.669 -50.834  1.00 20.88  ? 305 VAL A C      1 
ATOM   4720  O  O      . VAL A 1 325 ? 34.690  26.516 -50.942  1.00 17.30  ? 305 VAL A O      1 
ATOM   4721  C  CB     . VAL A 1 325 ? 34.474  23.523 -50.084  1.00 24.44  ? 305 VAL A CB     1 
ATOM   4722  C  CG1    . VAL A 1 325 ? 33.143  24.232 -49.879  1.00 22.28  ? 305 VAL A CG1    1 
ATOM   4723  C  CG2    . VAL A 1 325 ? 34.243  22.056 -50.433  1.00 27.06  ? 305 VAL A CG2    1 
ATOM   4724  H  H      . VAL A 1 325 ? 36.734  22.899 -50.814  1.00 24.96  ? 305 VAL A H      1 
ATOM   4725  H  HA     . VAL A 1 325 ? 34.776  24.205 -52.000  1.00 26.96  ? 305 VAL A HA     1 
ATOM   4726  H  HB     . VAL A 1 325 ? 34.966  23.560 -49.249  1.00 29.44  ? 305 VAL A HB     1 
ATOM   4727  H  HG11   . VAL A 1 325 ? 32.647  23.776 -49.181  1.00 26.85  ? 305 VAL A HG11   1 
ATOM   4728  H  HG12   . VAL A 1 325 ? 33.312  25.151 -49.617  1.00 26.85  ? 305 VAL A HG12   1 
ATOM   4729  H  HG13   . VAL A 1 325 ? 32.643  24.211 -50.709  1.00 26.85  ? 305 VAL A HG13   1 
ATOM   4730  H  HG21   . VAL A 1 325 ? 33.720  21.643 -49.727  1.00 32.60  ? 305 VAL A HG21   1 
ATOM   4731  H  HG22   . VAL A 1 325 ? 33.763  22.004 -51.274  1.00 32.60  ? 305 VAL A HG22   1 
ATOM   4732  H  HG23   . VAL A 1 325 ? 35.101  21.612 -50.512  1.00 32.60  ? 305 VAL A HG23   1 
ATOM   4733  N  N      . GLY A 1 326 ? 36.812  25.986 -50.421  1.00 24.00  ? 306 GLY A N      1 
ATOM   4734  C  CA     . GLY A 1 326 ? 37.205  27.355 -50.151  1.00 25.26  ? 306 GLY A CA     1 
ATOM   4735  C  C      . GLY A 1 326 ? 38.006  27.941 -51.296  1.00 28.73  ? 306 GLY A C      1 
ATOM   4736  O  O      . GLY A 1 326 ? 38.868  28.800 -51.092  1.00 32.30  ? 306 GLY A O      1 
ATOM   4737  H  H      . GLY A 1 326 ? 37.439  25.412 -50.290  1.00 28.92  ? 306 GLY A H      1 
ATOM   4738  H  HA2    . GLY A 1 326 ? 36.414  27.900 -50.015  1.00 30.43  ? 306 GLY A HA2    1 
ATOM   4739  H  HA3    . GLY A 1 326 ? 37.745  27.387 -49.346  1.00 30.43  ? 306 GLY A HA3    1 
ATOM   4740  N  N      . ARG A 1 327 ? 37.721  27.474 -52.514  1.00 29.05  ? 307 ARG A N      1 
ATOM   4741  C  CA     . ARG A 1 327 ? 38.473  27.892 -53.691  1.00 34.66  ? 307 ARG A CA     1 
ATOM   4742  C  C      . ARG A 1 327 ? 38.298  29.371 -54.023  1.00 33.41  ? 307 ARG A C      1 
ATOM   4743  O  O      . ARG A 1 327 ? 39.118  29.924 -54.764  1.00 35.63  ? 307 ARG A O      1 
ATOM   4744  C  CB     . ARG A 1 327 ? 38.061  27.026 -54.886  1.00 39.13  ? 307 ARG A CB     1 
ATOM   4745  C  CG     . ARG A 1 327 ? 36.570  27.066 -55.214  1.00 44.95  ? 307 ARG A CG     1 
ATOM   4746  C  CD     . ARG A 1 327 ? 36.187  25.969 -56.201  1.00 50.10  ? 307 ARG A CD     1 
ATOM   4747  N  NE     . ARG A 1 327 ? 34.746  25.916 -56.437  1.00 54.02  ? 307 ARG A NE     1 
ATOM   4748  C  CZ     . ARG A 1 327 ? 33.887  25.196 -55.716  1.00 57.56  ? 307 ARG A CZ     1 
ATOM   4749  N  NH1    . ARG A 1 327 ? 34.311  24.457 -54.698  1.00 58.38  ? 307 ARG A NH1    1 
ATOM   4750  N  NH2    . ARG A 1 327 ? 32.595  25.218 -56.012  1.00 59.06  ? 307 ARG A NH2    1 
ATOM   4751  H  H      . ARG A 1 327 ? 37.092  26.912 -52.682  1.00 34.97  ? 307 ARG A H      1 
ATOM   4752  H  HA     . ARG A 1 327 ? 39.417  27.738 -53.527  1.00 41.71  ? 307 ARG A HA     1 
ATOM   4753  H  HB2    . ARG A 1 327 ? 38.544  27.331 -55.670  1.00 47.08  ? 307 ARG A HB2    1 
ATOM   4754  H  HB3    . ARG A 1 327 ? 38.296  26.104 -54.696  1.00 47.08  ? 307 ARG A HB3    1 
ATOM   4755  H  HG2    . ARG A 1 327 ? 36.059  26.934 -54.400  1.00 54.06  ? 307 ARG A HG2    1 
ATOM   4756  H  HG3    . ARG A 1 327 ? 36.353  27.923 -55.613  1.00 54.06  ? 307 ARG A HG3    1 
ATOM   4757  H  HD2    . ARG A 1 327 ? 36.626  26.138 -57.049  1.00 60.24  ? 307 ARG A HD2    1 
ATOM   4758  H  HD3    . ARG A 1 327 ? 36.467  25.111 -55.846  1.00 60.24  ? 307 ARG A HD3    1 
ATOM   4759  H  HE     . ARG A 1 327 ? 34.430  26.382 -57.087  1.00 64.94  ? 307 ARG A HE     1 
ATOM   4760  H  HH11   . ARG A 1 327 ? 35.147  24.438 -54.499  1.00 70.17  ? 307 ARG A HH11   1 
ATOM   4761  H  HH12   . ARG A 1 327 ? 33.749  23.996 -54.238  1.00 70.17  ? 307 ARG A HH12   1 
ATOM   4762  H  HH21   . ARG A 1 327 ? 32.312  25.694 -56.669  1.00 70.99  ? 307 ARG A HH21   1 
ATOM   4763  H  HH22   . ARG A 1 327 ? 32.040  24.753 -55.547  1.00 70.99  ? 307 ARG A HH22   1 
ATOM   4764  N  N      . ASN A 1 328 ? 37.263  30.026 -53.496  1.00 24.58  ? 308 ASN A N      1 
ATOM   4765  C  CA     . ASN A 1 328 ? 36.994  31.427 -53.793  1.00 21.87  ? 308 ASN A CA     1 
ATOM   4766  C  C      . ASN A 1 328 ? 37.480  32.376 -52.702  1.00 25.34  ? 308 ASN A C      1 
ATOM   4767  O  O      . ASN A 1 328 ? 37.203  33.578 -52.777  1.00 27.82  ? 308 ASN A O      1 
ATOM   4768  C  CB     . ASN A 1 328 ? 35.497  31.640 -54.025  1.00 20.72  ? 308 ASN A CB     1 
ATOM   4769  C  CG     . ASN A 1 328 ? 35.013  31.020 -55.321  1.00 23.83  ? 308 ASN A CG     1 
ATOM   4770  O  OD1    . ASN A 1 328 ? 35.728  31.008 -56.324  1.00 27.54  ? 308 ASN A OD1    1 
ATOM   4771  N  ND2    . ASN A 1 328 ? 33.787  30.509 -55.310  1.00 22.97  ? 308 ASN A ND2    1 
ATOM   4772  H  H      . ASN A 1 328 ? 36.695  29.672 -52.956  1.00 29.62  ? 308 ASN A H      1 
ATOM   4773  H  HA     . ASN A 1 328 ? 37.455  31.663 -54.613  1.00 26.36  ? 308 ASN A HA     1 
ATOM   4774  H  HB2    . ASN A 1 328 ? 35.003  31.235 -53.296  1.00 24.98  ? 308 ASN A HB2    1 
ATOM   4775  H  HB3    . ASN A 1 328 ? 35.315  32.592 -54.062  1.00 24.98  ? 308 ASN A HB3    1 
ATOM   4776  H  HD21   . ASN A 1 328 ? 33.466  30.145 -56.020  1.00 27.68  ? 308 ASN A HD21   1 
ATOM   4777  H  HD22   . ASN A 1 328 ? 33.315  30.541 -54.592  1.00 27.68  ? 308 ASN A HD22   1 
ATOM   4778  N  N      . VAL A 1 329 ? 38.199  31.877 -51.702  1.00 24.32  ? 309 VAL A N      1 
ATOM   4779  C  CA     . VAL A 1 329 ? 38.680  32.708 -50.602  1.00 24.10  ? 309 VAL A CA     1 
ATOM   4780  C  C      . VAL A 1 329 ? 40.029  33.303 -50.993  1.00 23.01  ? 309 VAL A C      1 
ATOM   4781  O  O      . VAL A 1 329 ? 41.051  32.610 -51.004  1.00 22.65  ? 309 VAL A O      1 
ATOM   4782  C  CB     . VAL A 1 329 ? 38.781  31.908 -49.298  1.00 23.70  ? 309 VAL A CB     1 
ATOM   4783  C  CG1    . VAL A 1 329 ? 39.301  32.791 -48.167  1.00 24.24  ? 309 VAL A CG1    1 
ATOM   4784  C  CG2    . VAL A 1 329 ? 37.428  31.312 -48.938  1.00 23.23  ? 309 VAL A CG2    1 
ATOM   4785  H  H      . VAL A 1 329 ? 38.425  31.050 -51.636  1.00 29.31  ? 309 VAL A H      1 
ATOM   4786  H  HA     . VAL A 1 329 ? 38.057  33.438 -50.460  1.00 29.04  ? 309 VAL A HA     1 
ATOM   4787  H  HB     . VAL A 1 329 ? 39.407  31.178 -49.422  1.00 28.56  ? 309 VAL A HB     1 
ATOM   4788  H  HG11   . VAL A 1 329 ? 39.356  32.263 -47.355  1.00 29.21  ? 309 VAL A HG11   1 
ATOM   4789  H  HG12   . VAL A 1 329 ? 40.181  33.123 -48.406  1.00 29.21  ? 309 VAL A HG12   1 
ATOM   4790  H  HG13   . VAL A 1 329 ? 38.690  33.533 -48.039  1.00 29.21  ? 309 VAL A HG13   1 
ATOM   4791  H  HG21   . VAL A 1 329 ? 37.514  30.811 -48.112  1.00 28.00  ? 309 VAL A HG21   1 
ATOM   4792  H  HG22   . VAL A 1 329 ? 36.787  32.031 -48.824  1.00 28.00  ? 309 VAL A HG22   1 
ATOM   4793  H  HG23   . VAL A 1 329 ? 37.142  30.723 -49.654  1.00 28.00  ? 309 VAL A HG23   1 
ATOM   4794  N  N      . THR A 1 330 ? 40.028  34.591 -51.314  1.00 22.94  ? 310 THR A N      1 
ATOM   4795  C  CA     . THR A 1 330 ? 41.247  35.329 -51.607  1.00 24.13  ? 310 THR A CA     1 
ATOM   4796  C  C      . THR A 1 330 ? 41.950  35.714 -50.311  1.00 24.92  ? 310 THR A C      1 
ATOM   4797  O  O      . THR A 1 330 ? 41.400  35.561 -49.218  1.00 24.55  ? 310 THR A O      1 
ATOM   4798  C  CB     . THR A 1 330 ? 40.908  36.579 -52.417  1.00 24.58  ? 310 THR A CB     1 
ATOM   4799  O  OG1    . THR A 1 330 ? 40.121  37.468 -51.615  1.00 24.66  ? 310 THR A OG1    1 
ATOM   4800  C  CG2    . THR A 1 330 ? 40.121  36.216 -53.670  1.00 23.79  ? 310 THR A CG2    1 
ATOM   4801  H  H      . THR A 1 330 ? 39.316  35.069 -51.371  1.00 26.94  ? 310 THR A H      1 
ATOM   4802  H  HA     . THR A 1 330 ? 41.845  34.774 -52.131  1.00 28.36  ? 310 THR A HA     1 
ATOM   4803  H  HB     . THR A 1 330 ? 41.727  37.024 -52.686  1.00 28.90  ? 310 THR A HB     1 
ATOM   4804  H  HG1    . THR A 1 330 ? 39.930  38.158 -52.054  1.00 29.00  ? 310 THR A HG1    1 
ATOM   4805  H  HG21   . THR A 1 330 ? 39.913  37.017 -54.174  1.00 27.96  ? 310 THR A HG21   1 
ATOM   4806  H  HG22   . THR A 1 330 ? 40.644  35.619 -54.228  1.00 27.96  ? 310 THR A HG22   1 
ATOM   4807  H  HG23   . THR A 1 330 ? 39.293  35.773 -53.425  1.00 27.96  ? 310 THR A HG23   1 
ATOM   4808  N  N      . PRO A 1 331 ? 43.184  36.217 -50.395  1.00 32.30  ? 311 PRO A N      1 
ATOM   4809  C  CA     . PRO A 1 331 ? 43.838  36.729 -49.176  1.00 41.04  ? 311 PRO A CA     1 
ATOM   4810  C  C      . PRO A 1 331 ? 43.014  37.800 -48.480  1.00 42.19  ? 311 PRO A C      1 
ATOM   4811  O  O      . PRO A 1 331 ? 43.006  37.874 -47.241  1.00 41.77  ? 311 PRO A O      1 
ATOM   4812  C  CB     . PRO A 1 331 ? 45.175  37.272 -49.699  1.00 41.99  ? 311 PRO A CB     1 
ATOM   4813  C  CG     . PRO A 1 331 ? 45.419  36.519 -50.972  1.00 35.76  ? 311 PRO A CG     1 
ATOM   4814  C  CD     . PRO A 1 331 ? 44.072  36.268 -51.569  1.00 30.40  ? 311 PRO A CD     1 
ATOM   4815  H  HA     . PRO A 1 331 ? 44.008  36.003 -48.556  1.00 49.36  ? 311 PRO A HA     1 
ATOM   4816  H  HB2    . PRO A 1 331 ? 45.098  38.224 -49.871  1.00 50.51  ? 311 PRO A HB2    1 
ATOM   4817  H  HB3    . PRO A 1 331 ? 45.877  37.094 -49.054  1.00 50.51  ? 311 PRO A HB3    1 
ATOM   4818  H  HG2    . PRO A 1 331 ? 45.960  37.059 -51.569  1.00 43.03  ? 311 PRO A HG2    1 
ATOM   4819  H  HG3    . PRO A 1 331 ? 45.864  35.681 -50.772  1.00 43.03  ? 311 PRO A HG3    1 
ATOM   4820  H  HD2    . PRO A 1 331 ? 43.819  37.000 -52.153  1.00 36.59  ? 311 PRO A HD2    1 
ATOM   4821  H  HD3    . PRO A 1 331 ? 44.062  35.418 -52.037  1.00 36.59  ? 311 PRO A HD3    1 
ATOM   4822  N  N      . LEU A 1 332 ? 42.286  38.610 -49.251  1.00 38.51  ? 312 LEU A N      1 
ATOM   4823  C  CA     . LEU A 1 332 ? 41.426  39.636 -48.672  1.00 35.77  ? 312 LEU A CA     1 
ATOM   4824  C  C      . LEU A 1 332 ? 40.312  39.012 -47.849  1.00 29.39  ? 312 LEU A C      1 
ATOM   4825  O  O      . LEU A 1 332 ? 40.133  39.334 -46.668  1.00 26.59  ? 312 LEU A O      1 
ATOM   4826  C  CB     . LEU A 1 332 ? 40.819  40.484 -49.791  1.00 36.48  ? 312 LEU A CB     1 
ATOM   4827  C  CG     . LEU A 1 332 ? 40.212  41.848 -49.458  1.00 35.64  ? 312 LEU A CG     1 
ATOM   4828  C  CD1    . LEU A 1 332 ? 41.188  42.811 -48.808  1.00 35.63  ? 312 LEU A CD1    1 
ATOM   4829  C  CD2    . LEU A 1 332 ? 39.607  42.436 -50.726  1.00 35.08  ? 312 LEU A CD2    1 
ATOM   4830  H  H      . LEU A 1 332 ? 42.275  38.585 -50.111  1.00 46.33  ? 312 LEU A H      1 
ATOM   4831  H  HA     . LEU A 1 332 ? 41.950  40.214 -48.096  1.00 43.05  ? 312 LEU A HA     1 
ATOM   4832  H  HB2    . LEU A 1 332 ? 41.515  40.644 -50.447  1.00 43.89  ? 312 LEU A HB2    1 
ATOM   4833  H  HB3    . LEU A 1 332 ? 40.114  39.961 -50.205  1.00 43.89  ? 312 LEU A HB3    1 
ATOM   4834  H  HG     . LEU A 1 332 ? 39.485  41.710 -48.831  1.00 42.89  ? 312 LEU A HG     1 
ATOM   4835  H  HD11   . LEU A 1 332 ? 40.732  43.648 -48.628  1.00 42.88  ? 312 LEU A HD11   1 
ATOM   4836  H  HD12   . LEU A 1 332 ? 41.508  42.424 -47.978  1.00 42.88  ? 312 LEU A HD12   1 
ATOM   4837  H  HD13   . LEU A 1 332 ? 41.932  42.962 -49.412  1.00 42.88  ? 312 LEU A HD13   1 
ATOM   4838  H  HD21   . LEU A 1 332 ? 39.220  43.301 -50.518  1.00 42.21  ? 312 LEU A HD21   1 
ATOM   4839  H  HD22   . LEU A 1 332 ? 40.305  42.535 -51.391  1.00 42.21  ? 312 LEU A HD22   1 
ATOM   4840  H  HD23   . LEU A 1 332 ? 38.919  41.836 -51.054  1.00 42.21  ? 312 LEU A HD23   1 
ATOM   4841  N  N      . LYS A 1 333 ? 39.555  38.105 -48.462  1.00 32.05  ? 313 LYS A N      1 
ATOM   4842  C  CA     . LYS A 1 333 ? 38.463  37.450 -47.760  1.00 35.60  ? 313 LYS A CA     1 
ATOM   4843  C  C      . LYS A 1 333 ? 38.984  36.614 -46.596  1.00 32.99  ? 313 LYS A C      1 
ATOM   4844  O  O      . LYS A 1 333 ? 38.264  36.397 -45.612  1.00 31.60  ? 313 LYS A O      1 
ATOM   4845  C  CB     . LYS A 1 333 ? 37.664  36.625 -48.767  1.00 39.60  ? 313 LYS A CB     1 
ATOM   4846  C  CG     . LYS A 1 333 ? 37.117  37.515 -49.894  1.00 45.77  ? 313 LYS A CG     1 
ATOM   4847  C  CD     . LYS A 1 333 ? 36.349  36.750 -50.949  1.00 52.05  ? 313 LYS A CD     1 
ATOM   4848  C  CE     . LYS A 1 333 ? 35.924  37.649 -52.109  1.00 56.55  ? 313 LYS A CE     1 
ATOM   4849  N  NZ     . LYS A 1 333 ? 35.387  38.968 -51.670  1.00 59.33  ? 313 LYS A NZ     1 
ATOM   4850  H  H      . LYS A 1 333 ? 39.654  37.855 -49.279  1.00 38.58  ? 313 LYS A H      1 
ATOM   4851  H  HA     . LYS A 1 333 ? 37.872  38.128 -47.396  1.00 42.84  ? 313 LYS A HA     1 
ATOM   4852  H  HB2    . LYS A 1 333 ? 38.241  35.952 -49.161  1.00 47.64  ? 313 LYS A HB2    1 
ATOM   4853  H  HB3    . LYS A 1 333 ? 36.914  36.206 -48.317  1.00 47.64  ? 313 LYS A HB3    1 
ATOM   4854  H  HG2    . LYS A 1 333 ? 36.518  38.174 -49.510  1.00 55.04  ? 313 LYS A HG2    1 
ATOM   4855  H  HG3    . LYS A 1 333 ? 37.860  37.960 -50.330  1.00 55.04  ? 313 LYS A HG3    1 
ATOM   4856  H  HD2    . LYS A 1 333 ? 36.912  36.044 -51.304  1.00 62.58  ? 313 LYS A HD2    1 
ATOM   4857  H  HD3    . LYS A 1 333 ? 35.550  36.372 -50.551  1.00 62.58  ? 313 LYS A HD3    1 
ATOM   4858  H  HE2    . LYS A 1 333 ? 36.693  37.814 -52.677  1.00 67.98  ? 313 LYS A HE2    1 
ATOM   4859  H  HE3    . LYS A 1 333 ? 35.230  37.199 -52.616  1.00 67.98  ? 313 LYS A HE3    1 
ATOM   4860  H  HZ1    . LYS A 1 333 ? 34.672  38.849 -51.154  1.00 71.32  ? 313 LYS A HZ1    1 
ATOM   4861  H  HZ2    . LYS A 1 333 ? 36.007  39.410 -51.209  1.00 71.32  ? 313 LYS A HZ2    1 
ATOM   4862  H  HZ3    . LYS A 1 333 ? 35.155  39.452 -52.380  1.00 71.32  ? 313 LYS A HZ3    1 
ATOM   4863  N  N      . ARG A 1 334 ? 40.235  36.155 -46.681  1.00 33.11  ? 314 ARG A N      1 
ATOM   4864  C  CA     A ARG A 1 334 ? 40.868  35.504 -45.539  0.55 34.61  ? 314 ARG A CA     1 
ATOM   4865  C  CA     B ARG A 1 334 ? 40.872  35.505 -45.539  0.45 34.63  ? 314 ARG A CA     1 
ATOM   4866  C  C      . ARG A 1 334 ? 41.005  36.478 -44.375  1.00 34.01  ? 314 ARG A C      1 
ATOM   4867  O  O      . ARG A 1 334 ? 40.560  36.197 -43.252  1.00 32.73  ? 314 ARG A O      1 
ATOM   4868  C  CB     A ARG A 1 334 ? 42.235  34.950 -45.946  0.55 37.73  ? 314 ARG A CB     1 
ATOM   4869  C  CB     B ARG A 1 334 ? 42.241  34.958 -45.956  0.45 37.74  ? 314 ARG A CB     1 
ATOM   4870  C  CG     A ARG A 1 334 ? 42.794  33.896 -45.000  0.55 38.59  ? 314 ARG A CG     1 
ATOM   4871  C  CG     B ARG A 1 334 ? 43.144  34.478 -44.819  0.45 39.01  ? 314 ARG A CG     1 
ATOM   4872  C  CD     A ARG A 1 334 ? 44.153  34.281 -44.424  0.55 40.91  ? 314 ARG A CD     1 
ATOM   4873  C  CD     B ARG A 1 334 ? 42.724  33.120 -44.286  0.45 39.41  ? 314 ARG A CD     1 
ATOM   4874  N  NE     A ARG A 1 334 ? 45.157  34.545 -45.455  0.55 40.83  ? 314 ARG A NE     1 
ATOM   4875  N  NE     B ARG A 1 334 ? 43.598  32.677 -43.202  0.45 40.33  ? 314 ARG A NE     1 
ATOM   4876  C  CZ     A ARG A 1 334 ? 45.610  35.751 -45.797  0.55 40.17  ? 314 ARG A CZ     1 
ATOM   4877  C  CZ     B ARG A 1 334 ? 43.436  32.999 -41.921  0.45 40.45  ? 314 ARG A CZ     1 
ATOM   4878  N  NH1    A ARG A 1 334 ? 45.165  36.844 -45.195  0.55 42.06  ? 314 ARG A NH1    1 
ATOM   4879  N  NH1    B ARG A 1 334 ? 42.428  33.772 -41.542  0.45 39.97  ? 314 ARG A NH1    1 
ATOM   4880  N  NH2    A ARG A 1 334 ? 46.526  35.863 -46.750  0.55 37.62  ? 314 ARG A NH2    1 
ATOM   4881  N  NH2    B ARG A 1 334 ? 44.290  32.545 -41.014  0.45 40.08  ? 314 ARG A NH2    1 
ATOM   4882  H  H      A ARG A 1 334 ? 40.732  36.209 -47.381  0.55 39.84  ? 314 ARG A H      1 
ATOM   4883  H  H      B ARG A 1 334 ? 40.730  36.208 -47.382  0.45 39.84  ? 314 ARG A H      1 
ATOM   4884  H  HA     A ARG A 1 334 ? 40.315  34.761 -45.248  0.55 41.65  ? 314 ARG A HA     1 
ATOM   4885  H  HA     B ARG A 1 334 ? 40.323  34.759 -45.249  0.45 41.67  ? 314 ARG A HA     1 
ATOM   4886  H  HB2    A ARG A 1 334 ? 42.158  34.546 -46.825  0.55 45.39  ? 314 ARG A HB2    1 
ATOM   4887  H  HB2    B ARG A 1 334 ? 42.101  34.206 -46.552  0.45 45.41  ? 314 ARG A HB2    1 
ATOM   4888  H  HB3    A ARG A 1 334 ? 42.870  35.683 -45.979  0.55 45.39  ? 314 ARG A HB3    1 
ATOM   4889  H  HB3    B ARG A 1 334 ? 42.718  35.659 -46.428  0.45 45.41  ? 314 ARG A HB3    1 
ATOM   4890  H  HG2    A ARG A 1 334 ? 42.178  33.777 -44.260  0.55 46.43  ? 314 ARG A HG2    1 
ATOM   4891  H  HG2    B ARG A 1 334 ? 44.055  34.406 -45.145  0.45 46.92  ? 314 ARG A HG2    1 
ATOM   4892  H  HG3    A ARG A 1 334 ? 42.898  33.061 -45.483  0.55 46.43  ? 314 ARG A HG3    1 
ATOM   4893  H  HG3    B ARG A 1 334 ? 43.101  35.115 -44.089  0.45 46.92  ? 314 ARG A HG3    1 
ATOM   4894  H  HD2    A ARG A 1 334 ? 44.053  35.085 -43.891  0.55 49.21  ? 314 ARG A HD2    1 
ATOM   4895  H  HD2    B ARG A 1 334 ? 41.819  33.177 -43.943  0.45 47.41  ? 314 ARG A HD2    1 
ATOM   4896  H  HD3    A ARG A 1 334 ? 44.478  33.554 -43.870  0.55 49.21  ? 314 ARG A HD3    1 
ATOM   4897  H  HD3    B ARG A 1 334 ? 42.772  32.467 -45.001  0.45 47.41  ? 314 ARG A HD3    1 
ATOM   4898  H  HE     A ARG A 1 334 ? 45.481  33.868 -45.875  0.55 49.12  ? 314 ARG A HE     1 
ATOM   4899  H  HE     B ARG A 1 334 ? 44.263  32.172 -43.407  0.45 48.51  ? 314 ARG A HE     1 
ATOM   4900  H  HH11   A ARG A 1 334 ? 44.572  36.783 -44.576  0.55 50.59  ? 314 ARG A HH11   1 
ATOM   4901  H  HH11   B ARG A 1 334 ? 41.871  34.070 -42.125  0.45 48.08  ? 314 ARG A HH11   1 
ATOM   4902  H  HH12   A ARG A 1 334 ? 45.467  37.616 -45.426  0.55 50.59  ? 314 ARG A HH12   1 
ATOM   4903  H  HH12   B ARG A 1 334 ? 42.330  33.975 -40.712  0.45 48.08  ? 314 ARG A HH12   1 
ATOM   4904  H  HH21   A ARG A 1 334 ? 46.822  35.159 -47.147  0.55 45.27  ? 314 ARG A HH21   1 
ATOM   4905  H  HH21   B ARG A 1 334 ? 44.945  32.043 -41.253  0.45 48.21  ? 314 ARG A HH21   1 
ATOM   4906  H  HH22   A ARG A 1 334 ? 46.821  36.639 -46.974  0.55 45.27  ? 314 ARG A HH22   1 
ATOM   4907  H  HH22   B ARG A 1 334 ? 44.186  32.752 -40.185  0.45 48.21  ? 314 ARG A HH22   1 
ATOM   4908  N  N      . ASP A 1 335 ? 41.613  37.640 -44.630  1.00 31.85  ? 315 ASP A N      1 
ATOM   4909  C  CA     A ASP A 1 335 ? 41.746  38.658 -43.594  0.56 32.93  ? 315 ASP A CA     1 
ATOM   4910  C  CA     B ASP A 1 335 ? 41.746  38.654 -43.589  0.44 32.90  ? 315 ASP A CA     1 
ATOM   4911  C  C      . ASP A 1 335 ? 40.388  39.005 -42.991  1.00 32.04  ? 315 ASP A C      1 
ATOM   4912  O  O      . ASP A 1 335 ? 40.222  39.028 -41.764  1.00 33.48  ? 315 ASP A O      1 
ATOM   4913  C  CB     A ASP A 1 335 ? 42.417  39.899 -44.182  0.56 33.99  ? 315 ASP A CB     1 
ATOM   4914  C  CB     B ASP A 1 335 ? 42.427  39.899 -44.160  0.44 34.02  ? 315 ASP A CB     1 
ATOM   4915  C  CG     A ASP A 1 335 ? 42.702  40.960 -43.141  0.56 35.65  ? 315 ASP A CG     1 
ATOM   4916  C  CG     B ASP A 1 335 ? 43.848  39.627 -44.613  0.44 34.61  ? 315 ASP A CG     1 
ATOM   4917  O  OD1    A ASP A 1 335 ? 42.603  40.658 -41.933  0.56 35.07  ? 315 ASP A OD1    1 
ATOM   4918  O  OD1    B ASP A 1 335 ? 44.514  38.768 -43.998  0.44 32.88  ? 315 ASP A OD1    1 
ATOM   4919  O  OD2    A ASP A 1 335 ? 43.036  42.096 -43.536  0.56 36.25  ? 315 ASP A OD2    1 
ATOM   4920  O  OD2    B ASP A 1 335 ? 44.299  40.270 -45.584  0.44 35.05  ? 315 ASP A OD2    1 
ATOM   4921  H  H      A ASP A 1 335 ? 41.954  37.859 -45.388  0.56 38.34  ? 315 ASP A H      1 
ATOM   4922  H  H      B ASP A 1 335 ? 41.953  37.861 -45.388  0.44 38.34  ? 315 ASP A H      1 
ATOM   4923  H  HA     A ASP A 1 335 ? 42.312  38.317 -42.884  0.56 39.64  ? 315 ASP A HA     1 
ATOM   4924  H  HA     B ASP A 1 335 ? 42.305  38.305 -42.878  0.44 39.60  ? 315 ASP A HA     1 
ATOM   4925  H  HB2    A ASP A 1 335 ? 43.261  39.641 -44.586  0.56 40.91  ? 315 ASP A HB2    1 
ATOM   4926  H  HB2    B ASP A 1 335 ? 41.922  40.213 -44.926  0.44 40.94  ? 315 ASP A HB2    1 
ATOM   4927  H  HB3    A ASP A 1 335 ? 41.833  40.287 -44.853  0.56 40.91  ? 315 ASP A HB3    1 
ATOM   4928  H  HB3    B ASP A 1 335 ? 42.455  40.586 -43.476  0.44 40.94  ? 315 ASP A HB3    1 
ATOM   4929  N  N      . PHE A 1 336 ? 39.399  39.281 -43.847  1.00 31.30  ? 316 PHE A N      1 
ATOM   4930  C  CA     . PHE A 1 336 ? 38.047  39.543 -43.363  1.00 34.53  ? 316 PHE A CA     1 
ATOM   4931  C  C      . PHE A 1 336 ? 37.585  38.442 -42.415  1.00 35.22  ? 316 PHE A C      1 
ATOM   4932  O  O      . PHE A 1 336 ? 37.131  38.715 -41.296  1.00 35.99  ? 316 PHE A O      1 
ATOM   4933  C  CB     . PHE A 1 336 ? 37.074  39.669 -44.542  1.00 36.75  ? 316 PHE A CB     1 
ATOM   4934  C  CG     . PHE A 1 336 ? 37.315  40.870 -45.422  1.00 42.74  ? 316 PHE A CG     1 
ATOM   4935  C  CD1    . PHE A 1 336 ? 38.065  41.949 -44.979  1.00 46.76  ? 316 PHE A CD1    1 
ATOM   4936  C  CD2    . PHE A 1 336 ? 36.778  40.917 -46.701  1.00 44.10  ? 316 PHE A CD2    1 
ATOM   4937  C  CE1    . PHE A 1 336 ? 38.275  43.046 -45.795  1.00 49.86  ? 316 PHE A CE1    1 
ATOM   4938  C  CE2    . PHE A 1 336 ? 36.987  42.012 -47.518  1.00 46.57  ? 316 PHE A CE2    1 
ATOM   4939  C  CZ     . PHE A 1 336 ? 37.736  43.077 -47.064  1.00 49.55  ? 316 PHE A CZ     1 
ATOM   4940  H  H      . PHE A 1 336 ? 39.487  39.322 -44.702  1.00 37.68  ? 316 PHE A H      1 
ATOM   4941  H  HA     . PHE A 1 336 ? 38.041  40.382 -42.877  1.00 41.55  ? 316 PHE A HA     1 
ATOM   4942  H  HB2    . PHE A 1 336 ? 37.154  38.877 -45.096  1.00 44.22  ? 316 PHE A HB2    1 
ATOM   4943  H  HB3    . PHE A 1 336 ? 36.171  39.735 -44.194  1.00 44.22  ? 316 PHE A HB3    1 
ATOM   4944  H  HD1    . PHE A 1 336 ? 38.431  41.934 -44.124  1.00 56.23  ? 316 PHE A HD1    1 
ATOM   4945  H  HD2    . PHE A 1 336 ? 36.271  40.202 -47.013  1.00 53.03  ? 316 PHE A HD2    1 
ATOM   4946  H  HE1    . PHE A 1 336 ? 38.781  43.763 -45.487  1.00 59.95  ? 316 PHE A HE1    1 
ATOM   4947  H  HE2    . PHE A 1 336 ? 36.622  42.030 -48.374  1.00 56.01  ? 316 PHE A HE2    1 
ATOM   4948  H  HZ     . PHE A 1 336 ? 37.878  43.814 -47.613  1.00 59.57  ? 316 PHE A HZ     1 
ATOM   4949  N  N      . LEU A 1 337 ? 37.693  37.185 -42.854  1.00 34.41  ? 317 LEU A N      1 
ATOM   4950  C  CA     . LEU A 1 337 ? 37.267  36.067 -42.018  1.00 33.49  ? 317 LEU A CA     1 
ATOM   4951  C  C      . LEU A 1 337 ? 37.913  36.141 -40.638  1.00 31.89  ? 317 LEU A C      1 
ATOM   4952  O  O      . LEU A 1 337 ? 37.234  36.008 -39.611  1.00 26.42  ? 317 LEU A O      1 
ATOM   4953  C  CB     . LEU A 1 337 ? 37.607  34.743 -42.707  1.00 33.13  ? 317 LEU A CB     1 
ATOM   4954  C  CG     . LEU A 1 337 ? 37.341  33.458 -41.916  1.00 34.43  ? 317 LEU A CG     1 
ATOM   4955  C  CD1    . LEU A 1 337 ? 35.873  33.347 -41.530  1.00 32.79  ? 317 LEU A CD1    1 
ATOM   4956  C  CD2    . LEU A 1 337 ? 37.771  32.241 -42.720  1.00 36.23  ? 317 LEU A CD2    1 
ATOM   4957  H  H      . LEU A 1 337 ? 38.005  36.958 -43.622  1.00 41.41  ? 317 LEU A H      1 
ATOM   4958  H  HA     . LEU A 1 337 ? 36.305  36.107 -41.902  1.00 40.30  ? 317 LEU A HA     1 
ATOM   4959  H  HB2    . LEU A 1 337 ? 37.087  34.687 -43.525  1.00 39.87  ? 317 LEU A HB2    1 
ATOM   4960  H  HB3    . LEU A 1 337 ? 38.551  34.752 -42.929  1.00 39.87  ? 317 LEU A HB3    1 
ATOM   4961  H  HG     . LEU A 1 337 ? 37.865  33.477 -41.100  1.00 41.43  ? 317 LEU A HG     1 
ATOM   4962  H  HD11   . LEU A 1 337 ? 35.739  32.526 -41.032  1.00 39.47  ? 317 LEU A HD11   1 
ATOM   4963  H  HD12   . LEU A 1 337 ? 35.633  34.110 -40.981  1.00 39.47  ? 317 LEU A HD12   1 
ATOM   4964  H  HD13   . LEU A 1 337 ? 35.335  33.337 -42.336  1.00 39.47  ? 317 LEU A HD13   1 
ATOM   4965  H  HD21   . LEU A 1 337 ? 37.594  31.441 -42.201  1.00 43.59  ? 317 LEU A HD21   1 
ATOM   4966  H  HD22   . LEU A 1 337 ? 37.266  32.217 -43.548  1.00 43.59  ? 317 LEU A HD22   1 
ATOM   4967  H  HD23   . LEU A 1 337 ? 38.719  32.309 -42.912  1.00 43.59  ? 317 LEU A HD23   1 
ATOM   4968  N  N      . ARG A 1 338 ? 39.228  36.369 -40.592  1.00 35.95  ? 318 ARG A N      1 
ATOM   4969  C  CA     A ARG A 1 338 ? 39.911  36.473 -39.306  0.55 38.85  ? 318 ARG A CA     1 
ATOM   4970  C  CA     B ARG A 1 338 ? 39.905  36.468 -39.303  0.45 38.86  ? 318 ARG A CA     1 
ATOM   4971  C  C      . ARG A 1 338 ? 39.303  37.584 -38.457  1.00 38.02  ? 318 ARG A C      1 
ATOM   4972  O  O      . ARG A 1 338 ? 38.992  37.385 -37.274  1.00 36.00  ? 318 ARG A O      1 
ATOM   4973  C  CB     A ARG A 1 338 ? 41.405  36.717 -39.527  0.55 40.98  ? 318 ARG A CB     1 
ATOM   4974  C  CB     B ARG A 1 338 ? 41.404  36.697 -39.502  0.45 41.00  ? 318 ARG A CB     1 
ATOM   4975  C  CG     A ARG A 1 338 ? 42.274  36.349 -38.333  0.55 43.38  ? 318 ARG A CG     1 
ATOM   4976  C  CG     B ARG A 1 338 ? 42.193  36.734 -38.194  0.45 43.65  ? 318 ARG A CG     1 
ATOM   4977  C  CD     A ARG A 1 338 ? 43.678  36.933 -38.433  0.55 45.83  ? 318 ARG A CD     1 
ATOM   4978  C  CD     B ARG A 1 338 ? 43.623  37.202 -38.401  0.45 45.92  ? 318 ARG A CD     1 
ATOM   4979  N  NE     A ARG A 1 338 ? 44.298  36.700 -39.739  0.55 45.73  ? 318 ARG A NE     1 
ATOM   4980  N  NE     B ARG A 1 338 ? 44.437  36.210 -39.098  0.45 45.57  ? 318 ARG A NE     1 
ATOM   4981  C  CZ     A ARG A 1 338 ? 44.507  37.631 -40.670  0.55 42.68  ? 318 ARG A CZ     1 
ATOM   4982  C  CZ     B ARG A 1 338 ? 45.048  35.186 -38.508  0.45 45.32  ? 318 ARG A CZ     1 
ATOM   4983  N  NH1    A ARG A 1 338 ? 44.159  38.894 -40.466  0.55 40.45  ? 318 ARG A NH1    1 
ATOM   4984  N  NH1    B ARG A 1 338 ? 44.939  35.001 -37.199  0.45 43.29  ? 318 ARG A NH1    1 
ATOM   4985  N  NH2    A ARG A 1 338 ? 45.081  37.293 -41.817  0.55 39.25  ? 318 ARG A NH2    1 
ATOM   4986  N  NH2    B ARG A 1 338 ? 45.769  34.341 -39.232  0.45 46.23  ? 318 ARG A NH2    1 
ATOM   4987  H  H      A ARG A 1 338 ? 39.737  36.466 -41.279  0.55 43.26  ? 318 ARG A H      1 
ATOM   4988  H  H      B ARG A 1 338 ? 39.738  36.468 -41.277  0.45 43.26  ? 318 ARG A H      1 
ATOM   4989  H  HA     A ARG A 1 338 ? 39.810  35.636 -38.825  0.55 46.73  ? 318 ARG A HA     1 
ATOM   4990  H  HA     B ARG A 1 338 ? 39.791  35.634 -38.822  0.45 46.75  ? 318 ARG A HA     1 
ATOM   4991  H  HB2    A ARG A 1 338 ? 41.701  36.185 -40.282  0.55 49.29  ? 318 ARG A HB2    1 
ATOM   4992  H  HB2    B ARG A 1 338 ? 41.761  35.978 -40.046  0.45 49.32  ? 318 ARG A HB2    1 
ATOM   4993  H  HB3    A ARG A 1 338 ? 41.543  37.658 -39.714  0.55 49.29  ? 318 ARG A HB3    1 
ATOM   4994  H  HB3    B ARG A 1 338 ? 41.534  37.547 -39.952  0.45 49.32  ? 318 ARG A HB3    1 
ATOM   4995  H  HG2    A ARG A 1 338 ? 41.863  36.692 -37.524  0.55 52.17  ? 318 ARG A HG2    1 
ATOM   4996  H  HG2    B ARG A 1 338 ? 41.760  37.347 -37.579  0.45 52.50  ? 318 ARG A HG2    1 
ATOM   4997  H  HG3    A ARG A 1 338 ? 42.352  35.383 -38.283  0.55 52.17  ? 318 ARG A HG3    1 
ATOM   4998  H  HG3    B ARG A 1 338 ? 42.219  35.842 -37.814  0.45 52.50  ? 318 ARG A HG3    1 
ATOM   4999  H  HD2    A ARG A 1 338 ? 43.633  37.891 -38.290  0.55 55.11  ? 318 ARG A HD2    1 
ATOM   5000  H  HD2    B ARG A 1 338 ? 43.617  38.014 -38.931  0.45 55.22  ? 318 ARG A HD2    1 
ATOM   5001  H  HD3    A ARG A 1 338 ? 44.240  36.523 -37.758  0.55 55.11  ? 318 ARG A HD3    1 
ATOM   5002  H  HD3    B ARG A 1 338 ? 44.029  37.371 -37.537  0.45 55.22  ? 318 ARG A HD3    1 
ATOM   5003  H  HE     A ARG A 1 338 ? 44.546  35.897 -39.921  0.55 55.00  ? 318 ARG A HE     1 
ATOM   5004  H  HE     B ARG A 1 338 ? 44.528  36.294 -39.949  0.45 54.80  ? 318 ARG A HE     1 
ATOM   5005  H  HH11   A ARG A 1 338 ? 43.787  39.123 -39.725  0.55 48.65  ? 318 ARG A HH11   1 
ATOM   5006  H  HH11   B ARG A 1 338 ? 44.473  35.546 -36.725  0.45 52.07  ? 318 ARG A HH11   1 
ATOM   5007  H  HH12   A ARG A 1 338 ? 44.302  39.483 -41.076  0.55 48.65  ? 318 ARG A HH12   1 
ATOM   5008  H  HH12   B ARG A 1 338 ? 45.335  34.336 -36.825  0.45 52.07  ? 318 ARG A HH12   1 
ATOM   5009  H  HH21   A ARG A 1 338 ? 45.312  36.477 -41.959  0.55 47.22  ? 318 ARG A HH21   1 
ATOM   5010  H  HH21   B ARG A 1 338 ? 45.842  34.456 -40.081  0.45 55.60  ? 318 ARG A HH21   1 
ATOM   5011  H  HH22   A ARG A 1 338 ? 45.220  37.890 -42.421  0.55 47.22  ? 318 ARG A HH22   1 
ATOM   5012  H  HH22   B ARG A 1 338 ? 46.163  33.678 -38.853  0.45 55.60  ? 318 ARG A HH22   1 
ATOM   5013  N  N      . ARG A 1 339 ? 39.122  38.769 -39.049  1.00 38.60  ? 319 ARG A N      1 
ATOM   5014  C  CA     . ARG A 1 339 ? 38.577  39.895 -38.296  1.00 43.73  ? 319 ARG A CA     1 
ATOM   5015  C  C      . ARG A 1 339 ? 37.221  39.554 -37.692  1.00 38.27  ? 319 ARG A C      1 
ATOM   5016  O  O      . ARG A 1 339 ? 36.969  39.822 -36.510  1.00 30.05  ? 319 ARG A O      1 
ATOM   5017  C  CB     . ARG A 1 339 ? 38.455  41.127 -39.195  1.00 60.87  ? 319 ARG A CB     1 
ATOM   5018  C  CG     . ARG A 1 339 ? 39.773  41.696 -39.682  1.00 78.21  ? 319 ARG A CG     1 
ATOM   5019  C  CD     . ARG A 1 339 ? 39.558  43.056 -40.330  1.00 93.44  ? 319 ARG A CD     1 
ATOM   5020  N  NE     . ARG A 1 339 ? 40.798  43.629 -40.849  1.00 107.02 ? 319 ARG A NE     1 
ATOM   5021  C  CZ     . ARG A 1 339 ? 41.181  43.602 -42.123  1.00 116.89 ? 319 ARG A CZ     1 
ATOM   5022  N  NH1    . ARG A 1 339 ? 40.430  43.024 -43.051  1.00 119.33 ? 319 ARG A NH1    1 
ATOM   5023  N  NH2    . ARG A 1 339 ? 42.333  44.159 -42.473  1.00 120.78 ? 319 ARG A NH2    1 
ATOM   5024  H  H      . ARG A 1 339 ? 39.304  38.942 -39.872  1.00 46.44  ? 319 ARG A H      1 
ATOM   5025  H  HA     . ARG A 1 339 ? 39.182  40.112 -37.570  1.00 52.59  ? 319 ARG A HA     1 
ATOM   5026  H  HB2    . ARG A 1 339 ? 37.932  40.888 -39.976  1.00 73.17  ? 319 ARG A HB2    1 
ATOM   5027  H  HB3    . ARG A 1 339 ? 38.000  41.826 -38.700  1.00 73.17  ? 319 ARG A HB3    1 
ATOM   5028  H  HG2    . ARG A 1 339 ? 40.376  41.805 -38.931  1.00 93.97  ? 319 ARG A HG2    1 
ATOM   5029  H  HG3    . ARG A 1 339 ? 40.158  41.099 -40.343  1.00 93.97  ? 319 ARG A HG3    1 
ATOM   5030  H  HD2    . ARG A 1 339 ? 38.938  42.961 -41.069  1.00 112.25 ? 319 ARG A HD2    1 
ATOM   5031  H  HD3    . ARG A 1 339 ? 39.197  43.668 -39.669  1.00 112.25 ? 319 ARG A HD3    1 
ATOM   5032  H  HE     . ARG A 1 339 ? 41.322  44.014 -40.286  1.00 128.54 ? 319 ARG A HE     1 
ATOM   5033  H  HH11   . ARG A 1 339 ? 39.682  42.660 -42.833  1.00 143.31 ? 319 ARG A HH11   1 
ATOM   5034  H  HH12   . ARG A 1 339 ? 40.691  43.013 -43.870  1.00 143.31 ? 319 ARG A HH12   1 
ATOM   5035  H  HH21   . ARG A 1 339 ? 42.827  44.536 -41.879  1.00 145.05 ? 319 ARG A HH21   1 
ATOM   5036  H  HH22   . ARG A 1 339 ? 42.586  44.144 -43.295  1.00 145.05 ? 319 ARG A HH22   1 
ATOM   5037  N  N      . HIS A 1 340 ? 36.332  38.957 -38.487  1.00 44.27  ? 320 HIS A N      1 
ATOM   5038  C  CA     . HIS A 1 340 ? 35.002  38.643 -37.979  1.00 44.48  ? 320 HIS A CA     1 
ATOM   5039  C  C      . HIS A 1 340 ? 35.064  37.588 -36.881  1.00 43.37  ? 320 HIS A C      1 
ATOM   5040  O  O      . HIS A 1 340 ? 34.344  37.686 -35.878  1.00 43.09  ? 320 HIS A O      1 
ATOM   5041  C  CB     . HIS A 1 340 ? 34.098  38.200 -39.127  1.00 42.62  ? 320 HIS A CB     1 
ATOM   5042  C  CG     . HIS A 1 340 ? 33.521  39.346 -39.898  1.00 42.79  ? 320 HIS A CG     1 
ATOM   5043  N  ND1    . HIS A 1 340 ? 32.502  40.136 -39.409  1.00 42.72  ? 320 HIS A ND1    1 
ATOM   5044  C  CD2    . HIS A 1 340 ? 33.836  39.849 -41.116  1.00 42.20  ? 320 HIS A CD2    1 
ATOM   5045  C  CE1    . HIS A 1 340 ? 32.208  41.070 -40.297  1.00 42.60  ? 320 HIS A CE1    1 
ATOM   5046  N  NE2    . HIS A 1 340 ? 33.002  40.917 -41.341  1.00 42.43  ? 320 HIS A NE2    1 
ATOM   5047  H  H      . HIS A 1 340 ? 36.471  38.729 -39.305  1.00 53.24  ? 320 HIS A H      1 
ATOM   5048  H  HA     . HIS A 1 340 ? 34.618  39.447 -37.594  1.00 53.50  ? 320 HIS A HA     1 
ATOM   5049  H  HB2    . HIS A 1 340 ? 34.614  37.656 -39.742  1.00 51.27  ? 320 HIS A HB2    1 
ATOM   5050  H  HB3    . HIS A 1 340 ? 33.362  37.683 -38.765  1.00 51.27  ? 320 HIS A HB3    1 
ATOM   5051  H  HD2    . HIS A 1 340 ? 34.490  39.528 -41.693  1.00 50.76  ? 320 HIS A HD2    1 
ATOM   5052  H  HE1    . HIS A 1 340 ? 31.553  41.723 -40.202  1.00 51.24  ? 320 HIS A HE1    1 
ATOM   5053  H  HE2    . HIS A 1 340 ? 32.998  41.407 -42.048  1.00 51.03  ? 320 HIS A HE2    1 
ATOM   5054  N  N      . LEU A 1 341 ? 35.918  36.574 -37.044  1.00 40.51  ? 321 LEU A N      1 
ATOM   5055  C  CA     . LEU A 1 341 ? 36.110  35.609 -35.966  1.00 40.42  ? 321 LEU A CA     1 
ATOM   5056  C  C      . LEU A 1 341 ? 36.540  36.301 -34.680  1.00 46.29  ? 321 LEU A C      1 
ATOM   5057  O  O      . LEU A 1 341 ? 36.089  35.934 -33.588  1.00 45.02  ? 321 LEU A O      1 
ATOM   5058  C  CB     . LEU A 1 341 ? 37.146  34.557 -36.366  1.00 37.67  ? 321 LEU A CB     1 
ATOM   5059  C  CG     . LEU A 1 341 ? 36.767  33.543 -37.446  1.00 36.64  ? 321 LEU A CG     1 
ATOM   5060  C  CD1    . LEU A 1 341 ? 37.959  32.650 -37.760  1.00 36.45  ? 321 LEU A CD1    1 
ATOM   5061  C  CD2    . LEU A 1 341 ? 35.570  32.701 -37.026  1.00 35.64  ? 321 LEU A CD2    1 
ATOM   5062  H  H      . LEU A 1 341 ? 36.385  36.427 -37.751  1.00 48.73  ? 321 LEU A H      1 
ATOM   5063  H  HA     . LEU A 1 341 ? 35.270  35.154 -35.796  1.00 48.63  ? 321 LEU A HA     1 
ATOM   5064  H  HB2    . LEU A 1 341 ? 37.935  35.024 -36.682  1.00 45.32  ? 321 LEU A HB2    1 
ATOM   5065  H  HB3    . LEU A 1 341 ? 37.376  34.050 -35.571  1.00 45.32  ? 321 LEU A HB3    1 
ATOM   5066  H  HG     . LEU A 1 341 ? 36.528  34.019 -38.256  1.00 44.09  ? 321 LEU A HG     1 
ATOM   5067  H  HD11   . LEU A 1 341 ? 37.703  32.013 -38.445  1.00 43.86  ? 321 LEU A HD11   1 
ATOM   5068  H  HD12   . LEU A 1 341 ? 38.691  33.202 -38.077  1.00 43.86  ? 321 LEU A HD12   1 
ATOM   5069  H  HD13   . LEU A 1 341 ? 38.223  32.181 -36.953  1.00 43.86  ? 321 LEU A HD13   1 
ATOM   5070  H  HD21   . LEU A 1 341 ? 35.363  32.072 -37.735  1.00 42.89  ? 321 LEU A HD21   1 
ATOM   5071  H  HD22   . LEU A 1 341 ? 35.792  32.221 -36.213  1.00 42.89  ? 321 LEU A HD22   1 
ATOM   5072  H  HD23   . LEU A 1 341 ? 34.813  33.285 -36.870  1.00 42.89  ? 321 LEU A HD23   1 
ATOM   5073  N  N      . GLU A 1 342 ? 37.408  37.311 -34.786  1.00 52.47  ? 322 GLU A N      1 
ATOM   5074  C  CA     . GLU A 1 342 ? 37.859  38.018 -33.590  1.00 55.87  ? 322 GLU A CA     1 
ATOM   5075  C  C      . GLU A 1 342 ? 36.728  38.823 -32.959  1.00 52.09  ? 322 GLU A C      1 
ATOM   5076  O  O      . GLU A 1 342 ? 36.533  38.788 -31.738  1.00 56.68  ? 322 GLU A O      1 
ATOM   5077  C  CB     . GLU A 1 342 ? 39.033  38.934 -33.938  1.00 60.74  ? 322 GLU A CB     1 
ATOM   5078  C  CG     . GLU A 1 342 ? 40.334  38.206 -34.229  1.00 64.60  ? 322 GLU A CG     1 
ATOM   5079  C  CD     . GLU A 1 342 ? 41.397  39.126 -34.799  1.00 67.15  ? 322 GLU A CD     1 
ATOM   5080  O  OE1    . GLU A 1 342 ? 41.060  40.272 -35.166  1.00 67.31  ? 322 GLU A OE1    1 
ATOM   5081  O  OE2    . GLU A 1 342 ? 42.570  38.706 -34.877  1.00 67.78  ? 322 GLU A OE2    1 
ATOM   5082  H  H      . GLU A 1 342 ? 37.742  37.600 -35.523  1.00 63.08  ? 322 GLU A H      1 
ATOM   5083  H  HA     . GLU A 1 342 ? 38.167  37.370 -32.937  1.00 67.16  ? 322 GLU A HA     1 
ATOM   5084  H  HB2    . GLU A 1 342 ? 38.801  39.449 -34.726  1.00 73.01  ? 322 GLU A HB2    1 
ATOM   5085  H  HB3    . GLU A 1 342 ? 39.191  39.532 -33.191  1.00 73.01  ? 322 GLU A HB3    1 
ATOM   5086  H  HG2    . GLU A 1 342 ? 40.675  37.825 -33.405  1.00 77.63  ? 322 GLU A HG2    1 
ATOM   5087  H  HG3    . GLU A 1 342 ? 40.166  37.503 -34.876  1.00 77.63  ? 322 GLU A HG3    1 
ATOM   5088  N  N      . LYS A 1 343 ? 35.974  39.560 -33.775  1.00 46.33  ? 323 LYS A N      1 
ATOM   5089  C  CA     . LYS A 1 343 ? 34.899  40.393 -33.244  1.00 42.72  ? 323 LYS A CA     1 
ATOM   5090  C  C      . LYS A 1 343 ? 33.761  39.566 -32.649  1.00 41.84  ? 323 LYS A C      1 
ATOM   5091  O  O      . LYS A 1 343 ? 33.068  40.036 -31.739  1.00 39.04  ? 323 LYS A O      1 
ATOM   5092  C  CB     . LYS A 1 343 ? 34.373  41.318 -34.343  1.00 42.13  ? 323 LYS A CB     1 
ATOM   5093  C  CG     . LYS A 1 343 ? 35.094  42.662 -34.398  1.00 47.40  ? 323 LYS A CG     1 
ATOM   5094  C  CD     . LYS A 1 343 ? 34.654  43.523 -35.579  1.00 52.57  ? 323 LYS A CD     1 
ATOM   5095  C  CE     . LYS A 1 343 ? 33.465  44.416 -35.243  1.00 55.47  ? 323 LYS A CE     1 
ATOM   5096  N  NZ     . LYS A 1 343 ? 32.190  43.665 -35.066  1.00 54.24  ? 323 LYS A NZ     1 
ATOM   5097  H  H      . LYS A 1 343 ? 36.063  39.594 -34.629  1.00 55.72  ? 323 LYS A H      1 
ATOM   5098  H  HA     . LYS A 1 343 ? 35.258  40.950 -32.536  1.00 51.39  ? 323 LYS A HA     1 
ATOM   5099  H  HB2    . LYS A 1 343 ? 34.488  40.882 -35.202  1.00 50.67  ? 323 LYS A HB2    1 
ATOM   5100  H  HB3    . LYS A 1 343 ? 33.432  41.491 -34.184  1.00 50.67  ? 323 LYS A HB3    1 
ATOM   5101  H  HG2    . LYS A 1 343 ? 34.908  43.153 -33.583  1.00 57.00  ? 323 LYS A HG2    1 
ATOM   5102  H  HG3    . LYS A 1 343 ? 36.048  42.505 -34.480  1.00 57.00  ? 323 LYS A HG3    1 
ATOM   5103  H  HD2    . LYS A 1 343 ? 35.392  44.094 -35.846  1.00 63.20  ? 323 LYS A HD2    1 
ATOM   5104  H  HD3    . LYS A 1 343 ? 34.398  42.945 -36.314  1.00 63.20  ? 323 LYS A HD3    1 
ATOM   5105  H  HE2    . LYS A 1 343 ? 33.650  44.887 -34.415  1.00 66.68  ? 323 LYS A HE2    1 
ATOM   5106  H  HE3    . LYS A 1 343 ? 33.338  45.053 -35.963  1.00 66.68  ? 323 LYS A HE3    1 
ATOM   5107  H  HZ1    . LYS A 1 343 ? 31.988  43.229 -35.815  1.00 65.20  ? 323 LYS A HZ1    1 
ATOM   5108  H  HZ2    . LYS A 1 343 ? 32.273  43.078 -34.403  1.00 65.20  ? 323 LYS A HZ2    1 
ATOM   5109  H  HZ3    . LYS A 1 343 ? 31.530  44.229 -34.872  1.00 65.20  ? 323 LYS A HZ3    1 
ATOM   5110  N  N      . ALA A 1 344 ? 33.553  38.340 -33.140  1.00 42.74  ? 324 ALA A N      1 
ATOM   5111  C  CA     . ALA A 1 344 ? 32.376  37.569 -32.743  1.00 39.90  ? 324 ALA A CA     1 
ATOM   5112  C  C      . ALA A 1 344 ? 32.371  37.236 -31.252  1.00 39.11  ? 324 ALA A C      1 
ATOM   5113  O  O      . ALA A 1 344 ? 31.308  37.212 -30.620  1.00 32.50  ? 324 ALA A O      1 
ATOM   5114  C  CB     . ALA A 1 344 ? 32.297  36.284 -33.569  1.00 38.06  ? 324 ALA A CB     1 
ATOM   5115  H  H      . ALA A 1 344 ? 34.072  37.938 -33.695  1.00 51.40  ? 324 ALA A H      1 
ATOM   5116  H  HA     . ALA A 1 344 ? 31.582  38.093 -32.932  1.00 48.00  ? 324 ALA A HA     1 
ATOM   5117  H  HB1    . ALA A 1 344 ? 31.512  35.782 -33.297  1.00 45.78  ? 324 ALA A HB1    1 
ATOM   5118  H  HB2    . ALA A 1 344 ? 32.232  36.516 -34.508  1.00 45.78  ? 324 ALA A HB2    1 
ATOM   5119  H  HB3    . ALA A 1 344 ? 33.097  35.759 -33.412  1.00 45.78  ? 324 ALA A HB3    1 
ATOM   5120  N  N      . ARG A 1 345 ? 33.542  36.977 -30.665  1.00 43.87  ? 325 ARG A N      1 
ATOM   5121  C  CA     . ARG A 1 345 ? 33.569  36.511 -29.281  1.00 49.08  ? 325 ARG A CA     1 
ATOM   5122  C  C      . ARG A 1 345 ? 33.118  37.576 -28.287  1.00 53.35  ? 325 ARG A C      1 
ATOM   5123  O  O      . ARG A 1 345 ? 32.741  37.228 -27.163  1.00 53.03  ? 325 ARG A O      1 
ATOM   5124  C  CB     . ARG A 1 345 ? 34.958  35.980 -28.904  1.00 54.27  ? 325 ARG A CB     1 
ATOM   5125  C  CG     . ARG A 1 345 ? 36.144  36.863 -29.237  1.00 60.36  ? 325 ARG A CG     1 
ATOM   5126  C  CD     . ARG A 1 345 ? 37.430  36.159 -28.820  1.00 65.37  ? 325 ARG A CD     1 
ATOM   5127  N  NE     . ARG A 1 345 ? 38.634  36.867 -29.244  1.00 70.52  ? 325 ARG A NE     1 
ATOM   5128  C  CZ     . ARG A 1 345 ? 39.866  36.375 -29.139  1.00 72.01  ? 325 ARG A CZ     1 
ATOM   5129  N  NH1    . ARG A 1 345 ? 40.063  35.166 -28.625  1.00 70.53  ? 325 ARG A NH1    1 
ATOM   5130  N  NH2    . ARG A 1 345 ? 40.903  37.089 -29.551  1.00 73.62  ? 325 ARG A NH2    1 
ATOM   5131  H  H      . ARG A 1 345 ? 34.313  37.062 -31.035  1.00 52.76  ? 325 ARG A H      1 
ATOM   5132  H  HA     . ARG A 1 345 ? 32.949  35.769 -29.202  1.00 59.02  ? 325 ARG A HA     1 
ATOM   5133  H  HB2    . ARG A 1 345 ? 34.974  35.831 -27.946  1.00 65.24  ? 325 ARG A HB2    1 
ATOM   5134  H  HB3    . ARG A 1 345 ? 35.093  35.136 -29.361  1.00 65.24  ? 325 ARG A HB3    1 
ATOM   5135  H  HG2    . ARG A 1 345 ? 36.174  37.022 -30.194  1.00 72.55  ? 325 ARG A HG2    1 
ATOM   5136  H  HG3    . ARG A 1 345 ? 36.076  37.699 -28.752  1.00 72.55  ? 325 ARG A HG3    1 
ATOM   5137  H  HD2    . ARG A 1 345 ? 37.451  36.088 -27.852  1.00 78.56  ? 325 ARG A HD2    1 
ATOM   5138  H  HD3    . ARG A 1 345 ? 37.449  35.274 -29.217  1.00 78.56  ? 325 ARG A HD3    1 
ATOM   5139  H  HE     . ARG A 1 345 ? 38.545  37.667 -29.547  1.00 84.74  ? 325 ARG A HE     1 
ATOM   5140  H  HH11   . ARG A 1 345 ? 39.393  34.699 -28.357  1.00 84.76  ? 325 ARG A HH11   1 
ATOM   5141  H  HH12   . ARG A 1 345 ? 40.861  34.852 -28.560  1.00 84.76  ? 325 ARG A HH12   1 
ATOM   5142  H  HH21   . ARG A 1 345 ? 40.781  37.872 -29.885  1.00 88.46  ? 325 ARG A HH21   1 
ATOM   5143  H  HH22   . ARG A 1 345 ? 41.699  36.770 -29.484  1.00 88.46  ? 325 ARG A HH22   1 
ATOM   5144  N  N      . ASP A 1 346 ? 33.152  38.856 -28.658  1.00 59.96  ? 326 ASP A N      1 
ATOM   5145  C  CA     . ASP A 1 346 ? 32.749  39.908 -27.732  1.00 64.26  ? 326 ASP A CA     1 
ATOM   5146  C  C      . ASP A 1 346 ? 31.285  40.301 -27.886  1.00 61.33  ? 326 ASP A C      1 
ATOM   5147  O  O      . ASP A 1 346 ? 30.683  40.794 -26.925  1.00 65.29  ? 326 ASP A O      1 
ATOM   5148  C  CB     . ASP A 1 346 ? 33.626  41.149 -27.925  1.00 68.67  ? 326 ASP A CB     1 
ATOM   5149  C  CG     . ASP A 1 346 ? 35.079  40.896 -27.568  1.00 71.91  ? 326 ASP A CG     1 
ATOM   5150  O  OD1    . ASP A 1 346 ? 35.364  40.640 -26.379  1.00 73.45  ? 326 ASP A OD1    1 
ATOM   5151  O  OD2    . ASP A 1 346 ? 35.935  40.953 -28.476  1.00 71.92  ? 326 ASP A OD2    1 
ATOM   5152  H  H      . ASP A 1 346 ? 33.401  39.137 -29.431  1.00 72.07  ? 326 ASP A H      1 
ATOM   5153  H  HA     . ASP A 1 346 ? 32.877  39.592 -26.824  1.00 77.24  ? 326 ASP A HA     1 
ATOM   5154  H  HB2    . ASP A 1 346 ? 33.589  41.421 -28.855  1.00 82.52  ? 326 ASP A HB2    1 
ATOM   5155  H  HB3    . ASP A 1 346 ? 33.297  41.862 -27.356  1.00 82.52  ? 326 ASP A HB3    1 
ATOM   5156  N  N      . THR A 1 347 ? 30.699  40.095 -29.064  1.00 53.10  ? 327 THR A N      1 
ATOM   5157  C  CA     . THR A 1 347 ? 29.298  40.412 -29.312  1.00 46.61  ? 327 THR A CA     1 
ATOM   5158  C  C      . THR A 1 347 ? 28.391  39.190 -29.261  1.00 43.17  ? 327 THR A C      1 
ATOM   5159  O  O      . THR A 1 347 ? 27.184  39.324 -29.487  1.00 36.06  ? 327 THR A O      1 
ATOM   5160  C  CB     . THR A 1 347 ? 29.141  41.101 -30.672  1.00 46.88  ? 327 THR A CB     1 
ATOM   5161  O  OG1    . THR A 1 347 ? 29.517  40.196 -31.719  1.00 45.90  ? 327 THR A OG1    1 
ATOM   5162  C  CG2    . THR A 1 347 ? 30.004  42.352 -30.745  1.00 48.08  ? 327 THR A CG2    1 
ATOM   5163  H  H      . THR A 1 347 ? 31.103  39.766 -29.748  1.00 63.84  ? 327 THR A H      1 
ATOM   5164  H  HA     . THR A 1 347 ? 28.995  41.032 -28.630  1.00 56.05  ? 327 THR A HA     1 
ATOM   5165  H  HB     . THR A 1 347 ? 28.215  41.363 -30.793  1.00 56.38  ? 327 THR A HB     1 
ATOM   5166  H  HG1    . THR A 1 347 ? 29.432  40.570 -32.467  1.00 55.20  ? 327 THR A HG1    1 
ATOM   5167  H  HG21   . THR A 1 347 ? 29.896  42.779 -31.609  1.00 57.81  ? 327 THR A HG21   1 
ATOM   5168  H  HG22   . THR A 1 347 ? 29.742  42.976 -30.050  1.00 57.81  ? 327 THR A HG22   1 
ATOM   5169  H  HG23   . THR A 1 347 ? 30.937  42.118 -30.623  1.00 57.81  ? 327 THR A HG23   1 
ATOM   5170  N  N      . ALA A 1 348 ? 28.935  38.006 -28.974  1.00 51.37  ? 328 ALA A N      1 
ATOM   5171  C  CA     . ALA A 1 348 ? 28.160  36.766 -28.941  1.00 53.10  ? 328 ALA A CA     1 
ATOM   5172  C  C      . ALA A 1 348 ? 27.426  36.545 -30.266  1.00 50.05  ? 328 ALA A C      1 
ATOM   5173  O  O      . ALA A 1 348 ? 26.202  36.417 -30.322  1.00 56.15  ? 328 ALA A O      1 
ATOM   5174  C  CB     . ALA A 1 348 ? 27.181  36.768 -27.763  1.00 51.92  ? 328 ALA A CB     1 
ATOM   5175  H  H      . ALA A 1 348 ? 29.768  37.895 -28.791  1.00 61.77  ? 328 ALA A H      1 
ATOM   5176  H  HA     . ALA A 1 348 ? 28.771  36.023 -28.816  1.00 63.83  ? 328 ALA A HA     1 
ATOM   5177  H  HB1    . ALA A 1 348 ? 26.683  35.936 -27.766  1.00 62.42  ? 328 ALA A HB1    1 
ATOM   5178  H  HB2    . ALA A 1 348 ? 27.683  36.850 -26.937  1.00 62.42  ? 328 ALA A HB2    1 
ATOM   5179  H  HB3    . ALA A 1 348 ? 26.574  37.518 -27.859  1.00 62.42  ? 328 ALA A HB3    1 
ATOM   5180  N  N      . LEU A 1 349 ? 28.211  36.504 -31.344  1.00 38.83  ? 329 LEU A N      1 
ATOM   5181  C  CA     . LEU A 1 349 ? 27.686  36.279 -32.691  1.00 33.95  ? 329 LEU A CA     1 
ATOM   5182  C  C      . LEU A 1 349 ? 26.645  37.332 -33.063  1.00 39.66  ? 329 LEU A C      1 
ATOM   5183  O  O      . LEU A 1 349 ? 25.623  37.031 -33.685  1.00 34.43  ? 329 LEU A O      1 
ATOM   5184  C  CB     . LEU A 1 349 ? 27.108  34.870 -32.830  1.00 32.35  ? 329 LEU A CB     1 
ATOM   5185  C  CG     . LEU A 1 349 ? 28.102  33.723 -32.630  1.00 34.94  ? 329 LEU A CG     1 
ATOM   5186  C  CD1    . LEU A 1 349 ? 27.379  32.386 -32.623  1.00 36.76  ? 329 LEU A CD1    1 
ATOM   5187  C  CD2    . LEU A 1 349 ? 29.183  33.740 -33.702  1.00 34.78  ? 329 LEU A CD2    1 
ATOM   5188  H  H      . LEU A 1 349 ? 29.065  36.606 -31.319  1.00 46.72  ? 329 LEU A H      1 
ATOM   5189  H  HA     . LEU A 1 349 ? 28.418  36.357 -33.323  1.00 40.85  ? 329 LEU A HA     1 
ATOM   5190  H  HB2    . LEU A 1 349 ? 26.404  34.762 -32.171  1.00 38.94  ? 329 LEU A HB2    1 
ATOM   5191  H  HB3    . LEU A 1 349 ? 26.734  34.779 -33.720  1.00 38.94  ? 329 LEU A HB3    1 
ATOM   5192  H  HG     . LEU A 1 349 ? 28.535  33.831 -31.769  1.00 42.04  ? 329 LEU A HG     1 
ATOM   5193  H  HD11   . LEU A 1 349 ? 28.029  31.677 -32.496  1.00 44.23  ? 329 LEU A HD11   1 
ATOM   5194  H  HD12   . LEU A 1 349 ? 26.735  32.379 -31.898  1.00 44.23  ? 329 LEU A HD12   1 
ATOM   5195  H  HD13   . LEU A 1 349 ? 26.924  32.269 -33.472  1.00 44.23  ? 329 LEU A HD13   1 
ATOM   5196  H  HD21   . LEU A 1 349 ? 29.794  33.003 -33.546  1.00 41.85  ? 329 LEU A HD21   1 
ATOM   5197  H  HD22   . LEU A 1 349 ? 28.765  33.646 -34.572  1.00 41.85  ? 329 LEU A HD22   1 
ATOM   5198  H  HD23   . LEU A 1 349 ? 29.661  34.583 -33.654  1.00 41.85  ? 329 LEU A HD23   1 
ATOM   5199  N  N      . LEU A 1 350 ? 26.914  38.582 -32.685  1.00 50.49  ? 330 LEU A N      1 
ATOM   5200  C  CA     . LEU A 1 350 ? 26.063  39.717 -33.039  1.00 55.01  ? 330 LEU A CA     1 
ATOM   5201  C  C      . LEU A 1 350 ? 24.676  39.579 -32.410  1.00 59.34  ? 330 LEU A C      1 
ATOM   5202  O  O      . LEU A 1 350 ? 23.646  39.752 -33.066  1.00 57.96  ? 330 LEU A O      1 
ATOM   5203  C  CB     . LEU A 1 350 ? 25.959  39.860 -34.561  1.00 53.41  ? 330 LEU A CB     1 
ATOM   5204  C  CG     . LEU A 1 350 ? 27.179  40.422 -35.296  1.00 54.25  ? 330 LEU A CG     1 
ATOM   5205  C  CD1    . LEU A 1 350 ? 26.907  40.445 -36.793  1.00 53.03  ? 330 LEU A CD1    1 
ATOM   5206  C  CD2    . LEU A 1 350 ? 27.575  41.805 -34.798  1.00 56.52  ? 330 LEU A CD2    1 
ATOM   5207  H  H      . LEU A 1 350 ? 27.598  38.801 -32.212  1.00 60.71  ? 330 LEU A H      1 
ATOM   5208  H  HA     . LEU A 1 350 ? 26.465  40.529 -32.693  1.00 66.13  ? 330 LEU A HA     1 
ATOM   5209  H  HB2    . LEU A 1 350 ? 25.781  38.983 -34.934  1.00 64.21  ? 330 LEU A HB2    1 
ATOM   5210  H  HB3    . LEU A 1 350 ? 25.213  40.448 -34.757  1.00 64.21  ? 330 LEU A HB3    1 
ATOM   5211  H  HG     . LEU A 1 350 ? 27.931  39.829 -35.143  1.00 65.22  ? 330 LEU A HG     1 
ATOM   5212  H  HD11   . LEU A 1 350 ? 27.685  40.802 -37.249  1.00 63.75  ? 330 LEU A HD11   1 
ATOM   5213  H  HD12   . LEU A 1 350 ? 26.732  39.540 -37.096  1.00 63.75  ? 330 LEU A HD12   1 
ATOM   5214  H  HD13   . LEU A 1 350 ? 26.135  41.007 -36.965  1.00 63.75  ? 330 LEU A HD13   1 
ATOM   5215  H  HD21   . LEU A 1 350 ? 28.350  42.110 -35.296  1.00 67.95  ? 330 LEU A HD21   1 
ATOM   5216  H  HD22   . LEU A 1 350 ? 26.833  42.414 -34.934  1.00 67.95  ? 330 LEU A HD22   1 
ATOM   5217  H  HD23   . LEU A 1 350 ? 27.789  41.751 -33.853  1.00 67.95  ? 330 LEU A HD23   1 
ATOM   5218  N  N      . THR A 1 351 ? 24.659  39.270 -31.115  1.00 62.60  ? 331 THR A N      1 
ATOM   5219  C  CA     . THR A 1 351 ? 23.431  39.176 -30.336  1.00 64.60  ? 331 THR A CA     1 
ATOM   5220  C  C      . THR A 1 351 ? 23.345  40.193 -29.209  1.00 65.26  ? 331 THR A C      1 
ATOM   5221  O  O      . THR A 1 351 ? 22.236  40.586 -28.842  1.00 71.14  ? 331 THR A O      1 
ATOM   5222  C  CB     . THR A 1 351 ? 23.269  37.769 -29.738  1.00 61.42  ? 331 THR A CB     1 
ATOM   5223  O  OG1    . THR A 1 351 ? 24.379  37.473 -28.882  1.00 62.90  ? 331 THR A OG1    1 
ATOM   5224  C  CG2    . THR A 1 351 ? 23.185  36.723 -30.842  1.00 56.82  ? 331 THR A CG2    1 
ATOM   5225  H  H      . THR A 1 351 ? 25.367  39.106 -30.655  1.00 75.24  ? 331 THR A H      1 
ATOM   5226  H  HA     . THR A 1 351 ? 22.679  39.331 -30.928  1.00 77.64  ? 331 THR A HA     1 
ATOM   5227  H  HB     . THR A 1 351 ? 22.449  37.733 -29.222  1.00 73.82  ? 331 THR A HB     1 
ATOM   5228  H  HG1    . THR A 1 351 ? 25.096  37.504 -29.319  1.00 75.60  ? 331 THR A HG1    1 
ATOM   5229  H  HG21   . THR A 1 351 ? 23.083  35.839 -30.454  1.00 68.30  ? 331 THR A HG21   1 
ATOM   5230  H  HG22   . THR A 1 351 ? 22.423  36.906 -31.414  1.00 68.30  ? 331 THR A HG22   1 
ATOM   5231  H  HG23   . THR A 1 351 ? 23.993  36.740 -31.378  1.00 68.30  ? 331 THR A HG23   1 
ATOM   5232  N  N      . ILE A 1 352 ? 24.472  40.624 -28.651  1.00 59.90  ? 332 ILE A N      1 
ATOM   5233  C  CA     . ILE A 1 352 ? 24.468  41.602 -27.570  1.00 58.94  ? 332 ILE A CA     1 
ATOM   5234  C  C      . ILE A 1 352 ? 23.980  42.939 -28.111  1.00 59.43  ? 332 ILE A C      1 
ATOM   5235  O  O      . ILE A 1 352 ? 24.762  43.726 -28.646  1.00 58.91  ? 332 ILE A O      1 
ATOM   5236  C  CB     . ILE A 1 352 ? 25.872  41.757 -26.946  1.00 59.25  ? 332 ILE A CB     1 
ATOM   5237  C  CG1    . ILE A 1 352 ? 26.347  40.443 -26.316  1.00 58.35  ? 332 ILE A CG1    1 
ATOM   5238  C  CG2    . ILE A 1 352 ? 25.886  42.880 -25.909  1.00 61.00  ? 332 ILE A CG2    1 
ATOM   5239  C  CD1    . ILE A 1 352 ? 25.511  39.951 -25.154  1.00 59.06  ? 332 ILE A CD1    1 
ATOM   5240  H  H      . ILE A 1 352 ? 25.258  40.364 -28.883  1.00 71.99  ? 332 ILE A H      1 
ATOM   5241  H  HA     . ILE A 1 352 ? 23.856  41.311 -26.876  1.00 70.85  ? 332 ILE A HA     1 
ATOM   5242  H  HB     . ILE A 1 352 ? 26.492  41.993 -27.654  1.00 71.22  ? 332 ILE A HB     1 
ATOM   5243  H  HG12   . ILE A 1 352 ? 26.335  39.752 -26.997  1.00 70.14  ? 332 ILE A HG12   1 
ATOM   5244  H  HG13   . ILE A 1 352 ? 27.253  40.565 -25.993  1.00 70.14  ? 332 ILE A HG13   1 
ATOM   5245  H  HG21   . ILE A 1 352 ? 26.778  42.954 -25.536  1.00 73.32  ? 332 ILE A HG21   1 
ATOM   5246  H  HG22   . ILE A 1 352 ? 25.638  43.712 -26.342  1.00 73.32  ? 332 ILE A HG22   1 
ATOM   5247  H  HG23   . ILE A 1 352 ? 25.249  42.669 -25.208  1.00 73.32  ? 332 ILE A HG23   1 
ATOM   5248  H  HD11   . ILE A 1 352 ? 25.887  39.120 -24.824  1.00 70.99  ? 332 ILE A HD11   1 
ATOM   5249  H  HD12   . ILE A 1 352 ? 25.522  40.621 -24.452  1.00 70.99  ? 332 ILE A HD12   1 
ATOM   5250  H  HD13   . ILE A 1 352 ? 24.602  39.806 -25.458  1.00 70.99  ? 332 ILE A HD13   1 
ATOM   5251  N  N      . PRO B 1 22  ? -11.782 32.486 -90.980  1.00 123.11 ? 2   PRO B N      1 
ATOM   5252  C  CA     . PRO B 1 22  ? -10.820 31.642 -90.261  1.00 119.65 ? 2   PRO B CA     1 
ATOM   5253  C  C      . PRO B 1 22  ? -10.833 30.191 -90.745  1.00 114.01 ? 2   PRO B C      1 
ATOM   5254  O  O      . PRO B 1 22  ? -11.476 29.342 -90.127  1.00 116.02 ? 2   PRO B O      1 
ATOM   5255  C  CB     . PRO B 1 22  ? -11.283 31.747 -88.802  1.00 122.39 ? 2   PRO B CB     1 
ATOM   5256  C  CG     . PRO B 1 22  ? -12.029 33.032 -88.731  1.00 125.54 ? 2   PRO B CG     1 
ATOM   5257  C  CD     . PRO B 1 22  ? -12.692 33.191 -90.063  1.00 126.24 ? 2   PRO B CD     1 
ATOM   5258  H  HA     . PRO B 1 22  ? -9.924  32.003 -90.343  1.00 143.70 ? 2   PRO B HA     1 
ATOM   5259  H  HB2    . PRO B 1 22  ? -11.863 31.000 -88.587  1.00 146.99 ? 2   PRO B HB2    1 
ATOM   5260  H  HB3    . PRO B 1 22  ? -10.512 31.765 -88.214  1.00 146.99 ? 2   PRO B HB3    1 
ATOM   5261  H  HG2    . PRO B 1 22  ? -12.691 32.985 -88.024  1.00 150.76 ? 2   PRO B HG2    1 
ATOM   5262  H  HG3    . PRO B 1 22  ? -11.409 33.760 -88.570  1.00 150.76 ? 2   PRO B HG3    1 
ATOM   5263  H  HD2    . PRO B 1 22  ? -13.565 32.766 -90.059  1.00 151.60 ? 2   PRO B HD2    1 
ATOM   5264  H  HD3    . PRO B 1 22  ? -12.753 34.129 -90.301  1.00 151.60 ? 2   PRO B HD3    1 
ATOM   5265  N  N      . PRO B 1 23  ? -10.131 29.916 -91.844  1.00 101.25 ? 3   PRO B N      1 
ATOM   5266  C  CA     . PRO B 1 23  ? -10.127 28.555 -92.392  1.00 94.65  ? 3   PRO B CA     1 
ATOM   5267  C  C      . PRO B 1 23  ? -9.611  27.541 -91.383  1.00 88.05  ? 3   PRO B C      1 
ATOM   5268  O  O      . PRO B 1 23  ? -8.843  27.866 -90.475  1.00 82.78  ? 3   PRO B O      1 
ATOM   5269  C  CB     . PRO B 1 23  ? -9.198  28.661 -93.607  1.00 95.28  ? 3   PRO B CB     1 
ATOM   5270  C  CG     . PRO B 1 23  ? -9.197  30.106 -93.968  1.00 96.80  ? 3   PRO B CG     1 
ATOM   5271  C  CD     . PRO B 1 23  ? -9.361  30.852 -92.681  1.00 98.46  ? 3   PRO B CD     1 
ATOM   5272  H  HA     . PRO B 1 23  ? -11.017 28.302 -92.684  1.00 113.70 ? 3   PRO B HA     1 
ATOM   5273  H  HB2    . PRO B 1 23  ? -8.306  28.367 -93.363  1.00 114.46 ? 3   PRO B HB2    1 
ATOM   5274  H  HB3    . PRO B 1 23  ? -9.549  28.125 -94.336  1.00 114.46 ? 3   PRO B HB3    1 
ATOM   5275  H  HG2    . PRO B 1 23  ? -8.354  30.335 -94.389  1.00 116.28 ? 3   PRO B HG2    1 
ATOM   5276  H  HG3    . PRO B 1 23  ? -9.938  30.292 -94.566  1.00 116.28 ? 3   PRO B HG3    1 
ATOM   5277  H  HD2    . PRO B 1 23  ? -8.496  31.031 -92.280  1.00 118.27 ? 3   PRO B HD2    1 
ATOM   5278  H  HD3    . PRO B 1 23  ? -9.863  31.669 -92.824  1.00 118.27 ? 3   PRO B HD3    1 
ATOM   5279  N  N      . SER B 1 24  ? -10.047 26.298 -91.554  1.00 105.17 ? 4   SER B N      1 
ATOM   5280  C  CA     . SER B 1 24  ? -9.617  25.198 -90.708  1.00 98.21  ? 4   SER B CA     1 
ATOM   5281  C  C      . SER B 1 24  ? -8.308  24.616 -91.222  1.00 89.06  ? 4   SER B C      1 
ATOM   5282  O  O      . SER B 1 24  ? -7.900  24.880 -92.357  1.00 86.51  ? 4   SER B O      1 
ATOM   5283  C  CB     . SER B 1 24  ? -10.690 24.113 -90.676  1.00 99.17  ? 4   SER B CB     1 
ATOM   5284  O  OG     . SER B 1 24  ? -10.946 23.620 -91.980  1.00 99.95  ? 4   SER B OG     1 
ATOM   5285  H  H      . SER B 1 24  ? -10.604 26.064 -92.167  1.00 126.32 ? 4   SER B H      1 
ATOM   5286  H  HA     . SER B 1 24  ? -9.477  25.520 -89.804  1.00 117.97 ? 4   SER B HA     1 
ATOM   5287  H  HB2    . SER B 1 24  ? -10.383 23.382 -90.117  1.00 119.12 ? 4   SER B HB2    1 
ATOM   5288  H  HB3    . SER B 1 24  ? -11.507 24.487 -90.313  1.00 119.12 ? 4   SER B HB3    1 
ATOM   5289  H  HG     . SER B 1 24  ? -11.537 23.024 -91.951  1.00 120.06 ? 4   SER B HG     1 
ATOM   5290  N  N      . PRO B 1 25  ? -7.615  23.819 -90.404  1.00 83.77  ? 5   PRO B N      1 
ATOM   5291  C  CA     . PRO B 1 25  ? -6.362  23.209 -90.881  1.00 80.37  ? 5   PRO B CA     1 
ATOM   5292  C  C      . PRO B 1 25  ? -6.525  22.423 -92.172  1.00 77.72  ? 5   PRO B C      1 
ATOM   5293  O  O      . PRO B 1 25  ? -5.612  22.417 -93.006  1.00 81.83  ? 5   PRO B O      1 
ATOM   5294  C  CB     . PRO B 1 25  ? -5.950  22.307 -89.709  1.00 79.24  ? 5   PRO B CB     1 
ATOM   5295  C  CG     . PRO B 1 25  ? -6.598  22.915 -88.513  1.00 80.17  ? 5   PRO B CG     1 
ATOM   5296  C  CD     . PRO B 1 25  ? -7.895  23.485 -88.997  1.00 82.83  ? 5   PRO B CD     1 
ATOM   5297  H  HA     . PRO B 1 25  ? -5.686  23.893 -91.009  1.00 96.56  ? 5   PRO B HA     1 
ATOM   5298  H  HB2    . PRO B 1 25  ? -6.278  21.406 -89.857  1.00 95.21  ? 5   PRO B HB2    1 
ATOM   5299  H  HB3    . PRO B 1 25  ? -4.984  22.312 -89.616  1.00 95.21  ? 5   PRO B HB3    1 
ATOM   5300  H  HG2    . PRO B 1 25  ? -6.755  22.230 -87.845  1.00 96.33  ? 5   PRO B HG2    1 
ATOM   5301  H  HG3    . PRO B 1 25  ? -6.030  23.616 -88.157  1.00 96.33  ? 5   PRO B HG3    1 
ATOM   5302  H  HD2    . PRO B 1 25  ? -8.599  22.820 -88.941  1.00 99.51  ? 5   PRO B HD2    1 
ATOM   5303  H  HD3    . PRO B 1 25  ? -8.120  24.285 -88.497  1.00 99.51  ? 5   PRO B HD3    1 
ATOM   5304  N  N      . ALA B 1 26  ? -7.668  21.757 -92.360  1.00 67.37  ? 6   ALA B N      1 
ATOM   5305  C  CA     . ALA B 1 26  ? -7.865  20.954 -93.563  1.00 60.12  ? 6   ALA B CA     1 
ATOM   5306  C  C      . ALA B 1 26  ? -7.913  21.826 -94.812  1.00 62.62  ? 6   ALA B C      1 
ATOM   5307  O  O      . ALA B 1 26  ? -7.313  21.483 -95.839  1.00 52.53  ? 6   ALA B O      1 
ATOM   5308  C  CB     . ALA B 1 26  ? -9.145  20.131 -93.435  1.00 58.77  ? 6   ALA B CB     1 
ATOM   5309  H  H      . ALA B 1 26  ? -8.332  21.755 -91.814  1.00 80.96  ? 6   ALA B H      1 
ATOM   5310  H  HA     . ALA B 1 26  ? -7.121  20.338 -93.656  1.00 72.27  ? 6   ALA B HA     1 
ATOM   5311  H  HB1    . ALA B 1 26  ? -9.263  19.604 -94.240  1.00 70.65  ? 6   ALA B HB1    1 
ATOM   5312  H  HB2    . ALA B 1 26  ? -9.069  19.547 -92.664  1.00 70.65  ? 6   ALA B HB2    1 
ATOM   5313  H  HB3    . ALA B 1 26  ? -9.897  20.733 -93.320  1.00 70.65  ? 6   ALA B HB3    1 
ATOM   5314  N  N      . VAL B 1 27  ? -8.617  22.959 -94.747  1.00 79.74  ? 7   VAL B N      1 
ATOM   5315  C  CA     . VAL B 1 27  ? -8.718  23.841 -95.907  1.00 88.01  ? 7   VAL B CA     1 
ATOM   5316  C  C      . VAL B 1 27  ? -7.356  24.438 -96.237  1.00 84.92  ? 7   VAL B C      1 
ATOM   5317  O  O      . VAL B 1 27  ? -6.937  24.469 -97.400  1.00 86.54  ? 7   VAL B O      1 
ATOM   5318  C  CB     . VAL B 1 27  ? -9.771  24.936 -95.657  1.00 92.79  ? 7   VAL B CB     1 
ATOM   5319  C  CG1    . VAL B 1 27  ? -9.893  25.851 -96.871  1.00 94.07  ? 7   VAL B CG1    1 
ATOM   5320  C  CG2    . VAL B 1 27  ? -11.119 24.312 -95.318  1.00 95.51  ? 7   VAL B CG2    1 
ATOM   5321  H  H      . VAL B 1 27  ? -9.039  23.234 -94.050  1.00 95.81  ? 7   VAL B H      1 
ATOM   5322  H  HA     . VAL B 1 27  ? -9.008  23.320 -96.672  1.00 105.73 ? 7   VAL B HA     1 
ATOM   5323  H  HB     . VAL B 1 27  ? -9.491  25.476 -94.901  1.00 111.46 ? 7   VAL B HB     1 
ATOM   5324  H  HG11   . VAL B 1 27  ? -10.560 26.530 -96.688  1.00 113.00 ? 7   VAL B HG11   1 
ATOM   5325  H  HG12   . VAL B 1 27  ? -9.033  26.268 -97.040  1.00 113.00 ? 7   VAL B HG12   1 
ATOM   5326  H  HG13   . VAL B 1 27  ? -10.160 25.322 -97.639  1.00 113.00 ? 7   VAL B HG13   1 
ATOM   5327  H  HG21   . VAL B 1 27  ? -11.764 25.020 -95.165  1.00 114.73 ? 7   VAL B HG21   1 
ATOM   5328  H  HG22   . VAL B 1 27  ? -11.405 23.757 -96.060  1.00 114.73 ? 7   VAL B HG22   1 
ATOM   5329  H  HG23   . VAL B 1 27  ? -11.024 23.772 -94.518  1.00 114.73 ? 7   VAL B HG23   1 
ATOM   5330  N  N      . VAL B 1 28  ? -6.645  24.922 -95.216  1.00 82.09  ? 8   VAL B N      1 
ATOM   5331  C  CA     . VAL B 1 28  ? -5.297  25.443 -95.427  1.00 77.15  ? 8   VAL B CA     1 
ATOM   5332  C  C      . VAL B 1 28  ? -4.429  24.381 -96.089  1.00 72.12  ? 8   VAL B C      1 
ATOM   5333  O  O      . VAL B 1 28  ? -3.690  24.659 -97.041  1.00 70.96  ? 8   VAL B O      1 
ATOM   5334  C  CB     . VAL B 1 28  ? -4.691  25.920 -94.094  1.00 76.67  ? 8   VAL B CB     1 
ATOM   5335  C  CG1    . VAL B 1 28  ? -3.259  26.407 -94.294  1.00 75.85  ? 8   VAL B CG1    1 
ATOM   5336  C  CG2    . VAL B 1 28  ? -5.545  27.022 -93.480  1.00 76.98  ? 8   VAL B CG2    1 
ATOM   5337  H  H      . VAL B 1 28  ? -6.919  24.960 -94.402  1.00 98.63  ? 8   VAL B H      1 
ATOM   5338  H  HA     . VAL B 1 28  ? -5.343  26.206 -96.024  1.00 92.70  ? 8   VAL B HA     1 
ATOM   5339  H  HB     . VAL B 1 28  ? -4.670  25.176 -93.472  1.00 92.12  ? 8   VAL B HB     1 
ATOM   5340  H  HG11   . VAL B 1 28  ? -2.904  26.700 -93.440  1.00 91.14  ? 8   VAL B HG11   1 
ATOM   5341  H  HG12   . VAL B 1 28  ? -2.723  25.677 -94.642  1.00 91.14  ? 8   VAL B HG12   1 
ATOM   5342  H  HG13   . VAL B 1 28  ? -3.262  27.145 -94.923  1.00 91.14  ? 8   VAL B HG13   1 
ATOM   5343  H  HG21   . VAL B 1 28  ? -5.143  27.304 -92.644  1.00 92.49  ? 8   VAL B HG21   1 
ATOM   5344  H  HG22   . VAL B 1 28  ? -5.586  27.769 -94.097  1.00 92.49  ? 8   VAL B HG22   1 
ATOM   5345  H  HG23   . VAL B 1 28  ? -6.437  26.676 -93.319  1.00 92.49  ? 8   VAL B HG23   1 
ATOM   5346  N  N      . GLY B 1 29  ? -4.506  23.147 -95.588  1.00 64.85  ? 9   GLY B N      1 
ATOM   5347  C  CA     . GLY B 1 29  ? -3.737  22.067 -96.183  1.00 65.62  ? 9   GLY B CA     1 
ATOM   5348  C  C      . GLY B 1 29  ? -4.064  21.858 -97.649  1.00 69.01  ? 9   GLY B C      1 
ATOM   5349  O  O      . GLY B 1 29  ? -3.167  21.781 -98.492  1.00 67.64  ? 9   GLY B O      1 
ATOM   5350  H  H      . GLY B 1 29  ? -4.990  22.917 -94.915  1.00 77.94  ? 9   GLY B H      1 
ATOM   5351  H  HA2    . GLY B 1 29  ? -2.791  22.263 -96.104  1.00 78.86  ? 9   GLY B HA2    1 
ATOM   5352  H  HA3    . GLY B 1 29  ? -3.920  21.241 -95.708  1.00 78.86  ? 9   GLY B HA3    1 
ATOM   5353  N  N      . ARG B 1 30  ? -5.356  21.765 -97.975  1.00 75.56  ? 10  ARG B N      1 
ATOM   5354  C  CA     . ARG B 1 30  ? -5.747  21.567 -99.368  1.00 82.49  ? 10  ARG B CA     1 
ATOM   5355  C  C      . ARG B 1 30  ? -5.233  22.696 -100.251 1.00 79.10  ? 10  ARG B C      1 
ATOM   5356  O  O      . ARG B 1 30  ? -4.740  22.452 -101.359 1.00 82.81  ? 10  ARG B O      1 
ATOM   5357  C  CB     . ARG B 1 30  ? -7.267  21.447 -99.482  1.00 91.99  ? 10  ARG B CB     1 
ATOM   5358  C  CG     . ARG B 1 30  ? -7.782  20.020 -99.356  1.00 98.67  ? 10  ARG B CG     1 
ATOM   5359  C  CD     . ARG B 1 30  ? -9.259  19.919 -99.713  1.00 104.19 ? 10  ARG B CD     1 
ATOM   5360  N  NE     . ARG B 1 30  ? -10.110 20.632 -98.764  1.00 107.80 ? 10  ARG B NE     1 
ATOM   5361  C  CZ     . ARG B 1 30  ? -10.568 20.118 -97.625  1.00 110.70 ? 10  ARG B CZ     1 
ATOM   5362  N  NH1    . ARG B 1 30  ? -10.261 18.876 -97.273  1.00 111.60 ? 10  ARG B NH1    1 
ATOM   5363  N  NH2    . ARG B 1 30  ? -11.336 20.852 -96.832  1.00 111.70 ? 10  ARG B NH2    1 
ATOM   5364  H  H      . ARG B 1 30  ? -6.011  21.811 -97.419  1.00 90.79  ? 10  ARG B H      1 
ATOM   5365  H  HA     . ARG B 1 30  ? -5.358  20.738 -99.688  1.00 99.10  ? 10  ARG B HA     1 
ATOM   5366  H  HB2    . ARG B 1 30  ? -7.676  21.973 -98.777  1.00 110.51 ? 10  ARG B HB2    1 
ATOM   5367  H  HB3    . ARG B 1 30  ? -7.544  21.786 -100.348 1.00 110.51 ? 10  ARG B HB3    1 
ATOM   5368  H  HG2    . ARG B 1 30  ? -7.285  19.446 -99.959  1.00 118.52 ? 10  ARG B HG2    1 
ATOM   5369  H  HG3    . ARG B 1 30  ? -7.671  19.720 -98.440  1.00 118.52 ? 10  ARG B HG3    1 
ATOM   5370  H  HD2    . ARG B 1 30  ? -9.399  20.305 -100.592 1.00 125.14 ? 10  ARG B HD2    1 
ATOM   5371  H  HD3    . ARG B 1 30  ? -9.523  18.986 -99.712  1.00 125.14 ? 10  ARG B HD3    1 
ATOM   5372  H  HE     . ARG B 1 30  ? -10.330 21.442 -98.954  1.00 129.48 ? 10  ARG B HE     1 
ATOM   5373  H  HH11   . ARG B 1 30  ? -9.763  18.395 -97.784  1.00 134.03 ? 10  ARG B HH11   1 
ATOM   5374  H  HH12   . ARG B 1 30  ? -10.561 18.552 -96.536  1.00 134.03 ? 10  ARG B HH12   1 
ATOM   5375  H  HH21   . ARG B 1 30  ? -11.538 21.658 -97.054  1.00 134.15 ? 10  ARG B HH21   1 
ATOM   5376  H  HH22   . ARG B 1 30  ? -11.633 20.522 -96.095  1.00 134.15 ? 10  ARG B HH22   1 
ATOM   5377  N  N      . SER B 1 31  ? -5.341  23.941 -99.782  1.00 65.81  ? 11  SER B N      1 
ATOM   5378  C  CA     . SER B 1 31  ? -4.834  25.069 -100.558 1.00 65.13  ? 11  SER B CA     1 
ATOM   5379  C  C      . SER B 1 31  ? -3.332  24.943 -100.783 1.00 72.31  ? 11  SER B C      1 
ATOM   5380  O  O      . SER B 1 31  ? -2.840  25.132 -101.902 1.00 71.42  ? 11  SER B O      1 
ATOM   5381  C  CB     . SER B 1 31  ? -5.171  26.382 -99.852  1.00 61.45  ? 11  SER B CB     1 
ATOM   5382  O  OG     . SER B 1 31  ? -4.834  27.497 -100.661 1.00 59.88  ? 11  SER B OG     1 
ATOM   5383  H  H      . SER B 1 31  ? -5.698  24.155 -99.029  1.00 79.09  ? 11  SER B H      1 
ATOM   5384  H  HA     . SER B 1 31  ? -5.268  25.075 -101.426 1.00 78.28  ? 11  SER B HA     1 
ATOM   5385  H  HB2    . SER B 1 31  ? -6.123  26.405 -99.665  1.00 73.86  ? 11  SER B HB2    1 
ATOM   5386  H  HB3    . SER B 1 31  ? -4.670  26.432 -99.023  1.00 73.86  ? 11  SER B HB3    1 
ATOM   5387  H  HG     . SER B 1 31  ? -5.025  28.210 -100.261 1.00 71.98  ? 11  SER B HG     1 
ATOM   5388  N  N      . LEU B 1 32  ? -2.585  24.616 -99.725  1.00 74.60  ? 12  LEU B N      1 
ATOM   5389  C  CA     . LEU B 1 32  ? -1.132  24.530 -99.836  1.00 79.97  ? 12  LEU B CA     1 
ATOM   5390  C  C      . LEU B 1 32  ? -0.717  23.424 -100.799 1.00 80.46  ? 12  LEU B C      1 
ATOM   5391  O  O      . LEU B 1 32  ? 0.072   23.654 -101.723 1.00 86.44  ? 12  LEU B O      1 
ATOM   5392  C  CB     . LEU B 1 32  ? -0.515  24.307 -98.456  1.00 80.93  ? 12  LEU B CB     1 
ATOM   5393  C  CG     . LEU B 1 32  ? -0.567  25.509 -97.512  1.00 78.61  ? 12  LEU B CG     1 
ATOM   5394  C  CD1    . LEU B 1 32  ? -0.260  25.088 -96.084  1.00 77.77  ? 12  LEU B CD1    1 
ATOM   5395  C  CD2    . LEU B 1 32  ? 0.411   26.581 -97.972  1.00 75.93  ? 12  LEU B CD2    1 
ATOM   5396  H  H      . LEU B 1 32  ? -2.893  24.441 -98.941  1.00 89.64  ? 12  LEU B H      1 
ATOM   5397  H  HA     . LEU B 1 32  ? -0.792  25.370 -100.183 1.00 96.08  ? 12  LEU B HA     1 
ATOM   5398  H  HB2    . LEU B 1 32  ? -0.985  23.577 -98.023  1.00 97.23  ? 12  LEU B HB2    1 
ATOM   5399  H  HB3    . LEU B 1 32  ? 0.418   24.067 -98.571  1.00 97.23  ? 12  LEU B HB3    1 
ATOM   5400  H  HG     . LEU B 1 32  ? -1.460  25.888 -97.529  1.00 94.45  ? 12  LEU B HG     1 
ATOM   5401  H  HD11   . LEU B 1 32  ? -0.300  25.869 -95.510  1.00 93.44  ? 12  LEU B HD11   1 
ATOM   5402  H  HD12   . LEU B 1 32  ? -0.917  24.434 -95.800  1.00 93.44  ? 12  LEU B HD12   1 
ATOM   5403  H  HD13   . LEU B 1 32  ? 0.629   24.700 -96.055  1.00 93.44  ? 12  LEU B HD13   1 
ATOM   5404  H  HD21   . LEU B 1 32  ? 0.364   27.334 -97.362  1.00 91.24  ? 12  LEU B HD21   1 
ATOM   5405  H  HD22   . LEU B 1 32  ? 1.308   26.210 -97.971  1.00 91.24  ? 12  LEU B HD22   1 
ATOM   5406  H  HD23   . LEU B 1 32  ? 0.170   26.864 -98.867  1.00 91.24  ? 12  LEU B HD23   1 
ATOM   5407  N  N      . VAL B 1 33  ? -1.231  22.210 -100.594 1.00 64.47  ? 13  VAL B N      1 
ATOM   5408  C  CA     . VAL B 1 33  ? -0.910  21.109 -101.500 1.00 66.98  ? 13  VAL B CA     1 
ATOM   5409  C  C      . VAL B 1 33  ? -1.296  21.474 -102.927 1.00 70.74  ? 13  VAL B C      1 
ATOM   5410  O  O      . VAL B 1 33  ? -0.578  21.155 -103.883 1.00 72.13  ? 13  VAL B O      1 
ATOM   5411  C  CB     . VAL B 1 33  ? -1.605  19.814 -101.038 1.00 74.83  ? 13  VAL B CB     1 
ATOM   5412  C  CG1    . VAL B 1 33  ? -1.316  18.671 -102.008 1.00 78.60  ? 13  VAL B CG1    1 
ATOM   5413  C  CG2    . VAL B 1 33  ? -1.161  19.442 -99.631  1.00 76.28  ? 13  VAL B CG2    1 
ATOM   5414  H  H      . VAL B 1 33  ? -1.760  22.001 -99.949  1.00 77.48  ? 13  VAL B H      1 
ATOM   5415  H  HA     . VAL B 1 33  ? 0.047   20.956 -101.480 1.00 80.49  ? 13  VAL B HA     1 
ATOM   5416  H  HB     . VAL B 1 33  ? -2.564  19.958 -101.022 1.00 89.91  ? 13  VAL B HB     1 
ATOM   5417  H  HG11   . VAL B 1 33  ? -1.765  17.870 -101.694 1.00 94.44  ? 13  VAL B HG11   1 
ATOM   5418  H  HG12   . VAL B 1 33  ? -1.647  18.913 -102.887 1.00 94.44  ? 13  VAL B HG12   1 
ATOM   5419  H  HG13   . VAL B 1 33  ? -0.358  18.522 -102.043 1.00 94.44  ? 13  VAL B HG13   1 
ATOM   5420  H  HG21   . VAL B 1 33  ? -1.612  18.625 -99.364  1.00 91.65  ? 13  VAL B HG21   1 
ATOM   5421  H  HG22   . VAL B 1 33  ? -0.201  19.306 -99.629  1.00 91.65  ? 13  VAL B HG22   1 
ATOM   5422  H  HG23   . VAL B 1 33  ? -1.396  20.162 -99.026  1.00 91.65  ? 13  VAL B HG23   1 
ATOM   5423  N  N      . ASN B 1 34  ? -2.433  22.152 -103.093 1.00 110.49 ? 14  ASN B N      1 
ATOM   5424  C  CA     . ASN B 1 34  ? -2.849  22.584 -104.421 1.00 124.96 ? 14  ASN B CA     1 
ATOM   5425  C  C      . ASN B 1 34  ? -1.851  23.567 -105.022 1.00 123.95 ? 14  ASN B C      1 
ATOM   5426  O  O      . ASN B 1 34  ? -1.678  23.603 -106.245 1.00 134.47 ? 14  ASN B O      1 
ATOM   5427  C  CB     . ASN B 1 34  ? -4.248  23.200 -104.348 1.00 132.86 ? 14  ASN B CB     1 
ATOM   5428  C  CG     . ASN B 1 34  ? -4.735  23.719 -105.688 1.00 137.40 ? 14  ASN B CG     1 
ATOM   5429  O  OD1    . ASN B 1 34  ? -4.198  23.367 -106.738 1.00 138.71 ? 14  ASN B OD1    1 
ATOM   5430  N  ND2    . ASN B 1 34  ? -5.779  24.540 -105.659 1.00 138.59 ? 14  ASN B ND2    1 
ATOM   5431  H  H      . ASN B 1 34  ? -2.972  22.372 -102.460 1.00 132.71 ? 14  ASN B H      1 
ATOM   5432  H  HA     . ASN B 1 34  ? -2.894  21.810 -105.004 1.00 150.07 ? 14  ASN B HA     1 
ATOM   5433  H  HB2    . ASN B 1 34  ? -4.875  22.526 -104.042 1.00 159.55 ? 14  ASN B HB2    1 
ATOM   5434  H  HB3    . ASN B 1 34  ? -4.233  23.945 -103.726 1.00 159.55 ? 14  ASN B HB3    1 
ATOM   5435  H  HD21   . ASN B 1 34  ? -6.094  24.862 -106.392 1.00 166.42 ? 14  ASN B HD21   1 
ATOM   5436  H  HD22   . ASN B 1 34  ? -6.140  24.750 -104.907 1.00 166.42 ? 14  ASN B HD22   1 
ATOM   5437  N  N      . SER B 1 35  ? -1.188  24.371 -104.186 1.00 87.86  ? 15  SER B N      1 
ATOM   5438  C  CA     . SER B 1 35  ? -0.227  25.349 -104.685 1.00 82.69  ? 15  SER B CA     1 
ATOM   5439  C  C      . SER B 1 35  ? 1.133   24.739 -105.009 1.00 85.31  ? 15  SER B C      1 
ATOM   5440  O  O      . SER B 1 35  ? 1.896   25.342 -105.771 1.00 83.56  ? 15  SER B O      1 
ATOM   5441  C  CB     . SER B 1 35  ? -0.046  26.480 -103.671 1.00 80.55  ? 15  SER B CB     1 
ATOM   5442  O  OG     . SER B 1 35  ? 0.523   26.000 -102.466 1.00 80.77  ? 15  SER B OG     1 
ATOM   5443  H  H      . SER B 1 35  ? -1.278  24.368 -103.331 1.00 105.56 ? 15  SER B H      1 
ATOM   5444  H  HA     . SER B 1 35  ? -0.577  25.738 -105.502 1.00 99.34  ? 15  SER B HA     1 
ATOM   5445  H  HB2    . SER B 1 35  ? 0.542   27.152 -104.051 1.00 96.77  ? 15  SER B HB2    1 
ATOM   5446  H  HB3    . SER B 1 35  ? -0.912  26.870 -103.476 1.00 96.77  ? 15  SER B HB3    1 
ATOM   5447  H  HG     . SER B 1 35  ? 0.024   25.417 -102.125 1.00 97.05  ? 15  SER B HG     1 
ATOM   5448  N  N      . PHE B 1 36  ? 1.458   23.570 -104.456 1.00 93.70  ? 16  PHE B N      1 
ATOM   5449  C  CA     . PHE B 1 36  ? 2.738   22.921 -104.717 1.00 91.53  ? 16  PHE B CA     1 
ATOM   5450  C  C      . PHE B 1 36  ? 2.675   21.935 -105.876 1.00 98.96  ? 16  PHE B C      1 
ATOM   5451  O  O      . PHE B 1 36  ? 3.676   21.273 -106.167 1.00 97.83  ? 16  PHE B O      1 
ATOM   5452  C  CB     . PHE B 1 36  ? 3.236   22.204 -103.456 1.00 83.62  ? 16  PHE B CB     1 
ATOM   5453  C  CG     . PHE B 1 36  ? 3.959   23.103 -102.493 1.00 79.42  ? 16  PHE B CG     1 
ATOM   5454  C  CD1    . PHE B 1 36  ? 5.246   23.533 -102.769 1.00 79.18  ? 16  PHE B CD1    1 
ATOM   5455  C  CD2    . PHE B 1 36  ? 3.357   23.519 -101.317 1.00 77.93  ? 16  PHE B CD2    1 
ATOM   5456  C  CE1    . PHE B 1 36  ? 5.921   24.358 -101.892 1.00 78.66  ? 16  PHE B CE1    1 
ATOM   5457  C  CE2    . PHE B 1 36  ? 4.028   24.346 -100.435 1.00 77.43  ? 16  PHE B CE2    1 
ATOM   5458  C  CZ     . PHE B 1 36  ? 5.312   24.767 -100.724 1.00 77.84  ? 16  PHE B CZ     1 
ATOM   5459  H  H      . PHE B 1 36  ? 0.947   23.130 -103.922 1.00 112.56 ? 16  PHE B H      1 
ATOM   5460  H  HA     . PHE B 1 36  ? 3.390   23.602 -104.946 1.00 109.96 ? 16  PHE B HA     1 
ATOM   5461  H  HB2    . PHE B 1 36  ? 2.474   21.823 -102.992 1.00 100.46 ? 16  PHE B HB2    1 
ATOM   5462  H  HB3    . PHE B 1 36  ? 3.847   21.498 -103.719 1.00 100.46 ? 16  PHE B HB3    1 
ATOM   5463  H  HD1    . PHE B 1 36  ? 5.662   23.261 -103.555 1.00 95.13  ? 16  PHE B HD1    1 
ATOM   5464  H  HD2    . PHE B 1 36  ? 2.493   23.239 -101.118 1.00 93.64  ? 16  PHE B HD2    1 
ATOM   5465  H  HE1    . PHE B 1 36  ? 6.785   24.640 -102.089 1.00 94.51  ? 16  PHE B HE1    1 
ATOM   5466  H  HE2    . PHE B 1 36  ? 3.615   24.620 -99.648  1.00 93.04  ? 16  PHE B HE2    1 
ATOM   5467  H  HZ     . PHE B 1 36  ? 5.765   25.323 -100.132 1.00 93.52  ? 16  PHE B HZ     1 
ATOM   5468  N  N      . LYS B 1 37  ? 1.529   21.829 -106.536 1.00 102.60 ? 17  LYS B N      1 
ATOM   5469  C  CA     . LYS B 1 37  ? 1.336   20.913 -107.651 1.00 105.98 ? 17  LYS B CA     1 
ATOM   5470  C  C      . LYS B 1 37  ? 2.295   21.217 -108.799 1.00 103.00 ? 17  LYS B C      1 
ATOM   5471  O  O      . LYS B 1 37  ? 3.206   20.440 -109.084 1.00 101.17 ? 17  LYS B O      1 
ATOM   5472  C  CB     . LYS B 1 37  ? -0.114  21.004 -108.120 1.00 110.74 ? 17  LYS B CB     1 
ATOM   5473  C  CG     . LYS B 1 37  ? -0.459  22.365 -108.698 1.00 114.52 ? 17  LYS B CG     1 
ATOM   5474  C  CD     . LYS B 1 37  ? -1.929  22.482 -109.043 1.00 119.24 ? 17  LYS B CD     1 
ATOM   5475  C  CE     . LYS B 1 37  ? -2.257  23.887 -109.520 1.00 123.00 ? 17  LYS B CE     1 
ATOM   5476  N  NZ     . LYS B 1 37  ? -3.713  24.078 -109.753 1.00 126.64 ? 17  LYS B NZ     1 
ATOM   5477  H  H      . LYS B 1 37  ? 0.828   22.291 -106.350 1.00 123.24 ? 17  LYS B H      1 
ATOM   5478  H  HA     . LYS B 1 37  ? 1.502   20.006 -107.351 1.00 127.30 ? 17  LYS B HA     1 
ATOM   5479  H  HB2    . LYS B 1 37  ? -0.265  20.338 -108.809 1.00 133.01 ? 17  LYS B HB2    1 
ATOM   5480  H  HB3    . LYS B 1 37  ? -0.700  20.841 -107.365 1.00 133.01 ? 17  LYS B HB3    1 
ATOM   5481  H  HG2    . LYS B 1 37  ? -0.247  23.051 -108.046 1.00 137.55 ? 17  LYS B HG2    1 
ATOM   5482  H  HG3    . LYS B 1 37  ? 0.053   22.506 -109.510 1.00 137.55 ? 17  LYS B HG3    1 
ATOM   5483  H  HD2    . LYS B 1 37  ? -2.144  21.859 -109.754 1.00 143.21 ? 17  LYS B HD2    1 
ATOM   5484  H  HD3    . LYS B 1 37  ? -2.461  22.294 -108.255 1.00 143.21 ? 17  LYS B HD3    1 
ATOM   5485  H  HE2    . LYS B 1 37  ? -1.973  24.525 -108.847 1.00 147.72 ? 17  LYS B HE2    1 
ATOM   5486  H  HE3    . LYS B 1 37  ? -1.793  24.055 -110.355 1.00 147.72 ? 17  LYS B HE3    1 
ATOM   5487  H  HZ1    . LYS B 1 37  ? -3.870  24.908 -110.030 1.00 152.08 ? 17  LYS B HZ1    1 
ATOM   5488  H  HZ2    . LYS B 1 37  ? -3.999  23.506 -110.372 1.00 152.08 ? 17  LYS B HZ2    1 
ATOM   5489  H  HZ3    . LYS B 1 37  ? -4.163  23.935 -108.998 1.00 152.08 ? 17  LYS B HZ3    1 
ATOM   5490  N  N      . VAL B 1 49  ? 21.856  19.405 -110.649 1.00 78.23  ? 29  VAL B N      1 
ATOM   5491  C  CA     . VAL B 1 49  ? 22.708  20.179 -109.756 1.00 77.57  ? 29  VAL B CA     1 
ATOM   5492  C  C      . VAL B 1 49  ? 24.151  19.691 -109.862 1.00 78.99  ? 29  VAL B C      1 
ATOM   5493  O  O      . VAL B 1 49  ? 25.092  20.431 -109.573 1.00 77.86  ? 29  VAL B O      1 
ATOM   5494  C  CB     . VAL B 1 49  ? 22.188  20.080 -108.305 1.00 74.72  ? 29  VAL B CB     1 
ATOM   5495  C  CG1    . VAL B 1 49  ? 23.139  20.752 -107.322 1.00 72.18  ? 29  VAL B CG1    1 
ATOM   5496  C  CG2    . VAL B 1 49  ? 20.797  20.692 -108.203 1.00 73.37  ? 29  VAL B CG2    1 
ATOM   5497  H  HA     . VAL B 1 49  ? 22.684  21.111 -110.022 1.00 93.21  ? 29  VAL B HA     1 
ATOM   5498  H  HB     . VAL B 1 49  ? 22.120  19.144 -108.060 1.00 89.78  ? 29  VAL B HB     1 
ATOM   5499  H  HG11   . VAL B 1 49  ? 22.777  20.668 -106.426 1.00 86.73  ? 29  VAL B HG11   1 
ATOM   5500  H  HG12   . VAL B 1 49  ? 24.004  20.316 -107.373 1.00 86.73  ? 29  VAL B HG12   1 
ATOM   5501  H  HG13   . VAL B 1 49  ? 23.226  21.689 -107.558 1.00 86.73  ? 29  VAL B HG13   1 
ATOM   5502  H  HG21   . VAL B 1 49  ? 20.487  20.620 -107.287 1.00 88.16  ? 29  VAL B HG21   1 
ATOM   5503  H  HG22   . VAL B 1 49  ? 20.842  21.624 -108.466 1.00 88.16  ? 29  VAL B HG22   1 
ATOM   5504  H  HG23   . VAL B 1 49  ? 20.197  20.210 -108.794 1.00 88.16  ? 29  VAL B HG23   1 
ATOM   5505  N  N      . ASP B 1 50  ? 24.314  18.436 -110.282 1.00 87.04  ? 30  ASP B N      1 
ATOM   5506  C  CA     . ASP B 1 50  ? 25.647  17.860 -110.425 1.00 87.05  ? 30  ASP B CA     1 
ATOM   5507  C  C      . ASP B 1 50  ? 26.426  18.539 -111.547 1.00 82.77  ? 30  ASP B C      1 
ATOM   5508  O  O      . ASP B 1 50  ? 27.620  18.832 -111.400 1.00 81.19  ? 30  ASP B O      1 
ATOM   5509  C  CB     . ASP B 1 50  ? 25.537  16.355 -110.668 1.00 90.36  ? 30  ASP B CB     1 
ATOM   5510  C  CG     . ASP B 1 50  ? 24.756  15.647 -109.575 1.00 89.54  ? 30  ASP B CG     1 
ATOM   5511  O  OD1    . ASP B 1 50  ? 25.364  15.283 -108.546 1.00 88.65  ? 30  ASP B OD1    1 
ATOM   5512  O  OD2    . ASP B 1 50  ? 23.533  15.457 -109.744 1.00 89.23  ? 30  ASP B OD2    1 
ATOM   5513  H  H      . ASP B 1 50  ? 23.672  17.902 -110.489 1.00 104.57 ? 30  ASP B H      1 
ATOM   5514  H  HA     . ASP B 1 50  ? 26.138  17.993 -109.599 1.00 104.57 ? 30  ASP B HA     1 
ATOM   5515  H  HB2    . ASP B 1 50  ? 25.081  16.203 -111.510 1.00 108.54 ? 30  ASP B HB2    1 
ATOM   5516  H  HB3    . ASP B 1 50  ? 26.428  15.973 -110.697 1.00 108.54 ? 30  ASP B HB3    1 
ATOM   5517  N  N      . ALA B 1 51  ? 25.759  18.800 -112.676 1.00 78.98  ? 31  ALA B N      1 
ATOM   5518  C  CA     . ALA B 1 51  ? 26.437  19.384 -113.828 1.00 78.43  ? 31  ALA B CA     1 
ATOM   5519  C  C      . ALA B 1 51  ? 27.049  20.733 -113.480 1.00 77.41  ? 31  ALA B C      1 
ATOM   5520  O  O      . ALA B 1 51  ? 28.172  21.040 -113.897 1.00 78.70  ? 31  ALA B O      1 
ATOM   5521  C  CB     . ALA B 1 51  ? 25.457  19.524 -114.994 1.00 78.67  ? 31  ALA B CB     1 
ATOM   5522  H  H      . ALA B 1 51  ? 24.921  18.648 -112.795 1.00 94.89  ? 31  ALA B H      1 
ATOM   5523  H  HA     . ALA B 1 51  ? 27.153  18.792 -114.107 1.00 94.24  ? 31  ALA B HA     1 
ATOM   5524  H  HB1    . ALA B 1 51  ? 25.922  19.913 -115.751 1.00 94.53  ? 31  ALA B HB1    1 
ATOM   5525  H  HB2    . ALA B 1 51  ? 25.119  18.645 -115.228 1.00 94.53  ? 31  ALA B HB2    1 
ATOM   5526  H  HB3    . ALA B 1 51  ? 24.725  20.099 -114.723 1.00 94.53  ? 31  ALA B HB3    1 
ATOM   5527  N  N      . THR B 1 52  ? 26.322  21.560 -112.728 1.00 77.80  ? 32  THR B N      1 
ATOM   5528  C  CA     . THR B 1 52  ? 26.882  22.832 -112.287 1.00 72.83  ? 32  THR B CA     1 
ATOM   5529  C  C      . THR B 1 52  ? 28.104  22.611 -111.404 1.00 68.54  ? 32  THR B C      1 
ATOM   5530  O  O      . THR B 1 52  ? 29.119  23.304 -111.548 1.00 68.10  ? 32  THR B O      1 
ATOM   5531  C  CB     . THR B 1 52  ? 25.823  23.644 -111.541 1.00 70.13  ? 32  THR B CB     1 
ATOM   5532  O  OG1    . THR B 1 52  ? 24.587  23.605 -112.265 1.00 69.04  ? 32  THR B OG1    1 
ATOM   5533  C  CG2    . THR B 1 52  ? 26.270  25.091 -111.382 1.00 70.56  ? 32  THR B CG2    1 
ATOM   5534  H  H      . THR B 1 52  ? 25.518  21.410 -112.464 1.00 93.47  ? 32  THR B H      1 
ATOM   5535  H  HA     . THR B 1 52  ? 27.161  23.342 -113.064 1.00 87.51  ? 32  THR B HA     1 
ATOM   5536  H  HB     . THR B 1 52  ? 25.691  23.266 -110.657 1.00 84.28  ? 32  THR B HB     1 
ATOM   5537  H  HG1    . THR B 1 52  ? 24.001  24.050 -111.858 1.00 82.97  ? 32  THR B HG1    1 
ATOM   5538  H  HG21   . THR B 1 52  ? 25.592  25.597 -110.908 1.00 84.80  ? 32  THR B HG21   1 
ATOM   5539  H  HG22   . THR B 1 52  ? 27.099  25.129 -110.881 1.00 84.80  ? 32  THR B HG22   1 
ATOM   5540  H  HG23   . THR B 1 52  ? 26.410  25.492 -112.254 1.00 84.80  ? 32  THR B HG23   1 
ATOM   5541  N  N      . TYR B 1 53  ? 28.028  21.645 -110.485 1.00 65.39  ? 33  TYR B N      1 
ATOM   5542  C  CA     . TYR B 1 53  ? 29.159  21.362 -109.606 1.00 62.59  ? 33  TYR B CA     1 
ATOM   5543  C  C      . TYR B 1 53  ? 30.407  21.007 -110.405 1.00 68.13  ? 33  TYR B C      1 
ATOM   5544  O  O      . TYR B 1 53  ? 31.492  21.543 -110.153 1.00 61.23  ? 33  TYR B O      1 
ATOM   5545  C  CB     . TYR B 1 53  ? 28.803  20.233 -108.639 1.00 59.13  ? 33  TYR B CB     1 
ATOM   5546  C  CG     . TYR B 1 53  ? 29.929  19.879 -107.694 1.00 59.81  ? 33  TYR B CG     1 
ATOM   5547  C  CD1    . TYR B 1 53  ? 30.142  20.607 -106.531 1.00 60.37  ? 33  TYR B CD1    1 
ATOM   5548  C  CD2    . TYR B 1 53  ? 30.782  18.819 -107.970 1.00 61.84  ? 33  TYR B CD2    1 
ATOM   5549  C  CE1    . TYR B 1 53  ? 31.174  20.286 -105.667 1.00 61.96  ? 33  TYR B CE1    1 
ATOM   5550  C  CE2    . TYR B 1 53  ? 31.815  18.491 -107.113 1.00 62.92  ? 33  TYR B CE2    1 
ATOM   5551  C  CZ     . TYR B 1 53  ? 32.007  19.227 -105.964 1.00 62.45  ? 33  TYR B CZ     1 
ATOM   5552  O  OH     . TYR B 1 53  ? 33.036  18.902 -105.110 1.00 61.19  ? 33  TYR B OH     1 
ATOM   5553  H  H      . TYR B 1 53  ? 27.340  21.145 -110.353 1.00 78.59  ? 33  TYR B H      1 
ATOM   5554  H  HA     . TYR B 1 53  ? 29.356  22.154 -109.082 1.00 75.23  ? 33  TYR B HA     1 
ATOM   5555  H  HB2    . TYR B 1 53  ? 28.041  20.506 -108.105 1.00 71.07  ? 33  TYR B HB2    1 
ATOM   5556  H  HB3    . TYR B 1 53  ? 28.582  19.439 -109.150 1.00 71.07  ? 33  TYR B HB3    1 
ATOM   5557  H  HD1    . TYR B 1 53  ? 29.582  21.321 -106.329 1.00 72.56  ? 33  TYR B HD1    1 
ATOM   5558  H  HD2    . TYR B 1 53  ? 30.655  18.320 -108.745 1.00 74.33  ? 33  TYR B HD2    1 
ATOM   5559  H  HE1    . TYR B 1 53  ? 31.305  20.781 -104.891 1.00 74.47  ? 33  TYR B HE1    1 
ATOM   5560  H  HE2    . TYR B 1 53  ? 32.378  17.777 -107.311 1.00 75.62  ? 33  TYR B HE2    1 
ATOM   5561  H  HH     . TYR B 1 53  ? 33.040  19.426 -104.454 1.00 73.55  ? 33  TYR B HH     1 
ATOM   5562  N  N      . ARG B 1 54  ? 30.278  20.099 -111.375 1.00 91.30  ? 34  ARG B N      1 
ATOM   5563  C  CA     . ARG B 1 54  ? 31.439  19.731 -112.183 1.00 107.23 ? 34  ARG B CA     1 
ATOM   5564  C  C      . ARG B 1 54  ? 31.924  20.913 -113.015 1.00 101.23 ? 34  ARG B C      1 
ATOM   5565  O  O      . ARG B 1 54  ? 33.132  21.182 -113.086 1.00 104.96 ? 34  ARG B O      1 
ATOM   5566  C  CB     . ARG B 1 54  ? 31.093  18.550 -113.089 1.00 123.42 ? 34  ARG B CB     1 
ATOM   5567  C  CG     . ARG B 1 54  ? 30.849  17.249 -112.344 1.00 135.30 ? 34  ARG B CG     1 
ATOM   5568  C  CD     . ARG B 1 54  ? 30.711  16.083 -113.307 1.00 146.36 ? 34  ARG B CD     1 
ATOM   5569  N  NE     . ARG B 1 54  ? 29.494  16.183 -114.109 1.00 154.52 ? 34  ARG B NE     1 
ATOM   5570  C  CZ     . ARG B 1 54  ? 28.325  15.628 -113.796 1.00 160.86 ? 34  ARG B CZ     1 
ATOM   5571  N  NH1    . ARG B 1 54  ? 28.185  14.921 -112.683 1.00 163.04 ? 34  ARG B NH1    1 
ATOM   5572  N  NH2    . ARG B 1 54  ? 27.286  15.788 -114.604 1.00 163.02 ? 34  ARG B NH2    1 
ATOM   5573  H  H      . ARG B 1 54  ? 29.549  19.691 -111.581 1.00 109.68 ? 34  ARG B H      1 
ATOM   5574  H  HA     . ARG B 1 54  ? 32.161  19.459 -111.596 1.00 128.79 ? 34  ARG B HA     1 
ATOM   5575  H  HB2    . ARG B 1 54  ? 30.287  18.763 -113.584 1.00 148.23 ? 34  ARG B HB2    1 
ATOM   5576  H  HB3    . ARG B 1 54  ? 31.828  18.405 -113.705 1.00 148.23 ? 34  ARG B HB3    1 
ATOM   5577  H  HG2    . ARG B 1 54  ? 31.599  17.071 -111.755 1.00 162.48 ? 34  ARG B HG2    1 
ATOM   5578  H  HG3    . ARG B 1 54  ? 30.028  17.321 -111.833 1.00 162.48 ? 34  ARG B HG3    1 
ATOM   5579  H  HD2    . ARG B 1 54  ? 31.471  16.075 -113.909 1.00 175.75 ? 34  ARG B HD2    1 
ATOM   5580  H  HD3    . ARG B 1 54  ? 30.675  15.255 -112.802 1.00 175.75 ? 34  ARG B HD3    1 
ATOM   5581  H  HE     . ARG B 1 54  ? 29.535  16.634 -114.840 1.00 185.55 ? 34  ARG B HE     1 
ATOM   5582  H  HH11   . ARG B 1 54  ? 28.855  14.814 -112.154 1.00 195.77 ? 34  ARG B HH11   1 
ATOM   5583  H  HH12   . ARG B 1 54  ? 27.425  14.568 -112.490 1.00 195.77 ? 34  ARG B HH12   1 
ATOM   5584  H  HH21   . ARG B 1 54  ? 27.370  16.246 -115.327 1.00 195.74 ? 34  ARG B HH21   1 
ATOM   5585  H  HH22   . ARG B 1 54  ? 26.529  15.432 -114.406 1.00 195.74 ? 34  ARG B HH22   1 
ATOM   5586  N  N      . LEU B 1 55  ? 30.990  21.639 -113.633 1.00 82.66  ? 35  LEU B N      1 
ATOM   5587  C  CA     . LEU B 1 55  ? 31.348  22.776 -114.473 1.00 72.40  ? 35  LEU B CA     1 
ATOM   5588  C  C      . LEU B 1 55  ? 32.175  23.793 -113.696 1.00 69.12  ? 35  LEU B C      1 
ATOM   5589  O  O      . LEU B 1 55  ? 33.187  24.296 -114.198 1.00 71.20  ? 35  LEU B O      1 
ATOM   5590  C  CB     . LEU B 1 55  ? 30.075  23.416 -115.029 1.00 65.48  ? 35  LEU B CB     1 
ATOM   5591  C  CG     . LEU B 1 55  ? 30.170  24.354 -116.234 1.00 65.23  ? 35  LEU B CG     1 
ATOM   5592  C  CD1    . LEU B 1 55  ? 30.831  23.675 -117.423 1.00 68.61  ? 35  LEU B CD1    1 
ATOM   5593  C  CD2    . LEU B 1 55  ? 28.779  24.837 -116.611 1.00 63.53  ? 35  LEU B CD2    1 
ATOM   5594  H  H      . LEU B 1 55  ? 30.144  21.492 -113.580 1.00 99.31  ? 35  LEU B H      1 
ATOM   5595  H  HA     . LEU B 1 55  ? 31.880  22.463 -115.221 1.00 87.00  ? 35  LEU B HA     1 
ATOM   5596  H  HB2    . LEU B 1 55  ? 29.473  22.699 -115.284 1.00 78.69  ? 35  LEU B HB2    1 
ATOM   5597  H  HB3    . LEU B 1 55  ? 29.666  23.926 -114.313 1.00 78.69  ? 35  LEU B HB3    1 
ATOM   5598  H  HG     . LEU B 1 55  ? 30.704  25.128 -115.993 1.00 78.40  ? 35  LEU B HG     1 
ATOM   5599  H  HD11   . LEU B 1 55  ? 30.871  24.302 -118.162 1.00 82.45  ? 35  LEU B HD11   1 
ATOM   5600  H  HD12   . LEU B 1 55  ? 31.727  23.400 -117.173 1.00 82.45  ? 35  LEU B HD12   1 
ATOM   5601  H  HD13   . LEU B 1 55  ? 30.305  22.900 -117.676 1.00 82.45  ? 35  LEU B HD13   1 
ATOM   5602  H  HD21   . LEU B 1 55  ? 28.847  25.431 -117.375 1.00 76.35  ? 35  LEU B HD21   1 
ATOM   5603  H  HD22   . LEU B 1 55  ? 28.229  24.070 -116.836 1.00 76.35  ? 35  LEU B HD22   1 
ATOM   5604  H  HD23   . LEU B 1 55  ? 28.394  25.310 -115.857 1.00 76.35  ? 35  LEU B HD23   1 
ATOM   5605  N  N      . VAL B 1 56  ? 31.760  24.107 -112.467 1.00 63.64  ? 36  VAL B N      1 
ATOM   5606  C  CA     . VAL B 1 56  ? 32.532  25.023 -111.634 1.00 60.76  ? 36  VAL B CA     1 
ATOM   5607  C  C      . VAL B 1 56  ? 33.856  24.383 -111.230 1.00 60.89  ? 36  VAL B C      1 
ATOM   5608  O  O      . VAL B 1 56  ? 34.904  25.044 -111.211 1.00 64.10  ? 36  VAL B O      1 
ATOM   5609  C  CB     . VAL B 1 56  ? 31.705  25.448 -110.406 1.00 53.13  ? 36  VAL B CB     1 
ATOM   5610  C  CG1    . VAL B 1 56  ? 32.517  26.362 -109.494 1.00 49.80  ? 36  VAL B CG1    1 
ATOM   5611  C  CG2    . VAL B 1 56  ? 30.416  26.139 -110.841 1.00 48.68  ? 36  VAL B CG2    1 
ATOM   5612  H  H      . VAL B 1 56  ? 31.044  23.806 -112.098 1.00 76.48  ? 36  VAL B H      1 
ATOM   5613  H  HA     . VAL B 1 56  ? 32.733  25.821 -112.148 1.00 73.03  ? 36  VAL B HA     1 
ATOM   5614  H  HB     . VAL B 1 56  ? 31.464  24.657 -109.899 1.00 63.87  ? 36  VAL B HB     1 
ATOM   5615  H  HG11   . VAL B 1 56  ? 31.972  26.612 -108.732 1.00 59.87  ? 36  VAL B HG11   1 
ATOM   5616  H  HG12   . VAL B 1 56  ? 33.308  25.886 -109.194 1.00 59.87  ? 36  VAL B HG12   1 
ATOM   5617  H  HG13   . VAL B 1 56  ? 32.776  27.154 -109.991 1.00 59.87  ? 36  VAL B HG13   1 
ATOM   5618  H  HG21   . VAL B 1 56  ? 29.915  26.396 -110.051 1.00 58.54  ? 36  VAL B HG21   1 
ATOM   5619  H  HG22   . VAL B 1 56  ? 30.641  26.926 -111.361 1.00 58.54  ? 36  VAL B HG22   1 
ATOM   5620  H  HG23   . VAL B 1 56  ? 29.895  25.523 -111.379 1.00 58.54  ? 36  VAL B HG23   1 
ATOM   5621  N  N      . LEU B 1 57  ? 33.832  23.087 -110.904 1.00 54.80  ? 37  LEU B N      1 
ATOM   5622  C  CA     . LEU B 1 57  ? 35.048  22.408 -110.468 1.00 61.13  ? 37  LEU B CA     1 
ATOM   5623  C  C      . LEU B 1 57  ? 36.146  22.500 -111.520 1.00 75.30  ? 37  LEU B C      1 
ATOM   5624  O  O      . LEU B 1 57  ? 37.330  22.615 -111.181 1.00 67.92  ? 37  LEU B O      1 
ATOM   5625  C  CB     . LEU B 1 57  ? 34.744  20.943 -110.146 1.00 66.90  ? 37  LEU B CB     1 
ATOM   5626  C  CG     . LEU B 1 57  ? 35.931  20.084 -109.692 1.00 74.07  ? 37  LEU B CG     1 
ATOM   5627  C  CD1    . LEU B 1 57  ? 36.655  20.705 -108.503 1.00 75.18  ? 37  LEU B CD1    1 
ATOM   5628  C  CD2    . LEU B 1 57  ? 35.475  18.670 -109.361 1.00 76.24  ? 37  LEU B CD2    1 
ATOM   5629  H  H      . LEU B 1 57  ? 33.132  22.587 -110.927 1.00 65.87  ? 37  LEU B H      1 
ATOM   5630  H  HA     . LEU B 1 57  ? 35.373  22.831 -109.658 1.00 73.47  ? 37  LEU B HA     1 
ATOM   5631  H  HB2    . LEU B 1 57  ? 34.084  20.919 -109.436 1.00 80.40  ? 37  LEU B HB2    1 
ATOM   5632  H  HB3    . LEU B 1 57  ? 34.376  20.528 -110.942 1.00 80.40  ? 37  LEU B HB3    1 
ATOM   5633  H  HG     . LEU B 1 57  ? 36.566  20.024 -110.423 1.00 89.01  ? 37  LEU B HG     1 
ATOM   5634  H  HD11   . LEU B 1 57  ? 37.395  20.132 -108.250 1.00 90.34  ? 37  LEU B HD11   1 
ATOM   5635  H  HD12   . LEU B 1 57  ? 36.986  21.581 -108.758 1.00 90.34  ? 37  LEU B HD12   1 
ATOM   5636  H  HD13   . LEU B 1 57  ? 36.032  20.788 -107.764 1.00 90.34  ? 37  LEU B HD13   1 
ATOM   5637  H  HD21   . LEU B 1 57  ? 36.242  18.149 -109.077 1.00 91.60  ? 37  LEU B HD21   1 
ATOM   5638  H  HD22   . LEU B 1 57  ? 34.819  18.710 -108.647 1.00 91.60  ? 37  LEU B HD22   1 
ATOM   5639  H  HD23   . LEU B 1 57  ? 35.079  18.273 -110.152 1.00 91.60  ? 37  LEU B HD23   1 
ATOM   5640  N  N      . ASP B 1 58  ? 35.778  22.455 -112.803 1.00 110.93 ? 38  ASP B N      1 
ATOM   5641  C  CA     . ASP B 1 58  ? 36.784  22.607 -113.851 1.00 118.36 ? 38  ASP B CA     1 
ATOM   5642  C  C      . ASP B 1 58  ? 37.494  23.951 -113.736 1.00 112.14 ? 38  ASP B C      1 
ATOM   5643  O  O      . ASP B 1 58  ? 38.728  24.018 -113.775 1.00 114.85 ? 38  ASP B O      1 
ATOM   5644  C  CB     . ASP B 1 58  ? 36.146  22.445 -115.231 1.00 122.81 ? 38  ASP B CB     1 
ATOM   5645  C  CG     . ASP B 1 58  ? 35.877  20.994 -115.579 1.00 127.25 ? 38  ASP B CG     1 
ATOM   5646  O  OD1    . ASP B 1 58  ? 36.633  20.118 -115.106 1.00 129.32 ? 38  ASP B OD1    1 
ATOM   5647  O  OD2    . ASP B 1 58  ? 34.918  20.728 -116.332 1.00 129.20 ? 38  ASP B OD2    1 
ATOM   5648  H  H      . ASP B 1 58  ? 34.974  22.340 -113.085 1.00 133.23 ? 38  ASP B H      1 
ATOM   5649  H  HA     . ASP B 1 58  ? 37.450  21.910 -113.749 1.00 142.15 ? 38  ASP B HA     1 
ATOM   5650  H  HB2    . ASP B 1 58  ? 35.301  22.920 -115.248 1.00 147.49 ? 38  ASP B HB2    1 
ATOM   5651  H  HB3    . ASP B 1 58  ? 36.745  22.809 -115.902 1.00 147.49 ? 38  ASP B HB3    1 
ATOM   5652  N  N      . CYS B 1 59  ? 36.731  25.036 -113.594 1.00 94.44  ? 39  CYS B N      1 
ATOM   5653  C  CA     . CYS B 1 59  ? 37.340  26.353 -113.434 1.00 86.62  ? 39  CYS B CA     1 
ATOM   5654  C  C      . CYS B 1 59  ? 38.229  26.394 -112.197 1.00 78.50  ? 39  CYS B C      1 
ATOM   5655  O  O      . CYS B 1 59  ? 39.376  26.858 -112.255 1.00 83.41  ? 39  CYS B O      1 
ATOM   5656  C  CB     . CYS B 1 59  ? 36.251  27.424 -113.350 1.00 82.88  ? 39  CYS B CB     1 
ATOM   5657  S  SG     . CYS B 1 59  ? 35.063  27.392 -114.710 1.00 83.49  ? 39  CYS B SG     1 
ATOM   5658  H  H      . CYS B 1 59  ? 35.871  25.035 -113.587 1.00 113.44 ? 39  CYS B H      1 
ATOM   5659  H  HA     . CYS B 1 59  ? 37.891  26.544 -114.209 1.00 104.06 ? 39  CYS B HA     1 
ATOM   5660  H  HB2    . CYS B 1 59  ? 35.757  27.300 -112.524 1.00 99.57  ? 39  CYS B HB2    1 
ATOM   5661  H  HB3    . CYS B 1 59  ? 36.675  28.297 -113.349 1.00 99.57  ? 39  CYS B HB3    1 
ATOM   5662  H  HG     . CYS B 1 59  ? 34.258  28.267 -114.547 1.00 100.31 ? 39  CYS B HG     1 
ATOM   5663  N  N      . VAL B 1 60  ? 37.713  25.913 -111.063 1.00 61.62  ? 40  VAL B N      1 
ATOM   5664  C  CA     . VAL B 1 60  ? 38.506  25.894 -109.834 1.00 57.77  ? 40  VAL B CA     1 
ATOM   5665  C  C      . VAL B 1 60  ? 39.847  25.217 -110.087 1.00 63.79  ? 40  VAL B C      1 
ATOM   5666  O  O      . VAL B 1 60  ? 40.906  25.725 -109.699 1.00 60.11  ? 40  VAL B O      1 
ATOM   5667  C  CB     . VAL B 1 60  ? 37.729  25.201 -108.701 1.00 57.49  ? 40  VAL B CB     1 
ATOM   5668  C  CG1    . VAL B 1 60  ? 38.589  25.099 -107.440 1.00 58.45  ? 40  VAL B CG1    1 
ATOM   5669  C  CG2    . VAL B 1 60  ? 36.441  25.953 -108.405 1.00 56.38  ? 40  VAL B CG2    1 
ATOM   5670  H  H      . VAL B 1 60  ? 36.918  25.596 -110.980 1.00 74.07  ? 40  VAL B H      1 
ATOM   5671  H  HA     . VAL B 1 60  ? 38.681  26.808 -109.560 1.00 69.44  ? 40  VAL B HA     1 
ATOM   5672  H  HB     . VAL B 1 60  ? 37.496  24.302 -108.980 1.00 69.10  ? 40  VAL B HB     1 
ATOM   5673  H  HG11   . VAL B 1 60  ? 38.077  24.659 -106.744 1.00 70.26  ? 40  VAL B HG11   1 
ATOM   5674  H  HG12   . VAL B 1 60  ? 39.385  24.583 -107.642 1.00 70.26  ? 40  VAL B HG12   1 
ATOM   5675  H  HG13   . VAL B 1 60  ? 38.837  25.992 -107.155 1.00 70.26  ? 40  VAL B HG13   1 
ATOM   5676  H  HG21   . VAL B 1 60  ? 35.969  25.500 -107.689 1.00 67.78  ? 40  VAL B HG21   1 
ATOM   5677  H  HG22   . VAL B 1 60  ? 36.660  26.859 -108.136 1.00 67.78  ? 40  VAL B HG22   1 
ATOM   5678  H  HG23   . VAL B 1 60  ? 35.894  25.969 -109.206 1.00 67.78  ? 40  VAL B HG23   1 
ATOM   5679  N  N      . ALA B 1 61  ? 39.819  24.057 -110.746 1.00 76.54  ? 41  ALA B N      1 
ATOM   5680  C  CA     . ALA B 1 61  ? 41.060  23.355 -111.051 1.00 82.43  ? 41  ALA B CA     1 
ATOM   5681  C  C      . ALA B 1 61  ? 41.950  24.186 -111.966 1.00 83.93  ? 41  ALA B C      1 
ATOM   5682  O  O      . ALA B 1 61  ? 43.178  24.189 -111.817 1.00 78.16  ? 41  ALA B O      1 
ATOM   5683  C  CB     . ALA B 1 61  ? 40.752  22.000 -111.687 1.00 84.31  ? 41  ALA B CB     1 
ATOM   5684  H  H      . ALA B 1 61  ? 39.106  23.663 -111.022 1.00 91.96  ? 41  ALA B H      1 
ATOM   5685  H  HA     . ALA B 1 61  ? 41.544  23.196 -110.225 1.00 99.03  ? 41  ALA B HA     1 
ATOM   5686  H  HB1    . ALA B 1 61  ? 41.587  21.547 -111.883 1.00 101.29 ? 41  ALA B HB1    1 
ATOM   5687  H  HB2    . ALA B 1 61  ? 40.227  21.472 -111.066 1.00 101.29 ? 41  ALA B HB2    1 
ATOM   5688  H  HB3    . ALA B 1 61  ? 40.253  22.143 -112.506 1.00 101.29 ? 41  ALA B HB3    1 
ATOM   5689  N  N      . ALA B 1 62  ? 41.348  24.897 -112.923 1.00 98.11  ? 42  ALA B N      1 
ATOM   5690  C  CA     . ALA B 1 62  ? 42.127  25.759 -113.805 1.00 97.66  ? 42  ALA B CA     1 
ATOM   5691  C  C      . ALA B 1 62  ? 42.874  26.823 -113.010 1.00 94.25  ? 42  ALA B C      1 
ATOM   5692  O  O      . ALA B 1 62  ? 43.997  27.200 -113.366 1.00 98.78  ? 42  ALA B O      1 
ATOM   5693  C  CB     . ALA B 1 62  ? 41.218  26.406 -114.848 1.00 95.82  ? 42  ALA B CB     1 
ATOM   5694  H  H      . ALA B 1 62  ? 40.502  24.896 -113.079 1.00 117.85 ? 42  ALA B H      1 
ATOM   5695  H  HA     . ALA B 1 62  ? 42.784  25.220 -114.273 1.00 117.31 ? 42  ALA B HA     1 
ATOM   5696  H  HB1    . ALA B 1 62  ? 41.753  26.975 -115.424 1.00 115.11 ? 42  ALA B HB1    1 
ATOM   5697  H  HB2    . ALA B 1 62  ? 40.794  25.709 -115.373 1.00 115.11 ? 42  ALA B HB2    1 
ATOM   5698  H  HB3    . ALA B 1 62  ? 40.544  26.936 -114.394 1.00 115.11 ? 42  ALA B HB3    1 
ATOM   5699  N  N      . VAL B 1 63  ? 42.269  27.320 -111.930 1.00 80.09  ? 43  VAL B N      1 
ATOM   5700  C  CA     . VAL B 1 63  ? 42.971  28.266 -111.066 1.00 75.12  ? 43  VAL B CA     1 
ATOM   5701  C  C      . VAL B 1 63  ? 44.011  27.536 -110.227 1.00 76.35  ? 43  VAL B C      1 
ATOM   5702  O  O      . VAL B 1 63  ? 45.171  27.956 -110.139 1.00 73.58  ? 43  VAL B O      1 
ATOM   5703  C  CB     . VAL B 1 63  ? 41.975  29.028 -110.174 1.00 73.14  ? 43  VAL B CB     1 
ATOM   5704  C  CG1    . VAL B 1 63  ? 42.710  30.051 -109.308 1.00 72.39  ? 43  VAL B CG1    1 
ATOM   5705  C  CG2    . VAL B 1 63  ? 40.911  29.706 -111.010 1.00 73.87  ? 43  VAL B CG2    1 
ATOM   5706  H  H      . VAL B 1 63  ? 41.468  27.130 -111.680 1.00 96.22  ? 43  VAL B H      1 
ATOM   5707  H  HA     . VAL B 1 63  ? 43.434  28.914 -111.620 1.00 90.26  ? 43  VAL B HA     1 
ATOM   5708  H  HB     . VAL B 1 63  ? 41.535  28.397 -109.583 1.00 87.88  ? 43  VAL B HB     1 
ATOM   5709  H  HG11   . VAL B 1 63  ? 42.064  30.518 -108.756 1.00 86.98  ? 43  VAL B HG11   1 
ATOM   5710  H  HG12   . VAL B 1 63  ? 43.351  29.588 -108.748 1.00 86.98  ? 43  VAL B HG12   1 
ATOM   5711  H  HG13   . VAL B 1 63  ? 43.169  30.681 -109.886 1.00 86.98  ? 43  VAL B HG13   1 
ATOM   5712  H  HG21   . VAL B 1 63  ? 40.300  30.177 -110.422 1.00 88.76  ? 43  VAL B HG21   1 
ATOM   5713  H  HG22   . VAL B 1 63  ? 41.337  30.333 -111.615 1.00 88.76  ? 43  VAL B HG22   1 
ATOM   5714  H  HG23   . VAL B 1 63  ? 40.430  29.032 -111.516 1.00 88.76  ? 43  VAL B HG23   1 
ATOM   5715  N  N      . ASP B 1 64  ? 43.611  26.435 -109.600 1.00 81.15  ? 44  ASP B N      1 
ATOM   5716  C  CA     . ASP B 1 64  ? 44.488  25.668 -108.727 1.00 84.90  ? 44  ASP B CA     1 
ATOM   5717  C  C      . ASP B 1 64  ? 43.955  24.241 -108.631 1.00 87.01  ? 44  ASP B C      1 
ATOM   5718  O  O      . ASP B 1 64  ? 42.819  24.041 -108.184 1.00 87.37  ? 44  ASP B O      1 
ATOM   5719  C  CB     . ASP B 1 64  ? 44.566  26.319 -107.345 1.00 80.08  ? 44  ASP B CB     1 
ATOM   5720  C  CG     . ASP B 1 64  ? 45.640  25.707 -106.466 1.00 80.38  ? 44  ASP B CG     1 
ATOM   5721  O  OD1    . ASP B 1 64  ? 45.922  24.501 -106.611 1.00 81.57  ? 44  ASP B OD1    1 
ATOM   5722  O  OD2    . ASP B 1 64  ? 46.205  26.439 -105.626 1.00 79.97  ? 44  ASP B OD2    1 
ATOM   5723  H  H      . ASP B 1 64  ? 42.819  26.107 -109.666 1.00 97.50  ? 44  ASP B H      1 
ATOM   5724  H  HA     . ASP B 1 64  ? 45.381  25.640 -109.107 1.00 102.00 ? 44  ASP B HA     1 
ATOM   5725  H  HB2    . ASP B 1 64  ? 44.766  27.262 -107.451 1.00 96.21  ? 44  ASP B HB2    1 
ATOM   5726  H  HB3    . ASP B 1 64  ? 43.713  26.209 -106.896 1.00 96.21  ? 44  ASP B HB3    1 
ATOM   5727  N  N      . PRO B 1 65  ? 44.727  23.225 -109.035 1.00 94.95  ? 45  PRO B N      1 
ATOM   5728  C  CA     . PRO B 1 65  ? 44.201  21.851 -109.008 1.00 93.78  ? 45  PRO B CA     1 
ATOM   5729  C  C      . PRO B 1 65  ? 44.133  21.230 -107.623 1.00 89.44  ? 45  PRO B C      1 
ATOM   5730  O  O      . PRO B 1 65  ? 43.517  20.166 -107.474 1.00 89.99  ? 45  PRO B O      1 
ATOM   5731  C  CB     . PRO B 1 65  ? 45.185  21.081 -109.902 1.00 97.26  ? 45  PRO B CB     1 
ATOM   5732  C  CG     . PRO B 1 65  ? 46.444  21.877 -109.899 1.00 98.63  ? 45  PRO B CG     1 
ATOM   5733  C  CD     . PRO B 1 65  ? 46.134  23.281 -109.472 1.00 96.88  ? 45  PRO B CD     1 
ATOM   5734  H  HA     . PRO B 1 65  ? 43.320  21.824 -109.411 1.00 112.65 ? 45  PRO B HA     1 
ATOM   5735  H  HB2    . PRO B 1 65  ? 45.339  20.198 -109.531 1.00 116.83 ? 45  PRO B HB2    1 
ATOM   5736  H  HB3    . PRO B 1 65  ? 44.825  21.016 -110.801 1.00 116.83 ? 45  PRO B HB3    1 
ATOM   5737  H  HG2    . PRO B 1 65  ? 47.071  21.473 -109.279 1.00 118.48 ? 45  PRO B HG2    1 
ATOM   5738  H  HG3    . PRO B 1 65  ? 46.818  21.878 -110.794 1.00 118.48 ? 45  PRO B HG3    1 
ATOM   5739  H  HD2    . PRO B 1 65  ? 46.705  23.541 -108.733 1.00 116.37 ? 45  PRO B HD2    1 
ATOM   5740  H  HD3    . PRO B 1 65  ? 46.229  23.889 -110.222 1.00 116.37 ? 45  PRO B HD3    1 
ATOM   5741  N  N      . LEU B 1 66  ? 44.740  21.849 -106.612 1.00 77.61  ? 46  LEU B N      1 
ATOM   5742  C  CA     . LEU B 1 66  ? 44.740  21.320 -105.255 1.00 79.20  ? 46  LEU B CA     1 
ATOM   5743  C  C      . LEU B 1 66  ? 43.643  21.911 -104.376 1.00 83.24  ? 46  LEU B C      1 
ATOM   5744  O  O      . LEU B 1 66  ? 43.464  21.450 -103.243 1.00 81.08  ? 46  LEU B O      1 
ATOM   5745  C  CB     . LEU B 1 66  ? 46.112  21.550 -104.605 1.00 79.90  ? 46  LEU B CB     1 
ATOM   5746  C  CG     . LEU B 1 66  ? 47.073  20.354 -104.602 1.00 81.62  ? 46  LEU B CG     1 
ATOM   5747  C  CD1    . LEU B 1 66  ? 47.099  19.614 -105.940 1.00 82.54  ? 46  LEU B CD1    1 
ATOM   5748  C  CD2    . LEU B 1 66  ? 48.475  20.812 -104.233 1.00 83.94  ? 46  LEU B CD2    1 
ATOM   5749  H  H      . LEU B 1 66  ? 45.166  22.592 -106.691 1.00 93.24  ? 46  LEU B H      1 
ATOM   5750  H  HA     . LEU B 1 66  ? 44.594  20.362 -105.299 1.00 95.16  ? 46  LEU B HA     1 
ATOM   5751  H  HB2    . LEU B 1 66  ? 46.554  22.273 -105.076 1.00 96.00  ? 46  LEU B HB2    1 
ATOM   5752  H  HB3    . LEU B 1 66  ? 45.971  21.808 -103.680 1.00 96.00  ? 46  LEU B HB3    1 
ATOM   5753  H  HG     . LEU B 1 66  ? 46.782  19.724 -103.924 1.00 98.07  ? 46  LEU B HG     1 
ATOM   5754  H  HD11   . LEU B 1 66  ? 47.721  18.872 -105.878 1.00 99.17  ? 46  LEU B HD11   1 
ATOM   5755  H  HD12   . LEU B 1 66  ? 46.208  19.285 -106.135 1.00 99.17  ? 46  LEU B HD12   1 
ATOM   5756  H  HD13   . LEU B 1 66  ? 47.385  20.229 -106.634 1.00 99.17  ? 46  LEU B HD13   1 
ATOM   5757  H  HD21   . LEU B 1 66  ? 49.069  20.045 -104.236 1.00 100.84 ? 46  LEU B HD21   1 
ATOM   5758  H  HD22   . LEU B 1 66  ? 48.775  21.465 -104.884 1.00 100.84 ? 46  LEU B HD22   1 
ATOM   5759  H  HD23   . LEU B 1 66  ? 48.454  21.211 -103.349 1.00 100.84 ? 46  LEU B HD23   1 
ATOM   5760  N  N      . MET B 1 67  ? 42.912  22.909 -104.863 1.00 91.82  ? 47  MET B N      1 
ATOM   5761  C  CA     . MET B 1 67  ? 41.830  23.502 -104.091 1.00 92.00  ? 47  MET B CA     1 
ATOM   5762  C  C      . MET B 1 67  ? 40.619  22.576 -104.069 1.00 91.38  ? 47  MET B C      1 
ATOM   5763  O  O      . MET B 1 67  ? 40.386  21.802 -105.001 1.00 92.22  ? 47  MET B O      1 
ATOM   5764  C  CB     . MET B 1 67  ? 41.425  24.847 -104.694 1.00 94.76  ? 47  MET B CB     1 
ATOM   5765  C  CG     . MET B 1 67  ? 42.360  25.997 -104.376 1.00 99.31  ? 47  MET B CG     1 
ATOM   5766  S  SD     . MET B 1 67  ? 42.226  26.546 -102.667 1.00 100.83 ? 47  MET B SD     1 
ATOM   5767  C  CE     . MET B 1 67  ? 43.117  28.097 -102.747 1.00 103.60 ? 47  MET B CE     1 
ATOM   5768  H  H      . MET B 1 67  ? 43.023  23.260 -105.640 1.00 110.30 ? 47  MET B H      1 
ATOM   5769  H  HA     . MET B 1 67  ? 42.132  23.655 -103.182 1.00 110.52 ? 47  MET B HA     1 
ATOM   5770  H  HB2    . MET B 1 67  ? 41.392  24.755 -105.659 1.00 113.83 ? 47  MET B HB2    1 
ATOM   5771  H  HB3    . MET B 1 67  ? 40.546  25.083 -104.360 1.00 113.83 ? 47  MET B HB3    1 
ATOM   5772  H  HG2    . MET B 1 67  ? 43.275  25.712 -104.529 1.00 119.29 ? 47  MET B HG2    1 
ATOM   5773  H  HG3    . MET B 1 67  ? 42.145  26.748 -104.951 1.00 119.29 ? 47  MET B HG3    1 
ATOM   5774  H  HE1    . MET B 1 67  ? 43.118  28.506 -101.868 1.00 124.44 ? 47  MET B HE1    1 
ATOM   5775  H  HE2    . MET B 1 67  ? 44.027  27.923 -103.033 1.00 124.44 ? 47  MET B HE2    1 
ATOM   5776  H  HE3    . MET B 1 67  ? 42.675  28.681 -103.383 1.00 124.44 ? 47  MET B HE3    1 
ATOM   5777  N  N      . ARG B 1 68  ? 39.844  22.659 -102.989 1.00 93.00  ? 48  ARG B N      1 
ATOM   5778  C  CA     . ARG B 1 68  ? 38.654  21.836 -102.830 1.00 92.30  ? 48  ARG B CA     1 
ATOM   5779  C  C      . ARG B 1 68  ? 37.404  22.702 -102.915 1.00 85.02  ? 48  ARG B C      1 
ATOM   5780  O  O      . ARG B 1 68  ? 37.409  23.872 -102.520 1.00 83.61  ? 48  ARG B O      1 
ATOM   5781  C  CB     . ARG B 1 68  ? 38.660  21.086 -101.495 1.00 96.97  ? 48  ARG B CB     1 
ATOM   5782  C  CG     . ARG B 1 68  ? 39.718  20.003 -101.377 1.00 104.29 ? 48  ARG B CG     1 
ATOM   5783  C  CD     . ARG B 1 68  ? 39.838  19.532 -99.936  1.00 108.98 ? 48  ARG B CD     1 
ATOM   5784  N  NE     . ARG B 1 68  ? 40.887  18.534 -99.760  1.00 114.74 ? 48  ARG B NE     1 
ATOM   5785  C  CZ     . ARG B 1 68  ? 42.187  18.808 -99.782  1.00 120.48 ? 48  ARG B CZ     1 
ATOM   5786  N  NH1    . ARG B 1 68  ? 42.602  20.052 -99.984  1.00 122.95 ? 48  ARG B NH1    1 
ATOM   5787  N  NH2    . ARG B 1 68  ? 43.074  17.838 -99.608  1.00 122.57 ? 48  ARG B NH2    1 
ATOM   5788  H  H      . ARG B 1 68  ? 39.989  23.191 -102.329 1.00 111.72 ? 48  ARG B H      1 
ATOM   5789  H  HA     . ARG B 1 68  ? 38.620  21.182 -103.546 1.00 110.88 ? 48  ARG B HA     1 
ATOM   5790  H  HB2    . ARG B 1 68  ? 38.815  21.725 -100.782 1.00 116.48 ? 48  ARG B HB2    1 
ATOM   5791  H  HB3    . ARG B 1 68  ? 37.795  20.665 -101.373 1.00 116.48 ? 48  ARG B HB3    1 
ATOM   5792  H  HG2    . ARG B 1 68  ? 39.468  19.245 -101.928 1.00 125.26 ? 48  ARG B HG2    1 
ATOM   5793  H  HG3    . ARG B 1 68  ? 40.576  20.357 -101.657 1.00 125.26 ? 48  ARG B HG3    1 
ATOM   5794  H  HD2    . ARG B 1 68  ? 40.048  20.292 -99.371  1.00 130.89 ? 48  ARG B HD2    1 
ATOM   5795  H  HD3    . ARG B 1 68  ? 38.997  19.136 -99.662  1.00 130.89 ? 48  ARG B HD3    1 
ATOM   5796  H  HE     . ARG B 1 68  ? 40.651  17.711 -99.680  1.00 137.81 ? 48  ARG B HE     1 
ATOM   5797  H  HH11   . ARG B 1 68  ? 42.029  20.683 -100.097 1.00 147.66 ? 48  ARG B HH11   1 
ATOM   5798  H  HH12   . ARG B 1 68  ? 43.444  20.227 -100.000 1.00 147.66 ? 48  ARG B HH12   1 
ATOM   5799  H  HH21   . ARG B 1 68  ? 42.808  17.030 -99.479  1.00 147.20 ? 48  ARG B HH21   1 
ATOM   5800  H  HH22   . ARG B 1 68  ? 43.915  18.016 -99.626  1.00 147.20 ? 48  ARG B HH22   1 
ATOM   5801  N  N      . LEU B 1 69  ? 36.330  22.107 -103.430 1.00 78.02  ? 49  LEU B N      1 
ATOM   5802  C  CA     . LEU B 1 69  ? 35.057  22.789 -103.628 1.00 72.73  ? 49  LEU B CA     1 
ATOM   5803  C  C      . LEU B 1 69  ? 34.005  22.135 -102.743 1.00 73.47  ? 49  LEU B C      1 
ATOM   5804  O  O      . LEU B 1 69  ? 33.879  20.907 -102.730 1.00 77.31  ? 49  LEU B O      1 
ATOM   5805  C  CB     . LEU B 1 69  ? 34.630  22.731 -105.098 1.00 67.43  ? 49  LEU B CB     1 
ATOM   5806  C  CG     . LEU B 1 69  ? 33.354  23.493 -105.462 1.00 61.83  ? 49  LEU B CG     1 
ATOM   5807  C  CD1    . LEU B 1 69  ? 33.566  24.991 -105.302 1.00 60.06  ? 49  LEU B CD1    1 
ATOM   5808  C  CD2    . LEU B 1 69  ? 32.913  23.158 -106.876 1.00 61.10  ? 49  LEU B CD2    1 
ATOM   5809  H  H      . LEU B 1 69  ? 36.316  21.285 -103.680 1.00 93.74  ? 49  LEU B H      1 
ATOM   5810  H  HA     . LEU B 1 69  ? 35.144  23.719 -103.369 1.00 87.39  ? 49  LEU B HA     1 
ATOM   5811  H  HB2    . LEU B 1 69  ? 35.348  23.096 -105.638 1.00 81.03  ? 49  LEU B HB2    1 
ATOM   5812  H  HB3    . LEU B 1 69  ? 34.489  21.801 -105.337 1.00 81.03  ? 49  LEU B HB3    1 
ATOM   5813  H  HG     . LEU B 1 69  ? 32.645  23.225 -104.857 1.00 74.31  ? 49  LEU B HG     1 
ATOM   5814  H  HD11   . LEU B 1 69  ? 32.746  25.452 -105.538 1.00 72.18  ? 49  LEU B HD11   1 
ATOM   5815  H  HD12   . LEU B 1 69  ? 33.798  25.180 -104.379 1.00 72.18  ? 49  LEU B HD12   1 
ATOM   5816  H  HD13   . LEU B 1 69  ? 34.285  25.272 -105.889 1.00 72.18  ? 49  LEU B HD13   1 
ATOM   5817  H  HD21   . LEU B 1 69  ? 32.104  23.653 -107.080 1.00 73.44  ? 49  LEU B HD21   1 
ATOM   5818  H  HD22   . LEU B 1 69  ? 33.618  23.406 -107.494 1.00 73.44  ? 49  LEU B HD22   1 
ATOM   5819  H  HD23   . LEU B 1 69  ? 32.741  22.205 -106.936 1.00 73.44  ? 49  LEU B HD23   1 
ATOM   5820  N  N      . TYR B 1 70  ? 33.254  22.953 -102.006 1.00 68.80  ? 50  TYR B N      1 
ATOM   5821  C  CA     . TYR B 1 70  ? 32.245  22.465 -101.076 1.00 65.83  ? 50  TYR B CA     1 
ATOM   5822  C  C      . TYR B 1 70  ? 30.910  23.151 -101.329 1.00 63.07  ? 50  TYR B C      1 
ATOM   5823  O  O      . TYR B 1 70  ? 30.862  24.339 -101.664 1.00 61.48  ? 50  TYR B O      1 
ATOM   5824  C  CB     . TYR B 1 70  ? 32.676  22.693 -99.623  1.00 66.36  ? 50  TYR B CB     1 
ATOM   5825  C  CG     . TYR B 1 70  ? 33.560  21.600 -99.070  1.00 67.66  ? 50  TYR B CG     1 
ATOM   5826  C  CD1    . TYR B 1 70  ? 34.890  21.493 -99.455  1.00 69.76  ? 50  TYR B CD1    1 
ATOM   5827  C  CD2    . TYR B 1 70  ? 33.066  20.674 -98.160  1.00 65.39  ? 50  TYR B CD2    1 
ATOM   5828  C  CE1    . TYR B 1 70  ? 35.702  20.494 -98.951  1.00 69.23  ? 50  TYR B CE1    1 
ATOM   5829  C  CE2    . TYR B 1 70  ? 33.870  19.673 -97.650  1.00 64.61  ? 50  TYR B CE2    1 
ATOM   5830  C  CZ     . TYR B 1 70  ? 35.187  19.587 -98.049  1.00 66.05  ? 50  TYR B CZ     1 
ATOM   5831  O  OH     . TYR B 1 70  ? 35.992  18.593 -97.545  1.00 64.48  ? 50  TYR B OH     1 
ATOM   5832  H  H      . TYR B 1 70  ? 33.313  23.811 -102.030 1.00 82.68  ? 50  TYR B H      1 
ATOM   5833  H  HA     . TYR B 1 70  ? 32.125  21.511 -101.209 1.00 79.11  ? 50  TYR B HA     1 
ATOM   5834  H  HB2    . TYR B 1 70  ? 33.169  23.527 -99.571  1.00 79.75  ? 50  TYR B HB2    1 
ATOM   5835  H  HB3    . TYR B 1 70  ? 31.884  22.745 -99.066  1.00 79.75  ? 50  TYR B HB3    1 
ATOM   5836  H  HD1    . TYR B 1 70  ? 35.240  22.103 -100.063 1.00 83.83  ? 50  TYR B HD1    1 
ATOM   5837  H  HD2    . TYR B 1 70  ? 32.178  20.729 -97.889  1.00 78.58  ? 50  TYR B HD2    1 
ATOM   5838  H  HE1    . TYR B 1 70  ? 36.591  20.435 -99.218  1.00 83.19  ? 50  TYR B HE1    1 
ATOM   5839  H  HE2    . TYR B 1 70  ? 33.525  19.060 -97.042  1.00 77.65  ? 50  TYR B HE2    1 
ATOM   5840  H  HH     . TYR B 1 70  ? 35.556  18.113 -97.010  1.00 77.50  ? 50  TYR B HH     1 
ATOM   5841  N  N      . THR B 1 71  ? 29.831  22.389 -101.163 1.00 61.13  ? 51  THR B N      1 
ATOM   5842  C  CA     . THR B 1 71  ? 28.468  22.852 -101.376 1.00 58.38  ? 51  THR B CA     1 
ATOM   5843  C  C      . THR B 1 71  ? 27.764  23.067 -100.041 1.00 54.04  ? 51  THR B C      1 
ATOM   5844  O  O      . THR B 1 71  ? 28.020  22.355 -99.066  1.00 52.02  ? 51  THR B O      1 
ATOM   5845  C  CB     . THR B 1 71  ? 27.674  21.839 -102.210 1.00 57.02  ? 51  THR B CB     1 
ATOM   5846  O  OG1    . THR B 1 71  ? 28.414  21.497 -103.388 1.00 57.06  ? 51  THR B OG1    1 
ATOM   5847  C  CG2    . THR B 1 71  ? 26.317  22.405 -102.609 1.00 56.50  ? 51  THR B CG2    1 
ATOM   5848  H  H      . THR B 1 71  ? 29.870  21.566 -100.916 1.00 73.47  ? 51  THR B H      1 
ATOM   5849  H  HA     . THR B 1 71  ? 28.485  23.696 -101.853 1.00 70.18  ? 51  THR B HA     1 
ATOM   5850  H  HB     . THR B 1 71  ? 27.526  21.039 -101.683 1.00 68.55  ? 51  THR B HB     1 
ATOM   5851  H  HG1    . THR B 1 71  ? 29.153  21.159 -103.175 1.00 68.59  ? 51  THR B HG1    1 
ATOM   5852  H  HG21   . THR B 1 71  ? 25.828  21.752 -103.135 1.00 67.92  ? 51  THR B HG21   1 
ATOM   5853  H  HG22   . THR B 1 71  ? 25.801  22.620 -101.816 1.00 67.92  ? 51  THR B HG22   1 
ATOM   5854  H  HG23   . THR B 1 71  ? 26.435  23.210 -103.136 1.00 67.92  ? 51  THR B HG23   1 
ATOM   5855  N  N      . PHE B 1 72  ? 26.875  24.058 -100.002 1.00 51.55  ? 52  PHE B N      1 
ATOM   5856  C  CA     . PHE B 1 72  ? 26.007  24.256 -98.846  1.00 45.90  ? 52  PHE B CA     1 
ATOM   5857  C  C      . PHE B 1 72  ? 24.762  25.014 -99.297  1.00 44.12  ? 52  PHE B C      1 
ATOM   5858  O  O      . PHE B 1 72  ? 24.564  25.273 -100.487 1.00 44.90  ? 52  PHE B O      1 
ATOM   5859  C  CB     . PHE B 1 72  ? 26.738  24.977 -97.705  1.00 40.72  ? 52  PHE B CB     1 
ATOM   5860  C  CG     . PHE B 1 72  ? 27.206  26.363 -98.047  1.00 38.99  ? 52  PHE B CG     1 
ATOM   5861  C  CD1    . PHE B 1 72  ? 28.327  26.556 -98.836  1.00 37.14  ? 52  PHE B CD1    1 
ATOM   5862  C  CD2    . PHE B 1 72  ? 26.536  27.475 -97.561  1.00 39.43  ? 52  PHE B CD2    1 
ATOM   5863  C  CE1    . PHE B 1 72  ? 28.765  27.831 -99.143  1.00 37.47  ? 52  PHE B CE1    1 
ATOM   5864  C  CE2    . PHE B 1 72  ? 26.970  28.752 -97.864  1.00 37.82  ? 52  PHE B CE2    1 
ATOM   5865  C  CZ     . PHE B 1 72  ? 28.085  28.930 -98.656  1.00 37.36  ? 52  PHE B CZ     1 
ATOM   5866  H  H      . PHE B 1 72  ? 26.755  24.628 -100.634 1.00 61.98  ? 52  PHE B H      1 
ATOM   5867  H  HA     . PHE B 1 72  ? 25.723  23.390 -98.515  1.00 55.20  ? 52  PHE B HA     1 
ATOM   5868  H  HB2    . PHE B 1 72  ? 26.137  25.047 -96.947  1.00 48.99  ? 52  PHE B HB2    1 
ATOM   5869  H  HB3    . PHE B 1 72  ? 27.517  24.455 -97.457  1.00 48.99  ? 52  PHE B HB3    1 
ATOM   5870  H  HD1    . PHE B 1 72  ? 28.789  25.820 -99.166  1.00 44.69  ? 52  PHE B HD1    1 
ATOM   5871  H  HD2    . PHE B 1 72  ? 25.784  27.360 -97.026  1.00 47.43  ? 52  PHE B HD2    1 
ATOM   5872  H  HE1    . PHE B 1 72  ? 29.517  27.949 -99.677  1.00 45.09  ? 52  PHE B HE1    1 
ATOM   5873  H  HE2    . PHE B 1 72  ? 26.509  29.490 -97.535  1.00 45.51  ? 52  PHE B HE2    1 
ATOM   5874  H  HZ     . PHE B 1 72  ? 28.378  29.788 -98.863  1.00 44.95  ? 52  PHE B HZ     1 
ATOM   5875  N  N      . GLY B 1 73  ? 23.915  25.353 -98.332  1.00 41.08  ? 53  GLY B N      1 
ATOM   5876  C  CA     . GLY B 1 73  ? 22.662  26.031 -98.601  1.00 39.81  ? 53  GLY B CA     1 
ATOM   5877  C  C      . GLY B 1 73  ? 21.464  25.101 -98.577  1.00 40.83  ? 53  GLY B C      1 
ATOM   5878  O  O      . GLY B 1 73  ? 21.510  23.975 -98.076  1.00 43.89  ? 53  GLY B O      1 
ATOM   5879  H  H      . GLY B 1 73  ? 24.051  25.197 -97.497  1.00 49.42  ? 53  GLY B H      1 
ATOM   5880  H  HA2    . GLY B 1 73  ? 22.523  26.724 -97.936  1.00 47.89  ? 53  GLY B HA2    1 
ATOM   5881  H  HA3    . GLY B 1 73  ? 22.705  26.450 -99.474  1.00 47.89  ? 53  GLY B HA3    1 
ATOM   5882  N  N      . SER B 1 74  ? 20.363  25.597 -99.151  1.00 38.20  ? 54  SER B N      1 
ATOM   5883  C  CA     . SER B 1 74  ? 19.105  24.855 -99.119  1.00 36.15  ? 54  SER B CA     1 
ATOM   5884  C  C      . SER B 1 74  ? 19.232  23.492 -99.789  1.00 33.87  ? 54  SER B C      1 
ATOM   5885  O  O      . SER B 1 74  ? 18.547  22.541 -99.391  1.00 31.06  ? 54  SER B O      1 
ATOM   5886  C  CB     . SER B 1 74  ? 18.000  25.675 -99.786  1.00 39.33  ? 54  SER B CB     1 
ATOM   5887  O  OG     . SER B 1 74  ? 18.317  25.963 -101.137 1.00 42.67  ? 54  SER B OG     1 
ATOM   5888  H  H      . SER B 1 74  ? 20.320  26.353 -99.560  1.00 45.95  ? 54  SER B H      1 
ATOM   5889  H  HA     . SER B 1 74  ? 18.851  24.709 -98.195  1.00 43.50  ? 54  SER B HA     1 
ATOM   5890  H  HB2    . SER B 1 74  ? 17.173  25.169 -99.758  1.00 47.31  ? 54  SER B HB2    1 
ATOM   5891  H  HB3    . SER B 1 74  ? 17.893  26.510 -99.303  1.00 47.31  ? 54  SER B HB3    1 
ATOM   5892  H  HG     . SER B 1 74  ? 18.412  25.249 -101.568 1.00 51.32  ? 54  SER B HG     1 
ATOM   5893  N  N      . THR B 1 75  ? 20.093  23.374 -100.802 1.00 35.45  ? 55  THR B N      1 
ATOM   5894  C  CA     . THR B 1 75  ? 20.313  22.077 -101.435 1.00 38.68  ? 55  THR B CA     1 
ATOM   5895  C  C      . THR B 1 75  ? 20.758  21.040 -100.411 1.00 40.15  ? 55  THR B C      1 
ATOM   5896  O  O      . THR B 1 75  ? 20.373  19.867 -100.495 1.00 40.79  ? 55  THR B O      1 
ATOM   5897  C  CB     . THR B 1 75  ? 21.347  22.206 -102.557 1.00 38.82  ? 55  THR B CB     1 
ATOM   5898  O  OG1    . THR B 1 75  ? 20.863  23.112 -103.558 1.00 38.53  ? 55  THR B OG1    1 
ATOM   5899  C  CG2    . THR B 1 75  ? 21.629  20.850 -103.198 1.00 38.86  ? 55  THR B CG2    1 
ATOM   5900  H  H      . THR B 1 75  ? 20.554  24.019 -101.135 1.00 42.65  ? 55  THR B H      1 
ATOM   5901  H  HA     . THR B 1 75  ? 19.480  21.773 -101.828 1.00 46.54  ? 55  THR B HA     1 
ATOM   5902  H  HB     . THR B 1 75  ? 22.177  22.548 -102.190 1.00 46.71  ? 55  THR B HB     1 
ATOM   5903  H  HG1    . THR B 1 75  ? 20.729  23.869 -103.219 1.00 46.35  ? 55  THR B HG1    1 
ATOM   5904  H  HG21   . THR B 1 75  ? 22.285  20.948 -103.906 1.00 46.75  ? 55  THR B HG21   1 
ATOM   5905  H  HG22   . THR B 1 75  ? 21.973  20.234 -102.532 1.00 46.75  ? 55  THR B HG22   1 
ATOM   5906  H  HG23   . THR B 1 75  ? 20.812  20.485 -103.573 1.00 46.75  ? 55  THR B HG23   1 
ATOM   5907  N  N      . VAL B 1 76  ? 21.575  21.450 -99.444  1.00 40.68  ? 56  VAL B N      1 
ATOM   5908  C  CA     . VAL B 1 76  ? 22.053  20.540 -98.407  1.00 44.24  ? 56  VAL B CA     1 
ATOM   5909  C  C      . VAL B 1 76  ? 21.053  20.425 -97.264  1.00 46.76  ? 56  VAL B C      1 
ATOM   5910  O  O      . VAL B 1 76  ? 20.860  19.341 -96.710  1.00 46.68  ? 56  VAL B O      1 
ATOM   5911  C  CB     . VAL B 1 76  ? 23.434  21.006 -97.901  1.00 46.61  ? 56  VAL B CB     1 
ATOM   5912  C  CG1    . VAL B 1 76  ? 23.919  20.127 -96.755  1.00 45.54  ? 56  VAL B CG1    1 
ATOM   5913  C  CG2    . VAL B 1 76  ? 24.443  21.000 -99.037  1.00 49.26  ? 56  VAL B CG2    1 
ATOM   5914  H  H      . VAL B 1 76  ? 21.868  22.255 -99.366  1.00 48.93  ? 56  VAL B H      1 
ATOM   5915  H  HA     . VAL B 1 76  ? 22.162  19.657 -98.794  1.00 53.21  ? 56  VAL B HA     1 
ATOM   5916  H  HB     . VAL B 1 76  ? 23.359  21.915 -97.571  1.00 56.05  ? 56  VAL B HB     1 
ATOM   5917  H  HG11   . VAL B 1 76  ? 24.787  20.444 -96.459  1.00 54.76  ? 56  VAL B HG11   1 
ATOM   5918  H  HG12   . VAL B 1 76  ? 23.281  20.180 -96.025  1.00 54.76  ? 56  VAL B HG12   1 
ATOM   5919  H  HG13   . VAL B 1 76  ? 23.989  19.211 -97.067  1.00 54.76  ? 56  VAL B HG13   1 
ATOM   5920  H  HG21   . VAL B 1 76  ? 25.302  21.296 -98.697  1.00 59.23  ? 56  VAL B HG21   1 
ATOM   5921  H  HG22   . VAL B 1 76  ? 24.518  20.099 -99.388  1.00 59.23  ? 56  VAL B HG22   1 
ATOM   5922  H  HG23   . VAL B 1 76  ? 24.138  21.602 -99.734  1.00 59.23  ? 56  VAL B HG23   1 
ATOM   5923  N  N      . VAL B 1 77  ? 20.408  21.531 -96.890  1.00 45.81  ? 57  VAL B N      1 
ATOM   5924  C  CA     . VAL B 1 77  ? 19.484  21.507 -95.759  1.00 48.37  ? 57  VAL B CA     1 
ATOM   5925  C  C      . VAL B 1 77  ? 18.306  20.590 -96.061  1.00 46.20  ? 57  VAL B C      1 
ATOM   5926  O  O      . VAL B 1 77  ? 17.905  19.769 -95.228  1.00 47.88  ? 57  VAL B O      1 
ATOM   5927  C  CB     . VAL B 1 77  ? 19.017  22.934 -95.417  1.00 53.05  ? 57  VAL B CB     1 
ATOM   5928  C  CG1    . VAL B 1 77  ? 17.998  22.912 -94.284  1.00 54.96  ? 57  VAL B CG1    1 
ATOM   5929  C  CG2    . VAL B 1 77  ? 20.208  23.806 -95.045  1.00 54.97  ? 57  VAL B CG2    1 
ATOM   5930  H  H      . VAL B 1 77  ? 20.487  22.298 -97.271  1.00 55.09  ? 57  VAL B H      1 
ATOM   5931  H  HA     . VAL B 1 77  ? 19.947  21.151 -94.984  1.00 58.16  ? 57  VAL B HA     1 
ATOM   5932  H  HB     . VAL B 1 77  ? 18.592  23.323 -96.197  1.00 63.78  ? 57  VAL B HB     1 
ATOM   5933  H  HG11   . VAL B 1 77  ? 17.722  23.822 -94.090  1.00 66.07  ? 57  VAL B HG11   1 
ATOM   5934  H  HG12   . VAL B 1 77  ? 17.231  22.385 -94.559  1.00 66.07  ? 57  VAL B HG12   1 
ATOM   5935  H  HG13   . VAL B 1 77  ? 18.407  22.516 -93.499  1.00 66.07  ? 57  VAL B HG13   1 
ATOM   5936  H  HG21   . VAL B 1 77  ? 19.891  24.698 -94.834  1.00 66.08  ? 57  VAL B HG21   1 
ATOM   5937  H  HG22   . VAL B 1 77  ? 20.652  23.421 -94.274  1.00 66.08  ? 57  VAL B HG22   1 
ATOM   5938  H  HG23   . VAL B 1 77  ? 20.820  23.841 -95.797  1.00 66.08  ? 57  VAL B HG23   1 
ATOM   5939  N  N      . TYR B 1 78  ? 17.736  20.715 -97.258  1.00 44.78  ? 58  TYR B N      1 
ATOM   5940  C  CA     . TYR B 1 78  ? 16.601  19.885 -97.642  1.00 40.71  ? 58  TYR B CA     1 
ATOM   5941  C  C      . TYR B 1 78  ? 17.022  18.603 -98.342  1.00 41.73  ? 58  TYR B C      1 
ATOM   5942  O  O      . TYR B 1 78  ? 16.287  17.609 -98.294  1.00 43.30  ? 58  TYR B O      1 
ATOM   5943  C  CB     . TYR B 1 78  ? 15.660  20.666 -98.564  1.00 40.79  ? 58  TYR B CB     1 
ATOM   5944  C  CG     . TYR B 1 78  ? 15.037  21.891 -97.932  1.00 43.09  ? 58  TYR B CG     1 
ATOM   5945  C  CD1    . TYR B 1 78  ? 14.924  22.011 -96.552  1.00 41.52  ? 58  TYR B CD1    1 
ATOM   5946  C  CD2    . TYR B 1 78  ? 14.560  22.930 -98.721  1.00 45.62  ? 58  TYR B CD2    1 
ATOM   5947  C  CE1    . TYR B 1 78  ? 14.356  23.130 -95.980  1.00 41.18  ? 58  TYR B CE1    1 
ATOM   5948  C  CE2    . TYR B 1 78  ? 13.990  24.051 -98.157  1.00 43.55  ? 58  TYR B CE2    1 
ATOM   5949  C  CZ     . TYR B 1 78  ? 13.891  24.146 -96.788  1.00 43.55  ? 58  TYR B CZ     1 
ATOM   5950  O  OH     . TYR B 1 78  ? 13.323  25.264 -96.227  1.00 46.36  ? 58  TYR B OH     1 
ATOM   5951  H  H      . TYR B 1 78  ? 17.987  21.272 -97.863  1.00 53.85  ? 58  TYR B H      1 
ATOM   5952  H  HA     . TYR B 1 78  ? 16.106  19.642 -96.845  1.00 48.97  ? 58  TYR B HA     1 
ATOM   5953  H  HB2    . TYR B 1 78  ? 16.159  20.959 -99.342  1.00 49.06  ? 58  TYR B HB2    1 
ATOM   5954  H  HB3    . TYR B 1 78  ? 14.939  20.079 -98.840  1.00 49.06  ? 58  TYR B HB3    1 
ATOM   5955  H  HD1    . TYR B 1 78  ? 15.237  21.327 -96.005  1.00 49.94  ? 58  TYR B HD1    1 
ATOM   5956  H  HD2    . TYR B 1 78  ? 14.627  22.868 -99.646  1.00 54.87  ? 58  TYR B HD2    1 
ATOM   5957  H  HE1    . TYR B 1 78  ? 14.286  23.199 -95.055  1.00 49.54  ? 58  TYR B HE1    1 
ATOM   5958  H  HE2    . TYR B 1 78  ? 13.676  24.739 -98.698  1.00 52.38  ? 58  TYR B HE2    1 
ATOM   5959  H  HH     . TYR B 1 78  ? 13.324  25.197 -95.390  1.00 55.75  ? 58  TYR B HH     1 
ATOM   5960  N  N      . GLY B 1 79  ? 18.181  18.600 -98.994  1.00 43.41  ? 59  GLY B N      1 
ATOM   5961  C  CA     . GLY B 1 79  ? 18.562  17.486 -99.832  1.00 47.51  ? 59  GLY B CA     1 
ATOM   5962  C  C      . GLY B 1 79  ? 17.881  17.469 -101.179 1.00 51.26  ? 59  GLY B C      1 
ATOM   5963  O  O      . GLY B 1 79  ? 17.990  16.470 -101.900 1.00 50.08  ? 59  GLY B O      1 
ATOM   5964  H  H      . GLY B 1 79  ? 18.761  19.235 -98.962  1.00 52.21  ? 59  GLY B H      1 
ATOM   5965  H  HA2    . GLY B 1 79  ? 19.520  17.513 -99.979  1.00 57.13  ? 59  GLY B HA2    1 
ATOM   5966  H  HA3    . GLY B 1 79  ? 18.348  16.657 -99.376  1.00 57.13  ? 59  GLY B HA3    1 
ATOM   5967  N  N      . VAL B 1 80  ? 17.175  18.544 -101.538 1.00 54.30  ? 60  VAL B N      1 
ATOM   5968  C  CA     . VAL B 1 80  ? 16.526  18.673 -102.834 1.00 53.72  ? 60  VAL B CA     1 
ATOM   5969  C  C      . VAL B 1 80  ? 16.746  20.089 -103.347 1.00 51.90  ? 60  VAL B C      1 
ATOM   5970  O  O      . VAL B 1 80  ? 17.025  21.017 -102.584 1.00 50.33  ? 60  VAL B O      1 
ATOM   5971  C  CB     . VAL B 1 80  ? 15.014  18.365 -102.761 1.00 51.75  ? 60  VAL B CB     1 
ATOM   5972  C  CG1    . VAL B 1 80  ? 14.787  16.939 -102.290 1.00 53.37  ? 60  VAL B CG1    1 
ATOM   5973  C  CG2    . VAL B 1 80  ? 14.311  19.349 -101.835 1.00 48.83  ? 60  VAL B CG2    1 
ATOM   5974  H  H      . VAL B 1 80  ? 17.058  19.227 -101.029 1.00 65.28  ? 60  VAL B H      1 
ATOM   5975  H  HA     . VAL B 1 80  ? 16.934  18.055 -103.461 1.00 64.58  ? 60  VAL B HA     1 
ATOM   5976  H  HB     . VAL B 1 80  ? 14.629  18.455 -103.646 1.00 62.22  ? 60  VAL B HB     1 
ATOM   5977  H  HG11   . VAL B 1 80  ? 13.833  16.768 -102.252 1.00 64.16  ? 60  VAL B HG11   1 
ATOM   5978  H  HG12   . VAL B 1 80  ? 15.208  16.329 -102.917 1.00 64.16  ? 60  VAL B HG12   1 
ATOM   5979  H  HG13   . VAL B 1 80  ? 15.179  16.831 -101.410 1.00 64.16  ? 60  VAL B HG13   1 
ATOM   5980  H  HG21   . VAL B 1 80  ? 13.366  19.134 -101.806 1.00 58.71  ? 60  VAL B HG21   1 
ATOM   5981  H  HG22   . VAL B 1 80  ? 14.695  19.276 -100.947 1.00 58.71  ? 60  VAL B HG22   1 
ATOM   5982  H  HG23   . VAL B 1 80  ? 14.436  20.248 -102.177 1.00 58.71  ? 60  VAL B HG23   1 
ATOM   5983  N  N      . HIS B 1 81  ? 16.620  20.244 -104.661 1.00 55.32  ? 61  HIS B N      1 
ATOM   5984  C  CA     . HIS B 1 81  ? 16.776  21.533 -105.324 1.00 61.89  ? 61  HIS B CA     1 
ATOM   5985  C  C      . HIS B 1 81  ? 15.418  22.006 -105.824 1.00 66.29  ? 61  HIS B C      1 
ATOM   5986  O  O      . HIS B 1 81  ? 14.782  21.328 -106.638 1.00 68.95  ? 61  HIS B O      1 
ATOM   5987  C  CB     . HIS B 1 81  ? 17.766  21.444 -106.484 1.00 66.17  ? 61  HIS B CB     1 
ATOM   5988  C  CG     . HIS B 1 81  ? 18.034  22.760 -107.146 1.00 68.07  ? 61  HIS B CG     1 
ATOM   5989  N  ND1    . HIS B 1 81  ? 17.425  23.137 -108.324 1.00 69.21  ? 61  HIS B ND1    1 
ATOM   5990  C  CD2    . HIS B 1 81  ? 18.832  23.793 -106.788 1.00 67.81  ? 61  HIS B CD2    1 
ATOM   5991  C  CE1    . HIS B 1 81  ? 17.842  24.342 -108.667 1.00 69.32  ? 61  HIS B CE1    1 
ATOM   5992  N  NE2    . HIS B 1 81  ? 18.697  24.763 -107.752 1.00 68.55  ? 61  HIS B NE2    1 
ATOM   5993  H  H      . HIS B 1 81  ? 16.440  19.601 -105.203 1.00 66.50  ? 61  HIS B H      1 
ATOM   5994  H  HA     . HIS B 1 81  ? 17.110  22.183 -104.687 1.00 74.39  ? 61  HIS B HA     1 
ATOM   5995  H  HB2    . HIS B 1 81  ? 18.611  21.102 -106.149 1.00 79.53  ? 61  HIS B HB2    1 
ATOM   5996  H  HB3    . HIS B 1 81  ? 17.410  20.840 -107.155 1.00 79.53  ? 61  HIS B HB3    1 
ATOM   5997  H  HD2    . HIS B 1 81  ? 19.374  23.837 -106.034 1.00 81.50  ? 61  HIS B HD2    1 
ATOM   5998  H  HE1    . HIS B 1 81  ? 17.579  24.814 -109.424 1.00 83.30  ? 61  HIS B HE1    1 
ATOM   5999  H  HE2    . HIS B 1 81  ? 19.103  25.521 -107.759 1.00 82.37  ? 61  HIS B HE2    1 
ATOM   6000  N  N      . GLU B 1 82  ? 14.981  23.162 -105.338 1.00 65.61  ? 62  GLU B N      1 
ATOM   6001  C  CA     . GLU B 1 82  ? 13.706  23.743 -105.735 1.00 71.27  ? 62  GLU B CA     1 
ATOM   6002  C  C      . GLU B 1 82  ? 13.941  24.744 -106.859 1.00 83.13  ? 62  GLU B C      1 
ATOM   6003  O  O      . GLU B 1 82  ? 14.913  25.506 -106.836 1.00 75.89  ? 62  GLU B O      1 
ATOM   6004  C  CB     . GLU B 1 82  ? 12.996  24.420 -104.556 1.00 71.52  ? 62  GLU B CB     1 
ATOM   6005  C  CG     . GLU B 1 82  ? 13.743  24.370 -103.227 1.00 69.85  ? 62  GLU B CG     1 
ATOM   6006  C  CD     . GLU B 1 82  ? 13.059  25.178 -102.143 1.00 67.03  ? 62  GLU B CD     1 
ATOM   6007  O  OE1    . GLU B 1 82  ? 11.851  25.467 -102.280 1.00 66.17  ? 62  GLU B OE1    1 
ATOM   6008  O  OE2    . GLU B 1 82  ? 13.733  25.520 -101.149 1.00 65.62  ? 62  GLU B OE2    1 
ATOM   6009  H  H      . GLU B 1 82  ? 15.413  23.637 -104.767 1.00 78.85  ? 62  GLU B H      1 
ATOM   6010  H  HA     . GLU B 1 82  ? 13.128  23.041 -106.072 1.00 85.64  ? 62  GLU B HA     1 
ATOM   6011  H  HB2    . GLU B 1 82  ? 12.857  25.354 -104.776 1.00 85.94  ? 62  GLU B HB2    1 
ATOM   6012  H  HB3    . GLU B 1 82  ? 12.139  23.987 -104.424 1.00 85.94  ? 62  GLU B HB3    1 
ATOM   6013  H  HG2    . GLU B 1 82  ? 13.795  23.449 -102.928 1.00 83.94  ? 62  GLU B HG2    1 
ATOM   6014  H  HG3    . GLU B 1 82  ? 14.635  24.730 -103.352 1.00 83.94  ? 62  GLU B HG3    1 
ATOM   6015  N  N      . LYS B 1 83  ? 13.046  24.734 -107.844 1.00 128.03 ? 63  LYS B N      1 
ATOM   6016  C  CA     . LYS B 1 83  ? 13.146  25.664 -108.961 1.00 135.30 ? 63  LYS B CA     1 
ATOM   6017  C  C      . LYS B 1 83  ? 13.090  27.103 -108.463 1.00 131.20 ? 63  LYS B C      1 
ATOM   6018  O  O      . LYS B 1 83  ? 12.228  27.463 -107.656 1.00 130.40 ? 63  LYS B O      1 
ATOM   6019  C  CB     . LYS B 1 83  ? 12.021  25.395 -109.962 1.00 137.06 ? 63  LYS B CB     1 
ATOM   6020  C  CG     . LYS B 1 83  ? 12.047  26.272 -111.209 1.00 138.58 ? 63  LYS B CG     1 
ATOM   6021  C  CD     . LYS B 1 83  ? 11.098  27.456 -111.089 1.00 140.56 ? 63  LYS B CD     1 
ATOM   6022  C  CE     . LYS B 1 83  ? 11.045  28.267 -112.376 1.00 143.90 ? 63  LYS B CE     1 
ATOM   6023  N  NZ     . LYS B 1 83  ? 12.314  28.994 -112.654 1.00 144.86 ? 63  LYS B NZ     1 
ATOM   6024  H  H      . LYS B 1 83  ? 12.374  24.199 -107.887 1.00 153.76 ? 63  LYS B H      1 
ATOM   6025  H  HA     . LYS B 1 83  ? 13.994  25.531 -109.413 1.00 162.48 ? 63  LYS B HA     1 
ATOM   6026  H  HB2    . LYS B 1 83  ? 12.080  24.471 -110.252 1.00 164.59 ? 63  LYS B HB2    1 
ATOM   6027  H  HB3    . LYS B 1 83  ? 11.171  25.543 -109.518 1.00 164.59 ? 63  LYS B HB3    1 
ATOM   6028  H  HG2    . LYS B 1 83  ? 12.945  26.615 -111.339 1.00 166.41 ? 63  LYS B HG2    1 
ATOM   6029  H  HG3    . LYS B 1 83  ? 11.777  25.744 -111.976 1.00 166.41 ? 63  LYS B HG3    1 
ATOM   6030  H  HD2    . LYS B 1 83  ? 10.204  27.132 -110.898 1.00 168.79 ? 63  LYS B HD2    1 
ATOM   6031  H  HD3    . LYS B 1 83  ? 11.403  28.039 -110.375 1.00 168.79 ? 63  LYS B HD3    1 
ATOM   6032  H  HE2    . LYS B 1 83  ? 10.874  27.669 -113.120 1.00 172.80 ? 63  LYS B HE2    1 
ATOM   6033  H  HE3    . LYS B 1 83  ? 10.334  28.923 -112.307 1.00 172.80 ? 63  LYS B HE3    1 
ATOM   6034  H  HZ1    . LYS B 1 83  ? 12.242  29.454 -113.412 1.00 173.95 ? 63  LYS B HZ1    1 
ATOM   6035  H  HZ2    . LYS B 1 83  ? 12.493  29.558 -111.989 1.00 173.95 ? 63  LYS B HZ2    1 
ATOM   6036  H  HZ3    . LYS B 1 83  ? 12.986  28.414 -112.730 1.00 173.95 ? 63  LYS B HZ3    1 
ATOM   6037  N  N      . GLY B 1 84  ? 14.017  27.923 -108.950 1.00 112.87 ? 64  GLY B N      1 
ATOM   6038  C  CA     . GLY B 1 84  ? 14.112  29.307 -108.535 1.00 109.73 ? 64  GLY B CA     1 
ATOM   6039  C  C      . GLY B 1 84  ? 15.041  29.573 -107.373 1.00 105.97 ? 64  GLY B C      1 
ATOM   6040  O  O      . GLY B 1 84  ? 14.947  30.641 -106.758 1.00 113.23 ? 64  GLY B O      1 
ATOM   6041  H  H      . GLY B 1 84  ? 14.609  27.692 -109.530 1.00 135.57 ? 64  GLY B H      1 
ATOM   6042  H  HA2    . GLY B 1 84  ? 14.417  29.839 -109.287 1.00 131.80 ? 64  GLY B HA2    1 
ATOM   6043  H  HA3    . GLY B 1 84  ? 13.228  29.621 -108.286 1.00 131.80 ? 64  GLY B HA3    1 
ATOM   6044  N  N      . SER B 1 85  ? 15.933  28.639 -107.047 1.00 80.21  ? 65  SER B N      1 
ATOM   6045  C  CA     . SER B 1 85  ? 16.923  28.825 -105.997 1.00 66.59  ? 65  SER B CA     1 
ATOM   6046  C  C      . SER B 1 85  ? 18.317  28.587 -106.562 1.00 58.92  ? 65  SER B C      1 
ATOM   6047  O  O      . SER B 1 85  ? 18.511  27.750 -107.449 1.00 55.97  ? 65  SER B O      1 
ATOM   6048  C  CB     . SER B 1 85  ? 16.670  27.882 -104.815 1.00 64.64  ? 65  SER B CB     1 
ATOM   6049  O  OG     . SER B 1 85  ? 15.490  28.242 -104.119 1.00 64.30  ? 65  SER B OG     1 
ATOM   6050  H  H      . SER B 1 85  ? 15.983  27.872 -107.432 1.00 96.37  ? 65  SER B H      1 
ATOM   6051  H  HA     . SER B 1 85  ? 16.878  29.738 -105.673 1.00 80.03  ? 65  SER B HA     1 
ATOM   6052  H  HB2    . SER B 1 85  ? 16.575  26.976 -105.149 1.00 77.68  ? 65  SER B HB2    1 
ATOM   6053  H  HB3    . SER B 1 85  ? 17.423  27.933 -104.205 1.00 77.68  ? 65  SER B HB3    1 
ATOM   6054  H  HG     . SER B 1 85  ? 15.558  29.025 -103.823 1.00 77.28  ? 65  SER B HG     1 
ATOM   6055  N  N      . ASP B 1 86  ? 19.286  29.332 -106.040 1.00 59.32  ? 66  ASP B N      1 
ATOM   6056  C  CA     . ASP B 1 86  ? 20.662  29.246 -106.511 1.00 61.27  ? 66  ASP B CA     1 
ATOM   6057  C  C      . ASP B 1 86  ? 21.377  28.085 -105.816 1.00 59.52  ? 66  ASP B C      1 
ATOM   6058  O  O      . ASP B 1 86  ? 20.760  27.239 -105.162 1.00 55.56  ? 66  ASP B O      1 
ATOM   6059  C  CB     . ASP B 1 86  ? 21.370  30.583 -106.296 1.00 64.58  ? 66  ASP B CB     1 
ATOM   6060  C  CG     . ASP B 1 86  ? 21.486  30.959 -104.830 1.00 64.61  ? 66  ASP B CG     1 
ATOM   6061  O  OD1    . ASP B 1 86  ? 20.965  30.216 -103.972 1.00 63.76  ? 66  ASP B OD1    1 
ATOM   6062  O  OD2    . ASP B 1 86  ? 22.099  32.008 -104.538 1.00 66.18  ? 66  ASP B OD2    1 
ATOM   6063  H  H      . ASP B 1 86  ? 19.170  29.901 -105.405 1.00 71.30  ? 66  ASP B H      1 
ATOM   6064  H  HA     . ASP B 1 86  ? 20.656  29.063 -107.464 1.00 73.64  ? 66  ASP B HA     1 
ATOM   6065  H  HB2    . ASP B 1 86  ? 22.266  30.528 -106.664 1.00 77.61  ? 66  ASP B HB2    1 
ATOM   6066  H  HB3    . ASP B 1 86  ? 20.869  31.281 -106.746 1.00 77.61  ? 66  ASP B HB3    1 
ATOM   6067  N  N      . VAL B 1 87  ? 22.700  28.032 -105.962 1.00 59.00  ? 67  VAL B N      1 
ATOM   6068  C  CA     . VAL B 1 87  ? 23.547  27.074 -105.261 1.00 56.15  ? 67  VAL B CA     1 
ATOM   6069  C  C      . VAL B 1 87  ? 24.686  27.840 -104.605 1.00 53.54  ? 67  VAL B C      1 
ATOM   6070  O  O      . VAL B 1 87  ? 25.189  28.821 -105.163 1.00 54.76  ? 67  VAL B O      1 
ATOM   6071  C  CB     . VAL B 1 87  ? 24.094  25.986 -106.210 1.00 54.48  ? 67  VAL B CB     1 
ATOM   6072  C  CG1    . VAL B 1 87  ? 24.921  24.963 -105.439 1.00 55.40  ? 67  VAL B CG1    1 
ATOM   6073  C  CG2    . VAL B 1 87  ? 22.953  25.298 -106.942 1.00 50.77  ? 67  VAL B CG2    1 
ATOM   6074  H  H      . VAL B 1 87  ? 23.142  28.559 -106.479 1.00 70.92  ? 67  VAL B H      1 
ATOM   6075  H  HA     . VAL B 1 87  ? 23.030  26.639 -104.565 1.00 67.50  ? 67  VAL B HA     1 
ATOM   6076  H  HB     . VAL B 1 87  ? 24.669  26.401 -106.872 1.00 65.49  ? 67  VAL B HB     1 
ATOM   6077  H  HG11   . VAL B 1 87  ? 25.251  24.294 -106.058 1.00 66.59  ? 67  VAL B HG11   1 
ATOM   6078  H  HG12   . VAL B 1 87  ? 25.665  25.417 -105.013 1.00 66.59  ? 67  VAL B HG12   1 
ATOM   6079  H  HG13   . VAL B 1 87  ? 24.359  24.546 -104.768 1.00 66.59  ? 67  VAL B HG13   1 
ATOM   6080  H  HG21   . VAL B 1 87  ? 23.320  24.620 -107.531 1.00 61.04  ? 67  VAL B HG21   1 
ATOM   6081  H  HG22   . VAL B 1 87  ? 22.363  24.887 -106.291 1.00 61.04  ? 67  VAL B HG22   1 
ATOM   6082  H  HG23   . VAL B 1 87  ? 22.467  25.958 -107.459 1.00 61.04  ? 67  VAL B HG23   1 
ATOM   6083  N  N      . ASP B 1 88  ? 25.092  27.391 -103.421 1.00 52.27  ? 68  ASP B N      1 
ATOM   6084  C  CA     . ASP B 1 88  ? 26.104  28.071 -102.623 1.00 54.01  ? 68  ASP B CA     1 
ATOM   6085  C  C      . ASP B 1 88  ? 27.363  27.213 -102.561 1.00 54.85  ? 68  ASP B C      1 
ATOM   6086  O  O      . ASP B 1 88  ? 27.319  26.066 -102.100 1.00 54.10  ? 68  ASP B O      1 
ATOM   6087  C  CB     . ASP B 1 88  ? 25.567  28.367 -101.224 1.00 53.34  ? 68  ASP B CB     1 
ATOM   6088  C  CG     . ASP B 1 88  ? 24.391  29.327 -101.247 1.00 52.10  ? 68  ASP B CG     1 
ATOM   6089  O  OD1    . ASP B 1 88  ? 24.622  30.554 -101.290 1.00 51.88  ? 68  ASP B OD1    1 
ATOM   6090  O  OD2    . ASP B 1 88  ? 23.235  28.854 -101.230 1.00 51.04  ? 68  ASP B OD2    1 
ATOM   6091  H  H      . ASP B 1 88  ? 24.788  26.677 -103.051 1.00 62.84  ? 68  ASP B H      1 
ATOM   6092  H  HA     . ASP B 1 88  ? 26.331  28.914 -103.046 1.00 64.93  ? 68  ASP B HA     1 
ATOM   6093  H  HB2    . ASP B 1 88  ? 25.271  27.538 -100.816 1.00 64.13  ? 68  ASP B HB2    1 
ATOM   6094  H  HB3    . ASP B 1 88  ? 26.273  28.767 -100.691 1.00 64.13  ? 68  ASP B HB3    1 
ATOM   6095  N  N      . PHE B 1 89  ? 28.483  27.786 -103.005 1.00 54.87  ? 69  PHE B N      1 
ATOM   6096  C  CA     . PHE B 1 89  ? 29.769  27.109 -103.075 1.00 54.05  ? 69  PHE B CA     1 
ATOM   6097  C  C      . PHE B 1 89  ? 30.810  27.847 -102.242 1.00 51.19  ? 69  PHE B C      1 
ATOM   6098  O  O      . PHE B 1 89  ? 30.734  29.067 -102.057 1.00 48.95  ? 69  PHE B O      1 
ATOM   6099  C  CB     . PHE B 1 89  ? 30.273  27.023 -104.525 1.00 55.84  ? 69  PHE B CB     1 
ATOM   6100  C  CG     . PHE B 1 89  ? 29.435  26.153 -105.418 1.00 57.32  ? 69  PHE B CG     1 
ATOM   6101  C  CD1    . PHE B 1 89  ? 29.449  24.776 -105.282 1.00 58.55  ? 69  PHE B CD1    1 
ATOM   6102  C  CD2    . PHE B 1 89  ? 28.644  26.715 -106.406 1.00 57.68  ? 69  PHE B CD2    1 
ATOM   6103  C  CE1    . PHE B 1 89  ? 28.683  23.976 -106.110 1.00 58.42  ? 69  PHE B CE1    1 
ATOM   6104  C  CE2    . PHE B 1 89  ? 27.877  25.921 -107.235 1.00 58.12  ? 69  PHE B CE2    1 
ATOM   6105  C  CZ     . PHE B 1 89  ? 27.896  24.550 -107.087 1.00 57.90  ? 69  PHE B CZ     1 
ATOM   6106  H  H      . PHE B 1 89  ? 28.518  28.600 -103.280 1.00 65.96  ? 69  PHE B H      1 
ATOM   6107  H  HA     . PHE B 1 89  ? 29.680  26.208 -102.727 1.00 64.97  ? 69  PHE B HA     1 
ATOM   6108  H  HB2    . PHE B 1 89  ? 30.281  27.915 -104.905 1.00 67.12  ? 69  PHE B HB2    1 
ATOM   6109  H  HB3    . PHE B 1 89  ? 31.173  26.661 -104.521 1.00 67.12  ? 69  PHE B HB3    1 
ATOM   6110  H  HD1    . PHE B 1 89  ? 29.978  24.384 -104.625 1.00 70.38  ? 69  PHE B HD1    1 
ATOM   6111  H  HD2    . PHE B 1 89  ? 28.627  27.639 -106.510 1.00 69.34  ? 69  PHE B HD2    1 
ATOM   6112  H  HE1    . PHE B 1 89  ? 28.698  23.052 -106.008 1.00 70.23  ? 69  PHE B HE1    1 
ATOM   6113  H  HE2    . PHE B 1 89  ? 27.347  26.310 -107.893 1.00 69.87  ? 69  PHE B HE2    1 
ATOM   6114  H  HZ     . PHE B 1 89  ? 27.380  24.014 -107.644 1.00 69.60  ? 69  PHE B HZ     1 
ATOM   6115  N  N      . VAL B 1 90  ? 31.791  27.094 -101.744 1.00 54.60  ? 70  VAL B N      1 
ATOM   6116  C  CA     . VAL B 1 90  ? 32.932  27.660 -101.035 1.00 57.20  ? 70  VAL B CA     1 
ATOM   6117  C  C      . VAL B 1 90  ? 34.188  26.890 -101.425 1.00 58.08  ? 70  VAL B C      1 
ATOM   6118  O  O      . VAL B 1 90  ? 34.149  25.677 -101.654 1.00 61.61  ? 70  VAL B O      1 
ATOM   6119  C  CB     . VAL B 1 90  ? 32.726  27.637 -99.501  1.00 54.11  ? 70  VAL B CB     1 
ATOM   6120  C  CG1    . VAL B 1 90  ? 32.576  26.209 -98.997  1.00 55.73  ? 70  VAL B CG1    1 
ATOM   6121  C  CG2    . VAL B 1 90  ? 33.878  28.337 -98.790  1.00 49.67  ? 70  VAL B CG2    1 
ATOM   6122  H  H      . VAL B 1 90  ? 31.816  26.236 -101.807 1.00 65.64  ? 70  VAL B H      1 
ATOM   6123  H  HA     . VAL B 1 90  ? 33.049  28.584 -101.308 1.00 68.76  ? 70  VAL B HA     1 
ATOM   6124  H  HB     . VAL B 1 90  ? 31.910  28.115 -99.287  1.00 65.05  ? 70  VAL B HB     1 
ATOM   6125  H  HG11   . VAL B 1 90  ? 32.449  26.226 -98.036  1.00 67.00  ? 70  VAL B HG11   1 
ATOM   6126  H  HG12   . VAL B 1 90  ? 31.807  25.802 -99.426  1.00 67.00  ? 70  VAL B HG12   1 
ATOM   6127  H  HG13   . VAL B 1 90  ? 33.379  25.711 -99.216  1.00 67.00  ? 70  VAL B HG13   1 
ATOM   6128  H  HG21   . VAL B 1 90  ? 33.723  28.308 -97.833  1.00 59.72  ? 70  VAL B HG21   1 
ATOM   6129  H  HG22   . VAL B 1 90  ? 34.706  27.880 -99.005  1.00 59.72  ? 70  VAL B HG22   1 
ATOM   6130  H  HG23   . VAL B 1 90  ? 33.921  29.259 -99.090  1.00 59.72  ? 70  VAL B HG23   1 
ATOM   6131  N  N      . VAL B 1 91  ? 35.310  27.606 -101.503 1.00 52.05  ? 71  VAL B N      1 
ATOM   6132  C  CA     . VAL B 1 91  ? 36.604  27.013 -101.837 1.00 54.57  ? 71  VAL B CA     1 
ATOM   6133  C  C      . VAL B 1 91  ? 37.417  26.882 -100.556 1.00 63.47  ? 71  VAL B C      1 
ATOM   6134  O  O      . VAL B 1 91  ? 37.479  27.822 -99.753  1.00 60.56  ? 71  VAL B O      1 
ATOM   6135  C  CB     . VAL B 1 91  ? 37.351  27.857 -102.886 1.00 55.19  ? 71  VAL B CB     1 
ATOM   6136  C  CG1    . VAL B 1 91  ? 38.716  27.252 -103.197 1.00 57.41  ? 71  VAL B CG1    1 
ATOM   6137  C  CG2    . VAL B 1 91  ? 36.525  27.974 -104.159 1.00 55.26  ? 71  VAL B CG2    1 
ATOM   6138  H  H      . VAL B 1 91  ? 35.348  28.453 -101.363 1.00 62.58  ? 71  VAL B H      1 
ATOM   6139  H  HA     . VAL B 1 91  ? 36.466  26.126 -102.203 1.00 65.61  ? 71  VAL B HA     1 
ATOM   6140  H  HB     . VAL B 1 91  ? 37.490  28.750 -102.534 1.00 66.35  ? 71  VAL B HB     1 
ATOM   6141  H  HG11   . VAL B 1 91  ? 39.162  27.803 -103.858 1.00 69.01  ? 71  VAL B HG11   1 
ATOM   6142  H  HG12   . VAL B 1 91  ? 39.241  27.222 -102.382 1.00 69.01  ? 71  VAL B HG12   1 
ATOM   6143  H  HG13   . VAL B 1 91  ? 38.591  26.354 -103.543 1.00 69.01  ? 71  VAL B HG13   1 
ATOM   6144  H  HG21   . VAL B 1 91  ? 37.014  28.509 -104.804 1.00 66.43  ? 71  VAL B HG21   1 
ATOM   6145  H  HG22   . VAL B 1 91  ? 36.368  27.086 -104.516 1.00 66.43  ? 71  VAL B HG22   1 
ATOM   6146  H  HG23   . VAL B 1 91  ? 35.679  28.401 -103.948 1.00 66.43  ? 71  VAL B HG23   1 
ATOM   6147  N  N      . LEU B 1 92  ? 38.051  25.723 -100.367 1.00 75.31  ? 72  LEU B N      1 
ATOM   6148  C  CA     . LEU B 1 92  ? 38.750  25.424 -99.123  1.00 81.74  ? 72  LEU B CA     1 
ATOM   6149  C  C      . LEU B 1 92  ? 40.063  24.703 -99.397  1.00 90.75  ? 72  LEU B C      1 
ATOM   6150  O  O      . LEU B 1 92  ? 40.212  23.996 -100.400 1.00 92.08  ? 72  LEU B O      1 
ATOM   6151  C  CB     . LEU B 1 92  ? 37.885  24.569 -98.185  1.00 75.53  ? 72  LEU B CB     1 
ATOM   6152  C  CG     . LEU B 1 92  ? 36.596  25.213 -97.673  1.00 70.06  ? 72  LEU B CG     1 
ATOM   6153  C  CD1    . LEU B 1 92  ? 35.790  24.206 -96.869  1.00 70.24  ? 72  LEU B CD1    1 
ATOM   6154  C  CD2    . LEU B 1 92  ? 36.895  26.450 -96.837  1.00 65.93  ? 72  LEU B CD2    1 
ATOM   6155  H  H      . LEU B 1 92  ? 38.090  25.091 -100.949 1.00 90.49  ? 72  LEU B H      1 
ATOM   6156  H  HA     . LEU B 1 92  ? 38.954  26.256 -98.668  1.00 98.20  ? 72  LEU B HA     1 
ATOM   6157  H  HB2    . LEU B 1 92  ? 37.635  23.760 -98.658  1.00 90.75  ? 72  LEU B HB2    1 
ATOM   6158  H  HB3    . LEU B 1 92  ? 38.419  24.336 -97.409  1.00 90.75  ? 72  LEU B HB3    1 
ATOM   6159  H  HG     . LEU B 1 92  ? 36.058  25.489 -98.432  1.00 84.19  ? 72  LEU B HG     1 
ATOM   6160  H  HD11   . LEU B 1 92  ? 34.978  24.632 -96.553  1.00 84.41  ? 72  LEU B HD11   1 
ATOM   6161  H  HD12   . LEU B 1 92  ? 35.569  23.452 -97.438  1.00 84.41  ? 72  LEU B HD12   1 
ATOM   6162  H  HD13   . LEU B 1 92  ? 36.322  23.907 -96.115  1.00 84.41  ? 72  LEU B HD13   1 
ATOM   6163  H  HD21   . LEU B 1 92  ? 36.059  26.832 -96.529  1.00 79.24  ? 72  LEU B HD21   1 
ATOM   6164  H  HD22   . LEU B 1 92  ? 37.441  26.193 -96.077  1.00 79.24  ? 72  LEU B HD22   1 
ATOM   6165  H  HD23   . LEU B 1 92  ? 37.372  27.093 -97.384  1.00 79.24  ? 72  LEU B HD23   1 
ATOM   6166  N  N      . ASN B 1 93  ? 41.012  24.898 -98.482  1.00 102.93 ? 73  ASN B N      1 
ATOM   6167  C  CA     . ASN B 1 93  ? 42.306  24.234 -98.504  1.00 109.42 ? 73  ASN B CA     1 
ATOM   6168  C  C      . ASN B 1 93  ? 42.281  22.964 -97.653  1.00 104.46 ? 73  ASN B C      1 
ATOM   6169  O  O      . ASN B 1 93  ? 41.345  22.703 -96.895  1.00 108.26 ? 73  ASN B O      1 
ATOM   6170  C  CB     . ASN B 1 93  ? 43.395  25.175 -97.984  1.00 114.82 ? 73  ASN B CB     1 
ATOM   6171  C  CG     . ASN B 1 93  ? 43.663  26.336 -98.919  1.00 118.77 ? 73  ASN B CG     1 
ATOM   6172  O  OD1    . ASN B 1 93  ? 43.748  26.165 -100.134 1.00 121.68 ? 73  ASN B OD1    1 
ATOM   6173  N  ND2    . ASN B 1 93  ? 43.796  27.530 -98.352  1.00 118.12 ? 73  ASN B ND2    1 
ATOM   6174  H  H      . ASN B 1 93  ? 40.921  25.433 -97.815  1.00 123.64 ? 73  ASN B H      1 
ATOM   6175  H  HA     . ASN B 1 93  ? 42.525  23.986 -99.416  1.00 131.42 ? 73  ASN B HA     1 
ATOM   6176  H  HB2    . ASN B 1 93  ? 43.117  25.537 -97.129  1.00 137.90 ? 73  ASN B HB2    1 
ATOM   6177  H  HB3    . ASN B 1 93  ? 44.220  24.676 -97.881  1.00 137.90 ? 73  ASN B HB3    1 
ATOM   6178  H  HD21   . ASN B 1 93  ? 43.949  28.222 -98.839  1.00 141.86 ? 73  ASN B HD21   1 
ATOM   6179  H  HD22   . ASN B 1 93  ? 43.729  27.610 -97.498  1.00 141.86 ? 73  ASN B HD22   1 
ATOM   6180  N  N      . LYS B 1 94  ? 43.346  22.170 -97.784  1.00 85.22  ? 74  LYS B N      1 
ATOM   6181  C  CA     . LYS B 1 94  ? 43.477  20.944 -97.000  1.00 79.26  ? 74  LYS B CA     1 
ATOM   6182  C  C      . LYS B 1 94  ? 43.565  21.252 -95.509  1.00 78.93  ? 74  LYS B C      1 
ATOM   6183  O  O      . LYS B 1 94  ? 42.823  20.684 -94.696  1.00 74.30  ? 74  LYS B O      1 
ATOM   6184  C  CB     . LYS B 1 94  ? 44.707  20.167 -97.472  1.00 80.94  ? 74  LYS B CB     1 
ATOM   6185  C  CG     . LYS B 1 94  ? 44.860  18.776 -96.885  1.00 83.44  ? 74  LYS B CG     1 
ATOM   6186  C  CD     . LYS B 1 94  ? 46.177  18.164 -97.337  1.00 89.13  ? 74  LYS B CD     1 
ATOM   6187  C  CE     . LYS B 1 94  ? 46.389  16.772 -96.773  1.00 91.76  ? 74  LYS B CE     1 
ATOM   6188  N  NZ     . LYS B 1 94  ? 47.794  16.318 -96.969  1.00 94.74  ? 74  LYS B NZ     1 
ATOM   6189  H  H      . LYS B 1 94  ? 44.003  22.319 -98.319  1.00 102.38 ? 74  LYS B H      1 
ATOM   6190  H  HA     . LYS B 1 94  ? 42.696  20.389 -97.147  1.00 95.23  ? 74  LYS B HA     1 
ATOM   6191  H  HB2    . LYS B 1 94  ? 44.660  20.073 -98.436  1.00 97.25  ? 74  LYS B HB2    1 
ATOM   6192  H  HB3    . LYS B 1 94  ? 45.500  20.672 -97.234  1.00 97.25  ? 74  LYS B HB3    1 
ATOM   6193  H  HG2    . LYS B 1 94  ? 44.861  18.830 -95.917  1.00 100.25 ? 74  LYS B HG2    1 
ATOM   6194  H  HG3    . LYS B 1 94  ? 44.135  18.211 -97.194  1.00 100.25 ? 74  LYS B HG3    1 
ATOM   6195  H  HD2    . LYS B 1 94  ? 46.183  18.101 -98.305  1.00 107.08 ? 74  LYS B HD2    1 
ATOM   6196  H  HD3    . LYS B 1 94  ? 46.908  18.726 -97.035  1.00 107.08 ? 74  LYS B HD3    1 
ATOM   6197  H  HE2    . LYS B 1 94  ? 46.201  16.779 -95.821  1.00 110.23 ? 74  LYS B HE2    1 
ATOM   6198  H  HE3    . LYS B 1 94  ? 45.801  16.148 -97.227  1.00 110.23 ? 74  LYS B HE3    1 
ATOM   6199  H  HZ1    . LYS B 1 94  ? 47.900  15.501 -96.633  1.00 113.81 ? 74  LYS B HZ1    1 
ATOM   6200  H  HZ2    . LYS B 1 94  ? 47.990  16.301 -97.837  1.00 113.81 ? 74  LYS B HZ2    1 
ATOM   6201  H  HZ3    . LYS B 1 94  ? 48.354  16.875 -96.558  1.00 113.81 ? 74  LYS B HZ3    1 
ATOM   6202  N  N      . THR B 1 95  ? 44.471  22.159 -95.131  1.00 84.00  ? 75  THR B N      1 
ATOM   6203  C  CA     . THR B 1 95  ? 44.612  22.525 -93.726  1.00 87.24  ? 75  THR B CA     1 
ATOM   6204  C  C      . THR B 1 95  ? 43.317  23.096 -93.169  1.00 88.23  ? 75  THR B C      1 
ATOM   6205  O  O      . THR B 1 95  ? 43.011  22.903 -91.986  1.00 89.73  ? 75  THR B O      1 
ATOM   6206  C  CB     . THR B 1 95  ? 45.746  23.539 -93.559  1.00 87.10  ? 75  THR B CB     1 
ATOM   6207  O  OG1    . THR B 1 95  ? 45.501  24.676 -94.396  1.00 86.28  ? 75  THR B OG1    1 
ATOM   6208  C  CG2    . THR B 1 95  ? 47.081  22.918 -93.937  1.00 89.45  ? 75  THR B CG2    1 
ATOM   6209  H  H      . THR B 1 95  ? 45.007  22.569 -95.663  1.00 100.92 ? 75  THR B H      1 
ATOM   6210  H  HA     . THR B 1 95  ? 44.838  21.734 -93.213  1.00 104.81 ? 75  THR B HA     1 
ATOM   6211  H  HB     . THR B 1 95  ? 45.791  23.824 -92.632  1.00 104.63 ? 75  THR B HB     1 
ATOM   6212  H  HG1    . THR B 1 95  ? 46.120  25.236 -94.308  1.00 103.66 ? 75  THR B HG1    1 
ATOM   6213  H  HG21   . THR B 1 95  ? 47.792  23.568 -93.827  1.00 107.46 ? 75  THR B HG21   1 
ATOM   6214  H  HG22   . THR B 1 95  ? 47.263  22.153 -93.369  1.00 107.46 ? 75  THR B HG22   1 
ATOM   6215  H  HG23   . THR B 1 95  ? 47.060  22.626 -94.862  1.00 107.46 ? 75  THR B HG23   1 
ATOM   6216  N  N      . ASP B 1 96  ? 42.545  23.799 -94.000  1.00 88.24  ? 76  ASP B N      1 
ATOM   6217  C  CA     . ASP B 1 96  ? 41.259  24.321 -93.553  1.00 83.63  ? 76  ASP B CA     1 
ATOM   6218  C  C      . ASP B 1 96  ? 40.302  23.190 -93.201  1.00 77.20  ? 76  ASP B C      1 
ATOM   6219  O  O      . ASP B 1 96  ? 39.564  23.275 -92.212  1.00 74.82  ? 76  ASP B O      1 
ATOM   6220  C  CB     . ASP B 1 96  ? 40.656  25.221 -94.632  1.00 84.62  ? 76  ASP B CB     1 
ATOM   6221  C  CG     . ASP B 1 96  ? 41.480  26.471 -94.876  1.00 84.59  ? 76  ASP B CG     1 
ATOM   6222  O  OD1    . ASP B 1 96  ? 42.135  26.948 -93.925  1.00 83.98  ? 76  ASP B OD1    1 
ATOM   6223  O  OD2    . ASP B 1 96  ? 41.474  26.976 -96.019  1.00 84.59  ? 76  ASP B OD2    1 
ATOM   6224  H  H      . ASP B 1 96  ? 42.742  23.983 -94.817  1.00 106.00 ? 76  ASP B H      1 
ATOM   6225  H  HA     . ASP B 1 96  ? 41.396  24.857 -92.756  1.00 100.48 ? 76  ASP B HA     1 
ATOM   6226  H  HB2    . ASP B 1 96  ? 40.607  24.727 -95.465  1.00 101.67 ? 76  ASP B HB2    1 
ATOM   6227  H  HB3    . ASP B 1 96  ? 39.768  25.496 -94.355  1.00 101.67 ? 76  ASP B HB3    1 
ATOM   6228  N  N      . VAL B 1 97  ? 40.303  22.117 -93.995  1.00 75.10  ? 77  VAL B N      1 
ATOM   6229  C  CA     . VAL B 1 97  ? 39.399  21.003 -93.730  1.00 70.88  ? 77  VAL B CA     1 
ATOM   6230  C  C      . VAL B 1 97  ? 39.859  20.222 -92.508  1.00 74.91  ? 77  VAL B C      1 
ATOM   6231  O  O      . VAL B 1 97  ? 39.038  19.760 -91.707  1.00 76.15  ? 77  VAL B O      1 
ATOM   6232  C  CB     . VAL B 1 97  ? 39.292  20.096 -94.970  1.00 66.69  ? 77  VAL B CB     1 
ATOM   6233  C  CG1    . VAL B 1 97  ? 38.435  18.866 -94.670  1.00 63.33  ? 77  VAL B CG1    1 
ATOM   6234  C  CG2    . VAL B 1 97  ? 38.722  20.869 -96.151  1.00 65.11  ? 77  VAL B CG2    1 
ATOM   6235  H  H      . VAL B 1 97  ? 40.809  22.013 -94.682  1.00 90.23  ? 77  VAL B H      1 
ATOM   6236  H  HA     . VAL B 1 97  ? 38.514  21.355 -93.542  1.00 85.17  ? 77  VAL B HA     1 
ATOM   6237  H  HB     . VAL B 1 97  ? 40.179  19.789 -95.214  1.00 80.15  ? 77  VAL B HB     1 
ATOM   6238  H  HG11   . VAL B 1 97  ? 38.385  18.314 -95.466  1.00 76.11  ? 77  VAL B HG11   1 
ATOM   6239  H  HG12   . VAL B 1 97  ? 38.843  18.366 -93.945  1.00 76.11  ? 77  VAL B HG12   1 
ATOM   6240  H  HG13   . VAL B 1 97  ? 37.546  19.156 -94.412  1.00 76.11  ? 77  VAL B HG13   1 
ATOM   6241  H  HG21   . VAL B 1 97  ? 38.664  20.278 -96.917  1.00 78.25  ? 77  VAL B HG21   1 
ATOM   6242  H  HG22   . VAL B 1 97  ? 37.839  21.196 -95.917  1.00 78.25  ? 77  VAL B HG22   1 
ATOM   6243  H  HG23   . VAL B 1 97  ? 39.308  21.615 -96.352  1.00 78.25  ? 77  VAL B HG23   1 
ATOM   6244  N  N      . GLU B 1 98  ? 41.174  20.056 -92.342  1.00 79.70  ? 78  GLU B N      1 
ATOM   6245  C  CA     . GLU B 1 98  ? 41.667  19.281 -91.208  1.00 78.87  ? 78  GLU B CA     1 
ATOM   6246  C  C      . GLU B 1 98  ? 41.423  20.001 -89.886  1.00 73.79  ? 78  GLU B C      1 
ATOM   6247  O  O      . GLU B 1 98  ? 41.221  19.347 -88.856  1.00 72.61  ? 78  GLU B O      1 
ATOM   6248  C  CB     . GLU B 1 98  ? 43.148  18.962 -91.395  1.00 80.35  ? 78  GLU B CB     1 
ATOM   6249  C  CG     . GLU B 1 98  ? 43.391  17.935 -92.490  1.00 81.74  ? 78  GLU B CG     1 
ATOM   6250  C  CD     . GLU B 1 98  ? 44.851  17.564 -92.640  1.00 84.04  ? 78  GLU B CD     1 
ATOM   6251  O  OE1    . GLU B 1 98  ? 45.695  18.164 -91.943  1.00 84.77  ? 78  GLU B OE1    1 
ATOM   6252  O  OE2    . GLU B 1 98  ? 45.153  16.668 -93.457  1.00 85.53  ? 78  GLU B OE2    1 
ATOM   6253  H  H      . GLU B 1 98  ? 41.784  20.374 -92.858  1.00 95.76  ? 78  GLU B H      1 
ATOM   6254  H  HA     . GLU B 1 98  ? 41.187  18.439 -91.176  1.00 94.76  ? 78  GLU B HA     1 
ATOM   6255  H  HB2    . GLU B 1 98  ? 43.619  19.775 -91.636  1.00 96.54  ? 78  GLU B HB2    1 
ATOM   6256  H  HB3    . GLU B 1 98  ? 43.502  18.606 -90.566  1.00 96.54  ? 78  GLU B HB3    1 
ATOM   6257  H  HG2    . GLU B 1 98  ? 42.897  17.128 -92.280  1.00 98.20  ? 78  GLU B HG2    1 
ATOM   6258  H  HG3    . GLU B 1 98  ? 43.087  18.299 -93.336  1.00 98.20  ? 78  GLU B HG3    1 
ATOM   6259  N  N      . ASP B 1 99  ? 41.436  21.335 -89.890  1.00 68.40  ? 79  ASP B N      1 
ATOM   6260  C  CA     . ASP B 1 99  ? 41.067  22.119 -88.711  1.00 63.67  ? 79  ASP B CA     1 
ATOM   6261  C  C      . ASP B 1 99  ? 39.540  22.219 -88.676  1.00 65.25  ? 79  ASP B C      1 
ATOM   6262  O  O      . ASP B 1 99  ? 38.932  23.264 -88.919  1.00 62.27  ? 79  ASP B O      1 
ATOM   6263  C  CB     . ASP B 1 99  ? 41.733  23.488 -88.749  1.00 62.89  ? 79  ASP B CB     1 
ATOM   6264  C  CG     . ASP B 1 99  ? 41.483  24.297 -87.492  1.00 61.60  ? 79  ASP B CG     1 
ATOM   6265  O  OD1    . ASP B 1 99  ? 41.309  23.688 -86.415  1.00 61.13  ? 79  ASP B OD1    1 
ATOM   6266  O  OD2    . ASP B 1 99  ? 41.467  25.543 -87.580  1.00 61.62  ? 79  ASP B OD2    1 
ATOM   6267  H  H      . ASP B 1 99  ? 41.657  21.813 -90.570  1.00 82.20  ? 79  ASP B H      1 
ATOM   6268  H  HA     . ASP B 1 99  ? 41.362  21.657 -87.910  1.00 76.52  ? 79  ASP B HA     1 
ATOM   6269  H  HB2    . ASP B 1 99  ? 42.691  23.371 -88.845  1.00 75.58  ? 79  ASP B HB2    1 
ATOM   6270  H  HB3    . ASP B 1 99  ? 41.383  23.989 -89.503  1.00 75.58  ? 79  ASP B HB3    1 
ATOM   6271  N  N      . GLY B 1 100 ? 38.921  21.081 -88.352  1.00 70.67  ? 80  GLY B N      1 
ATOM   6272  C  CA     . GLY B 1 100 ? 37.507  20.894 -88.635  1.00 66.90  ? 80  GLY B CA     1 
ATOM   6273  C  C      . GLY B 1 100 ? 36.571  21.765 -87.821  1.00 58.82  ? 80  GLY B C      1 
ATOM   6274  O  O      . GLY B 1 100 ? 35.462  22.068 -88.272  1.00 56.70  ? 80  GLY B O      1 
ATOM   6275  H  H      . GLY B 1 100 ? 39.299  20.410 -87.970  1.00 84.92  ? 80  GLY B H      1 
ATOM   6276  H  HA2    . GLY B 1 100 ? 37.348  21.079 -89.573  1.00 80.39  ? 80  GLY B HA2    1 
ATOM   6277  H  HA3    . GLY B 1 100 ? 37.274  19.968 -88.467  1.00 80.39  ? 80  GLY B HA3    1 
ATOM   6278  N  N      . LYS B 1 101 ? 36.988  22.180 -86.623  1.00 53.23  ? 81  LYS B N      1 
ATOM   6279  C  CA     . LYS B 1 101 ? 36.105  22.909 -85.718  1.00 48.10  ? 81  LYS B CA     1 
ATOM   6280  C  C      . LYS B 1 101 ? 36.626  24.303 -85.390  1.00 47.24  ? 81  LYS B C      1 
ATOM   6281  O  O      . LYS B 1 101 ? 36.169  24.918 -84.421  1.00 36.35  ? 81  LYS B O      1 
ATOM   6282  C  CB     . LYS B 1 101 ? 35.896  22.106 -84.434  1.00 50.02  ? 81  LYS B CB     1 
ATOM   6283  C  CG     . LYS B 1 101 ? 35.242  20.756 -84.670  1.00 53.36  ? 81  LYS B CG     1 
ATOM   6284  C  CD     . LYS B 1 101 ? 34.874  20.069 -83.367  1.00 55.73  ? 81  LYS B CD     1 
ATOM   6285  C  CE     . LYS B 1 101 ? 34.286  18.693 -83.628  1.00 57.22  ? 81  LYS B CE     1 
ATOM   6286  N  NZ     . LYS B 1 101 ? 33.877  18.004 -82.375  1.00 54.74  ? 81  LYS B NZ     1 
ATOM   6287  H  H      . LYS B 1 101 ? 37.780  22.051 -86.313  1.00 63.99  ? 81  LYS B H      1 
ATOM   6288  H  HA     . LYS B 1 101 ? 35.240  23.012 -86.145  1.00 57.84  ? 81  LYS B HA     1 
ATOM   6289  H  HB2    . LYS B 1 101 ? 36.757  21.950 -84.016  1.00 60.14  ? 81  LYS B HB2    1 
ATOM   6290  H  HB3    . LYS B 1 101 ? 35.325  22.613 -83.836  1.00 60.14  ? 81  LYS B HB3    1 
ATOM   6291  H  HG2    . LYS B 1 101 ? 34.430  20.881 -85.186  1.00 64.15  ? 81  LYS B HG2    1 
ATOM   6292  H  HG3    . LYS B 1 101 ? 35.859  20.183 -85.151  1.00 64.15  ? 81  LYS B HG3    1 
ATOM   6293  H  HD2    . LYS B 1 101 ? 35.670  19.963 -82.823  1.00 67.00  ? 81  LYS B HD2    1 
ATOM   6294  H  HD3    . LYS B 1 101 ? 34.213  20.601 -82.898  1.00 67.00  ? 81  LYS B HD3    1 
ATOM   6295  H  HE2    . LYS B 1 101 ? 33.501  18.785 -84.190  1.00 68.78  ? 81  LYS B HE2    1 
ATOM   6296  H  HE3    . LYS B 1 101 ? 34.950  18.142 -84.071  1.00 68.78  ? 81  LYS B HE3    1 
ATOM   6297  H  HZ1    . LYS B 1 101 ? 33.538  17.204 -82.565  1.00 65.81  ? 81  LYS B HZ1    1 
ATOM   6298  H  HZ2    . LYS B 1 101 ? 34.582  17.901 -81.842  1.00 65.81  ? 81  LYS B HZ2    1 
ATOM   6299  H  HZ3    . LYS B 1 101 ? 33.261  18.486 -81.950  1.00 65.81  ? 81  LYS B HZ3    1 
ATOM   6300  N  N      . GLY B 1 102 ? 37.560  24.823 -86.182  1.00 62.32  ? 82  GLY B N      1 
ATOM   6301  C  CA     . GLY B 1 102 ? 38.053  26.163 -85.954  1.00 68.25  ? 82  GLY B CA     1 
ATOM   6302  C  C      . GLY B 1 102 ? 37.056  27.222 -86.382  1.00 66.08  ? 82  GLY B C      1 
ATOM   6303  O  O      . GLY B 1 102 ? 36.097  26.967 -87.110  1.00 68.56  ? 82  GLY B O      1 
ATOM   6304  H  H      . GLY B 1 102 ? 37.918  24.419 -86.851  1.00 74.90  ? 82  GLY B H      1 
ATOM   6305  H  HA2    . GLY B 1 102 ? 38.242  26.282 -85.010  1.00 82.01  ? 82  GLY B HA2    1 
ATOM   6306  H  HA3    . GLY B 1 102 ? 38.875  26.295 -86.452  1.00 82.01  ? 82  GLY B HA3    1 
ATOM   6307  N  N      . GLY B 1 103 ? 37.297  28.447 -85.909  1.00 53.49  ? 83  GLY B N      1 
ATOM   6308  C  CA     . GLY B 1 103 ? 36.453  29.573 -86.244  1.00 53.36  ? 83  GLY B CA     1 
ATOM   6309  C  C      . GLY B 1 103 ? 36.921  30.295 -87.496  1.00 58.80  ? 83  GLY B C      1 
ATOM   6310  O  O      . GLY B 1 103 ? 37.923  29.949 -88.120  1.00 59.97  ? 83  GLY B O      1 
ATOM   6311  H  H      . GLY B 1 103 ? 37.951  28.644 -85.388  1.00 64.31  ? 83  GLY B H      1 
ATOM   6312  H  HA2    . GLY B 1 103 ? 35.545  29.265 -86.389  1.00 64.15  ? 83  GLY B HA2    1 
ATOM   6313  H  HA3    . GLY B 1 103 ? 36.450  30.204 -85.508  1.00 64.15  ? 83  GLY B HA3    1 
ATOM   6314  N  N      . ASP B 1 104 ? 36.164  31.325 -87.861  1.00 65.32  ? 84  ASP B N      1 
ATOM   6315  C  CA     . ASP B 1 104 ? 36.458  32.153 -89.022  1.00 73.07  ? 84  ASP B CA     1 
ATOM   6316  C  C      . ASP B 1 104 ? 36.897  33.533 -88.550  1.00 75.12  ? 84  ASP B C      1 
ATOM   6317  O  O      . ASP B 1 104 ? 36.206  34.168 -87.746  1.00 78.32  ? 84  ASP B O      1 
ATOM   6318  C  CB     . ASP B 1 104 ? 35.237  32.266 -89.938  1.00 72.97  ? 84  ASP B CB     1 
ATOM   6319  C  CG     . ASP B 1 104 ? 34.849  30.938 -90.559  1.00 69.56  ? 84  ASP B CG     1 
ATOM   6320  O  OD1    . ASP B 1 104 ? 35.737  30.075 -90.723  1.00 68.73  ? 84  ASP B OD1    1 
ATOM   6321  O  OD2    . ASP B 1 104 ? 33.656  30.756 -90.885  1.00 67.14  ? 84  ASP B OD2    1 
ATOM   6322  H  H      . ASP B 1 104 ? 35.455  31.568 -87.440  1.00 78.50  ? 84  ASP B H      1 
ATOM   6323  H  HA     . ASP B 1 104 ? 37.184  31.756 -89.527  1.00 87.81  ? 84  ASP B HA     1 
ATOM   6324  H  HB2    . ASP B 1 104 ? 34.482  32.588 -89.421  1.00 87.68  ? 84  ASP B HB2    1 
ATOM   6325  H  HB3    . ASP B 1 104 ? 35.436  32.887 -90.656  1.00 87.68  ? 84  ASP B HB3    1 
ATOM   6326  N  N      . ALA B 1 105 ? 38.041  33.992 -89.053  1.00 64.61  ? 85  ALA B N      1 
ATOM   6327  C  CA     . ALA B 1 105 ? 38.596  35.265 -88.617  1.00 59.11  ? 85  ALA B CA     1 
ATOM   6328  C  C      . ALA B 1 105 ? 37.762  36.428 -89.142  1.00 59.22  ? 85  ALA B C      1 
ATOM   6329  O  O      . ALA B 1 105 ? 37.086  36.327 -90.170  1.00 56.01  ? 85  ALA B O      1 
ATOM   6330  C  CB     . ALA B 1 105 ? 40.041  35.404 -89.094  1.00 58.73  ? 85  ALA B CB     1 
ATOM   6331  H  H      . ALA B 1 105 ? 38.512  33.585 -89.646  1.00 77.65  ? 85  ALA B H      1 
ATOM   6332  H  HA     . ALA B 1 105 ? 38.591  35.300 -87.648  1.00 71.05  ? 85  ALA B HA     1 
ATOM   6333  H  HB1    . ALA B 1 105 ? 40.391  36.257 -88.793  1.00 70.60  ? 85  ALA B HB1    1 
ATOM   6334  H  HB2    . ALA B 1 105 ? 40.567  34.680 -88.720  1.00 70.60  ? 85  ALA B HB2    1 
ATOM   6335  H  HB3    . ALA B 1 105 ? 40.059  35.361 -90.062  1.00 70.60  ? 85  ALA B HB3    1 
ATOM   6336  N  N      . ALA B 1 106 ? 37.822  37.550 -88.421  1.00 66.12  ? 86  ALA B N      1 
ATOM   6337  C  CA     . ALA B 1 106 ? 37.060  38.744 -88.769  1.00 68.30  ? 86  ALA B CA     1 
ATOM   6338  C  C      . ALA B 1 106 ? 37.947  39.944 -89.081  1.00 74.51  ? 86  ALA B C      1 
ATOM   6339  O  O      . ALA B 1 106 ? 37.430  41.059 -89.225  1.00 73.75  ? 86  ALA B O      1 
ATOM   6340  C  CB     . ALA B 1 106 ? 36.095  39.097 -87.634  1.00 64.73  ? 86  ALA B CB     1 
ATOM   6341  H  H      . ALA B 1 106 ? 38.305  37.643 -87.716  1.00 79.46  ? 86  ALA B H      1 
ATOM   6342  H  HA     . ALA B 1 106 ? 36.531  38.555 -89.560  1.00 82.08  ? 86  ALA B HA     1 
ATOM   6343  H  HB1    . ALA B 1 106 ? 35.597  39.892 -87.880  1.00 77.80  ? 86  ALA B HB1    1 
ATOM   6344  H  HB2    . ALA B 1 106 ? 35.487  38.354 -87.494  1.00 77.80  ? 86  ALA B HB2    1 
ATOM   6345  H  HB3    . ALA B 1 106 ? 36.606  39.263 -86.826  1.00 77.80  ? 86  ALA B HB3    1 
ATOM   6346  N  N      . THR B 1 107 ? 39.259  39.754 -89.194  1.00 83.18  ? 87  THR B N      1 
ATOM   6347  C  CA     . THR B 1 107 ? 40.156  40.868 -89.453  1.00 85.74  ? 87  THR B CA     1 
ATOM   6348  C  C      . THR B 1 107 ? 40.118  41.251 -90.931  1.00 91.93  ? 87  THR B C      1 
ATOM   6349  O  O      . THR B 1 107 ? 39.751  40.452 -91.796  1.00 89.77  ? 87  THR B O      1 
ATOM   6350  C  CB     . THR B 1 107 ? 41.585  40.511 -89.036  1.00 80.33  ? 87  THR B CB     1 
ATOM   6351  O  OG1    . THR B 1 107 ? 42.042  39.386 -89.797  1.00 77.21  ? 87  THR B OG1    1 
ATOM   6352  C  CG2    . THR B 1 107 ? 41.643  40.165 -87.549  1.00 77.30  ? 87  THR B CG2    1 
ATOM   6353  H  H      . THR B 1 107 ? 39.650  38.991 -89.126  1.00 99.93  ? 87  THR B H      1 
ATOM   6354  H  HA     . THR B 1 107 ? 39.871  41.636 -88.932  1.00 103.00 ? 87  THR B HA     1 
ATOM   6355  H  HB     . THR B 1 107 ? 42.168  41.269 -89.198  1.00 96.52  ? 87  THR B HB     1 
ATOM   6356  H  HG1    . THR B 1 107 ? 42.826  39.186 -89.571  1.00 92.77  ? 87  THR B HG1    1 
ATOM   6357  H  HG21   . THR B 1 107 ? 42.552  39.941 -87.297  1.00 92.87  ? 87  THR B HG21   1 
ATOM   6358  H  HG22   . THR B 1 107 ? 41.347  40.923 -87.021  1.00 92.87  ? 87  THR B HG22   1 
ATOM   6359  H  HG23   . THR B 1 107 ? 41.067  39.407 -87.362  1.00 92.87  ? 87  THR B HG23   1 
ATOM   6360  N  N      . GLN B 1 108 ? 40.525  42.493 -91.218  1.00 94.82  ? 88  GLN B N      1 
ATOM   6361  C  CA     . GLN B 1 108 ? 40.563  42.962 -92.601  1.00 100.25 ? 88  GLN B CA     1 
ATOM   6362  C  C      . GLN B 1 108 ? 41.648  42.251 -93.404  1.00 103.43 ? 88  GLN B C      1 
ATOM   6363  O  O      . GLN B 1 108 ? 41.450  41.936 -94.593  1.00 107.57 ? 88  GLN B O      1 
ATOM   6364  C  CB     . GLN B 1 108 ? 40.771  44.480 -92.617  1.00 103.47 ? 88  GLN B CB     1 
ATOM   6365  C  CG     . GLN B 1 108 ? 39.534  45.277 -92.200  1.00 105.27 ? 88  GLN B CG     1 
ATOM   6366  C  CD     . GLN B 1 108 ? 39.731  46.779 -92.290  1.00 109.35 ? 88  GLN B CD     1 
ATOM   6367  O  OE1    . GLN B 1 108 ? 39.319  47.412 -93.262  1.00 110.61 ? 88  GLN B OE1    1 
ATOM   6368  N  NE2    . GLN B 1 108 ? 40.353  47.360 -91.269  1.00 111.03 ? 88  GLN B NE2    1 
ATOM   6369  H  H      . GLN B 1 108 ? 40.781  43.073 -90.637  1.00 113.91 ? 88  GLN B H      1 
ATOM   6370  H  HA     . GLN B 1 108 ? 39.709  42.773 -93.021  1.00 120.42 ? 88  GLN B HA     1 
ATOM   6371  H  HB2    . GLN B 1 108 ? 41.488  44.703 -92.003  1.00 124.28 ? 88  GLN B HB2    1 
ATOM   6372  H  HB3    . GLN B 1 108 ? 41.011  44.753 -93.516  1.00 124.28 ? 88  GLN B HB3    1 
ATOM   6373  H  HG2    . GLN B 1 108 ? 38.795  45.038 -92.782  1.00 126.44 ? 88  GLN B HG2    1 
ATOM   6374  H  HG3    . GLN B 1 108 ? 39.314  45.059 -91.281  1.00 126.44 ? 88  GLN B HG3    1 
ATOM   6375  H  HE21   . GLN B 1 108 ? 40.620  46.887 -90.602  1.00 133.35 ? 88  GLN B HE21   1 
ATOM   6376  H  HE22   . GLN B 1 108 ? 40.488  48.209 -91.274  1.00 133.35 ? 88  GLN B HE22   1 
ATOM   6377  N  N      . VAL B 1 109 ? 42.771  41.937 -92.752  1.00 90.69  ? 89  VAL B N      1 
ATOM   6378  C  CA     . VAL B 1 109 ? 43.856  41.235 -93.427  1.00 91.13  ? 89  VAL B CA     1 
ATOM   6379  C  C      . VAL B 1 109 ? 43.335  39.938 -94.025  1.00 91.68  ? 89  VAL B C      1 
ATOM   6380  O  O      . VAL B 1 109 ? 43.647  39.594 -95.172  1.00 90.67  ? 89  VAL B O      1 
ATOM   6381  C  CB     . VAL B 1 109 ? 45.024  40.994 -92.449  1.00 92.23  ? 89  VAL B CB     1 
ATOM   6382  C  CG1    . VAL B 1 109 ? 45.595  42.320 -91.962  1.00 93.55  ? 89  VAL B CG1    1 
ATOM   6383  C  CG2    . VAL B 1 109 ? 44.583  40.152 -91.252  1.00 90.49  ? 89  VAL B CG2    1 
ATOM   6384  H  H      . VAL B 1 109 ? 42.925  42.119 -91.926  1.00 108.95 ? 89  VAL B H      1 
ATOM   6385  H  HA     . VAL B 1 109 ? 44.184  41.788 -94.153  1.00 109.47 ? 89  VAL B HA     1 
ATOM   6386  H  HB     . VAL B 1 109 ? 45.729  40.515 -92.910  1.00 110.80 ? 89  VAL B HB     1 
ATOM   6387  H  HG11   . VAL B 1 109 ? 46.327  42.142 -91.349  1.00 112.38 ? 89  VAL B HG11   1 
ATOM   6388  H  HG12   . VAL B 1 109 ? 45.918  42.824 -92.725  1.00 112.38 ? 89  VAL B HG12   1 
ATOM   6389  H  HG13   . VAL B 1 109 ? 44.897  42.817 -91.508  1.00 112.38 ? 89  VAL B HG13   1 
ATOM   6390  H  HG21   . VAL B 1 109 ? 45.342  40.022 -90.661  1.00 108.71 ? 89  VAL B HG21   1 
ATOM   6391  H  HG22   . VAL B 1 109 ? 43.874  40.617 -90.782  1.00 108.71 ? 89  VAL B HG22   1 
ATOM   6392  H  HG23   . VAL B 1 109 ? 44.262  39.294 -91.571  1.00 108.71 ? 89  VAL B HG23   1 
ATOM   6393  N  N      . ALA B 1 110 ? 42.521  39.205 -93.262  1.00 108.82 ? 90  ALA B N      1 
ATOM   6394  C  CA     . ALA B 1 110 ? 41.910  37.984 -93.772  1.00 107.91 ? 90  ALA B CA     1 
ATOM   6395  C  C      . ALA B 1 110 ? 40.953  38.287 -94.919  1.00 103.23 ? 90  ALA B C      1 
ATOM   6396  O  O      . ALA B 1 110 ? 40.886  37.537 -95.900  1.00 104.49 ? 90  ALA B O      1 
ATOM   6397  C  CB     . ALA B 1 110 ? 41.181  37.255 -92.643  1.00 106.61 ? 90  ALA B CB     1 
ATOM   6398  H  H      . ALA B 1 110 ? 42.310  39.395 -92.451  1.00 130.71 ? 90  ALA B H      1 
ATOM   6399  H  HA     . ALA B 1 110 ? 42.606  37.398 -94.108  1.00 129.60 ? 90  ALA B HA     1 
ATOM   6400  H  HB1    . ALA B 1 110 ? 40.780  36.446 -92.997  1.00 128.05 ? 90  ALA B HB1    1 
ATOM   6401  H  HB2    . ALA B 1 110 ? 41.820  37.032 -91.948  1.00 128.05 ? 90  ALA B HB2    1 
ATOM   6402  H  HB3    . ALA B 1 110 ? 40.493  37.837 -92.285  1.00 128.05 ? 90  ALA B HB3    1 
ATOM   6403  N  N      . LYS B 1 111 ? 40.203  39.387 -94.813  1.00 100.85 ? 91  LYS B N      1 
ATOM   6404  C  CA     . LYS B 1 111 ? 39.230  39.751 -95.838  1.00 94.18  ? 91  LYS B CA     1 
ATOM   6405  C  C      . LYS B 1 111 ? 39.873  40.041 -97.192  1.00 90.86  ? 91  LYS B C      1 
ATOM   6406  O  O      . LYS B 1 111 ? 39.194  39.927 -98.217  1.00 90.60  ? 91  LYS B O      1 
ATOM   6407  C  CB     . LYS B 1 111 ? 38.413  40.959 -95.356  1.00 94.07  ? 91  LYS B CB     1 
ATOM   6408  C  CG     . LYS B 1 111 ? 37.531  40.640 -94.145  1.00 94.09  ? 91  LYS B CG     1 
ATOM   6409  C  CD     . LYS B 1 111 ? 36.478  41.706 -93.837  1.00 95.51  ? 91  LYS B CD     1 
ATOM   6410  C  CE     . LYS B 1 111 ? 37.056  42.823 -92.976  1.00 98.14  ? 91  LYS B CE     1 
ATOM   6411  N  NZ     . LYS B 1 111 ? 36.059  43.851 -92.561  1.00 97.95  ? 91  LYS B NZ     1 
ATOM   6412  H  H      . LYS B 1 111 ? 40.242  39.939 -94.154  1.00 121.13 ? 91  LYS B H      1 
ATOM   6413  H  HA     . LYS B 1 111 ? 38.616  39.009 -95.958  1.00 113.13 ? 91  LYS B HA     1 
ATOM   6414  H  HB2    . LYS B 1 111 ? 39.021  41.671 -95.104  1.00 113.01 ? 91  LYS B HB2    1 
ATOM   6415  H  HB3    . LYS B 1 111 ? 37.835  41.256 -96.077  1.00 113.01 ? 91  LYS B HB3    1 
ATOM   6416  H  HG2    . LYS B 1 111 ? 37.066  39.805 -94.310  1.00 113.03 ? 91  LYS B HG2    1 
ATOM   6417  H  HG3    . LYS B 1 111 ? 38.097  40.550 -93.363  1.00 113.03 ? 91  LYS B HG3    1 
ATOM   6418  H  HD2    . LYS B 1 111 ? 36.162  42.095 -94.668  1.00 114.74 ? 91  LYS B HD2    1 
ATOM   6419  H  HD3    . LYS B 1 111 ? 35.741  41.300 -93.355  1.00 114.74 ? 91  LYS B HD3    1 
ATOM   6420  H  HE2    . LYS B 1 111 ? 37.431  42.433 -92.171  1.00 117.88 ? 91  LYS B HE2    1 
ATOM   6421  H  HE3    . LYS B 1 111 ? 37.754  43.274 -93.478  1.00 117.88 ? 91  LYS B HE3    1 
ATOM   6422  H  HZ1    . LYS B 1 111 ? 36.454  44.474 -92.063  1.00 117.66 ? 91  LYS B HZ1    1 
ATOM   6423  H  HZ2    . LYS B 1 111 ? 35.704  44.238 -93.279  1.00 117.66 ? 91  LYS B HZ2    1 
ATOM   6424  H  HZ3    . LYS B 1 111 ? 35.409  43.470 -92.086  1.00 117.66 ? 91  LYS B HZ3    1 
ATOM   6425  N  N      . GLY B 1 112 ? 41.155  40.412 -97.232  1.00 87.16  ? 92  GLY B N      1 
ATOM   6426  C  CA     . GLY B 1 112 ? 41.796  40.665 -98.523  1.00 84.22  ? 92  GLY B CA     1 
ATOM   6427  C  C      . GLY B 1 112 ? 42.054  39.417 -99.361  1.00 78.15  ? 92  GLY B C      1 
ATOM   6428  O  O      . GLY B 1 112 ? 41.704  39.366 -100.554 1.00 77.51  ? 92  GLY B O      1 
ATOM   6429  H  H      . GLY B 1 112 ? 41.663  40.522 -96.546  1.00 104.72 ? 92  GLY B H      1 
ATOM   6430  H  HA2    . GLY B 1 112 ? 41.235  41.264 -99.041  1.00 101.18 ? 92  GLY B HA2    1 
ATOM   6431  H  HA3    . GLY B 1 112 ? 42.647  41.106 -98.372  1.00 101.18 ? 92  GLY B HA3    1 
ATOM   6432  N  N      . LEU B 1 113 ? 42.667  38.394 -98.753  1.00 75.56  ? 93  LEU B N      1 
ATOM   6433  C  CA     . LEU B 1 113 ? 43.071  37.200 -99.496  1.00 70.27  ? 93  LEU B CA     1 
ATOM   6434  C  C      . LEU B 1 113 ? 41.898  36.578 -100.254 1.00 70.63  ? 93  LEU B C      1 
ATOM   6435  O  O      . LEU B 1 113 ? 42.001  36.292 -101.461 1.00 76.35  ? 93  LEU B O      1 
ATOM   6436  C  CB     . LEU B 1 113 ? 43.699  36.193 -98.527  1.00 62.92  ? 93  LEU B CB     1 
ATOM   6437  C  CG     . LEU B 1 113 ? 44.816  36.757 -97.632  1.00 60.77  ? 93  LEU B CG     1 
ATOM   6438  C  CD1    . LEU B 1 113 ? 44.331  36.937 -96.200  1.00 58.21  ? 93  LEU B CD1    1 
ATOM   6439  C  CD2    . LEU B 1 113 ? 46.070  35.893 -97.656  1.00 61.79  ? 93  LEU B CD2    1 
ATOM   6440  H  H      . LEU B 1 113 ? 42.857  38.369 -97.914  1.00 90.79  ? 93  LEU B H      1 
ATOM   6441  H  HA     . LEU B 1 113 ? 43.746  37.449 -100.146 1.00 84.44  ? 93  LEU B HA     1 
ATOM   6442  H  HB2    . LEU B 1 113 ? 43.004  35.850 -97.944  1.00 75.62  ? 93  LEU B HB2    1 
ATOM   6443  H  HB3    . LEU B 1 113 ? 44.079  35.464 -99.043  1.00 75.62  ? 93  LEU B HB3    1 
ATOM   6444  H  HG     . LEU B 1 113 ? 45.062  37.633 -97.967  1.00 73.04  ? 93  LEU B HG     1 
ATOM   6445  H  HD11   . LEU B 1 113 ? 45.056  37.293 -95.664  1.00 69.97  ? 93  LEU B HD11   1 
ATOM   6446  H  HD12   . LEU B 1 113 ? 43.582  37.554 -96.196  1.00 69.97  ? 93  LEU B HD12   1 
ATOM   6447  H  HD13   . LEU B 1 113 ? 44.052  36.076 -95.851  1.00 69.97  ? 93  LEU B HD13   1 
ATOM   6448  H  HD21   . LEU B 1 113 ? 46.739  36.292 -97.078  1.00 74.27  ? 93  LEU B HD21   1 
ATOM   6449  H  HD22   . LEU B 1 113 ? 45.846  35.004 -97.339  1.00 74.27  ? 93  LEU B HD22   1 
ATOM   6450  H  HD23   . LEU B 1 113 ? 46.403  35.846 -98.566  1.00 74.27  ? 93  LEU B HD23   1 
ATOM   6451  N  N      . GLN B 1 114 ? 40.755  36.422 -99.582  1.00 61.93  ? 94  GLN B N      1 
ATOM   6452  C  CA     . GLN B 1 114 ? 39.591  35.819 -100.224 1.00 61.60  ? 94  GLN B CA     1 
ATOM   6453  C  C      . GLN B 1 114 ? 39.211  36.587 -101.483 1.00 63.05  ? 94  GLN B C      1 
ATOM   6454  O  O      . GLN B 1 114 ? 39.009  35.997 -102.553 1.00 61.06  ? 94  GLN B O      1 
ATOM   6455  C  CB     . GLN B 1 114 ? 38.411  35.797 -99.249  1.00 61.12  ? 94  GLN B CB     1 
ATOM   6456  C  CG     . GLN B 1 114 ? 38.582  34.904 -98.023  1.00 58.88  ? 94  GLN B CG     1 
ATOM   6457  C  CD     . GLN B 1 114 ? 37.472  35.113 -97.000  1.00 56.94  ? 94  GLN B CD     1 
ATOM   6458  O  OE1    . GLN B 1 114 ? 36.657  36.026 -97.133  1.00 56.48  ? 94  GLN B OE1    1 
ATOM   6459  N  NE2    . GLN B 1 114 ? 37.432  34.262 -95.980  1.00 55.89  ? 94  GLN B NE2    1 
ATOM   6460  H  H      . GLN B 1 114 ? 40.630  36.654 -98.764  1.00 74.43  ? 94  GLN B H      1 
ATOM   6461  H  HA     . GLN B 1 114 ? 39.799  34.905 -100.474 1.00 74.03  ? 94  GLN B HA     1 
ATOM   6462  H  HB2    . GLN B 1 114 ? 38.260  36.701 -98.931  1.00 73.47  ? 94  GLN B HB2    1 
ATOM   6463  H  HB3    . GLN B 1 114 ? 37.626  35.487 -99.726  1.00 73.47  ? 94  GLN B HB3    1 
ATOM   6464  H  HG2    . GLN B 1 114 ? 38.565  33.975 -98.301  1.00 70.78  ? 94  GLN B HG2    1 
ATOM   6465  H  HG3    . GLN B 1 114 ? 39.429  35.109 -97.596  1.00 70.78  ? 94  GLN B HG3    1 
ATOM   6466  H  HE21   . GLN B 1 114 ? 38.015  33.633 -95.922  1.00 67.18  ? 94  GLN B HE21   1 
ATOM   6467  H  HE22   . GLN B 1 114 ? 36.823  34.341 -95.378  1.00 67.18  ? 94  GLN B HE22   1 
ATOM   6468  N  N      . ALA B 1 115 ? 39.129  37.914 -101.376 1.00 66.82  ? 95  ALA B N      1 
ATOM   6469  C  CA     . ALA B 1 115 ? 38.719  38.724 -102.515 1.00 70.71  ? 95  ALA B CA     1 
ATOM   6470  C  C      . ALA B 1 115 ? 39.683  38.579 -103.685 1.00 76.64  ? 95  ALA B C      1 
ATOM   6471  O  O      . ALA B 1 115 ? 39.248  38.440 -104.836 1.00 72.88  ? 95  ALA B O      1 
ATOM   6472  C  CB     . ALA B 1 115 ? 38.601  40.188 -102.097 1.00 71.04  ? 95  ALA B CB     1 
ATOM   6473  H  H      . ALA B 1 115 ? 39.304  38.362 -100.663 1.00 80.31  ? 95  ALA B H      1 
ATOM   6474  H  HA     . ALA B 1 115 ? 37.844  38.428 -102.812 1.00 84.97  ? 95  ALA B HA     1 
ATOM   6475  H  HB1    . ALA B 1 115 ? 38.328  40.714 -102.864 1.00 85.37  ? 95  ALA B HB1    1 
ATOM   6476  H  HB2    . ALA B 1 115 ? 37.940  40.262 -101.392 1.00 85.37  ? 95  ALA B HB2    1 
ATOM   6477  H  HB3    . ALA B 1 115 ? 39.464  40.494 -101.776 1.00 85.37  ? 95  ALA B HB3    1 
ATOM   6478  N  N      . ASP B 1 116 ? 40.995  38.587 -103.425 1.00 94.30  ? 96  ASP B N      1 
ATOM   6479  C  CA     . ASP B 1 116 ? 41.923  38.523 -104.555 1.00 102.76 ? 96  ASP B CA     1 
ATOM   6480  C  C      . ASP B 1 116 ? 41.825  37.175 -105.273 1.00 100.53 ? 96  ASP B C      1 
ATOM   6481  O  O      . ASP B 1 116 ? 41.698  37.119 -106.512 1.00 109.59 ? 96  ASP B O      1 
ATOM   6482  C  CB     . ASP B 1 116 ? 43.356  38.819 -104.098 1.00 103.46 ? 96  ASP B CB     1 
ATOM   6483  C  CG     . ASP B 1 116 ? 43.857  37.865 -103.039 1.00 101.10 ? 96  ASP B CG     1 
ATOM   6484  O  OD1    . ASP B 1 116 ? 43.670  36.640 -103.187 1.00 100.11 ? 96  ASP B OD1    1 
ATOM   6485  O  OD2    . ASP B 1 116 ? 44.465  38.350 -102.063 1.00 99.93  ? 96  ASP B OD2    1 
ATOM   6486  H  H      . ASP B 1 116 ? 41.356  38.627 -102.646 1.00 113.28 ? 96  ASP B H      1 
ATOM   6487  H  HA     . ASP B 1 116 ? 41.675  39.209 -105.193 1.00 123.43 ? 96  ASP B HA     1 
ATOM   6488  H  HB2    . ASP B 1 116 ? 43.949  38.754 -104.863 1.00 124.28 ? 96  ASP B HB2    1 
ATOM   6489  H  HB3    . ASP B 1 116 ? 43.390  39.716 -103.730 1.00 124.28 ? 96  ASP B HB3    1 
ATOM   6490  N  N      . ILE B 1 117 ? 41.821  36.072 -104.518 1.00 78.93  ? 97  ILE B N      1 
ATOM   6491  C  CA     . ILE B 1 117 ? 41.759  34.783 -105.202 1.00 75.06  ? 97  ILE B CA     1 
ATOM   6492  C  C      . ILE B 1 117 ? 40.431  34.648 -105.942 1.00 75.51  ? 97  ILE B C      1 
ATOM   6493  O  O      . ILE B 1 117 ? 40.372  34.105 -107.057 1.00 78.53  ? 97  ILE B O      1 
ATOM   6494  C  CB     . ILE B 1 117 ? 41.998  33.618 -104.223 1.00 75.64  ? 97  ILE B CB     1 
ATOM   6495  C  CG1    . ILE B 1 117 ? 42.227  32.329 -105.016 1.00 77.60  ? 97  ILE B CG1    1 
ATOM   6496  C  CG2    . ILE B 1 117 ? 40.828  33.447 -103.270 1.00 73.82  ? 97  ILE B CG2    1 
ATOM   6497  C  CD1    . ILE B 1 117 ? 42.891  31.232 -104.227 1.00 78.14  ? 97  ILE B CD1    1 
ATOM   6498  H  H      . ILE B 1 117 ? 41.852  36.042 -103.659 1.00 94.84  ? 97  ILE B H      1 
ATOM   6499  H  HA     . ILE B 1 117 ? 42.465  34.753 -105.866 1.00 90.19  ? 97  ILE B HA     1 
ATOM   6500  H  HB     . ILE B 1 117 ? 42.795  33.809 -103.704 1.00 90.89  ? 97  ILE B HB     1 
ATOM   6501  H  HG12   . ILE B 1 117 ? 41.369  31.995 -105.323 1.00 93.23  ? 97  ILE B HG12   1 
ATOM   6502  H  HG13   . ILE B 1 117 ? 42.792  32.528 -105.779 1.00 93.23  ? 97  ILE B HG13   1 
ATOM   6503  H  HG21   . ILE B 1 117 ? 41.015  32.707 -102.671 1.00 88.70  ? 97  ILE B HG21   1 
ATOM   6504  H  HG22   . ILE B 1 117 ? 40.714  34.265 -102.761 1.00 88.70  ? 97  ILE B HG22   1 
ATOM   6505  H  HG23   . ILE B 1 117 ? 40.026  33.263 -103.784 1.00 88.70  ? 97  ILE B HG23   1 
ATOM   6506  H  HD11   . ILE B 1 117 ? 43.000  30.455 -104.797 1.00 93.89  ? 97  ILE B HD11   1 
ATOM   6507  H  HD12   . ILE B 1 117 ? 43.758  31.543 -103.923 1.00 93.89  ? 97  ILE B HD12   1 
ATOM   6508  H  HD13   . ILE B 1 117 ? 42.333  31.009 -103.465 1.00 93.89  ? 97  ILE B HD13   1 
ATOM   6509  N  N      . LEU B 1 118 ? 39.350  35.172 -105.356 1.00 71.60  ? 98  LEU B N      1 
ATOM   6510  C  CA     . LEU B 1 118 ? 38.077  35.186 -106.068 1.00 70.70  ? 98  LEU B CA     1 
ATOM   6511  C  C      . LEU B 1 118 ? 38.176  35.998 -107.351 1.00 69.81  ? 98  LEU B C      1 
ATOM   6512  O  O      . LEU B 1 118 ? 37.469  35.708 -108.324 1.00 65.29  ? 98  LEU B O      1 
ATOM   6513  C  CB     . LEU B 1 118 ? 36.967  35.738 -105.174 1.00 73.30  ? 98  LEU B CB     1 
ATOM   6514  C  CG     . LEU B 1 118 ? 36.523  34.841 -104.015 1.00 74.54  ? 98  LEU B CG     1 
ATOM   6515  C  CD1    . LEU B 1 118 ? 35.566  35.584 -103.098 1.00 74.01  ? 98  LEU B CD1    1 
ATOM   6516  C  CD2    . LEU B 1 118 ? 35.866  33.571 -104.541 1.00 74.75  ? 98  LEU B CD2    1 
ATOM   6517  H  H      . LEU B 1 118 ? 39.329  35.516 -104.568 1.00 86.03  ? 98  LEU B H      1 
ATOM   6518  H  HA     . LEU B 1 118 ? 37.842  34.276 -106.309 1.00 84.96  ? 98  LEU B HA     1 
ATOM   6519  H  HB2    . LEU B 1 118 ? 37.273  36.574 -104.790 1.00 88.08  ? 98  LEU B HB2    1 
ATOM   6520  H  HB3    . LEU B 1 118 ? 36.186  35.903 -105.725 1.00 88.08  ? 98  LEU B HB3    1 
ATOM   6521  H  HG     . LEU B 1 118 ? 37.301  34.586 -103.495 1.00 89.57  ? 98  LEU B HG     1 
ATOM   6522  H  HD11   . LEU B 1 118 ? 35.301  34.995 -102.374 1.00 88.93  ? 98  LEU B HD11   1 
ATOM   6523  H  HD12   . LEU B 1 118 ? 36.014  36.367 -102.741 1.00 88.93  ? 98  LEU B HD12   1 
ATOM   6524  H  HD13   . LEU B 1 118 ? 34.786  35.853 -103.608 1.00 88.93  ? 98  LEU B HD13   1 
ATOM   6525  H  HD21   . LEU B 1 118 ? 35.595  33.022 -103.788 1.00 89.82  ? 98  LEU B HD21   1 
ATOM   6526  H  HD22   . LEU B 1 118 ? 35.091  33.813 -105.071 1.00 89.82  ? 98  LEU B HD22   1 
ATOM   6527  H  HD23   . LEU B 1 118 ? 36.505  33.089 -105.089 1.00 89.82  ? 98  LEU B HD23   1 
ATOM   6528  N  N      . ALA B 1 119 ? 39.044  37.012 -107.382 1.00 81.72  ? 99  ALA B N      1 
ATOM   6529  C  CA     . ALA B 1 119 ? 39.258  37.744 -108.625 1.00 82.86  ? 99  ALA B CA     1 
ATOM   6530  C  C      . ALA B 1 119 ? 39.843  36.826 -109.688 1.00 82.57  ? 99  ALA B C      1 
ATOM   6531  O  O      . ALA B 1 119 ? 39.343  36.767 -110.822 1.00 79.32  ? 99  ALA B O      1 
ATOM   6532  C  CB     . ALA B 1 119 ? 40.170  38.950 -108.391 1.00 80.99  ? 99  ALA B CB     1 
ATOM   6533  H  H      . ALA B 1 119 ? 39.508  37.288 -106.713 1.00 98.18  ? 99  ALA B H      1 
ATOM   6534  H  HA     . ALA B 1 119 ? 38.405  38.073 -108.949 1.00 99.55  ? 99  ALA B HA     1 
ATOM   6535  H  HB1    . ALA B 1 119 ? 40.296  39.418 -109.231 1.00 97.30  ? 99  ALA B HB1    1 
ATOM   6536  H  HB2    . ALA B 1 119 ? 39.753  39.539 -107.742 1.00 97.30  ? 99  ALA B HB2    1 
ATOM   6537  H  HB3    . ALA B 1 119 ? 41.024  38.638 -108.053 1.00 97.30  ? 99  ALA B HB3    1 
ATOM   6538  N  N      . LYS B 1 120 ? 40.889  36.072 -109.335 1.00 82.77  ? 100 LYS B N      1 
ATOM   6539  C  CA     . LYS B 1 120 ? 41.433  35.119 -110.303 1.00 88.91  ? 100 LYS B CA     1 
ATOM   6540  C  C      . LYS B 1 120 ? 40.351  34.167 -110.810 1.00 88.68  ? 100 LYS B C      1 
ATOM   6541  O  O      . LYS B 1 120 ? 40.167  33.995 -112.027 1.00 91.34  ? 100 LYS B O      1 
ATOM   6542  C  CB     . LYS B 1 120 ? 42.582  34.322 -109.688 1.00 92.98  ? 100 LYS B CB     1 
ATOM   6543  C  CG     . LYS B 1 120 ? 43.832  35.125 -109.414 1.00 97.94  ? 100 LYS B CG     1 
ATOM   6544  C  CD     . LYS B 1 120 ? 44.902  34.242 -108.805 1.00 101.30 ? 100 LYS B CD     1 
ATOM   6545  C  CE     . LYS B 1 120 ? 46.169  35.019 -108.518 1.00 104.91 ? 100 LYS B CE     1 
ATOM   6546  N  NZ     . LYS B 1 120 ? 47.201  34.162 -107.875 1.00 106.21 ? 100 LYS B NZ     1 
ATOM   6547  H  H      . LYS B 1 120 ? 41.287  36.091 -108.572 1.00 99.44  ? 100 LYS B H      1 
ATOM   6548  H  HA     . LYS B 1 120 ? 41.782  35.608 -111.065 1.00 106.81 ? 100 LYS B HA     1 
ATOM   6549  H  HB2    . LYS B 1 120 ? 42.283  33.948 -108.844 1.00 111.70 ? 100 LYS B HB2    1 
ATOM   6550  H  HB3    . LYS B 1 120 ? 42.822  33.604 -110.295 1.00 111.70 ? 100 LYS B HB3    1 
ATOM   6551  H  HG2    . LYS B 1 120 ? 44.171  35.490 -110.247 1.00 117.65 ? 100 LYS B HG2    1 
ATOM   6552  H  HG3    . LYS B 1 120 ? 43.628  35.838 -108.789 1.00 117.65 ? 100 LYS B HG3    1 
ATOM   6553  H  HD2    . LYS B 1 120 ? 44.576  33.875 -107.968 1.00 121.68 ? 100 LYS B HD2    1 
ATOM   6554  H  HD3    . LYS B 1 120 ? 45.118  33.527 -109.424 1.00 121.68 ? 100 LYS B HD3    1 
ATOM   6555  H  HE2    . LYS B 1 120 ? 46.532  35.359 -109.351 1.00 126.01 ? 100 LYS B HE2    1 
ATOM   6556  H  HE3    . LYS B 1 120 ? 45.966  35.753 -107.916 1.00 126.01 ? 100 LYS B HE3    1 
ATOM   6557  H  HZ1    . LYS B 1 120 ? 47.936  34.638 -107.716 1.00 127.57 ? 100 LYS B HZ1    1 
ATOM   6558  H  HZ2    . LYS B 1 120 ? 46.892  33.840 -107.105 1.00 127.57 ? 100 LYS B HZ2    1 
ATOM   6559  H  HZ3    . LYS B 1 120 ? 47.408  33.482 -108.411 1.00 127.57 ? 100 LYS B HZ3    1 
ATOM   6560  N  N      . LEU B 1 121 ? 39.611  33.549 -109.886 1.00 83.72  ? 101 LEU B N      1 
ATOM   6561  C  CA     . LEU B 1 121 ? 38.602  32.574 -110.288 1.00 80.67  ? 101 LEU B CA     1 
ATOM   6562  C  C      . LEU B 1 121 ? 37.581  33.206 -111.229 1.00 78.17  ? 101 LEU B C      1 
ATOM   6563  O  O      . LEU B 1 121 ? 37.220  32.622 -112.261 1.00 77.81  ? 101 LEU B O      1 
ATOM   6564  C  CB     . LEU B 1 121 ? 37.919  31.991 -109.050 1.00 78.93  ? 101 LEU B CB     1 
ATOM   6565  C  CG     . LEU B 1 121 ? 36.914  30.858 -109.273 1.00 78.89  ? 101 LEU B CG     1 
ATOM   6566  C  CD1    . LEU B 1 121 ? 37.552  29.685 -110.005 1.00 82.06  ? 101 LEU B CD1    1 
ATOM   6567  C  CD2    . LEU B 1 121 ? 36.343  30.398 -107.944 1.00 75.98  ? 101 LEU B CD2    1 
ATOM   6568  H  H      . LEU B 1 121 ? 39.673  33.675 -109.037 1.00 100.59 ? 101 LEU B H      1 
ATOM   6569  H  HA     . LEU B 1 121 ? 39.036  31.848 -110.762 1.00 96.93  ? 101 LEU B HA     1 
ATOM   6570  H  HB2    . LEU B 1 121 ? 38.608  31.648 -108.460 1.00 94.84  ? 101 LEU B HB2    1 
ATOM   6571  H  HB3    . LEU B 1 121 ? 37.444  32.708 -108.602 1.00 94.84  ? 101 LEU B HB3    1 
ATOM   6572  H  HG     . LEU B 1 121 ? 36.181  31.188 -109.816 1.00 94.78  ? 101 LEU B HG     1 
ATOM   6573  H  HD11   . LEU B 1 121 ? 36.886  28.990 -110.127 1.00 98.59  ? 101 LEU B HD11   1 
ATOM   6574  H  HD12   . LEU B 1 121 ? 37.874  29.990 -110.868 1.00 98.59  ? 101 LEU B HD12   1 
ATOM   6575  H  HD13   . LEU B 1 121 ? 38.291  29.347 -109.476 1.00 98.59  ? 101 LEU B HD13   1 
ATOM   6576  H  HD21   . LEU B 1 121 ? 35.710  29.681 -108.104 1.00 91.29  ? 101 LEU B HD21   1 
ATOM   6577  H  HD22   . LEU B 1 121 ? 37.067  30.081 -107.382 1.00 91.29  ? 101 LEU B HD22   1 
ATOM   6578  H  HD23   . LEU B 1 121 ? 35.896  31.146 -107.517 1.00 91.29  ? 101 LEU B HD23   1 
ATOM   6579  N  N      . ALA B 1 122 ? 37.111  34.409 -110.891 1.00 74.47  ? 102 ALA B N      1 
ATOM   6580  C  CA     . ALA B 1 122 ? 36.172  35.103 -111.764 1.00 72.20  ? 102 ALA B CA     1 
ATOM   6581  C  C      . ALA B 1 122 ? 36.749  35.281 -113.162 1.00 72.35  ? 102 ALA B C      1 
ATOM   6582  O  O      . ALA B 1 122 ? 36.047  35.073 -114.160 1.00 67.25  ? 102 ALA B O      1 
ATOM   6583  C  CB     . ALA B 1 122 ? 35.797  36.456 -111.163 1.00 72.29  ? 102 ALA B CB     1 
ATOM   6584  H  H      . ALA B 1 122 ? 37.317  34.835 -110.174 1.00 89.48  ? 102 ALA B H      1 
ATOM   6585  H  HA     . ALA B 1 122 ? 35.362  34.575 -111.840 1.00 86.76  ? 102 ALA B HA     1 
ATOM   6586  H  HB1    . ALA B 1 122 ? 35.173  36.903 -111.756 1.00 86.86  ? 102 ALA B HB1    1 
ATOM   6587  H  HB2    . ALA B 1 122 ? 35.385  36.313 -110.296 1.00 86.86  ? 102 ALA B HB2    1 
ATOM   6588  H  HB3    . ALA B 1 122 ? 36.600  36.991 -111.064 1.00 86.86  ? 102 ALA B HB3    1 
ATOM   6589  N  N      . ARG B 1 123 ? 38.026  35.668 -113.262 1.00 80.37  ? 103 ARG B N      1 
ATOM   6590  C  CA     . ARG B 1 123 ? 38.639  35.780 -114.583 1.00 87.29  ? 103 ARG B CA     1 
ATOM   6591  C  C      . ARG B 1 123 ? 38.538  34.468 -115.349 1.00 79.23  ? 103 ARG B C      1 
ATOM   6592  O  O      . ARG B 1 123 ? 38.075  34.442 -116.497 1.00 80.41  ? 103 ARG B O      1 
ATOM   6593  C  CB     . ARG B 1 123 ? 40.097  36.226 -114.484 1.00 98.79  ? 103 ARG B CB     1 
ATOM   6594  C  CG     . ARG B 1 123 ? 40.690  36.510 -115.864 1.00 109.37 ? 103 ARG B CG     1 
ATOM   6595  C  CD     . ARG B 1 123 ? 42.114  37.026 -115.825 1.00 116.14 ? 103 ARG B CD     1 
ATOM   6596  N  NE     . ARG B 1 123 ? 42.203  38.327 -115.173 1.00 119.56 ? 103 ARG B NE     1 
ATOM   6597  C  CZ     . ARG B 1 123 ? 43.337  38.891 -114.772 1.00 124.62 ? 103 ARG B CZ     1 
ATOM   6598  N  NH1    . ARG B 1 123 ? 44.496  38.269 -114.951 1.00 128.24 ? 103 ARG B NH1    1 
ATOM   6599  N  NH2    . ARG B 1 123 ? 43.313  40.083 -114.192 1.00 125.34 ? 103 ARG B NH2    1 
ATOM   6600  H  H      . ARG B 1 123 ? 38.541  35.865 -112.601 1.00 96.56  ? 103 ARG B H      1 
ATOM   6601  H  HA     . ARG B 1 123 ? 38.160  36.454 -115.090 1.00 104.87 ? 103 ARG B HA     1 
ATOM   6602  H  HB2    . ARG B 1 123 ? 40.149  37.039 -113.958 1.00 118.66 ? 103 ARG B HB2    1 
ATOM   6603  H  HB3    . ARG B 1 123 ? 40.620  35.523 -114.067 1.00 118.66 ? 103 ARG B HB3    1 
ATOM   6604  H  HG2    . ARG B 1 123 ? 40.686  35.688 -116.381 1.00 131.36 ? 103 ARG B HG2    1 
ATOM   6605  H  HG3    . ARG B 1 123 ? 40.144  37.178 -116.307 1.00 131.36 ? 103 ARG B HG3    1 
ATOM   6606  H  HD2    . ARG B 1 123 ? 42.666  36.400 -115.330 1.00 139.49 ? 103 ARG B HD2    1 
ATOM   6607  H  HD3    . ARG B 1 123 ? 42.444  37.119 -116.732 1.00 139.49 ? 103 ARG B HD3    1 
ATOM   6608  H  HE     . ARG B 1 123 ? 41.472  38.759 -115.039 1.00 143.58 ? 103 ARG B HE     1 
ATOM   6609  H  HH11   . ARG B 1 123 ? 44.515  37.497 -115.328 1.00 154.00 ? 103 ARG B HH11   1 
ATOM   6610  H  HH12   . ARG B 1 123 ? 45.227  38.639 -114.689 1.00 154.00 ? 103 ARG B HH12   1 
ATOM   6611  H  HH21   . ARG B 1 123 ? 42.564  40.488 -114.074 1.00 150.52 ? 103 ARG B HH21   1 
ATOM   6612  H  HH22   . ARG B 1 123 ? 44.046  40.448 -113.930 1.00 150.52 ? 103 ARG B HH22   1 
ATOM   6613  N  N      . VAL B 1 124 ? 38.970  33.362 -114.734 1.00 70.46  ? 104 VAL B N      1 
ATOM   6614  C  CA     . VAL B 1 124 ? 38.901  32.082 -115.441 1.00 67.81  ? 104 VAL B CA     1 
ATOM   6615  C  C      . VAL B 1 124 ? 37.479  31.817 -115.919 1.00 66.90  ? 104 VAL B C      1 
ATOM   6616  O  O      . VAL B 1 124 ? 37.259  31.387 -117.059 1.00 67.64  ? 104 VAL B O      1 
ATOM   6617  C  CB     . VAL B 1 124 ? 39.422  30.938 -114.551 1.00 67.14  ? 104 VAL B CB     1 
ATOM   6618  C  CG1    . VAL B 1 124 ? 39.189  29.582 -115.218 1.00 67.03  ? 104 VAL B CG1    1 
ATOM   6619  C  CG2    . VAL B 1 124 ? 40.901  31.128 -114.268 1.00 68.89  ? 104 VAL B CG2    1 
ATOM   6620  H  H      . VAL B 1 124 ? 39.295  33.325 -113.939 1.00 84.66  ? 104 VAL B H      1 
ATOM   6621  H  HA     . VAL B 1 124 ? 39.471  32.129 -116.225 1.00 81.49  ? 104 VAL B HA     1 
ATOM   6622  H  HB     . VAL B 1 124 ? 38.947  30.947 -113.705 1.00 80.68  ? 104 VAL B HB     1 
ATOM   6623  H  HG11   . VAL B 1 124 ? 39.525  28.883 -114.636 1.00 80.56  ? 104 VAL B HG11   1 
ATOM   6624  H  HG12   . VAL B 1 124 ? 38.237  29.462 -115.363 1.00 80.56  ? 104 VAL B HG12   1 
ATOM   6625  H  HG13   . VAL B 1 124 ? 39.659  29.563 -116.066 1.00 80.56  ? 104 VAL B HG13   1 
ATOM   6626  H  HG21   . VAL B 1 124 ? 41.211  30.400 -113.707 1.00 82.79  ? 104 VAL B HG21   1 
ATOM   6627  H  HG22   . VAL B 1 124 ? 41.385  31.128 -115.108 1.00 82.79  ? 104 VAL B HG22   1 
ATOM   6628  H  HG23   . VAL B 1 124 ? 41.028  31.975 -113.812 1.00 82.79  ? 104 VAL B HG23   1 
ATOM   6629  N  N      . ILE B 1 125 ? 36.491  32.070 -115.059 1.00 68.13  ? 105 ILE B N      1 
ATOM   6630  C  CA     . ILE B 1 125 ? 35.099  31.848 -115.447 1.00 66.50  ? 105 ILE B CA     1 
ATOM   6631  C  C      . ILE B 1 125 ? 34.759  32.659 -116.692 1.00 71.66  ? 105 ILE B C      1 
ATOM   6632  O  O      . ILE B 1 125 ? 34.212  32.132 -117.667 1.00 70.36  ? 105 ILE B O      1 
ATOM   6633  C  CB     . ILE B 1 125 ? 34.153  32.187 -114.281 1.00 61.47  ? 105 ILE B CB     1 
ATOM   6634  C  CG1    . ILE B 1 125 ? 34.387  31.225 -113.115 1.00 59.39  ? 105 ILE B CG1    1 
ATOM   6635  C  CG2    . ILE B 1 125 ? 32.693  32.126 -114.741 1.00 60.23  ? 105 ILE B CG2    1 
ATOM   6636  C  CD1    . ILE B 1 125 ? 33.654  31.608 -111.844 1.00 57.63  ? 105 ILE B CD1    1 
ATOM   6637  H  H      . ILE B 1 125 ? 36.597  32.366 -114.258 1.00 81.87  ? 105 ILE B H      1 
ATOM   6638  H  HA     . ILE B 1 125 ? 34.980  30.909 -115.662 1.00 79.92  ? 105 ILE B HA     1 
ATOM   6639  H  HB     . ILE B 1 125 ? 34.345  33.089 -113.981 1.00 73.88  ? 105 ILE B HB     1 
ATOM   6640  H  HG12   . ILE B 1 125 ? 34.086  30.340 -113.375 1.00 71.38  ? 105 ILE B HG12   1 
ATOM   6641  H  HG13   . ILE B 1 125 ? 35.336  31.203 -112.913 1.00 71.38  ? 105 ILE B HG13   1 
ATOM   6642  H  HG21   . ILE B 1 125 ? 32.117  32.343 -113.991 1.00 72.40  ? 105 ILE B HG21   1 
ATOM   6643  H  HG22   . ILE B 1 125 ? 32.560  32.768 -115.457 1.00 72.40  ? 105 ILE B HG22   1 
ATOM   6644  H  HG23   . ILE B 1 125 ? 32.499  31.231 -115.059 1.00 72.40  ? 105 ILE B HG23   1 
ATOM   6645  H  HD11   . ILE B 1 125 ? 33.852  30.953 -111.156 1.00 69.27  ? 105 ILE B HD11   1 
ATOM   6646  H  HD12   . ILE B 1 125 ? 33.951  32.486 -111.560 1.00 69.27  ? 105 ILE B HD12   1 
ATOM   6647  H  HD13   . ILE B 1 125 ? 32.700  31.622 -112.022 1.00 69.27  ? 105 ILE B HD13   1 
ATOM   6648  N  N      . ARG B 1 126 ? 35.077  33.957 -116.677 1.00 76.23  ? 106 ARG B N      1 
ATOM   6649  C  CA     . ARG B 1 126 ? 34.747  34.808 -117.817 1.00 80.95  ? 106 ARG B CA     1 
ATOM   6650  C  C      . ARG B 1 126 ? 35.413  34.311 -119.094 1.00 84.56  ? 106 ARG B C      1 
ATOM   6651  O  O      . ARG B 1 126 ? 34.815  34.363 -120.175 1.00 88.25  ? 106 ARG B O      1 
ATOM   6652  C  CB     . ARG B 1 126 ? 35.170  36.249 -117.536 1.00 79.56  ? 106 ARG B CB     1 
ATOM   6653  C  CG     . ARG B 1 126 ? 34.299  36.967 -116.525 1.00 78.65  ? 106 ARG B CG     1 
ATOM   6654  C  CD     . ARG B 1 126 ? 34.619  38.454 -116.471 1.00 78.71  ? 106 ARG B CD     1 
ATOM   6655  N  NE     . ARG B 1 126 ? 34.242  39.046 -115.190 1.00 74.44  ? 106 ARG B NE     1 
ATOM   6656  C  CZ     . ARG B 1 126 ? 35.068  39.231 -114.163 1.00 70.84  ? 106 ARG B CZ     1 
ATOM   6657  N  NH1    . ARG B 1 126 ? 36.343  38.876 -114.246 1.00 73.58  ? 106 ARG B NH1    1 
ATOM   6658  N  NH2    . ARG B 1 126 ? 34.614  39.775 -113.042 1.00 65.51  ? 106 ARG B NH2    1 
ATOM   6659  H  H      . ARG B 1 126 ? 35.475  34.360 -116.030 1.00 91.60  ? 106 ARG B H      1 
ATOM   6660  H  HA     . ARG B 1 126 ? 33.787  34.796 -117.954 1.00 97.26  ? 106 ARG B HA     1 
ATOM   6661  H  HB2    . ARG B 1 126 ? 36.077  36.246 -117.194 1.00 95.59  ? 106 ARG B HB2    1 
ATOM   6662  H  HB3    . ARG B 1 126 ? 35.134  36.751 -118.365 1.00 95.59  ? 106 ARG B HB3    1 
ATOM   6663  H  HG2    . ARG B 1 126 ? 33.367  36.866 -116.775 1.00 94.50  ? 106 ARG B HG2    1 
ATOM   6664  H  HG3    . ARG B 1 126 ? 34.453  36.591 -115.644 1.00 94.50  ? 106 ARG B HG3    1 
ATOM   6665  H  HD2    . ARG B 1 126 ? 35.573  38.579 -116.594 1.00 94.57  ? 106 ARG B HD2    1 
ATOM   6666  H  HD3    . ARG B 1 126 ? 34.128  38.911 -117.172 1.00 94.57  ? 106 ARG B HD3    1 
ATOM   6667  H  HE     . ARG B 1 126 ? 33.424  39.293 -115.091 1.00 89.44  ? 106 ARG B HE     1 
ATOM   6668  H  HH11   . ARG B 1 126 ? 36.645  38.522 -114.969 1.00 88.42  ? 106 ARG B HH11   1 
ATOM   6669  H  HH12   . ARG B 1 126 ? 36.868  39.001 -113.576 1.00 88.42  ? 106 ARG B HH12   1 
ATOM   6670  H  HH21   . ARG B 1 126 ? 33.789  40.009 -112.981 1.00 78.74  ? 106 ARG B HH21   1 
ATOM   6671  H  HH22   . ARG B 1 126 ? 35.146  39.898 -112.378 1.00 78.74  ? 106 ARG B HH22   1 
ATOM   6672  N  N      . GLN B 1 127 ? 36.650  33.821 -118.992 1.00 80.25  ? 107 GLN B N      1 
ATOM   6673  C  CA     . GLN B 1 127 ? 37.344  33.345 -120.183 1.00 85.95  ? 107 GLN B CA     1 
ATOM   6674  C  C      . GLN B 1 127 ? 36.741  32.045 -120.703 1.00 89.06  ? 107 GLN B C      1 
ATOM   6675  O  O      . GLN B 1 127 ? 36.694  31.830 -121.919 1.00 96.09  ? 107 GLN B O      1 
ATOM   6676  C  CB     . GLN B 1 127 ? 38.834  33.183 -119.891 1.00 89.63  ? 107 GLN B CB     1 
ATOM   6677  C  CG     . GLN B 1 127 ? 39.512  34.502 -119.546 1.00 93.81  ? 107 GLN B CG     1 
ATOM   6678  C  CD     . GLN B 1 127 ? 41.021  34.396 -119.471 1.00 99.22  ? 107 GLN B CD     1 
ATOM   6679  O  OE1    . GLN B 1 127 ? 41.606  33.387 -119.863 1.00 101.78 ? 107 GLN B OE1    1 
ATOM   6680  N  NE2    . GLN B 1 127 ? 41.661  35.445 -118.964 1.00 100.80 ? 107 GLN B NE2    1 
ATOM   6681  H  H      . GLN B 1 127 ? 37.098  33.756 -118.261 1.00 96.42  ? 107 GLN B H      1 
ATOM   6682  H  HA     . GLN B 1 127 ? 37.252  34.011 -120.883 1.00 103.26 ? 107 GLN B HA     1 
ATOM   6683  H  HB2    . GLN B 1 127 ? 38.945  32.582 -119.137 1.00 107.68 ? 107 GLN B HB2    1 
ATOM   6684  H  HB3    . GLN B 1 127 ? 39.273  32.817 -120.675 1.00 107.68 ? 107 GLN B HB3    1 
ATOM   6685  H  HG2    . GLN B 1 127 ? 39.292  35.156 -120.228 1.00 112.70 ? 107 GLN B HG2    1 
ATOM   6686  H  HG3    . GLN B 1 127 ? 39.190  34.804 -118.682 1.00 112.70 ? 107 GLN B HG3    1 
ATOM   6687  H  HE21   . GLN B 1 127 ? 41.217  36.133 -118.701 1.00 121.08 ? 107 GLN B HE21   1 
ATOM   6688  H  HE22   . GLN B 1 127 ? 42.518  35.435 -118.899 1.00 121.08 ? 107 GLN B HE22   1 
ATOM   6689  N  N      . LYS B 1 128 ? 36.278  31.172 -119.808 1.00 81.80  ? 108 LYS B N      1 
ATOM   6690  C  CA     . LYS B 1 128 ? 35.742  29.879 -120.214 1.00 81.39  ? 108 LYS B CA     1 
ATOM   6691  C  C      . LYS B 1 128 ? 34.264  29.929 -120.579 1.00 80.91  ? 108 LYS B C      1 
ATOM   6692  O  O      . LYS B 1 128 ? 33.782  29.025 -121.271 1.00 76.48  ? 108 LYS B O      1 
ATOM   6693  C  CB     . LYS B 1 128 ? 35.943  28.857 -119.091 1.00 85.70  ? 108 LYS B CB     1 
ATOM   6694  C  CG     . LYS B 1 128 ? 37.399  28.508 -118.820 1.00 93.24  ? 108 LYS B CG     1 
ATOM   6695  C  CD     . LYS B 1 128 ? 37.524  27.221 -118.017 1.00 97.51  ? 108 LYS B CD     1 
ATOM   6696  C  CE     . LYS B 1 128 ? 38.226  26.128 -118.805 1.00 102.46 ? 108 LYS B CE     1 
ATOM   6697  N  NZ     . LYS B 1 128 ? 38.375  24.881 -118.004 1.00 102.91 ? 108 LYS B NZ     1 
ATOM   6698  H  H      . LYS B 1 128 ? 36.263  31.308 -118.958 1.00 98.28  ? 108 LYS B H      1 
ATOM   6699  H  HA     . LYS B 1 128 ? 36.231  29.568 -120.992 1.00 97.79  ? 108 LYS B HA     1 
ATOM   6700  H  HB2    . LYS B 1 128 ? 35.568  29.217 -118.272 1.00 102.96 ? 108 LYS B HB2    1 
ATOM   6701  H  HB3    . LYS B 1 128 ? 35.482  28.038 -119.330 1.00 102.96 ? 108 LYS B HB3    1 
ATOM   6702  H  HG2    . LYS B 1 128 ? 37.861  28.385 -119.664 1.00 112.00 ? 108 LYS B HG2    1 
ATOM   6703  H  HG3    . LYS B 1 128 ? 37.810  29.224 -118.312 1.00 112.00 ? 108 LYS B HG3    1 
ATOM   6704  H  HD2    . LYS B 1 128 ? 38.041  27.395 -117.215 1.00 117.13 ? 108 LYS B HD2    1 
ATOM   6705  H  HD3    . LYS B 1 128 ? 36.638  26.904 -117.782 1.00 117.13 ? 108 LYS B HD3    1 
ATOM   6706  H  HE2    . LYS B 1 128 ? 37.705  25.920 -119.596 1.00 123.07 ? 108 LYS B HE2    1 
ATOM   6707  H  HE3    . LYS B 1 128 ? 39.111  26.434 -119.058 1.00 123.07 ? 108 LYS B HE3    1 
ATOM   6708  H  HZ1    . LYS B 1 128 ? 38.788  24.258 -118.486 1.00 123.61 ? 108 LYS B HZ1    1 
ATOM   6709  H  HZ2    . LYS B 1 128 ? 38.854  25.046 -117.272 1.00 123.61 ? 108 LYS B HZ2    1 
ATOM   6710  H  HZ3    . LYS B 1 128 ? 37.574  24.577 -117.763 1.00 123.61 ? 108 LYS B HZ3    1 
ATOM   6711  N  N      . HIS B 1 129 ? 33.536  30.954 -120.136 1.00 91.54  ? 109 HIS B N      1 
ATOM   6712  C  CA     . HIS B 1 129 ? 32.112  31.102 -120.435 1.00 90.58  ? 109 HIS B CA     1 
ATOM   6713  C  C      . HIS B 1 129 ? 31.844  32.564 -120.763 1.00 90.53  ? 109 HIS B C      1 
ATOM   6714  O  O      . HIS B 1 129 ? 31.971  33.432 -119.895 1.00 92.36  ? 109 HIS B O      1 
ATOM   6715  C  CB     . HIS B 1 129 ? 31.244  30.627 -119.270 1.00 83.33  ? 109 HIS B CB     1 
ATOM   6716  C  CG     . HIS B 1 129 ? 31.401  29.170 -118.958 1.00 78.11  ? 109 HIS B CG     1 
ATOM   6717  N  ND1    . HIS B 1 129 ? 32.353  28.691 -118.085 1.00 76.20  ? 109 HIS B ND1    1 
ATOM   6718  C  CD2    . HIS B 1 129 ? 30.730  28.086 -119.415 1.00 76.54  ? 109 HIS B CD2    1 
ATOM   6719  C  CE1    . HIS B 1 129 ? 32.258  27.375 -118.011 1.00 75.38  ? 109 HIS B CE1    1 
ATOM   6720  N  NE2    . HIS B 1 129 ? 31.281  26.983 -118.810 1.00 76.32  ? 109 HIS B NE2    1 
ATOM   6721  H  H      . HIS B 1 129 ? 33.852  31.590 -119.651 1.00 109.97 ? 109 HIS B H      1 
ATOM   6722  H  HA     . HIS B 1 129 ? 31.892  30.570 -121.215 1.00 108.81 ? 109 HIS B HA     1 
ATOM   6723  H  HB2    . HIS B 1 129 ? 31.485  31.128 -118.475 1.00 100.12 ? 109 HIS B HB2    1 
ATOM   6724  H  HB3    . HIS B 1 129 ? 30.312  30.785 -119.489 1.00 100.12 ? 109 HIS B HB3    1 
ATOM   6725  H  HD1    . HIS B 1 129 ? 32.918  29.174 -117.652 1.00 91.56  ? 109 HIS B HD1    1 
ATOM   6726  H  HD2    . HIS B 1 129 ? 30.026  28.088 -120.023 1.00 91.97  ? 109 HIS B HD2    1 
ATOM   6727  H  HE1    . HIS B 1 129 ? 32.789  26.820 -117.488 1.00 90.57  ? 109 HIS B HE1    1 
ATOM   6728  N  N      . LEU B 1 130 ? 31.474  32.830 -122.016 1.00 80.12  ? 110 LEU B N      1 
ATOM   6729  C  CA     . LEU B 1 130 ? 31.363  34.191 -122.526 1.00 78.90  ? 110 LEU B CA     1 
ATOM   6730  C  C      . LEU B 1 130 ? 29.993  34.823 -122.301 1.00 82.10  ? 110 LEU B C      1 
ATOM   6731  O  O      . LEU B 1 130 ? 29.906  36.048 -122.152 1.00 81.34  ? 110 LEU B O      1 
ATOM   6732  C  CB     . LEU B 1 130 ? 31.685  34.188 -124.023 1.00 77.45  ? 110 LEU B CB     1 
ATOM   6733  C  CG     . LEU B 1 130 ? 31.701  35.507 -124.794 1.00 77.41  ? 110 LEU B CG     1 
ATOM   6734  C  CD1    . LEU B 1 130 ? 32.562  36.548 -124.102 1.00 78.55  ? 110 LEU B CD1    1 
ATOM   6735  C  CD2    . LEU B 1 130 ? 32.207  35.247 -126.205 1.00 78.79  ? 110 LEU B CD2    1 
ATOM   6736  H  H      . LEU B 1 130 ? 31.279  32.227 -122.597 1.00 96.26  ? 110 LEU B H      1 
ATOM   6737  H  HA     . LEU B 1 130 ? 32.022  34.746 -122.080 1.00 94.80  ? 110 LEU B HA     1 
ATOM   6738  H  HB2    . LEU B 1 130 ? 32.565  33.794 -124.132 1.00 93.06  ? 110 LEU B HB2    1 
ATOM   6739  H  HB3    . LEU B 1 130 ? 31.033  33.620 -124.462 1.00 93.06  ? 110 LEU B HB3    1 
ATOM   6740  H  HG     . LEU B 1 130 ? 30.797  35.853 -124.855 1.00 93.01  ? 110 LEU B HG     1 
ATOM   6741  H  HD11   . LEU B 1 130 ? 32.545  37.367 -124.622 1.00 94.38  ? 110 LEU B HD11   1 
ATOM   6742  H  HD12   . LEU B 1 130 ? 32.207  36.712 -123.215 1.00 94.38  ? 110 LEU B HD12   1 
ATOM   6743  H  HD13   . LEU B 1 130 ? 33.471  36.215 -124.039 1.00 94.38  ? 110 LEU B HD13   1 
ATOM   6744  H  HD21   . LEU B 1 130 ? 32.217  36.084 -126.695 1.00 94.67  ? 110 LEU B HD21   1 
ATOM   6745  H  HD22   . LEU B 1 130 ? 33.104  34.881 -126.156 1.00 94.67  ? 110 LEU B HD22   1 
ATOM   6746  H  HD23   . LEU B 1 130 ? 31.614  34.615 -126.641 1.00 94.67  ? 110 LEU B HD23   1 
ATOM   6747  N  N      . SER B 1 131 ? 28.924  34.028 -122.270 1.00 89.01  ? 111 SER B N      1 
ATOM   6748  C  CA     . SER B 1 131 ? 27.574  34.552 -122.089 1.00 90.60  ? 111 SER B CA     1 
ATOM   6749  C  C      . SER B 1 131 ? 27.162  34.691 -120.627 1.00 87.74  ? 111 SER B C      1 
ATOM   6750  O  O      . SER B 1 131 ? 26.095  35.250 -120.355 1.00 87.89  ? 111 SER B O      1 
ATOM   6751  C  CB     . SER B 1 131 ? 26.562  33.660 -122.817 1.00 91.65  ? 111 SER B CB     1 
ATOM   6752  O  OG     . SER B 1 131 ? 26.684  32.308 -122.414 1.00 91.80  ? 111 SER B OG     1 
ATOM   6753  H  H      . SER B 1 131 ? 28.956  33.172 -122.353 1.00 106.93 ? 111 SER B H      1 
ATOM   6754  H  HA     . SER B 1 131 ? 27.530  35.434 -122.490 1.00 108.84 ? 111 SER B HA     1 
ATOM   6755  H  HB2    . SER B 1 131 ? 25.666  33.969 -122.613 1.00 110.10 ? 111 SER B HB2    1 
ATOM   6756  H  HB3    . SER B 1 131 ? 26.722  33.719 -123.772 1.00 110.10 ? 111 SER B HB3    1 
ATOM   6757  H  HG     . SER B 1 131 ? 26.123  31.834 -122.823 1.00 110.28 ? 111 SER B HG     1 
ATOM   6758  N  N      . TRP B 1 132 ? 27.966  34.205 -119.687 1.00 88.32  ? 112 TRP B N      1 
ATOM   6759  C  CA     . TRP B 1 132 ? 27.612  34.263 -118.276 1.00 86.29  ? 112 TRP B CA     1 
ATOM   6760  C  C      . TRP B 1 132 ? 27.835  35.654 -117.693 1.00 87.46  ? 112 TRP B C      1 
ATOM   6761  O  O      . TRP B 1 132 ? 28.703  36.411 -118.137 1.00 81.94  ? 112 TRP B O      1 
ATOM   6762  C  CB     . TRP B 1 132 ? 28.423  33.240 -117.480 1.00 89.87  ? 112 TRP B CB     1 
ATOM   6763  C  CG     . TRP B 1 132 ? 28.054  31.816 -117.763 1.00 92.27  ? 112 TRP B CG     1 
ATOM   6764  C  CD1    . TRP B 1 132 ? 27.202  31.361 -118.728 1.00 93.65  ? 112 TRP B CD1    1 
ATOM   6765  C  CD2    . TRP B 1 132 ? 28.529  30.658 -117.069 1.00 91.69  ? 112 TRP B CD2    1 
ATOM   6766  N  NE1    . TRP B 1 132 ? 27.117  29.991 -118.676 1.00 93.72  ? 112 TRP B NE1    1 
ATOM   6767  C  CE2    . TRP B 1 132 ? 27.924  29.535 -117.667 1.00 92.81  ? 112 TRP B CE2    1 
ATOM   6768  C  CE3    . TRP B 1 132 ? 29.409  30.462 -116.000 1.00 88.68  ? 112 TRP B CE3    1 
ATOM   6769  C  CZ2    . TRP B 1 132 ? 28.170  28.235 -117.230 1.00 91.59  ? 112 TRP B CZ2    1 
ATOM   6770  C  CZ3    . TRP B 1 132 ? 29.651  29.173 -115.569 1.00 87.09  ? 112 TRP B CZ3    1 
ATOM   6771  C  CH2    . TRP B 1 132 ? 29.034  28.076 -116.182 1.00 88.76  ? 112 TRP B CH2    1 
ATOM   6772  H  H      . TRP B 1 132 ? 28.726  33.834 -119.843 1.00 106.11 ? 112 TRP B H      1 
ATOM   6773  H  HA     . TRP B 1 132 ? 26.672  34.043 -118.177 1.00 103.67 ? 112 TRP B HA     1 
ATOM   6774  H  HB2    . TRP B 1 132 ? 29.362  33.351 -117.696 1.00 107.97 ? 112 TRP B HB2    1 
ATOM   6775  H  HB3    . TRP B 1 132 ? 28.282  33.400 -116.534 1.00 107.97 ? 112 TRP B HB3    1 
ATOM   6776  H  HD1    . TRP B 1 132 ? 26.745  31.900 -119.332 1.00 112.50 ? 112 TRP B HD1    1 
ATOM   6777  H  HE1    . TRP B 1 132 ? 26.638  29.499 -119.194 1.00 112.58 ? 112 TRP B HE1    1 
ATOM   6778  H  HE3    . TRP B 1 132 ? 29.822  31.185 -115.587 1.00 106.53 ? 112 TRP B HE3    1 
ATOM   6779  H  HZ2    . TRP B 1 132 ? 27.762  27.504 -117.635 1.00 110.03 ? 112 TRP B HZ2    1 
ATOM   6780  H  HZ3    . TRP B 1 132 ? 30.234  29.031 -114.859 1.00 104.63 ? 112 TRP B HZ3    1 
ATOM   6781  H  HH2    . TRP B 1 132 ? 29.217  27.220 -115.870 1.00 106.64 ? 112 TRP B HH2    1 
ATOM   6782  N  N      . ASN B 1 133 ? 27.024  35.984 -116.688 1.00 99.75  ? 113 ASN B N      1 
ATOM   6783  C  CA     . ASN B 1 133 ? 27.151  37.223 -115.929 1.00 98.96  ? 113 ASN B CA     1 
ATOM   6784  C  C      . ASN B 1 133 ? 27.853  36.923 -114.610 1.00 93.49  ? 113 ASN B C      1 
ATOM   6785  O  O      . ASN B 1 133 ? 27.382  36.088 -113.829 1.00 96.01  ? 113 ASN B O      1 
ATOM   6786  C  CB     . ASN B 1 133 ? 25.777  37.842 -115.672 1.00 94.66  ? 113 ASN B CB     1 
ATOM   6787  C  CG     . ASN B 1 133 ? 25.864  39.223 -115.054 1.00 92.56  ? 113 ASN B CG     1 
ATOM   6788  O  OD1    . ASN B 1 133 ? 26.141  39.366 -113.863 1.00 91.32  ? 113 ASN B OD1    1 
ATOM   6789  N  ND2    . ASN B 1 133 ? 25.614  40.249 -115.859 1.00 94.04  ? 113 ASN B ND2    1 
ATOM   6790  H  H      . ASN B 1 133 ? 26.374  35.489 -116.421 1.00 119.81 ? 113 ASN B H      1 
ATOM   6791  H  HA     . ASN B 1 133 ? 27.688  37.858 -116.428 1.00 118.88 ? 113 ASN B HA     1 
ATOM   6792  H  HB2    . ASN B 1 133 ? 25.302  37.919 -116.514 1.00 113.71 ? 113 ASN B HB2    1 
ATOM   6793  H  HB3    . ASN B 1 133 ? 25.282  37.272 -115.063 1.00 113.71 ? 113 ASN B HB3    1 
ATOM   6794  H  HD21   . ASN B 1 133 ? 25.651  41.053 -115.555 1.00 112.97 ? 113 ASN B HD21   1 
ATOM   6795  H  HD22   . ASN B 1 133 ? 25.415  40.110 -116.684 1.00 112.97 ? 113 ASN B HD22   1 
ATOM   6796  N  N      . VAL B 1 134 ? 28.971  37.604 -114.365 1.00 83.18  ? 114 VAL B N      1 
ATOM   6797  C  CA     . VAL B 1 134 ? 29.816  37.360 -113.198 1.00 76.84  ? 114 VAL B CA     1 
ATOM   6798  C  C      . VAL B 1 134 ? 30.002  38.683 -112.461 1.00 80.11  ? 114 VAL B C      1 
ATOM   6799  O  O      . VAL B 1 134 ? 30.646  39.601 -112.984 1.00 81.23  ? 114 VAL B O      1 
ATOM   6800  C  CB     . VAL B 1 134 ? 31.175  36.762 -113.590 1.00 72.07  ? 114 VAL B CB     1 
ATOM   6801  C  CG1    . VAL B 1 134 ? 32.031  36.501 -112.355 1.00 70.19  ? 114 VAL B CG1    1 
ATOM   6802  C  CG2    . VAL B 1 134 ? 30.981  35.482 -114.395 1.00 68.90  ? 114 VAL B CG2    1 
ATOM   6803  H  H      . VAL B 1 134 ? 29.269  38.229 -114.875 1.00 99.93  ? 114 VAL B H      1 
ATOM   6804  H  HA     . VAL B 1 134 ? 29.369  36.739 -112.602 1.00 92.33  ? 114 VAL B HA     1 
ATOM   6805  H  HB     . VAL B 1 134 ? 31.647  37.397 -114.151 1.00 86.60  ? 114 VAL B HB     1 
ATOM   6806  H  HG11   . VAL B 1 134 ? 32.880  36.124 -112.634 1.00 84.34  ? 114 VAL B HG11   1 
ATOM   6807  H  HG12   . VAL B 1 134 ? 32.178  37.340 -111.890 1.00 84.34  ? 114 VAL B HG12   1 
ATOM   6808  H  HG13   . VAL B 1 134 ? 31.567  35.878 -111.775 1.00 84.34  ? 114 VAL B HG13   1 
ATOM   6809  H  HG21   . VAL B 1 134 ? 31.850  35.123 -114.631 1.00 82.80  ? 114 VAL B HG21   1 
ATOM   6810  H  HG22   . VAL B 1 134 ? 30.493  34.841 -113.855 1.00 82.80  ? 114 VAL B HG22   1 
ATOM   6811  H  HG23   . VAL B 1 134 ? 30.478  35.688 -115.199 1.00 82.80  ? 114 VAL B HG23   1 
ATOM   6812  N  N      . GLU B 1 135 ? 29.451  38.781 -111.253 1.00 81.89  ? 115 GLU B N      1 
ATOM   6813  C  CA     . GLU B 1 135 ? 29.559  39.982 -110.432 1.00 88.18  ? 115 GLU B CA     1 
ATOM   6814  C  C      . GLU B 1 135 ? 30.400  39.676 -109.199 1.00 86.01  ? 115 GLU B C      1 
ATOM   6815  O  O      . GLU B 1 135 ? 30.195  38.650 -108.542 1.00 90.55  ? 115 GLU B O      1 
ATOM   6816  C  CB     . GLU B 1 135 ? 28.175  40.490 -110.021 1.00 91.54  ? 115 GLU B CB     1 
ATOM   6817  C  CG     . GLU B 1 135 ? 28.201  41.779 -109.214 1.00 95.51  ? 115 GLU B CG     1 
ATOM   6818  C  CD     . GLU B 1 135 ? 26.830  42.174 -108.702 1.00 96.95  ? 115 GLU B CD     1 
ATOM   6819  O  OE1    . GLU B 1 135 ? 25.849  41.472 -109.026 1.00 97.15  ? 115 GLU B OE1    1 
ATOM   6820  O  OE2    . GLU B 1 135 ? 26.734  43.183 -107.971 1.00 97.16  ? 115 GLU B OE2    1 
ATOM   6821  H  H      . GLU B 1 135 ? 29.000  38.150 -110.880 1.00 98.38  ? 115 GLU B H      1 
ATOM   6822  H  HA     . GLU B 1 135 ? 30.002  40.679 -110.940 1.00 105.93 ? 115 GLU B HA     1 
ATOM   6823  H  HB2    . GLU B 1 135 ? 27.653  40.654 -110.822 1.00 109.97 ? 115 GLU B HB2    1 
ATOM   6824  H  HB3    . GLU B 1 135 ? 27.742  39.811 -109.481 1.00 109.97 ? 115 GLU B HB3    1 
ATOM   6825  H  HG2    . GLU B 1 135 ? 28.785  41.662 -108.448 1.00 114.74 ? 115 GLU B HG2    1 
ATOM   6826  H  HG3    . GLU B 1 135 ? 28.531  42.498 -109.775 1.00 114.74 ? 115 GLU B HG3    1 
ATOM   6827  N  N      . GLU B 1 136 ? 31.341  40.568 -108.888 1.00 76.65  ? 116 GLU B N      1 
ATOM   6828  C  CA     . GLU B 1 136 ? 32.208  40.440 -107.721 1.00 71.52  ? 116 GLU B CA     1 
ATOM   6829  C  C      . GLU B 1 136 ? 31.797  41.428 -106.637 1.00 71.73  ? 116 GLU B C      1 
ATOM   6830  O  O      . GLU B 1 136 ? 31.782  42.640 -106.877 1.00 75.28  ? 116 GLU B O      1 
ATOM   6831  C  CB     . GLU B 1 136 ? 33.666  40.687 -108.107 1.00 71.17  ? 116 GLU B CB     1 
ATOM   6832  C  CG     . GLU B 1 136 ? 34.252  39.671 -109.060 1.00 71.55  ? 116 GLU B CG     1 
ATOM   6833  C  CD     . GLU B 1 136 ? 35.621  40.081 -109.560 1.00 71.70  ? 116 GLU B CD     1 
ATOM   6834  O  OE1    . GLU B 1 136 ? 35.713  41.085 -110.299 1.00 72.24  ? 116 GLU B OE1    1 
ATOM   6835  O  OE2    . GLU B 1 136 ? 36.608  39.409 -109.201 1.00 70.36  ? 116 GLU B OE2    1 
ATOM   6836  H  H      . GLU B 1 136 ? 31.498  41.275 -109.352 1.00 92.10  ? 116 GLU B H      1 
ATOM   6837  H  HA     . GLU B 1 136 ? 32.134  39.542 -107.361 1.00 85.94  ? 116 GLU B HA     1 
ATOM   6838  H  HB2    . GLU B 1 136 ? 33.730  41.557 -108.530 1.00 85.52  ? 116 GLU B HB2    1 
ATOM   6839  H  HB3    . GLU B 1 136 ? 34.205  40.676 -107.300 1.00 85.52  ? 116 GLU B HB3    1 
ATOM   6840  H  HG2    . GLU B 1 136 ? 34.340  38.819 -108.604 1.00 85.97  ? 116 GLU B HG2    1 
ATOM   6841  H  HG3    . GLU B 1 136 ? 33.665  39.579 -109.828 1.00 85.97  ? 116 GLU B HG3    1 
ATOM   6842  N  N      . VAL B 1 137 ? 31.461  40.915 -105.455 1.00 65.12  ? 117 VAL B N      1 
ATOM   6843  C  CA     . VAL B 1 137 ? 31.139  41.748 -104.300 1.00 64.64  ? 117 VAL B CA     1 
ATOM   6844  C  C      . VAL B 1 137 ? 32.196  41.479 -103.236 1.00 75.25  ? 117 VAL B C      1 
ATOM   6845  O  O      . VAL B 1 137 ? 32.315  40.345 -102.755 1.00 72.19  ? 117 VAL B O      1 
ATOM   6846  C  CB     . VAL B 1 137 ? 29.729  41.461 -103.758 1.00 59.15  ? 117 VAL B CB     1 
ATOM   6847  C  CG1    . VAL B 1 137 ? 29.394  42.408 -102.612 1.00 57.85  ? 117 VAL B CG1    1 
ATOM   6848  C  CG2    . VAL B 1 137 ? 28.694  41.573 -104.869 1.00 58.00  ? 117 VAL B CG2    1 
ATOM   6849  H  H      . VAL B 1 137 ? 31.411  40.071 -105.295 1.00 78.26  ? 117 VAL B H      1 
ATOM   6850  H  HA     . VAL B 1 137 ? 31.187  42.684 -104.552 1.00 77.69  ? 117 VAL B HA     1 
ATOM   6851  H  HB     . VAL B 1 137 ? 29.703  40.555 -103.414 1.00 71.10  ? 117 VAL B HB     1 
ATOM   6852  H  HG11   . VAL B 1 137 ? 28.502  42.207 -102.289 1.00 69.54  ? 117 VAL B HG11   1 
ATOM   6853  H  HG12   . VAL B 1 137 ? 30.040  42.283 -101.900 1.00 69.54  ? 117 VAL B HG12   1 
ATOM   6854  H  HG13   . VAL B 1 137 ? 29.430  43.321 -102.937 1.00 69.54  ? 117 VAL B HG13   1 
ATOM   6855  H  HG21   . VAL B 1 137 ? 27.816  41.388 -104.502 1.00 69.72  ? 117 VAL B HG21   1 
ATOM   6856  H  HG22   . VAL B 1 137 ? 28.718  42.472 -105.233 1.00 69.72  ? 117 VAL B HG22   1 
ATOM   6857  H  HG23   . VAL B 1 137 ? 28.905  40.929 -105.563 1.00 69.72  ? 117 VAL B HG23   1 
ATOM   6858  N  N      . ARG B 1 138 ? 32.963  42.511 -102.864 1.00 97.14  ? 118 ARG B N      1 
ATOM   6859  C  CA     . ARG B 1 138 ? 33.975  42.354 -101.824 1.00 105.70 ? 118 ARG B CA     1 
ATOM   6860  C  C      . ARG B 1 138 ? 33.969  43.474 -100.787 1.00 104.22 ? 118 ARG B C      1 
ATOM   6861  O  O      . ARG B 1 138 ? 34.906  43.558 -99.984  1.00 104.86 ? 118 ARG B O      1 
ATOM   6862  C  CB     . ARG B 1 138 ? 35.376  42.209 -102.437 1.00 109.89 ? 118 ARG B CB     1 
ATOM   6863  C  CG     . ARG B 1 138 ? 35.730  43.168 -103.559 1.00 113.28 ? 118 ARG B CG     1 
ATOM   6864  C  CD     . ARG B 1 138 ? 37.100  42.796 -104.113 1.00 116.68 ? 118 ARG B CD     1 
ATOM   6865  N  NE     . ARG B 1 138 ? 37.474  43.541 -105.310 1.00 120.85 ? 118 ARG B NE     1 
ATOM   6866  C  CZ     . ARG B 1 138 ? 38.608  43.350 -105.979 1.00 124.40 ? 118 ARG B CZ     1 
ATOM   6867  N  NH1    . ARG B 1 138 ? 39.484  42.442 -105.567 1.00 125.05 ? 118 ARG B NH1    1 
ATOM   6868  N  NH2    . ARG B 1 138 ? 38.871  44.069 -107.061 1.00 126.69 ? 118 ARG B NH2    1 
ATOM   6869  H  H      . ARG B 1 138 ? 32.915  43.302 -103.197 1.00 116.68 ? 118 ARG B H      1 
ATOM   6870  H  HA     . ARG B 1 138 ? 33.788  41.529 -101.349 1.00 126.95 ? 118 ARG B HA     1 
ATOM   6871  H  HB2    . ARG B 1 138 ? 36.030  42.338 -101.733 1.00 131.98 ? 118 ARG B HB2    1 
ATOM   6872  H  HB3    . ARG B 1 138 ? 35.460  41.310 -102.791 1.00 131.98 ? 118 ARG B HB3    1 
ATOM   6873  H  HG2    . ARG B 1 138 ? 35.076  43.096 -104.272 1.00 136.06 ? 118 ARG B HG2    1 
ATOM   6874  H  HG3    . ARG B 1 138 ? 35.768  44.075 -103.217 1.00 136.06 ? 118 ARG B HG3    1 
ATOM   6875  H  HD2    . ARG B 1 138 ? 37.770  42.971 -103.434 1.00 140.13 ? 118 ARG B HD2    1 
ATOM   6876  H  HD3    . ARG B 1 138 ? 37.101  41.852 -104.339 1.00 140.13 ? 118 ARG B HD3    1 
ATOM   6877  H  HE     . ARG B 1 138 ? 36.970  44.195 -105.550 1.00 145.14 ? 118 ARG B HE     1 
ATOM   6878  H  HH11   . ARG B 1 138 ? 39.318  41.972 -104.865 1.00 150.17 ? 118 ARG B HH11   1 
ATOM   6879  H  HH12   . ARG B 1 138 ? 40.216  42.322 -106.001 1.00 150.17 ? 118 ARG B HH12   1 
ATOM   6880  H  HH21   . ARG B 1 138 ? 38.308  44.660 -107.333 1.00 152.15 ? 118 ARG B HH21   1 
ATOM   6881  H  HH22   . ARG B 1 138 ? 39.606  43.945 -107.491 1.00 152.15 ? 118 ARG B HH22   1 
ATOM   6882  N  N      . ARG B 1 139 ? 32.948  44.332 -100.771 1.00 92.95  ? 119 ARG B N      1 
ATOM   6883  C  CA     . ARG B 1 139 ? 32.855  45.423 -99.807  1.00 92.79  ? 119 ARG B CA     1 
ATOM   6884  C  C      . ARG B 1 139 ? 31.899  45.094 -98.664  1.00 86.40  ? 119 ARG B C      1 
ATOM   6885  O  O      . ARG B 1 139 ? 31.230  45.988 -98.135  1.00 88.53  ? 119 ARG B O      1 
ATOM   6886  C  CB     . ARG B 1 139 ? 32.414  46.710 -100.506 1.00 100.54 ? 119 ARG B CB     1 
ATOM   6887  C  CG     . ARG B 1 139 ? 33.499  47.411 -101.313 1.00 109.39 ? 119 ARG B CG     1 
ATOM   6888  C  CD     . ARG B 1 139 ? 33.871  48.754 -100.692 1.00 115.80 ? 119 ARG B CD     1 
ATOM   6889  N  NE     . ARG B 1 139 ? 34.494  49.660 -101.652 1.00 122.34 ? 119 ARG B NE     1 
ATOM   6890  C  CZ     . ARG B 1 139 ? 34.756  50.942 -101.408 1.00 127.43 ? 119 ARG B CZ     1 
ATOM   6891  N  NH1    . ARG B 1 139 ? 34.450  51.476 -100.232 1.00 128.45 ? 119 ARG B NH1    1 
ATOM   6892  N  NH2    . ARG B 1 139 ? 35.324  51.693 -102.341 1.00 130.59 ? 119 ARG B NH2    1 
ATOM   6893  H  H      . ARG B 1 139 ? 32.286  44.300 -101.320 1.00 111.66 ? 119 ARG B H      1 
ATOM   6894  H  HA     . ARG B 1 139 ? 33.733  45.578 -99.425  1.00 111.47 ? 119 ARG B HA     1 
ATOM   6895  H  HB2    . ARG B 1 139 ? 31.689  46.498 -101.114 1.00 120.76 ? 119 ARG B HB2    1 
ATOM   6896  H  HB3    . ARG B 1 139 ? 32.101  47.334 -99.832  1.00 120.76 ? 119 ARG B HB3    1 
ATOM   6897  H  HG2    . ARG B 1 139 ? 34.293  46.854 -101.334 1.00 131.39 ? 119 ARG B HG2    1 
ATOM   6898  H  HG3    . ARG B 1 139 ? 33.176  47.571 -102.213 1.00 131.39 ? 119 ARG B HG3    1 
ATOM   6899  H  HD2    . ARG B 1 139 ? 33.068  49.179 -100.353 1.00 139.08 ? 119 ARG B HD2    1 
ATOM   6900  H  HD3    . ARG B 1 139 ? 34.499  48.604 -99.968  1.00 139.08 ? 119 ARG B HD3    1 
ATOM   6901  H  HE     . ARG B 1 139 ? 34.684  49.352 -102.432 1.00 146.93 ? 119 ARG B HE     1 
ATOM   6902  H  HH11   . ARG B 1 139 ? 34.082  50.994 -99.624  1.00 154.26 ? 119 ARG B HH11   1 
ATOM   6903  H  HH12   . ARG B 1 139 ? 34.622  52.305 -100.079 1.00 154.26 ? 119 ARG B HH12   1 
ATOM   6904  H  HH21   . ARG B 1 139 ? 35.524  51.352 -103.105 1.00 156.82 ? 119 ARG B HH21   1 
ATOM   6905  H  HH22   . ARG B 1 139 ? 35.493  52.521 -102.182 1.00 156.82 ? 119 ARG B HH22   1 
ATOM   6906  N  N      . THR B 1 140 ? 31.830  43.826 -98.266  1.00 82.66  ? 120 THR B N      1 
ATOM   6907  C  CA     . THR B 1 140 ? 30.950  43.375 -97.196  1.00 74.57  ? 120 THR B CA     1 
ATOM   6908  C  C      . THR B 1 140 ? 31.714  42.443 -96.261  1.00 70.19  ? 120 THR B C      1 
ATOM   6909  O  O      . THR B 1 140 ? 32.888  42.126 -96.478  1.00 70.36  ? 120 THR B O      1 
ATOM   6910  C  CB     . THR B 1 140 ? 29.703  42.682 -97.761  1.00 73.21  ? 120 THR B CB     1 
ATOM   6911  O  OG1    . THR B 1 140 ? 28.860  42.255 -96.684  1.00 71.45  ? 120 THR B OG1    1 
ATOM   6912  C  CG2    . THR B 1 140 ? 30.091  41.480 -98.610  1.00 74.22  ? 120 THR B CG2    1 
ATOM   6913  H  H      . THR B 1 140 ? 32.298  43.193 -98.612  1.00 99.31  ? 120 THR B H      1 
ATOM   6914  H  HA     . THR B 1 140 ? 30.658  44.144 -96.682  1.00 89.61  ? 120 THR B HA     1 
ATOM   6915  H  HB     . THR B 1 140 ? 29.215  43.306 -98.322  1.00 87.97  ? 120 THR B HB     1 
ATOM   6916  H  HG1    . THR B 1 140 ? 28.623  42.917 -96.225  1.00 85.86  ? 120 THR B HG1    1 
ATOM   6917  H  HG21   . THR B 1 140 ? 29.294  41.051 -98.961  1.00 89.18  ? 120 THR B HG21   1 
ATOM   6918  H  HG22   . THR B 1 140 ? 30.649  41.764 -99.351  1.00 89.18  ? 120 THR B HG22   1 
ATOM   6919  H  HG23   . THR B 1 140 ? 30.582  40.840 -98.072  1.00 89.18  ? 120 THR B HG23   1 
ATOM   6920  N  N      . ARG B 1 141 ? 31.026  42.000 -95.205  1.00 68.59  ? 121 ARG B N      1 
ATOM   6921  C  CA     . ARG B 1 141 ? 31.659  41.149 -94.203  1.00 64.64  ? 121 ARG B CA     1 
ATOM   6922  C  C      . ARG B 1 141 ? 32.147  39.838 -94.803  1.00 61.91  ? 121 ARG B C      1 
ATOM   6923  O  O      . ARG B 1 141 ? 33.158  39.289 -94.348  1.00 58.67  ? 121 ARG B O      1 
ATOM   6924  C  CB     . ARG B 1 141 ? 30.672  40.864 -93.070  1.00 65.42  ? 121 ARG B CB     1 
ATOM   6925  C  CG     . ARG B 1 141 ? 31.241  40.025 -91.932  1.00 67.31  ? 121 ARG B CG     1 
ATOM   6926  C  CD     . ARG B 1 141 ? 30.203  39.789 -90.843  1.00 66.41  ? 121 ARG B CD     1 
ATOM   6927  N  NE     . ARG B 1 141 ? 29.066  39.013 -91.334  1.00 65.45  ? 121 ARG B NE     1 
ATOM   6928  C  CZ     . ARG B 1 141 ? 29.018  37.682 -91.371  1.00 64.64  ? 121 ARG B CZ     1 
ATOM   6929  N  NH1    . ARG B 1 141 ? 30.046  36.958 -90.948  1.00 65.49  ? 121 ARG B NH1    1 
ATOM   6930  N  NH2    . ARG B 1 141 ? 27.937  37.071 -91.838  1.00 62.84  ? 121 ARG B NH2    1 
ATOM   6931  H  H      . ARG B 1 141 ? 30.200  42.179 -95.049  1.00 82.42  ? 121 ARG B H      1 
ATOM   6932  H  HA     . ARG B 1 141 ? 32.424  41.614 -93.829  1.00 77.69  ? 121 ARG B HA     1 
ATOM   6933  H  HB2    . ARG B 1 141 ? 30.379  41.708 -92.694  1.00 78.62  ? 121 ARG B HB2    1 
ATOM   6934  H  HB3    . ARG B 1 141 ? 29.911  40.386 -93.435  1.00 78.62  ? 121 ARG B HB3    1 
ATOM   6935  H  HG2    . ARG B 1 141 ? 31.520  39.163 -92.279  1.00 80.90  ? 121 ARG B HG2    1 
ATOM   6936  H  HG3    . ARG B 1 141 ? 31.996  40.489 -91.538  1.00 80.90  ? 121 ARG B HG3    1 
ATOM   6937  H  HD2    . ARG B 1 141 ? 30.613  39.299 -90.113  1.00 79.81  ? 121 ARG B HD2    1 
ATOM   6938  H  HD3    . ARG B 1 141 ? 29.872  40.645 -90.528  1.00 79.81  ? 121 ARG B HD3    1 
ATOM   6939  H  HE     . ARG B 1 141 ? 28.379  39.445 -91.618  1.00 78.66  ? 121 ARG B HE     1 
ATOM   6940  H  HH11   . ARG B 1 141 ? 30.751  37.347 -90.645  1.00 78.71  ? 121 ARG B HH11   1 
ATOM   6941  H  HH12   . ARG B 1 141 ? 30.007  36.099 -90.976  1.00 78.71  ? 121 ARG B HH12   1 
ATOM   6942  H  HH21   . ARG B 1 141 ? 27.267  37.534 -92.114  1.00 75.53  ? 121 ARG B HH21   1 
ATOM   6943  H  HH22   . ARG B 1 141 ? 27.906  36.212 -91.862  1.00 75.53  ? 121 ARG B HH22   1 
ATOM   6944  N  N      . VAL B 1 142 ? 31.451  39.316 -95.808  1.00 65.49  ? 122 VAL B N      1 
ATOM   6945  C  CA     . VAL B 1 142 ? 31.846  38.060 -96.443  1.00 63.04  ? 122 VAL B CA     1 
ATOM   6946  C  C      . VAL B 1 142 ? 31.910  38.280 -97.951  1.00 55.55  ? 122 VAL B C      1 
ATOM   6947  O  O      . VAL B 1 142 ? 30.861  38.330 -98.609  1.00 54.66  ? 122 VAL B O      1 
ATOM   6948  C  CB     . VAL B 1 142 ? 30.874  36.925 -96.081  1.00 63.05  ? 122 VAL B CB     1 
ATOM   6949  C  CG1    . VAL B 1 142 ? 31.342  35.606 -96.685  1.00 64.37  ? 122 VAL B CG1    1 
ATOM   6950  C  CG2    . VAL B 1 142 ? 30.734  36.804 -94.566  1.00 59.88  ? 122 VAL B CG2    1 
ATOM   6951  H  H      . VAL B 1 142 ? 30.742  39.670 -96.143  1.00 78.70  ? 122 VAL B H      1 
ATOM   6952  H  HA     . VAL B 1 142 ? 32.731  37.811 -96.134  1.00 75.77  ? 122 VAL B HA     1 
ATOM   6953  H  HB     . VAL B 1 142 ? 29.999  37.129 -96.448  1.00 75.78  ? 122 VAL B HB     1 
ATOM   6954  H  HG11   . VAL B 1 142 ? 30.713  34.908 -96.444  1.00 77.37  ? 122 VAL B HG11   1 
ATOM   6955  H  HG12   . VAL B 1 142 ? 31.380  35.697 -97.650  1.00 77.37  ? 122 VAL B HG12   1 
ATOM   6956  H  HG13   . VAL B 1 142 ? 32.222  35.394 -96.337  1.00 77.37  ? 122 VAL B HG13   1 
ATOM   6957  H  HG21   . VAL B 1 142 ? 30.118  36.083 -94.363  1.00 71.98  ? 122 VAL B HG21   1 
ATOM   6958  H  HG22   . VAL B 1 142 ? 31.605  36.613 -94.184  1.00 71.98  ? 122 VAL B HG22   1 
ATOM   6959  H  HG23   . VAL B 1 142 ? 30.393  37.640 -94.213  1.00 71.98  ? 122 VAL B HG23   1 
ATOM   6960  N  N      . PRO B 1 143 ? 33.100  38.416 -98.541  1.00 49.28  ? 123 PRO B N      1 
ATOM   6961  C  CA     . PRO B 1 143 ? 33.183  38.553 -100.001 1.00 50.18  ? 123 PRO B CA     1 
ATOM   6962  C  C      . PRO B 1 143 ? 32.588  37.347 -100.714 1.00 61.01  ? 123 PRO B C      1 
ATOM   6963  O  O      . PRO B 1 143 ? 32.629  36.220 -100.216 1.00 60.74  ? 123 PRO B O      1 
ATOM   6964  C  CB     . PRO B 1 143 ? 34.688  38.674 -100.265 1.00 45.20  ? 123 PRO B CB     1 
ATOM   6965  C  CG     . PRO B 1 143 ? 35.262  39.168 -98.982  1.00 42.88  ? 123 PRO B CG     1 
ATOM   6966  C  CD     . PRO B 1 143 ? 34.415  38.577 -97.898  1.00 43.35  ? 123 PRO B CD     1 
ATOM   6967  H  HA     . PRO B 1 143 ? 32.734  39.361 -100.296 1.00 60.33  ? 123 PRO B HA     1 
ATOM   6968  H  HB2    . PRO B 1 143 ? 35.052  37.804 -100.492 1.00 54.36  ? 123 PRO B HB2    1 
ATOM   6969  H  HB3    . PRO B 1 143 ? 34.845  39.311 -100.979 1.00 54.36  ? 123 PRO B HB3    1 
ATOM   6970  H  HG2    . PRO B 1 143 ? 36.180  38.866 -98.900  1.00 51.57  ? 123 PRO B HG2    1 
ATOM   6971  H  HG3    . PRO B 1 143 ? 35.218  40.137 -98.959  1.00 51.57  ? 123 PRO B HG3    1 
ATOM   6972  H  HD2    . PRO B 1 143 ? 34.767  37.715 -97.626  1.00 52.14  ? 123 PRO B HD2    1 
ATOM   6973  H  HD3    . PRO B 1 143 ? 34.352  39.188 -97.147  1.00 52.14  ? 123 PRO B HD3    1 
ATOM   6974  N  N      . VAL B 1 144 ? 32.034  37.598 -101.901 1.00 67.26  ? 124 VAL B N      1 
ATOM   6975  C  CA     . VAL B 1 144 ? 31.314  36.573 -102.648 1.00 67.31  ? 124 VAL B CA     1 
ATOM   6976  C  C      . VAL B 1 144 ? 31.261  36.987 -104.111 1.00 60.62  ? 124 VAL B C      1 
ATOM   6977  O  O      . VAL B 1 144 ? 31.260  38.179 -104.436 1.00 58.16  ? 124 VAL B O      1 
ATOM   6978  C  CB     . VAL B 1 144 ? 29.895  36.357 -102.062 1.00 67.92  ? 124 VAL B CB     1 
ATOM   6979  C  CG1    . VAL B 1 144 ? 29.084  37.644 -102.135 1.00 68.30  ? 124 VAL B CG1    1 
ATOM   6980  C  CG2    . VAL B 1 144 ? 29.177  35.228 -102.787 1.00 68.38  ? 124 VAL B CG2    1 
ATOM   6981  H  H      . VAL B 1 144 ? 32.063  38.361 -102.297 1.00 80.83  ? 124 VAL B H      1 
ATOM   6982  H  HA     . VAL B 1 144 ? 31.797  35.734 -102.588 1.00 80.89  ? 124 VAL B HA     1 
ATOM   6983  H  HB     . VAL B 1 144 ? 29.975  36.108 -101.128 1.00 81.63  ? 124 VAL B HB     1 
ATOM   6984  H  HG11   . VAL B 1 144 ? 28.202  37.483 -101.763 1.00 82.08  ? 124 VAL B HG11   1 
ATOM   6985  H  HG12   . VAL B 1 144 ? 29.538  38.333 -101.625 1.00 82.08  ? 124 VAL B HG12   1 
ATOM   6986  H  HG13   . VAL B 1 144 ? 29.007  37.916 -103.063 1.00 82.08  ? 124 VAL B HG13   1 
ATOM   6987  H  HG21   . VAL B 1 144 ? 28.294  35.116 -102.400 1.00 82.18  ? 124 VAL B HG21   1 
ATOM   6988  H  HG22   . VAL B 1 144 ? 29.100  35.455 -103.727 1.00 82.18  ? 124 VAL B HG22   1 
ATOM   6989  H  HG23   . VAL B 1 144 ? 29.690  34.411 -102.684 1.00 82.18  ? 124 VAL B HG23   1 
ATOM   6990  N  N      . VAL B 1 145 ? 31.223  35.991 -104.997 1.00 58.23  ? 125 VAL B N      1 
ATOM   6991  C  CA     . VAL B 1 145 ? 31.031  36.205 -106.429 1.00 59.70  ? 125 VAL B CA     1 
ATOM   6992  C  C      . VAL B 1 145 ? 29.729  35.532 -106.843 1.00 68.81  ? 125 VAL B C      1 
ATOM   6993  O  O      . VAL B 1 145 ? 29.519  34.348 -106.554 1.00 65.15  ? 125 VAL B O      1 
ATOM   6994  C  CB     . VAL B 1 145 ? 32.214  35.660 -107.253 1.00 57.55  ? 125 VAL B CB     1 
ATOM   6995  C  CG1    . VAL B 1 145 ? 31.953  35.820 -108.749 1.00 57.62  ? 125 VAL B CG1    1 
ATOM   6996  C  CG2    . VAL B 1 145 ? 33.505  36.360 -106.859 1.00 56.91  ? 125 VAL B CG2    1 
ATOM   6997  H  H      . VAL B 1 145 ? 31.308  35.162 -104.785 1.00 70.00  ? 125 VAL B H      1 
ATOM   6998  H  HA     . VAL B 1 145 ? 30.952  37.156 -106.603 1.00 71.76  ? 125 VAL B HA     1 
ATOM   6999  H  HB     . VAL B 1 145 ? 32.318  34.713 -107.067 1.00 69.18  ? 125 VAL B HB     1 
ATOM   7000  H  HG11   . VAL B 1 145 ? 32.712  35.469 -109.240 1.00 69.26  ? 125 VAL B HG11   1 
ATOM   7001  H  HG12   . VAL B 1 145 ? 31.151  35.328 -108.983 1.00 69.26  ? 125 VAL B HG12   1 
ATOM   7002  H  HG13   . VAL B 1 145 ? 31.835  36.761 -108.949 1.00 69.26  ? 125 VAL B HG13   1 
ATOM   7003  H  HG21   . VAL B 1 145 ? 34.233  36.001 -107.389 1.00 68.41  ? 125 VAL B HG21   1 
ATOM   7004  H  HG22   . VAL B 1 145 ? 33.411  37.311 -107.025 1.00 68.41  ? 125 VAL B HG22   1 
ATOM   7005  H  HG23   . VAL B 1 145 ? 33.673  36.204 -105.916 1.00 68.41  ? 125 VAL B HG23   1 
ATOM   7006  N  N      . ARG B 1 146 ? 28.859  36.284 -107.515 1.00 80.68  ? 126 ARG B N      1 
ATOM   7007  C  CA     . ARG B 1 146 ? 27.560  35.785 -107.948 1.00 91.84  ? 126 ARG B CA     1 
ATOM   7008  C  C      . ARG B 1 146 ? 27.566  35.617 -109.461 1.00 83.24  ? 126 ARG B C      1 
ATOM   7009  O  O      . ARG B 1 146 ? 27.890  36.559 -110.194 1.00 83.02  ? 126 ARG B O      1 
ATOM   7010  C  CB     . ARG B 1 146 ? 26.429  36.732 -107.539 1.00 107.09 ? 126 ARG B CB     1 
ATOM   7011  C  CG     . ARG B 1 146 ? 25.043  36.137 -107.752 1.00 121.44 ? 126 ARG B CG     1 
ATOM   7012  C  CD     . ARG B 1 146 ? 23.951  36.953 -107.074 1.00 133.19 ? 126 ARG B CD     1 
ATOM   7013  N  NE     . ARG B 1 146 ? 23.925  36.784 -105.623 1.00 141.94 ? 126 ARG B NE     1 
ATOM   7014  C  CZ     . ARG B 1 146 ? 23.208  37.544 -104.799 1.00 148.05 ? 126 ARG B CZ     1 
ATOM   7015  N  NH1    . ARG B 1 146 ? 22.455  38.524 -105.282 1.00 151.20 ? 126 ARG B NH1    1 
ATOM   7016  N  NH2    . ARG B 1 146 ? 23.242  37.327 -103.492 1.00 148.53 ? 126 ARG B NH2    1 
ATOM   7017  H  H      . ARG B 1 146 ? 29.004  37.102 -107.737 1.00 96.93  ? 126 ARG B H      1 
ATOM   7018  H  HA     . ARG B 1 146 ? 27.395  34.919 -107.543 1.00 110.33 ? 126 ARG B HA     1 
ATOM   7019  H  HB2    . ARG B 1 146 ? 26.521  36.944 -106.597 1.00 128.63 ? 126 ARG B HB2    1 
ATOM   7020  H  HB3    . ARG B 1 146 ? 26.490  37.543 -108.068 1.00 128.63 ? 126 ARG B HB3    1 
ATOM   7021  H  HG2    . ARG B 1 146 ? 24.852  36.110 -108.703 1.00 145.85 ? 126 ARG B HG2    1 
ATOM   7022  H  HG3    . ARG B 1 146 ? 25.022  35.240 -107.383 1.00 145.85 ? 126 ARG B HG3    1 
ATOM   7023  H  HD2    . ARG B 1 146 ? 24.098  37.893 -107.262 1.00 159.95 ? 126 ARG B HD2    1 
ATOM   7024  H  HD3    . ARG B 1 146 ? 23.089  36.676 -107.422 1.00 159.95 ? 126 ARG B HD3    1 
ATOM   7025  H  HE     . ARG B 1 146 ? 24.345  36.113 -105.288 1.00 170.44 ? 126 ARG B HE     1 
ATOM   7026  H  HH11   . ARG B 1 146 ? 22.429  38.670 -106.129 1.00 181.55 ? 126 ARG B HH11   1 
ATOM   7027  H  HH12   . ARG B 1 146 ? 21.992  39.013 -104.747 1.00 181.55 ? 126 ARG B HH12   1 
ATOM   7028  H  HH21   . ARG B 1 146 ? 23.728  36.692 -103.174 1.00 178.35 ? 126 ARG B HH21   1 
ATOM   7029  H  HH22   . ARG B 1 146 ? 22.776  37.818 -102.962 1.00 178.35 ? 126 ARG B HH22   1 
ATOM   7030  N  N      . VAL B 1 147 ? 27.214  34.419 -109.922 1.00 74.02  ? 127 VAL B N      1 
ATOM   7031  C  CA     . VAL B 1 147 ? 27.250  34.065 -111.336 1.00 72.11  ? 127 VAL B CA     1 
ATOM   7032  C  C      . VAL B 1 147 ? 25.851  33.646 -111.760 1.00 76.43  ? 127 VAL B C      1 
ATOM   7033  O  O      . VAL B 1 147 ? 25.259  32.746 -111.152 1.00 72.23  ? 127 VAL B O      1 
ATOM   7034  C  CB     . VAL B 1 147 ? 28.257  32.933 -111.615 1.00 75.64  ? 127 VAL B CB     1 
ATOM   7035  C  CG1    . VAL B 1 147 ? 28.330  32.633 -113.110 1.00 78.85  ? 127 VAL B CG1    1 
ATOM   7036  C  CG2    . VAL B 1 147 ? 29.630  33.290 -111.068 1.00 77.12  ? 127 VAL B CG2    1 
ATOM   7037  H  H      . VAL B 1 147 ? 26.943  33.777 -109.418 1.00 88.95  ? 127 VAL B H      1 
ATOM   7038  H  HA     . VAL B 1 147 ? 27.509  34.841 -111.857 1.00 86.65  ? 127 VAL B HA     1 
ATOM   7039  H  HB     . VAL B 1 147 ? 27.957  32.129 -111.165 1.00 90.89  ? 127 VAL B HB     1 
ATOM   7040  H  HG11   . VAL B 1 147 ? 28.969  31.919 -113.257 1.00 94.74  ? 127 VAL B HG11   1 
ATOM   7041  H  HG12   . VAL B 1 147 ? 27.452  32.361 -113.420 1.00 94.74  ? 127 VAL B HG12   1 
ATOM   7042  H  HG13   . VAL B 1 147 ? 28.613  33.433 -113.579 1.00 94.74  ? 127 VAL B HG13   1 
ATOM   7043  H  HG21   . VAL B 1 147 ? 30.244  32.563 -111.256 1.00 92.66  ? 127 VAL B HG21   1 
ATOM   7044  H  HG22   . VAL B 1 147 ? 29.939  34.104 -111.496 1.00 92.66  ? 127 VAL B HG22   1 
ATOM   7045  H  HG23   . VAL B 1 147 ? 29.562  33.426 -110.110 1.00 92.66  ? 127 VAL B HG23   1 
ATOM   7046  N  N      . LYS B 1 148 ? 25.323  34.298 -112.796 1.00 96.62  ? 128 LYS B N      1 
ATOM   7047  C  CA     . LYS B 1 148 ? 24.023  33.948 -113.355 1.00 102.72 ? 128 LYS B CA     1 
ATOM   7048  C  C      . LYS B 1 148 ? 24.178  33.735 -114.853 1.00 100.93 ? 128 LYS B C      1 
ATOM   7049  O  O      . LYS B 1 148 ? 24.781  34.566 -115.540 1.00 106.78 ? 128 LYS B O      1 
ATOM   7050  C  CB     . LYS B 1 148 ? 22.990  35.046 -113.077 1.00 105.63 ? 128 LYS B CB     1 
ATOM   7051  C  CG     . LYS B 1 148 ? 22.663  35.225 -111.601 1.00 109.07 ? 128 LYS B CG     1 
ATOM   7052  C  CD     . LYS B 1 148 ? 21.339  35.949 -111.392 1.00 113.70 ? 128 LYS B CD     1 
ATOM   7053  C  CE     . LYS B 1 148 ? 21.376  37.369 -111.939 1.00 119.62 ? 128 LYS B CE     1 
ATOM   7054  N  NZ     . LYS B 1 148 ? 20.072  38.065 -111.761 1.00 122.66 ? 128 LYS B NZ     1 
ATOM   7055  H  H      . LYS B 1 148 ? 25.706  34.956 -113.196 1.00 116.06 ? 128 LYS B H      1 
ATOM   7056  H  HA     . LYS B 1 148 ? 23.710  33.121 -112.956 1.00 123.38 ? 128 LYS B HA     1 
ATOM   7057  H  HB2    . LYS B 1 148 ? 23.335  35.890 -113.408 1.00 126.87 ? 128 LYS B HB2    1 
ATOM   7058  H  HB3    . LYS B 1 148 ? 22.166  34.824 -113.538 1.00 126.87 ? 128 LYS B HB3    1 
ATOM   7059  H  HG2    . LYS B 1 148 ? 22.600  34.353 -111.181 1.00 131.00 ? 128 LYS B HG2    1 
ATOM   7060  H  HG3    . LYS B 1 148 ? 23.363  35.748 -111.181 1.00 131.00 ? 128 LYS B HG3    1 
ATOM   7061  H  HD2    . LYS B 1 148 ? 20.635  35.466 -111.852 1.00 136.56 ? 128 LYS B HD2    1 
ATOM   7062  H  HD3    . LYS B 1 148 ? 21.148  35.995 -110.442 1.00 136.56 ? 128 LYS B HD3    1 
ATOM   7063  H  HE2    . LYS B 1 148 ? 22.056  37.875 -111.468 1.00 143.66 ? 128 LYS B HE2    1 
ATOM   7064  H  HE3    . LYS B 1 148 ? 21.577  37.341 -112.888 1.00 143.66 ? 128 LYS B HE3    1 
ATOM   7065  H  HZ1    . LYS B 1 148 ? 20.121  38.891 -112.088 1.00 147.32 ? 128 LYS B HZ1    1 
ATOM   7066  H  HZ2    . LYS B 1 148 ? 19.430  37.621 -112.189 1.00 147.32 ? 128 LYS B HZ2    1 
ATOM   7067  H  HZ3    . LYS B 1 148 ? 19.866  38.108 -110.896 1.00 147.32 ? 128 LYS B HZ3    1 
ATOM   7068  N  N      . GLY B 1 149 ? 23.625  32.636 -115.358 1.00 87.66  ? 129 GLY B N      1 
ATOM   7069  C  CA     . GLY B 1 149 ? 23.668  32.356 -116.782 1.00 83.41  ? 129 GLY B CA     1 
ATOM   7070  C  C      . GLY B 1 149 ? 22.546  31.450 -117.256 1.00 82.19  ? 129 GLY B C      1 
ATOM   7071  O  O      . GLY B 1 149 ? 22.795  30.412 -117.875 1.00 82.49  ? 129 GLY B O      1 
ATOM   7072  H  H      . GLY B 1 149 ? 23.218  32.038 -114.893 1.00 105.30 ? 129 GLY B H      1 
ATOM   7073  H  HA2    . GLY B 1 149 ? 23.613  33.190 -117.274 1.00 100.20 ? 129 GLY B HA2    1 
ATOM   7074  H  HA3    . GLY B 1 149 ? 24.513  31.931 -116.998 1.00 100.20 ? 129 GLY B HA3    1 
ATOM   7075  N  N      . ASP B 1 154 ? 22.683  29.607 -111.799 1.00 88.73  ? 134 ASP B N      1 
ATOM   7076  C  CA     . ASP B 1 154 ? 22.856  30.683 -110.830 1.00 88.26  ? 134 ASP B CA     1 
ATOM   7077  C  C      . ASP B 1 154 ? 23.495  30.145 -109.555 1.00 79.92  ? 134 ASP B C      1 
ATOM   7078  O  O      . ASP B 1 154 ? 23.017  29.161 -108.992 1.00 84.00  ? 134 ASP B O      1 
ATOM   7079  C  CB     . ASP B 1 154 ? 21.513  31.338 -110.505 1.00 89.55  ? 134 ASP B CB     1 
ATOM   7080  C  CG     . ASP B 1 154 ? 20.567  31.349 -111.688 1.00 92.23  ? 134 ASP B CG     1 
ATOM   7081  O  OD1    . ASP B 1 154 ? 19.743  30.417 -111.800 1.00 92.80  ? 134 ASP B OD1    1 
ATOM   7082  O  OD2    . ASP B 1 154 ? 20.648  32.288 -112.508 1.00 93.36  ? 134 ASP B OD2    1 
ATOM   7083  H  HA     . ASP B 1 154 ? 23.442  31.360 -111.203 1.00 106.03 ? 134 ASP B HA     1 
ATOM   7084  H  HB2    . ASP B 1 154 ? 21.087  30.847 -109.785 1.00 107.58 ? 134 ASP B HB2    1 
ATOM   7085  H  HB3    . ASP B 1 154 ? 21.666  32.257 -110.235 1.00 107.58 ? 134 ASP B HB3    1 
ATOM   7086  N  N      . PHE B 1 155 ? 24.573  30.780 -109.097 1.00 66.46  ? 135 PHE B N      1 
ATOM   7087  C  CA     . PHE B 1 155 ? 25.226  30.324 -107.876 1.00 56.10  ? 135 PHE B CA     1 
ATOM   7088  C  C      . PHE B 1 155 ? 26.094  31.437 -107.307 1.00 57.99  ? 135 PHE B C      1 
ATOM   7089  O  O      . PHE B 1 155 ? 26.516  32.350 -108.020 1.00 54.01  ? 135 PHE B O      1 
ATOM   7090  C  CB     . PHE B 1 155 ? 26.076  29.072 -108.127 1.00 54.39  ? 135 PHE B CB     1 
ATOM   7091  C  CG     . PHE B 1 155 ? 27.078  29.230 -109.236 1.00 55.74  ? 135 PHE B CG     1 
ATOM   7092  C  CD1    . PHE B 1 155 ? 28.324  29.783 -108.987 1.00 55.16  ? 135 PHE B CD1    1 
ATOM   7093  C  CD2    . PHE B 1 155 ? 26.780  28.817 -110.525 1.00 55.73  ? 135 PHE B CD2    1 
ATOM   7094  C  CE1    . PHE B 1 155 ? 29.250  29.927 -110.002 1.00 54.92  ? 135 PHE B CE1    1 
ATOM   7095  C  CE2    . PHE B 1 155 ? 27.704  28.958 -111.546 1.00 53.47  ? 135 PHE B CE2    1 
ATOM   7096  C  CZ     . PHE B 1 155 ? 28.940  29.514 -111.284 1.00 53.12  ? 135 PHE B CZ     1 
ATOM   7097  H  H      . PHE B 1 155 ? 24.939  31.464 -109.468 1.00 79.87  ? 135 PHE B H      1 
ATOM   7098  H  HA     . PHE B 1 155 ? 24.549  30.103 -107.218 1.00 67.44  ? 135 PHE B HA     1 
ATOM   7099  H  HB2    . PHE B 1 155 ? 26.562  28.857 -107.316 1.00 65.39  ? 135 PHE B HB2    1 
ATOM   7100  H  HB3    . PHE B 1 155 ? 25.487  28.338 -108.362 1.00 65.39  ? 135 PHE B HB3    1 
ATOM   7101  H  HD1    . PHE B 1 155 ? 28.538  30.064 -108.126 1.00 66.31  ? 135 PHE B HD1    1 
ATOM   7102  H  HD2    . PHE B 1 155 ? 25.949  28.442 -110.707 1.00 67.00  ? 135 PHE B HD2    1 
ATOM   7103  H  HE1    . PHE B 1 155 ? 30.083  30.302 -109.823 1.00 66.02  ? 135 PHE B HE1    1 
ATOM   7104  H  HE2    . PHE B 1 155 ? 27.492  28.679 -112.407 1.00 64.29  ? 135 PHE B HE2    1 
ATOM   7105  H  HZ     . PHE B 1 155 ? 29.562  29.610 -111.968 1.00 63.87  ? 135 PHE B HZ     1 
ATOM   7106  N  N      . ASP B 1 156 ? 26.348  31.342 -106.004 1.00 67.05  ? 136 ASP B N      1 
ATOM   7107  C  CA     . ASP B 1 156 ? 27.268  32.220 -105.298 1.00 70.20  ? 136 ASP B CA     1 
ATOM   7108  C  C      . ASP B 1 156 ? 28.470  31.404 -104.841 1.00 70.07  ? 136 ASP B C      1 
ATOM   7109  O  O      . ASP B 1 156 ? 28.346  30.213 -104.545 1.00 71.75  ? 136 ASP B O      1 
ATOM   7110  C  CB     . ASP B 1 156 ? 26.596  32.868 -104.082 1.00 67.06  ? 136 ASP B CB     1 
ATOM   7111  C  CG     . ASP B 1 156 ? 25.347  33.647 -104.445 1.00 67.02  ? 136 ASP B CG     1 
ATOM   7112  O  OD1    . ASP B 1 156 ? 24.911  33.571 -105.613 1.00 69.93  ? 136 ASP B OD1    1 
ATOM   7113  O  OD2    . ASP B 1 156 ? 24.795  34.330 -103.556 1.00 66.04  ? 136 ASP B OD2    1 
ATOM   7114  H  H      . ASP B 1 156 ? 25.984  30.754 -105.493 1.00 80.58  ? 136 ASP B H      1 
ATOM   7115  H  HA     . ASP B 1 156 ? 27.575  32.921 -105.895 1.00 84.36  ? 136 ASP B HA     1 
ATOM   7116  H  HB2    . ASP B 1 156 ? 26.344  32.174 -103.454 1.00 80.59  ? 136 ASP B HB2    1 
ATOM   7117  H  HB3    . ASP B 1 156 ? 27.221  33.481 -103.665 1.00 80.59  ? 136 ASP B HB3    1 
ATOM   7118  N  N      . ILE B 1 157 ? 29.640  32.039 -104.791 1.00 65.25  ? 137 ILE B N      1 
ATOM   7119  C  CA     . ILE B 1 157 ? 30.864  31.350 -104.395 1.00 65.90  ? 137 ILE B CA     1 
ATOM   7120  C  C      . ILE B 1 157 ? 31.653  32.224 -103.428 1.00 64.61  ? 137 ILE B C      1 
ATOM   7121  O  O      . ILE B 1 157 ? 31.803  33.433 -103.644 1.00 61.02  ? 137 ILE B O      1 
ATOM   7122  C  CB     . ILE B 1 157 ? 31.720  30.956 -105.617 1.00 70.41  ? 137 ILE B CB     1 
ATOM   7123  C  CG1    . ILE B 1 157 ? 32.898  30.089 -105.171 1.00 70.73  ? 137 ILE B CG1    1 
ATOM   7124  C  CG2    . ILE B 1 157 ? 32.210  32.187 -106.360 1.00 73.03  ? 137 ILE B CG2    1 
ATOM   7125  C  CD1    . ILE B 1 157 ? 33.546  29.322 -106.298 1.00 70.89  ? 137 ILE B CD1    1 
ATOM   7126  H  H      . ILE B 1 157 ? 29.750  32.871 -104.983 1.00 78.41  ? 137 ILE B H      1 
ATOM   7127  H  HA     . ILE B 1 157 ? 30.624  30.534 -103.928 1.00 79.20  ? 137 ILE B HA     1 
ATOM   7128  H  HB     . ILE B 1 157 ? 31.169  30.435 -106.221 1.00 84.61  ? 137 ILE B HB     1 
ATOM   7129  H  HG12   . ILE B 1 157 ? 33.574  30.659 -104.773 1.00 85.00  ? 137 ILE B HG12   1 
ATOM   7130  H  HG13   . ILE B 1 157 ? 32.584  29.446 -104.516 1.00 85.00  ? 137 ILE B HG13   1 
ATOM   7131  H  HG21   . ILE B 1 157 ? 32.743  31.905 -107.120 1.00 87.75  ? 137 ILE B HG21   1 
ATOM   7132  H  HG22   . ILE B 1 157 ? 31.443  32.697 -106.665 1.00 87.75  ? 137 ILE B HG22   1 
ATOM   7133  H  HG23   . ILE B 1 157 ? 32.748  32.725 -105.759 1.00 87.75  ? 137 ILE B HG23   1 
ATOM   7134  H  HD11   . ILE B 1 157 ? 34.280  28.798 -105.941 1.00 85.19  ? 137 ILE B HD11   1 
ATOM   7135  H  HD12   . ILE B 1 157 ? 32.886  28.737 -106.701 1.00 85.19  ? 137 ILE B HD12   1 
ATOM   7136  H  HD13   . ILE B 1 157 ? 33.878  29.951 -106.957 1.00 85.19  ? 137 ILE B HD13   1 
ATOM   7137  N  N      . THR B 1 158 ? 32.145  31.600 -102.355 1.00 66.16  ? 138 THR B N      1 
ATOM   7138  C  CA     . THR B 1 158 ? 33.009  32.229 -101.360 1.00 67.72  ? 138 THR B CA     1 
ATOM   7139  C  C      . THR B 1 158 ? 34.264  31.374 -101.179 1.00 70.71  ? 138 THR B C      1 
ATOM   7140  O  O      . THR B 1 158 ? 34.467  30.376 -101.878 1.00 71.23  ? 138 THR B O      1 
ATOM   7141  C  CB     . THR B 1 158 ? 32.276  32.407 -100.023 1.00 65.59  ? 138 THR B CB     1 
ATOM   7142  O  OG1    . THR B 1 158 ? 31.787  31.138 -99.571  1.00 64.47  ? 138 THR B OG1    1 
ATOM   7143  C  CG2    . THR B 1 158 ? 31.103  33.365 -100.180 1.00 64.68  ? 138 THR B CG2    1 
ATOM   7144  H  H      . THR B 1 158 ? 31.982  30.774 -102.177 1.00 79.51  ? 138 THR B H      1 
ATOM   7145  H  HA     . THR B 1 158 ? 33.280  33.104 -101.678 1.00 81.39  ? 138 THR B HA     1 
ATOM   7146  H  HB     . THR B 1 158 ? 32.887  32.773 -99.365  1.00 78.83  ? 138 THR B HB     1 
ATOM   7147  H  HG1    . THR B 1 158 ? 31.385  31.229 -98.840  1.00 77.48  ? 138 THR B HG1    1 
ATOM   7148  H  HG21   . THR B 1 158 ? 30.646  33.471 -99.331  1.00 77.73  ? 138 THR B HG21   1 
ATOM   7149  H  HG22   . THR B 1 158 ? 31.421  34.232 -100.478 1.00 77.73  ? 138 THR B HG22   1 
ATOM   7150  H  HG23   . THR B 1 158 ? 30.476  33.017 -100.834 1.00 77.73  ? 138 THR B HG23   1 
ATOM   7151  N  N      . ALA B 1 159 ? 35.120  31.768 -100.233 1.00 68.75  ? 139 ALA B N      1 
ATOM   7152  C  CA     . ALA B 1 159 ? 36.392  31.085 -100.034 1.00 71.20  ? 139 ALA B CA     1 
ATOM   7153  C  C      . ALA B 1 159 ? 36.855  31.208 -98.587  1.00 71.47  ? 139 ALA B C      1 
ATOM   7154  O  O      . ALA B 1 159 ? 36.652  32.243 -97.945  1.00 67.31  ? 139 ALA B O      1 
ATOM   7155  C  CB     . ALA B 1 159 ? 37.470  31.645 -100.969 1.00 73.79  ? 139 ALA B CB     1 
ATOM   7156  H  H      . ALA B 1 159 ? 34.984  32.426 -99.696  1.00 82.62  ? 139 ALA B H      1 
ATOM   7157  H  HA     . ALA B 1 159 ? 36.280  30.143 -100.234 1.00 85.56  ? 139 ALA B HA     1 
ATOM   7158  H  HB1    . ALA B 1 159 ? 38.301  31.171 -100.812 1.00 88.67  ? 139 ALA B HB1    1 
ATOM   7159  H  HB2    . ALA B 1 159 ? 37.186  31.520 -101.888 1.00 88.67  ? 139 ALA B HB2    1 
ATOM   7160  H  HB3    . ALA B 1 159 ? 37.588  32.590 -100.784 1.00 88.67  ? 139 ALA B HB3    1 
ATOM   7161  N  N      . TYR B 1 160 ? 37.477  30.136 -98.085  1.00 82.26  ? 140 TYR B N      1 
ATOM   7162  C  CA     . TYR B 1 160 ? 38.222  30.152 -96.820  1.00 83.78  ? 140 TYR B CA     1 
ATOM   7163  C  C      . TYR B 1 160 ? 37.317  30.331 -95.598  1.00 76.75  ? 140 TYR B C      1 
ATOM   7164  O  O      . TYR B 1 160 ? 37.675  31.036 -94.654  1.00 78.61  ? 140 TYR B O      1 
ATOM   7165  C  CB     . TYR B 1 160 ? 39.309  31.232 -96.825  1.00 87.13  ? 140 TYR B CB     1 
ATOM   7166  C  CG     . TYR B 1 160 ? 40.356  31.103 -97.912  1.00 89.74  ? 140 TYR B CG     1 
ATOM   7167  C  CD1    . TYR B 1 160 ? 40.604  29.887 -98.536  1.00 91.15  ? 140 TYR B CD1    1 
ATOM   7168  C  CD2    . TYR B 1 160 ? 41.113  32.202 -98.298  1.00 91.57  ? 140 TYR B CD2    1 
ATOM   7169  C  CE1    . TYR B 1 160 ? 41.568  29.775 -99.523  1.00 93.87  ? 140 TYR B CE1    1 
ATOM   7170  C  CE2    . TYR B 1 160 ? 42.076  32.099 -99.281  1.00 94.22  ? 140 TYR B CE2    1 
ATOM   7171  C  CZ     . TYR B 1 160 ? 42.301  30.884 -99.890  1.00 94.70  ? 140 TYR B CZ     1 
ATOM   7172  O  OH     . TYR B 1 160 ? 43.262  30.781 -100.870 1.00 95.51  ? 140 TYR B OH     1 
ATOM   7173  H  H      . TYR B 1 160 ? 37.481  29.367 -98.470  1.00 98.82  ? 140 TYR B H      1 
ATOM   7174  H  HA     . TYR B 1 160 ? 38.668  29.296 -96.722  1.00 100.65 ? 140 TYR B HA     1 
ATOM   7175  H  HB2    . TYR B 1 160 ? 38.882  32.096 -96.935  1.00 104.68 ? 140 TYR B HB2    1 
ATOM   7176  H  HB3    . TYR B 1 160 ? 39.771  31.206 -95.972  1.00 104.68 ? 140 TYR B HB3    1 
ATOM   7177  H  HD1    . TYR B 1 160 ? 40.111  29.138 -98.290  1.00 109.50 ? 140 TYR B HD1    1 
ATOM   7178  H  HD2    . TYR B 1 160 ? 40.964  33.024 -97.889  1.00 110.00 ? 140 TYR B HD2    1 
ATOM   7179  H  HE1    . TYR B 1 160 ? 41.721  28.955 -99.935  1.00 112.76 ? 140 TYR B HE1    1 
ATOM   7180  H  HE2    . TYR B 1 160 ? 42.572  32.846 -99.531  1.00 113.18 ? 140 TYR B HE2    1 
ATOM   7181  H  HH     . TYR B 1 160 ? 43.628  31.527 -100.993 1.00 114.73 ? 140 TYR B HH     1 
ATOM   7182  N  N      . ARG B 1 161 ? 36.147  29.696 -95.601  1.00 68.06  ? 141 ARG B N      1 
ATOM   7183  C  CA     . ARG B 1 161 ? 35.242  29.782 -94.460  1.00 61.48  ? 141 ARG B CA     1 
ATOM   7184  C  C      . ARG B 1 161 ? 34.535  28.453 -94.243  1.00 56.96  ? 141 ARG B C      1 
ATOM   7185  O  O      . ARG B 1 161 ? 34.214  27.744 -95.201  1.00 56.52  ? 141 ARG B O      1 
ATOM   7186  C  CB     . ARG B 1 161 ? 34.215  30.908 -94.637  1.00 61.18  ? 141 ARG B CB     1 
ATOM   7187  C  CG     . ARG B 1 161 ? 34.796  32.297 -94.410  1.00 61.69  ? 141 ARG B CG     1 
ATOM   7188  C  CD     . ARG B 1 161 ? 33.788  33.393 -94.708  1.00 63.83  ? 141 ARG B CD     1 
ATOM   7189  N  NE     . ARG B 1 161 ? 34.369  34.725 -94.544  1.00 68.47  ? 141 ARG B NE     1 
ATOM   7190  C  CZ     . ARG B 1 161 ? 34.355  35.425 -93.411  1.00 70.85  ? 141 ARG B CZ     1 
ATOM   7191  N  NH1    . ARG B 1 161 ? 33.792  34.931 -92.316  1.00 71.50  ? 141 ARG B NH1    1 
ATOM   7192  N  NH2    . ARG B 1 161 ? 34.913  36.628 -93.372  1.00 71.26  ? 141 ARG B NH2    1 
ATOM   7193  H  H      . ARG B 1 161 ? 35.856  29.210 -96.248  1.00 81.79  ? 141 ARG B H      1 
ATOM   7194  H  HA     . ARG B 1 161 ? 35.761  29.976 -93.664  1.00 73.89  ? 141 ARG B HA     1 
ATOM   7195  H  HB2    . ARG B 1 161 ? 33.865  30.875 -95.541  1.00 73.53  ? 141 ARG B HB2    1 
ATOM   7196  H  HB3    . ARG B 1 161 ? 33.495  30.779 -93.999  1.00 73.53  ? 141 ARG B HB3    1 
ATOM   7197  H  HG2    . ARG B 1 161 ? 35.068  32.381 -93.483  1.00 74.15  ? 141 ARG B HG2    1 
ATOM   7198  H  HG3    . ARG B 1 161 ? 35.560  32.421 -94.995  1.00 74.15  ? 141 ARG B HG3    1 
ATOM   7199  H  HD2    . ARG B 1 161 ? 33.484  33.306 -95.625  1.00 76.71  ? 141 ARG B HD2    1 
ATOM   7200  H  HD3    . ARG B 1 161 ? 33.039  33.312 -94.098  1.00 76.71  ? 141 ARG B HD3    1 
ATOM   7201  H  HE     . ARG B 1 161 ? 34.746  35.083 -95.229  1.00 82.28  ? 141 ARG B HE     1 
ATOM   7202  H  HH11   . ARG B 1 161 ? 33.429  34.151 -92.334  1.00 85.92  ? 141 ARG B HH11   1 
ATOM   7203  H  HH12   . ARG B 1 161 ? 33.789  35.390 -91.589  1.00 85.92  ? 141 ARG B HH12   1 
ATOM   7204  H  HH21   . ARG B 1 161 ? 35.280  36.955 -94.077  1.00 85.62  ? 141 ARG B HH21   1 
ATOM   7205  H  HH22   . ARG B 1 161 ? 34.906  37.081 -92.641  1.00 85.62  ? 141 ARG B HH22   1 
ATOM   7206  N  N      . ARG B 1 162 ? 34.299  28.124 -92.968  1.00 53.84  ? 142 ARG B N      1 
ATOM   7207  C  CA     . ARG B 1 162 ? 33.708  26.851 -92.577  1.00 49.25  ? 142 ARG B CA     1 
ATOM   7208  C  C      . ARG B 1 162 ? 32.313  26.973 -91.978  1.00 44.41  ? 142 ARG B C      1 
ATOM   7209  O  O      . ARG B 1 162 ? 31.587  25.975 -91.949  1.00 43.08  ? 142 ARG B O      1 
ATOM   7210  C  CB     . ARG B 1 162 ? 34.608  26.140 -91.554  1.00 51.77  ? 142 ARG B CB     1 
ATOM   7211  C  CG     . ARG B 1 162 ? 35.920  25.602 -92.118  1.00 56.53  ? 142 ARG B CG     1 
ATOM   7212  C  CD     . ARG B 1 162 ? 36.783  24.972 -91.025  1.00 58.33  ? 142 ARG B CD     1 
ATOM   7213  N  NE     . ARG B 1 162 ? 37.293  25.957 -90.070  1.00 61.96  ? 142 ARG B NE     1 
ATOM   7214  C  CZ     . ARG B 1 162 ? 38.517  26.484 -90.089  1.00 67.22  ? 142 ARG B CZ     1 
ATOM   7215  N  NH1    . ARG B 1 162 ? 39.400  26.129 -91.012  1.00 72.27  ? 142 ARG B NH1    1 
ATOM   7216  N  NH2    . ARG B 1 162 ? 38.863  27.373 -89.168  1.00 66.72  ? 142 ARG B NH2    1 
ATOM   7217  H  H      . ARG B 1 162 ? 34.478  28.637 -92.301  1.00 64.73  ? 142 ARG B H      1 
ATOM   7218  H  HA     . ARG B 1 162 ? 33.644  26.284 -93.361  1.00 59.22  ? 142 ARG B HA     1 
ATOM   7219  H  HB2    . ARG B 1 162 ? 34.829  26.768 -90.848  1.00 62.25  ? 142 ARG B HB2    1 
ATOM   7220  H  HB3    . ARG B 1 162 ? 34.120  25.390 -91.181  1.00 62.25  ? 142 ARG B HB3    1 
ATOM   7221  H  HG2    . ARG B 1 162 ? 35.728  24.922 -92.783  1.00 67.96  ? 142 ARG B HG2    1 
ATOM   7222  H  HG3    . ARG B 1 162 ? 36.420  26.331 -92.518  1.00 67.96  ? 142 ARG B HG3    1 
ATOM   7223  H  HD2    . ARG B 1 162 ? 36.251  24.326 -90.534  1.00 70.11  ? 142 ARG B HD2    1 
ATOM   7224  H  HD3    . ARG B 1 162 ? 37.544  24.532 -91.436  1.00 70.11  ? 142 ARG B HD3    1 
ATOM   7225  H  HE     . ARG B 1 162 ? 36.760  26.217 -89.447  1.00 74.47  ? 142 ARG B HE     1 
ATOM   7226  H  HH11   . ARG B 1 162 ? 39.185  25.554 -91.614  1.00 86.85  ? 142 ARG B HH11   1 
ATOM   7227  H  HH12   . ARG B 1 162 ? 40.186  26.477 -91.011  1.00 86.85  ? 142 ARG B HH12   1 
ATOM   7228  H  HH21   . ARG B 1 162 ? 38.299  27.608 -88.563  1.00 80.18  ? 142 ARG B HH21   1 
ATOM   7229  H  HH22   . ARG B 1 162 ? 39.653  27.714 -89.175  1.00 80.18  ? 142 ARG B HH22   1 
ATOM   7230  N  N      . ASN B 1 163 ? 31.926  28.152 -91.486  1.00 41.00  ? 143 ASN B N      1 
ATOM   7231  C  CA     . ASN B 1 163 ? 30.697  28.258 -90.703  1.00 39.38  ? 143 ASN B CA     1 
ATOM   7232  C  C      . ASN B 1 163 ? 29.462  27.935 -91.539  1.00 38.41  ? 143 ASN B C      1 
ATOM   7233  O  O      . ASN B 1 163 ? 28.520  27.303 -91.045  1.00 37.49  ? 143 ASN B O      1 
ATOM   7234  C  CB     . ASN B 1 163 ? 30.582  29.657 -90.096  1.00 36.58  ? 143 ASN B CB     1 
ATOM   7235  C  CG     . ASN B 1 163 ? 31.543  29.872 -88.938  1.00 32.18  ? 143 ASN B CG     1 
ATOM   7236  O  OD1    . ASN B 1 163 ? 32.286  28.968 -88.555  1.00 30.01  ? 143 ASN B OD1    1 
ATOM   7237  N  ND2    . ASN B 1 163 ? 31.524  31.071 -88.368  1.00 31.43  ? 143 ASN B ND2    1 
ATOM   7238  H  H      . ASN B 1 163 ? 32.349  28.893 -91.591  1.00 49.32  ? 143 ASN B H      1 
ATOM   7239  H  HA     . ASN B 1 163 ? 30.736  27.620 -89.973  1.00 47.37  ? 143 ASN B HA     1 
ATOM   7240  H  HB2    . ASN B 1 163 ? 30.783  30.316 -90.779  1.00 44.01  ? 143 ASN B HB2    1 
ATOM   7241  H  HB3    . ASN B 1 163 ? 29.680  29.785 -89.765  1.00 44.01  ? 143 ASN B HB3    1 
ATOM   7242  H  HD21   . ASN B 1 163 ? 32.049  31.242 -87.709  1.00 37.83  ? 143 ASN B HD21   1 
ATOM   7243  H  HD22   . ASN B 1 163 ? 30.987  31.676 -88.658  1.00 37.83  ? 143 ASN B HD22   1 
ATOM   7244  N  N      . GLY B 1 164 ? 29.444  28.356 -92.806  1.00 36.67  ? 144 GLY B N      1 
ATOM   7245  C  CA     . GLY B 1 164 ? 28.282  28.096 -93.643  1.00 33.47  ? 144 GLY B CA     1 
ATOM   7246  C  C      . GLY B 1 164 ? 27.997  26.616 -93.802  1.00 35.76  ? 144 GLY B C      1 
ATOM   7247  O  O      . GLY B 1 164 ? 26.892  26.148 -93.511  1.00 29.75  ? 144 GLY B O      1 
ATOM   7248  H  H      . GLY B 1 164 ? 30.080  28.786 -93.194  1.00 44.13  ? 144 GLY B H      1 
ATOM   7249  H  HA2    . GLY B 1 164 ? 27.501  28.518 -93.251  1.00 40.28  ? 144 GLY B HA2    1 
ATOM   7250  H  HA3    . GLY B 1 164 ? 28.426  28.477 -94.523  1.00 40.28  ? 144 GLY B HA3    1 
ATOM   7251  N  N      . VAL B 1 165 ? 28.994  25.855 -94.263  1.00 47.28  ? 145 VAL B N      1 
ATOM   7252  C  CA     . VAL B 1 165 ? 28.827  24.410 -94.383  1.00 56.40  ? 145 VAL B CA     1 
ATOM   7253  C  C      . VAL B 1 165 ? 28.436  23.808 -93.039  1.00 54.67  ? 145 VAL B C      1 
ATOM   7254  O  O      . VAL B 1 165 ? 27.641  22.863 -92.973  1.00 57.35  ? 145 VAL B O      1 
ATOM   7255  C  CB     . VAL B 1 165 ? 30.105  23.758 -94.948  1.00 61.53  ? 145 VAL B CB     1 
ATOM   7256  C  CG1    . VAL B 1 165 ? 30.364  24.233 -96.373  1.00 64.56  ? 145 VAL B CG1    1 
ATOM   7257  C  CG2    . VAL B 1 165 ? 31.308  24.053 -94.072  1.00 63.43  ? 145 VAL B CG2    1 
ATOM   7258  H  H      . VAL B 1 165 ? 29.764  26.149 -94.508  1.00 56.86  ? 145 VAL B H      1 
ATOM   7259  H  HA     . VAL B 1 165 ? 28.105  24.231 -95.006  1.00 67.79  ? 145 VAL B HA     1 
ATOM   7260  H  HB     . VAL B 1 165 ? 29.982  22.796 -94.972  1.00 73.96  ? 145 VAL B HB     1 
ATOM   7261  H  HG11   . VAL B 1 165 ? 31.171  23.809 -96.704  1.00 77.60  ? 145 VAL B HG11   1 
ATOM   7262  H  HG12   . VAL B 1 165 ? 29.608  23.987 -96.929  1.00 77.60  ? 145 VAL B HG12   1 
ATOM   7263  H  HG13   . VAL B 1 165 ? 30.472  25.197 -96.369  1.00 77.60  ? 145 VAL B HG13   1 
ATOM   7264  H  HG21   . VAL B 1 165 ? 32.090  23.629 -94.457  1.00 76.23  ? 145 VAL B HG21   1 
ATOM   7265  H  HG22   . VAL B 1 165 ? 31.439  25.014 -94.029  1.00 76.23  ? 145 VAL B HG22   1 
ATOM   7266  H  HG23   . VAL B 1 165 ? 31.144  23.701 -93.183  1.00 76.23  ? 145 VAL B HG23   1 
ATOM   7267  N  N      . ARG B 1 166 ? 28.982  24.349 -91.948  1.00 48.52  ? 146 ARG B N      1 
ATOM   7268  C  CA     . ARG B 1 166 ? 28.736  23.774 -90.629  1.00 46.26  ? 146 ARG B CA     1 
ATOM   7269  C  C      . ARG B 1 166 ? 27.271  23.913 -90.230  1.00 44.36  ? 146 ARG B C      1 
ATOM   7270  O  O      . ARG B 1 166 ? 26.585  22.915 -89.973  1.00 41.74  ? 146 ARG B O      1 
ATOM   7271  C  CB     . ARG B 1 166 ? 29.640  24.443 -89.591  1.00 48.38  ? 146 ARG B CB     1 
ATOM   7272  C  CG     . ARG B 1 166 ? 30.286  23.464 -88.629  1.00 51.61  ? 146 ARG B CG     1 
ATOM   7273  C  CD     . ARG B 1 166 ? 31.206  24.157 -87.639  1.00 51.60  ? 146 ARG B CD     1 
ATOM   7274  N  NE     . ARG B 1 166 ? 31.489  23.300 -86.491  1.00 49.07  ? 146 ARG B NE     1 
ATOM   7275  C  CZ     . ARG B 1 166 ? 32.176  23.678 -85.419  1.00 47.42  ? 146 ARG B CZ     1 
ATOM   7276  N  NH1    . ARG B 1 166 ? 32.661  24.909 -85.332  1.00 46.70  ? 146 ARG B NH1    1 
ATOM   7277  N  NH2    . ARG B 1 166 ? 32.377  22.820 -84.428  1.00 47.99  ? 146 ARG B NH2    1 
ATOM   7278  H  H      . ARG B 1 166 ? 29.493  25.040 -91.946  1.00 58.34  ? 146 ARG B H      1 
ATOM   7279  H  HA     . ARG B 1 166 ? 28.953  22.829 -90.650  1.00 55.63  ? 146 ARG B HA     1 
ATOM   7280  H  HB2    . ARG B 1 166 ? 30.349  24.918 -90.053  1.00 58.17  ? 146 ARG B HB2    1 
ATOM   7281  H  HB3    . ARG B 1 166 ? 29.111  25.067 -89.070  1.00 58.17  ? 146 ARG B HB3    1 
ATOM   7282  H  HG2    . ARG B 1 166 ? 29.592  23.007 -88.127  1.00 62.05  ? 146 ARG B HG2    1 
ATOM   7283  H  HG3    . ARG B 1 166 ? 30.811  22.823 -89.132  1.00 62.05  ? 146 ARG B HG3    1 
ATOM   7284  H  HD2    . ARG B 1 166 ? 32.046  24.368 -88.076  1.00 62.04  ? 146 ARG B HD2    1 
ATOM   7285  H  HD3    . ARG B 1 166 ? 30.780  24.967 -87.318  1.00 62.04  ? 146 ARG B HD3    1 
ATOM   7286  H  HE     . ARG B 1 166 ? 31.189  22.494 -86.510  1.00 59.00  ? 146 ARG B HE     1 
ATOM   7287  H  HH11   . ARG B 1 166 ? 32.532  25.468 -85.972  1.00 56.16  ? 146 ARG B HH11   1 
ATOM   7288  H  HH12   . ARG B 1 166 ? 33.104  25.148 -84.635  1.00 56.16  ? 146 ARG B HH12   1 
ATOM   7289  H  HH21   . ARG B 1 166 ? 32.064  22.021 -84.481  1.00 57.70  ? 146 ARG B HH21   1 
ATOM   7290  H  HH22   . ARG B 1 166 ? 32.821  23.063 -83.733  1.00 57.70  ? 146 ARG B HH22   1 
ATOM   7291  N  N      . ASN B 1 167 ? 26.766  25.149 -90.178  1.00 47.45  ? 147 ASN B N      1 
ATOM   7292  C  CA     . ASN B 1 167 ? 25.376  25.344 -89.780  1.00 46.85  ? 147 ASN B CA     1 
ATOM   7293  C  C      . ASN B 1 167 ? 24.423  24.708 -90.785  1.00 45.88  ? 147 ASN B C      1 
ATOM   7294  O  O      . ASN B 1 167 ? 23.346  24.227 -90.406  1.00 47.40  ? 147 ASN B O      1 
ATOM   7295  C  CB     . ASN B 1 167 ? 25.080  26.837 -89.604  1.00 43.96  ? 147 ASN B CB     1 
ATOM   7296  C  CG     . ASN B 1 167 ? 25.171  27.621 -90.903  1.00 43.79  ? 147 ASN B CG     1 
ATOM   7297  O  OD1    . ASN B 1 167 ? 24.688  27.186 -91.948  1.00 43.88  ? 147 ASN B OD1    1 
ATOM   7298  N  ND2    . ASN B 1 167 ? 25.793  28.792 -90.838  1.00 43.60  ? 147 ASN B ND2    1 
ATOM   7299  H  H      . ASN B 1 167 ? 27.196  25.870 -90.364  1.00 57.05  ? 147 ASN B H      1 
ATOM   7300  H  HA     . ASN B 1 167 ? 25.233  24.912 -88.924  1.00 56.34  ? 147 ASN B HA     1 
ATOM   7301  H  HB2    . ASN B 1 167 ? 24.181  26.941 -89.255  1.00 52.87  ? 147 ASN B HB2    1 
ATOM   7302  H  HB3    . ASN B 1 167 ? 25.722  27.214 -88.982  1.00 52.87  ? 147 ASN B HB3    1 
ATOM   7303  H  HD21   . ASN B 1 167 ? 25.873  29.276 -91.544  1.00 52.44  ? 147 ASN B HD21   1 
ATOM   7304  H  HD22   . ASN B 1 167 ? 26.117  29.065 -90.090  1.00 52.44  ? 147 ASN B HD22   1 
ATOM   7305  N  N      . SER B 1 168 ? 24.810  24.674 -92.063  1.00 42.56  ? 148 SER B N      1 
ATOM   7306  C  CA     . SER B 1 168 ? 24.018  23.946 -93.048  1.00 42.57  ? 148 SER B CA     1 
ATOM   7307  C  C      . SER B 1 168 ? 23.905  22.475 -92.669  1.00 40.82  ? 148 SER B C      1 
ATOM   7308  O  O      . SER B 1 168 ? 22.821  21.883 -92.753  1.00 40.59  ? 148 SER B O      1 
ATOM   7309  C  CB     . SER B 1 168 ? 24.642  24.094 -94.437  1.00 45.12  ? 148 SER B CB     1 
ATOM   7310  O  OG     . SER B 1 168 ? 24.599  25.439 -94.883  1.00 44.86  ? 148 SER B OG     1 
ATOM   7311  H  H      . SER B 1 168 ? 25.512  25.057 -92.378  1.00 51.19  ? 148 SER B H      1 
ATOM   7312  H  HA     . SER B 1 168 ? 23.123  24.320 -93.077  1.00 51.20  ? 148 SER B HA     1 
ATOM   7313  H  HB2    . SER B 1 168 ? 25.567  23.805 -94.398  1.00 54.27  ? 148 SER B HB2    1 
ATOM   7314  H  HB3    . SER B 1 168 ? 24.149  23.540 -95.063  1.00 54.27  ? 148 SER B HB3    1 
ATOM   7315  H  HG     . SER B 1 168 ? 25.023  25.931 -94.350  1.00 53.95  ? 148 SER B HG     1 
ATOM   7316  N  N      . ALA B 1 169 ? 25.016  21.870 -92.241  1.00 39.57  ? 149 ALA B N      1 
ATOM   7317  C  CA     . ALA B 1 169 ? 24.986  20.479 -91.801  1.00 40.44  ? 149 ALA B CA     1 
ATOM   7318  C  C      . ALA B 1 169 ? 24.112  20.307 -90.564  1.00 39.43  ? 149 ALA B C      1 
ATOM   7319  O  O      . ALA B 1 169 ? 23.350  19.337 -90.462  1.00 38.16  ? 149 ALA B O      1 
ATOM   7320  C  CB     . ALA B 1 169 ? 26.408  19.991 -91.524  1.00 42.83  ? 149 ALA B CB     1 
ATOM   7321  H  H      . ALA B 1 169 ? 25.790  22.241 -92.197  1.00 47.60  ? 149 ALA B H      1 
ATOM   7322  H  HA     . ALA B 1 169 ? 24.614  19.931 -92.510  1.00 48.65  ? 149 ALA B HA     1 
ATOM   7323  H  HB1    . ALA B 1 169 ? 26.373  19.067 -91.233  1.00 51.51  ? 149 ALA B HB1    1 
ATOM   7324  H  HB2    . ALA B 1 169 ? 26.930  20.062 -92.339  1.00 51.51  ? 149 ALA B HB2    1 
ATOM   7325  H  HB3    . ALA B 1 169 ? 26.801  20.543 -90.830  1.00 51.51  ? 149 ALA B HB3    1 
ATOM   7326  N  N      . LEU B 1 170 ? 24.204  21.240 -89.613  1.00 40.43  ? 150 LEU B N      1 
ATOM   7327  C  CA     . LEU B 1 170 ? 23.366  21.159 -88.419  1.00 38.92  ? 150 LEU B CA     1 
ATOM   7328  C  C      . LEU B 1 170 ? 21.887  21.144 -88.793  1.00 38.58  ? 150 LEU B C      1 
ATOM   7329  O  O      . LEU B 1 170 ? 21.130  20.259 -88.368  1.00 37.90  ? 150 LEU B O      1 
ATOM   7330  C  CB     . LEU B 1 170 ? 23.685  22.328 -87.483  1.00 35.78  ? 150 LEU B CB     1 
ATOM   7331  C  CG     . LEU B 1 170 ? 22.887  22.409 -86.179  1.00 33.53  ? 150 LEU B CG     1 
ATOM   7332  C  CD1    . LEU B 1 170 ? 23.169  21.213 -85.284  1.00 34.11  ? 150 LEU B CD1    1 
ATOM   7333  C  CD2    . LEU B 1 170 ? 23.208  23.703 -85.448  1.00 30.79  ? 150 LEU B CD2    1 
ATOM   7334  H  H      . LEU B 1 170 ? 24.734  21.917 -89.635  1.00 48.63  ? 150 LEU B H      1 
ATOM   7335  H  HA     . LEU B 1 170 ? 23.564  20.335 -87.949  1.00 46.82  ? 150 LEU B HA     1 
ATOM   7336  H  HB2    . LEU B 1 170 ? 24.623  22.272 -87.241  1.00 43.05  ? 150 LEU B HB2    1 
ATOM   7337  H  HB3    . LEU B 1 170 ? 23.528  23.154 -87.967  1.00 43.05  ? 150 LEU B HB3    1 
ATOM   7338  H  HG     . LEU B 1 170 ? 21.940  22.410 -86.388  1.00 40.35  ? 150 LEU B HG     1 
ATOM   7339  H  HD11   . LEU B 1 170 ? 22.649  21.298 -84.471  1.00 41.05  ? 150 LEU B HD11   1 
ATOM   7340  H  HD12   . LEU B 1 170 ? 22.920  20.402 -85.754  1.00 41.05  ? 150 LEU B HD12   1 
ATOM   7341  H  HD13   . LEU B 1 170 ? 24.116  21.195 -85.072  1.00 41.05  ? 150 LEU B HD13   1 
ATOM   7342  H  HD21   . LEU B 1 170 ? 22.694  23.737 -84.626  1.00 37.07  ? 150 LEU B HD21   1 
ATOM   7343  H  HD22   . LEU B 1 170 ? 24.156  23.725 -85.246  1.00 37.07  ? 150 LEU B HD22   1 
ATOM   7344  H  HD23   . LEU B 1 170 ? 22.973  24.453 -86.017  1.00 37.07  ? 150 LEU B HD23   1 
ATOM   7345  N  N      . LEU B 1 171 ? 21.460  22.112 -89.609  1.00 35.17  ? 151 LEU B N      1 
ATOM   7346  C  CA     . LEU B 1 171 ? 20.065  22.147 -90.038  1.00 33.61  ? 151 LEU B CA     1 
ATOM   7347  C  C      . LEU B 1 171 ? 19.690  20.873 -90.783  1.00 32.39  ? 151 LEU B C      1 
ATOM   7348  O  O      . LEU B 1 171 ? 18.598  20.325 -90.583  1.00 27.27  ? 151 LEU B O      1 
ATOM   7349  C  CB     . LEU B 1 171 ? 19.820  23.379 -90.908  1.00 35.42  ? 151 LEU B CB     1 
ATOM   7350  C  CG     . LEU B 1 171 ? 20.057  24.725 -90.215  1.00 35.20  ? 151 LEU B CG     1 
ATOM   7351  C  CD1    . LEU B 1 171 ? 20.075  25.861 -91.224  1.00 35.72  ? 151 LEU B CD1    1 
ATOM   7352  C  CD2    . LEU B 1 171 ? 18.991  24.974 -89.157  1.00 35.30  ? 151 LEU B CD2    1 
ATOM   7353  H  H      . LEU B 1 171 ? 21.949  22.747 -89.921  1.00 42.32  ? 151 LEU B H      1 
ATOM   7354  H  HA     . LEU B 1 171 ? 19.496  22.215 -89.255  1.00 40.45  ? 151 LEU B HA     1 
ATOM   7355  H  HB2    . LEU B 1 171 ? 20.413  23.338 -91.675  1.00 42.62  ? 151 LEU B HB2    1 
ATOM   7356  H  HB3    . LEU B 1 171 ? 18.898  23.365 -91.209  1.00 42.62  ? 151 LEU B HB3    1 
ATOM   7357  H  HG     . LEU B 1 171 ? 20.920  24.704 -89.772  1.00 42.36  ? 151 LEU B HG     1 
ATOM   7358  H  HD11   . LEU B 1 171 ? 20.226  26.696 -90.756  1.00 42.98  ? 151 LEU B HD11   1 
ATOM   7359  H  HD12   . LEU B 1 171 ? 20.788  25.705 -91.862  1.00 42.98  ? 151 LEU B HD12   1 
ATOM   7360  H  HD13   . LEU B 1 171 ? 19.220  25.888 -91.683  1.00 42.98  ? 151 LEU B HD13   1 
ATOM   7361  H  HD21   . LEU B 1 171 ? 19.162  25.829 -88.733  1.00 42.48  ? 151 LEU B HD21   1 
ATOM   7362  H  HD22   . LEU B 1 171 ? 18.120  24.984 -89.584  1.00 42.48  ? 151 LEU B HD22   1 
ATOM   7363  H  HD23   . LEU B 1 171 ? 19.030  24.264 -88.498  1.00 42.48  ? 151 LEU B HD23   1 
ATOM   7364  N  N      . ARG B 1 172 ? 20.586  20.382 -91.644  1.00 39.70  ? 152 ARG B N      1 
ATOM   7365  C  CA     . ARG B 1 172 ? 20.324  19.139 -92.363  1.00 39.87  ? 152 ARG B CA     1 
ATOM   7366  C  C      . ARG B 1 172 ? 20.030  17.998 -91.396  1.00 34.61  ? 152 ARG B C      1 
ATOM   7367  O  O      . ARG B 1 172 ? 19.087  17.226 -91.601  1.00 35.68  ? 152 ARG B O      1 
ATOM   7368  C  CB     . ARG B 1 172 ? 21.509  18.795 -93.266  1.00 40.94  ? 152 ARG B CB     1 
ATOM   7369  C  CG     . ARG B 1 172 ? 21.308  17.540 -94.109  1.00 42.50  ? 152 ARG B CG     1 
ATOM   7370  C  CD     . ARG B 1 172 ? 22.545  17.223 -94.936  1.00 44.78  ? 152 ARG B CD     1 
ATOM   7371  N  NE     . ARG B 1 172 ? 22.390  16.000 -95.722  1.00 47.50  ? 152 ARG B NE     1 
ATOM   7372  C  CZ     . ARG B 1 172 ? 21.957  15.949 -96.980  1.00 52.34  ? 152 ARG B CZ     1 
ATOM   7373  N  NH1    . ARG B 1 172 ? 21.619  17.055 -97.628  1.00 53.23  ? 152 ARG B NH1    1 
ATOM   7374  N  NH2    . ARG B 1 172 ? 21.857  14.778 -97.594  1.00 56.73  ? 152 ARG B NH2    1 
ATOM   7375  H  H      . ARG B 1 172 ? 21.344  20.746 -91.825  1.00 47.75  ? 152 ARG B H      1 
ATOM   7376  H  HA     . ARG B 1 172 ? 19.544  19.261 -92.927  1.00 47.96  ? 152 ARG B HA     1 
ATOM   7377  H  HB2    . ARG B 1 172 ? 21.665  19.536 -93.872  1.00 49.25  ? 152 ARG B HB2    1 
ATOM   7378  H  HB3    . ARG B 1 172 ? 22.293  18.655 -92.711  1.00 49.25  ? 152 ARG B HB3    1 
ATOM   7379  H  HG2    . ARG B 1 172 ? 21.131  16.786 -93.525  1.00 51.12  ? 152 ARG B HG2    1 
ATOM   7380  H  HG3    . ARG B 1 172 ? 20.564  17.677 -94.716  1.00 51.12  ? 152 ARG B HG3    1 
ATOM   7381  H  HD2    . ARG B 1 172 ? 22.714  17.956 -95.548  1.00 53.86  ? 152 ARG B HD2    1 
ATOM   7382  H  HD3    . ARG B 1 172 ? 23.303  17.104 -94.341  1.00 53.86  ? 152 ARG B HD3    1 
ATOM   7383  H  HE     . ARG B 1 172 ? 22.594  15.256 -95.343  1.00 57.12  ? 152 ARG B HE     1 
ATOM   7384  H  HH11   . ARG B 1 172 ? 21.681  17.819 -97.237  1.00 63.99  ? 152 ARG B HH11   1 
ATOM   7385  H  HH12   . ARG B 1 172 ? 21.340  17.009 -98.440  1.00 63.99  ? 152 ARG B HH12   1 
ATOM   7386  H  HH21   . ARG B 1 172 ? 22.074  14.056 -97.180  1.00 68.20  ? 152 ARG B HH21   1 
ATOM   7387  H  HH22   . ARG B 1 172 ? 21.577  14.740 -98.406  1.00 68.20  ? 152 ARG B HH22   1 
ATOM   7388  N  N      . ALA B 1 173 ? 20.831  17.870 -90.337  1.00 28.47  ? 153 ALA B N      1 
ATOM   7389  C  CA     . ALA B 1 173 ? 20.582  16.822 -89.350  1.00 29.12  ? 153 ALA B CA     1 
ATOM   7390  C  C      . ALA B 1 173 ? 19.221  17.011 -88.689  1.00 33.35  ? 153 ALA B C      1 
ATOM   7391  O  O      . ALA B 1 173 ? 18.408  16.073 -88.617  1.00 33.44  ? 153 ALA B O      1 
ATOM   7392  C  CB     . ALA B 1 173 ? 21.695  16.821 -88.301  1.00 26.72  ? 153 ALA B CB     1 
ATOM   7393  H  H      . ALA B 1 173 ? 21.512  18.367 -90.170  1.00 34.28  ? 153 ALA B H      1 
ATOM   7394  H  HA     . ALA B 1 173 ? 20.585  15.960 -89.794  1.00 35.07  ? 153 ALA B HA     1 
ATOM   7395  H  HB1    . ALA B 1 173 ? 21.517  16.122 -87.653  1.00 32.19  ? 153 ALA B HB1    1 
ATOM   7396  H  HB2    . ALA B 1 173 ? 22.543  16.657 -88.742  1.00 32.19  ? 153 ALA B HB2    1 
ATOM   7397  H  HB3    . ALA B 1 173 ? 21.713  17.685 -87.860  1.00 32.19  ? 153 ALA B HB3    1 
ATOM   7398  N  N      . TYR B 1 174 ? 18.945  18.235 -88.222  1.00 34.54  ? 154 TYR B N      1 
ATOM   7399  C  CA     . TYR B 1 174 ? 17.657  18.512 -87.595  1.00 33.42  ? 154 TYR B CA     1 
ATOM   7400  C  C      . TYR B 1 174 ? 16.506  18.048 -88.480  1.00 35.56  ? 154 TYR B C      1 
ATOM   7401  O  O      . TYR B 1 174 ? 15.573  17.388 -88.009  1.00 31.72  ? 154 TYR B O      1 
ATOM   7402  C  CB     . TYR B 1 174 ? 17.528  20.006 -87.284  1.00 31.42  ? 154 TYR B CB     1 
ATOM   7403  C  CG     . TYR B 1 174 ? 17.984  20.390 -85.895  1.00 30.98  ? 154 TYR B CG     1 
ATOM   7404  C  CD1    . TYR B 1 174 ? 17.428  19.792 -84.770  1.00 30.43  ? 154 TYR B CD1    1 
ATOM   7405  C  CD2    . TYR B 1 174 ? 18.966  21.354 -85.705  1.00 30.73  ? 154 TYR B CD2    1 
ATOM   7406  C  CE1    . TYR B 1 174 ? 17.839  20.139 -83.498  1.00 28.94  ? 154 TYR B CE1    1 
ATOM   7407  C  CE2    . TYR B 1 174 ? 19.384  21.707 -84.436  1.00 29.97  ? 154 TYR B CE2    1 
ATOM   7408  C  CZ     . TYR B 1 174 ? 18.817  21.097 -83.337  1.00 28.05  ? 154 TYR B CZ     1 
ATOM   7409  O  OH     . TYR B 1 174 ? 19.232  21.449 -82.073  1.00 24.96  ? 154 TYR B OH     1 
ATOM   7410  H  H      . TYR B 1 174 ? 19.479  18.908 -88.257  1.00 41.57  ? 154 TYR B H      1 
ATOM   7411  H  HA     . TYR B 1 174 ? 17.603  18.026 -86.757  1.00 40.22  ? 154 TYR B HA     1 
ATOM   7412  H  HB2    . TYR B 1 174 ? 18.065  20.503 -87.920  1.00 37.82  ? 154 TYR B HB2    1 
ATOM   7413  H  HB3    . TYR B 1 174 ? 16.596  20.262 -87.371  1.00 37.82  ? 154 TYR B HB3    1 
ATOM   7414  H  HD1    . TYR B 1 174 ? 16.768  19.145 -84.876  1.00 36.63  ? 154 TYR B HD1    1 
ATOM   7415  H  HD2    . TYR B 1 174 ? 19.351  21.767 -86.445  1.00 36.99  ? 154 TYR B HD2    1 
ATOM   7416  H  HE1    . TYR B 1 174 ? 17.459  19.729 -82.755  1.00 34.85  ? 154 TYR B HE1    1 
ATOM   7417  H  HE2    . TYR B 1 174 ? 20.043  22.353 -84.324  1.00 36.08  ? 154 TYR B HE2    1 
ATOM   7418  H  HH     . TYR B 1 174 ? 18.810  21.005 -81.499  1.00 30.06  ? 154 TYR B HH     1 
ATOM   7419  N  N      . PHE B 1 175 ? 16.556  18.380 -89.772  1.00 40.90  ? 155 PHE B N      1 
ATOM   7420  C  CA     . PHE B 1 175 ? 15.476  17.978 -90.665  1.00 42.77  ? 155 PHE B CA     1 
ATOM   7421  C  C      . PHE B 1 175 ? 15.503  16.487 -90.968  1.00 45.34  ? 155 PHE B C      1 
ATOM   7422  O  O      . PHE B 1 175 ? 14.460  15.915 -91.301  1.00 44.81  ? 155 PHE B O      1 
ATOM   7423  C  CB     . PHE B 1 175 ? 15.534  18.783 -91.962  1.00 39.64  ? 155 PHE B CB     1 
ATOM   7424  C  CG     . PHE B 1 175 ? 14.969  20.167 -91.832  1.00 39.76  ? 155 PHE B CG     1 
ATOM   7425  C  CD1    . PHE B 1 175 ? 13.620  20.353 -91.580  1.00 39.03  ? 155 PHE B CD1    1 
ATOM   7426  C  CD2    . PHE B 1 175 ? 15.783  21.279 -91.951  1.00 39.78  ? 155 PHE B CD2    1 
ATOM   7427  C  CE1    . PHE B 1 175 ? 13.091  21.620 -91.454  1.00 36.41  ? 155 PHE B CE1    1 
ATOM   7428  C  CE2    . PHE B 1 175 ? 15.259  22.551 -91.826  1.00 38.36  ? 155 PHE B CE2    1 
ATOM   7429  C  CZ     . PHE B 1 175 ? 13.911  22.721 -91.576  1.00 36.40  ? 155 PHE B CZ     1 
ATOM   7430  H  H      . PHE B 1 175 ? 17.189  18.827 -90.146  1.00 49.20  ? 155 PHE B H      1 
ATOM   7431  H  HA     . PHE B 1 175 ? 14.629  18.175 -90.235  1.00 51.44  ? 155 PHE B HA     1 
ATOM   7432  H  HB2    . PHE B 1 175 ? 16.460  18.865 -92.240  1.00 47.69  ? 155 PHE B HB2    1 
ATOM   7433  H  HB3    . PHE B 1 175 ? 15.025  18.317 -92.644  1.00 47.69  ? 155 PHE B HB3    1 
ATOM   7434  H  HD1    . PHE B 1 175 ? 13.063  19.613 -91.496  1.00 46.96  ? 155 PHE B HD1    1 
ATOM   7435  H  HD2    . PHE B 1 175 ? 16.691  21.170 -92.119  1.00 47.85  ? 155 PHE B HD2    1 
ATOM   7436  H  HE1    . PHE B 1 175 ? 12.183  21.732 -91.287  1.00 43.81  ? 155 PHE B HE1    1 
ATOM   7437  H  HE2    . PHE B 1 175 ? 15.814  23.293 -91.909  1.00 46.15  ? 155 PHE B HE2    1 
ATOM   7438  H  HZ     . PHE B 1 175 ? 13.557  23.577 -91.493  1.00 43.80  ? 155 PHE B HZ     1 
ATOM   7439  N  N      . GLU B 1 176 ? 16.667  15.844 -90.862  1.00 44.53  ? 156 GLU B N      1 
ATOM   7440  C  CA     . GLU B 1 176 ? 16.714  14.395 -91.010  1.00 44.01  ? 156 GLU B CA     1 
ATOM   7441  C  C      . GLU B 1 176 ? 15.991  13.706 -89.863  1.00 40.26  ? 156 GLU B C      1 
ATOM   7442  O  O      . GLU B 1 176 ? 15.485  12.591 -90.035  1.00 36.67  ? 156 GLU B O      1 
ATOM   7443  C  CB     . GLU B 1 176 ? 18.165  13.923 -91.096  1.00 46.11  ? 156 GLU B CB     1 
ATOM   7444  C  CG     . GLU B 1 176 ? 18.787  14.115 -92.472  1.00 49.03  ? 156 GLU B CG     1 
ATOM   7445  C  CD     . GLU B 1 176 ? 20.227  13.646 -92.540  1.00 52.74  ? 156 GLU B CD     1 
ATOM   7446  O  OE1    . GLU B 1 176 ? 20.950  13.789 -91.530  1.00 54.34  ? 156 GLU B OE1    1 
ATOM   7447  O  OE2    . GLU B 1 176 ? 20.641  13.143 -93.606  1.00 54.63  ? 156 GLU B OE2    1 
ATOM   7448  H  H      . GLU B 1 176 ? 17.426  16.216 -90.708  1.00 53.56  ? 156 GLU B H      1 
ATOM   7449  H  HA     . GLU B 1 176 ? 16.269  14.148 -91.836  1.00 52.94  ? 156 GLU B HA     1 
ATOM   7450  H  HB2    . GLU B 1 176 ? 18.696  14.423 -90.457  1.00 55.45  ? 156 GLU B HB2    1 
ATOM   7451  H  HB3    . GLU B 1 176 ? 18.200  12.977 -90.884  1.00 55.45  ? 156 GLU B HB3    1 
ATOM   7452  H  HG2    . GLU B 1 176 ? 18.276  13.609 -93.123  1.00 58.96  ? 156 GLU B HG2    1 
ATOM   7453  H  HG3    . GLU B 1 176 ? 18.769  15.058 -92.698  1.00 58.96  ? 156 GLU B HG3    1 
ATOM   7454  N  N      . GLN B 1 177 ? 15.923  14.348 -88.691  1.00 38.29  ? 157 GLN B N      1 
ATOM   7455  C  CA     . GLN B 1 177 ? 15.121  13.782 -87.607  1.00 34.11  ? 157 GLN B CA     1 
ATOM   7456  C  C      . GLN B 1 177 ? 13.651  13.633 -87.995  1.00 31.57  ? 157 GLN B C      1 
ATOM   7457  O  O      . GLN B 1 177 ? 12.985  12.699 -87.537  1.00 26.69  ? 157 GLN B O      1 
ATOM   7458  C  CB     . GLN B 1 177 ? 15.233  14.634 -86.342  1.00 33.43  ? 157 GLN B CB     1 
ATOM   7459  C  CG     . GLN B 1 177 ? 16.563  14.526 -85.617  1.00 35.12  ? 157 GLN B CG     1 
ATOM   7460  C  CD     . GLN B 1 177 ? 16.556  15.272 -84.295  1.00 36.43  ? 157 GLN B CD     1 
ATOM   7461  O  OE1    . GLN B 1 177 ? 15.496  15.611 -83.768  1.00 36.90  ? 157 GLN B OE1    1 
ATOM   7462  N  NE2    . GLN B 1 177 ? 17.738  15.527 -83.750  1.00 36.29  ? 157 GLN B NE2    1 
ATOM   7463  H  H      . GLN B 1 177 ? 16.319  15.088 -88.505  1.00 46.07  ? 157 GLN B H      1 
ATOM   7464  H  HA     . GLN B 1 177 ? 15.461  12.898 -87.398  1.00 41.05  ? 157 GLN B HA     1 
ATOM   7465  H  HB2    . GLN B 1 177 ? 15.105  15.565 -86.583  1.00 40.24  ? 157 GLN B HB2    1 
ATOM   7466  H  HB3    . GLN B 1 177 ? 14.538  14.360 -85.722  1.00 40.24  ? 157 GLN B HB3    1 
ATOM   7467  H  HG2    . GLN B 1 177 ? 16.752  13.592 -85.435  1.00 42.26  ? 157 GLN B HG2    1 
ATOM   7468  H  HG3    . GLN B 1 177 ? 17.260  14.906 -86.174  1.00 42.26  ? 157 GLN B HG3    1 
ATOM   7469  H  HE21   . GLN B 1 177 ? 18.458  15.272 -84.145  1.00 43.67  ? 157 GLN B HE21   1 
ATOM   7470  H  HE22   . GLN B 1 177 ? 17.785  15.947 -83.001  1.00 43.67  ? 157 GLN B HE22   1 
ATOM   7471  N  N      . ASN B 1 178 ? 13.120  14.539 -88.816  1.00 38.87  ? 158 ASN B N      1 
ATOM   7472  C  CA     . ASN B 1 178 ? 11.690  14.552 -89.140  1.00 41.62  ? 158 ASN B CA     1 
ATOM   7473  C  C      . ASN B 1 178 ? 11.501  15.075 -90.559  1.00 46.46  ? 158 ASN B C      1 
ATOM   7474  O  O      . ASN B 1 178 ? 11.213  16.259 -90.774  1.00 45.20  ? 158 ASN B O      1 
ATOM   7475  C  CB     . ASN B 1 178 ? 10.912  15.402 -88.134  1.00 39.26  ? 158 ASN B CB     1 
ATOM   7476  C  CG     . ASN B 1 178 ? 9.431   15.073 -88.110  1.00 41.38  ? 158 ASN B CG     1 
ATOM   7477  O  OD1    . ASN B 1 178 ? 8.871   14.597 -89.097  1.00 45.80  ? 158 ASN B OD1    1 
ATOM   7478  N  ND2    . ASN B 1 178 ? 8.789   15.322 -86.973  1.00 40.06  ? 158 ASN B ND2    1 
ATOM   7479  H  H      . ASN B 1 178 ? 13.569  15.162 -89.202  1.00 46.77  ? 158 ASN B H      1 
ATOM   7480  H  HA     . ASN B 1 178 ? 11.346  13.646 -89.102  1.00 50.06  ? 158 ASN B HA     1 
ATOM   7481  H  HB2    . ASN B 1 178 ? 11.268  15.246 -87.246  1.00 47.23  ? 158 ASN B HB2    1 
ATOM   7482  H  HB3    . ASN B 1 178 ? 11.007  16.338 -88.370  1.00 47.23  ? 158 ASN B HB3    1 
ATOM   7483  H  HD21   . ASN B 1 178 ? 7.949   15.154 -86.908  1.00 48.19  ? 158 ASN B HD21   1 
ATOM   7484  H  HD22   . ASN B 1 178 ? 9.215   15.652 -86.303  1.00 48.19  ? 158 ASN B HD22   1 
ATOM   7485  N  N      . PRO B 1 179 ? 11.648  14.209 -91.561  1.00 51.61  ? 159 PRO B N      1 
ATOM   7486  C  CA     . PRO B 1 179 ? 11.692  14.677 -92.958  1.00 56.02  ? 159 PRO B CA     1 
ATOM   7487  C  C      . PRO B 1 179 ? 10.472  15.499 -93.341  1.00 58.59  ? 159 PRO B C      1 
ATOM   7488  O  O      . PRO B 1 179 ? 10.622  16.594 -93.904  1.00 62.82  ? 159 PRO B O      1 
ATOM   7489  C  CB     . PRO B 1 179 ? 11.761  13.372 -93.765  1.00 54.30  ? 159 PRO B CB     1 
ATOM   7490  C  CG     . PRO B 1 179 ? 12.358  12.383 -92.833  1.00 50.35  ? 159 PRO B CG     1 
ATOM   7491  C  CD     . PRO B 1 179 ? 11.886  12.757 -91.460  1.00 49.88  ? 159 PRO B CD     1 
ATOM   7492  H  HA     . PRO B 1 179 ? 12.496  15.197 -93.116  1.00 67.34  ? 159 PRO B HA     1 
ATOM   7493  H  HB2    . PRO B 1 179 ? 10.868  13.101 -94.029  1.00 65.28  ? 159 PRO B HB2    1 
ATOM   7494  H  HB3    . PRO B 1 179 ? 12.327  13.497 -94.543  1.00 65.28  ? 159 PRO B HB3    1 
ATOM   7495  H  HG2    . PRO B 1 179 ? 12.051  11.493 -93.067  1.00 60.54  ? 159 PRO B HG2    1 
ATOM   7496  H  HG3    . PRO B 1 179 ? 13.325  12.433 -92.885  1.00 60.54  ? 159 PRO B HG3    1 
ATOM   7497  H  HD2    . PRO B 1 179 ? 11.062  12.293 -91.248  1.00 59.97  ? 159 PRO B HD2    1 
ATOM   7498  H  HD3    . PRO B 1 179 ? 12.577  12.573 -90.804  1.00 59.97  ? 159 PRO B HD3    1 
ATOM   7499  N  N      . PRO B 1 180 ? 9.248   15.024 -93.068  1.00 51.26  ? 160 PRO B N      1 
ATOM   7500  C  CA     . PRO B 1 180 ? 8.076   15.778 -93.550  1.00 45.50  ? 160 PRO B CA     1 
ATOM   7501  C  C      . PRO B 1 180 ? 8.048   17.224 -93.089  1.00 41.74  ? 160 PRO B C      1 
ATOM   7502  O  O      . PRO B 1 180 ? 7.534   18.086 -93.816  1.00 41.97  ? 160 PRO B O      1 
ATOM   7503  C  CB     . PRO B 1 180 ? 6.883   14.979 -93.002  1.00 44.75  ? 160 PRO B CB     1 
ATOM   7504  C  CG     . PRO B 1 180 ? 7.436   14.110 -91.944  1.00 44.85  ? 160 PRO B CG     1 
ATOM   7505  C  CD     . PRO B 1 180 ? 8.841   13.815 -92.328  1.00 48.01  ? 160 PRO B CD     1 
ATOM   7506  H  HA     . PRO B 1 180 ? 8.047   15.758 -94.520  1.00 54.72  ? 160 PRO B HA     1 
ATOM   7507  H  HB2    . PRO B 1 180 ? 6.225   15.589 -92.634  1.00 53.82  ? 160 PRO B HB2    1 
ATOM   7508  H  HB3    . PRO B 1 180 ? 6.495   14.446 -93.713  1.00 53.82  ? 160 PRO B HB3    1 
ATOM   7509  H  HG2    . PRO B 1 180 ? 7.408   14.578 -91.095  1.00 53.94  ? 160 PRO B HG2    1 
ATOM   7510  H  HG3    . PRO B 1 180 ? 6.918   13.291 -91.896  1.00 53.94  ? 160 PRO B HG3    1 
ATOM   7511  H  HD2    . PRO B 1 180 ? 9.391   13.700 -91.538  1.00 57.73  ? 160 PRO B HD2    1 
ATOM   7512  H  HD3    . PRO B 1 180 ? 8.878   13.037 -92.906  1.00 57.73  ? 160 PRO B HD3    1 
ATOM   7513  N  N      . CYS B 1 181 ? 8.599   17.522 -91.908  1.00 41.16  ? 161 CYS B N      1 
ATOM   7514  C  CA     . CYS B 1 181 ? 8.597   18.895 -91.412  1.00 42.82  ? 161 CYS B CA     1 
ATOM   7515  C  C      . CYS B 1 181 ? 9.181   19.864 -92.430  1.00 45.92  ? 161 CYS B C      1 
ATOM   7516  O  O      . CYS B 1 181 ? 8.827   21.051 -92.433  1.00 48.77  ? 161 CYS B O      1 
ATOM   7517  C  CB     . CYS B 1 181 ? 9.376   18.978 -90.099  1.00 41.64  ? 161 CYS B CB     1 
ATOM   7518  S  SG     . CYS B 1 181 ? 8.501   18.280 -88.678  1.00 41.03  ? 161 CYS B SG     1 
ATOM   7519  H  H      . CYS B 1 181 ? 8.975   16.954 -91.384  1.00 49.51  ? 161 CYS B H      1 
ATOM   7520  H  HA     . CYS B 1 181 ? 7.682   19.164 -91.235  1.00 51.50  ? 161 CYS B HA     1 
ATOM   7521  H  HB2    . CYS B 1 181 ? 10.210  18.493 -90.200  1.00 50.09  ? 161 CYS B HB2    1 
ATOM   7522  H  HB3    . CYS B 1 181 ? 9.560   19.910 -89.904  1.00 50.09  ? 161 CYS B HB3    1 
ATOM   7523  H  HG     . CYS B 1 181 ? 9.190   18.392 -87.701  1.00 49.35  ? 161 CYS B HG     1 
ATOM   7524  N  N      . ARG B 1 182 ? 10.064  19.379 -93.309  1.00 44.79  ? 162 ARG B N      1 
ATOM   7525  C  CA     . ARG B 1 182 ? 10.611  20.216 -94.370  1.00 44.21  ? 162 ARG B CA     1 
ATOM   7526  C  C      . ARG B 1 182 ? 9.522   21.052 -95.027  1.00 50.54  ? 162 ARG B C      1 
ATOM   7527  O  O      . ARG B 1 182 ? 9.672   22.268 -95.194  1.00 53.77  ? 162 ARG B O      1 
ATOM   7528  C  CB     . ARG B 1 182 ? 11.321  19.345 -95.410  1.00 39.17  ? 162 ARG B CB     1 
ATOM   7529  C  CG     . ARG B 1 182 ? 12.699  18.868 -94.979  1.00 38.21  ? 162 ARG B CG     1 
ATOM   7530  C  CD     . ARG B 1 182 ? 13.331  17.951 -96.017  1.00 39.90  ? 162 ARG B CD     1 
ATOM   7531  N  NE     . ARG B 1 182 ? 12.591  16.702 -96.168  1.00 42.71  ? 162 ARG B NE     1 
ATOM   7532  C  CZ     . ARG B 1 182 ? 12.893  15.751 -97.047  1.00 46.09  ? 162 ARG B CZ     1 
ATOM   7533  N  NH1    . ARG B 1 182 ? 13.927  15.896 -97.867  1.00 45.35  ? 162 ARG B NH1    1 
ATOM   7534  N  NH2    . ARG B 1 182 ? 12.158  14.650 -97.108  1.00 49.76  ? 162 ARG B NH2    1 
ATOM   7535  H  H      . ARG B 1 182 ? 10.357  18.571 -93.309  1.00 53.86  ? 162 ARG B H      1 
ATOM   7536  H  HA     . ARG B 1 182 ? 11.266  20.823 -93.989  1.00 53.17  ? 162 ARG B HA     1 
ATOM   7537  H  HB2    . ARG B 1 182 ? 10.777  18.561 -95.584  1.00 47.12  ? 162 ARG B HB2    1 
ATOM   7538  H  HB3    . ARG B 1 182 ? 11.428  19.858 -96.226  1.00 47.12  ? 162 ARG B HB3    1 
ATOM   7539  H  HG2    . ARG B 1 182 ? 13.279  19.635 -94.859  1.00 45.97  ? 162 ARG B HG2    1 
ATOM   7540  H  HG3    . ARG B 1 182 ? 12.620  18.374 -94.148  1.00 45.97  ? 162 ARG B HG3    1 
ATOM   7541  H  HD2    . ARG B 1 182 ? 13.343  18.402 -96.876  1.00 48.00  ? 162 ARG B HD2    1 
ATOM   7542  H  HD3    . ARG B 1 182 ? 14.236  17.735 -95.741  1.00 48.00  ? 162 ARG B HD3    1 
ATOM   7543  H  HE     . ARG B 1 182 ? 11.914  16.573 -95.655  1.00 51.37  ? 162 ARG B HE     1 
ATOM   7544  H  HH11   . ARG B 1 182 ? 14.407  16.608 -97.832  1.00 54.54  ? 162 ARG B HH11   1 
ATOM   7545  H  HH12   . ARG B 1 182 ? 14.117  15.277 -98.434  1.00 54.54  ? 162 ARG B HH12   1 
ATOM   7546  H  HH21   . ARG B 1 182 ? 11.487  14.551 -96.579  1.00 59.83  ? 162 ARG B HH21   1 
ATOM   7547  H  HH22   . ARG B 1 182 ? 12.351  14.034 -97.676  1.00 59.83  ? 162 ARG B HH22   1 
ATOM   7548  N  N      . TRP B 1 183 ? 8.400   20.414 -95.377  1.00 50.58  ? 163 TRP B N      1 
ATOM   7549  C  CA     . TRP B 1 183 ? 7.298   21.127 -96.013  1.00 50.58  ? 163 TRP B CA     1 
ATOM   7550  C  C      . TRP B 1 183 ? 7.035   22.458 -95.322  1.00 44.63  ? 163 TRP B C      1 
ATOM   7551  O  O      . TRP B 1 183 ? 7.106   23.524 -95.948  1.00 46.06  ? 163 TRP B O      1 
ATOM   7552  C  CB     . TRP B 1 183 ? 6.032   20.264 -96.005  1.00 51.90  ? 163 TRP B CB     1 
ATOM   7553  C  CG     . TRP B 1 183 ? 6.031   19.195 -97.045  1.00 53.01  ? 163 TRP B CG     1 
ATOM   7554  C  CD1    . TRP B 1 183 ? 6.007   17.847 -96.839  1.00 55.06  ? 163 TRP B CD1    1 
ATOM   7555  C  CD2    . TRP B 1 183 ? 6.063   19.385 -98.463  1.00 50.79  ? 163 TRP B CD2    1 
ATOM   7556  N  NE1    . TRP B 1 183 ? 6.017   17.185 -98.043  1.00 54.74  ? 163 TRP B NE1    1 
ATOM   7557  C  CE2    . TRP B 1 183 ? 6.052   18.107 -99.056  1.00 51.91  ? 163 TRP B CE2    1 
ATOM   7558  C  CE3    . TRP B 1 183 ? 6.099   20.512 -99.290  1.00 50.82  ? 163 TRP B CE3    1 
ATOM   7559  C  CZ2    . TRP B 1 183 ? 6.076   17.925 -100.437 1.00 52.32  ? 163 TRP B CZ2    1 
ATOM   7560  C  CZ3    . TRP B 1 183 ? 6.122   20.329 -100.660 1.00 52.02  ? 163 TRP B CZ3    1 
ATOM   7561  C  CH2    . TRP B 1 183 ? 6.110   19.046 -101.220 1.00 52.84  ? 163 TRP B CH2    1 
ATOM   7562  H  H      . TRP B 1 183 ? 8.256   19.575 -95.257  1.00 60.82  ? 163 TRP B H      1 
ATOM   7563  H  HA     . TRP B 1 183 ? 7.531   21.309 -96.937  1.00 60.81  ? 163 TRP B HA     1 
ATOM   7564  H  HB2    . TRP B 1 183 ? 5.951   19.836 -95.139  1.00 62.40  ? 163 TRP B HB2    1 
ATOM   7565  H  HB3    . TRP B 1 183 ? 5.264   20.834 -96.164  1.00 62.40  ? 163 TRP B HB3    1 
ATOM   7566  H  HD1    . TRP B 1 183 ? 5.983   17.436 -96.005  1.00 66.18  ? 163 TRP B HD1    1 
ATOM   7567  H  HE1    . TRP B 1 183 ? 6.004   16.331 -98.144  1.00 65.81  ? 163 TRP B HE1    1 
ATOM   7568  H  HE3    . TRP B 1 183 ? 6.107   21.367 -98.925  1.00 61.10  ? 163 TRP B HE3    1 
ATOM   7569  H  HZ2    . TRP B 1 183 ? 6.068   17.074 -100.812 1.00 62.90  ? 163 TRP B HZ2    1 
ATOM   7570  H  HZ3    . TRP B 1 183 ? 6.146   21.071 -101.220 1.00 62.55  ? 163 TRP B HZ3    1 
ATOM   7571  H  HH2    . TRP B 1 183 ? 6.126   18.953 -102.145 1.00 63.53  ? 163 TRP B HH2    1 
ATOM   7572  N  N      . LEU B 1 184 ? 6.761   22.408 -94.016  1.00 35.26  ? 164 LEU B N      1 
ATOM   7573  C  CA     . LEU B 1 184 ? 6.520   23.624 -93.253  1.00 31.65  ? 164 LEU B CA     1 
ATOM   7574  C  C      . LEU B 1 184 ? 7.536   24.694 -93.631  1.00 35.97  ? 164 LEU B C      1 
ATOM   7575  O  O      . LEU B 1 184 ? 7.185   25.734 -94.204  1.00 35.28  ? 164 LEU B O      1 
ATOM   7576  C  CB     . LEU B 1 184 ? 6.580   23.319 -91.752  1.00 30.43  ? 164 LEU B CB     1 
ATOM   7577  C  CG     . LEU B 1 184 ? 6.439   24.510 -90.801  1.00 30.44  ? 164 LEU B CG     1 
ATOM   7578  C  CD1    . LEU B 1 184 ? 5.115   25.231 -91.021  1.00 35.10  ? 164 LEU B CD1    1 
ATOM   7579  C  CD2    . LEU B 1 184 ? 6.576   24.054 -89.358  1.00 26.02  ? 164 LEU B CD2    1 
ATOM   7580  H  H      . LEU B 1 184 ? 6.710   21.684 -93.555  1.00 42.43  ? 164 LEU B H      1 
ATOM   7581  H  HA     . LEU B 1 184 ? 5.634   23.961 -93.460  1.00 38.09  ? 164 LEU B HA     1 
ATOM   7582  H  HB2    . LEU B 1 184 ? 5.866   22.697 -91.541  1.00 36.64  ? 164 LEU B HB2    1 
ATOM   7583  H  HB3    . LEU B 1 184 ? 7.435   22.900 -91.563  1.00 36.64  ? 164 LEU B HB3    1 
ATOM   7584  H  HG     . LEU B 1 184 ? 7.154   25.140 -90.982  1.00 36.65  ? 164 LEU B HG     1 
ATOM   7585  H  HD11   . LEU B 1 184 ? 5.056   25.978 -90.404  1.00 42.23  ? 164 LEU B HD11   1 
ATOM   7586  H  HD12   . LEU B 1 184 ? 5.079   25.553 -91.935  1.00 42.23  ? 164 LEU B HD12   1 
ATOM   7587  H  HD13   . LEU B 1 184 ? 4.387   24.611 -90.859  1.00 42.23  ? 164 LEU B HD13   1 
ATOM   7588  H  HD21   . LEU B 1 184 ? 6.484   24.823 -88.774  1.00 30.63  ? 164 LEU B HD21   1 
ATOM   7589  H  HD22   . LEU B 1 184 ? 5.881   23.406 -89.165  1.00 30.63  ? 164 LEU B HD22   1 
ATOM   7590  H  HD23   . LEU B 1 184 ? 7.450   23.649 -89.237  1.00 30.63  ? 164 LEU B HD23   1 
ATOM   7591  N  N      . SER B 1 185 ? 8.814   24.415 -93.365  1.00 43.07  ? 165 SER B N      1 
ATOM   7592  C  CA     . SER B 1 185 ? 9.871   25.369 -93.680  1.00 47.65  ? 165 SER B CA     1 
ATOM   7593  C  C      . SER B 1 185 ? 9.699   25.915 -95.091  1.00 43.61  ? 165 SER B C      1 
ATOM   7594  O  O      . SER B 1 185 ? 9.570   27.129 -95.293  1.00 44.22  ? 165 SER B O      1 
ATOM   7595  C  CB     . SER B 1 185 ? 11.237  24.699 -93.520  1.00 52.80  ? 165 SER B CB     1 
ATOM   7596  O  OG     . SER B 1 185 ? 12.286  25.630 -93.715  1.00 55.37  ? 165 SER B OG     1 
ATOM   7597  H  H      . SER B 1 185 ? 9.091   23.685 -93.004  1.00 51.81  ? 165 SER B H      1 
ATOM   7598  H  HA     . SER B 1 185 ? 9.824   26.113 -93.059  1.00 57.30  ? 165 SER B HA     1 
ATOM   7599  H  HB2    . SER B 1 185 ? 11.305  24.331 -92.625  1.00 63.48  ? 165 SER B HB2    1 
ATOM   7600  H  HB3    . SER B 1 185 ? 11.319  23.990 -94.177  1.00 63.48  ? 165 SER B HB3    1 
ATOM   7601  H  HG     . SER B 1 185 ? 13.029  25.249 -93.624  1.00 66.57  ? 165 SER B HG     1 
ATOM   7602  N  N      . MET B 1 186 ? 9.647   25.017 -96.077  1.00 40.18  ? 166 MET B N      1 
ATOM   7603  C  CA     . MET B 1 186 ? 9.511   25.440 -97.464  1.00 42.09  ? 166 MET B CA     1 
ATOM   7604  C  C      . MET B 1 186 ? 8.414   26.489 -97.591  1.00 47.22  ? 166 MET B C      1 
ATOM   7605  O  O      . MET B 1 186 ? 8.661   27.619 -98.032  1.00 51.03  ? 166 MET B O      1 
ATOM   7606  C  CB     . MET B 1 186 ? 9.228   24.223 -98.349  1.00 42.93  ? 166 MET B CB     1 
ATOM   7607  C  CG     . MET B 1 186 ? 10.434  23.297 -98.502  1.00 41.78  ? 166 MET B CG     1 
ATOM   7608  S  SD     . MET B 1 186 ? 10.126  21.787 -99.451  1.00 40.49  ? 166 MET B SD     1 
ATOM   7609  C  CE     . MET B 1 186 ? 9.489   22.441 -100.992 1.00 42.18  ? 166 MET B CE     1 
ATOM   7610  H  H      . MET B 1 186 ? 9.688   24.165 -95.967  1.00 48.33  ? 166 MET B H      1 
ATOM   7611  H  HA     . MET B 1 186 ? 10.350  25.830 -97.755  1.00 50.63  ? 166 MET B HA     1 
ATOM   7612  H  HB2    . MET B 1 186 ? 8.505   23.710 -97.956  1.00 51.64  ? 166 MET B HB2    1 
ATOM   7613  H  HB3    . MET B 1 186 ? 8.974   24.529 -99.233  1.00 51.64  ? 166 MET B HB3    1 
ATOM   7614  H  HG2    . MET B 1 186 ? 11.142  23.784 -98.950  1.00 50.26  ? 166 MET B HG2    1 
ATOM   7615  H  HG3    . MET B 1 186 ? 10.731  23.030 -97.618  1.00 50.26  ? 166 MET B HG3    1 
ATOM   7616  H  HE1    . MET B 1 186 ? 9.286   21.703 -101.588 1.00 50.74  ? 166 MET B HE1    1 
ATOM   7617  H  HE2    . MET B 1 186 ? 8.683   22.950 -100.809 1.00 50.74  ? 166 MET B HE2    1 
ATOM   7618  H  HE3    . MET B 1 186 ? 10.160  23.016 -101.392 1.00 50.74  ? 166 MET B HE3    1 
ATOM   7619  N  N      . SER B 1 187 ? 7.205   26.148 -97.139  1.00 48.31  ? 167 SER B N      1 
ATOM   7620  C  CA     . SER B 1 187 ? 6.093   27.087 -97.213  1.00 49.44  ? 167 SER B CA     1 
ATOM   7621  C  C      . SER B 1 187 ? 6.522   28.459 -96.714  1.00 47.21  ? 167 SER B C      1 
ATOM   7622  O  O      . SER B 1 187 ? 6.521   29.443 -97.466  1.00 49.01  ? 167 SER B O      1 
ATOM   7623  C  CB     . SER B 1 187 ? 4.910   26.561 -96.395  1.00 51.42  ? 167 SER B CB     1 
ATOM   7624  O  OG     . SER B 1 187 ? 4.472   25.304 -96.879  1.00 52.10  ? 167 SER B OG     1 
ATOM   7625  H  H      . SER B 1 187 ? 7.007   25.387 -96.789  1.00 58.09  ? 167 SER B H      1 
ATOM   7626  H  HA     . SER B 1 187 ? 5.809   27.174 -98.136  1.00 59.45  ? 167 SER B HA     1 
ATOM   7627  H  HB2    . SER B 1 187 ? 5.186   26.463 -95.471  1.00 61.82  ? 167 SER B HB2    1 
ATOM   7628  H  HB3    . SER B 1 187 ? 4.179   27.194 -96.457  1.00 61.82  ? 167 SER B HB3    1 
ATOM   7629  H  HG     . SER B 1 187 ? 3.824   25.030 -96.420  1.00 62.64  ? 167 SER B HG     1 
ATOM   7630  N  N      . ILE B 1 188 ? 6.966   28.521 -95.456  1.00 41.17  ? 168 ILE B N      1 
ATOM   7631  C  CA     . ILE B 1 188 ? 7.330   29.800 -94.853  1.00 37.72  ? 168 ILE B CA     1 
ATOM   7632  C  C      . ILE B 1 188 ? 8.270   30.561 -95.775  1.00 41.12  ? 168 ILE B C      1 
ATOM   7633  O  O      . ILE B 1 188 ? 8.029   31.727 -96.112  1.00 46.06  ? 168 ILE B O      1 
ATOM   7634  C  CB     . ILE B 1 188 ? 7.953   29.583 -93.461  1.00 35.10  ? 168 ILE B CB     1 
ATOM   7635  C  CG1    . ILE B 1 188 ? 6.991   28.818 -92.544  1.00 31.10  ? 168 ILE B CG1    1 
ATOM   7636  C  CG2    . ILE B 1 188 ? 8.338   30.917 -92.827  1.00 38.20  ? 168 ILE B CG2    1 
ATOM   7637  C  CD1    . ILE B 1 188 ? 5.661   29.514 -92.298  1.00 28.88  ? 168 ILE B CD1    1 
ATOM   7638  H  H      . ILE B 1 188 ? 7.065   27.842 -94.937  1.00 49.52  ? 168 ILE B H      1 
ATOM   7639  H  HA     . ILE B 1 188 ? 6.528   30.333 -94.740  1.00 45.38  ? 168 ILE B HA     1 
ATOM   7640  H  HB     . ILE B 1 188 ? 8.759   29.053 -93.568  1.00 42.23  ? 168 ILE B HB     1 
ATOM   7641  H  HG12   . ILE B 1 188 ? 6.801   27.956 -92.945  1.00 37.44  ? 168 ILE B HG12   1 
ATOM   7642  H  HG13   . ILE B 1 188 ? 7.420   28.690 -91.683  1.00 37.44  ? 168 ILE B HG13   1 
ATOM   7643  H  HG21   . ILE B 1 188 ? 8.727   30.750 -91.954  1.00 45.96  ? 168 ILE B HG21   1 
ATOM   7644  H  HG22   . ILE B 1 188 ? 8.984   31.363 -93.397  1.00 45.96  ? 168 ILE B HG22   1 
ATOM   7645  H  HG23   . ILE B 1 188 ? 7.543   31.464 -92.736  1.00 45.96  ? 168 ILE B HG23   1 
ATOM   7646  H  HD11   . ILE B 1 188 ? 5.121   28.962 -91.712  1.00 34.78  ? 168 ILE B HD11   1 
ATOM   7647  H  HD12   . ILE B 1 188 ? 5.828   30.375 -91.883  1.00 34.78  ? 168 ILE B HD12   1 
ATOM   7648  H  HD13   . ILE B 1 188 ? 5.209   29.638 -93.147  1.00 34.78  ? 168 ILE B HD13   1 
ATOM   7649  N  N      . LYS B 1 189 ? 9.335   29.897 -96.235  1.00 42.67  ? 169 LYS B N      1 
ATOM   7650  C  CA     . LYS B 1 189 ? 10.306  30.582 -97.078  1.00 46.93  ? 169 LYS B CA     1 
ATOM   7651  C  C      . LYS B 1 189 ? 9.605   31.288 -98.229  1.00 47.51  ? 169 LYS B C      1 
ATOM   7652  O  O      . LYS B 1 189 ? 9.736   32.505 -98.406  1.00 50.95  ? 169 LYS B O      1 
ATOM   7653  C  CB     . LYS B 1 189 ? 11.351  29.600 -97.613  1.00 48.00  ? 169 LYS B CB     1 
ATOM   7654  C  CG     . LYS B 1 189 ? 12.496  30.297 -98.348  1.00 48.58  ? 169 LYS B CG     1 
ATOM   7655  C  CD     . LYS B 1 189 ? 13.174  29.407 -99.376  1.00 50.28  ? 169 LYS B CD     1 
ATOM   7656  C  CE     . LYS B 1 189 ? 14.104  28.404 -98.728  1.00 53.55  ? 169 LYS B CE     1 
ATOM   7657  N  NZ     . LYS B 1 189 ? 14.844  27.609 -99.747  1.00 56.87  ? 169 LYS B NZ     1 
ATOM   7658  H  H      . LYS B 1 189 ? 9.512   29.071 -96.076  1.00 51.33  ? 169 LYS B H      1 
ATOM   7659  H  HA     . LYS B 1 189 ? 10.767  31.253 -96.550  1.00 56.44  ? 169 LYS B HA     1 
ATOM   7660  H  HB2    . LYS B 1 189 ? 11.729  29.105 -96.869  1.00 57.71  ? 169 LYS B HB2    1 
ATOM   7661  H  HB3    . LYS B 1 189 ? 10.923  28.990 -98.234  1.00 57.71  ? 169 LYS B HB3    1 
ATOM   7662  H  HG2    . LYS B 1 189 ? 12.146  31.075 -98.810  1.00 58.41  ? 169 LYS B HG2    1 
ATOM   7663  H  HG3    . LYS B 1 189 ? 13.166  30.570 -97.701  1.00 58.41  ? 169 LYS B HG3    1 
ATOM   7664  H  HD2    . LYS B 1 189 ? 12.497  28.918 -99.870  1.00 60.46  ? 169 LYS B HD2    1 
ATOM   7665  H  HD3    . LYS B 1 189 ? 13.696  29.958 -99.981  1.00 60.46  ? 169 LYS B HD3    1 
ATOM   7666  H  HE2    . LYS B 1 189 ? 14.752  28.875 -98.181  1.00 64.37  ? 169 LYS B HE2    1 
ATOM   7667  H  HE3    . LYS B 1 189 ? 13.585  27.792 -98.183  1.00 64.37  ? 169 LYS B HE3    1 
ATOM   7668  H  HZ1    . LYS B 1 189 ? 15.384  27.027 -99.345  1.00 68.36  ? 169 LYS B HZ1    1 
ATOM   7669  H  HZ2    . LYS B 1 189 ? 14.270  27.164 -100.261 1.00 68.36  ? 169 LYS B HZ2    1 
ATOM   7670  H  HZ3    . LYS B 1 189 ? 15.331  28.150 -100.259 1.00 68.36  ? 169 LYS B HZ3    1 
ATOM   7671  N  N      . ARG B 1 190 ? 8.823   30.536 -99.005  1.00 44.76  ? 170 ARG B N      1 
ATOM   7672  C  CA     . ARG B 1 190 ? 8.133   31.136 -100.140 1.00 44.92  ? 170 ARG B CA     1 
ATOM   7673  C  C      . ARG B 1 190 ? 7.307   32.329 -99.681  1.00 45.21  ? 170 ARG B C      1 
ATOM   7674  O  O      . ARG B 1 190 ? 7.392   33.421 -100.256 1.00 42.58  ? 170 ARG B O      1 
ATOM   7675  C  CB     . ARG B 1 190 ? 7.268   30.087 -100.841 1.00 49.62  ? 170 ARG B CB     1 
ATOM   7676  C  CG     . ARG B 1 190 ? 6.739   30.538 -102.190 1.00 54.09  ? 170 ARG B CG     1 
ATOM   7677  C  CD     . ARG B 1 190 ? 6.050   29.404 -102.930 1.00 58.64  ? 170 ARG B CD     1 
ATOM   7678  N  NE     . ARG B 1 190 ? 4.878   28.894 -102.224 1.00 62.90  ? 170 ARG B NE     1 
ATOM   7679  C  CZ     . ARG B 1 190 ? 4.147   27.864 -102.640 1.00 66.71  ? 170 ARG B CZ     1 
ATOM   7680  N  NH1    . ARG B 1 190 ? 4.466   27.225 -103.759 1.00 69.70  ? 170 ARG B NH1    1 
ATOM   7681  N  NH2    . ARG B 1 190 ? 3.095   27.469 -101.936 1.00 66.31  ? 170 ARG B NH2    1 
ATOM   7682  H  H      . ARG B 1 190 ? 8.679   29.695 -98.897  1.00 53.84  ? 170 ARG B H      1 
ATOM   7683  H  HA     . ARG B 1 190 ? 8.792   31.455 -100.776 1.00 54.02  ? 170 ARG B HA     1 
ATOM   7684  H  HB2    . ARG B 1 190 ? 7.799   29.288 -100.982 1.00 59.67  ? 170 ARG B HB2    1 
ATOM   7685  H  HB3    . ARG B 1 190 ? 6.507   29.882 -100.277 1.00 59.67  ? 170 ARG B HB3    1 
ATOM   7686  H  HG2    . ARG B 1 190 ? 6.095   31.251 -102.059 1.00 65.03  ? 170 ARG B HG2    1 
ATOM   7687  H  HG3    . ARG B 1 190 ? 7.478   30.851 -102.735 1.00 65.03  ? 170 ARG B HG3    1 
ATOM   7688  H  HD2    . ARG B 1 190 ? 5.760   29.723 -103.799 1.00 70.48  ? 170 ARG B HD2    1 
ATOM   7689  H  HD3    . ARG B 1 190 ? 6.676   28.671 -103.038 1.00 70.48  ? 170 ARG B HD3    1 
ATOM   7690  H  HE     . ARG B 1 190 ? 4.676   29.252 -101.469 1.00 75.59  ? 170 ARG B HE     1 
ATOM   7691  H  HH11   . ARG B 1 190 ? 5.147   27.478 -104.219 1.00 83.76  ? 170 ARG B HH11   1 
ATOM   7692  H  HH12   . ARG B 1 190 ? 3.991   26.559 -104.024 1.00 83.76  ? 170 ARG B HH12   1 
ATOM   7693  H  HH21   . ARG B 1 190 ? 2.884   27.879 -101.210 1.00 79.69  ? 170 ARG B HH21   1 
ATOM   7694  H  HH22   . ARG B 1 190 ? 2.623   26.802 -102.205 1.00 79.69  ? 170 ARG B HH22   1 
ATOM   7695  N  N      . TRP B 1 191 ? 6.524   32.144 -98.616  1.00 46.02  ? 171 TRP B N      1 
ATOM   7696  C  CA     . TRP B 1 191 ? 5.711   33.235 -98.094  1.00 46.72  ? 171 TRP B CA     1 
ATOM   7697  C  C      . TRP B 1 191 ? 6.570   34.460 -97.803  1.00 44.23  ? 171 TRP B C      1 
ATOM   7698  O  O      . TRP B 1 191 ? 6.223   35.584 -98.185  1.00 38.69  ? 171 TRP B O      1 
ATOM   7699  C  CB     . TRP B 1 191 ? 4.976   32.768 -96.835  1.00 44.85  ? 171 TRP B CB     1 
ATOM   7700  C  CG     . TRP B 1 191 ? 4.306   33.863 -96.069  1.00 42.29  ? 171 TRP B CG     1 
ATOM   7701  C  CD1    . TRP B 1 191 ? 3.142   34.497 -96.391  1.00 40.61  ? 171 TRP B CD1    1 
ATOM   7702  C  CD2    . TRP B 1 191 ? 4.754   34.445 -94.838  1.00 38.03  ? 171 TRP B CD2    1 
ATOM   7703  N  NE1    . TRP B 1 191 ? 2.840   35.443 -95.441  1.00 38.35  ? 171 TRP B NE1    1 
ATOM   7704  C  CE2    . TRP B 1 191 ? 3.814   35.431 -94.477  1.00 36.94  ? 171 TRP B CE2    1 
ATOM   7705  C  CE3    . TRP B 1 191 ? 5.859   34.231 -94.010  1.00 34.01  ? 171 TRP B CE3    1 
ATOM   7706  C  CZ2    . TRP B 1 191 ? 3.945   36.201 -93.323  1.00 34.84  ? 171 TRP B CZ2    1 
ATOM   7707  C  CZ3    . TRP B 1 191 ? 5.988   34.997 -92.864  1.00 33.21  ? 171 TRP B CZ3    1 
ATOM   7708  C  CH2    . TRP B 1 191 ? 5.036   35.970 -92.532  1.00 32.88  ? 171 TRP B CH2    1 
ATOM   7709  H  H      . TRP B 1 191 ? 6.449   31.404 -98.184  1.00 55.35  ? 171 TRP B H      1 
ATOM   7710  H  HA     . TRP B 1 191 ? 5.047   33.482 -98.756  1.00 56.18  ? 171 TRP B HA     1 
ATOM   7711  H  HB2    . TRP B 1 191 ? 4.293   32.129 -97.093  1.00 53.94  ? 171 TRP B HB2    1 
ATOM   7712  H  HB3    . TRP B 1 191 ? 5.615   32.342 -96.243  1.00 53.94  ? 171 TRP B HB3    1 
ATOM   7713  H  HD1    . TRP B 1 191 ? 2.629   34.317 -97.145  1.00 48.85  ? 171 TRP B HD1    1 
ATOM   7714  H  HE1    . TRP B 1 191 ? 2.152   35.958 -95.450  1.00 46.14  ? 171 TRP B HE1    1 
ATOM   7715  H  HE3    . TRP B 1 191 ? 6.495   33.587 -94.224  1.00 40.93  ? 171 TRP B HE3    1 
ATOM   7716  H  HZ2    . TRP B 1 191 ? 3.315   36.847 -93.100  1.00 41.93  ? 171 TRP B HZ2    1 
ATOM   7717  H  HZ3    . TRP B 1 191 ? 6.719   34.864 -92.305  1.00 39.97  ? 171 TRP B HZ3    1 
ATOM   7718  H  HH2    . TRP B 1 191 ? 5.149   36.469 -91.756  1.00 39.58  ? 171 TRP B HH2    1 
ATOM   7719  N  N      . SER B 1 192 ? 7.726   34.252 -97.165  1.00 44.65  ? 172 SER B N      1 
ATOM   7720  C  CA     . SER B 1 192 ? 8.567   35.380 -96.779  1.00 42.98  ? 172 SER B CA     1 
ATOM   7721  C  C      . SER B 1 192 ? 9.037   36.168 -97.994  1.00 46.50  ? 172 SER B C      1 
ATOM   7722  O  O      . SER B 1 192 ? 9.334   37.363 -97.881  1.00 50.80  ? 172 SER B O      1 
ATOM   7723  C  CB     . SER B 1 192 ? 9.767   34.892 -95.967  1.00 37.20  ? 172 SER B CB     1 
ATOM   7724  O  OG     . SER B 1 192 ? 10.717  34.242 -96.793  1.00 36.03  ? 172 SER B OG     1 
ATOM   7725  H  H      . SER B 1 192 ? 8.038   33.480 -96.948  1.00 53.70  ? 172 SER B H      1 
ATOM   7726  H  HA     . SER B 1 192 ? 8.050   35.979 -96.218  1.00 51.70  ? 172 SER B HA     1 
ATOM   7727  H  HB2    . SER B 1 192 ? 10.190  35.655 -95.543  1.00 44.75  ? 172 SER B HB2    1 
ATOM   7728  H  HB3    . SER B 1 192 ? 9.458   34.268 -95.293  1.00 44.75  ? 172 SER B HB3    1 
ATOM   7729  H  HG     . SER B 1 192 ? 10.365  33.578 -97.167  1.00 43.36  ? 172 SER B HG     1 
ATOM   7730  N  N      . LYS B 1 193 ? 9.119   35.523 -99.159  1.00 45.20  ? 173 LYS B N      1 
ATOM   7731  C  CA     . LYS B 1 193 ? 9.532   36.224 -100.367 1.00 45.24  ? 173 LYS B CA     1 
ATOM   7732  C  C      . LYS B 1 193 ? 8.377   36.934 -101.054 1.00 50.07  ? 173 LYS B C      1 
ATOM   7733  O  O      . LYS B 1 193 ? 8.613   37.887 -101.804 1.00 45.41  ? 173 LYS B O      1 
ATOM   7734  C  CB     . LYS B 1 193 ? 10.174  35.245 -101.352 1.00 46.65  ? 173 LYS B CB     1 
ATOM   7735  C  CG     . LYS B 1 193 ? 11.568  34.787 -100.960 1.00 44.97  ? 173 LYS B CG     1 
ATOM   7736  C  CD     . LYS B 1 193 ? 12.039  33.628 -101.826 1.00 43.26  ? 173 LYS B CD     1 
ATOM   7737  C  CE     . LYS B 1 193 ? 13.413  33.142 -101.399 1.00 43.37  ? 173 LYS B CE     1 
ATOM   7738  N  NZ     . LYS B 1 193 ? 13.778  31.850 -102.044 1.00 45.42  ? 173 LYS B NZ     1 
ATOM   7739  H  H      . LYS B 1 193 ? 8.943   34.689 -99.273  1.00 54.36  ? 173 LYS B H      1 
ATOM   7740  H  HA     . LYS B 1 193 ? 10.196  36.891 -100.132 1.00 54.41  ? 173 LYS B HA     1 
ATOM   7741  H  HB2    . LYS B 1 193 ? 9.613   34.457 -101.418 1.00 56.09  ? 173 LYS B HB2    1 
ATOM   7742  H  HB3    . LYS B 1 193 ? 10.238  35.674 -102.220 1.00 56.09  ? 173 LYS B HB3    1 
ATOM   7743  H  HG2    . LYS B 1 193 ? 12.190  35.523 -101.072 1.00 54.08  ? 173 LYS B HG2    1 
ATOM   7744  H  HG3    . LYS B 1 193 ? 11.560  34.492 -100.036 1.00 54.08  ? 173 LYS B HG3    1 
ATOM   7745  H  HD2    . LYS B 1 193 ? 11.415  32.890 -101.740 1.00 52.03  ? 173 LYS B HD2    1 
ATOM   7746  H  HD3    . LYS B 1 193 ? 12.091  33.919 -102.750 1.00 52.03  ? 173 LYS B HD3    1 
ATOM   7747  H  HE2    . LYS B 1 193 ? 14.076  33.803 -101.652 1.00 52.16  ? 173 LYS B HE2    1 
ATOM   7748  H  HE3    . LYS B 1 193 ? 13.420  33.013 -100.438 1.00 52.16  ? 173 LYS B HE3    1 
ATOM   7749  H  HZ1    . LYS B 1 193 ? 14.586  31.593 -101.774 1.00 54.62  ? 173 LYS B HZ1    1 
ATOM   7750  H  HZ2    . LYS B 1 193 ? 13.186  31.222 -101.823 1.00 54.62  ? 173 LYS B HZ2    1 
ATOM   7751  H  HZ3    . LYS B 1 193 ? 13.784  31.943 -102.929 1.00 54.62  ? 173 LYS B HZ3    1 
ATOM   7752  N  N      . GLN B 1 194 ? 7.140   36.500 -100.815 1.00 57.75  ? 174 GLN B N      1 
ATOM   7753  C  CA     . GLN B 1 194 ? 5.990   37.113 -101.462 1.00 61.95  ? 174 GLN B CA     1 
ATOM   7754  C  C      . GLN B 1 194 ? 5.481   38.339 -100.716 1.00 55.89  ? 174 GLN B C      1 
ATOM   7755  O  O      . GLN B 1 194 ? 4.813   39.185 -101.321 1.00 58.83  ? 174 GLN B O      1 
ATOM   7756  C  CB     . GLN B 1 194 ? 4.866   36.084 -101.591 1.00 62.79  ? 174 GLN B CB     1 
ATOM   7757  C  CG     . GLN B 1 194 ? 5.149   35.044 -102.663 1.00 65.28  ? 174 GLN B CG     1 
ATOM   7758  C  CD     . GLN B 1 194 ? 4.094   33.960 -102.733 1.00 68.78  ? 174 GLN B CD     1 
ATOM   7759  O  OE1    . GLN B 1 194 ? 3.250   33.841 -101.845 1.00 71.11  ? 174 GLN B OE1    1 
ATOM   7760  N  NE2    . GLN B 1 194 ? 4.180   33.120 -103.758 1.00 69.57  ? 174 GLN B NE2    1 
ATOM   7761  H  H      . GLN B 1 194 ? 6.944   35.854 -100.283 1.00 69.42  ? 174 GLN B H      1 
ATOM   7762  H  HA     . GLN B 1 194 ? 6.244   37.392 -102.356 1.00 74.45  ? 174 GLN B HA     1 
ATOM   7763  H  HB2    . GLN B 1 194 ? 4.761   35.622 -100.744 1.00 75.46  ? 174 GLN B HB2    1 
ATOM   7764  H  HB3    . GLN B 1 194 ? 4.043   36.541 -101.825 1.00 75.46  ? 174 GLN B HB3    1 
ATOM   7765  H  HG2    . GLN B 1 194 ? 5.183   35.484 -103.527 1.00 78.45  ? 174 GLN B HG2    1 
ATOM   7766  H  HG3    . GLN B 1 194 ? 6.001   34.620 -102.474 1.00 78.45  ? 174 GLN B HG3    1 
ATOM   7767  H  HE21   . GLN B 1 194 ? 4.810   33.210 -104.336 1.00 83.60  ? 174 GLN B HE21   1 
ATOM   7768  H  HE22   . GLN B 1 194 ? 3.605   32.486 -103.843 1.00 83.60  ? 174 GLN B HE22   1 
ATOM   7769  N  N      . THR B 1 195 ? 5.785   38.453 -99.422  1.00 47.35  ? 175 THR B N      1 
ATOM   7770  C  CA     . THR B 1 195 ? 5.338   39.569 -98.599  1.00 45.99  ? 175 THR B CA     1 
ATOM   7771  C  C      . THR B 1 195 ? 6.378   40.674 -98.477  1.00 48.54  ? 175 THR B C      1 
ATOM   7772  O  O      . THR B 1 195 ? 6.054   41.752 -97.969  1.00 43.97  ? 175 THR B O      1 
ATOM   7773  C  CB     . THR B 1 195 ? 4.971   39.078 -97.192  1.00 50.40  ? 175 THR B CB     1 
ATOM   7774  O  OG1    . THR B 1 195 ? 6.100   38.419 -96.603  1.00 52.48  ? 175 THR B OG1    1 
ATOM   7775  C  CG2    . THR B 1 195 ? 3.793   38.116 -97.242  1.00 51.56  ? 175 THR B CG2    1 
ATOM   7776  H  H      . THR B 1 195 ? 6.260   37.881 -98.991  1.00 56.94  ? 175 THR B H      1 
ATOM   7777  H  HA     . THR B 1 195 ? 4.541   39.953 -98.998  1.00 55.31  ? 175 THR B HA     1 
ATOM   7778  H  HB     . THR B 1 195 ? 4.721   39.837 -96.642  1.00 60.60  ? 175 THR B HB     1 
ATOM   7779  H  HG1    . THR B 1 195 ? 5.905   38.148 -95.832  1.00 63.09  ? 175 THR B HG1    1 
ATOM   7780  H  HG21   . THR B 1 195 ? 3.574   37.815 -96.346  1.00 61.99  ? 175 THR B HG21   1 
ATOM   7781  H  HG22   . THR B 1 195 ? 3.020   38.560 -97.624  1.00 61.99  ? 175 THR B HG22   1 
ATOM   7782  H  HG23   . THR B 1 195 ? 4.017   37.346 -97.788  1.00 61.99  ? 175 THR B HG23   1 
ATOM   7783  N  N      . GLY B 1 196 ? 7.610   40.434 -98.917  1.00 59.26  ? 176 GLY B N      1 
ATOM   7784  C  CA     . GLY B 1 196 ? 8.668   41.416 -98.819  1.00 62.83  ? 176 GLY B CA     1 
ATOM   7785  C  C      . GLY B 1 196 ? 9.511   41.332 -97.567  1.00 60.34  ? 176 GLY B C      1 
ATOM   7786  O  O      . GLY B 1 196 ? 10.370  42.197 -97.360  1.00 68.16  ? 176 GLY B O      1 
ATOM   7787  H  H      . GLY B 1 196 ? 7.856   39.695 -99.282  1.00 71.23  ? 176 GLY B H      1 
ATOM   7788  H  HA2    . GLY B 1 196 ? 9.259   41.319 -99.582  1.00 75.52  ? 176 GLY B HA2    1 
ATOM   7789  H  HA3    . GLY B 1 196 ? 8.277   42.303 -98.855  1.00 75.52  ? 176 GLY B HA3    1 
ATOM   7790  N  N      . LEU B 1 197 ? 9.298   40.320 -96.723  1.00 45.69  ? 177 LEU B N      1 
ATOM   7791  C  CA     . LEU B 1 197 ? 10.097  40.176 -95.512  1.00 37.77  ? 177 LEU B CA     1 
ATOM   7792  C  C      . LEU B 1 197 ? 11.476  39.598 -95.799  1.00 33.48  ? 177 LEU B C      1 
ATOM   7793  O  O      . LEU B 1 197 ? 12.441  39.954 -95.115  1.00 32.25  ? 177 LEU B O      1 
ATOM   7794  C  CB     . LEU B 1 197 ? 9.357   39.302 -94.500  1.00 39.99  ? 177 LEU B CB     1 
ATOM   7795  C  CG     . LEU B 1 197 ? 8.026   39.872 -94.008  1.00 45.32  ? 177 LEU B CG     1 
ATOM   7796  C  CD1    . LEU B 1 197 ? 7.255   38.835 -93.211  1.00 46.33  ? 177 LEU B CD1    1 
ATOM   7797  C  CD2    . LEU B 1 197 ? 8.262   41.119 -93.164  1.00 47.52  ? 177 LEU B CD2    1 
ATOM   7798  H  H      . LEU B 1 197 ? 8.701   39.711 -96.830  1.00 54.94  ? 177 LEU B H      1 
ATOM   7799  H  HA     . LEU B 1 197 ? 10.220  41.052 -95.114  1.00 45.45  ? 177 LEU B HA     1 
ATOM   7800  H  HB2    . LEU B 1 197 ? 9.174   38.442 -94.909  1.00 48.10  ? 177 LEU B HB2    1 
ATOM   7801  H  HB3    . LEU B 1 197 ? 9.926   39.178 -93.724  1.00 48.10  ? 177 LEU B HB3    1 
ATOM   7802  H  HG     . LEU B 1 197 ? 7.487   40.125 -94.774  1.00 54.50  ? 177 LEU B HG     1 
ATOM   7803  H  HD11   . LEU B 1 197 ? 6.418   39.224 -92.913  1.00 55.71  ? 177 LEU B HD11   1 
ATOM   7804  H  HD12   . LEU B 1 197 ? 7.081   38.068 -93.778  1.00 55.71  ? 177 LEU B HD12   1 
ATOM   7805  H  HD13   . LEU B 1 197 ? 7.787   38.567 -92.445  1.00 55.71  ? 177 LEU B HD13   1 
ATOM   7806  H  HD21   . LEU B 1 197 ? 7.407   41.463 -92.863  1.00 57.15  ? 177 LEU B HD21   1 
ATOM   7807  H  HD22   . LEU B 1 197 ? 8.811   40.883 -92.400  1.00 57.15  ? 177 LEU B HD22   1 
ATOM   7808  H  HD23   . LEU B 1 197 ? 8.716   41.784 -93.705  1.00 57.15  ? 177 LEU B HD23   1 
ATOM   7809  N  N      . ASN B 1 198 ? 11.593  38.717 -96.789  1.00 33.10  ? 178 ASN B N      1 
ATOM   7810  C  CA     . ASN B 1 198 ? 12.881  38.106 -97.083  1.00 34.31  ? 178 ASN B CA     1 
ATOM   7811  C  C      . ASN B 1 198 ? 13.858  39.162 -97.581  1.00 37.70  ? 178 ASN B C      1 
ATOM   7812  O  O      . ASN B 1 198 ? 13.510  40.019 -98.396  1.00 42.26  ? 178 ASN B O      1 
ATOM   7813  C  CB     . ASN B 1 198 ? 12.730  37.004 -98.130  1.00 34.06  ? 178 ASN B CB     1 
ATOM   7814  C  CG     . ASN B 1 198 ? 13.955  36.111 -98.215  1.00 32.79  ? 178 ASN B CG     1 
ATOM   7815  O  OD1    . ASN B 1 198 ? 15.000  36.519 -98.723  1.00 31.64  ? 178 ASN B OD1    1 
ATOM   7816  N  ND2    . ASN B 1 198 ? 13.830  34.883 -97.727  1.00 32.11  ? 178 ASN B ND2    1 
ATOM   7817  H  H      . ASN B 1 198 ? 10.950  38.460 -97.299  1.00 39.84  ? 178 ASN B H      1 
ATOM   7818  H  HA     . ASN B 1 198 ? 13.243  37.712 -96.273  1.00 41.29  ? 178 ASN B HA     1 
ATOM   7819  H  HB2    . ASN B 1 198 ? 11.969  36.449 -97.898  1.00 40.99  ? 178 ASN B HB2    1 
ATOM   7820  H  HB3    . ASN B 1 198 ? 12.593  37.410 -99.000  1.00 40.99  ? 178 ASN B HB3    1 
ATOM   7821  H  HD21   . ASN B 1 198 ? 14.496  34.340 -97.752  1.00 38.64  ? 178 ASN B HD21   1 
ATOM   7822  H  HD22   . ASN B 1 198 ? 13.082  34.631 -97.385  1.00 38.64  ? 178 ASN B HD22   1 
ATOM   7823  N  N      . ALA B 1 199 ? 15.095  39.094 -97.085  1.00 36.48  ? 179 ALA B N      1 
ATOM   7824  C  CA     . ALA B 1 199 ? 16.115  40.066 -97.456  1.00 35.90  ? 179 ALA B CA     1 
ATOM   7825  C  C      . ALA B 1 199 ? 16.498  39.992 -98.929  1.00 44.01  ? 179 ALA B C      1 
ATOM   7826  O  O      . ALA B 1 199 ? 17.253  40.852 -99.395  1.00 42.44  ? 179 ALA B O      1 
ATOM   7827  C  CB     . ALA B 1 199 ? 17.359  39.869 -96.590  1.00 31.36  ? 179 ALA B CB     1 
ATOM   7828  H  H      . ALA B 1 199 ? 15.365  38.493 -96.532  1.00 43.90  ? 179 ALA B H      1 
ATOM   7829  H  HA     . ALA B 1 199 ? 15.773  40.957 -97.284  1.00 43.20  ? 179 ALA B HA     1 
ATOM   7830  H  HB1    . ALA B 1 199 ? 18.029  40.522 -96.848  1.00 37.75  ? 179 ALA B HB1    1 
ATOM   7831  H  HB2    . ALA B 1 199 ? 17.118  39.992 -95.659  1.00 37.75  ? 179 ALA B HB2    1 
ATOM   7832  H  HB3    . ALA B 1 199 ? 17.701  38.972 -96.728  1.00 37.75  ? 179 ALA B HB3    1 
ATOM   7833  N  N      . SER B 1 200 ? 16.001  39.000 -99.671  1.00 54.03  ? 180 SER B N      1 
ATOM   7834  C  CA     . SER B 1 200 ? 16.245  38.948 -101.107 1.00 61.48  ? 180 SER B CA     1 
ATOM   7835  C  C      . SER B 1 200 ? 15.427  39.977 -101.873 1.00 60.43  ? 180 SER B C      1 
ATOM   7836  O  O      . SER B 1 200 ? 15.668  40.170 -103.069 1.00 66.46  ? 180 SER B O      1 
ATOM   7837  C  CB     . SER B 1 200 ? 15.931  37.551 -101.645 1.00 62.31  ? 180 SER B CB     1 
ATOM   7838  O  OG     . SER B 1 200 ? 14.561  37.233 -101.470 1.00 63.35  ? 180 SER B OG     1 
ATOM   7839  H  H      . SER B 1 200 ? 15.525  38.352 -99.367  1.00 64.95  ? 180 SER B H      1 
ATOM   7840  H  HA     . SER B 1 200 ? 17.183  39.129 -101.274 1.00 73.89  ? 180 SER B HA     1 
ATOM   7841  H  HB2    . SER B 1 200 ? 16.143  37.523 -102.591 1.00 74.89  ? 180 SER B HB2    1 
ATOM   7842  H  HB3    . SER B 1 200 ? 16.469  36.901 -101.166 1.00 74.89  ? 180 SER B HB3    1 
ATOM   7843  H  HG     . SER B 1 200 ? 14.363  37.254 -100.654 1.00 76.13  ? 180 SER B HG     1 
ATOM   7844  N  N      . VAL B 1 201 ? 14.477  40.635 -101.218 1.00 51.55  ? 181 VAL B N      1 
ATOM   7845  C  CA     . VAL B 1 201 ? 13.658  41.664 -101.840 1.00 46.26  ? 181 VAL B CA     1 
ATOM   7846  C  C      . VAL B 1 201 ? 14.058  43.004 -101.242 1.00 45.55  ? 181 VAL B C      1 
ATOM   7847  O  O      . VAL B 1 201 ? 14.407  43.100 -100.060 1.00 42.06  ? 181 VAL B O      1 
ATOM   7848  C  CB     . VAL B 1 201 ? 12.153  41.386 -101.634 1.00 44.78  ? 181 VAL B CB     1 
ATOM   7849  C  CG1    . VAL B 1 201 ? 11.305  42.463 -102.298 1.00 47.09  ? 181 VAL B CG1    1 
ATOM   7850  C  CG2    . VAL B 1 201 ? 11.793  40.008 -102.171 1.00 42.85  ? 181 VAL B CG2    1 
ATOM   7851  H  H      . VAL B 1 201 ? 14.285  40.499 -100.390 1.00 61.98  ? 181 VAL B H      1 
ATOM   7852  H  HA     . VAL B 1 201 ? 13.837  41.687 -102.792 1.00 55.63  ? 181 VAL B HA     1 
ATOM   7853  H  HB     . VAL B 1 201 ? 11.958  41.397 -100.684 1.00 53.85  ? 181 VAL B HB     1 
ATOM   7854  H  HG11   . VAL B 1 201 ? 10.368  42.262 -102.152 1.00 56.63  ? 181 VAL B HG11   1 
ATOM   7855  H  HG12   . VAL B 1 201 ? 11.524  43.323 -101.906 1.00 56.63  ? 181 VAL B HG12   1 
ATOM   7856  H  HG13   . VAL B 1 201 ? 11.497  42.474 -103.249 1.00 56.63  ? 181 VAL B HG13   1 
ATOM   7857  H  HG21   . VAL B 1 201 ? 10.845  39.853 -102.033 1.00 51.54  ? 181 VAL B HG21   1 
ATOM   7858  H  HG22   . VAL B 1 201 ? 11.999  39.975 -103.118 1.00 51.54  ? 181 VAL B HG22   1 
ATOM   7859  H  HG23   . VAL B 1 201 ? 12.310  39.339 -101.696 1.00 51.54  ? 181 VAL B HG23   1 
ATOM   7860  N  N      . ILE B 1 202 ? 14.006  44.047 -102.071 1.00 48.84  ? 182 ILE B N      1 
ATOM   7861  C  CA     . ILE B 1 202 ? 14.337  45.386 -101.601 1.00 51.77  ? 182 ILE B CA     1 
ATOM   7862  C  C      . ILE B 1 202 ? 13.390  45.748 -100.467 1.00 51.22  ? 182 ILE B C      1 
ATOM   7863  O  O      . ILE B 1 202 ? 12.168  45.802 -100.651 1.00 50.95  ? 182 ILE B O      1 
ATOM   7864  C  CB     . ILE B 1 202 ? 14.273  46.393 -102.755 1.00 55.52  ? 182 ILE B CB     1 
ATOM   7865  C  CG1    . ILE B 1 202 ? 15.331  46.043 -103.809 1.00 55.15  ? 182 ILE B CG1    1 
ATOM   7866  C  CG2    . ILE B 1 202 ? 14.492  47.813 -102.244 1.00 57.67  ? 182 ILE B CG2    1 
ATOM   7867  C  CD1    . ILE B 1 202 ? 15.239  46.851 -105.089 1.00 54.34  ? 182 ILE B CD1    1 
ATOM   7868  H  H      . ILE B 1 202 ? 13.784  44.004 -102.901 1.00 58.72  ? 182 ILE B H      1 
ATOM   7869  H  HA     . ILE B 1 202 ? 15.241  45.386 -101.251 1.00 62.25  ? 182 ILE B HA     1 
ATOM   7870  H  HB     . ILE B 1 202 ? 13.396  46.342 -103.166 1.00 66.74  ? 182 ILE B HB     1 
ATOM   7871  H  HG12   . ILE B 1 202 ? 16.210  46.196 -103.428 1.00 66.30  ? 182 ILE B HG12   1 
ATOM   7872  H  HG13   . ILE B 1 202 ? 15.236  45.107 -104.044 1.00 66.30  ? 182 ILE B HG13   1 
ATOM   7873  H  HG21   . ILE B 1 202 ? 14.447  48.428 -102.993 1.00 69.33  ? 182 ILE B HG21   1 
ATOM   7874  H  HG22   . ILE B 1 202 ? 13.801  48.026 -101.598 1.00 69.33  ? 182 ILE B HG22   1 
ATOM   7875  H  HG23   . ILE B 1 202 ? 15.365  47.866 -101.824 1.00 69.33  ? 182 ILE B HG23   1 
ATOM   7876  H  HD11   . ILE B 1 202 ? 15.941  46.565 -105.694 1.00 65.32  ? 182 ILE B HD11   1 
ATOM   7877  H  HD12   . ILE B 1 202 ? 14.371  46.701 -105.495 1.00 65.32  ? 182 ILE B HD12   1 
ATOM   7878  H  HD13   . ILE B 1 202 ? 15.347  47.791 -104.877 1.00 65.32  ? 182 ILE B HD13   1 
ATOM   7879  N  N      . GLY B 1 203 ? 13.953  46.002 -99.286  1.00 50.54  ? 183 GLY B N      1 
ATOM   7880  C  CA     . GLY B 1 203 ? 13.182  46.291 -98.092  1.00 51.34  ? 183 GLY B CA     1 
ATOM   7881  C  C      . GLY B 1 203 ? 13.130  45.161 -97.085  1.00 50.68  ? 183 GLY B C      1 
ATOM   7882  O  O      . GLY B 1 203 ? 12.710  45.394 -95.944  1.00 45.86  ? 183 GLY B O      1 
ATOM   7883  H  H      . GLY B 1 203 ? 14.803  46.010 -99.154  1.00 60.77  ? 183 GLY B H      1 
ATOM   7884  H  HA2    . GLY B 1 203 ? 13.562  47.068 -97.652  1.00 61.73  ? 183 GLY B HA2    1 
ATOM   7885  H  HA3    . GLY B 1 203 ? 12.272  46.506 -98.349  1.00 61.73  ? 183 GLY B HA3    1 
ATOM   7886  N  N      . GLY B 1 204 ? 13.540  43.951 -97.461  1.00 56.90  ? 184 GLY B N      1 
ATOM   7887  C  CA     . GLY B 1 204 ? 13.506  42.838 -96.535  1.00 56.91  ? 184 GLY B CA     1 
ATOM   7888  C  C      . GLY B 1 204 ? 14.511  42.992 -95.410  1.00 54.11  ? 184 GLY B C      1 
ATOM   7889  O  O      . GLY B 1 204 ? 15.456  43.779 -95.480  1.00 56.11  ? 184 GLY B O      1 
ATOM   7890  H  H      . GLY B 1 204 ? 13.839  43.755 -98.243  1.00 68.40  ? 184 GLY B H      1 
ATOM   7891  H  HA2    . GLY B 1 204 ? 12.619  42.767 -96.148  1.00 68.41  ? 184 GLY B HA2    1 
ATOM   7892  H  HA3    . GLY B 1 204 ? 13.701  42.015 -97.011  1.00 68.41  ? 184 GLY B HA3    1 
ATOM   7893  N  N      . SER B 1 205 ? 14.297  42.217 -94.345  1.00 47.38  ? 185 SER B N      1 
ATOM   7894  C  CA     . SER B 1 205 ? 15.118  42.317 -93.142  1.00 43.10  ? 185 SER B CA     1 
ATOM   7895  C  C      . SER B 1 205 ? 15.631  40.987 -92.605  1.00 38.61  ? 185 SER B C      1 
ATOM   7896  O  O      . SER B 1 205 ? 16.567  41.001 -91.797  1.00 37.34  ? 185 SER B O      1 
ATOM   7897  C  CB     . SER B 1 205 ? 14.336  43.023 -92.023  1.00 45.03  ? 185 SER B CB     1 
ATOM   7898  O  OG     . SER B 1 205 ? 13.086  42.395 -91.798  1.00 47.48  ? 185 SER B OG     1 
ATOM   7899  H  H      . SER B 1 205 ? 13.679  41.621 -94.296  1.00 56.97  ? 185 SER B H      1 
ATOM   7900  H  HA     . SER B 1 205 ? 15.892  42.865 -93.346  1.00 51.84  ? 185 SER B HA     1 
ATOM   7901  H  HB2    . SER B 1 205 ? 14.857  42.989 -91.206  1.00 54.16  ? 185 SER B HB2    1 
ATOM   7902  H  HB3    . SER B 1 205 ? 14.183  43.946 -92.280  1.00 54.16  ? 185 SER B HB3    1 
ATOM   7903  H  HG     . SER B 1 205 ? 12.671  42.792 -91.184  1.00 57.09  ? 185 SER B HG     1 
ATOM   7904  N  N      . ILE B 1 206 ? 15.065  39.851 -93.008  1.00 38.83  ? 186 ILE B N      1 
ATOM   7905  C  CA     . ILE B 1 206 ? 15.475  38.547 -92.495  1.00 39.64  ? 186 ILE B CA     1 
ATOM   7906  C  C      . ILE B 1 206 ? 15.725  37.621 -93.678  1.00 38.95  ? 186 ILE B C      1 
ATOM   7907  O  O      . ILE B 1 206 ? 14.864  37.479 -94.553  1.00 39.95  ? 186 ILE B O      1 
ATOM   7908  C  CB     . ILE B 1 206 ? 14.423  37.940 -91.547  1.00 38.69  ? 186 ILE B CB     1 
ATOM   7909  C  CG1    . ILE B 1 206 ? 14.124  38.910 -90.400  1.00 33.93  ? 186 ILE B CG1    1 
ATOM   7910  C  CG2    . ILE B 1 206 ? 14.915  36.600 -91.001  1.00 41.38  ? 186 ILE B CG2    1 
ATOM   7911  C  CD1    . ILE B 1 206 ? 13.032  38.446 -89.453  1.00 30.55  ? 186 ILE B CD1    1 
ATOM   7912  H  H      . ILE B 1 206 ? 14.431  39.809 -93.587  1.00 46.72  ? 186 ILE B H      1 
ATOM   7913  H  HA     . ILE B 1 206 ? 16.306  38.643 -92.004  1.00 47.68  ? 186 ILE B HA     1 
ATOM   7914  H  HB     . ILE B 1 206 ? 13.605  37.790 -92.047  1.00 46.55  ? 186 ILE B HB     1 
ATOM   7915  H  HG12   . ILE B 1 206 ? 14.932  39.033 -89.879  1.00 40.84  ? 186 ILE B HG12   1 
ATOM   7916  H  HG13   . ILE B 1 206 ? 13.845  39.759 -90.776  1.00 40.84  ? 186 ILE B HG13   1 
ATOM   7917  H  HG21   . ILE B 1 206 ? 14.240  36.234 -90.408  1.00 49.78  ? 186 ILE B HG21   1 
ATOM   7918  H  HG22   . ILE B 1 206 ? 15.066  35.993 -91.743  1.00 49.78  ? 186 ILE B HG22   1 
ATOM   7919  H  HG23   . ILE B 1 206 ? 15.742  36.742 -90.514  1.00 49.78  ? 186 ILE B HG23   1 
ATOM   7920  H  HD11   . ILE B 1 206 ? 12.909  39.116 -88.762  1.00 36.78  ? 186 ILE B HD11   1 
ATOM   7921  H  HD12   . ILE B 1 206 ? 12.209  38.331 -89.953  1.00 36.78  ? 186 ILE B HD12   1 
ATOM   7922  H  HD13   . ILE B 1 206 ? 13.298  37.603 -89.053  1.00 36.78  ? 186 ILE B HD13   1 
ATOM   7923  N  N      . THR B 1 207 ? 16.897  36.991 -93.697  1.00 36.58  ? 187 THR B N      1 
ATOM   7924  C  CA     . THR B 1 207 ? 17.250  36.055 -94.751  1.00 37.59  ? 187 THR B CA     1 
ATOM   7925  C  C      . THR B 1 207 ? 16.537  34.719 -94.545  1.00 39.19  ? 187 THR B C      1 
ATOM   7926  O  O      . THR B 1 207 ? 15.947  34.450 -93.495  1.00 39.53  ? 187 THR B O      1 
ATOM   7927  C  CB     . THR B 1 207 ? 18.763  35.835 -94.793  1.00 40.62  ? 187 THR B CB     1 
ATOM   7928  O  OG1    . THR B 1 207 ? 19.202  35.260 -93.555  1.00 41.84  ? 187 THR B OG1    1 
ATOM   7929  C  CG2    . THR B 1 207 ? 19.496  37.150 -95.026  1.00 41.19  ? 187 THR B CG2    1 
ATOM   7930  H  H      . THR B 1 207 ? 17.509  37.092 -93.102  1.00 44.01  ? 187 THR B H      1 
ATOM   7931  H  HA     . THR B 1 207 ? 16.972  36.418 -95.607  1.00 45.23  ? 187 THR B HA     1 
ATOM   7932  H  HB     . THR B 1 207 ? 18.979  35.233 -95.521  1.00 48.86  ? 187 THR B HB     1 
ATOM   7933  H  HG1    . THR B 1 207 ? 19.017  35.774 -92.917  1.00 50.32  ? 187 THR B HG1    1 
ATOM   7934  H  HG21   . THR B 1 207 ? 20.453  36.996 -95.050  1.00 49.55  ? 187 THR B HG21   1 
ATOM   7935  H  HG22   . THR B 1 207 ? 19.218  37.539 -95.870  1.00 49.55  ? 187 THR B HG22   1 
ATOM   7936  H  HG23   . THR B 1 207 ? 19.294  37.773 -94.310  1.00 49.55  ? 187 THR B HG23   1 
ATOM   7937  N  N      . SER B 1 208 ? 16.601  33.870 -95.574  1.00 42.35  ? 188 SER B N      1 
ATOM   7938  C  CA     . SER B 1 208 ? 16.029  32.532 -95.464  1.00 43.41  ? 188 SER B CA     1 
ATOM   7939  C  C      . SER B 1 208 ? 16.682  31.752 -94.330  1.00 41.91  ? 188 SER B C      1 
ATOM   7940  O  O      . SER B 1 208 ? 16.018  30.972 -93.635  1.00 44.02  ? 188 SER B O      1 
ATOM   7941  C  CB     . SER B 1 208 ? 16.192  31.784 -96.788  1.00 42.78  ? 188 SER B CB     1 
ATOM   7942  O  OG     . SER B 1 208 ? 15.637  32.519 -97.865  1.00 39.47  ? 188 SER B OG     1 
ATOM   7943  H  H      . SER B 1 208 ? 16.965  34.043 -96.333  1.00 50.93  ? 188 SER B H      1 
ATOM   7944  H  HA     . SER B 1 208 ? 15.080  32.606 -95.273  1.00 52.21  ? 188 SER B HA     1 
ATOM   7945  H  HB2    . SER B 1 208 ? 17.138  31.646 -96.956  1.00 51.45  ? 188 SER B HB2    1 
ATOM   7946  H  HB3    . SER B 1 208 ? 15.739  30.929 -96.724  1.00 51.45  ? 188 SER B HB3    1 
ATOM   7947  H  HG     . SER B 1 208 ? 15.736  32.094 -98.583  1.00 47.48  ? 188 SER B HG     1 
ATOM   7948  N  N      . TYR B 1 209 ? 17.985  31.954 -94.130  1.00 38.70  ? 189 TYR B N      1 
ATOM   7949  C  CA     . TYR B 1 209 ? 18.699  31.302 -93.036  1.00 36.56  ? 189 TYR B CA     1 
ATOM   7950  C  C      . TYR B 1 209 ? 18.035  31.598 -91.695  1.00 32.35  ? 189 TYR B C      1 
ATOM   7951  O  O      . TYR B 1 209 ? 17.766  30.685 -90.900  1.00 28.16  ? 189 TYR B O      1 
ATOM   7952  C  CB     . TYR B 1 209 ? 20.157  31.772 -93.054  1.00 40.93  ? 189 TYR B CB     1 
ATOM   7953  C  CG     . TYR B 1 209 ? 21.019  31.297 -91.909  1.00 47.14  ? 189 TYR B CG     1 
ATOM   7954  C  CD1    . TYR B 1 209 ? 21.209  29.943 -91.667  1.00 51.41  ? 189 TYR B CD1    1 
ATOM   7955  C  CD2    . TYR B 1 209 ? 21.672  32.208 -91.087  1.00 47.65  ? 189 TYR B CD2    1 
ATOM   7956  C  CE1    . TYR B 1 209 ? 22.006  29.509 -90.625  1.00 51.38  ? 189 TYR B CE1    1 
ATOM   7957  C  CE2    . TYR B 1 209 ? 22.471  31.784 -90.044  1.00 48.16  ? 189 TYR B CE2    1 
ATOM   7958  C  CZ     . TYR B 1 209 ? 22.635  30.433 -89.817  1.00 50.04  ? 189 TYR B CZ     1 
ATOM   7959  O  OH     . TYR B 1 209 ? 23.431  30.006 -88.780  1.00 49.79  ? 189 TYR B OH     1 
ATOM   7960  H  H      . TYR B 1 209 ? 18.478  32.465 -94.616  1.00 46.56  ? 189 TYR B H      1 
ATOM   7961  H  HA     . TYR B 1 209 ? 18.688  30.342 -93.174  1.00 43.99  ? 189 TYR B HA     1 
ATOM   7962  H  HB2    . TYR B 1 209 ? 20.568  31.458 -93.875  1.00 49.23  ? 189 TYR B HB2    1 
ATOM   7963  H  HB3    . TYR B 1 209 ? 20.165  32.741 -93.040  1.00 49.23  ? 189 TYR B HB3    1 
ATOM   7964  H  HD1    . TYR B 1 209 ? 20.784  29.318 -92.209  1.00 61.81  ? 189 TYR B HD1    1 
ATOM   7965  H  HD2    . TYR B 1 209 ? 21.562  33.119 -91.236  1.00 57.30  ? 189 TYR B HD2    1 
ATOM   7966  H  HE1    . TYR B 1 209 ? 22.119  28.599 -90.470  1.00 61.78  ? 189 TYR B HE1    1 
ATOM   7967  H  HE2    . TYR B 1 209 ? 22.896  32.405 -89.498  1.00 57.91  ? 189 TYR B HE2    1 
ATOM   7968  H  HH     . TYR B 1 209 ? 23.750  30.667 -88.372  1.00 59.87  ? 189 TYR B HH     1 
ATOM   7969  N  N      . GLY B 1 210 ? 17.733  32.875 -91.441  1.00 33.25  ? 190 GLY B N      1 
ATOM   7970  C  CA     . GLY B 1 210 ? 17.085  33.242 -90.193  1.00 32.44  ? 190 GLY B CA     1 
ATOM   7971  C  C      . GLY B 1 210 ? 15.724  32.595 -90.028  1.00 32.32  ? 190 GLY B C      1 
ATOM   7972  O  O      . GLY B 1 210 ? 15.364  32.153 -88.934  1.00 27.73  ? 190 GLY B O      1 
ATOM   7973  H  H      . GLY B 1 210 ? 17.893  33.534 -91.970  1.00 40.02  ? 190 GLY B H      1 
ATOM   7974  H  HA2    . GLY B 1 210 ? 17.644  32.973 -89.448  1.00 39.05  ? 190 GLY B HA2    1 
ATOM   7975  H  HA3    . GLY B 1 210 ? 16.972  34.205 -90.159  1.00 39.05  ? 190 GLY B HA3    1 
ATOM   7976  N  N      . PHE B 1 211 ? 14.948  32.525 -91.112  1.00 35.83  ? 191 PHE B N      1 
ATOM   7977  C  CA     . PHE B 1 211 ? 13.641  31.881 -91.035  1.00 36.50  ? 191 PHE B CA     1 
ATOM   7978  C  C      . PHE B 1 211 ? 13.777  30.393 -90.732  1.00 34.65  ? 191 PHE B C      1 
ATOM   7979  O  O      . PHE B 1 211 ? 12.978  29.835 -89.970  1.00 37.60  ? 191 PHE B O      1 
ATOM   7980  C  CB     . PHE B 1 211 ? 12.866  32.104 -92.334  1.00 36.62  ? 191 PHE B CB     1 
ATOM   7981  C  CG     . PHE B 1 211 ? 12.191  33.447 -92.414  1.00 36.43  ? 191 PHE B CG     1 
ATOM   7982  C  CD1    . PHE B 1 211 ? 11.031  33.695 -91.699  1.00 34.21  ? 191 PHE B CD1    1 
ATOM   7983  C  CD2    . PHE B 1 211 ? 12.714  34.459 -93.204  1.00 39.36  ? 191 PHE B CD2    1 
ATOM   7984  C  CE1    . PHE B 1 211 ? 10.406  34.925 -91.768  1.00 34.18  ? 191 PHE B CE1    1 
ATOM   7985  C  CE2    . PHE B 1 211 ? 12.092  35.693 -93.276  1.00 38.39  ? 191 PHE B CE2    1 
ATOM   7986  C  CZ     . PHE B 1 211 ? 10.937  35.926 -92.557  1.00 35.80  ? 191 PHE B CZ     1 
ATOM   7987  H  H      . PHE B 1 211 ? 15.152  32.835 -91.888  1.00 43.11  ? 191 PHE B H      1 
ATOM   7988  H  HA     . PHE B 1 211 ? 13.135  32.286 -90.313  1.00 43.91  ? 191 PHE B HA     1 
ATOM   7989  H  HB2    . PHE B 1 211 ? 13.481  32.035 -93.081  1.00 44.06  ? 191 PHE B HB2    1 
ATOM   7990  H  HB3    . PHE B 1 211 ? 12.180  31.422 -92.409  1.00 44.06  ? 191 PHE B HB3    1 
ATOM   7991  H  HD1    . PHE B 1 211 ? 10.669  33.026 -91.165  1.00 41.17  ? 191 PHE B HD1    1 
ATOM   7992  H  HD2    . PHE B 1 211 ? 13.492  34.307 -93.690  1.00 47.35  ? 191 PHE B HD2    1 
ATOM   7993  H  HE1    . PHE B 1 211 ? 9.628   35.080 -91.282  1.00 41.13  ? 191 PHE B HE1    1 
ATOM   7994  H  HE2    . PHE B 1 211 ? 12.451  36.365 -93.809  1.00 46.19  ? 191 PHE B HE2    1 
ATOM   7995  H  HZ     . PHE B 1 211 ? 10.518  36.754 -92.605  1.00 43.08  ? 191 PHE B HZ     1 
ATOM   7996  N  N      . ASN B 1 212 ? 14.782  29.733 -91.310  1.00 31.53  ? 192 ASN B N      1 
ATOM   7997  C  CA     . ASN B 1 212 ? 15.050  28.345 -90.948  1.00 34.81  ? 192 ASN B CA     1 
ATOM   7998  C  C      . ASN B 1 212 ? 15.334  28.222 -89.457  1.00 34.49  ? 192 ASN B C      1 
ATOM   7999  O  O      . ASN B 1 212 ? 14.789  27.342 -88.777  1.00 34.97  ? 192 ASN B O      1 
ATOM   8000  C  CB     . ASN B 1 212 ? 16.226  27.801 -91.762  1.00 38.46  ? 192 ASN B CB     1 
ATOM   8001  C  CG     . ASN B 1 212 ? 15.785  27.081 -93.024  1.00 39.86  ? 192 ASN B CG     1 
ATOM   8002  O  OD1    . ASN B 1 212 ? 14.634  26.663 -93.147  1.00 38.37  ? 192 ASN B OD1    1 
ATOM   8003  N  ND2    . ASN B 1 212 ? 16.709  26.922 -93.966  1.00 41.87  ? 192 ASN B ND2    1 
ATOM   8004  H  H      . ASN B 1 212 ? 15.312  30.061 -91.903  1.00 37.96  ? 192 ASN B H      1 
ATOM   8005  H  HA     . ASN B 1 212 ? 14.269  27.808 -91.152  1.00 41.89  ? 192 ASN B HA     1 
ATOM   8006  H  HB2    . ASN B 1 212 ? 16.798  28.540 -92.023  1.00 46.27  ? 192 ASN B HB2    1 
ATOM   8007  H  HB3    . ASN B 1 212 ? 16.724  27.172 -91.217  1.00 46.27  ? 192 ASN B HB3    1 
ATOM   8008  H  HD21   . ASN B 1 212 ? 16.510  26.520 -94.700  1.00 50.37  ? 192 ASN B HD21   1 
ATOM   8009  H  HD22   . ASN B 1 212 ? 17.506  27.220 -93.841  1.00 50.37  ? 192 ASN B HD22   1 
ATOM   8010  N  N      . LEU B 1 213 ? 16.181  29.109 -88.925  1.00 32.54  ? 193 LEU B N      1 
ATOM   8011  C  CA     . LEU B 1 213 ? 16.453  29.086 -87.491  1.00 30.28  ? 193 LEU B CA     1 
ATOM   8012  C  C      . LEU B 1 213 ? 15.167  29.251 -86.684  1.00 29.22  ? 193 LEU B C      1 
ATOM   8013  O  O      . LEU B 1 213 ? 14.956  28.549 -85.686  1.00 29.18  ? 193 LEU B O      1 
ATOM   8014  C  CB     . LEU B 1 213 ? 17.465  30.174 -87.130  1.00 29.81  ? 193 LEU B CB     1 
ATOM   8015  C  CG     . LEU B 1 213 ? 18.869  30.004 -87.725  1.00 30.22  ? 193 LEU B CG     1 
ATOM   8016  C  CD1    . LEU B 1 213 ? 19.710  31.255 -87.503  1.00 30.87  ? 193 LEU B CD1    1 
ATOM   8017  C  CD2    . LEU B 1 213 ? 19.574  28.783 -87.147  1.00 26.90  ? 193 LEU B CD2    1 
ATOM   8018  H  H      . LEU B 1 213 ? 16.600  29.719 -89.363  1.00 39.16  ? 193 LEU B H      1 
ATOM   8019  H  HA     . LEU B 1 213 ? 16.841  28.228 -87.259  1.00 36.46  ? 193 LEU B HA     1 
ATOM   8020  H  HB2    . LEU B 1 213 ? 17.121  31.026 -87.439  1.00 35.89  ? 193 LEU B HB2    1 
ATOM   8021  H  HB3    . LEU B 1 213 ? 17.560  30.195 -86.165  1.00 35.89  ? 193 LEU B HB3    1 
ATOM   8022  H  HG     . LEU B 1 213 ? 18.787  29.871 -88.683  1.00 36.38  ? 193 LEU B HG     1 
ATOM   8023  H  HD11   . LEU B 1 213 ? 20.589  31.116 -87.889  1.00 37.16  ? 193 LEU B HD11   1 
ATOM   8024  H  HD12   . LEU B 1 213 ? 19.274  32.008 -87.931  1.00 37.16  ? 193 LEU B HD12   1 
ATOM   8025  H  HD13   . LEU B 1 213 ? 19.788  31.416 -86.549  1.00 37.16  ? 193 LEU B HD13   1 
ATOM   8026  H  HD21   . LEU B 1 213 ? 20.455  28.709 -87.546  1.00 32.40  ? 193 LEU B HD21   1 
ATOM   8027  H  HD22   . LEU B 1 213 ? 19.653  28.890 -86.186  1.00 32.40  ? 193 LEU B HD22   1 
ATOM   8028  H  HD23   . LEU B 1 213 ? 19.052  27.991 -87.350  1.00 32.40  ? 193 LEU B HD23   1 
ATOM   8029  N  N      . MET B 1 214 ? 14.286  30.160 -87.114  1.00 29.36  ? 194 MET B N      1 
ATOM   8030  C  CA     . MET B 1 214 ? 13.012  30.350 -86.427  1.00 28.76  ? 194 MET B CA     1 
ATOM   8031  C  C      . MET B 1 214 ? 12.192  29.064 -86.426  1.00 31.79  ? 194 MET B C      1 
ATOM   8032  O  O      . MET B 1 214 ? 11.663  28.648 -85.386  1.00 33.80  ? 194 MET B O      1 
ATOM   8033  C  CB     . MET B 1 214 ? 12.235  31.488 -87.091  1.00 28.99  ? 194 MET B CB     1 
ATOM   8034  C  CG     . MET B 1 214 ? 12.797  32.873 -86.796  1.00 32.57  ? 194 MET B CG     1 
ATOM   8035  S  SD     . MET B 1 214 ? 11.916  34.233 -87.606  1.00 33.46  ? 194 MET B SD     1 
ATOM   8036  C  CE     . MET B 1 214 ? 10.245  33.990 -87.009  1.00 37.39  ? 194 MET B CE     1 
ATOM   8037  H  H      . MET B 1 214 ? 14.403  30.672 -87.795  1.00 35.35  ? 194 MET B H      1 
ATOM   8038  H  HA     . MET B 1 214 ? 13.188  30.609 -85.508  1.00 34.63  ? 194 MET B HA     1 
ATOM   8039  H  HB2    . MET B 1 214 ? 12.253  31.360 -88.052  1.00 34.91  ? 194 MET B HB2    1 
ATOM   8040  H  HB3    . MET B 1 214 ? 11.318  31.467 -86.774  1.00 34.91  ? 194 MET B HB3    1 
ATOM   8041  H  HG2    . MET B 1 214 ? 12.758  33.026 -85.839  1.00 39.21  ? 194 MET B HG2    1 
ATOM   8042  H  HG3    . MET B 1 214 ? 13.720  32.903 -87.094  1.00 39.21  ? 194 MET B HG3    1 
ATOM   8043  H  HE1    . MET B 1 214 ? 9.673   34.677 -87.386  1.00 44.99  ? 194 MET B HE1    1 
ATOM   8044  H  HE2    . MET B 1 214 ? 9.936   33.113 -87.284  1.00 44.99  ? 194 MET B HE2    1 
ATOM   8045  H  HE3    . MET B 1 214 ? 10.244  34.053 -86.041  1.00 44.99  ? 194 MET B HE3    1 
ATOM   8046  N  N      . VAL B 1 215 ? 12.087  28.410 -87.585  1.00 32.87  ? 195 VAL B N      1 
ATOM   8047  C  CA     . VAL B 1 215 ? 11.308  27.177 -87.679  1.00 34.11  ? 195 VAL B CA     1 
ATOM   8048  C  C      . VAL B 1 215 ? 11.870  26.121 -86.735  1.00 28.64  ? 195 VAL B C      1 
ATOM   8049  O  O      . VAL B 1 215 ? 11.129  25.473 -85.985  1.00 28.54  ? 195 VAL B O      1 
ATOM   8050  C  CB     . VAL B 1 215 ? 11.271  26.674 -89.133  1.00 38.25  ? 195 VAL B CB     1 
ATOM   8051  C  CG1    . VAL B 1 215 ? 10.644  25.284 -89.214  1.00 38.50  ? 195 VAL B CG1    1 
ATOM   8052  C  CG2    . VAL B 1 215 ? 10.502  27.651 -90.008  1.00 39.22  ? 195 VAL B CG2    1 
ATOM   8053  H  H      . VAL B 1 215 ? 12.453  28.658 -88.323  1.00 39.56  ? 195 VAL B H      1 
ATOM   8054  H  HA     . VAL B 1 215 ? 10.395  27.363 -87.406  1.00 41.04  ? 195 VAL B HA     1 
ATOM   8055  H  HB     . VAL B 1 215 ? 12.178  26.615 -89.472  1.00 46.01  ? 195 VAL B HB     1 
ATOM   8056  H  HG11   . VAL B 1 215 ? 10.635  24.995 -90.140  1.00 46.31  ? 195 VAL B HG11   1 
ATOM   8057  H  HG12   . VAL B 1 215 ? 11.170  24.669 -88.680  1.00 46.31  ? 195 VAL B HG12   1 
ATOM   8058  H  HG13   . VAL B 1 215 ? 9.737   25.327 -88.872  1.00 46.31  ? 195 VAL B HG13   1 
ATOM   8059  H  HG21   . VAL B 1 215 ? 10.490  27.317 -90.919  1.00 47.18  ? 195 VAL B HG21   1 
ATOM   8060  H  HG22   . VAL B 1 215 ? 9.595   27.729 -89.672  1.00 47.18  ? 195 VAL B HG22   1 
ATOM   8061  H  HG23   . VAL B 1 215 ? 10.942  28.515 -89.978  1.00 47.18  ? 195 VAL B HG23   1 
ATOM   8062  N  N      . VAL B 1 216 ? 13.191  25.933 -86.753  1.00 26.96  ? 196 VAL B N      1 
ATOM   8063  C  CA     . VAL B 1 216 ? 13.791  24.903 -85.909  1.00 29.12  ? 196 VAL B CA     1 
ATOM   8064  C  C      . VAL B 1 216 ? 13.552  25.217 -84.437  1.00 29.55  ? 196 VAL B C      1 
ATOM   8065  O  O      . VAL B 1 216 ? 13.287  24.315 -83.631  1.00 29.33  ? 196 VAL B O      1 
ATOM   8066  C  CB     . VAL B 1 216 ? 15.291  24.753 -86.227  1.00 28.91  ? 196 VAL B CB     1 
ATOM   8067  C  CG1    . VAL B 1 216 ? 15.973  23.827 -85.224  1.00 29.29  ? 196 VAL B CG1    1 
ATOM   8068  C  CG2    . VAL B 1 216 ? 15.477  24.219 -87.640  1.00 27.58  ? 196 VAL B CG2    1 
ATOM   8069  H  H      . VAL B 1 216 ? 13.749  26.378 -87.234  1.00 32.47  ? 196 VAL B H      1 
ATOM   8070  H  HA     . VAL B 1 216 ? 13.363  24.054 -86.102  1.00 35.06  ? 196 VAL B HA     1 
ATOM   8071  H  HB     . VAL B 1 216 ? 15.717  25.623 -86.174  1.00 34.81  ? 196 VAL B HB     1 
ATOM   8072  H  HG11   . VAL B 1 216 ? 16.913  23.754 -85.451  1.00 35.26  ? 196 VAL B HG11   1 
ATOM   8073  H  HG12   . VAL B 1 216 ? 15.875  24.200 -84.334  1.00 35.26  ? 196 VAL B HG12   1 
ATOM   8074  H  HG13   . VAL B 1 216 ? 15.553  22.954 -85.266  1.00 35.26  ? 196 VAL B HG13   1 
ATOM   8075  H  HG21   . VAL B 1 216 ? 16.425  24.132 -87.823  1.00 33.22  ? 196 VAL B HG21   1 
ATOM   8076  H  HG22   . VAL B 1 216 ? 15.045  23.353 -87.709  1.00 33.22  ? 196 VAL B HG22   1 
ATOM   8077  H  HG23   . VAL B 1 216 ? 15.075  24.840 -88.268  1.00 33.22  ? 196 VAL B HG23   1 
ATOM   8078  N  N      . TYR B 1 217 ? 13.628  26.496 -84.063  1.00 24.23  ? 197 TYR B N      1 
ATOM   8079  C  CA     . TYR B 1 217 ? 13.363  26.868 -82.676  1.00 25.20  ? 197 TYR B CA     1 
ATOM   8080  C  C      . TYR B 1 217 ? 11.931  26.516 -82.281  1.00 23.39  ? 197 TYR B C      1 
ATOM   8081  O  O      . TYR B 1 217 ? 11.698  25.869 -81.250  1.00 20.53  ? 197 TYR B O      1 
ATOM   8082  C  CB     . TYR B 1 217 ? 13.632  28.361 -82.475  1.00 27.62  ? 197 TYR B CB     1 
ATOM   8083  C  CG     . TYR B 1 217 ? 13.319  28.860 -81.081  1.00 29.21  ? 197 TYR B CG     1 
ATOM   8084  C  CD1    . TYR B 1 217 ? 14.212  28.663 -80.033  1.00 30.92  ? 197 TYR B CD1    1 
ATOM   8085  C  CD2    . TYR B 1 217 ? 12.133  29.533 -80.814  1.00 28.32  ? 197 TYR B CD2    1 
ATOM   8086  C  CE1    . TYR B 1 217 ? 13.929  29.119 -78.758  1.00 30.42  ? 197 TYR B CE1    1 
ATOM   8087  C  CE2    . TYR B 1 217 ? 11.842  29.992 -79.544  1.00 28.53  ? 197 TYR B CE2    1 
ATOM   8088  C  CZ     . TYR B 1 217 ? 12.742  29.784 -78.519  1.00 27.67  ? 197 TYR B CZ     1 
ATOM   8089  O  OH     . TYR B 1 217 ? 12.452  30.241 -77.253  1.00 23.13  ? 197 TYR B OH     1 
ATOM   8090  H  H      . TYR B 1 217 ? 13.826  27.152 -84.581  1.00 29.20  ? 197 TYR B H      1 
ATOM   8091  H  HA     . TYR B 1 217 ? 13.964  26.374 -82.097  1.00 30.35  ? 197 TYR B HA     1 
ATOM   8092  H  HB2    . TYR B 1 217 ? 14.571  28.534 -82.648  1.00 33.26  ? 197 TYR B HB2    1 
ATOM   8093  H  HB3    . TYR B 1 217 ? 13.085  28.863 -83.099  1.00 33.26  ? 197 TYR B HB3    1 
ATOM   8094  H  HD1    . TYR B 1 217 ? 15.011  28.216 -80.192  1.00 37.22  ? 197 TYR B HD1    1 
ATOM   8095  H  HD2    . TYR B 1 217 ? 11.524  29.675 -81.502  1.00 34.10  ? 197 TYR B HD2    1 
ATOM   8096  H  HE1    . TYR B 1 217 ? 14.534  28.980 -78.066  1.00 36.62  ? 197 TYR B HE1    1 
ATOM   8097  H  HE2    . TYR B 1 217 ? 11.043  30.440 -79.381  1.00 34.35  ? 197 TYR B HE2    1 
ATOM   8098  H  HH     . TYR B 1 217 ? 13.079  30.050 -76.728  1.00 27.87  ? 197 TYR B HH     1 
ATOM   8099  N  N      . TYR B 1 218 ? 10.955  26.923 -83.099  1.00 32.83  ? 198 TYR B N      1 
ATOM   8100  C  CA     . TYR B 1 218 ? 9.563   26.597 -82.803  1.00 31.95  ? 198 TYR B CA     1 
ATOM   8101  C  C      . TYR B 1 218 ? 9.369   25.092 -82.656  1.00 31.55  ? 198 TYR B C      1 
ATOM   8102  O  O      . TYR B 1 218 ? 8.813   24.622 -81.657  1.00 27.63  ? 198 TYR B O      1 
ATOM   8103  C  CB     . TYR B 1 218 ? 8.641   27.145 -83.893  1.00 31.27  ? 198 TYR B CB     1 
ATOM   8104  C  CG     . TYR B 1 218 ? 7.340   26.379 -84.004  1.00 32.96  ? 198 TYR B CG     1 
ATOM   8105  C  CD1    . TYR B 1 218 ? 6.293   26.617 -83.124  1.00 33.25  ? 198 TYR B CD1    1 
ATOM   8106  C  CD2    . TYR B 1 218 ? 7.166   25.407 -84.982  1.00 36.00  ? 198 TYR B CD2    1 
ATOM   8107  C  CE1    . TYR B 1 218 ? 5.105   25.911 -83.222  1.00 35.07  ? 198 TYR B CE1    1 
ATOM   8108  C  CE2    . TYR B 1 218 ? 5.984   24.698 -85.086  1.00 35.54  ? 198 TYR B CE2    1 
ATOM   8109  C  CZ     . TYR B 1 218 ? 4.959   24.953 -84.205  1.00 36.26  ? 198 TYR B CZ     1 
ATOM   8110  O  OH     . TYR B 1 218 ? 3.785   24.248 -84.308  1.00 39.48  ? 198 TYR B OH     1 
ATOM   8111  H  H      . TYR B 1 218 ? 11.073  27.381 -83.818  1.00 39.52  ? 198 TYR B H      1 
ATOM   8112  H  HA     . TYR B 1 218 ? 9.314   27.014 -81.964  1.00 38.45  ? 198 TYR B HA     1 
ATOM   8113  H  HB2    . TYR B 1 218 ? 8.428   28.070 -83.691  1.00 37.65  ? 198 TYR B HB2    1 
ATOM   8114  H  HB3    . TYR B 1 218 ? 9.095   27.089 -84.748  1.00 37.65  ? 198 TYR B HB3    1 
ATOM   8115  H  HD1    . TYR B 1 218 ? 6.389   27.261 -82.461  1.00 40.02  ? 198 TYR B HD1    1 
ATOM   8116  H  HD2    . TYR B 1 218 ? 7.858   25.232 -85.579  1.00 43.32  ? 198 TYR B HD2    1 
ATOM   8117  H  HE1    . TYR B 1 218 ? 4.410   26.081 -82.628  1.00 42.20  ? 198 TYR B HE1    1 
ATOM   8118  H  HE2    . TYR B 1 218 ? 5.883   24.052 -85.748  1.00 42.76  ? 198 TYR B HE2    1 
ATOM   8119  H  HH     . TYR B 1 218 ? 3.246   24.500 -83.714  1.00 47.49  ? 198 TYR B HH     1 
ATOM   8120  N  N      . LEU B 1 219 ? 9.821   24.316 -83.646  1.00 33.94  ? 199 LEU B N      1 
ATOM   8121  C  CA     . LEU B 1 219 ? 9.683   22.865 -83.555  1.00 36.59  ? 199 LEU B CA     1 
ATOM   8122  C  C      . LEU B 1 219 ? 10.353  22.325 -82.302  1.00 35.77  ? 199 LEU B C      1 
ATOM   8123  O  O      . LEU B 1 219 ? 9.920   21.304 -81.755  1.00 30.78  ? 199 LEU B O      1 
ATOM   8124  C  CB     . LEU B 1 219 ? 10.276  22.193 -84.794  1.00 39.35  ? 199 LEU B CB     1 
ATOM   8125  C  CG     . LEU B 1 219 ? 9.555   22.428 -86.122  1.00 42.24  ? 199 LEU B CG     1 
ATOM   8126  C  CD1    . LEU B 1 219 ? 10.347  21.809 -87.263  1.00 42.27  ? 199 LEU B CD1    1 
ATOM   8127  C  CD2    . LEU B 1 219 ? 8.137   21.873 -86.088  1.00 43.41  ? 199 LEU B CD2    1 
ATOM   8128  H  H      . LEU B 1 219 ? 10.202  24.599 -84.363  1.00 40.85  ? 199 LEU B H      1 
ATOM   8129  H  HA     . LEU B 1 219 ? 8.741   22.640 -83.513  1.00 44.02  ? 199 LEU B HA     1 
ATOM   8130  H  HB2    . LEU B 1 219 ? 11.186  22.510 -84.903  1.00 47.34  ? 199 LEU B HB2    1 
ATOM   8131  H  HB3    . LEU B 1 219 ? 10.288  21.235 -84.641  1.00 47.34  ? 199 LEU B HB3    1 
ATOM   8132  H  HG     . LEU B 1 219 ? 9.497   23.382 -86.283  1.00 50.81  ? 199 LEU B HG     1 
ATOM   8133  H  HD11   . LEU B 1 219 ? 9.875   21.967 -88.096  1.00 50.84  ? 199 LEU B HD11   1 
ATOM   8134  H  HD12   . LEU B 1 219 ? 11.225  22.220 -87.296  1.00 50.84  ? 199 LEU B HD12   1 
ATOM   8135  H  HD13   . LEU B 1 219 ? 10.432  20.856 -87.106  1.00 50.84  ? 199 LEU B HD13   1 
ATOM   8136  H  HD21   . LEU B 1 219 ? 7.713   22.040 -86.944  1.00 52.21  ? 199 LEU B HD21   1 
ATOM   8137  H  HD22   . LEU B 1 219 ? 8.176   20.919 -85.918  1.00 52.21  ? 199 LEU B HD22   1 
ATOM   8138  H  HD23   . LEU B 1 219 ? 7.642   22.316 -85.381  1.00 52.21  ? 199 LEU B HD23   1 
ATOM   8139  N  N      . LEU B 1 220 ? 11.408  22.993 -81.833  1.00 37.92  ? 200 LEU B N      1 
ATOM   8140  C  CA     . LEU B 1 220 ? 12.120  22.518 -80.653  1.00 35.96  ? 200 LEU B CA     1 
ATOM   8141  C  C      . LEU B 1 220 ? 11.309  22.770 -79.387  1.00 37.07  ? 200 LEU B C      1 
ATOM   8142  O  O      . LEU B 1 220 ? 11.289  21.930 -78.479  1.00 31.72  ? 200 LEU B O      1 
ATOM   8143  C  CB     . LEU B 1 220 ? 13.490  23.193 -80.570  1.00 31.50  ? 200 LEU B CB     1 
ATOM   8144  C  CG     . LEU B 1 220 ? 14.740  22.351 -80.301  1.00 27.73  ? 200 LEU B CG     1 
ATOM   8145  C  CD1    . LEU B 1 220 ? 14.787  21.059 -81.110  1.00 30.65  ? 200 LEU B CD1    1 
ATOM   8146  C  CD2    . LEU B 1 220 ? 15.967  23.195 -80.610  1.00 24.25  ? 200 LEU B CD2    1 
ATOM   8147  H  H      . LEU B 1 220 ? 11.726  23.715 -82.176  1.00 45.62  ? 200 LEU B H      1 
ATOM   8148  H  HA     . LEU B 1 220 ? 12.261  21.561 -80.733  1.00 43.26  ? 200 LEU B HA     1 
ATOM   8149  H  HB2    . LEU B 1 220 ? 13.641  23.649 -81.413  1.00 37.92  ? 200 LEU B HB2    1 
ATOM   8150  H  HB3    . LEU B 1 220 ? 13.446  23.855 -79.862  1.00 37.92  ? 200 LEU B HB3    1 
ATOM   8151  H  HG     . LEU B 1 220 ? 14.767  22.117 -79.360  1.00 33.40  ? 200 LEU B HG     1 
ATOM   8152  H  HD11   . LEU B 1 220 ? 15.601  20.579 -80.891  1.00 36.90  ? 200 LEU B HD11   1 
ATOM   8153  H  HD12   . LEU B 1 220 ? 14.014  20.518 -80.887  1.00 36.90  ? 200 LEU B HD12   1 
ATOM   8154  H  HD13   . LEU B 1 220 ? 14.777  21.278 -82.055  1.00 36.90  ? 200 LEU B HD13   1 
ATOM   8155  H  HD21   . LEU B 1 220 ? 16.763  22.667 -80.441  1.00 29.22  ? 200 LEU B HD21   1 
ATOM   8156  H  HD22   . LEU B 1 220 ? 15.938  23.463 -81.542  1.00 29.22  ? 200 LEU B HD22   1 
ATOM   8157  H  HD23   . LEU B 1 220 ? 15.962  23.979 -80.040  1.00 29.22  ? 200 LEU B HD23   1 
ATOM   8158  N  N      . GLN B 1 221 ? 10.633  23.919 -79.307  1.00 43.20  ? 201 GLN B N      1 
ATOM   8159  C  CA     . GLN B 1 221 ? 9.826   24.205 -78.124  1.00 44.84  ? 201 GLN B CA     1 
ATOM   8160  C  C      . GLN B 1 221 ? 8.640   23.254 -78.003  1.00 44.46  ? 201 GLN B C      1 
ATOM   8161  O  O      . GLN B 1 221 ? 8.194   22.965 -76.887  1.00 48.17  ? 201 GLN B O      1 
ATOM   8162  C  CB     . GLN B 1 221 ? 9.334   25.652 -78.160  1.00 46.24  ? 201 GLN B CB     1 
ATOM   8163  C  CG     . GLN B 1 221 ? 10.438  26.699 -78.064  1.00 47.29  ? 201 GLN B CG     1 
ATOM   8164  C  CD     . GLN B 1 221 ? 11.137  26.703 -76.716  1.00 49.03  ? 201 GLN B CD     1 
ATOM   8165  O  OE1    . GLN B 1 221 ? 12.364  26.659 -76.640  1.00 48.16  ? 201 GLN B OE1    1 
ATOM   8166  N  NE2    . GLN B 1 221 ? 10.356  26.773 -75.644  1.00 51.93  ? 201 GLN B NE2    1 
ATOM   8167  H  H      . GLN B 1 221 ? 10.625  24.533 -79.908  1.00 51.95  ? 201 GLN B H      1 
ATOM   8168  H  HA     . GLN B 1 221 ? 10.377  24.097 -77.334  1.00 53.93  ? 201 GLN B HA     1 
ATOM   8169  H  HB2    . GLN B 1 221 ? 8.862   25.799 -78.995  1.00 55.60  ? 201 GLN B HB2    1 
ATOM   8170  H  HB3    . GLN B 1 221 ? 8.730   25.793 -77.414  1.00 55.60  ? 201 GLN B HB3    1 
ATOM   8171  H  HG2    . GLN B 1 221 ? 11.105  26.518 -78.745  1.00 56.87  ? 201 GLN B HG2    1 
ATOM   8172  H  HG3    . GLN B 1 221 ? 10.053  27.578 -78.203  1.00 56.87  ? 201 GLN B HG3    1 
ATOM   8173  H  HE21   . GLN B 1 221 ? 9.502   26.814 -75.736  1.00 62.43  ? 201 GLN B HE21   1 
ATOM   8174  H  HE22   . GLN B 1 221 ? 10.704  26.778 -74.858  1.00 62.43  ? 201 GLN B HE22   1 
ATOM   8175  N  N      . ARG B 1 222 ? 8.117   22.762 -79.125  1.00 39.79  ? 202 ARG B N      1 
ATOM   8176  C  CA     . ARG B 1 222 ? 6.978   21.851 -79.133  1.00 37.61  ? 202 ARG B CA     1 
ATOM   8177  C  C      . ARG B 1 222 ? 7.381   20.379 -79.031  1.00 42.87  ? 202 ARG B C      1 
ATOM   8178  O  O      . ARG B 1 222 ? 6.521   19.506 -79.181  1.00 40.77  ? 202 ARG B O      1 
ATOM   8179  C  CB     . ARG B 1 222 ? 6.143   22.062 -80.399  1.00 35.62  ? 202 ARG B CB     1 
ATOM   8180  C  CG     . ARG B 1 222 ? 5.359   23.374 -80.457  1.00 35.84  ? 202 ARG B CG     1 
ATOM   8181  C  CD     . ARG B 1 222 ? 4.102   23.334 -79.593  1.00 36.26  ? 202 ARG B CD     1 
ATOM   8182  N  NE     . ARG B 1 222 ? 3.208   24.458 -79.876  1.00 34.02  ? 202 ARG B NE     1 
ATOM   8183  C  CZ     . ARG B 1 222 ? 3.206   25.623 -79.231  1.00 27.78  ? 202 ARG B CZ     1 
ATOM   8184  N  NH1    . ARG B 1 222 ? 4.053   25.857 -78.239  1.00 25.62  ? 202 ARG B NH1    1 
ATOM   8185  N  NH2    . ARG B 1 222 ? 2.344   26.563 -79.588  1.00 25.62  ? 202 ARG B NH2    1 
ATOM   8186  H  H      . ARG B 1 222 ? 8.413   22.946 -79.912  1.00 47.87  ? 202 ARG B H      1 
ATOM   8187  H  HA     . ARG B 1 222 ? 6.414   22.054 -78.371  1.00 45.25  ? 202 ARG B HA     1 
ATOM   8188  H  HB2    . ARG B 1 222 ? 6.737   22.044 -81.166  1.00 42.86  ? 202 ARG B HB2    1 
ATOM   8189  H  HB3    . ARG B 1 222 ? 5.502   21.337 -80.469  1.00 42.86  ? 202 ARG B HB3    1 
ATOM   8190  H  HG2    . ARG B 1 222 ? 5.922   24.095 -80.136  1.00 43.13  ? 202 ARG B HG2    1 
ATOM   8191  H  HG3    . ARG B 1 222 ? 5.089   23.543 -81.373  1.00 43.13  ? 202 ARG B HG3    1 
ATOM   8192  H  HD2    . ARG B 1 222 ? 3.620   22.511 -79.771  1.00 43.63  ? 202 ARG B HD2    1 
ATOM   8193  H  HD3    . ARG B 1 222 ? 4.357   23.377 -78.658  1.00 43.63  ? 202 ARG B HD3    1 
ATOM   8194  H  HE     . ARG B 1 222 ? 2.638   24.358 -80.511  1.00 40.94  ? 202 ARG B HE     1 
ATOM   8195  H  HH11   . ARG B 1 222 ? 4.616   25.251 -78.002  1.00 30.87  ? 202 ARG B HH11   1 
ATOM   8196  H  HH12   . ARG B 1 222 ? 4.039   26.614 -77.831  1.00 30.87  ? 202 ARG B HH12   1 
ATOM   8197  H  HH21   . ARG B 1 222 ? 1.791   26.419 -80.230  1.00 30.86  ? 202 ARG B HH21   1 
ATOM   8198  H  HH22   . ARG B 1 222 ? 2.336   27.318 -79.175  1.00 30.86  ? 202 ARG B HH22   1 
ATOM   8199  N  N      . ASN B 1 223 ? 8.661   20.084 -78.790  1.00 48.13  ? 203 ASN B N      1 
ATOM   8200  C  CA     . ASN B 1 223 ? 9.138   18.710 -78.604  1.00 49.43  ? 203 ASN B CA     1 
ATOM   8201  C  C      . ASN B 1 223 ? 8.961   17.847 -79.854  1.00 45.84  ? 203 ASN B C      1 
ATOM   8202  O  O      . ASN B 1 223 ? 8.860   16.622 -79.759  1.00 45.61  ? 203 ASN B O      1 
ATOM   8203  C  CB     . ASN B 1 223 ? 8.448   18.040 -77.409  1.00 53.68  ? 203 ASN B CB     1 
ATOM   8204  C  CG     . ASN B 1 223 ? 9.188   18.261 -76.107  1.00 60.82  ? 203 ASN B CG     1 
ATOM   8205  O  OD1    . ASN B 1 223 ? 10.408  18.112 -76.041  1.00 64.34  ? 203 ASN B OD1    1 
ATOM   8206  N  ND2    . ASN B 1 223 ? 8.452   18.614 -75.059  1.00 63.12  ? 203 ASN B ND2    1 
ATOM   8207  H  H      . ASN B 1 223 ? 9.284   20.674 -78.729  1.00 57.88  ? 203 ASN B H      1 
ATOM   8208  H  HA     . ASN B 1 223 ? 10.088  18.742 -78.408  1.00 59.43  ? 203 ASN B HA     1 
ATOM   8209  H  HB2    . ASN B 1 223 ? 7.556   18.408 -77.312  1.00 64.53  ? 203 ASN B HB2    1 
ATOM   8210  H  HB3    . ASN B 1 223 ? 8.398   17.085 -77.567  1.00 64.53  ? 203 ASN B HB3    1 
ATOM   8211  H  HD21   . ASN B 1 223 ? 8.826   18.751 -74.297  1.00 75.86  ? 203 ASN B HD21   1 
ATOM   8212  H  HD22   . ASN B 1 223 ? 7.601   18.706 -75.143  1.00 75.86  ? 203 ASN B HD22   1 
ATOM   8213  N  N      . HIS B 1 224 ? 8.935   18.455 -81.040  1.00 43.64  ? 204 HIS B N      1 
ATOM   8214  C  CA     . HIS B 1 224 ? 8.935   17.680 -82.275  1.00 41.42  ? 204 HIS B CA     1 
ATOM   8215  C  C      . HIS B 1 224 ? 10.338  17.358 -82.782  1.00 38.74  ? 204 HIS B C      1 
ATOM   8216  O  O      . HIS B 1 224 ? 10.472  16.572 -83.725  1.00 40.30  ? 204 HIS B O      1 
ATOM   8217  C  CB     . HIS B 1 224 ? 8.164   18.421 -83.374  1.00 42.37  ? 204 HIS B CB     1 
ATOM   8218  C  CG     . HIS B 1 224 ? 6.710   18.610 -83.072  1.00 45.79  ? 204 HIS B CG     1 
ATOM   8219  N  ND1    . HIS B 1 224 ? 5.794   17.583 -83.148  1.00 47.76  ? 204 HIS B ND1    1 
ATOM   8220  C  CD2    . HIS B 1 224 ? 6.013   19.710 -82.702  1.00 46.83  ? 204 HIS B CD2    1 
ATOM   8221  C  CE1    . HIS B 1 224 ? 4.596   18.041 -82.833  1.00 48.52  ? 204 HIS B CE1    1 
ATOM   8222  N  NE2    . HIS B 1 224 ? 4.701   19.329 -82.558  1.00 47.44  ? 204 HIS B NE2    1 
ATOM   8223  H  H      . HIS B 1 224 ? 8.917   19.308 -81.154  1.00 52.49  ? 204 HIS B H      1 
ATOM   8224  H  HA     . HIS B 1 224 ? 8.481   16.838 -82.113  1.00 49.82  ? 204 HIS B HA     1 
ATOM   8225  H  HB2    . HIS B 1 224 ? 8.559   19.299 -83.494  1.00 50.96  ? 204 HIS B HB2    1 
ATOM   8226  H  HB3    . HIS B 1 224 ? 8.232   17.915 -84.199  1.00 50.96  ? 204 HIS B HB3    1 
ATOM   8227  H  HD2    . HIS B 1 224 ? 6.358   20.563 -82.567  1.00 56.31  ? 204 HIS B HD2    1 
ATOM   8228  H  HE1    . HIS B 1 224 ? 3.811   17.542 -82.809  1.00 58.35  ? 204 HIS B HE1    1 
ATOM   8229  H  HE2    . HIS B 1 224 ? 4.053   19.845 -82.327  1.00 57.05  ? 204 HIS B HE2    1 
ATOM   8230  N  N      . LEU B 1 225 ? 11.377  17.933 -82.180  1.00 33.50  ? 205 LEU B N      1 
ATOM   8231  C  CA     . LEU B 1 225 ? 12.762  17.620 -82.502  1.00 30.61  ? 205 LEU B CA     1 
ATOM   8232  C  C      . LEU B 1 225 ? 13.543  17.459 -81.206  1.00 29.93  ? 205 LEU B C      1 
ATOM   8233  O  O      . LEU B 1 225 ? 13.066  17.808 -80.123  1.00 22.67  ? 205 LEU B O      1 
ATOM   8234  C  CB     . LEU B 1 225 ? 13.400  18.710 -83.374  1.00 33.82  ? 205 LEU B CB     1 
ATOM   8235  C  CG     . LEU B 1 225 ? 12.844  18.888 -84.787  1.00 36.87  ? 205 LEU B CG     1 
ATOM   8236  C  CD1    . LEU B 1 225 ? 13.323  20.206 -85.368  1.00 37.73  ? 205 LEU B CD1    1 
ATOM   8237  C  CD2    . LEU B 1 225 ? 13.258  17.725 -85.680  1.00 37.20  ? 205 LEU B CD2    1 
ATOM   8238  H  H      . LEU B 1 225 ? 11.299  18.527 -81.562  1.00 40.32  ? 205 LEU B H      1 
ATOM   8239  H  HA     . LEU B 1 225 ? 12.798  16.781 -82.986  1.00 36.84  ? 205 LEU B HA     1 
ATOM   8240  H  HB2    . LEU B 1 225 ? 13.297  19.560 -82.918  1.00 40.70  ? 205 LEU B HB2    1 
ATOM   8241  H  HB3    . LEU B 1 225 ? 14.345  18.509 -83.464  1.00 40.70  ? 205 LEU B HB3    1 
ATOM   8242  H  HG     . LEU B 1 225 ? 11.875  18.909 -84.747  1.00 44.36  ? 205 LEU B HG     1 
ATOM   8243  H  HD11   . LEU B 1 225 ? 12.963  20.305 -86.263  1.00 45.39  ? 205 LEU B HD11   1 
ATOM   8244  H  HD12   . LEU B 1 225 ? 13.013  20.931 -84.803  1.00 45.39  ? 205 LEU B HD12   1 
ATOM   8245  H  HD13   . LEU B 1 225 ? 14.293  20.202 -85.400  1.00 45.39  ? 205 LEU B HD13   1 
ATOM   8246  H  HD21   . LEU B 1 225 ? 12.892  17.864 -86.568  1.00 44.75  ? 205 LEU B HD21   1 
ATOM   8247  H  HD22   . LEU B 1 225 ? 14.227  17.690 -85.723  1.00 44.75  ? 205 LEU B HD22   1 
ATOM   8248  H  HD23   . LEU B 1 225 ? 12.913  16.900 -85.305  1.00 44.75  ? 205 LEU B HD23   1 
ATOM   8249  N  N      . GLN B 1 226 ? 14.761  16.933 -81.323  1.00 41.08  ? 206 GLN B N      1 
ATOM   8250  C  CA     . GLN B 1 226 ? 15.623  16.714 -80.171  1.00 47.57  ? 206 GLN B CA     1 
ATOM   8251  C  C      . GLN B 1 226 ? 16.900  17.533 -80.317  1.00 46.58  ? 206 GLN B C      1 
ATOM   8252  O  O      . GLN B 1 226 ? 17.452  17.652 -81.416  1.00 48.17  ? 206 GLN B O      1 
ATOM   8253  C  CB     . GLN B 1 226 ? 15.953  15.227 -80.022  1.00 50.24  ? 206 GLN B CB     1 
ATOM   8254  C  CG     . GLN B 1 226 ? 14.715  14.361 -79.802  1.00 54.40  ? 206 GLN B CG     1 
ATOM   8255  C  CD     . GLN B 1 226 ? 13.883  14.797 -78.611  1.00 57.51  ? 206 GLN B CD     1 
ATOM   8256  O  OE1    . GLN B 1 226 ? 12.738  15.222 -78.767  1.00 58.14  ? 206 GLN B OE1    1 
ATOM   8257  N  NE2    . GLN B 1 226 ? 14.453  14.698 -77.418  1.00 58.53  ? 206 GLN B NE2    1 
ATOM   8258  H  H      . GLN B 1 226 ? 15.112  16.692 -82.070  1.00 49.42  ? 206 GLN B H      1 
ATOM   8259  H  HA     . GLN B 1 226 ? 15.165  17.006 -79.368  1.00 57.21  ? 206 GLN B HA     1 
ATOM   8260  H  HB2    . GLN B 1 226 ? 16.394  14.920 -80.829  1.00 60.40  ? 206 GLN B HB2    1 
ATOM   8261  H  HB3    . GLN B 1 226 ? 16.540  15.110 -79.259  1.00 60.40  ? 206 GLN B HB3    1 
ATOM   8262  H  HG2    . GLN B 1 226 ? 14.153  14.409 -80.591  1.00 65.40  ? 206 GLN B HG2    1 
ATOM   8263  H  HG3    . GLN B 1 226 ? 14.995  13.445 -79.651  1.00 65.40  ? 206 GLN B HG3    1 
ATOM   8264  H  HE21   . GLN B 1 226 ? 15.256  14.399 -77.348  1.00 70.35  ? 206 GLN B HE21   1 
ATOM   8265  H  HE22   . GLN B 1 226 ? 14.019  14.933 -76.714  1.00 70.35  ? 206 GLN B HE22   1 
ATOM   8266  N  N      . PHE B 1 227 ? 17.364  18.093 -79.202  1.00 41.60  ? 207 PHE B N      1 
ATOM   8267  C  CA     . PHE B 1 227 ? 18.450  19.065 -79.231  1.00 38.38  ? 207 PHE B CA     1 
ATOM   8268  C  C      . PHE B 1 227 ? 19.758  18.431 -79.696  1.00 36.88  ? 207 PHE B C      1 
ATOM   8269  O  O      . PHE B 1 227 ? 20.059  17.278 -79.377  1.00 32.40  ? 207 PHE B O      1 
ATOM   8270  C  CB     . PHE B 1 227 ? 18.644  19.682 -77.847  1.00 36.69  ? 207 PHE B CB     1 
ATOM   8271  C  CG     . PHE B 1 227 ? 19.711  20.736 -77.802  1.00 36.65  ? 207 PHE B CG     1 
ATOM   8272  C  CD1    . PHE B 1 227 ? 19.439  22.032 -78.204  1.00 35.85  ? 207 PHE B CD1    1 
ATOM   8273  C  CD2    . PHE B 1 227 ? 20.990  20.428 -77.371  1.00 38.33  ? 207 PHE B CD2    1 
ATOM   8274  C  CE1    . PHE B 1 227 ? 20.418  23.004 -78.168  1.00 35.88  ? 207 PHE B CE1    1 
ATOM   8275  C  CE2    . PHE B 1 227 ? 21.975  21.395 -77.334  1.00 38.56  ? 207 PHE B CE2    1 
ATOM   8276  C  CZ     . PHE B 1 227 ? 21.688  22.685 -77.733  1.00 37.37  ? 207 PHE B CZ     1 
ATOM   8277  H  H      . PHE B 1 227 ? 17.065  17.924 -78.413  1.00 50.04  ? 207 PHE B H      1 
ATOM   8278  H  HA     . PHE B 1 227 ? 18.223  19.777 -79.850  1.00 46.18  ? 207 PHE B HA     1 
ATOM   8279  H  HB2    . PHE B 1 227 ? 17.810  20.091 -77.567  1.00 44.14  ? 207 PHE B HB2    1 
ATOM   8280  H  HB3    . PHE B 1 227 ? 18.892  18.981 -77.224  1.00 44.14  ? 207 PHE B HB3    1 
ATOM   8281  H  HD1    . PHE B 1 227 ? 18.584  22.252 -78.497  1.00 43.13  ? 207 PHE B HD1    1 
ATOM   8282  H  HD2    . PHE B 1 227 ? 21.187  19.560 -77.100  1.00 46.11  ? 207 PHE B HD2    1 
ATOM   8283  H  HE1    . PHE B 1 227 ? 20.223  23.872 -78.438  1.00 43.18  ? 207 PHE B HE1    1 
ATOM   8284  H  HE2    . PHE B 1 227 ? 22.830  21.178 -77.040  1.00 46.40  ? 207 PHE B HE2    1 
ATOM   8285  H  HZ     . PHE B 1 227 ? 22.350  23.338 -77.708  1.00 44.96  ? 207 PHE B HZ     1 
ATOM   8286  N  N      . VAL B 1 228 ? 20.539  19.205 -80.454  1.00 38.31  ? 208 VAL B N      1 
ATOM   8287  C  CA     . VAL B 1 228 ? 21.835  18.774 -80.958  1.00 35.13  ? 208 VAL B CA     1 
ATOM   8288  C  C      . VAL B 1 228 ? 22.848  19.876 -80.664  1.00 35.35  ? 208 VAL B C      1 
ATOM   8289  O  O      . VAL B 1 228 ? 22.692  21.000 -81.148  1.00 36.18  ? 208 VAL B O      1 
ATOM   8290  C  CB     . VAL B 1 228 ? 21.806  18.470 -82.466  1.00 30.90  ? 208 VAL B CB     1 
ATOM   8291  C  CG1    . VAL B 1 228 ? 23.171  17.981 -82.939  1.00 30.57  ? 208 VAL B CG1    1 
ATOM   8292  C  CG2    . VAL B 1 228 ? 20.735  17.439 -82.780  1.00 30.52  ? 208 VAL B CG2    1 
ATOM   8293  H  H      . VAL B 1 228 ? 20.330  20.004 -80.693  1.00 46.09  ? 208 VAL B H      1 
ATOM   8294  H  HA     . VAL B 1 228 ? 22.112  17.971 -80.490  1.00 42.27  ? 208 VAL B HA     1 
ATOM   8295  H  HB     . VAL B 1 228 ? 21.593  19.284 -82.950  1.00 37.20  ? 208 VAL B HB     1 
ATOM   8296  H  HG11   . VAL B 1 228 ? 23.128  17.797 -83.890  1.00 36.81  ? 208 VAL B HG11   1 
ATOM   8297  H  HG12   . VAL B 1 228 ? 23.831  18.671 -82.765  1.00 36.81  ? 208 VAL B HG12   1 
ATOM   8298  H  HG13   . VAL B 1 228 ? 23.401  17.173 -82.454  1.00 36.81  ? 208 VAL B HG13   1 
ATOM   8299  H  HG21   . VAL B 1 228 ? 20.736  17.264 -83.734  1.00 36.74  ? 208 VAL B HG21   1 
ATOM   8300  H  HG22   . VAL B 1 228 ? 20.930  16.623 -82.293  1.00 36.74  ? 208 VAL B HG22   1 
ATOM   8301  H  HG23   . VAL B 1 228 ? 19.872  17.788 -82.508  1.00 36.74  ? 208 VAL B HG23   1 
ATOM   8302  N  N      . PRO B 1 229 ? 23.897  19.619 -79.883  1.00 36.69  ? 209 PRO B N      1 
ATOM   8303  C  CA     . PRO B 1 229 ? 24.888  20.671 -79.604  1.00 33.13  ? 209 PRO B CA     1 
ATOM   8304  C  C      . PRO B 1 229 ? 25.624  21.081 -80.868  1.00 29.76  ? 209 PRO B C      1 
ATOM   8305  O  O      . PRO B 1 229 ? 26.130  20.222 -81.605  1.00 26.24  ? 209 PRO B O      1 
ATOM   8306  C  CB     . PRO B 1 229 ? 25.845  20.008 -78.600  1.00 34.59  ? 209 PRO B CB     1 
ATOM   8307  C  CG     . PRO B 1 229 ? 25.103  18.847 -78.051  1.00 36.06  ? 209 PRO B CG     1 
ATOM   8308  C  CD     . PRO B 1 229 ? 24.197  18.381 -79.143  1.00 37.88  ? 209 PRO B CD     1 
ATOM   8309  H  HA     . PRO B 1 229 ? 24.468  21.446 -79.198  1.00 39.87  ? 209 PRO B HA     1 
ATOM   8310  H  HB2    . PRO B 1 229 ? 26.647  19.714 -79.060  1.00 41.62  ? 209 PRO B HB2    1 
ATOM   8311  H  HB3    . PRO B 1 229 ? 26.066  20.637 -77.896  1.00 41.62  ? 209 PRO B HB3    1 
ATOM   8312  H  HG2    . PRO B 1 229 ? 25.729  18.148 -77.806  1.00 43.40  ? 209 PRO B HG2    1 
ATOM   8313  H  HG3    . PRO B 1 229 ? 24.587  19.128 -77.279  1.00 43.40  ? 209 PRO B HG3    1 
ATOM   8314  H  HD2    . PRO B 1 229 ? 24.656  17.747 -79.717  1.00 45.57  ? 209 PRO B HD2    1 
ATOM   8315  H  HD3    . PRO B 1 229 ? 23.385  18.002 -78.772  1.00 45.57  ? 209 PRO B HD3    1 
ATOM   8316  N  N      . PRO B 1 230 ? 25.712  22.384 -81.158  1.00 31.93  ? 210 PRO B N      1 
ATOM   8317  C  CA     . PRO B 1 230 ? 26.469  22.813 -82.347  1.00 34.45  ? 210 PRO B CA     1 
ATOM   8318  C  C      . PRO B 1 230 ? 27.931  22.395 -82.343  1.00 36.59  ? 210 PRO B C      1 
ATOM   8319  O  O      . PRO B 1 230 ? 28.515  22.232 -83.422  1.00 36.62  ? 210 PRO B O      1 
ATOM   8320  C  CB     . PRO B 1 230 ? 26.325  24.340 -82.319  1.00 31.52  ? 210 PRO B CB     1 
ATOM   8321  C  CG     . PRO B 1 230 ? 25.057  24.583 -81.592  1.00 29.08  ? 210 PRO B CG     1 
ATOM   8322  C  CD     . PRO B 1 230 ? 24.967  23.505 -80.555  1.00 30.55  ? 210 PRO B CD     1 
ATOM   8323  H  HA     . PRO B 1 230 ? 26.045  22.471 -83.151  1.00 41.46  ? 210 PRO B HA     1 
ATOM   8324  H  HB2    . PRO B 1 230 ? 27.075  24.732 -81.844  1.00 37.94  ? 210 PRO B HB2    1 
ATOM   8325  H  HB3    . PRO B 1 230 ? 26.273  24.682 -83.225  1.00 37.94  ? 210 PRO B HB3    1 
ATOM   8326  H  HG2    . PRO B 1 230 ? 25.085  25.457 -81.172  1.00 35.01  ? 210 PRO B HG2    1 
ATOM   8327  H  HG3    . PRO B 1 230 ? 24.312  24.524 -82.210  1.00 35.01  ? 210 PRO B HG3    1 
ATOM   8328  H  HD2    . PRO B 1 230 ? 25.394  23.790 -79.732  1.00 36.78  ? 210 PRO B HD2    1 
ATOM   8329  H  HD3    . PRO B 1 230 ? 24.041  23.255 -80.407  1.00 36.78  ? 210 PRO B HD3    1 
ATOM   8330  N  N      . SER B 1 231 ? 28.545  22.216 -81.171  1.00 39.15  ? 211 SER B N      1 
ATOM   8331  C  CA     . SER B 1 231 ? 29.971  21.910 -81.103  1.00 44.10  ? 211 SER B CA     1 
ATOM   8332  C  C      . SER B 1 231 ? 30.313  20.499 -81.567  1.00 50.82  ? 211 SER B C      1 
ATOM   8333  O  O      . SER B 1 231 ? 31.483  20.116 -81.476  1.00 57.69  ? 211 SER B O      1 
ATOM   8334  C  CB     . SER B 1 231 ? 30.477  22.100 -79.672  1.00 43.59  ? 211 SER B CB     1 
ATOM   8335  O  OG     . SER B 1 231 ? 29.770  21.271 -78.767  1.00 44.01  ? 211 SER B OG     1 
ATOM   8336  H  H      . SER B 1 231 ? 28.157  22.267 -80.405  1.00 47.09  ? 211 SER B H      1 
ATOM   8337  H  HA     . SER B 1 231 ? 30.451  22.533 -81.672  1.00 53.04  ? 211 SER B HA     1 
ATOM   8338  H  HB2    . SER B 1 231 ? 31.419  21.872 -79.639  1.00 52.43  ? 211 SER B HB2    1 
ATOM   8339  H  HB3    . SER B 1 231 ? 30.351  23.027 -79.414  1.00 52.43  ? 211 SER B HB3    1 
ATOM   8340  H  HG     . SER B 1 231 ? 29.870  20.464 -78.978  1.00 52.93  ? 211 SER B HG     1 
ATOM   8341  N  N      . THR B 1 232 ? 29.346  19.725 -82.056  1.00 46.87  ? 212 THR B N      1 
ATOM   8342  C  CA     . THR B 1 232 ? 29.602  18.368 -82.513  1.00 41.02  ? 212 THR B CA     1 
ATOM   8343  C  C      . THR B 1 232 ? 29.798  18.265 -84.021  1.00 39.37  ? 212 THR B C      1 
ATOM   8344  O  O      . THR B 1 232 ? 30.250  17.218 -84.495  1.00 38.35  ? 212 THR B O      1 
ATOM   8345  C  CB     . THR B 1 232 ? 28.454  17.442 -82.088  1.00 39.49  ? 212 THR B CB     1 
ATOM   8346  O  OG1    . THR B 1 232 ? 27.247  17.825 -82.759  1.00 39.65  ? 212 THR B OG1    1 
ATOM   8347  C  CG2    . THR B 1 232 ? 28.237  17.523 -80.582  1.00 36.62  ? 212 THR B CG2    1 
ATOM   8348  H  H      . THR B 1 232 ? 28.524  19.969 -82.132  1.00 56.36  ? 212 THR B H      1 
ATOM   8349  H  HA     . THR B 1 232 ? 30.412  18.046 -82.089  1.00 49.34  ? 212 THR B HA     1 
ATOM   8350  H  HB     . THR B 1 232 ? 28.675  16.526 -82.318  1.00 47.51  ? 212 THR B HB     1 
ATOM   8351  H  HG1    . THR B 1 232 ? 27.048  18.617 -82.561  1.00 47.70  ? 212 THR B HG1    1 
ATOM   8352  H  HG21   . THR B 1 232 ? 27.511  16.936 -80.319  1.00 44.06  ? 212 THR B HG21   1 
ATOM   8353  H  HG22   . THR B 1 232 ? 29.045  17.253 -80.116  1.00 44.06  ? 212 THR B HG22   1 
ATOM   8354  H  HG23   . THR B 1 232 ? 28.015  18.432 -80.328  1.00 44.06  ? 212 THR B HG23   1 
ATOM   8355  N  N      . ILE B 1 233 ? 29.473  19.308 -84.778  1.00 42.40  ? 213 ILE B N      1 
ATOM   8356  C  CA     . ILE B 1 233 ? 29.614  19.276 -86.231  1.00 43.23  ? 213 ILE B CA     1 
ATOM   8357  C  C      . ILE B 1 233 ? 31.086  19.440 -86.587  1.00 42.10  ? 213 ILE B C      1 
ATOM   8358  O  O      . ILE B 1 233 ? 31.742  20.391 -86.148  1.00 37.00  ? 213 ILE B O      1 
ATOM   8359  C  CB     . ILE B 1 233 ? 28.758  20.375 -86.884  1.00 42.95  ? 213 ILE B CB     1 
ATOM   8360  C  CG1    . ILE B 1 233 ? 27.293  20.258 -86.446  1.00 44.94  ? 213 ILE B CG1    1 
ATOM   8361  C  CG2    . ILE B 1 233 ? 28.861  20.307 -88.404  1.00 41.14  ? 213 ILE B CG2    1 
ATOM   8362  C  CD1    . ILE B 1 233 ? 26.604  18.968 -86.854  1.00 47.02  ? 213 ILE B CD1    1 
ATOM   8363  H  H      . ILE B 1 233 ? 29.167  20.052 -84.473  1.00 51.00  ? 213 ILE B H      1 
ATOM   8364  H  HA     . ILE B 1 233 ? 29.312  18.416 -86.564  1.00 51.99  ? 213 ILE B HA     1 
ATOM   8365  H  HB     . ILE B 1 233 ? 29.096  21.237 -86.593  1.00 51.66  ? 213 ILE B HB     1 
ATOM   8366  H  HG12   . ILE B 1 233 ? 27.254  20.317 -85.478  1.00 54.05  ? 213 ILE B HG12   1 
ATOM   8367  H  HG13   . ILE B 1 233 ? 26.794  20.992 -86.837  1.00 54.05  ? 213 ILE B HG13   1 
ATOM   8368  H  HG21   . ILE B 1 233 ? 28.314  21.010 -88.789  1.00 49.48  ? 213 ILE B HG21   1 
ATOM   8369  H  HG22   . ILE B 1 233 ? 29.788  20.430 -88.663  1.00 49.48  ? 213 ILE B HG22   1 
ATOM   8370  H  HG23   . ILE B 1 233 ? 28.546  19.440 -88.702  1.00 49.48  ? 213 ILE B HG23   1 
ATOM   8371  H  HD11   . ILE B 1 233 ? 25.688  18.985 -86.536  1.00 56.55  ? 213 ILE B HD11   1 
ATOM   8372  H  HD12   . ILE B 1 233 ? 26.617  18.896 -87.822  1.00 56.55  ? 213 ILE B HD12   1 
ATOM   8373  H  HD13   . ILE B 1 233 ? 27.078  18.219 -86.460  1.00 56.55  ? 213 ILE B HD13   1 
ATOM   8374  N  N      . ASP B 1 234 ? 31.609  18.511 -87.387  1.00 45.61  ? 214 ASP B N      1 
ATOM   8375  C  CA     . ASP B 1 234 ? 33.015  18.501 -87.777  1.00 54.21  ? 214 ASP B CA     1 
ATOM   8376  C  C      . ASP B 1 234 ? 33.113  18.580 -89.294  1.00 52.60  ? 214 ASP B C      1 
ATOM   8377  O  O      . ASP B 1 234 ? 32.623  17.690 -89.998  1.00 57.49  ? 214 ASP B O      1 
ATOM   8378  C  CB     . ASP B 1 234 ? 33.719  17.245 -87.257  1.00 58.87  ? 214 ASP B CB     1 
ATOM   8379  C  CG     . ASP B 1 234 ? 35.232  17.340 -87.353  1.00 62.42  ? 214 ASP B CG     1 
ATOM   8380  O  OD1    . ASP B 1 234 ? 35.732  18.075 -88.230  1.00 64.21  ? 214 ASP B OD1    1 
ATOM   8381  O  OD2    . ASP B 1 234 ? 35.921  16.682 -86.546  1.00 63.64  ? 214 ASP B OD2    1 
ATOM   8382  H  H      . ASP B 1 234 ? 31.157  17.861 -87.722  1.00 54.84  ? 214 ASP B H      1 
ATOM   8383  H  HA     . ASP B 1 234 ? 33.458  19.277 -87.401  1.00 65.17  ? 214 ASP B HA     1 
ATOM   8384  H  HB2    . ASP B 1 234 ? 33.485  17.114 -86.325  1.00 70.76  ? 214 ASP B HB2    1 
ATOM   8385  H  HB3    . ASP B 1 234 ? 33.433  16.481 -87.782  1.00 70.76  ? 214 ASP B HB3    1 
ATOM   8386  N  N      . VAL B 1 235 ? 33.753  19.641 -89.794  1.00 42.79  ? 215 VAL B N      1 
ATOM   8387  C  CA     . VAL B 1 235 ? 33.911  19.820 -91.233  1.00 43.58  ? 215 VAL B CA     1 
ATOM   8388  C  C      . VAL B 1 235 ? 34.730  18.692 -91.841  1.00 50.28  ? 215 VAL B C      1 
ATOM   8389  O  O      . VAL B 1 235 ? 34.627  18.431 -93.044  1.00 50.02  ? 215 VAL B O      1 
ATOM   8390  C  CB     . VAL B 1 235 ? 34.552  21.194 -91.532  1.00 45.83  ? 215 VAL B CB     1 
ATOM   8391  C  CG1    . VAL B 1 235 ? 34.936  21.320 -93.010  1.00 48.89  ? 215 VAL B CG1    1 
ATOM   8392  C  CG2    . VAL B 1 235 ? 33.606  22.317 -91.137  1.00 43.91  ? 215 VAL B CG2    1 
ATOM   8393  H  H      . VAL B 1 235 ? 34.102  20.268 -89.319  1.00 51.47  ? 215 VAL B H      1 
ATOM   8394  H  HA     . VAL B 1 235 ? 33.034  19.805 -91.648  1.00 52.42  ? 215 VAL B HA     1 
ATOM   8395  H  HB     . VAL B 1 235 ? 35.361  21.286 -91.005  1.00 55.12  ? 215 VAL B HB     1 
ATOM   8396  H  HG11   . VAL B 1 235 ? 35.333  22.193 -93.159  1.00 58.78  ? 215 VAL B HG11   1 
ATOM   8397  H  HG12   . VAL B 1 235 ? 35.573  20.624 -93.231  1.00 58.78  ? 215 VAL B HG12   1 
ATOM   8398  H  HG13   . VAL B 1 235 ? 34.138  21.223 -93.553  1.00 58.78  ? 215 VAL B HG13   1 
ATOM   8399  H  HG21   . VAL B 1 235 ? 34.027  23.168 -91.333  1.00 52.81  ? 215 VAL B HG21   1 
ATOM   8400  H  HG22   . VAL B 1 235 ? 32.784  22.230 -91.644  1.00 52.81  ? 215 VAL B HG22   1 
ATOM   8401  H  HG23   . VAL B 1 235 ? 33.418  22.251 -90.187  1.00 52.81  ? 215 VAL B HG23   1 
ATOM   8402  N  N      . SER B 1 236 ? 35.546  18.013 -91.038  1.00 58.66  ? 216 SER B N      1 
ATOM   8403  C  CA     . SER B 1 236 ? 36.367  16.911 -91.520  1.00 62.04  ? 216 SER B CA     1 
ATOM   8404  C  C      . SER B 1 236 ? 35.571  15.628 -91.731  1.00 61.88  ? 216 SER B C      1 
ATOM   8405  O  O      . SER B 1 236 ? 36.173  14.593 -92.034  1.00 60.84  ? 216 SER B O      1 
ATOM   8406  C  CB     . SER B 1 236 ? 37.514  16.647 -90.540  1.00 63.44  ? 216 SER B CB     1 
ATOM   8407  O  OG     . SER B 1 236 ? 38.267  17.826 -90.305  1.00 64.58  ? 216 SER B OG     1 
ATOM   8408  H  H      . SER B 1 236 ? 35.641  18.175 -90.198  1.00 70.51  ? 216 SER B H      1 
ATOM   8409  H  HA     . SER B 1 236 ? 36.756  17.162 -92.372  1.00 74.57  ? 216 SER B HA     1 
ATOM   8410  H  HB2    . SER B 1 236 ? 37.144  16.337 -89.699  1.00 76.24  ? 216 SER B HB2    1 
ATOM   8411  H  HB3    . SER B 1 236 ? 38.098  15.970 -90.914  1.00 76.24  ? 216 SER B HB3    1 
ATOM   8412  H  HG     . SER B 1 236 ? 38.594  18.106 -91.026  1.00 77.61  ? 216 SER B HG     1 
ATOM   8413  N  N      . ARG B 1 237 ? 34.242  15.670 -91.578  1.00 67.57  ? 217 ARG B N      1 
ATOM   8414  C  CA     . ARG B 1 237 ? 33.406  14.486 -91.729  1.00 70.40  ? 217 ARG B CA     1 
ATOM   8415  C  C      . ARG B 1 237 ? 32.208  14.720 -92.644  1.00 68.29  ? 217 ARG B C      1 
ATOM   8416  O  O      . ARG B 1 237 ? 31.318  13.864 -92.700  1.00 70.12  ? 217 ARG B O      1 
ATOM   8417  C  CB     . ARG B 1 237 ? 32.902  14.001 -90.364  1.00 72.55  ? 217 ARG B CB     1 
ATOM   8418  C  CG     . ARG B 1 237 ? 33.979  13.507 -89.413  1.00 77.82  ? 217 ARG B CG     1 
ATOM   8419  C  CD     . ARG B 1 237 ? 33.429  13.393 -87.995  1.00 81.16  ? 217 ARG B CD     1 
ATOM   8420  N  NE     . ARG B 1 237 ? 32.650  12.171 -87.810  1.00 83.97  ? 217 ARG B NE     1 
ATOM   8421  C  CZ     . ARG B 1 237 ? 31.985  11.861 -86.701  1.00 85.54  ? 217 ARG B CZ     1 
ATOM   8422  N  NH1    . ARG B 1 237 ? 31.994  12.685 -85.661  1.00 85.97  ? 217 ARG B NH1    1 
ATOM   8423  N  NH2    . ARG B 1 237 ? 31.305  10.725 -86.631  1.00 86.72  ? 217 ARG B NH2    1 
ATOM   8424  H  H      . ARG B 1 237 ? 33.802  16.383 -91.384  1.00 81.21  ? 217 ARG B H      1 
ATOM   8425  H  HA     . ARG B 1 237 ? 33.940  13.775 -92.118  1.00 84.59  ? 217 ARG B HA     1 
ATOM   8426  H  HB2    . ARG B 1 237 ? 32.442  14.735 -89.928  1.00 87.18  ? 217 ARG B HB2    1 
ATOM   8427  H  HB3    . ARG B 1 237 ? 32.282  13.269 -90.508  1.00 87.18  ? 217 ARG B HB3    1 
ATOM   8428  H  HG2    . ARG B 1 237 ? 34.284  12.631 -89.696  1.00 93.50  ? 217 ARG B HG2    1 
ATOM   8429  H  HG3    . ARG B 1 237 ? 34.717  14.137 -89.405  1.00 93.50  ? 217 ARG B HG3    1 
ATOM   8430  H  HD2    . ARG B 1 237 ? 34.167  13.379 -87.366  1.00 97.51  ? 217 ARG B HD2    1 
ATOM   8431  H  HD3    . ARG B 1 237 ? 32.851  14.150 -87.815  1.00 97.51  ? 217 ARG B HD3    1 
ATOM   8432  H  HE     . ARG B 1 237 ? 32.619  11.613 -88.464  1.00 100.88 ? 217 ARG B HE     1 
ATOM   8433  H  HH11   . ARG B 1 237 ? 32.433  13.424 -85.701  1.00 103.28 ? 217 ARG B HH11   1 
ATOM   8434  H  HH12   . ARG B 1 237 ? 31.562  12.480 -84.946  1.00 103.28 ? 217 ARG B HH12   1 
ATOM   8435  H  HH21   . ARG B 1 237 ? 31.296  10.188 -87.303  1.00 104.18 ? 217 ARG B HH21   1 
ATOM   8436  H  HH22   . ARG B 1 237 ? 30.874  10.525 -85.914  1.00 104.18 ? 217 ARG B HH22   1 
ATOM   8437  N  N      . VAL B 1 238 ? 32.158  15.840 -93.362  1.00 62.34  ? 218 VAL B N      1 
ATOM   8438  C  CA     . VAL B 1 238 ? 31.030  16.152 -94.231  1.00 59.91  ? 218 VAL B CA     1 
ATOM   8439  C  C      . VAL B 1 238 ? 31.459  15.963 -95.679  1.00 64.14  ? 218 VAL B C      1 
ATOM   8440  O  O      . VAL B 1 238 ? 32.630  16.138 -96.033  1.00 66.36  ? 218 VAL B O      1 
ATOM   8441  C  CB     . VAL B 1 238 ? 30.503  17.584 -93.984  1.00 55.29  ? 218 VAL B CB     1 
ATOM   8442  C  CG1    . VAL B 1 238 ? 31.556  18.624 -94.340  1.00 53.50  ? 218 VAL B CG1    1 
ATOM   8443  C  CG2    . VAL B 1 238 ? 29.212  17.827 -94.759  1.00 55.18  ? 218 VAL B CG2    1 
ATOM   8444  H  H      . VAL B 1 238 ? 32.773  16.441 -93.361  1.00 74.93  ? 218 VAL B H      1 
ATOM   8445  H  HA     . VAL B 1 238 ? 30.308  15.530 -94.048  1.00 72.01  ? 218 VAL B HA     1 
ATOM   8446  H  HB     . VAL B 1 238 ? 30.301  17.681 -93.040  1.00 66.46  ? 218 VAL B HB     1 
ATOM   8447  H  HG11   . VAL B 1 238 ? 31.195  19.508 -94.174  1.00 64.32  ? 218 VAL B HG11   1 
ATOM   8448  H  HG12   . VAL B 1 238 ? 32.342  18.478 -93.790  1.00 64.32  ? 218 VAL B HG12   1 
ATOM   8449  H  HG13   . VAL B 1 238 ? 31.787  18.531 -95.278  1.00 64.32  ? 218 VAL B HG13   1 
ATOM   8450  H  HG21   . VAL B 1 238 ? 28.905  18.730 -94.585  1.00 66.33  ? 218 VAL B HG21   1 
ATOM   8451  H  HG22   . VAL B 1 238 ? 29.387  17.713 -95.706  1.00 66.33  ? 218 VAL B HG22   1 
ATOM   8452  H  HG23   . VAL B 1 238 ? 28.543  17.188 -94.466  1.00 66.33  ? 218 VAL B HG23   1 
ATOM   8453  N  N      . GLU B 1 239 ? 30.475  15.602 -96.539  1.00 63.17  ? 219 GLU B N      1 
ATOM   8454  C  CA     . GLU B 1 239 ? 30.732  15.374 -97.956  1.00 68.55  ? 219 GLU B CA     1 
ATOM   8455  C  C      . GLU B 1 239 ? 30.664  16.690 -98.733  1.00 64.03  ? 219 GLU B C      1 
ATOM   8456  O  O      . GLU B 1 239 ? 29.757  17.496 -98.505  1.00 57.74  ? 219 GLU B O      1 
ATOM   8457  C  CB     . GLU B 1 239 ? 29.725  14.384 -98.532  1.00 81.62  ? 219 GLU B CB     1 
ATOM   8458  C  CG     . GLU B 1 239 ? 29.918  12.964 -98.019  1.00 95.35  ? 219 GLU B CG     1 
ATOM   8459  C  CD     . GLU B 1 239 ? 31.075  12.247 -98.693  1.00 109.35 ? 219 GLU B CD     1 
ATOM   8460  O  OE1    . GLU B 1 239 ? 31.702  12.840 -99.599  1.00 114.59 ? 219 GLU B OE1    1 
ATOM   8461  O  OE2    . GLU B 1 239 ? 31.364  11.093 -98.313  1.00 114.06 ? 219 GLU B OE2    1 
ATOM   8462  H  H      . GLU B 1 239 ? 29.654  15.486 -96.311  1.00 75.92  ? 219 GLU B H      1 
ATOM   8463  H  HA     . GLU B 1 239 ? 31.621  15.002 -98.065  1.00 82.38  ? 219 GLU B HA     1 
ATOM   8464  H  HB2    . GLU B 1 239 ? 28.830  14.669 -98.291  1.00 98.07  ? 219 GLU B HB2    1 
ATOM   8465  H  HB3    . GLU B 1 239 ? 29.818  14.367 -99.498  1.00 98.07  ? 219 GLU B HB3    1 
ATOM   8466  H  HG2    . GLU B 1 239 ? 30.098  12.994 -97.066  1.00 114.54 ? 219 GLU B HG2    1 
ATOM   8467  H  HG3    . GLU B 1 239 ? 29.110  12.454 -98.188  1.00 114.54 ? 219 GLU B HG3    1 
ATOM   8468  N  N      . PRO B 1 240 ? 31.598  16.943 -99.655  1.00 70.74  ? 220 PRO B N      1 
ATOM   8469  C  CA     . PRO B 1 240 ? 31.518  18.186 -100.442 1.00 70.66  ? 220 PRO B CA     1 
ATOM   8470  C  C      . PRO B 1 240 ? 30.227  18.328 -101.229 1.00 63.58  ? 220 PRO B C      1 
ATOM   8471  O  O      . PRO B 1 240 ? 29.740  19.453 -101.401 1.00 63.48  ? 220 PRO B O      1 
ATOM   8472  C  CB     . PRO B 1 240 ? 32.737  18.090 -101.372 1.00 73.25  ? 220 PRO B CB     1 
ATOM   8473  C  CG     . PRO B 1 240 ? 33.661  17.134 -100.706 1.00 74.52  ? 220 PRO B CG     1 
ATOM   8474  C  CD     . PRO B 1 240 ? 32.791  16.150 -99.996  1.00 74.63  ? 220 PRO B CD     1 
ATOM   8475  H  HA     . PRO B 1 240 ? 31.622  18.955 -99.861  1.00 84.91  ? 220 PRO B HA     1 
ATOM   8476  H  HB2    . PRO B 1 240 ? 32.462  17.754 -102.239 1.00 88.02  ? 220 PRO B HB2    1 
ATOM   8477  H  HB3    . PRO B 1 240 ? 33.151  18.963 -101.458 1.00 88.02  ? 220 PRO B HB3    1 
ATOM   8478  H  HG2    . PRO B 1 240 ? 34.204  16.688 -101.375 1.00 89.54  ? 220 PRO B HG2    1 
ATOM   8479  H  HG3    . PRO B 1 240 ? 34.222  17.611 -100.074 1.00 89.54  ? 220 PRO B HG3    1 
ATOM   8480  H  HD2    . PRO B 1 240 ? 32.554  15.419 -100.588 1.00 89.67  ? 220 PRO B HD2    1 
ATOM   8481  H  HD3    . PRO B 1 240 ? 33.228  15.831 -99.191  1.00 89.67  ? 220 PRO B HD3    1 
ATOM   8482  N  N      . LEU B 1 241 ? 29.656  17.227 -101.717 1.00 56.89  ? 221 LEU B N      1 
ATOM   8483  C  CA     . LEU B 1 241 ? 28.388  17.250 -102.445 1.00 50.00  ? 221 LEU B CA     1 
ATOM   8484  C  C      . LEU B 1 241 ? 27.508  16.143 -101.882 1.00 53.09  ? 221 LEU B C      1 
ATOM   8485  O  O      . LEU B 1 241 ? 27.532  15.005 -102.373 1.00 50.79  ? 221 LEU B O      1 
ATOM   8486  C  CB     . LEU B 1 241 ? 28.606  17.075 -103.947 1.00 47.65  ? 221 LEU B CB     1 
ATOM   8487  C  CG     . LEU B 1 241 ? 27.367  17.273 -104.824 1.00 48.29  ? 221 LEU B CG     1 
ATOM   8488  C  CD1    . LEU B 1 241 ? 26.912  18.730 -104.794 1.00 49.05  ? 221 LEU B CD1    1 
ATOM   8489  C  CD2    . LEU B 1 241 ? 27.641  16.828 -106.254 1.00 50.91  ? 221 LEU B CD2    1 
ATOM   8490  H  H      . LEU B 1 241 ? 29.990  16.439 -101.636 1.00 68.38  ? 221 LEU B H      1 
ATOM   8491  H  HA     . LEU B 1 241 ? 27.945  18.100 -102.297 1.00 60.11  ? 221 LEU B HA     1 
ATOM   8492  H  HB2    . LEU B 1 241 ? 29.272  17.718 -104.236 1.00 57.30  ? 221 LEU B HB2    1 
ATOM   8493  H  HB3    . LEU B 1 241 ? 28.934  16.176 -104.106 1.00 57.30  ? 221 LEU B HB3    1 
ATOM   8494  H  HG     . LEU B 1 241 ? 26.645  16.728 -104.475 1.00 58.07  ? 221 LEU B HG     1 
ATOM   8495  H  HD11   . LEU B 1 241 ? 26.128  18.828 -105.356 1.00 58.98  ? 221 LEU B HD11   1 
ATOM   8496  H  HD12   . LEU B 1 241 ? 26.697  18.975 -103.880 1.00 58.98  ? 221 LEU B HD12   1 
ATOM   8497  H  HD13   . LEU B 1 241 ? 27.630  19.292 -105.126 1.00 58.98  ? 221 LEU B HD13   1 
ATOM   8498  H  HD21   . LEU B 1 241 ? 26.840  16.964 -106.785 1.00 61.21  ? 221 LEU B HD21   1 
ATOM   8499  H  HD22   . LEU B 1 241 ? 28.371  17.355 -106.614 1.00 61.21  ? 221 LEU B HD22   1 
ATOM   8500  H  HD23   . LEU B 1 241 ? 27.880  15.888 -106.251 1.00 61.21  ? 221 LEU B HD23   1 
ATOM   8501  N  N      . PRO B 1 242 ? 26.724  16.432 -100.846 1.00 56.18  ? 222 PRO B N      1 
ATOM   8502  C  CA     . PRO B 1 242 ? 25.920  15.384 -100.206 1.00 57.76  ? 222 PRO B CA     1 
ATOM   8503  C  C      . PRO B 1 242 ? 24.919  14.784 -101.176 1.00 51.71  ? 222 PRO B C      1 
ATOM   8504  O  O      . PRO B 1 242 ? 24.591  15.394 -102.205 1.00 46.57  ? 222 PRO B O      1 
ATOM   8505  C  CB     . PRO B 1 242 ? 25.211  16.127 -99.064  1.00 60.02  ? 222 PRO B CB     1 
ATOM   8506  C  CG     . PRO B 1 242 ? 26.062  17.318 -98.797  1.00 59.90  ? 222 PRO B CG     1 
ATOM   8507  C  CD     . PRO B 1 242 ? 26.625  17.714 -100.126 1.00 58.75  ? 222 PRO B CD     1 
ATOM   8508  H  HA     . PRO B 1 242 ? 26.488  14.686 -99.843  1.00 69.44  ? 222 PRO B HA     1 
ATOM   8509  H  HB2    . PRO B 1 242 ? 24.323  16.396 -99.350  1.00 72.14  ? 222 PRO B HB2    1 
ATOM   8510  H  HB3    . PRO B 1 242 ? 25.162  15.557 -98.281  1.00 72.14  ? 222 PRO B HB3    1 
ATOM   8511  H  HG2    . PRO B 1 242 ? 25.518  18.032 -98.430  1.00 71.99  ? 222 PRO B HG2    1 
ATOM   8512  H  HG3    . PRO B 1 242 ? 26.773  17.079 -98.182  1.00 71.99  ? 222 PRO B HG3    1 
ATOM   8513  H  HD2    . PRO B 1 242 ? 26.018  18.314 -100.586 1.00 70.62  ? 222 PRO B HD2    1 
ATOM   8514  H  HD3    . PRO B 1 242 ? 27.504  18.110 -100.018 1.00 70.62  ? 222 PRO B HD3    1 
ATOM   8515  N  N      . PRO B 1 243 ? 24.404  13.585 -100.881 1.00 52.55  ? 223 PRO B N      1 
ATOM   8516  C  CA     . PRO B 1 243 ? 23.444  12.947 -101.792 1.00 50.88  ? 223 PRO B CA     1 
ATOM   8517  C  C      . PRO B 1 243 ? 22.066  13.590 -101.749 1.00 48.32  ? 223 PRO B C      1 
ATOM   8518  O  O      . PRO B 1 243 ? 21.828  14.533 -100.986 1.00 41.86  ? 223 PRO B O      1 
ATOM   8519  C  CB     . PRO B 1 243 ? 23.404  11.495 -101.297 1.00 50.37  ? 223 PRO B CB     1 
ATOM   8520  C  CG     . PRO B 1 243 ? 23.779  11.575 -99.861  1.00 49.93  ? 223 PRO B CG     1 
ATOM   8521  C  CD     . PRO B 1 243 ? 24.746  12.720 -99.738  1.00 51.05  ? 223 PRO B CD     1 
ATOM   8522  H  HA     . PRO B 1 243 ? 23.779  12.967 -102.702 1.00 61.17  ? 223 PRO B HA     1 
ATOM   8523  H  HB2    . PRO B 1 243 ? 22.508  11.138 -101.400 1.00 60.56  ? 223 PRO B HB2    1 
ATOM   8524  H  HB3    . PRO B 1 243 ? 24.046  10.963 -101.792 1.00 60.56  ? 223 PRO B HB3    1 
ATOM   8525  H  HG2    . PRO B 1 243 ? 22.986  11.743 -99.329  1.00 60.04  ? 223 PRO B HG2    1 
ATOM   8526  H  HG3    . PRO B 1 243 ? 24.201  10.745 -99.591  1.00 60.04  ? 223 PRO B HG3    1 
ATOM   8527  H  HD2    . PRO B 1 243 ? 24.605  13.192 -98.903  1.00 61.38  ? 223 PRO B HD2    1 
ATOM   8528  H  HD3    . PRO B 1 243 ? 25.659  12.401 -99.817  1.00 61.38  ? 223 PRO B HD3    1 
ATOM   8529  N  N      . HIS B 1 244 ? 21.152  13.071 -102.561 1.00 52.88  ? 224 HIS B N      1 
ATOM   8530  C  CA     . HIS B 1 244 ? 19.794  13.587 -102.644 1.00 55.24  ? 224 HIS B CA     1 
ATOM   8531  C  C      . HIS B 1 244 ? 18.906  12.895 -101.619 1.00 54.63  ? 224 HIS B C      1 
ATOM   8532  O  O      . HIS B 1 244 ? 19.069  11.703 -101.340 1.00 52.18  ? 224 HIS B O      1 
ATOM   8533  C  CB     . HIS B 1 244 ? 19.249  13.379 -104.060 1.00 62.38  ? 224 HIS B CB     1 
ATOM   8534  C  CG     . HIS B 1 244 ? 17.774  13.596 -104.189 1.00 66.46  ? 224 HIS B CG     1 
ATOM   8535  N  ND1    . HIS B 1 244 ? 16.864  12.562 -104.135 1.00 67.72  ? 224 HIS B ND1    1 
ATOM   8536  C  CD2    . HIS B 1 244 ? 17.050  14.723 -104.386 1.00 66.75  ? 224 HIS B CD2    1 
ATOM   8537  C  CE1    . HIS B 1 244 ? 15.643  13.043 -104.285 1.00 67.53  ? 224 HIS B CE1    1 
ATOM   8538  N  NE2    . HIS B 1 244 ? 15.728  14.352 -104.440 1.00 66.81  ? 224 HIS B NE2    1 
ATOM   8539  H  H      . HIS B 1 244 ? 21.299  12.405 -103.085 1.00 63.57  ? 224 HIS B H      1 
ATOM   8540  H  HA     . HIS B 1 244 ? 19.798  14.538 -102.454 1.00 66.40  ? 224 HIS B HA     1 
ATOM   8541  H  HB2    . HIS B 1 244 ? 19.692  14.000 -104.658 1.00 74.98  ? 224 HIS B HB2    1 
ATOM   8542  H  HB3    . HIS B 1 244 ? 19.438  12.468 -104.335 1.00 74.98  ? 224 HIS B HB3    1 
ATOM   8543  H  HD1    . HIS B 1 244 ? 17.061  11.733 -104.018 1.00 81.39  ? 224 HIS B HD1    1 
ATOM   8544  H  HD2    . HIS B 1 244 ? 17.384  15.587 -104.467 1.00 80.22  ? 224 HIS B HD2    1 
ATOM   8545  H  HE1    . HIS B 1 244 ? 14.858  12.545 -104.282 1.00 81.16  ? 224 HIS B HE1    1 
ATOM   8546  N  N      . LEU B 1 245 ? 17.967  13.650 -101.061 1.00 60.68  ? 225 LEU B N      1 
ATOM   8547  C  CA     . LEU B 1 245 ? 17.035  13.137 -100.056 1.00 65.48  ? 225 LEU B CA     1 
ATOM   8548  C  C      . LEU B 1 245 ? 15.617  13.225 -100.599 1.00 67.80  ? 225 LEU B C      1 
ATOM   8549  O  O      . LEU B 1 245 ? 15.103  14.344 -100.789 1.00 71.62  ? 225 LEU B O      1 
ATOM   8550  C  CB     . LEU B 1 245 ? 17.157  13.925 -98.751  1.00 62.78  ? 225 LEU B CB     1 
ATOM   8551  C  CG     . LEU B 1 245 ? 18.482  13.787 -97.998  1.00 60.99  ? 225 LEU B CG     1 
ATOM   8552  C  CD1    . LEU B 1 245 ? 18.589  14.833 -96.902  1.00 58.45  ? 225 LEU B CD1    1 
ATOM   8553  C  CD2    . LEU B 1 245 ? 18.608  12.392 -97.406  1.00 61.01  ? 225 LEU B CD2    1 
ATOM   8554  H  H      . LEU B 1 245 ? 17.845  14.480 -101.251 1.00 72.94  ? 225 LEU B H      1 
ATOM   8555  H  HA     . LEU B 1 245 ? 17.237  12.206 -99.873  1.00 78.69  ? 225 LEU B HA     1 
ATOM   8556  H  HB2    . LEU B 1 245 ? 17.036  14.867 -98.952  1.00 75.45  ? 225 LEU B HB2    1 
ATOM   8557  H  HB3    . LEU B 1 245 ? 16.453  13.632 -98.152  1.00 75.45  ? 225 LEU B HB3    1 
ATOM   8558  H  HG     . LEU B 1 245 ? 19.216  13.921 -98.617  1.00 73.31  ? 225 LEU B HG     1 
ATOM   8559  H  HD11   . LEU B 1 245 ? 19.436  14.723 -96.442  1.00 70.26  ? 225 LEU B HD11   1 
ATOM   8560  H  HD12   . LEU B 1 245 ? 18.542  15.715 -97.303  1.00 70.26  ? 225 LEU B HD12   1 
ATOM   8561  H  HD13   . LEU B 1 245 ? 17.855  14.713 -96.279  1.00 70.26  ? 225 LEU B HD13   1 
ATOM   8562  H  HD21   . LEU B 1 245 ? 19.453  12.325 -96.934  1.00 73.33  ? 225 LEU B HD21   1 
ATOM   8563  H  HD22   . LEU B 1 245 ? 17.872  12.242 -96.792  1.00 73.33  ? 225 LEU B HD22   1 
ATOM   8564  H  HD23   . LEU B 1 245 ? 18.577  11.741 -98.124  1.00 73.33  ? 225 LEU B HD23   1 
ATOM   8565  N  N      . PRO B 1 246 ? 14.941  12.105 -100.860 1.00 63.54  ? 226 PRO B N      1 
ATOM   8566  C  CA     . PRO B 1 246 ? 13.604  12.185 -101.460 1.00 62.02  ? 226 PRO B CA     1 
ATOM   8567  C  C      . PRO B 1 246 ? 12.615  12.905 -100.556 1.00 58.69  ? 226 PRO B C      1 
ATOM   8568  O  O      . PRO B 1 246 ? 12.712  12.863 -99.327  1.00 59.31  ? 226 PRO B O      1 
ATOM   8569  C  CB     . PRO B 1 246 ? 13.212  10.715 -101.660 1.00 62.49  ? 226 PRO B CB     1 
ATOM   8570  C  CG     . PRO B 1 246 ? 14.502  9.971  -101.673 1.00 62.53  ? 226 PRO B CG     1 
ATOM   8571  C  CD     . PRO B 1 246 ? 15.405  10.712 -100.742 1.00 61.08  ? 226 PRO B CD     1 
ATOM   8572  H  HA     . PRO B 1 246 ? 13.642  12.631 -102.321 1.00 74.54  ? 226 PRO B HA     1 
ATOM   8573  H  HB2    . PRO B 1 246 ? 12.654  10.422 -100.923 1.00 75.10  ? 226 PRO B HB2    1 
ATOM   8574  H  HB3    . PRO B 1 246 ? 12.748  10.612 -102.505 1.00 75.10  ? 226 PRO B HB3    1 
ATOM   8575  H  HG2    . PRO B 1 246 ? 14.358  9.065  -101.359 1.00 75.15  ? 226 PRO B HG2    1 
ATOM   8576  H  HG3    . PRO B 1 246 ? 14.867  9.968  -102.572 1.00 75.15  ? 226 PRO B HG3    1 
ATOM   8577  H  HD2    . PRO B 1 246 ? 15.291  10.392 -99.834  1.00 73.41  ? 226 PRO B HD2    1 
ATOM   8578  H  HD3    . PRO B 1 246 ? 16.327  10.636 -101.034 1.00 73.41  ? 226 PRO B HD3    1 
ATOM   8579  N  N      . LEU B 1 247 ? 11.650  13.566 -101.190 1.00 53.47  ? 227 LEU B N      1 
ATOM   8580  C  CA     . LEU B 1 247 ? 10.572  14.268 -100.503 1.00 53.63  ? 227 LEU B CA     1 
ATOM   8581  C  C      . LEU B 1 247 ? 9.276   13.509 -100.747 1.00 63.85  ? 227 LEU B C      1 
ATOM   8582  O  O      . LEU B 1 247 ? 8.875   13.315 -101.900 1.00 60.11  ? 227 LEU B O      1 
ATOM   8583  C  CB     . LEU B 1 247 ? 10.454  15.710 -100.997 1.00 55.14  ? 227 LEU B CB     1 
ATOM   8584  C  CG     . LEU B 1 247 ? 10.709  16.834 -99.988  1.00 59.10  ? 227 LEU B CG     1 
ATOM   8585  C  CD1    . LEU B 1 247 ? 10.560  18.183 -100.673 1.00 60.60  ? 227 LEU B CD1    1 
ATOM   8586  C  CD2    . LEU B 1 247 ? 9.768   16.743 -98.790  1.00 60.65  ? 227 LEU B CD2    1 
ATOM   8587  H  H      . LEU B 1 247 ? 11.598  13.623 -102.046 1.00 64.28  ? 227 LEU B H      1 
ATOM   8588  H  HA     . LEU B 1 247 ? 10.748  14.281 -99.549  1.00 64.47  ? 227 LEU B HA     1 
ATOM   8589  H  HB2    . LEU B 1 247 ? 11.089  15.831 -101.721 1.00 66.28  ? 227 LEU B HB2    1 
ATOM   8590  H  HB3    . LEU B 1 247 ? 9.555   15.836 -101.340 1.00 66.28  ? 227 LEU B HB3    1 
ATOM   8591  H  HG     . LEU B 1 247 ? 11.619  16.763 -99.660  1.00 71.04  ? 227 LEU B HG     1 
ATOM   8592  H  HD11   . LEU B 1 247 ? 10.724  18.886 -100.024 1.00 72.84  ? 227 LEU B HD11   1 
ATOM   8593  H  HD12   . LEU B 1 247 ? 11.205  18.243 -101.395 1.00 72.84  ? 227 LEU B HD12   1 
ATOM   8594  H  HD13   . LEU B 1 247 ? 9.660   18.260 -101.025 1.00 72.84  ? 227 LEU B HD13   1 
ATOM   8595  H  HD21   . LEU B 1 247 ? 9.964   17.471 -98.179  1.00 72.90  ? 227 LEU B HD21   1 
ATOM   8596  H  HD22   . LEU B 1 247 ? 8.852   16.811 -99.102  1.00 72.90  ? 227 LEU B HD22   1 
ATOM   8597  H  HD23   . LEU B 1 247 ? 9.904   15.892 -98.345  1.00 72.90  ? 227 LEU B HD23   1 
ATOM   8598  N  N      . GLU B 1 248 ? 8.622   13.093 -99.669  1.00 80.00  ? 228 GLU B N      1 
ATOM   8599  C  CA     . GLU B 1 248 ? 7.381   12.337 -99.754  1.00 93.48  ? 228 GLU B CA     1 
ATOM   8600  C  C      . GLU B 1 248 ? 6.204   13.290 -99.605  1.00 98.25  ? 228 GLU B C      1 
ATOM   8601  O  O      . GLU B 1 248 ? 6.146   14.069 -98.647  1.00 97.77  ? 228 GLU B O      1 
ATOM   8602  C  CB     . GLU B 1 248 ? 7.332   11.257 -98.672  1.00 97.33  ? 228 GLU B CB     1 
ATOM   8603  C  CG     . GLU B 1 248 ? 6.074   10.403 -98.689  1.00 102.41 ? 228 GLU B CG     1 
ATOM   8604  C  CD     . GLU B 1 248 ? 6.086   9.333  -97.615  1.00 107.60 ? 228 GLU B CD     1 
ATOM   8605  O  OE1    . GLU B 1 248 ? 7.182   9.005  -97.112  1.00 108.99 ? 228 GLU B OE1    1 
ATOM   8606  O  OE2    . GLU B 1 248 ? 5.000   8.822  -97.270  1.00 110.37 ? 228 GLU B OE2    1 
ATOM   8607  H  H      . GLU B 1 248 ? 8.883   13.238 -98.862  1.00 96.12  ? 228 GLU B H      1 
ATOM   8608  H  HA     . GLU B 1 248 ? 7.321   11.908 -100.621 1.00 112.30 ? 228 GLU B HA     1 
ATOM   8609  H  HB2    . GLU B 1 248 ? 8.091   10.664 -98.791  1.00 116.92 ? 228 GLU B HB2    1 
ATOM   8610  H  HB3    . GLU B 1 248 ? 7.385   11.685 -97.803  1.00 116.92 ? 228 GLU B HB3    1 
ATOM   8611  H  HG2    . GLU B 1 248 ? 5.303   10.972 -98.538  1.00 123.02 ? 228 GLU B HG2    1 
ATOM   8612  H  HG3    . GLU B 1 248 ? 6.000   9.965  -99.551  1.00 123.02 ? 228 GLU B HG3    1 
ATOM   8613  N  N      . GLU B 1 249 ? 5.272   13.224 -100.550 1.00 102.39 ? 229 GLU B N      1 
ATOM   8614  C  CA     . GLU B 1 249 ? 4.090   14.063 -100.481 1.00 105.55 ? 229 GLU B CA     1 
ATOM   8615  C  C      . GLU B 1 249 ? 3.234   13.670 -99.276  1.00 106.60 ? 229 GLU B C      1 
ATOM   8616  O  O      . GLU B 1 249 ? 3.202   12.501 -98.883  1.00 109.21 ? 229 GLU B O      1 
ATOM   8617  C  CB     . GLU B 1 249 ? 3.273   13.944 -101.763 1.00 106.61 ? 229 GLU B CB     1 
ATOM   8618  C  CG     . GLU B 1 249 ? 3.879   14.684 -102.945 1.00 106.74 ? 229 GLU B CG     1 
ATOM   8619  C  CD     . GLU B 1 249 ? 2.911   14.836 -104.101 1.00 108.00 ? 229 GLU B CD     1 
ATOM   8620  O  OE1    . GLU B 1 249 ? 1.974   14.017 -104.205 1.00 109.10 ? 229 GLU B OE1    1 
ATOM   8621  O  OE2    . GLU B 1 249 ? 3.087   15.774 -104.907 1.00 107.82 ? 229 GLU B OE2    1 
ATOM   8622  H  H      . GLU B 1 249 ? 5.302   12.704 -101.234 1.00 122.99 ? 229 GLU B H      1 
ATOM   8623  H  HA     . GLU B 1 249 ? 4.360   14.989 -100.375 1.00 126.78 ? 229 GLU B HA     1 
ATOM   8624  H  HB2    . GLU B 1 249 ? 3.203   13.007 -102.004 1.00 128.05 ? 229 GLU B HB2    1 
ATOM   8625  H  HB3    . GLU B 1 249 ? 2.388   14.310 -101.606 1.00 128.05 ? 229 GLU B HB3    1 
ATOM   8626  H  HG2    . GLU B 1 249 ? 4.146   15.572 -102.659 1.00 128.21 ? 229 GLU B HG2    1 
ATOM   8627  H  HG3    . GLU B 1 249 ? 4.652   14.192 -103.264 1.00 128.21 ? 229 GLU B HG3    1 
ATOM   8628  N  N      . PRO B 1 250 ? 2.532   14.627 -98.669  1.00 93.91  ? 230 PRO B N      1 
ATOM   8629  C  CA     . PRO B 1 250 ? 1.674   14.287 -97.527  1.00 94.91  ? 230 PRO B CA     1 
ATOM   8630  C  C      . PRO B 1 250 ? 0.587   13.297 -97.920  1.00 102.00 ? 230 PRO B C      1 
ATOM   8631  O  O      . PRO B 1 250 ? 0.018   13.370 -99.011  1.00 99.64  ? 230 PRO B O      1 
ATOM   8632  C  CB     . PRO B 1 250 ? 1.082   15.638 -97.106  1.00 91.09  ? 230 PRO B CB     1 
ATOM   8633  C  CG     . PRO B 1 250 ? 1.982   16.666 -97.702  1.00 87.41  ? 230 PRO B CG     1 
ATOM   8634  C  CD     . PRO B 1 250 ? 2.514   16.072 -98.960  1.00 88.97  ? 230 PRO B CD     1 
ATOM   8635  H  HA     . PRO B 1 250 ? 2.202   13.921 -96.799  1.00 114.01 ? 230 PRO B HA     1 
ATOM   8636  H  HB2    . PRO B 1 250 ? 0.183   15.724 -97.460  1.00 109.43 ? 230 PRO B HB2    1 
ATOM   8637  H  HB3    . PRO B 1 250 ? 1.078   15.705 -96.138  1.00 109.43 ? 230 PRO B HB3    1 
ATOM   8638  H  HG2    . PRO B 1 250 ? 1.474   17.470 -97.893  1.00 105.01 ? 230 PRO B HG2    1 
ATOM   8639  H  HG3    . PRO B 1 250 ? 2.706   16.860 -97.085  1.00 105.01 ? 230 PRO B HG3    1 
ATOM   8640  H  HD2    . PRO B 1 250 ? 1.918   16.260 -99.702  1.00 106.89 ? 230 PRO B HD2    1 
ATOM   8641  H  HD3    . PRO B 1 250 ? 3.413   16.393 -99.133  1.00 106.89 ? 230 PRO B HD3    1 
ATOM   8642  N  N      . ALA B 1 251 ? 0.305   12.361 -97.012  1.00 131.90 ? 231 ALA B N      1 
ATOM   8643  C  CA     . ALA B 1 251 ? -0.726  11.355 -97.232  1.00 139.46 ? 231 ALA B CA     1 
ATOM   8644  C  C      . ALA B 1 251 ? -2.073  11.733 -96.635  1.00 143.37 ? 231 ALA B C      1 
ATOM   8645  O  O      . ALA B 1 251 ? -3.085  11.124 -96.998  1.00 148.34 ? 231 ALA B O      1 
ATOM   8646  C  CB     . ALA B 1 251 ? -0.285  10.008 -96.648  1.00 138.49 ? 231 ALA B CB     1 
ATOM   8647  H  H      . ALA B 1 251 ? 0.703   12.290 -96.253  1.00 158.40 ? 231 ALA B H      1 
ATOM   8648  H  HA     . ALA B 1 251 ? -0.848  11.239 -98.187  1.00 167.47 ? 231 ALA B HA     1 
ATOM   8649  H  HB1    . ALA B 1 251 ? -0.983  9.353  -96.804  1.00 166.30 ? 231 ALA B HB1    1 
ATOM   8650  H  HB2    . ALA B 1 251 ? 0.535   9.728  -97.084  1.00 166.30 ? 231 ALA B HB2    1 
ATOM   8651  H  HB3    . ALA B 1 251 ? -0.135  10.111 -95.695  1.00 166.30 ? 231 ALA B HB3    1 
ATOM   8652  N  N      . ASP B 1 252 ? -2.113  12.714 -95.736  1.00 110.20 ? 232 ASP B N      1 
ATOM   8653  C  CA     . ASP B 1 252 ? -3.350  13.139 -95.096  1.00 106.35 ? 232 ASP B CA     1 
ATOM   8654  C  C      . ASP B 1 252 ? -4.019  14.297 -95.823  1.00 104.61 ? 232 ASP B C      1 
ATOM   8655  O  O      . ASP B 1 252 ? -4.896  14.949 -95.246  1.00 103.78 ? 232 ASP B O      1 
ATOM   8656  C  CB     . ASP B 1 252 ? -3.081  13.533 -93.641  1.00 105.31 ? 232 ASP B CB     1 
ATOM   8657  C  CG     . ASP B 1 252 ? -2.144  14.719 -93.521  1.00 107.23 ? 232 ASP B CG     1 
ATOM   8658  O  OD1    . ASP B 1 252 ? -1.464  15.044 -94.516  1.00 109.01 ? 232 ASP B OD1    1 
ATOM   8659  O  OD2    . ASP B 1 252 ? -2.090  15.328 -92.432  1.00 108.06 ? 232 ASP B OD2    1 
ATOM   8660  H  H      . ASP B 1 252 ? -1.422  13.156 -95.477  1.00 132.36 ? 232 ASP B H      1 
ATOM   8661  H  HA     . ASP B 1 252 ? -3.971  12.393 -95.092  1.00 127.73 ? 232 ASP B HA     1 
ATOM   8662  H  HB2    . ASP B 1 252 ? -3.921  13.770 -93.217  1.00 126.49 ? 232 ASP B HB2    1 
ATOM   8663  H  HB3    . ASP B 1 252 ? -2.676  12.782 -93.179  1.00 126.49 ? 232 ASP B HB3    1 
ATOM   8664  N  N      . GLU B 1 253 ? -3.619  14.573 -97.063  1.00 116.50 ? 233 GLU B N      1 
ATOM   8665  C  CA     . GLU B 1 253 ? -4.170  15.643 -97.889  1.00 115.06 ? 233 GLU B CA     1 
ATOM   8666  C  C      . GLU B 1 253 ? -3.788  17.029 -97.381  1.00 107.86 ? 233 GLU B C      1 
ATOM   8667  O  O      . GLU B 1 253 ? -4.312  18.031 -97.886  1.00 113.00 ? 233 GLU B O      1 
ATOM   8668  C  CB     . GLU B 1 253 ? -5.696  15.540 -97.994  1.00 120.59 ? 233 GLU B CB     1 
ATOM   8669  C  CG     . GLU B 1 253 ? -6.178  14.271 -98.681  1.00 127.69 ? 233 GLU B CG     1 
ATOM   8670  C  CD     . GLU B 1 253 ? -7.688  14.186 -98.743  1.00 135.91 ? 233 GLU B CD     1 
ATOM   8671  O  OE1    . GLU B 1 253 ? -8.350  14.824 -97.898  1.00 138.32 ? 233 GLU B OE1    1 
ATOM   8672  O  OE2    . GLU B 1 253 ? -8.212  13.478 -99.629  1.00 140.00 ? 233 GLU B OE2    1 
ATOM   8673  H  H      . GLU B 1 253 ? -3.000  14.131 -97.464  1.00 139.92 ? 233 GLU B H      1 
ATOM   8674  H  HA     . GLU B 1 253 ? -3.810  15.554 -98.785  1.00 138.19 ? 233 GLU B HA     1 
ATOM   8675  H  HB2    . GLU B 1 253 ? -6.073  15.555 -97.100  1.00 144.83 ? 233 GLU B HB2    1 
ATOM   8676  H  HB3    . GLU B 1 253 ? -6.027  16.296 -98.503  1.00 144.83 ? 233 GLU B HB3    1 
ATOM   8677  H  HG2    . GLU B 1 253 ? -5.838  14.253 -99.589  1.00 153.35 ? 233 GLU B HG2    1 
ATOM   8678  H  HG3    . GLU B 1 253 ? -5.853  13.501 -98.188  1.00 153.35 ? 233 GLU B HG3    1 
ATOM   8679  N  N      . GLY B 1 254 ? -2.894  17.118 -96.399  1.00 90.25  ? 234 GLY B N      1 
ATOM   8680  C  CA     . GLY B 1 254 ? -2.370  18.384 -95.928  1.00 82.45  ? 234 GLY B CA     1 
ATOM   8681  C  C      . GLY B 1 254 ? -2.864  18.830 -94.566  1.00 76.61  ? 234 GLY B C      1 
ATOM   8682  O  O      . GLY B 1 254 ? -2.621  19.981 -94.188  1.00 77.47  ? 234 GLY B O      1 
ATOM   8683  H  H      . GLY B 1 254 ? -2.571  16.438 -95.983  1.00 108.42 ? 234 GLY B H      1 
ATOM   8684  H  HA2    . GLY B 1 254 ? -1.403  18.327 -95.888  1.00 99.06  ? 234 GLY B HA2    1 
ATOM   8685  H  HA3    . GLY B 1 254 ? -2.602  19.075 -96.568  1.00 99.06  ? 234 GLY B HA3    1 
ATOM   8686  N  N      . LEU B 1 255 ? -3.537  17.957 -93.814  1.00 74.37  ? 235 LEU B N      1 
ATOM   8687  C  CA     . LEU B 1 255 ? -4.067  18.337 -92.507  1.00 73.25  ? 235 LEU B CA     1 
ATOM   8688  C  C      . LEU B 1 255 ? -2.948  18.711 -91.540  1.00 69.85  ? 235 LEU B C      1 
ATOM   8689  O  O      . LEU B 1 255 ? -2.936  19.812 -90.971  1.00 70.46  ? 235 LEU B O      1 
ATOM   8690  C  CB     . LEU B 1 255 ? -4.910  17.190 -91.948  1.00 75.60  ? 235 LEU B CB     1 
ATOM   8691  C  CG     . LEU B 1 255 ? -5.698  17.471 -90.669  1.00 73.90  ? 235 LEU B CG     1 
ATOM   8692  C  CD1    . LEU B 1 255 ? -6.796  18.492 -90.921  1.00 73.75  ? 235 LEU B CD1    1 
ATOM   8693  C  CD2    . LEU B 1 255 ? -6.281  16.175 -90.124  1.00 73.68  ? 235 LEU B CD2    1 
ATOM   8694  H  H      . LEU B 1 255 ? -3.699  17.143 -94.038  1.00 89.36  ? 235 LEU B H      1 
ATOM   8695  H  HA     . LEU B 1 255 ? -4.644  19.110 -92.613  1.00 88.02  ? 235 LEU B HA     1 
ATOM   8696  H  HB2    . LEU B 1 255 ? -5.551  16.927 -92.627  1.00 90.84  ? 235 LEU B HB2    1 
ATOM   8697  H  HB3    . LEU B 1 255 ? -4.318  16.444 -91.762  1.00 90.84  ? 235 LEU B HB3    1 
ATOM   8698  H  HG     . LEU B 1 255 ? -5.097  17.834 -90.000  1.00 88.80  ? 235 LEU B HG     1 
ATOM   8699  H  HD11   . LEU B 1 255 ? -7.277  18.649 -90.093  1.00 88.61  ? 235 LEU B HD11   1 
ATOM   8700  H  HD12   . LEU B 1 255 ? -6.393  19.318 -91.232  1.00 88.61  ? 235 LEU B HD12   1 
ATOM   8701  H  HD13   . LEU B 1 255 ? -7.401  18.145 -91.595  1.00 88.61  ? 235 LEU B HD13   1 
ATOM   8702  H  HD21   . LEU B 1 255 ? -6.777  16.370 -89.313  1.00 88.53  ? 235 LEU B HD21   1 
ATOM   8703  H  HD22   . LEU B 1 255 ? -6.872  15.791 -90.790  1.00 88.53  ? 235 LEU B HD22   1 
ATOM   8704  H  HD23   . LEU B 1 255 ? -5.556  15.561 -89.929  1.00 88.53  ? 235 LEU B HD23   1 
ATOM   8705  N  N      . GLU B 1 256 ? -1.994  17.797 -91.340  1.00 70.88  ? 236 GLU B N      1 
ATOM   8706  C  CA     . GLU B 1 256 ? -0.887  18.066 -90.427  1.00 65.79  ? 236 GLU B CA     1 
ATOM   8707  C  C      . GLU B 1 256 ? -0.167  19.353 -90.807  1.00 59.13  ? 236 GLU B C      1 
ATOM   8708  O  O      . GLU B 1 256 ? 0.222   20.139 -89.934  1.00 51.96  ? 236 GLU B O      1 
ATOM   8709  C  CB     . GLU B 1 256 ? 0.085   16.885 -90.422  1.00 70.81  ? 236 GLU B CB     1 
ATOM   8710  C  CG     . GLU B 1 256 ? 1.264   17.051 -89.470  1.00 74.52  ? 236 GLU B CG     1 
ATOM   8711  C  CD     . GLU B 1 256 ? 2.243   15.892 -89.538  1.00 78.20  ? 236 GLU B CD     1 
ATOM   8712  O  OE1    . GLU B 1 256 ? 1.882   14.836 -90.099  1.00 80.27  ? 236 GLU B OE1    1 
ATOM   8713  O  OE2    . GLU B 1 256 ? 3.376   16.040 -89.032  1.00 78.12  ? 236 GLU B OE2    1 
ATOM   8714  H  H      . GLU B 1 256 ? -1.967  17.025 -91.717  1.00 85.18  ? 236 GLU B H      1 
ATOM   8715  H  HA     . GLU B 1 256 ? -1.237  18.172 -89.529  1.00 79.06  ? 236 GLU B HA     1 
ATOM   8716  H  HB2    . GLU B 1 256 ? -0.398  16.086 -90.157  1.00 85.10  ? 236 GLU B HB2    1 
ATOM   8717  H  HB3    . GLU B 1 256 ? 0.441   16.771 -91.316  1.00 85.10  ? 236 GLU B HB3    1 
ATOM   8718  H  HG2    . GLU B 1 256 ? 1.743   17.863 -89.700  1.00 89.54  ? 236 GLU B HG2    1 
ATOM   8719  H  HG3    . GLU B 1 256 ? 0.930   17.109 -88.561  1.00 89.54  ? 236 GLU B HG3    1 
ATOM   8720  N  N      . LEU B 1 257 ? 0.020   19.585 -92.108  1.00 65.22  ? 237 LEU B N      1 
ATOM   8721  C  CA     . LEU B 1 257 ? 0.711   20.788 -92.557  1.00 60.44  ? 237 LEU B CA     1 
ATOM   8722  C  C      . LEU B 1 257 ? -0.022  22.040 -92.090  1.00 60.41  ? 237 LEU B C      1 
ATOM   8723  O  O      . LEU B 1 257 ? 0.578   22.936 -91.485  1.00 57.65  ? 237 LEU B O      1 
ATOM   8724  C  CB     . LEU B 1 257 ? 0.841   20.775 -94.080  1.00 57.18  ? 237 LEU B CB     1 
ATOM   8725  C  CG     . LEU B 1 257 ? 2.059   21.479 -94.684  1.00 52.87  ? 237 LEU B CG     1 
ATOM   8726  C  CD1    . LEU B 1 257 ? 1.963   21.475 -96.202  1.00 52.63  ? 237 LEU B CD1    1 
ATOM   8727  C  CD2    . LEU B 1 257 ? 2.213   22.901 -94.161  1.00 51.06  ? 237 LEU B CD2    1 
ATOM   8728  H  H      . LEU B 1 257 ? -0.241  19.066 -92.742  1.00 78.39  ? 237 LEU B H      1 
ATOM   8729  H  HA     . LEU B 1 257 ? 1.604   20.803 -92.177  1.00 72.65  ? 237 LEU B HA     1 
ATOM   8730  H  HB2    . LEU B 1 257 ? 0.873   19.850 -94.372  1.00 68.74  ? 237 LEU B HB2    1 
ATOM   8731  H  HB3    . LEU B 1 257 ? 0.053   21.199 -94.453  1.00 68.74  ? 237 LEU B HB3    1 
ATOM   8732  H  HG     . LEU B 1 257 ? 2.857   20.986 -94.437  1.00 63.56  ? 237 LEU B HG     1 
ATOM   8733  H  HD11   . LEU B 1 257 ? 2.741   21.924 -96.569  1.00 63.28  ? 237 LEU B HD11   1 
ATOM   8734  H  HD12   . LEU B 1 257 ? 1.934   20.556 -96.513  1.00 63.28  ? 237 LEU B HD12   1 
ATOM   8735  H  HD13   . LEU B 1 257 ? 1.155   21.941 -96.469  1.00 63.28  ? 237 LEU B HD13   1 
ATOM   8736  H  HD21   . LEU B 1 257 ? 2.995   23.304 -94.570  1.00 61.38  ? 237 LEU B HD21   1 
ATOM   8737  H  HD22   . LEU B 1 257 ? 1.420   23.409 -94.390  1.00 61.38  ? 237 LEU B HD22   1 
ATOM   8738  H  HD23   . LEU B 1 257 ? 2.321   22.872 -93.197  1.00 61.38  ? 237 LEU B HD23   1 
ATOM   8739  N  N      . GLY B 1 258 ? -1.327  22.119 -92.357  1.00 66.36  ? 238 GLY B N      1 
ATOM   8740  C  CA     . GLY B 1 258 ? -2.084  23.287 -91.938  1.00 63.62  ? 238 GLY B CA     1 
ATOM   8741  C  C      . GLY B 1 258 ? -2.077  23.475 -90.434  1.00 55.25  ? 238 GLY B C      1 
ATOM   8742  O  O      . GLY B 1 258 ? -1.877  24.589 -89.936  1.00 55.77  ? 238 GLY B O      1 
ATOM   8743  H  H      . GLY B 1 258 ? -1.785  21.520 -92.770  1.00 79.75  ? 238 GLY B H      1 
ATOM   8744  H  HA2    . GLY B 1 258 ? -1.707  24.081 -92.349  1.00 76.46  ? 238 GLY B HA2    1 
ATOM   8745  H  HA3    . GLY B 1 258 ? -3.005  23.197 -92.232  1.00 76.46  ? 238 GLY B HA3    1 
ATOM   8746  N  N      . THR B 1 259 ? -2.282  22.386 -89.688  1.00 48.75  ? 239 THR B N      1 
ATOM   8747  C  CA     . THR B 1 259 ? -2.201  22.458 -88.232  1.00 49.65  ? 239 THR B CA     1 
ATOM   8748  C  C      . THR B 1 259 ? -0.873  23.065 -87.787  1.00 53.73  ? 239 THR B C      1 
ATOM   8749  O  O      . THR B 1 259 ? -0.837  23.987 -86.961  1.00 57.28  ? 239 THR B O      1 
ATOM   8750  C  CB     . THR B 1 259 ? -2.385  21.058 -87.638  1.00 48.57  ? 239 THR B CB     1 
ATOM   8751  O  OG1    . THR B 1 259 ? -3.640  20.515 -88.069  1.00 51.30  ? 239 THR B OG1    1 
ATOM   8752  C  CG2    . THR B 1 259 ? -2.352  21.095 -86.113  1.00 45.10  ? 239 THR B CG2    1 
ATOM   8753  H  H      . THR B 1 259 ? -2.466  21.606 -89.998  1.00 58.62  ? 239 THR B H      1 
ATOM   8754  H  HA     . THR B 1 259 ? -2.917  23.023 -87.901  1.00 59.69  ? 239 THR B HA     1 
ATOM   8755  H  HB     . THR B 1 259 ? -1.666  20.484 -87.944  1.00 58.40  ? 239 THR B HB     1 
ATOM   8756  H  HG1    . THR B 1 259 ? -3.658  20.464 -88.908  1.00 61.67  ? 239 THR B HG1    1 
ATOM   8757  H  HG21   . THR B 1 259 ? -2.470  20.201 -85.757  1.00 54.24  ? 239 THR B HG21   1 
ATOM   8758  H  HG22   . THR B 1 259 ? -1.500  21.446 -85.809  1.00 54.24  ? 239 THR B HG22   1 
ATOM   8759  H  HG23   . THR B 1 259 ? -3.064  21.664 -85.780  1.00 54.24  ? 239 THR B HG23   1 
ATOM   8760  N  N      . GLN B 1 260 ? 0.234   22.570 -88.349  1.00 50.61  ? 240 GLN B N      1 
ATOM   8761  C  CA     . GLN B 1 260 ? 1.550   23.064 -87.957  1.00 48.37  ? 240 GLN B CA     1 
ATOM   8762  C  C      . GLN B 1 260 ? 1.726   24.532 -88.325  1.00 43.42  ? 240 GLN B C      1 
ATOM   8763  O  O      . GLN B 1 260 ? 2.314   25.302 -87.559  1.00 42.23  ? 240 GLN B O      1 
ATOM   8764  C  CB     . GLN B 1 260 ? 2.649   22.217 -88.600  1.00 51.32  ? 240 GLN B CB     1 
ATOM   8765  C  CG     . GLN B 1 260 ? 2.793   20.821 -88.006  1.00 53.81  ? 240 GLN B CG     1 
ATOM   8766  C  CD     . GLN B 1 260 ? 3.923   20.030 -88.641  1.00 55.29  ? 240 GLN B CD     1 
ATOM   8767  O  OE1    . GLN B 1 260 ? 4.575   20.497 -89.574  1.00 53.67  ? 240 GLN B OE1    1 
ATOM   8768  N  NE2    . GLN B 1 260 ? 4.161   18.825 -88.134  1.00 58.11  ? 240 GLN B NE2    1 
ATOM   8769  H  H      . GLN B 1 260 ? 0.247   21.956 -88.951  1.00 60.84  ? 240 GLN B H      1 
ATOM   8770  H  HA     . GLN B 1 260 ? 1.640   22.986 -86.994  1.00 58.16  ? 240 GLN B HA     1 
ATOM   8771  H  HB2    . GLN B 1 260 ? 2.452   22.117 -89.545  1.00 61.70  ? 240 GLN B HB2    1 
ATOM   8772  H  HB3    . GLN B 1 260 ? 3.498   22.674 -88.490  1.00 61.70  ? 240 GLN B HB3    1 
ATOM   8773  H  HG2    . GLN B 1 260 ? 2.977   20.898 -87.057  1.00 64.69  ? 240 GLN B HG2    1 
ATOM   8774  H  HG3    . GLN B 1 260 ? 1.968   20.331 -88.146  1.00 64.69  ? 240 GLN B HG3    1 
ATOM   8775  H  HE21   . GLN B 1 260 ? 3.686   18.531 -87.480  1.00 69.85  ? 240 GLN B HE21   1 
ATOM   8776  H  HE22   . GLN B 1 260 ? 4.791   18.338 -88.460  1.00 69.85  ? 240 GLN B HE22   1 
ATOM   8777  N  N      . VAL B 1 261 ? 1.248   24.937 -89.504  1.00 42.55  ? 241 VAL B N      1 
ATOM   8778  C  CA     . VAL B 1 261 ? 1.389   26.329 -89.927  1.00 43.44  ? 241 VAL B CA     1 
ATOM   8779  C  C      . VAL B 1 261 ? 0.649   27.254 -88.967  1.00 43.03  ? 241 VAL B C      1 
ATOM   8780  O  O      . VAL B 1 261 ? 1.219   28.218 -88.435  1.00 37.42  ? 241 VAL B O      1 
ATOM   8781  C  CB     . VAL B 1 261 ? 0.895   26.497 -91.377  1.00 44.19  ? 241 VAL B CB     1 
ATOM   8782  C  CG1    . VAL B 1 261 ? 0.795   27.972 -91.762  1.00 43.82  ? 241 VAL B CG1    1 
ATOM   8783  C  CG2    . VAL B 1 261 ? 1.828   25.771 -92.337  1.00 42.08  ? 241 VAL B CG2    1 
ATOM   8784  H  H      . VAL B 1 261 ? 0.842   24.431 -90.069  1.00 51.17  ? 241 VAL B H      1 
ATOM   8785  H  HA     . VAL B 1 261 ? 2.328   26.569 -89.905  1.00 52.24  ? 241 VAL B HA     1 
ATOM   8786  H  HB     . VAL B 1 261 ? 0.012   26.103 -91.459  1.00 53.15  ? 241 VAL B HB     1 
ATOM   8787  H  HG11   . VAL B 1 261 ? 0.482   28.039 -92.677  1.00 52.71  ? 241 VAL B HG11   1 
ATOM   8788  H  HG12   . VAL B 1 261 ? 0.169   28.412 -91.165  1.00 52.71  ? 241 VAL B HG12   1 
ATOM   8789  H  HG13   . VAL B 1 261 ? 1.671   28.380 -91.681  1.00 52.71  ? 241 VAL B HG13   1 
ATOM   8790  H  HG21   . VAL B 1 261 ? 1.501   25.888 -93.243  1.00 50.61  ? 241 VAL B HG21   1 
ATOM   8791  H  HG22   . VAL B 1 261 ? 2.719   26.146 -92.255  1.00 50.61  ? 241 VAL B HG22   1 
ATOM   8792  H  HG23   . VAL B 1 261 ? 1.843   24.828 -92.109  1.00 50.61  ? 241 VAL B HG23   1 
ATOM   8793  N  N      . LEU B 1 262 ? -0.634  26.973 -88.725  1.00 48.17  ? 242 LEU B N      1 
ATOM   8794  C  CA     . LEU B 1 262 ? -1.409  27.820 -87.823  1.00 50.81  ? 242 LEU B CA     1 
ATOM   8795  C  C      . LEU B 1 262 ? -0.784  27.858 -86.432  1.00 45.77  ? 242 LEU B C      1 
ATOM   8796  O  O      . LEU B 1 262 ? -0.685  28.928 -85.816  1.00 47.92  ? 242 LEU B O      1 
ATOM   8797  C  CB     . LEU B 1 262 ? -2.858  27.333 -87.768  1.00 52.77  ? 242 LEU B CB     1 
ATOM   8798  C  CG     . LEU B 1 262 ? -3.579  27.296 -89.122  1.00 52.64  ? 242 LEU B CG     1 
ATOM   8799  C  CD1    . LEU B 1 262 ? -5.024  26.857 -88.950  1.00 55.75  ? 242 LEU B CD1    1 
ATOM   8800  C  CD2    . LEU B 1 262 ? -3.516  28.644 -89.839  1.00 49.72  ? 242 LEU B CD2    1 
ATOM   8801  H  H      . LEU B 1 262 ? -1.068  26.312 -89.063  1.00 57.93  ? 242 LEU B H      1 
ATOM   8802  H  HA     . LEU B 1 262 ? -1.413  28.725 -88.171  1.00 61.10  ? 242 LEU B HA     1 
ATOM   8803  H  HB2    . LEU B 1 262 ? -2.867  26.433 -87.406  1.00 63.44  ? 242 LEU B HB2    1 
ATOM   8804  H  HB3    . LEU B 1 262 ? -3.359  27.924 -87.185  1.00 63.44  ? 242 LEU B HB3    1 
ATOM   8805  H  HG     . LEU B 1 262 ? -3.140  26.642 -89.688  1.00 63.28  ? 242 LEU B HG     1 
ATOM   8806  H  HD11   . LEU B 1 262 ? -5.455  26.843 -89.819  1.00 67.02  ? 242 LEU B HD11   1 
ATOM   8807  H  HD12   . LEU B 1 262 ? -5.040  25.970 -88.557  1.00 67.02  ? 242 LEU B HD12   1 
ATOM   8808  H  HD13   . LEU B 1 262 ? -5.477  27.485 -88.366  1.00 67.02  ? 242 LEU B HD13   1 
ATOM   8809  H  HD21   . LEU B 1 262 ? -3.983  28.573 -90.686  1.00 59.79  ? 242 LEU B HD21   1 
ATOM   8810  H  HD22   . LEU B 1 262 ? -3.939  29.317 -89.284  1.00 59.79  ? 242 LEU B HD22   1 
ATOM   8811  H  HD23   . LEU B 1 262 ? -2.587  28.877 -89.992  1.00 59.79  ? 242 LEU B HD23   1 
ATOM   8812  N  N      . ASP B 1 263 ? -0.344  26.704 -85.922  1.00 38.34  ? 243 ASP B N      1 
ATOM   8813  C  CA     . ASP B 1 263 ? 0.288   26.684 -84.605  1.00 37.42  ? 243 ASP B CA     1 
ATOM   8814  C  C      . ASP B 1 263 ? 1.569   27.512 -84.598  1.00 35.53  ? 243 ASP B C      1 
ATOM   8815  O  O      . ASP B 1 263 ? 1.885   28.173 -83.603  1.00 33.17  ? 243 ASP B O      1 
ATOM   8816  C  CB     . ASP B 1 263 ? 0.582   25.244 -84.187  1.00 38.94  ? 243 ASP B CB     1 
ATOM   8817  C  CG     . ASP B 1 263 ? 1.046   25.138 -82.747  1.00 43.55  ? 243 ASP B CG     1 
ATOM   8818  O  OD1    . ASP B 1 263 ? 0.427   25.776 -81.871  1.00 46.77  ? 243 ASP B OD1    1 
ATOM   8819  O  OD2    . ASP B 1 263 ? 2.035   24.419 -82.492  1.00 46.02  ? 243 ASP B OD2    1 
ATOM   8820  H  H      . ASP B 1 263 ? -0.399  25.938 -86.309  1.00 46.13  ? 243 ASP B H      1 
ATOM   8821  H  HA     . ASP B 1 263 ? -0.321  27.067 -83.955  1.00 45.02  ? 243 ASP B HA     1 
ATOM   8822  H  HB2    . ASP B 1 263 ? -0.226  24.715 -84.282  1.00 46.84  ? 243 ASP B HB2    1 
ATOM   8823  H  HB3    . ASP B 1 263 ? 1.282   24.886 -84.756  1.00 46.84  ? 243 ASP B HB3    1 
ATOM   8824  N  N      . PHE B 1 264 ? 2.325   27.472 -85.697  1.00 32.49  ? 244 PHE B N      1 
ATOM   8825  C  CA     . PHE B 1 264 ? 3.536   28.278 -85.827  1.00 31.20  ? 244 PHE B CA     1 
ATOM   8826  C  C      . PHE B 1 264 ? 3.217   29.767 -85.722  1.00 33.69  ? 244 PHE B C      1 
ATOM   8827  O  O      . PHE B 1 264 ? 3.800   30.488 -84.897  1.00 29.18  ? 244 PHE B O      1 
ATOM   8828  C  CB     . PHE B 1 264 ? 4.208   27.943 -87.162  1.00 31.10  ? 244 PHE B CB     1 
ATOM   8829  C  CG     . PHE B 1 264 ? 5.394   28.803 -87.500  1.00 30.52  ? 244 PHE B CG     1 
ATOM   8830  C  CD1    . PHE B 1 264 ? 5.237   29.970 -88.229  1.00 28.00  ? 244 PHE B CD1    1 
ATOM   8831  C  CD2    . PHE B 1 264 ? 6.673   28.421 -87.125  1.00 31.27  ? 244 PHE B CD2    1 
ATOM   8832  C  CE1    . PHE B 1 264 ? 6.327   30.753 -88.556  1.00 25.76  ? 244 PHE B CE1    1 
ATOM   8833  C  CE2    . PHE B 1 264 ? 7.769   29.202 -87.450  1.00 29.80  ? 244 PHE B CE2    1 
ATOM   8834  C  CZ     . PHE B 1 264 ? 7.595   30.368 -88.167  1.00 26.79  ? 244 PHE B CZ     1 
ATOM   8835  H  H      . PHE B 1 264 ? 2.156   26.982 -86.383  1.00 39.10  ? 244 PHE B H      1 
ATOM   8836  H  HA     . PHE B 1 264 ? 4.150   28.049 -85.112  1.00 37.55  ? 244 PHE B HA     1 
ATOM   8837  H  HB2    . PHE B 1 264 ? 4.511   27.022 -87.134  1.00 37.44  ? 244 PHE B HB2    1 
ATOM   8838  H  HB3    . PHE B 1 264 ? 3.556   28.050 -87.872  1.00 37.44  ? 244 PHE B HB3    1 
ATOM   8839  H  HD1    . PHE B 1 264 ? 4.386   30.235 -88.493  1.00 33.72  ? 244 PHE B HD1    1 
ATOM   8840  H  HD2    . PHE B 1 264 ? 6.795   27.637 -86.641  1.00 37.64  ? 244 PHE B HD2    1 
ATOM   8841  H  HE1    . PHE B 1 264 ? 6.208   31.538 -89.039  1.00 30.32  ? 244 PHE B HE1    1 
ATOM   8842  H  HE2    . PHE B 1 264 ? 8.621   28.941 -87.186  1.00 35.87  ? 244 PHE B HE2    1 
ATOM   8843  H  HZ     . PHE B 1 264 ? 8.329   30.894 -88.385  1.00 32.27  ? 244 PHE B HZ     1 
ATOM   8844  N  N      . LEU B 1 265 ? 2.276   30.242 -86.543  1.00 44.54  ? 245 LEU B N      1 
ATOM   8845  C  CA     . LEU B 1 265 ? 1.909   31.654 -86.500  1.00 48.75  ? 245 LEU B CA     1 
ATOM   8846  C  C      . LEU B 1 265 ? 1.433   32.055 -85.109  1.00 45.94  ? 245 LEU B C      1 
ATOM   8847  O  O      . LEU B 1 265 ? 1.865   33.078 -84.562  1.00 46.87  ? 245 LEU B O      1 
ATOM   8848  C  CB     . LEU B 1 265 ? 0.833   31.949 -87.547  1.00 51.08  ? 245 LEU B CB     1 
ATOM   8849  C  CG     . LEU B 1 265 ? 1.283   31.913 -89.010  1.00 51.47  ? 245 LEU B CG     1 
ATOM   8850  C  CD1    . LEU B 1 265 ? 0.082   32.033 -89.928  1.00 48.51  ? 245 LEU B CD1    1 
ATOM   8851  C  CD2    . LEU B 1 265 ? 2.285   33.026 -89.299  1.00 54.47  ? 245 LEU B CD2    1 
ATOM   8852  H  H      . LEU B 1 265 ? 1.844   29.775 -87.122  1.00 53.56  ? 245 LEU B H      1 
ATOM   8853  H  HA     . LEU B 1 265 ? 2.689   32.189 -86.715  1.00 58.62  ? 245 LEU B HA     1 
ATOM   8854  H  HB2    . LEU B 1 265 ? 0.124   31.295 -87.447  1.00 61.42  ? 245 LEU B HB2    1 
ATOM   8855  H  HB3    . LEU B 1 265 ? 0.478   32.836 -87.376  1.00 61.42  ? 245 LEU B HB3    1 
ATOM   8856  H  HG     . LEU B 1 265 ? 1.715   31.064 -89.189  1.00 61.89  ? 245 LEU B HG     1 
ATOM   8857  H  HD11   . LEU B 1 265 ? 0.385   32.008 -90.849  1.00 58.33  ? 245 LEU B HD11   1 
ATOM   8858  H  HD12   . LEU B 1 265 ? -0.521  31.292 -89.757  1.00 58.33  ? 245 LEU B HD12   1 
ATOM   8859  H  HD13   . LEU B 1 265 ? -0.369  32.873 -89.749  1.00 58.33  ? 245 LEU B HD13   1 
ATOM   8860  H  HD21   . LEU B 1 265 ? 2.550   32.977 -90.231  1.00 65.48  ? 245 LEU B HD21   1 
ATOM   8861  H  HD22   . LEU B 1 265 ? 1.866   33.882 -89.118  1.00 65.48  ? 245 LEU B HD22   1 
ATOM   8862  H  HD23   . LEU B 1 265 ? 3.060   32.909 -88.727  1.00 65.48  ? 245 LEU B HD23   1 
ATOM   8863  N  N      . HIS B 1 266 ? 0.547   31.252 -84.514  1.00 40.34  ? 246 HIS B N      1 
ATOM   8864  C  CA     . HIS B 1 266 ? 0.088   31.557 -83.163  1.00 39.08  ? 246 HIS B CA     1 
ATOM   8865  C  C      . HIS B 1 266 ? 1.263   31.646 -82.198  1.00 36.06  ? 246 HIS B C      1 
ATOM   8866  O  O      . HIS B 1 266 ? 1.324   32.554 -81.361  1.00 29.88  ? 246 HIS B O      1 
ATOM   8867  C  CB     . HIS B 1 266 ? -0.915  30.508 -82.685  1.00 44.14  ? 246 HIS B CB     1 
ATOM   8868  C  CG     . HIS B 1 266 ? -1.458  30.783 -81.316  1.00 47.21  ? 246 HIS B CG     1 
ATOM   8869  N  ND1    . HIS B 1 266 ? -2.485  31.675 -81.091  1.00 48.39  ? 246 HIS B ND1    1 
ATOM   8870  C  CD2    . HIS B 1 266 ? -1.110  30.296 -80.101  1.00 46.50  ? 246 HIS B CD2    1 
ATOM   8871  C  CE1    . HIS B 1 266 ? -2.751  31.721 -79.798  1.00 47.83  ? 246 HIS B CE1    1 
ATOM   8872  N  NE2    . HIS B 1 266 ? -1.931  30.894 -79.175  1.00 47.38  ? 246 HIS B NE2    1 
ATOM   8873  H  H      . HIS B 1 266 ? 0.205   30.544 -84.862  1.00 48.52  ? 246 HIS B H      1 
ATOM   8874  H  HA     . HIS B 1 266 ? -0.359  32.418 -83.169  1.00 47.02  ? 246 HIS B HA     1 
ATOM   8875  H  HB2    . HIS B 1 266 ? -1.663  30.485 -83.302  1.00 53.08  ? 246 HIS B HB2    1 
ATOM   8876  H  HB3    . HIS B 1 266 ? -0.478  29.643 -82.663  1.00 53.08  ? 246 HIS B HB3    1 
ATOM   8877  H  HD2    . HIS B 1 266 ? -0.443  29.672 -79.926  1.00 55.92  ? 246 HIS B HD2    1 
ATOM   8878  H  HE1    . HIS B 1 266 ? -3.404  32.246 -79.395  1.00 57.51  ? 246 HIS B HE1    1 
ATOM   8879  H  HE2    . HIS B 1 266 ? -1.914  30.752 -78.327  1.00 56.97  ? 246 HIS B HE2    1 
ATOM   8880  N  N      . PHE B 1 267 ? 2.207   30.708 -82.297  1.00 42.50  ? 247 PHE B N      1 
ATOM   8881  C  CA     . PHE B 1 267 ? 3.352   30.710 -81.394  1.00 41.07  ? 247 PHE B CA     1 
ATOM   8882  C  C      . PHE B 1 267 ? 4.134   32.010 -81.500  1.00 42.06  ? 247 PHE B C      1 
ATOM   8883  O  O      . PHE B 1 267 ? 4.421   32.658 -80.487  1.00 40.54  ? 247 PHE B O      1 
ATOM   8884  C  CB     . PHE B 1 267 ? 4.271   29.526 -81.694  1.00 35.37  ? 247 PHE B CB     1 
ATOM   8885  C  CG     . PHE B 1 267 ? 5.530   29.525 -80.875  1.00 32.95  ? 247 PHE B CG     1 
ATOM   8886  C  CD1    . PHE B 1 267 ? 5.561   28.940 -79.620  1.00 31.73  ? 247 PHE B CD1    1 
ATOM   8887  C  CD2    . PHE B 1 267 ? 6.682   30.134 -81.354  1.00 34.13  ? 247 PHE B CD2    1 
ATOM   8888  C  CE1    . PHE B 1 267 ? 6.721   28.949 -78.866  1.00 33.59  ? 247 PHE B CE1    1 
ATOM   8889  C  CE2    . PHE B 1 267 ? 7.843   30.147 -80.604  1.00 34.10  ? 247 PHE B CE2    1 
ATOM   8890  C  CZ     . PHE B 1 267 ? 7.863   29.555 -79.359  1.00 34.34  ? 247 PHE B CZ     1 
ATOM   8891  H  H      . PHE B 1 267 ? 2.206   30.068 -82.872  1.00 51.12  ? 247 PHE B H      1 
ATOM   8892  H  HA     . PHE B 1 267 ? 3.036   30.622 -80.481  1.00 49.41  ? 247 PHE B HA     1 
ATOM   8893  H  HB2    . PHE B 1 267 ? 3.793   28.702 -81.507  1.00 42.57  ? 247 PHE B HB2    1 
ATOM   8894  H  HB3    . PHE B 1 267 ? 4.524   29.554 -82.630  1.00 42.57  ? 247 PHE B HB3    1 
ATOM   8895  H  HD1    . PHE B 1 267 ? 4.797   28.531 -79.284  1.00 38.19  ? 247 PHE B HD1    1 
ATOM   8896  H  HD2    . PHE B 1 267 ? 6.673   30.534 -82.193  1.00 41.08  ? 247 PHE B HD2    1 
ATOM   8897  H  HE1    . PHE B 1 267 ? 6.733   28.550 -78.026  1.00 40.43  ? 247 PHE B HE1    1 
ATOM   8898  H  HE2    . PHE B 1 267 ? 8.609   30.555 -80.938  1.00 41.03  ? 247 PHE B HE2    1 
ATOM   8899  H  HZ     . PHE B 1 267 ? 8.643   29.562 -78.852  1.00 41.33  ? 247 PHE B HZ     1 
ATOM   8900  N  N      . PHE B 1 268 ? 4.495   32.410 -82.717  1.00 42.57  ? 248 PHE B N      1 
ATOM   8901  C  CA     . PHE B 1 268 ? 5.300   33.619 -82.853  1.00 38.09  ? 248 PHE B CA     1 
ATOM   8902  C  C      . PHE B 1 268 ? 4.476   34.896 -82.755  1.00 41.50  ? 248 PHE B C      1 
ATOM   8903  O  O      . PHE B 1 268 ? 5.047   35.988 -82.844  1.00 37.98  ? 248 PHE B O      1 
ATOM   8904  C  CB     . PHE B 1 268 ? 6.088   33.587 -84.164  1.00 33.14  ? 248 PHE B CB     1 
ATOM   8905  C  CG     . PHE B 1 268 ? 7.362   32.797 -84.073  1.00 31.50  ? 248 PHE B CG     1 
ATOM   8906  C  CD1    . PHE B 1 268 ? 8.432   33.269 -83.329  1.00 28.37  ? 248 PHE B CD1    1 
ATOM   8907  C  CD2    . PHE B 1 268 ? 7.485   31.574 -84.712  1.00 32.36  ? 248 PHE B CD2    1 
ATOM   8908  C  CE1    . PHE B 1 268 ? 9.603   32.541 -83.234  1.00 27.15  ? 248 PHE B CE1    1 
ATOM   8909  C  CE2    . PHE B 1 268 ? 8.655   30.842 -84.619  1.00 30.96  ? 248 PHE B CE2    1 
ATOM   8910  C  CZ     . PHE B 1 268 ? 9.714   31.327 -83.879  1.00 28.87  ? 248 PHE B CZ     1 
ATOM   8911  H  H      . PHE B 1 268 ? 4.296   32.016 -83.455  1.00 51.20  ? 248 PHE B H      1 
ATOM   8912  H  HA     . PHE B 1 268 ? 5.945   33.636 -82.129  1.00 45.82  ? 248 PHE B HA     1 
ATOM   8913  H  HB2    . PHE B 1 268 ? 5.536   33.185 -84.853  1.00 39.88  ? 248 PHE B HB2    1 
ATOM   8914  H  HB3    . PHE B 1 268 ? 6.318   34.496 -84.414  1.00 39.88  ? 248 PHE B HB3    1 
ATOM   8915  H  HD1    . PHE B 1 268 ? 8.363   34.087 -82.892  1.00 34.16  ? 248 PHE B HD1    1 
ATOM   8916  H  HD2    . PHE B 1 268 ? 6.774   31.243 -85.211  1.00 38.96  ? 248 PHE B HD2    1 
ATOM   8917  H  HE1    . PHE B 1 268 ? 10.316  32.870 -82.735  1.00 32.70  ? 248 PHE B HE1    1 
ATOM   8918  H  HE2    . PHE B 1 268 ? 8.727   30.024 -85.055  1.00 37.27  ? 248 PHE B HE2    1 
ATOM   8919  H  HZ     . PHE B 1 268 ? 10.502  30.836 -83.817  1.00 34.77  ? 248 PHE B HZ     1 
ATOM   8920  N  N      . LEU B 1 269 ? 3.162   34.794 -82.564  1.00 46.52  ? 249 LEU B N      1 
ATOM   8921  C  CA     . LEU B 1 269 ? 2.328   35.966 -82.326  1.00 51.59  ? 249 LEU B CA     1 
ATOM   8922  C  C      . LEU B 1 269 ? 2.009   36.187 -80.852  1.00 50.24  ? 249 LEU B C      1 
ATOM   8923  O  O      . LEU B 1 269 ? 1.991   37.336 -80.399  1.00 53.99  ? 249 LEU B O      1 
ATOM   8924  C  CB     . LEU B 1 269 ? 1.016   35.852 -83.110  1.00 52.93  ? 249 LEU B CB     1 
ATOM   8925  C  CG     . LEU B 1 269 ? 1.028   36.301 -84.573  1.00 54.90  ? 249 LEU B CG     1 
ATOM   8926  C  CD1    . LEU B 1 269 ? -0.295  35.964 -85.238  1.00 57.77  ? 249 LEU B CD1    1 
ATOM   8927  C  CD2    . LEU B 1 269 ? 1.303   37.795 -84.687  1.00 54.04  ? 249 LEU B CD2    1 
ATOM   8928  H  H      . LEU B 1 269 ? 2.728   34.052 -82.568  1.00 55.95  ? 249 LEU B H      1 
ATOM   8929  H  HA     . LEU B 1 269 ? 2.798   36.752 -82.647  1.00 62.03  ? 249 LEU B HA     1 
ATOM   8930  H  HB2    . LEU B 1 269 ? 0.741   34.922 -83.101  1.00 63.63  ? 249 LEU B HB2    1 
ATOM   8931  H  HB3    . LEU B 1 269 ? 0.347   36.386 -82.655  1.00 63.63  ? 249 LEU B HB3    1 
ATOM   8932  H  HG     . LEU B 1 269 ? 1.732   35.828 -85.045  1.00 65.99  ? 249 LEU B HG     1 
ATOM   8933  H  HD11   . LEU B 1 269 ? -0.267  36.256 -86.162  1.00 69.44  ? 249 LEU B HD11   1 
ATOM   8934  H  HD12   . LEU B 1 269 ? -0.433  35.005 -85.198  1.00 69.44  ? 249 LEU B HD12   1 
ATOM   8935  H  HD13   . LEU B 1 269 ? -1.010  36.421 -84.767  1.00 69.44  ? 249 LEU B HD13   1 
ATOM   8936  H  HD21   . LEU B 1 269 ? 1.303   38.045 -85.624  1.00 64.96  ? 249 LEU B HD21   1 
ATOM   8937  H  HD22   . LEU B 1 269 ? 0.608   38.280 -84.215  1.00 64.96  ? 249 LEU B HD22   1 
ATOM   8938  H  HD23   . LEU B 1 269 ? 2.168   37.988 -84.292  1.00 64.96  ? 249 LEU B HD23   1 
ATOM   8939  N  N      . HIS B 1 270 ? 1.760   35.119 -80.087  1.00 46.01  ? 250 HIS B N      1 
ATOM   8940  C  CA     . HIS B 1 270 ? 1.261   35.253 -78.723  1.00 43.48  ? 250 HIS B CA     1 
ATOM   8941  C  C      . HIS B 1 270 ? 2.062   34.516 -77.657  1.00 44.42  ? 250 HIS B C      1 
ATOM   8942  O  O      . HIS B 1 270 ? 1.791   34.726 -76.470  1.00 45.57  ? 250 HIS B O      1 
ATOM   8943  C  CB     . HIS B 1 270 ? -0.199  34.781 -78.646  1.00 43.08  ? 250 HIS B CB     1 
ATOM   8944  C  CG     . HIS B 1 270 ? -1.121  35.522 -79.564  1.00 43.06  ? 250 HIS B CG     1 
ATOM   8945  N  ND1    . HIS B 1 270 ? -2.185  34.919 -80.198  1.00 43.67  ? 250 HIS B ND1    1 
ATOM   8946  C  CD2    . HIS B 1 270 ? -1.142  36.821 -79.947  1.00 43.20  ? 250 HIS B CD2    1 
ATOM   8947  C  CE1    . HIS B 1 270 ? -2.819  35.813 -80.937  1.00 44.15  ? 250 HIS B CE1    1 
ATOM   8948  N  NE2    . HIS B 1 270 ? -2.206  36.975 -80.802  1.00 44.11  ? 250 HIS B NE2    1 
ATOM   8949  H  H      . HIS B 1 270 ? 1.874   34.305 -80.339  1.00 55.33  ? 250 HIS B H      1 
ATOM   8950  H  HA     . HIS B 1 270 ? 1.272   36.194 -78.489  1.00 52.29  ? 250 HIS B HA     1 
ATOM   8951  H  HB2    . HIS B 1 270 ? -0.237  33.841 -78.883  1.00 51.82  ? 250 HIS B HB2    1 
ATOM   8952  H  HB3    . HIS B 1 270 ? -0.521  34.905 -77.739  1.00 51.82  ? 250 HIS B HB3    1 
ATOM   8953  H  HD2    . HIS B 1 270 ? -0.545  37.484 -79.683  1.00 51.96  ? 250 HIS B HD2    1 
ATOM   8954  H  HE1    . HIS B 1 270 ? -3.569  35.651 -81.462  1.00 53.10  ? 250 HIS B HE1    1 
ATOM   8955  H  HE2    . HIS B 1 270 ? -2.436  37.709 -81.187  1.00 53.05  ? 250 HIS B HE2    1 
ATOM   8956  N  N      . GLU B 1 271 ? 3.028   33.675 -78.021  1.00 46.81  ? 251 GLU B N      1 
ATOM   8957  C  CA     . GLU B 1 271 ? 3.809   32.931 -77.038  1.00 49.25  ? 251 GLU B CA     1 
ATOM   8958  C  C      . GLU B 1 271 ? 5.235   33.445 -76.907  1.00 48.55  ? 251 GLU B C      1 
ATOM   8959  O  O      . GLU B 1 271 ? 5.730   33.609 -75.788  1.00 50.02  ? 251 GLU B O      1 
ATOM   8960  C  CB     . GLU B 1 271 ? 3.823   31.433 -77.384  1.00 52.23  ? 251 GLU B CB     1 
ATOM   8961  C  CG     . GLU B 1 271 ? 2.536   30.708 -77.015  1.00 55.56  ? 251 GLU B CG     1 
ATOM   8962  C  CD     . GLU B 1 271 ? 2.584   29.227 -77.337  1.00 55.91  ? 251 GLU B CD     1 
ATOM   8963  O  OE1    . GLU B 1 271 ? 1.923   28.809 -78.309  1.00 56.93  ? 251 GLU B OE1    1 
ATOM   8964  O  OE2    . GLU B 1 271 ? 3.286   28.481 -76.620  1.00 54.20  ? 251 GLU B OE2    1 
ATOM   8965  H  H      . GLU B 1 271 ? 3.252   33.517 -78.836  1.00 56.29  ? 251 GLU B H      1 
ATOM   8966  H  HA     . GLU B 1 271 ? 3.384   33.027 -76.171  1.00 59.22  ? 251 GLU B HA     1 
ATOM   8967  H  HB2    . GLU B 1 271 ? 3.956   31.334 -78.340  1.00 62.80  ? 251 GLU B HB2    1 
ATOM   8968  H  HB3    . GLU B 1 271 ? 4.551   31.008 -76.905  1.00 62.80  ? 251 GLU B HB3    1 
ATOM   8969  H  HG2    . GLU B 1 271 ? 2.382   30.803 -76.062  1.00 66.79  ? 251 GLU B HG2    1 
ATOM   8970  H  HG3    . GLU B 1 271 ? 1.800   31.099 -77.511  1.00 66.79  ? 251 GLU B HG3    1 
ATOM   8971  N  N      . PHE B 1 272 ? 5.915   33.705 -78.019  1.00 44.90  ? 252 PHE B N      1 
ATOM   8972  C  CA     . PHE B 1 272 ? 7.258   34.262 -77.952  1.00 42.60  ? 252 PHE B CA     1 
ATOM   8973  C  C      . PHE B 1 272 ? 7.190   35.721 -77.515  1.00 41.80  ? 252 PHE B C      1 
ATOM   8974  O  O      . PHE B 1 272 ? 6.461   36.523 -78.105  1.00 45.13  ? 252 PHE B O      1 
ATOM   8975  C  CB     . PHE B 1 272 ? 7.947   34.142 -79.310  1.00 40.30  ? 252 PHE B CB     1 
ATOM   8976  C  CG     . PHE B 1 272 ? 9.290   34.811 -79.372  1.00 36.66  ? 252 PHE B CG     1 
ATOM   8977  C  CD1    . PHE B 1 272 ? 10.389  34.247 -78.746  1.00 34.00  ? 252 PHE B CD1    1 
ATOM   8978  C  CD2    . PHE B 1 272 ? 9.453   36.004 -80.058  1.00 35.64  ? 252 PHE B CD2    1 
ATOM   8979  C  CE1    . PHE B 1 272 ? 11.626  34.859 -78.800  1.00 33.04  ? 252 PHE B CE1    1 
ATOM   8980  C  CE2    . PHE B 1 272 ? 10.687  36.622 -80.115  1.00 35.12  ? 252 PHE B CE2    1 
ATOM   8981  C  CZ     . PHE B 1 272 ? 11.776  36.048 -79.485  1.00 34.03  ? 252 PHE B CZ     1 
ATOM   8982  H  H      . PHE B 1 272 ? 5.623   33.570 -78.817  1.00 54.00  ? 252 PHE B H      1 
ATOM   8983  H  HA     . PHE B 1 272 ? 7.779   33.770 -77.299  1.00 51.24  ? 252 PHE B HA     1 
ATOM   8984  H  HB2    . PHE B 1 272 ? 8.074   33.202 -79.514  1.00 48.48  ? 252 PHE B HB2    1 
ATOM   8985  H  HB3    . PHE B 1 272 ? 7.381   34.550 -79.984  1.00 48.48  ? 252 PHE B HB3    1 
ATOM   8986  H  HD1    . PHE B 1 272 ? 10.293  33.446 -78.282  1.00 40.92  ? 252 PHE B HD1    1 
ATOM   8987  H  HD2    . PHE B 1 272 ? 8.724   36.394 -80.483  1.00 42.89  ? 252 PHE B HD2    1 
ATOM   8988  H  HE1    . PHE B 1 272 ? 12.357  34.471 -78.376  1.00 39.76  ? 252 PHE B HE1    1 
ATOM   8989  H  HE2    . PHE B 1 272 ? 10.786  37.423 -80.578  1.00 42.26  ? 252 PHE B HE2    1 
ATOM   8990  H  HZ     . PHE B 1 272 ? 12.608  36.462 -79.524  1.00 40.95  ? 252 PHE B HZ     1 
ATOM   8991  N  N      . ASP B 1 273 ? 7.952   36.063 -76.477  1.00 37.38  ? 253 ASP B N      1 
ATOM   8992  C  CA     . ASP B 1 273 ? 7.977   37.417 -75.925  1.00 33.74  ? 253 ASP B CA     1 
ATOM   8993  C  C      . ASP B 1 273 ? 9.243   38.102 -76.425  1.00 33.90  ? 253 ASP B C      1 
ATOM   8994  O  O      . ASP B 1 273 ? 10.340  37.844 -75.925  1.00 35.53  ? 253 ASP B O      1 
ATOM   8995  C  CB     . ASP B 1 273 ? 7.923   37.390 -74.401  1.00 31.25  ? 253 ASP B CB     1 
ATOM   8996  C  CG     . ASP B 1 273 ? 7.829   38.781 -73.793  1.00 33.53  ? 253 ASP B CG     1 
ATOM   8997  O  OD1    . ASP B 1 273 ? 8.168   39.766 -74.484  1.00 34.69  ? 253 ASP B OD1    1 
ATOM   8998  O  OD2    . ASP B 1 273 ? 7.413   38.892 -72.621  1.00 35.43  ? 253 ASP B OD2    1 
ATOM   8999  H  H      . ASP B 1 273 ? 8.475   35.517 -76.067  1.00 44.98  ? 253 ASP B H      1 
ATOM   9000  H  HA     . ASP B 1 273 ? 7.209   37.913 -76.251  1.00 40.60  ? 253 ASP B HA     1 
ATOM   9001  H  HB2    . ASP B 1 273 ? 7.142   36.887 -74.121  1.00 37.62  ? 253 ASP B HB2    1 
ATOM   9002  H  HB3    . ASP B 1 273 ? 8.728   36.968 -74.063  1.00 37.62  ? 253 ASP B HB3    1 
ATOM   9003  N  N      . SER B 1 274 ? 9.085   38.981 -77.417  1.00 35.29  ? 254 SER B N      1 
ATOM   9004  C  CA     . SER B 1 274 ? 10.226  39.650 -78.031  1.00 40.06  ? 254 SER B CA     1 
ATOM   9005  C  C      . SER B 1 274 ? 10.906  40.649 -77.102  1.00 38.02  ? 254 SER B C      1 
ATOM   9006  O  O      . SER B 1 274 ? 11.996  41.128 -77.436  1.00 32.30  ? 254 SER B O      1 
ATOM   9007  C  CB     . SER B 1 274 ? 9.783   40.362 -79.310  1.00 49.47  ? 254 SER B CB     1 
ATOM   9008  O  OG     . SER B 1 274 ? 8.783   41.327 -79.033  1.00 59.51  ? 254 SER B OG     1 
ATOM   9009  H  H      . SER B 1 274 ? 8.325   39.205 -77.751  1.00 42.47  ? 254 SER B H      1 
ATOM   9010  H  HA     . SER B 1 274 ? 10.884  38.981 -78.277  1.00 48.19  ? 254 SER B HA     1 
ATOM   9011  H  HB2    . SER B 1 274 ? 10.549  40.807 -79.705  1.00 59.49  ? 254 SER B HB2    1 
ATOM   9012  H  HB3    . SER B 1 274 ? 9.426   39.706 -79.928  1.00 59.49  ? 254 SER B HB3    1 
ATOM   9013  H  HG     . SER B 1 274 ? 9.080   41.902 -78.497  1.00 71.53  ? 254 SER B HG     1 
ATOM   9014  N  N      . ASP B 1 275 ? 10.305  40.975 -75.958  1.00 44.58  ? 255 ASP B N      1 
ATOM   9015  C  CA     . ASP B 1 275 ? 10.923  41.884 -75.001  1.00 49.01  ? 255 ASP B CA     1 
ATOM   9016  C  C      . ASP B 1 275 ? 11.818  41.175 -73.995  1.00 52.05  ? 255 ASP B C      1 
ATOM   9017  O  O      . ASP B 1 275 ? 12.524  41.851 -73.238  1.00 55.22  ? 255 ASP B O      1 
ATOM   9018  C  CB     . ASP B 1 275 ? 9.852   42.668 -74.232  1.00 50.16  ? 255 ASP B CB     1 
ATOM   9019  C  CG     . ASP B 1 275 ? 9.095   43.645 -75.109  1.00 52.59  ? 255 ASP B CG     1 
ATOM   9020  O  OD1    . ASP B 1 275 ? 9.685   44.148 -76.089  1.00 53.67  ? 255 ASP B OD1    1 
ATOM   9021  O  OD2    . ASP B 1 275 ? 7.914   43.922 -74.809  1.00 53.02  ? 255 ASP B OD2    1 
ATOM   9022  H  H      . ASP B 1 275 ? 9.535   40.680 -75.713  1.00 53.62  ? 255 ASP B H      1 
ATOM   9023  H  HA     . ASP B 1 275 ? 11.468  42.523 -75.485  1.00 58.94  ? 255 ASP B HA     1 
ATOM   9024  H  HB2    . ASP B 1 275 ? 9.211   42.044 -73.857  1.00 60.31  ? 255 ASP B HB2    1 
ATOM   9025  H  HB3    . ASP B 1 275 ? 10.278  43.172 -73.521  1.00 60.31  ? 255 ASP B HB3    1 
ATOM   9026  N  N      . LYS B 1 276 ? 11.813  39.841 -73.967  1.00 49.32  ? 256 LYS B N      1 
ATOM   9027  C  CA     . LYS B 1 276 ? 12.523  39.103 -72.930  1.00 48.87  ? 256 LYS B CA     1 
ATOM   9028  C  C      . LYS B 1 276 ? 13.377  37.973 -73.493  1.00 42.37  ? 256 LYS B C      1 
ATOM   9029  O  O      . LYS B 1 276 ? 14.448  37.671 -72.957  1.00 38.29  ? 256 LYS B O      1 
ATOM   9030  C  CB     . LYS B 1 276 ? 11.521  38.521 -71.929  1.00 56.26  ? 256 LYS B CB     1 
ATOM   9031  C  CG     . LYS B 1 276 ? 10.707  39.548 -71.156  1.00 63.65  ? 256 LYS B CG     1 
ATOM   9032  C  CD     . LYS B 1 276 ? 11.431  40.020 -69.907  1.00 70.12  ? 256 LYS B CD     1 
ATOM   9033  C  CE     . LYS B 1 276 ? 10.487  40.749 -68.962  1.00 76.95  ? 256 LYS B CE     1 
ATOM   9034  N  NZ     . LYS B 1 276 ? 9.918   41.984 -69.568  1.00 81.94  ? 256 LYS B NZ     1 
ATOM   9035  H  H      . LYS B 1 276 ? 11.406  39.343 -74.538  1.00 59.30  ? 256 LYS B H      1 
ATOM   9036  H  HA     . LYS B 1 276 ? 13.108  39.712 -72.451  1.00 58.76  ? 256 LYS B HA     1 
ATOM   9037  H  HB2    . LYS B 1 276 ? 10.897  37.957 -72.412  1.00 67.64  ? 256 LYS B HB2    1 
ATOM   9038  H  HB3    . LYS B 1 276 ? 12.007  37.987 -71.282  1.00 67.64  ? 256 LYS B HB3    1 
ATOM   9039  H  HG2    . LYS B 1 276 ? 10.546  40.319 -71.722  1.00 76.50  ? 256 LYS B HG2    1 
ATOM   9040  H  HG3    . LYS B 1 276 ? 9.865   39.150 -70.886  1.00 76.50  ? 256 LYS B HG3    1 
ATOM   9041  H  HD2    . LYS B 1 276 ? 11.797  39.253 -69.440  1.00 84.26  ? 256 LYS B HD2    1 
ATOM   9042  H  HD3    . LYS B 1 276 ? 12.141  40.630 -70.159  1.00 84.26  ? 256 LYS B HD3    1 
ATOM   9043  H  HE2    . LYS B 1 276 ? 9.752   40.160 -68.731  1.00 92.46  ? 256 LYS B HE2    1 
ATOM   9044  H  HE3    . LYS B 1 276 ? 10.974  41.003 -68.162  1.00 92.46  ? 256 LYS B HE3    1 
ATOM   9045  H  HZ1    . LYS B 1 276 ? 9.373   42.383 -68.989  1.00 98.44  ? 256 LYS B HZ1    1 
ATOM   9046  H  HZ2    . LYS B 1 276 ? 10.574  42.546 -69.783  1.00 98.44  ? 256 LYS B HZ2    1 
ATOM   9047  H  HZ3    . LYS B 1 276 ? 9.460   41.779 -70.302  1.00 98.44  ? 256 LYS B HZ3    1 
ATOM   9048  N  N      . GLN B 1 277 ? 12.918  37.347 -74.572  1.00 39.86  ? 257 GLN B N      1 
ATOM   9049  C  CA     . GLN B 1 277 ? 13.456  36.073 -75.019  1.00 37.12  ? 257 GLN B CA     1 
ATOM   9050  C  C      . GLN B 1 277 ? 14.282  36.230 -76.290  1.00 37.88  ? 257 GLN B C      1 
ATOM   9051  O  O      . GLN B 1 277 ? 14.188  37.230 -77.006  1.00 39.85  ? 257 GLN B O      1 
ATOM   9052  C  CB     . GLN B 1 277 ? 12.316  35.075 -75.242  1.00 35.42  ? 257 GLN B CB     1 
ATOM   9053  C  CG     . GLN B 1 277 ? 11.402  34.954 -74.034  1.00 33.64  ? 257 GLN B CG     1 
ATOM   9054  C  CD     . GLN B 1 277 ? 10.284  33.954 -74.230  1.00 35.13  ? 257 GLN B CD     1 
ATOM   9055  O  OE1    . GLN B 1 277 ? 9.698   33.861 -75.310  1.00 38.41  ? 257 GLN B OE1    1 
ATOM   9056  N  NE2    . GLN B 1 277 ? 9.977   33.201 -73.179  1.00 32.36  ? 257 GLN B NE2    1 
ATOM   9057  H  H      . GLN B 1 277 ? 12.285  37.649 -75.070  1.00 47.94  ? 257 GLN B H      1 
ATOM   9058  H  HA     . GLN B 1 277 ? 14.035  35.715 -74.328  1.00 44.66  ? 257 GLN B HA     1 
ATOM   9059  H  HB2    . GLN B 1 277 ? 11.781  35.370 -75.996  1.00 42.62  ? 257 GLN B HB2    1 
ATOM   9060  H  HB3    . GLN B 1 277 ? 12.692  34.200 -75.424  1.00 42.62  ? 257 GLN B HB3    1 
ATOM   9061  H  HG2    . GLN B 1 277 ? 11.926  34.669 -73.270  1.00 40.49  ? 257 GLN B HG2    1 
ATOM   9062  H  HG3    . GLN B 1 277 ? 11.000  35.818 -73.855  1.00 40.49  ? 257 GLN B HG3    1 
ATOM   9063  H  HE21   . GLN B 1 277 ? 10.406  33.298 -72.441  1.00 38.95  ? 257 GLN B HE21   1 
ATOM   9064  H  HE22   . GLN B 1 277 ? 9.349   32.616 -73.238  1.00 38.95  ? 257 GLN B HE22   1 
ATOM   9065  N  N      . VAL B 1 278 ? 15.098  35.211 -76.560  1.00 36.49  ? 258 VAL B N      1 
ATOM   9066  C  CA     . VAL B 1 278 ? 16.000  35.185 -77.706  1.00 37.70  ? 258 VAL B CA     1 
ATOM   9067  C  C      . VAL B 1 278 ? 15.807  33.870 -78.447  1.00 37.88  ? 258 VAL B C      1 
ATOM   9068  O  O      . VAL B 1 278 ? 15.770  32.802 -77.826  1.00 39.86  ? 258 VAL B O      1 
ATOM   9069  C  CB     . VAL B 1 278 ? 17.472  35.342 -77.275  1.00 36.23  ? 258 VAL B CB     1 
ATOM   9070  C  CG1    . VAL B 1 278 ? 18.403  35.283 -78.482  1.00 35.93  ? 258 VAL B CG1    1 
ATOM   9071  C  CG2    . VAL B 1 278 ? 17.670  36.642 -76.510  1.00 36.10  ? 258 VAL B CG2    1 
ATOM   9072  H  H      . VAL B 1 278 ? 15.147  34.502 -76.075  1.00 43.90  ? 258 VAL B H      1 
ATOM   9073  H  HA     . VAL B 1 278 ? 15.777  35.912 -78.308  1.00 45.36  ? 258 VAL B HA     1 
ATOM   9074  H  HB     . VAL B 1 278 ? 17.705  34.610 -76.683  1.00 43.60  ? 258 VAL B HB     1 
ATOM   9075  H  HG11   . VAL B 1 278 ? 19.319  35.385 -78.179  1.00 43.24  ? 258 VAL B HG11   1 
ATOM   9076  H  HG12   . VAL B 1 278 ? 18.293  34.426 -78.923  1.00 43.24  ? 258 VAL B HG12   1 
ATOM   9077  H  HG13   . VAL B 1 278 ? 18.174  36.001 -79.092  1.00 43.24  ? 258 VAL B HG13   1 
ATOM   9078  H  HG21   . VAL B 1 278 ? 18.602  36.716 -76.251  1.00 43.44  ? 258 VAL B HG21   1 
ATOM   9079  H  HG22   . VAL B 1 278 ? 17.425  37.385 -77.083  1.00 43.44  ? 258 VAL B HG22   1 
ATOM   9080  H  HG23   . VAL B 1 278 ? 17.106  36.632 -75.721  1.00 43.44  ? 258 VAL B HG23   1 
ATOM   9081  N  N      . ILE B 1 279 ? 15.680  33.948 -79.770  1.00 34.93  ? 259 ILE B N      1 
ATOM   9082  C  CA     . ILE B 1 279 ? 15.613  32.760 -80.615  1.00 33.88  ? 259 ILE B CA     1 
ATOM   9083  C  C      . ILE B 1 279 ? 17.035  32.223 -80.757  1.00 31.44  ? 259 ILE B C      1 
ATOM   9084  O  O      . ILE B 1 279 ? 17.890  32.870 -81.367  1.00 32.85  ? 259 ILE B O      1 
ATOM   9085  C  CB     . ILE B 1 279 ? 14.998  33.077 -81.983  1.00 34.20  ? 259 ILE B CB     1 
ATOM   9086  C  CG1    . ILE B 1 279 ? 13.580  33.636 -81.819  1.00 36.19  ? 259 ILE B CG1    1 
ATOM   9087  C  CG2    . ILE B 1 279 ? 14.963  31.834 -82.860  1.00 31.06  ? 259 ILE B CG2    1 
ATOM   9088  C  CD1    . ILE B 1 279 ? 13.082  34.404 -83.026  1.00 35.87  ? 259 ILE B CD1    1 
ATOM   9089  H  H      . ILE B 1 279 ? 15.630  34.688 -80.206  1.00 42.03  ? 259 ILE B H      1 
ATOM   9090  H  HA     . ILE B 1 279 ? 15.070  32.083 -80.182  1.00 40.77  ? 259 ILE B HA     1 
ATOM   9091  H  HB     . ILE B 1 279 ? 15.546  33.748 -82.420  1.00 41.15  ? 259 ILE B HB     1 
ATOM   9092  H  HG12   . ILE B 1 279 ? 12.970  32.899 -81.664  1.00 43.54  ? 259 ILE B HG12   1 
ATOM   9093  H  HG13   . ILE B 1 279 ? 13.568  34.239 -81.059  1.00 43.54  ? 259 ILE B HG13   1 
ATOM   9094  H  HG21   . ILE B 1 279 ? 14.570  32.064 -83.717  1.00 37.39  ? 259 ILE B HG21   1 
ATOM   9095  H  HG22   . ILE B 1 279 ? 15.869  31.513 -82.987  1.00 37.39  ? 259 ILE B HG22   1 
ATOM   9096  H  HG23   . ILE B 1 279 ? 14.428  31.154 -82.422  1.00 37.39  ? 259 ILE B HG23   1 
ATOM   9097  H  HD11   . ILE B 1 279 ? 12.184  34.724 -82.847  1.00 43.16  ? 259 ILE B HD11   1 
ATOM   9098  H  HD12   . ILE B 1 279 ? 13.675  35.154 -83.190  1.00 43.16  ? 259 ILE B HD12   1 
ATOM   9099  H  HD13   . ILE B 1 279 ? 13.076  33.812 -83.795  1.00 43.16  ? 259 ILE B HD13   1 
ATOM   9100  N  N      . SER B 1 280 ? 17.294  31.040 -80.198  1.00 27.14  ? 260 SER B N      1 
ATOM   9101  C  CA     . SER B 1 280 ? 18.653  30.520 -80.145  1.00 27.92  ? 260 SER B CA     1 
ATOM   9102  C  C      . SER B 1 280 ? 18.660  29.003 -80.262  1.00 26.56  ? 260 SER B C      1 
ATOM   9103  O  O      . SER B 1 280 ? 17.774  28.326 -79.734  1.00 28.45  ? 260 SER B O      1 
ATOM   9104  C  CB     . SER B 1 280 ? 19.344  30.936 -78.842  1.00 31.17  ? 260 SER B CB     1 
ATOM   9105  O  OG     . SER B 1 280 ? 20.639  30.372 -78.751  1.00 34.99  ? 260 SER B OG     1 
ATOM   9106  H  H      . SER B 1 280 ? 16.702  30.525 -79.846  1.00 32.69  ? 260 SER B H      1 
ATOM   9107  H  HA     . SER B 1 280 ? 19.162  30.883 -80.886  1.00 33.62  ? 260 SER B HA     1 
ATOM   9108  H  HB2    . SER B 1 280 ? 19.419  31.903 -78.820  1.00 37.52  ? 260 SER B HB2    1 
ATOM   9109  H  HB3    . SER B 1 280 ? 18.813  30.628 -78.091  1.00 37.52  ? 260 SER B HB3    1 
ATOM   9110  H  HG     . SER B 1 280 ? 21.006  30.609 -78.034  1.00 42.10  ? 260 SER B HG     1 
ATOM   9111  N  N      . LEU B 1 281 ? 19.666  28.482 -80.967  1.00 25.13  ? 261 LEU B N      1 
ATOM   9112  C  CA     . LEU B 1 281 ? 19.964  27.056 -81.004  1.00 28.46  ? 261 LEU B CA     1 
ATOM   9113  C  C      . LEU B 1 281 ? 21.255  26.716 -80.267  1.00 32.04  ? 261 LEU B C      1 
ATOM   9114  O  O      . LEU B 1 281 ? 21.757  25.596 -80.404  1.00 32.22  ? 261 LEU B O      1 
ATOM   9115  C  CB     . LEU B 1 281 ? 20.052  26.557 -82.449  1.00 30.51  ? 261 LEU B CB     1 
ATOM   9116  C  CG     . LEU B 1 281 ? 18.845  26.770 -83.367  1.00 31.63  ? 261 LEU B CG     1 
ATOM   9117  C  CD1    . LEU B 1 281 ? 19.076  26.061 -84.694  1.00 29.32  ? 261 LEU B CD1    1 
ATOM   9118  C  CD2    . LEU B 1 281 ? 17.558  26.282 -82.718  1.00 32.69  ? 261 LEU B CD2    1 
ATOM   9119  H  H      . LEU B 1 281 ? 20.204  28.953 -81.446  1.00 30.28  ? 261 LEU B H      1 
ATOM   9120  H  HA     . LEU B 1 281 ? 19.242  26.577 -80.570  1.00 34.27  ? 261 LEU B HA     1 
ATOM   9121  H  HB2    . LEU B 1 281 ? 20.806  26.998 -82.870  1.00 36.73  ? 261 LEU B HB2    1 
ATOM   9122  H  HB3    . LEU B 1 281 ? 20.220  25.602 -82.423  1.00 36.73  ? 261 LEU B HB3    1 
ATOM   9123  H  HG     . LEU B 1 281 ? 18.748  27.718 -83.547  1.00 38.08  ? 261 LEU B HG     1 
ATOM   9124  H  HD11   . LEU B 1 281 ? 18.305  26.203 -85.266  1.00 35.31  ? 261 LEU B HD11   1 
ATOM   9125  H  HD12   . LEU B 1 281 ? 19.870  26.426 -85.113  1.00 35.31  ? 261 LEU B HD12   1 
ATOM   9126  H  HD13   . LEU B 1 281 ? 19.195  25.112 -84.528  1.00 35.31  ? 261 LEU B HD13   1 
ATOM   9127  H  HD21   . LEU B 1 281 ? 16.820  26.434 -83.329  1.00 39.34  ? 261 LEU B HD21   1 
ATOM   9128  H  HD22   . LEU B 1 281 ? 17.641  25.335 -82.527  1.00 39.34  ? 261 LEU B HD22   1 
ATOM   9129  H  HD23   . LEU B 1 281 ? 17.414  26.775 -81.895  1.00 39.34  ? 261 LEU B HD23   1 
ATOM   9130  N  N      . ASN B 1 282 ? 21.808  27.656 -79.498  1.00 35.84  ? 262 ASN B N      1 
ATOM   9131  C  CA     . ASN B 1 282 ? 23.051  27.404 -78.775  1.00 35.74  ? 262 ASN B CA     1 
ATOM   9132  C  C      . ASN B 1 282 ? 22.831  26.579 -77.514  1.00 35.88  ? 262 ASN B C      1 
ATOM   9133  O  O      . ASN B 1 282 ? 23.733  25.844 -77.098  1.00 36.56  ? 262 ASN B O      1 
ATOM   9134  C  CB     . ASN B 1 282 ? 23.724  28.730 -78.410  1.00 35.36  ? 262 ASN B CB     1 
ATOM   9135  C  CG     . ASN B 1 282 ? 24.223  29.488 -79.624  1.00 39.45  ? 262 ASN B CG     1 
ATOM   9136  O  OD1    . ASN B 1 282 ? 23.440  30.075 -80.370  1.00 42.90  ? 262 ASN B OD1    1 
ATOM   9137  N  ND2    . ASN B 1 282 ? 25.535  29.496 -79.816  1.00 40.34  ? 262 ASN B ND2    1 
ATOM   9138  H  H      . ASN B 1 282 ? 21.484  28.444 -79.379  1.00 43.13  ? 262 ASN B H      1 
ATOM   9139  H  HA     . ASN B 1 282 ? 23.656  26.911 -79.352  1.00 43.00  ? 262 ASN B HA     1 
ATOM   9140  H  HB2    . ASN B 1 282 ? 23.084  29.292 -77.947  1.00 42.55  ? 262 ASN B HB2    1 
ATOM   9141  H  HB3    . ASN B 1 282 ? 24.485  28.550 -77.835  1.00 42.55  ? 262 ASN B HB3    1 
ATOM   9142  H  HD21   . ASN B 1 282 ? 25.869  29.912 -80.491  1.00 48.52  ? 262 ASN B HD21   1 
ATOM   9143  H  HD22   . ASN B 1 282 ? 26.053  29.084 -79.267  1.00 48.52  ? 262 ASN B HD22   1 
ATOM   9144  N  N      . ARG B 1 283 ? 21.658  26.684 -76.898  1.00 35.87  ? 263 ARG B N      1 
ATOM   9145  C  CA     . ARG B 1 283 ? 21.365  26.003 -75.646  1.00 36.47  ? 263 ARG B CA     1 
ATOM   9146  C  C      . ARG B 1 283 ? 19.947  25.456 -75.682  1.00 37.24  ? 263 ARG B C      1 
ATOM   9147  O  O      . ARG B 1 283 ? 19.097  25.976 -76.416  1.00 38.21  ? 263 ARG B O      1 
ATOM   9148  C  CB     . ARG B 1 283 ? 21.499  26.948 -74.442  1.00 37.78  ? 263 ARG B CB     1 
ATOM   9149  C  CG     . ARG B 1 283 ? 22.906  27.464 -74.196  1.00 41.01  ? 263 ARG B CG     1 
ATOM   9150  C  CD     . ARG B 1 283 ? 22.880  28.776 -73.432  1.00 40.31  ? 263 ARG B CD     1 
ATOM   9151  N  NE     . ARG B 1 283 ? 22.262  29.834 -74.226  1.00 39.36  ? 263 ARG B NE     1 
ATOM   9152  C  CZ     . ARG B 1 283 ? 22.904  30.575 -75.122  1.00 39.56  ? 263 ARG B CZ     1 
ATOM   9153  N  NH1    . ARG B 1 283 ? 24.196  30.393 -75.351  1.00 38.01  ? 263 ARG B NH1    1 
ATOM   9154  N  NH2    . ARG B 1 283 ? 22.248  31.507 -75.795  1.00 43.80  ? 263 ARG B NH2    1 
ATOM   9155  H  H      . ARG B 1 283 ? 21.003  27.155 -77.194  1.00 43.16  ? 263 ARG B H      1 
ATOM   9156  H  HA     . ARG B 1 283 ? 21.979  25.262 -75.528  1.00 43.88  ? 263 ARG B HA     1 
ATOM   9157  H  HB2    . ARG B 1 283 ? 20.926  27.717 -74.586  1.00 45.46  ? 263 ARG B HB2    1 
ATOM   9158  H  HB3    . ARG B 1 283 ? 21.216  26.475 -73.644  1.00 45.46  ? 263 ARG B HB3    1 
ATOM   9159  H  HG2    . ARG B 1 283 ? 23.400  26.815 -73.671  1.00 49.33  ? 263 ARG B HG2    1 
ATOM   9160  H  HG3    . ARG B 1 283 ? 23.347  27.615 -75.047  1.00 49.33  ? 263 ARG B HG3    1 
ATOM   9161  H  HD2    . ARG B 1 283 ? 22.364  28.664 -72.618  1.00 48.49  ? 263 ARG B HD2    1 
ATOM   9162  H  HD3    . ARG B 1 283 ? 23.788  29.044 -73.221  1.00 48.49  ? 263 ARG B HD3    1 
ATOM   9163  H  HE     . ARG B 1 283 ? 21.425  29.987 -74.105  1.00 47.36  ? 263 ARG B HE     1 
ATOM   9164  H  HH11   . ARG B 1 283 ? 24.628  29.789 -74.918  1.00 45.73  ? 263 ARG B HH11   1 
ATOM   9165  H  HH12   . ARG B 1 283 ? 24.603  30.879 -75.932  1.00 45.73  ? 263 ARG B HH12   1 
ATOM   9166  H  HH21   . ARG B 1 283 ? 21.409  31.631 -75.650  1.00 52.68  ? 263 ARG B HH21   1 
ATOM   9167  H  HH22   . ARG B 1 283 ? 22.660  31.991 -76.373  1.00 52.68  ? 263 ARG B HH22   1 
ATOM   9168  N  N      . PRO B 1 284 ? 19.662  24.415 -74.904  1.00 34.75  ? 264 PRO B N      1 
ATOM   9169  C  CA     . PRO B 1 284 ? 18.270  24.001 -74.710  1.00 31.43  ? 264 PRO B CA     1 
ATOM   9170  C  C      . PRO B 1 284 ? 17.559  24.888 -73.700  1.00 24.28  ? 264 PRO B C      1 
ATOM   9171  O  O      . PRO B 1 284 ? 18.172  25.469 -72.802  1.00 17.95  ? 264 PRO B O      1 
ATOM   9172  C  CB     . PRO B 1 284 ? 18.398  22.563 -74.192  1.00 32.99  ? 264 PRO B CB     1 
ATOM   9173  C  CG     . PRO B 1 284 ? 19.716  22.535 -73.508  1.00 33.89  ? 264 PRO B CG     1 
ATOM   9174  C  CD     . PRO B 1 284 ? 20.607  23.473 -74.278  1.00 34.04  ? 264 PRO B CD     1 
ATOM   9175  H  HA     . PRO B 1 284 ? 17.788  24.006 -75.552  1.00 37.83  ? 264 PRO B HA     1 
ATOM   9176  H  HB2    . PRO B 1 284 ? 17.680  22.373 -73.569  1.00 39.70  ? 264 PRO B HB2    1 
ATOM   9177  H  HB3    . PRO B 1 284 ? 18.383  21.942 -74.938  1.00 39.70  ? 264 PRO B HB3    1 
ATOM   9178  H  HG2    . PRO B 1 284 ? 19.612  22.840 -72.593  1.00 40.79  ? 264 PRO B HG2    1 
ATOM   9179  H  HG3    . PRO B 1 284 ? 20.072  21.633 -73.528  1.00 40.79  ? 264 PRO B HG3    1 
ATOM   9180  H  HD2    . PRO B 1 284 ? 21.203  23.944 -73.675  1.00 40.97  ? 264 PRO B HD2    1 
ATOM   9181  H  HD3    . PRO B 1 284 ? 21.100  22.988 -74.958  1.00 40.97  ? 264 PRO B HD3    1 
ATOM   9182  N  N      . GLY B 1 285 ? 16.243  24.994 -73.870  1.00 27.84  ? 265 GLY B N      1 
ATOM   9183  C  CA     . GLY B 1 285 ? 15.421  25.798 -72.986  1.00 28.89  ? 265 GLY B CA     1 
ATOM   9184  C  C      . GLY B 1 285 ? 15.197  27.204 -73.501  1.00 31.93  ? 265 GLY B C      1 
ATOM   9185  O  O      . GLY B 1 285 ? 15.092  27.418 -74.713  1.00 38.84  ? 265 GLY B O      1 
ATOM   9186  H  H      . GLY B 1 285 ? 15.803  24.603 -74.497  1.00 33.52  ? 265 GLY B H      1 
ATOM   9187  H  HA2    . GLY B 1 285 ? 14.557  25.372 -72.876  1.00 34.79  ? 265 GLY B HA2    1 
ATOM   9188  H  HA3    . GLY B 1 285 ? 15.846  25.855 -72.116  1.00 34.79  ? 265 GLY B HA3    1 
ATOM   9189  N  N      . ILE B 1 286 ? 15.117  28.172 -72.592  1.00 27.08  ? 266 ILE B N      1 
ATOM   9190  C  CA     . ILE B 1 286 ? 14.828  29.562 -72.931  1.00 30.91  ? 266 ILE B CA     1 
ATOM   9191  C  C      . ILE B 1 286 ? 16.069  30.394 -72.648  1.00 32.56  ? 266 ILE B C      1 
ATOM   9192  O  O      . ILE B 1 286 ? 16.690  30.256 -71.587  1.00 29.76  ? 266 ILE B O      1 
ATOM   9193  C  CB     . ILE B 1 286 ? 13.606  30.094 -72.160  1.00 35.80  ? 266 ILE B CB     1 
ATOM   9194  C  CG1    . ILE B 1 286 ? 12.358  29.301 -72.572  1.00 34.98  ? 266 ILE B CG1    1 
ATOM   9195  C  CG2    . ILE B 1 286 ? 13.433  31.603 -72.391  1.00 38.77  ? 266 ILE B CG2    1 
ATOM   9196  C  CD1    . ILE B 1 286 ? 11.061  29.778 -71.948  1.00 32.81  ? 266 ILE B CD1    1 
ATOM   9197  H  H      . ILE B 1 286 ? 15.229  28.044 -71.749  1.00 32.61  ? 266 ILE B H      1 
ATOM   9198  H  HA     . ILE B 1 286 ? 14.635  29.623 -73.880  1.00 37.22  ? 266 ILE B HA     1 
ATOM   9199  H  HB     . ILE B 1 286 ? 13.759  29.949 -71.213  1.00 43.08  ? 266 ILE B HB     1 
ATOM   9200  H  HG12   . ILE B 1 286 ? 12.258  29.361 -73.535  1.00 42.09  ? 266 ILE B HG12   1 
ATOM   9201  H  HG13   . ILE B 1 286 ? 12.483  28.374 -72.314  1.00 42.09  ? 266 ILE B HG13   1 
ATOM   9202  H  HG21   . ILE B 1 286 ? 12.658  31.911 -71.896  1.00 46.64  ? 266 ILE B HG21   1 
ATOM   9203  H  HG22   . ILE B 1 286 ? 14.228  32.063 -72.081  1.00 46.64  ? 266 ILE B HG22   1 
ATOM   9204  H  HG23   . ILE B 1 286 ? 13.305  31.764 -73.339  1.00 46.64  ? 266 ILE B HG23   1 
ATOM   9205  H  HD11   . ILE B 1 286 ? 10.334  29.219 -72.266  1.00 39.49  ? 266 ILE B HD11   1 
ATOM   9206  H  HD12   . ILE B 1 286 ? 11.132  29.712 -70.983  1.00 39.49  ? 266 ILE B HD12   1 
ATOM   9207  H  HD13   . ILE B 1 286 ? 10.907  30.700 -72.206  1.00 39.49  ? 266 ILE B HD13   1 
ATOM   9208  N  N      . THR B 1 287 ? 16.415  31.265 -73.591  1.00 38.65  ? 267 THR B N      1 
ATOM   9209  C  CA     . THR B 1 287 ? 17.503  32.220 -73.439  1.00 37.75  ? 267 THR B CA     1 
ATOM   9210  C  C      . THR B 1 287 ? 16.920  33.620 -73.326  1.00 35.30  ? 267 THR B C      1 
ATOM   9211  O  O      . THR B 1 287 ? 16.108  34.028 -74.164  1.00 35.84  ? 267 THR B O      1 
ATOM   9212  C  CB     . THR B 1 287 ? 18.462  32.155 -74.630  1.00 34.92  ? 267 THR B CB     1 
ATOM   9213  O  OG1    . THR B 1 287 ? 18.971  30.822 -74.771  1.00 30.26  ? 267 THR B OG1    1 
ATOM   9214  C  CG2    . THR B 1 287 ? 19.621  33.133 -74.445  1.00 36.11  ? 267 THR B CG2    1 
ATOM   9215  H  H      . THR B 1 287 ? 16.019  31.322 -74.352  1.00 46.50  ? 267 THR B H      1 
ATOM   9216  H  HA     . THR B 1 287 ? 17.999  32.024 -72.629  1.00 45.41  ? 267 THR B HA     1 
ATOM   9217  H  HB     . THR B 1 287 ? 17.985  32.401 -75.438  1.00 42.02  ? 267 THR B HB     1 
ATOM   9218  H  HG1    . THR B 1 287 ? 18.337  30.285 -74.899  1.00 36.43  ? 267 THR B HG1    1 
ATOM   9219  H  HG21   . THR B 1 287 ? 20.222  33.083 -75.205  1.00 43.45  ? 267 THR B HG21   1 
ATOM   9220  H  HG22   . THR B 1 287 ? 19.281  34.039 -74.371  1.00 43.45  ? 267 THR B HG22   1 
ATOM   9221  H  HG23   . THR B 1 287 ? 20.114  32.914 -73.639  1.00 43.45  ? 267 THR B HG23   1 
ATOM   9222  N  N      . THR B 1 288 ? 17.333  34.349 -72.296  1.00 31.19  ? 268 THR B N      1 
ATOM   9223  C  CA     . THR B 1 288 ? 16.811  35.683 -72.048  1.00 31.71  ? 268 THR B CA     1 
ATOM   9224  C  C      . THR B 1 288 ? 17.760  36.732 -72.609  1.00 29.54  ? 268 THR B C      1 
ATOM   9225  O  O      . THR B 1 288 ? 18.978  36.542 -72.654  1.00 26.83  ? 268 THR B O      1 
ATOM   9226  C  CB     . THR B 1 288 ? 16.598  35.929 -70.551  1.00 30.88  ? 268 THR B CB     1 
ATOM   9227  O  OG1    . THR B 1 288 ? 17.866  36.063 -69.895  1.00 31.38  ? 268 THR B OG1    1 
ATOM   9228  C  CG2    . THR B 1 288 ? 15.816  34.786 -69.919  1.00 27.96  ? 268 THR B CG2    1 
ATOM   9229  H  H      . THR B 1 288 ? 17.919  34.090 -71.723  1.00 37.54  ? 268 THR B H      1 
ATOM   9230  H  HA     . THR B 1 288 ? 15.955  35.778 -72.495  1.00 38.17  ? 268 THR B HA     1 
ATOM   9231  H  HB     . THR B 1 288 ? 16.089  36.747 -70.431  1.00 37.17  ? 268 THR B HB     1 
ATOM   9232  H  HG1    . THR B 1 288 ? 18.317  35.362 -69.996  1.00 37.77  ? 268 THR B HG1    1 
ATOM   9233  H  HG21   . THR B 1 288 ? 15.689  34.955 -68.972  1.00 33.66  ? 268 THR B HG21   1 
ATOM   9234  H  HG22   . THR B 1 288 ? 14.948  34.703 -70.344  1.00 33.66  ? 268 THR B HG22   1 
ATOM   9235  H  HG23   . THR B 1 288 ? 16.301  33.953 -70.028  1.00 33.66  ? 268 THR B HG23   1 
ATOM   9236  N  N      . LYS B 1 289 ? 17.180  37.853 -73.037  1.00 31.84  ? 269 LYS B N      1 
ATOM   9237  C  CA     . LYS B 1 289 ? 17.983  38.977 -73.498  1.00 35.70  ? 269 LYS B CA     1 
ATOM   9238  C  C      . LYS B 1 289 ? 18.929  39.458 -72.406  1.00 36.12  ? 269 LYS B C      1 
ATOM   9239  O  O      . LYS B 1 289 ? 20.022  39.955 -72.703  1.00 34.77  ? 269 LYS B O      1 
ATOM   9240  C  CB     . LYS B 1 289 ? 17.055  40.098 -73.963  1.00 39.07  ? 269 LYS B CB     1 
ATOM   9241  C  CG     . LYS B 1 289 ? 16.226  39.717 -75.189  1.00 39.81  ? 269 LYS B CG     1 
ATOM   9242  C  CD     . LYS B 1 289 ? 15.092  40.696 -75.454  1.00 39.77  ? 269 LYS B CD     1 
ATOM   9243  C  CE     . LYS B 1 289 ? 15.592  42.051 -75.919  1.00 40.74  ? 269 LYS B CE     1 
ATOM   9244  N  NZ     . LYS B 1 289 ? 14.487  43.049 -75.950  1.00 42.71  ? 269 LYS B NZ     1 
ATOM   9245  H  H      . LYS B 1 289 ? 16.331  37.984 -73.070  1.00 38.32  ? 269 LYS B H      1 
ATOM   9246  H  HA     . LYS B 1 289 ? 18.518  38.695 -74.257  1.00 42.95  ? 269 LYS B HA     1 
ATOM   9247  H  HB2    . LYS B 1 289 ? 16.442  40.318 -73.244  1.00 47.01  ? 269 LYS B HB2    1 
ATOM   9248  H  HB3    . LYS B 1 289 ? 17.589  40.875 -74.192  1.00 47.01  ? 269 LYS B HB3    1 
ATOM   9249  H  HG2    . LYS B 1 289 ? 16.802  39.705 -75.970  1.00 47.89  ? 269 LYS B HG2    1 
ATOM   9250  H  HG3    . LYS B 1 289 ? 15.838  38.838 -75.049  1.00 47.89  ? 269 LYS B HG3    1 
ATOM   9251  H  HD2    . LYS B 1 289 ? 14.516  40.334 -76.145  1.00 47.84  ? 269 LYS B HD2    1 
ATOM   9252  H  HD3    . LYS B 1 289 ? 14.588  40.826 -74.635  1.00 47.84  ? 269 LYS B HD3    1 
ATOM   9253  H  HE2    . LYS B 1 289 ? 16.274  42.369 -75.307  1.00 49.00  ? 269 LYS B HE2    1 
ATOM   9254  H  HE3    . LYS B 1 289 ? 15.955  41.969 -76.815  1.00 49.00  ? 269 LYS B HE3    1 
ATOM   9255  H  HZ1    . LYS B 1 289 ? 14.797  43.837 -76.224  1.00 51.37  ? 269 LYS B HZ1    1 
ATOM   9256  H  HZ2    . LYS B 1 289 ? 13.849  42.779 -76.508  1.00 51.37  ? 269 LYS B HZ2    1 
ATOM   9257  H  HZ3    . LYS B 1 289 ? 14.139  43.143 -75.136  1.00 51.37  ? 269 LYS B HZ3    1 
ATOM   9258  N  N      . GLU B 1 290 ? 18.522  39.319 -71.140  1.00 37.85  ? 270 GLU B N      1 
ATOM   9259  C  CA     . GLU B 1 290 ? 19.345  39.769 -70.020  1.00 40.12  ? 270 GLU B CA     1 
ATOM   9260  C  C      . GLU B 1 290 ? 20.692  39.057 -69.983  1.00 35.46  ? 270 GLU B C      1 
ATOM   9261  O  O      . GLU B 1 290 ? 21.743  39.699 -69.876  1.00 30.97  ? 270 GLU B O      1 
ATOM   9262  C  CB     . GLU B 1 290 ? 18.586  39.541 -68.711  1.00 50.55  ? 270 GLU B CB     1 
ATOM   9263  C  CG     . GLU B 1 290 ? 19.338  39.946 -67.450  1.00 61.42  ? 270 GLU B CG     1 
ATOM   9264  C  CD     . GLU B 1 290 ? 19.624  41.431 -67.373  1.00 71.40  ? 270 GLU B CD     1 
ATOM   9265  O  OE1    . GLU B 1 290 ? 18.984  42.206 -68.114  1.00 74.65  ? 270 GLU B OE1    1 
ATOM   9266  O  OE2    . GLU B 1 290 ? 20.496  41.822 -66.567  1.00 74.83  ? 270 GLU B OE2    1 
ATOM   9267  H  H      . GLU B 1 290 ? 17.773  38.968 -70.907  1.00 45.54  ? 270 GLU B H      1 
ATOM   9268  H  HA     . GLU B 1 290 ? 19.510  40.721 -70.110  1.00 48.26  ? 270 GLU B HA     1 
ATOM   9269  H  HB2    . GLU B 1 290 ? 17.763  40.053 -68.738  1.00 60.78  ? 270 GLU B HB2    1 
ATOM   9270  H  HB3    . GLU B 1 290 ? 18.378  38.596 -68.636  1.00 60.78  ? 270 GLU B HB3    1 
ATOM   9271  H  HG2    . GLU B 1 290 ? 18.806  39.704 -66.676  1.00 73.83  ? 270 GLU B HG2    1 
ATOM   9272  H  HG3    . GLU B 1 290 ? 20.187  39.477 -67.427  1.00 73.83  ? 270 GLU B HG3    1 
ATOM   9273  N  N      . GLU B 1 291 ? 20.685  37.726 -70.072  1.00 36.36  ? 271 GLU B N      1 
ATOM   9274  C  CA     . GLU B 1 291 ? 21.918  36.964 -69.905  1.00 37.53  ? 271 GLU B CA     1 
ATOM   9275  C  C      . GLU B 1 291 ? 22.886  37.129 -71.071  1.00 37.13  ? 271 GLU B C      1 
ATOM   9276  O  O      . GLU B 1 291 ? 24.033  36.683 -70.961  1.00 35.58  ? 271 GLU B O      1 
ATOM   9277  C  CB     . GLU B 1 291 ? 21.588  35.484 -69.684  1.00 38.88  ? 271 GLU B CB     1 
ATOM   9278  C  CG     . GLU B 1 291 ? 21.138  34.729 -70.918  1.00 42.65  ? 271 GLU B CG     1 
ATOM   9279  C  CD     . GLU B 1 291 ? 20.550  33.370 -70.578  1.00 42.16  ? 271 GLU B CD     1 
ATOM   9280  O  OE1    . GLU B 1 291 ? 19.306  33.254 -70.548  1.00 40.27  ? 271 GLU B OE1    1 
ATOM   9281  O  OE2    . GLU B 1 291 ? 21.329  32.424 -70.327  1.00 41.00  ? 271 GLU B OE2    1 
ATOM   9282  H  H      . GLU B 1 291 ? 19.987  37.247 -70.227  1.00 43.75  ? 271 GLU B H      1 
ATOM   9283  H  HA     . GLU B 1 291 ? 22.368  37.284 -69.107  1.00 45.15  ? 271 GLU B HA     1 
ATOM   9284  H  HB2    . GLU B 1 291 ? 22.380  35.040 -69.343  1.00 46.78  ? 271 GLU B HB2    1 
ATOM   9285  H  HB3    . GLU B 1 291 ? 20.875  35.422 -69.029  1.00 46.78  ? 271 GLU B HB3    1 
ATOM   9286  H  HG2    . GLU B 1 291 ? 20.457  35.246 -71.376  1.00 51.30  ? 271 GLU B HG2    1 
ATOM   9287  H  HG3    . GLU B 1 291 ? 21.901  34.590 -71.501  1.00 51.30  ? 271 GLU B HG3    1 
ATOM   9288  N  N      . LEU B 1 292 ? 22.462  37.745 -72.174  1.00 41.51  ? 272 LEU B N      1 
ATOM   9289  C  CA     . LEU B 1 292 ? 23.344  38.044 -73.296  1.00 45.11  ? 272 LEU B CA     1 
ATOM   9290  C  C      . LEU B 1 292 ? 23.717  39.518 -73.389  1.00 47.22  ? 272 LEU B C      1 
ATOM   9291  O  O      . LEU B 1 292 ? 24.487  39.893 -74.281  1.00 45.01  ? 272 LEU B O      1 
ATOM   9292  C  CB     . LEU B 1 292 ? 22.697  37.604 -74.617  1.00 43.91  ? 272 LEU B CB     1 
ATOM   9293  C  CG     . LEU B 1 292 ? 22.481  36.105 -74.832  1.00 43.31  ? 272 LEU B CG     1 
ATOM   9294  C  CD1    . LEU B 1 292 ? 21.794  35.862 -76.165  1.00 45.16  ? 272 LEU B CD1    1 
ATOM   9295  C  CD2    . LEU B 1 292 ? 23.799  35.346 -74.772  1.00 42.44  ? 272 LEU B CD2    1 
ATOM   9296  H  H      . LEU B 1 292 ? 21.651  38.003 -72.296  1.00 49.92  ? 272 LEU B H      1 
ATOM   9297  H  HA     . LEU B 1 292 ? 24.166  37.540 -73.188  1.00 54.25  ? 272 LEU B HA     1 
ATOM   9298  H  HB2    . LEU B 1 292 ? 21.827  38.028 -74.680  1.00 52.80  ? 272 LEU B HB2    1 
ATOM   9299  H  HB3    . LEU B 1 292 ? 23.257  37.917 -75.344  1.00 52.80  ? 272 LEU B HB3    1 
ATOM   9300  H  HG     . LEU B 1 292 ? 21.905  35.764 -74.129  1.00 52.09  ? 272 LEU B HG     1 
ATOM   9301  H  HD11   . LEU B 1 292 ? 21.665  34.908 -76.284  1.00 54.31  ? 272 LEU B HD11   1 
ATOM   9302  H  HD12   . LEU B 1 292 ? 20.936  36.314 -76.165  1.00 54.31  ? 272 LEU B HD12   1 
ATOM   9303  H  HD13   . LEU B 1 292 ? 22.352  36.212 -76.876  1.00 54.31  ? 272 LEU B HD13   1 
ATOM   9304  H  HD21   . LEU B 1 292 ? 23.626  34.402 -74.912  1.00 51.05  ? 272 LEU B HD21   1 
ATOM   9305  H  HD22   . LEU B 1 292 ? 24.387  35.681 -75.466  1.00 51.05  ? 272 LEU B HD22   1 
ATOM   9306  H  HD23   . LEU B 1 292 ? 24.203  35.483 -73.901  1.00 51.05  ? 272 LEU B HD23   1 
ATOM   9307  N  N      . ASP B 1 293 ? 23.191  40.362 -72.503  1.00 49.88  ? 273 ASP B N      1 
ATOM   9308  C  CA     . ASP B 1 293 ? 23.391  41.809 -72.576  1.00 52.73  ? 273 ASP B CA     1 
ATOM   9309  C  C      . ASP B 1 293 ? 22.864  42.375 -73.891  1.00 49.79  ? 273 ASP B C      1 
ATOM   9310  O  O      . ASP B 1 293 ? 23.383  43.367 -74.408  1.00 49.65  ? 273 ASP B O      1 
ATOM   9311  C  CB     . ASP B 1 293 ? 24.868  42.175 -72.393  1.00 55.54  ? 273 ASP B CB     1 
ATOM   9312  C  CG     . ASP B 1 293 ? 25.379  41.853 -71.004  1.00 56.89  ? 273 ASP B CG     1 
ATOM   9313  O  OD1    . ASP B 1 293 ? 24.627  42.067 -70.029  1.00 57.24  ? 273 ASP B OD1    1 
ATOM   9314  O  OD2    . ASP B 1 293 ? 26.531  41.385 -70.887  1.00 56.89  ? 273 ASP B OD2    1 
ATOM   9315  H  H      . ASP B 1 293 ? 22.704  40.117 -71.837  1.00 59.97  ? 273 ASP B H      1 
ATOM   9316  H  HA     . ASP B 1 293 ? 22.894  42.227 -71.856  1.00 63.39  ? 273 ASP B HA     1 
ATOM   9317  H  HB2    . ASP B 1 293 ? 25.400  41.676 -73.032  1.00 66.77  ? 273 ASP B HB2    1 
ATOM   9318  H  HB3    . ASP B 1 293 ? 24.978  43.128 -72.540  1.00 66.77  ? 273 ASP B HB3    1 
ATOM   9319  N  N      . TRP B 1 294 ? 21.829  41.740 -74.439  1.00 46.49  ? 274 TRP B N      1 
ATOM   9320  C  CA     . TRP B 1 294 ? 21.136  42.242 -75.623  1.00 45.61  ? 274 TRP B CA     1 
ATOM   9321  C  C      . TRP B 1 294 ? 19.853  42.939 -75.172  1.00 43.28  ? 274 TRP B C      1 
ATOM   9322  O  O      . TRP B 1 294 ? 18.735  42.502 -75.444  1.00 42.24  ? 274 TRP B O      1 
ATOM   9323  C  CB     . TRP B 1 294 ? 20.851  41.099 -76.592  1.00 44.33  ? 274 TRP B CB     1 
ATOM   9324  C  CG     . TRP B 1 294 ? 22.070  40.596 -77.307  1.00 41.47  ? 274 TRP B CG     1 
ATOM   9325  C  CD1    . TRP B 1 294 ? 23.362  40.987 -77.104  1.00 39.18  ? 274 TRP B CD1    1 
ATOM   9326  C  CD2    . TRP B 1 294 ? 22.110  39.603 -78.340  1.00 38.37  ? 274 TRP B CD2    1 
ATOM   9327  N  NE1    . TRP B 1 294 ? 24.202  40.301 -77.946  1.00 37.00  ? 274 TRP B NE1    1 
ATOM   9328  C  CE2    . TRP B 1 294 ? 23.459  39.445 -78.715  1.00 37.44  ? 274 TRP B CE2    1 
ATOM   9329  C  CE3    . TRP B 1 294 ? 21.136  38.834 -78.983  1.00 35.51  ? 274 TRP B CE3    1 
ATOM   9330  C  CZ2    . TRP B 1 294 ? 23.859  38.549 -79.705  1.00 37.23  ? 274 TRP B CZ2    1 
ATOM   9331  C  CZ3    . TRP B 1 294 ? 21.536  37.946 -79.967  1.00 34.74  ? 274 TRP B CZ3    1 
ATOM   9332  C  CH2    . TRP B 1 294 ? 22.885  37.810 -80.317  1.00 34.85  ? 274 TRP B CH2    1 
ATOM   9333  H  H      . TRP B 1 294 ? 21.505  41.002 -74.137  1.00 55.91  ? 274 TRP B H      1 
ATOM   9334  H  HA     . TRP B 1 294 ? 21.696  42.894 -76.073  1.00 54.85  ? 274 TRP B HA     1 
ATOM   9335  H  HB2    . TRP B 1 294 ? 20.470  40.357 -76.097  1.00 53.32  ? 274 TRP B HB2    1 
ATOM   9336  H  HB3    . TRP B 1 294 ? 20.219  41.406 -77.261  1.00 53.32  ? 274 TRP B HB3    1 
ATOM   9337  H  HD1    . TRP B 1 294 ? 23.633  41.626 -76.485  1.00 47.13  ? 274 TRP B HD1    1 
ATOM   9338  H  HE1    . TRP B 1 294 ? 25.056  40.393 -77.984  1.00 44.51  ? 274 TRP B HE1    1 
ATOM   9339  H  HE3    . TRP B 1 294 ? 20.238  38.917 -78.756  1.00 42.73  ? 274 TRP B HE3    1 
ATOM   9340  H  HZ2    . TRP B 1 294 ? 24.754  38.458 -79.941  1.00 44.79  ? 274 TRP B HZ2    1 
ATOM   9341  H  HZ3    . TRP B 1 294 ? 20.897  37.428 -80.402  1.00 41.80  ? 274 TRP B HZ3    1 
ATOM   9342  H  HH2    . TRP B 1 294 ? 23.124  37.205 -80.982  1.00 41.93  ? 274 TRP B HH2    1 
ATOM   9343  N  N      . THR B 1 295 ? 20.041  44.057 -74.479  1.00 43.23  ? 275 THR B N      1 
ATOM   9344  C  CA     . THR B 1 295 ? 18.960  44.736 -73.782  1.00 41.12  ? 275 THR B CA     1 
ATOM   9345  C  C      . THR B 1 295 ? 18.735  46.130 -74.352  1.00 39.06  ? 275 THR B C      1 
ATOM   9346  O  O      . THR B 1 295 ? 19.504  46.628 -75.180  1.00 38.98  ? 275 THR B O      1 
ATOM   9347  C  CB     . THR B 1 295 ? 19.269  44.841 -72.284  1.00 41.14  ? 275 THR B CB     1 
ATOM   9348  O  OG1    . THR B 1 295 ? 20.497  45.558 -72.099  1.00 40.43  ? 275 THR B OG1    1 
ATOM   9349  C  CG2    . THR B 1 295 ? 19.397  43.457 -71.665  1.00 40.73  ? 275 THR B CG2    1 
ATOM   9350  H  H      . THR B 1 295 ? 20.802  44.447 -74.397  1.00 52.00  ? 275 THR B H      1 
ATOM   9351  H  HA     . THR B 1 295 ? 18.141  44.228 -73.889  1.00 49.46  ? 275 THR B HA     1 
ATOM   9352  H  HB     . THR B 1 295 ? 18.549  45.312 -71.837  1.00 49.48  ? 275 THR B HB     1 
ATOM   9353  H  HG1    . THR B 1 295 ? 20.673  45.620 -71.280  1.00 48.64  ? 275 THR B HG1    1 
ATOM   9354  H  HG21   . THR B 1 295 ? 19.592  43.534 -70.718  1.00 49.00  ? 275 THR B HG21   1 
ATOM   9355  H  HG22   . THR B 1 295 ? 18.568  42.966 -71.777  1.00 49.00  ? 275 THR B HG22   1 
ATOM   9356  H  HG23   . THR B 1 295 ? 20.114  42.967 -72.096  1.00 49.00  ? 275 THR B HG23   1 
ATOM   9357  N  N      . LYS B 1 296 ? 17.649  46.759 -73.894  1.00 37.24  ? 276 LYS B N      1 
ATOM   9358  C  CA     . LYS B 1 296 ? 17.358  48.122 -74.324  1.00 39.66  ? 276 LYS B CA     1 
ATOM   9359  C  C      . LYS B 1 296 ? 18.452  49.070 -73.855  1.00 42.20  ? 276 LYS B C      1 
ATOM   9360  O  O      . LYS B 1 296 ? 18.828  50.007 -74.571  1.00 40.80  ? 276 LYS B O      1 
ATOM   9361  C  CB     . LYS B 1 296 ? 16.018  48.591 -73.759  1.00 41.45  ? 276 LYS B CB     1 
ATOM   9362  C  CG     . LYS B 1 296 ? 15.651  50.005 -74.195  1.00 47.86  ? 276 LYS B CG     1 
ATOM   9363  C  CD     . LYS B 1 296 ? 14.771  50.720 -73.192  1.00 53.21  ? 276 LYS B CD     1 
ATOM   9364  C  CE     . LYS B 1 296 ? 14.603  52.180 -73.589  1.00 57.45  ? 276 LYS B CE     1 
ATOM   9365  N  NZ     . LYS B 1 296 ? 14.584  53.108 -72.425  1.00 59.55  ? 276 LYS B NZ     1 
ATOM   9366  H  H      . LYS B 1 296 ? 17.078  46.424 -73.345  1.00 44.81  ? 276 LYS B H      1 
ATOM   9367  H  HA     . LYS B 1 296 ? 17.314  48.155 -75.292  1.00 47.71  ? 276 LYS B HA     1 
ATOM   9368  H  HB2    . LYS B 1 296 ? 15.320  47.992 -74.066  1.00 49.85  ? 276 LYS B HB2    1 
ATOM   9369  H  HB3    . LYS B 1 296 ? 16.063  48.579 -72.790  1.00 49.85  ? 276 LYS B HB3    1 
ATOM   9370  H  HG2    . LYS B 1 296 ? 16.463  50.524 -74.304  1.00 57.55  ? 276 LYS B HG2    1 
ATOM   9371  H  HG3    . LYS B 1 296 ? 15.170  49.961 -75.037  1.00 57.55  ? 276 LYS B HG3    1 
ATOM   9372  H  HD2    . LYS B 1 296 ? 13.896  50.303 -73.172  1.00 63.97  ? 276 LYS B HD2    1 
ATOM   9373  H  HD3    . LYS B 1 296 ? 15.185  50.685 -72.315  1.00 63.97  ? 276 LYS B HD3    1 
ATOM   9374  H  HE2    . LYS B 1 296 ? 15.342  52.436 -74.164  1.00 69.06  ? 276 LYS B HE2    1 
ATOM   9375  H  HE3    . LYS B 1 296 ? 13.764  52.281 -74.065  1.00 69.06  ? 276 LYS B HE3    1 
ATOM   9376  H  HZ1    . LYS B 1 296 ? 14.485  53.946 -72.706  1.00 71.57  ? 276 LYS B HZ1    1 
ATOM   9377  H  HZ2    . LYS B 1 296 ? 13.909  52.902 -71.883  1.00 71.57  ? 276 LYS B HZ2    1 
ATOM   9378  H  HZ3    . LYS B 1 296 ? 15.348  53.043 -71.973  1.00 71.57  ? 276 LYS B HZ3    1 
ATOM   9379  N  N      . SER B 1 297 ? 18.963  48.847 -72.642  1.00 46.58  ? 277 SER B N      1 
ATOM   9380  C  CA     . SER B 1 297 ? 20.074  49.647 -72.139  1.00 48.66  ? 277 SER B CA     1 
ATOM   9381  C  C      . SER B 1 297 ? 21.259  49.599 -73.092  1.00 42.76  ? 277 SER B C      1 
ATOM   9382  O  O      . SER B 1 297 ? 21.976  50.595 -73.256  1.00 38.56  ? 277 SER B O      1 
ATOM   9383  C  CB     . SER B 1 297 ? 20.478  49.157 -70.748  1.00 52.58  ? 277 SER B CB     1 
ATOM   9384  O  OG     . SER B 1 297 ? 21.655  49.806 -70.300  1.00 57.57  ? 277 SER B OG     1 
ATOM   9385  H  H      . SER B 1 297 ? 18.686  48.243 -72.097  1.00 56.01  ? 277 SER B H      1 
ATOM   9386  H  HA     . SER B 1 297 ? 19.788  50.571 -72.061  1.00 58.51  ? 277 SER B HA     1 
ATOM   9387  H  HB2    . SER B 1 297 ? 19.758  49.346 -70.126  1.00 63.21  ? 277 SER B HB2    1 
ATOM   9388  H  HB3    . SER B 1 297 ? 20.640  48.201 -70.786  1.00 63.21  ? 277 SER B HB3    1 
ATOM   9389  H  HG     . SER B 1 297 ? 21.864  49.526 -69.536  1.00 69.20  ? 277 SER B HG     1 
ATOM   9390  N  N      . ALA B 1 298 ? 21.476  48.452 -73.741  1.00 42.17  ? 278 ALA B N      1 
ATOM   9391  C  CA     . ALA B 1 298 ? 22.586  48.348 -74.679  1.00 42.68  ? 278 ALA B CA     1 
ATOM   9392  C  C      . ALA B 1 298 ? 22.277  49.083 -75.976  1.00 39.17  ? 278 ALA B C      1 
ATOM   9393  O  O      . ALA B 1 298 ? 23.186  49.646 -76.599  1.00 35.71  ? 278 ALA B O      1 
ATOM   9394  C  CB     . ALA B 1 298 ? 22.902  46.879 -74.957  1.00 42.95  ? 278 ALA B CB     1 
ATOM   9395  H  H      . ALA B 1 298 ? 21.006  47.737 -73.655  1.00 50.72  ? 278 ALA B H      1 
ATOM   9396  H  HA     . ALA B 1 298 ? 23.373  48.754 -74.284  1.00 51.34  ? 278 ALA B HA     1 
ATOM   9397  H  HB1    . ALA B 1 298 ? 23.642  46.829 -75.583  1.00 51.65  ? 278 ALA B HB1    1 
ATOM   9398  H  HB2    . ALA B 1 298 ? 23.143  46.446 -74.123  1.00 51.65  ? 278 ALA B HB2    1 
ATOM   9399  H  HB3    . ALA B 1 298 ? 22.117  46.454 -75.337  1.00 51.65  ? 278 ALA B HB3    1 
ATOM   9400  N  N      . GLU B 1 299 ? 21.007  49.101 -76.391  1.00 35.77  ? 279 GLU B N      1 
ATOM   9401  C  CA     . GLU B 1 299 ? 20.625  49.906 -77.546  1.00 33.63  ? 279 GLU B CA     1 
ATOM   9402  C  C      . GLU B 1 299 ? 20.867  51.382 -77.264  1.00 32.56  ? 279 GLU B C      1 
ATOM   9403  O  O      . GLU B 1 299 ? 21.384  52.115 -78.117  1.00 34.24  ? 279 GLU B O      1 
ATOM   9404  C  CB     . GLU B 1 299 ? 19.155  49.661 -77.887  1.00 38.00  ? 279 GLU B CB     1 
ATOM   9405  C  CG     . GLU B 1 299 ? 18.858  48.296 -78.490  1.00 42.09  ? 279 GLU B CG     1 
ATOM   9406  C  CD     . GLU B 1 299 ? 17.390  48.127 -78.839  1.00 44.41  ? 279 GLU B CD     1 
ATOM   9407  O  OE1    . GLU B 1 299 ? 16.557  48.863 -78.269  1.00 45.61  ? 279 GLU B OE1    1 
ATOM   9408  O  OE2    . GLU B 1 299 ? 17.067  47.267 -79.685  1.00 44.14  ? 279 GLU B OE2    1 
ATOM   9409  H  H      . GLU B 1 299 ? 20.362  48.664 -76.028  1.00 43.04  ? 279 GLU B H      1 
ATOM   9410  H  HA     . GLU B 1 299 ? 21.164  49.648 -78.310  1.00 40.47  ? 279 GLU B HA     1 
ATOM   9411  H  HB2    . GLU B 1 299 ? 18.631  49.743 -77.074  1.00 45.72  ? 279 GLU B HB2    1 
ATOM   9412  H  HB3    . GLU B 1 299 ? 18.870  50.332 -78.527  1.00 45.72  ? 279 GLU B HB3    1 
ATOM   9413  H  HG2    . GLU B 1 299 ? 19.375  48.189 -79.303  1.00 50.63  ? 279 GLU B HG2    1 
ATOM   9414  H  HG3    . GLU B 1 299 ? 19.096  47.607 -77.850  1.00 50.63  ? 279 GLU B HG3    1 
ATOM   9415  N  N      . ASP B 1 300 ? 20.516  51.828 -76.054  1.00 34.45  ? 280 ASP B N      1 
ATOM   9416  C  CA     . ASP B 1 300 ? 20.730  53.219 -75.670  1.00 40.80  ? 280 ASP B CA     1 
ATOM   9417  C  C      . ASP B 1 300 ? 22.216  53.539 -75.607  1.00 43.69  ? 280 ASP B C      1 
ATOM   9418  O  O      . ASP B 1 300 ? 22.647  54.619 -76.032  1.00 41.03  ? 280 ASP B O      1 
ATOM   9419  C  CB     . ASP B 1 300 ? 20.061  53.506 -74.327  1.00 40.94  ? 280 ASP B CB     1 
ATOM   9420  C  CG     . ASP B 1 300 ? 18.550  53.399 -74.393  1.00 42.06  ? 280 ASP B CG     1 
ATOM   9421  O  OD1    . ASP B 1 300 ? 17.985  53.604 -75.488  1.00 44.26  ? 280 ASP B OD1    1 
ATOM   9422  O  OD2    . ASP B 1 300 ? 17.927  53.115 -73.347  1.00 40.89  ? 280 ASP B OD2    1 
ATOM   9423  H  H      . ASP B 1 300 ? 20.155  51.344 -75.441  1.00 41.46  ? 280 ASP B H      1 
ATOM   9424  H  HA     . ASP B 1 300 ? 20.327  53.797 -76.337  1.00 49.07  ? 280 ASP B HA     1 
ATOM   9425  H  HB2    . ASP B 1 300 ? 20.379  52.866 -73.671  1.00 49.25  ? 280 ASP B HB2    1 
ATOM   9426  H  HB3    . ASP B 1 300 ? 20.286  54.408 -74.048  1.00 49.25  ? 280 ASP B HB3    1 
ATOM   9427  N  N      . PHE B 1 301 ? 23.018  52.605 -75.088  1.00 44.07  ? 281 PHE B N      1 
ATOM   9428  C  CA     . PHE B 1 301 ? 24.447  52.853 -74.953  1.00 43.50  ? 281 PHE B CA     1 
ATOM   9429  C  C      . PHE B 1 301 ? 25.109  52.919 -76.322  1.00 37.84  ? 281 PHE B C      1 
ATOM   9430  O  O      . PHE B 1 301 ? 25.989  53.757 -76.553  1.00 34.27  ? 281 PHE B O      1 
ATOM   9431  C  CB     . PHE B 1 301 ? 25.069  51.747 -74.097  1.00 42.15  ? 281 PHE B CB     1 
ATOM   9432  C  CG     . PHE B 1 301 ? 26.540  51.916 -73.836  1.00 42.08  ? 281 PHE B CG     1 
ATOM   9433  C  CD1    . PHE B 1 301 ? 27.475  51.606 -74.810  1.00 40.82  ? 281 PHE B CD1    1 
ATOM   9434  C  CD2    . PHE B 1 301 ? 26.987  52.356 -72.602  1.00 42.52  ? 281 PHE B CD2    1 
ATOM   9435  C  CE1    . PHE B 1 301 ? 28.825  51.753 -74.566  1.00 40.58  ? 281 PHE B CE1    1 
ATOM   9436  C  CE2    . PHE B 1 301 ? 28.337  52.504 -72.352  1.00 42.57  ? 281 PHE B CE2    1 
ATOM   9437  C  CZ     . PHE B 1 301 ? 29.257  52.201 -73.335  1.00 41.83  ? 281 PHE B CZ     1 
ATOM   9438  H  H      . PHE B 1 301 ? 22.760  51.833 -74.812  1.00 53.00  ? 281 PHE B H      1 
ATOM   9439  H  HA     . PHE B 1 301 ? 24.586  53.702 -74.505  1.00 52.31  ? 281 PHE B HA     1 
ATOM   9440  H  HB2    . PHE B 1 301 ? 24.618  51.728 -73.238  1.00 50.70  ? 281 PHE B HB2    1 
ATOM   9441  H  HB3    . PHE B 1 301 ? 24.947  50.897 -74.549  1.00 50.70  ? 281 PHE B HB3    1 
ATOM   9442  H  HD1    . PHE B 1 301 ? 27.189  51.305 -75.642  1.00 49.11  ? 281 PHE B HD1    1 
ATOM   9443  H  HD2    . PHE B 1 301 ? 26.371  52.563 -71.937  1.00 51.15  ? 281 PHE B HD2    1 
ATOM   9444  H  HE1    . PHE B 1 301 ? 29.443  51.548 -75.229  1.00 48.81  ? 281 PHE B HE1    1 
ATOM   9445  H  HE2    . PHE B 1 301 ? 28.626  52.806 -71.522  1.00 51.20  ? 281 PHE B HE2    1 
ATOM   9446  H  HZ     . PHE B 1 301 ? 30.166  52.300 -73.169  1.00 50.31  ? 281 PHE B HZ     1 
ATOM   9447  N  N      . ALA B 1 302 ? 24.679  52.063 -77.251  1.00 33.93  ? 282 ALA B N      1 
ATOM   9448  C  CA     . ALA B 1 302 ? 25.214  52.114 -78.606  1.00 32.79  ? 282 ALA B CA     1 
ATOM   9449  C  C      . ALA B 1 302 ? 24.814  53.413 -79.295  1.00 34.26  ? 282 ALA B C      1 
ATOM   9450  O  O      . ALA B 1 302 ? 25.651  54.091 -79.901  1.00 35.41  ? 282 ALA B O      1 
ATOM   9451  C  CB     . ALA B 1 302 ? 24.735  50.904 -79.408  1.00 31.68  ? 282 ALA B CB     1 
ATOM   9452  H  H      . ALA B 1 302 ? 24.087  51.452 -77.121  1.00 40.83  ? 282 ALA B H      1 
ATOM   9453  H  HA     . ALA B 1 302 ? 26.183  52.082 -78.566  1.00 38.76  ? 282 ALA B HA     1 
ATOM   9454  H  HB1    . ALA B 1 302 ? 25.100  50.955 -80.306  1.00 38.13  ? 282 ALA B HB1    1 
ATOM   9455  H  HB2    . ALA B 1 302 ? 25.043  50.094 -78.972  1.00 38.13  ? 282 ALA B HB2    1 
ATOM   9456  H  HB3    . ALA B 1 302 ? 23.766  50.913 -79.444  1.00 38.13  ? 282 ALA B HB3    1 
ATOM   9457  N  N      . ARG B 1 303 ? 23.530  53.777 -79.210  1.00 41.65  ? 283 ARG B N      1 
ATOM   9458  C  CA     . ARG B 1 303 ? 23.071  55.018 -79.830  1.00 47.71  ? 283 ARG B CA     1 
ATOM   9459  C  C      . ARG B 1 303 ? 23.819  56.221 -79.272  1.00 51.26  ? 283 ARG B C      1 
ATOM   9460  O  O      . ARG B 1 303 ? 24.127  57.167 -80.007  1.00 52.23  ? 283 ARG B O      1 
ATOM   9461  C  CB     . ARG B 1 303 ? 21.565  55.186 -79.621  1.00 50.43  ? 283 ARG B CB     1 
ATOM   9462  C  CG     . ARG B 1 303 ? 21.023  56.544 -80.066  1.00 53.43  ? 283 ARG B CG     1 
ATOM   9463  C  CD     . ARG B 1 303 ? 19.503  56.592 -80.010  1.00 54.33  ? 283 ARG B CD     1 
ATOM   9464  N  NE     . ARG B 1 303 ? 18.985  56.340 -78.666  1.00 54.78  ? 283 ARG B NE     1 
ATOM   9465  C  CZ     . ARG B 1 303 ? 18.823  57.271 -77.729  1.00 55.65  ? 283 ARG B CZ     1 
ATOM   9466  N  NH1    . ARG B 1 303 ? 19.141  58.535 -77.971  1.00 57.35  ? 283 ARG B NH1    1 
ATOM   9467  N  NH2    . ARG B 1 303 ? 18.342  56.936 -76.540  1.00 54.73  ? 283 ARG B NH2    1 
ATOM   9468  H  H      . ARG B 1 303 ? 22.916  53.330 -78.807  1.00 50.10  ? 283 ARG B H      1 
ATOM   9469  H  HA     . ARG B 1 303 ? 23.239  54.975 -80.784  1.00 57.37  ? 283 ARG B HA     1 
ATOM   9470  H  HB2    . ARG B 1 303 ? 21.101  54.502 -80.128  1.00 60.64  ? 283 ARG B HB2    1 
ATOM   9471  H  HB3    . ARG B 1 303 ? 21.368  55.084 -78.676  1.00 60.64  ? 283 ARG B HB3    1 
ATOM   9472  H  HG2    . ARG B 1 303 ? 21.370  57.234 -79.479  1.00 64.23  ? 283 ARG B HG2    1 
ATOM   9473  H  HG3    . ARG B 1 303 ? 21.298  56.713 -80.980  1.00 64.23  ? 283 ARG B HG3    1 
ATOM   9474  H  HD2    . ARG B 1 303 ? 19.204  57.472 -80.287  1.00 65.32  ? 283 ARG B HD2    1 
ATOM   9475  H  HD3    . ARG B 1 303 ? 19.143  55.915 -80.603  1.00 65.32  ? 283 ARG B HD3    1 
ATOM   9476  H  HE     . ARG B 1 303 ? 18.769  55.532 -78.467  1.00 65.86  ? 283 ARG B HE     1 
ATOM   9477  H  HH11   . ARG B 1 303 ? 19.454  58.760 -78.741  1.00 68.94  ? 283 ARG B HH11   1 
ATOM   9478  H  HH12   . ARG B 1 303 ? 19.034  59.131 -77.360  1.00 68.94  ? 283 ARG B HH12   1 
ATOM   9479  H  HH21   . ARG B 1 303 ? 18.134  56.118 -76.375  1.00 65.80  ? 283 ARG B HH21   1 
ATOM   9480  H  HH22   . ARG B 1 303 ? 18.238  57.536 -75.933  1.00 65.80  ? 283 ARG B HH22   1 
ATOM   9481  N  N      . MET B 1 304 ? 24.123  56.202 -77.978  1.00 52.11  ? 284 MET B N      1 
ATOM   9482  C  CA     . MET B 1 304 ? 24.811  57.310 -77.334  1.00 51.88  ? 284 MET B CA     1 
ATOM   9483  C  C      . MET B 1 304 ? 26.327  57.223 -77.464  1.00 50.64  ? 284 MET B C      1 
ATOM   9484  O  O      . MET B 1 304 ? 27.018  58.165 -77.063  1.00 50.31  ? 284 MET B O      1 
ATOM   9485  C  CB     . MET B 1 304 ? 24.434  57.362 -75.847  1.00 51.55  ? 284 MET B CB     1 
ATOM   9486  C  CG     . MET B 1 304 ? 24.521  58.745 -75.211  1.00 57.37  ? 284 MET B CG     1 
ATOM   9487  S  SD     . MET B 1 304 ? 23.187  59.864 -75.703  1.00 61.71  ? 284 MET B SD     1 
ATOM   9488  C  CE     . MET B 1 304 ? 21.755  59.068 -74.973  1.00 59.85  ? 284 MET B CE     1 
ATOM   9489  H  H      . MET B 1 304 ? 23.938  55.551 -77.447  1.00 62.65  ? 284 MET B H      1 
ATOM   9490  H  HA     . MET B 1 304 ? 24.513  58.138 -77.742  1.00 62.38  ? 284 MET B HA     1 
ATOM   9491  H  HB2    . MET B 1 304 ? 23.520  57.052 -75.750  1.00 61.98  ? 284 MET B HB2    1 
ATOM   9492  H  HB3    . MET B 1 304 ? 25.031  56.776 -75.356  1.00 61.98  ? 284 MET B HB3    1 
ATOM   9493  H  HG2    . MET B 1 304 ? 24.485  58.648 -74.247  1.00 68.97  ? 284 MET B HG2    1 
ATOM   9494  H  HG3    . MET B 1 304 ? 25.361  59.155 -75.469  1.00 68.97  ? 284 MET B HG3    1 
ATOM   9495  H  HE1    . MET B 1 304 ? 20.965  59.592 -75.177  1.00 71.94  ? 284 MET B HE1    1 
ATOM   9496  H  HE2    . MET B 1 304 ? 21.666  58.176 -75.345  1.00 71.94  ? 284 MET B HE2    1 
ATOM   9497  H  HE3    . MET B 1 304 ? 21.879  59.015 -74.012  1.00 71.94  ? 284 MET B HE3    1 
ATOM   9498  N  N      . ASN B 1 305 ? 26.861  56.132 -78.020  1.00 52.24  ? 285 ASN B N      1 
ATOM   9499  C  CA     . ASN B 1 305 ? 28.299  55.993 -78.218  1.00 57.69  ? 285 ASN B CA     1 
ATOM   9500  C  C      . ASN B 1 305 ? 28.720  56.083 -79.681  1.00 59.63  ? 285 ASN B C      1 
ATOM   9501  O  O      . ASN B 1 305 ? 29.879  55.797 -79.993  1.00 63.01  ? 285 ASN B O      1 
ATOM   9502  C  CB     . ASN B 1 305 ? 28.773  54.657 -77.640  1.00 59.00  ? 285 ASN B CB     1 
ATOM   9503  C  CG     . ASN B 1 305 ? 30.196  54.711 -77.116  1.00 61.06  ? 285 ASN B CG     1 
ATOM   9504  O  OD1    . ASN B 1 305 ? 30.497  54.133 -76.073  1.00 60.01  ? 285 ASN B OD1    1 
ATOM   9505  N  ND2    . ASN B 1 305 ? 31.075  55.408 -77.828  1.00 63.55  ? 285 ASN B ND2    1 
ATOM   9506  H  H      . ASN B 1 305 ? 26.405  55.456 -78.292  1.00 62.80  ? 285 ASN B H      1 
ATOM   9507  H  HA     . ASN B 1 305 ? 28.751  56.703 -77.736  1.00 69.34  ? 285 ASN B HA     1 
ATOM   9508  H  HB2    . ASN B 1 305 ? 28.192  54.408 -76.904  1.00 70.92  ? 285 ASN B HB2    1 
ATOM   9509  H  HB3    . ASN B 1 305 ? 28.735  53.982 -78.335  1.00 70.92  ? 285 ASN B HB3    1 
ATOM   9510  H  HD21   . ASN B 1 305 ? 31.893  55.464 -77.566  1.00 76.38  ? 285 ASN B HD21   1 
ATOM   9511  H  HD22   . ASN B 1 305 ? 30.827  55.803 -78.550  1.00 76.38  ? 285 ASN B HD22   1 
ATOM   9512  N  N      . GLY B 1 306 ? 27.825  56.482 -80.584  1.00 58.13  ? 286 GLY B N      1 
ATOM   9513  C  CA     . GLY B 1 306 ? 28.154  56.557 -81.989  1.00 56.62  ? 286 GLY B CA     1 
ATOM   9514  C  C      . GLY B 1 306 ? 27.842  55.317 -82.803  1.00 59.20  ? 286 GLY B C      1 
ATOM   9515  O  O      . GLY B 1 306 ? 27.730  55.416 -84.031  1.00 54.69  ? 286 GLY B O      1 
ATOM   9516  H  H      . GLY B 1 306 ? 27.018  56.715 -80.399  1.00 69.88  ? 286 GLY B H      1 
ATOM   9517  H  HA2    . GLY B 1 306 ? 27.670  57.300 -82.383  1.00 68.07  ? 286 GLY B HA2    1 
ATOM   9518  H  HA3    . GLY B 1 306 ? 29.103  56.739 -82.078  1.00 68.07  ? 286 GLY B HA3    1 
ATOM   9519  N  N      . GLU B 1 307 ? 27.704  54.155 -82.172  1.00 69.45  ? 287 GLU B N      1 
ATOM   9520  C  CA     . GLU B 1 307 ? 27.405  52.944 -82.916  1.00 77.62  ? 287 GLU B CA     1 
ATOM   9521  C  C      . GLU B 1 307 ? 25.899  52.790 -83.097  1.00 75.30  ? 287 GLU B C      1 
ATOM   9522  O  O      . GLU B 1 307 ? 25.097  53.535 -82.531  1.00 79.36  ? 287 GLU B O      1 
ATOM   9523  C  CB     . GLU B 1 307 ? 27.953  51.717 -82.184  1.00 80.27  ? 287 GLU B CB     1 
ATOM   9524  C  CG     . GLU B 1 307 ? 29.231  51.953 -81.390  1.00 86.29  ? 287 GLU B CG     1 
ATOM   9525  C  CD     . GLU B 1 307 ? 29.673  50.722 -80.623  1.00 92.94  ? 287 GLU B CD     1 
ATOM   9526  O  OE1    . GLU B 1 307 ? 29.320  49.601 -81.044  1.00 95.41  ? 287 GLU B OE1    1 
ATOM   9527  O  OE2    . GLU B 1 307 ? 30.383  50.873 -79.606  1.00 95.61  ? 287 GLU B OE2    1 
ATOM   9528  H  H      . GLU B 1 307 ? 27.777  54.045 -81.322  1.00 83.45  ? 287 GLU B H      1 
ATOM   9529  H  HA     . GLU B 1 307 ? 27.818  52.991 -83.792  1.00 93.26  ? 287 GLU B HA     1 
ATOM   9530  H  HB2    . GLU B 1 307 ? 27.277  51.402 -81.563  1.00 96.44  ? 287 GLU B HB2    1 
ATOM   9531  H  HB3    . GLU B 1 307 ? 28.139  51.026 -82.839  1.00 96.44  ? 287 GLU B HB3    1 
ATOM   9532  H  HG2    . GLU B 1 307 ? 29.943  52.198 -82.001  1.00 103.66 ? 287 GLU B HG2    1 
ATOM   9533  H  HG3    . GLU B 1 307 ? 29.080  52.667 -80.751  1.00 103.66 ? 287 GLU B HG3    1 
ATOM   9534  N  N      . LYS B 1 308 ? 25.517  51.804 -83.907  1.00 67.75  ? 288 LYS B N      1 
ATOM   9535  C  CA     . LYS B 1 308 ? 24.114  51.476 -84.101  1.00 67.24  ? 288 LYS B CA     1 
ATOM   9536  C  C      . LYS B 1 308 ? 23.947  49.966 -84.030  1.00 62.29  ? 288 LYS B C      1 
ATOM   9537  O  O      . LYS B 1 308 ? 24.842  49.208 -84.414  1.00 69.63  ? 288 LYS B O      1 
ATOM   9538  C  CB     . LYS B 1 308 ? 23.579  52.059 -85.419  1.00 71.84  ? 288 LYS B CB     1 
ATOM   9539  C  CG     . LYS B 1 308 ? 22.135  51.690 -85.736  1.00 73.22  ? 288 LYS B CG     1 
ATOM   9540  C  CD     . LYS B 1 308 ? 21.466  52.768 -86.594  1.00 74.92  ? 288 LYS B CD     1 
ATOM   9541  C  CE     . LYS B 1 308 ? 20.780  52.234 -87.839  1.00 75.90  ? 288 LYS B CE     1 
ATOM   9542  N  NZ     . LYS B 1 308 ? 21.582  52.527 -89.058  1.00 78.50  ? 288 LYS B NZ     1 
ATOM   9543  H  H      . LYS B 1 308 ? 26.057  51.309 -84.357  1.00 81.42  ? 288 LYS B H      1 
ATOM   9544  H  HA     . LYS B 1 308 ? 23.599  51.865 -83.377  1.00 80.80  ? 288 LYS B HA     1 
ATOM   9545  H  HB2    . LYS B 1 308 ? 23.632  53.026 -85.374  1.00 86.33  ? 288 LYS B HB2    1 
ATOM   9546  H  HB3    . LYS B 1 308 ? 24.132  51.735 -86.148  1.00 86.33  ? 288 LYS B HB3    1 
ATOM   9547  H  HG2    . LYS B 1 308 ? 22.117  50.855 -86.228  1.00 87.98  ? 288 LYS B HG2    1 
ATOM   9548  H  HG3    . LYS B 1 308 ? 21.636  51.606 -84.909  1.00 87.98  ? 288 LYS B HG3    1 
ATOM   9549  H  HD2    . LYS B 1 308 ? 20.796  53.221 -86.058  1.00 90.02  ? 288 LYS B HD2    1 
ATOM   9550  H  HD3    . LYS B 1 308 ? 22.142  53.403 -86.878  1.00 90.02  ? 288 LYS B HD3    1 
ATOM   9551  H  HE2    . LYS B 1 308 ? 20.680  51.272 -87.763  1.00 91.19  ? 288 LYS B HE2    1 
ATOM   9552  H  HE3    . LYS B 1 308 ? 19.913  52.658 -87.935  1.00 91.19  ? 288 LYS B HE3    1 
ATOM   9553  H  HZ1    . LYS B 1 308 ? 21.167  52.208 -89.778  1.00 94.32  ? 288 LYS B HZ1    1 
ATOM   9554  H  HZ2    . LYS B 1 308 ? 21.686  53.406 -89.150  1.00 94.32  ? 288 LYS B HZ2    1 
ATOM   9555  H  HZ3    . LYS B 1 308 ? 22.383  52.146 -88.993  1.00 94.32  ? 288 LYS B HZ3    1 
ATOM   9556  N  N      . VAL B 1 309 ? 22.784  49.537 -83.548  1.00 45.77  ? 289 VAL B N      1 
ATOM   9557  C  CA     . VAL B 1 309 ? 22.484  48.119 -83.384  1.00 35.10  ? 289 VAL B CA     1 
ATOM   9558  C  C      . VAL B 1 309 ? 21.064  47.996 -82.853  1.00 37.72  ? 289 VAL B C      1 
ATOM   9559  O  O      . VAL B 1 309 ? 20.625  48.812 -82.034  1.00 34.02  ? 289 VAL B O      1 
ATOM   9560  C  CB     . VAL B 1 309 ? 23.497  47.443 -82.439  1.00 31.31  ? 289 VAL B CB     1 
ATOM   9561  C  CG1    . VAL B 1 309 ? 23.554  48.175 -81.106  1.00 30.49  ? 289 VAL B CG1    1 
ATOM   9562  C  CG2    . VAL B 1 309 ? 23.152  45.973 -82.230  1.00 31.91  ? 289 VAL B CG2    1 
ATOM   9563  H  H      . VAL B 1 309 ? 22.143  50.056 -83.306  1.00 55.05  ? 289 VAL B H      1 
ATOM   9564  H  HA     . VAL B 1 309 ? 22.528  47.678 -84.247  1.00 42.24  ? 289 VAL B HA     1 
ATOM   9565  H  HB     . VAL B 1 309 ? 24.379  47.488 -82.841  1.00 37.69  ? 289 VAL B HB     1 
ATOM   9566  H  HG11   . VAL B 1 309 ? 24.197  47.732 -80.530  1.00 36.70  ? 289 VAL B HG11   1 
ATOM   9567  H  HG12   . VAL B 1 309 ? 23.827  49.093 -81.261  1.00 36.70  ? 289 VAL B HG12   1 
ATOM   9568  H  HG13   . VAL B 1 309 ? 22.675  48.156 -80.697  1.00 36.70  ? 289 VAL B HG13   1 
ATOM   9569  H  HG21   . VAL B 1 309 ? 23.806  45.578 -81.632  1.00 38.40  ? 289 VAL B HG21   1 
ATOM   9570  H  HG22   . VAL B 1 309 ? 22.266  45.910 -81.840  1.00 38.40  ? 289 VAL B HG22   1 
ATOM   9571  H  HG23   . VAL B 1 309 ? 23.170  45.520 -83.087  1.00 38.40  ? 289 VAL B HG23   1 
ATOM   9572  N  N      . HIS B 1 310 ? 20.339  46.975 -83.303  1.00 47.14  ? 290 HIS B N      1 
ATOM   9573  C  CA     . HIS B 1 310 ? 18.971  46.745 -82.869  1.00 51.09  ? 290 HIS B CA     1 
ATOM   9574  C  C      . HIS B 1 310 ? 18.859  45.401 -82.164  1.00 49.19  ? 290 HIS B C      1 
ATOM   9575  O  O      . HIS B 1 310 ? 19.563  44.442 -82.497  1.00 53.59  ? 290 HIS B O      1 
ATOM   9576  C  CB     . HIS B 1 310 ? 18.006  46.785 -84.059  1.00 54.08  ? 290 HIS B CB     1 
ATOM   9577  C  CG     . HIS B 1 310 ? 17.993  48.097 -84.781  1.00 57.88  ? 290 HIS B CG     1 
ATOM   9578  N  ND1    . HIS B 1 310 ? 17.196  49.154 -84.395  1.00 59.18  ? 290 HIS B ND1    1 
ATOM   9579  C  CD2    . HIS B 1 310 ? 18.682  48.523 -85.866  1.00 58.93  ? 290 HIS B CD2    1 
ATOM   9580  C  CE1    . HIS B 1 310 ? 17.394  50.173 -85.212  1.00 60.04  ? 290 HIS B CE1    1 
ATOM   9581  N  NE2    . HIS B 1 310 ? 18.291  49.816 -86.114  1.00 60.04  ? 290 HIS B NE2    1 
ATOM   9582  H  H      . HIS B 1 310 ? 20.625  46.395 -83.870  1.00 56.69  ? 290 HIS B H      1 
ATOM   9583  H  HA     . HIS B 1 310 ? 18.713  47.439 -82.244  1.00 61.43  ? 290 HIS B HA     1 
ATOM   9584  H  HB2    . HIS B 1 310 ? 18.265  46.099 -84.695  1.00 65.01  ? 290 HIS B HB2    1 
ATOM   9585  H  HB3    . HIS B 1 310 ? 17.107  46.614 -83.739  1.00 65.01  ? 290 HIS B HB3    1 
ATOM   9586  H  HD2    . HIS B 1 310 ? 19.303  48.031 -86.354  1.00 70.83  ? 290 HIS B HD2    1 
ATOM   9587  H  HE1    . HIS B 1 310 ? 16.974  51.001 -85.161  1.00 72.17  ? 290 HIS B HE1    1 
ATOM   9588  H  HE2    . HIS B 1 310 ? 18.583  50.313 -86.752  1.00 72.16  ? 290 HIS B HE2    1 
ATOM   9589  N  N      . TYR B 1 311 ? 17.963  45.344 -81.184  1.00 39.41  ? 291 TYR B N      1 
ATOM   9590  C  CA     . TYR B 1 311 ? 17.616  44.118 -80.479  1.00 32.63  ? 291 TYR B CA     1 
ATOM   9591  C  C      . TYR B 1 311 ? 16.103  43.997 -80.375  1.00 30.31  ? 291 TYR B C      1 
ATOM   9592  O  O      . TYR B 1 311 ? 15.555  43.640 -79.327  1.00 25.06  ? 291 TYR B O      1 
ATOM   9593  C  CB     . TYR B 1 311 ? 18.281  44.068 -79.107  1.00 33.59  ? 291 TYR B CB     1 
ATOM   9594  C  CG     . TYR B 1 311 ? 19.794  43.985 -79.178  1.00 38.17  ? 291 TYR B CG     1 
ATOM   9595  C  CD1    . TYR B 1 311 ? 20.422  42.897 -79.776  1.00 40.70  ? 291 TYR B CD1    1 
ATOM   9596  C  CD2    . TYR B 1 311 ? 20.595  44.991 -78.651  1.00 41.12  ? 291 TYR B CD2    1 
ATOM   9597  C  CE1    . TYR B 1 311 ? 21.800  42.814 -79.848  1.00 42.92  ? 291 TYR B CE1    1 
ATOM   9598  C  CE2    . TYR B 1 311 ? 21.976  44.915 -78.718  1.00 43.98  ? 291 TYR B CE2    1 
ATOM   9599  C  CZ     . TYR B 1 311 ? 22.573  43.825 -79.318  1.00 44.00  ? 291 TYR B CZ     1 
ATOM   9600  O  OH     . TYR B 1 311 ? 23.946  43.745 -79.388  1.00 43.14  ? 291 TYR B OH     1 
ATOM   9601  H  H      . TYR B 1 311 ? 17.528  46.029 -80.902  1.00 47.41  ? 291 TYR B H      1 
ATOM   9602  H  HA     . TYR B 1 311 ? 17.938  43.360 -80.992  1.00 39.28  ? 291 TYR B HA     1 
ATOM   9603  H  HB2    . TYR B 1 311 ? 18.049  44.872 -78.615  1.00 40.42  ? 291 TYR B HB2    1 
ATOM   9604  H  HB3    . TYR B 1 311 ? 17.962  43.286 -78.630  1.00 40.42  ? 291 TYR B HB3    1 
ATOM   9605  H  HD1    . TYR B 1 311 ? 19.904  42.213 -80.136  1.00 48.96  ? 291 TYR B HD1    1 
ATOM   9606  H  HD2    . TYR B 1 311 ? 20.196  45.728 -78.246  1.00 49.46  ? 291 TYR B HD2    1 
ATOM   9607  H  HE1    . TYR B 1 311 ? 22.204  42.080 -80.252  1.00 51.62  ? 291 TYR B HE1    1 
ATOM   9608  H  HE2    . TYR B 1 311 ? 22.500  45.596 -78.361  1.00 52.90  ? 291 TYR B HE2    1 
ATOM   9609  H  HH     . TYR B 1 311 ? 24.292  44.421 -79.029  1.00 51.88  ? 291 TYR B HH     1 
ATOM   9610  N  N      . GLN B 1 312 ? 15.405  44.289 -81.477  1.00 39.95  ? 292 GLN B N      1 
ATOM   9611  C  CA     . GLN B 1 312 ? 13.949  44.204 -81.494  1.00 41.48  ? 292 GLN B CA     1 
ATOM   9612  C  C      . GLN B 1 312 ? 13.477  42.787 -81.792  1.00 39.08  ? 292 GLN B C      1 
ATOM   9613  O  O      . GLN B 1 312 ? 12.493  42.323 -81.205  1.00 41.98  ? 292 GLN B O      1 
ATOM   9614  C  CB     . GLN B 1 312 ? 13.388  45.164 -82.545  1.00 44.24  ? 292 GLN B CB     1 
ATOM   9615  C  CG     . GLN B 1 312 ? 13.747  46.625 -82.329  1.00 46.73  ? 292 GLN B CG     1 
ATOM   9616  C  CD     . GLN B 1 312 ? 13.052  47.236 -81.133  1.00 49.65  ? 292 GLN B CD     1 
ATOM   9617  O  OE1    . GLN B 1 312 ? 11.834  47.127 -80.987  1.00 49.71  ? 292 GLN B OE1    1 
ATOM   9618  N  NE2    . GLN B 1 312 ? 13.823  47.889 -80.270  1.00 52.35  ? 292 GLN B NE2    1 
ATOM   9619  H  H      . GLN B 1 312 ? 15.753  44.538 -82.223  1.00 48.06  ? 292 GLN B H      1 
ATOM   9620  H  HA     . GLN B 1 312 ? 13.602  44.465 -80.627  1.00 49.89  ? 292 GLN B HA     1 
ATOM   9621  H  HB2    . GLN B 1 312 ? 13.729  44.904 -83.415  1.00 53.20  ? 292 GLN B HB2    1 
ATOM   9622  H  HB3    . GLN B 1 312 ? 12.420  45.096 -82.541  1.00 53.20  ? 292 GLN B HB3    1 
ATOM   9623  H  HG2    . GLN B 1 312 ? 14.704  46.696 -82.187  1.00 56.19  ? 292 GLN B HG2    1 
ATOM   9624  H  HG3    . GLN B 1 312 ? 13.490  47.132 -83.115  1.00 56.19  ? 292 GLN B HG3    1 
ATOM   9625  H  HE21   . GLN B 1 312 ? 14.670  47.946 -80.408  1.00 62.93  ? 292 GLN B HE21   1 
ATOM   9626  H  HE22   . GLN B 1 312 ? 13.475  48.254 -79.574  1.00 62.93  ? 292 GLN B HE22   1 
ATOM   9627  N  N      . TRP B 1 313 ? 14.163  42.093 -82.697  1.00 36.20  ? 293 TRP B N      1 
ATOM   9628  C  CA     . TRP B 1 313 ? 13.863  40.703 -83.037  1.00 36.67  ? 293 TRP B CA     1 
ATOM   9629  C  C      . TRP B 1 313 ? 15.194  39.957 -83.003  1.00 37.97  ? 293 TRP B C      1 
ATOM   9630  O  O      . TRP B 1 313 ? 15.996  40.068 -83.935  1.00 41.21  ? 293 TRP B O      1 
ATOM   9631  C  CB     . TRP B 1 313 ? 13.182  40.611 -84.400  1.00 36.68  ? 293 TRP B CB     1 
ATOM   9632  C  CG     . TRP B 1 313 ? 12.513  39.301 -84.679  1.00 34.37  ? 293 TRP B CG     1 
ATOM   9633  C  CD1    . TRP B 1 313 ? 13.015  38.257 -85.400  1.00 36.04  ? 293 TRP B CD1    1 
ATOM   9634  C  CD2    . TRP B 1 313 ? 11.209  38.898 -84.243  1.00 33.56  ? 293 TRP B CD2    1 
ATOM   9635  N  NE1    . TRP B 1 313 ? 12.103  37.228 -85.441  1.00 37.24  ? 293 TRP B NE1    1 
ATOM   9636  C  CE2    . TRP B 1 313 ? 10.987  37.596 -84.736  1.00 36.52  ? 293 TRP B CE2    1 
ATOM   9637  C  CE3    . TRP B 1 313 ? 10.209  39.511 -83.481  1.00 29.95  ? 293 TRP B CE3    1 
ATOM   9638  C  CZ2    . TRP B 1 313 ? 9.806   36.896 -84.492  1.00 34.94  ? 293 TRP B CZ2    1 
ATOM   9639  C  CZ3    . TRP B 1 313 ? 9.036   38.815 -83.241  1.00 28.80  ? 293 TRP B CZ3    1 
ATOM   9640  C  CH2    . TRP B 1 313 ? 8.845   37.521 -83.745  1.00 31.60  ? 293 TRP B CH2    1 
ATOM   9641  H  H      . TRP B 1 313 ? 14.825  42.415 -83.141  1.00 43.56  ? 293 TRP B H      1 
ATOM   9642  H  HA     . TRP B 1 313 ? 13.274  40.321 -82.367  1.00 44.12  ? 293 TRP B HA     1 
ATOM   9643  H  HB2    . TRP B 1 313 ? 12.505  41.304 -84.455  1.00 44.13  ? 293 TRP B HB2    1 
ATOM   9644  H  HB3    . TRP B 1 313 ? 13.849  40.752 -85.090  1.00 44.13  ? 293 TRP B HB3    1 
ATOM   9645  H  HD1    . TRP B 1 313 ? 13.850  38.244 -85.808  1.00 43.37  ? 293 TRP B HD1    1 
ATOM   9646  H  HE1    . TRP B 1 313 ? 12.216  36.475 -85.841  1.00 44.81  ? 293 TRP B HE1    1 
ATOM   9647  H  HE3    . TRP B 1 313 ? 10.328  40.369 -83.143  1.00 36.05  ? 293 TRP B HE3    1 
ATOM   9648  H  HZ2    . TRP B 1 313 ? 9.676   36.037 -84.825  1.00 42.05  ? 293 TRP B HZ2    1 
ATOM   9649  H  HZ3    . TRP B 1 313 ? 8.364   39.212 -82.735  1.00 34.67  ? 293 TRP B HZ3    1 
ATOM   9650  H  HH2    . TRP B 1 313 ? 8.048   37.077 -83.567  1.00 38.04  ? 293 TRP B HH2    1 
ATOM   9651  N  N      . CYS B 1 314 ? 15.429  39.201 -81.935  1.00 38.25  ? 294 CYS B N      1 
ATOM   9652  C  CA     . CYS B 1 314 ? 16.746  38.651 -81.644  1.00 40.05  ? 294 CYS B CA     1 
ATOM   9653  C  C      . CYS B 1 314 ? 16.832  37.197 -82.088  1.00 34.59  ? 294 CYS B C      1 
ATOM   9654  O  O      . CYS B 1 314 ? 15.994  36.372 -81.707  1.00 37.01  ? 294 CYS B O      1 
ATOM   9655  C  CB     . CYS B 1 314 ? 17.050  38.765 -80.150  1.00 42.36  ? 294 CYS B CB     1 
ATOM   9656  S  SG     . CYS B 1 314 ? 17.130  40.473 -79.541  1.00 46.09  ? 294 CYS B SG     1 
ATOM   9657  H  H      . CYS B 1 314 ? 14.830  38.990 -81.355  1.00 46.02  ? 294 CYS B H      1 
ATOM   9658  H  HA     . CYS B 1 314 ? 17.417  39.156 -82.129  1.00 48.18  ? 294 CYS B HA     1 
ATOM   9659  H  HB2    . CYS B 1 314 ? 16.354  38.306 -79.654  1.00 50.94  ? 294 CYS B HB2    1 
ATOM   9660  H  HB3    . CYS B 1 314 ? 17.908  38.347 -79.973  1.00 50.94  ? 294 CYS B HB3    1 
ATOM   9661  H  HG     . CYS B 1 314 ? 16.073  41.006 -79.734  1.00 55.42  ? 294 CYS B HG     1 
ATOM   9662  N  N      . ILE B 1 315 ? 17.850  36.891 -82.891  1.00 28.19  ? 295 ILE B N      1 
ATOM   9663  C  CA     . ILE B 1 315 ? 18.119  35.538 -83.369  1.00 26.03  ? 295 ILE B CA     1 
ATOM   9664  C  C      . ILE B 1 315 ? 19.615  35.300 -83.211  1.00 25.82  ? 295 ILE B C      1 
ATOM   9665  O  O      . ILE B 1 315 ? 20.415  35.824 -83.996  1.00 25.43  ? 295 ILE B O      1 
ATOM   9666  C  CB     . ILE B 1 315 ? 17.686  35.336 -84.828  1.00 28.38  ? 295 ILE B CB     1 
ATOM   9667  C  CG1    . ILE B 1 315 ? 16.194  35.646 -84.990  1.00 29.04  ? 295 ILE B CG1    1 
ATOM   9668  C  CG2    . ILE B 1 315 ? 17.987  33.904 -85.270  1.00 28.76  ? 295 ILE B CG2    1 
ATOM   9669  C  CD1    . ILE B 1 315 ? 15.702  35.602 -86.427  1.00 29.86  ? 295 ILE B CD1    1 
ATOM   9670  H  H      . ILE B 1 315 ? 18.416  37.470 -83.180  1.00 33.95  ? 295 ILE B H      1 
ATOM   9671  H  HA     . ILE B 1 315 ? 17.645  34.898 -82.815  1.00 31.35  ? 295 ILE B HA     1 
ATOM   9672  H  HB     . ILE B 1 315 ? 18.191  35.945 -85.388  1.00 34.18  ? 295 ILE B HB     1 
ATOM   9673  H  HG12   . ILE B 1 315 ? 15.684  34.995 -84.483  1.00 34.97  ? 295 ILE B HG12   1 
ATOM   9674  H  HG13   . ILE B 1 315 ? 16.022  36.537 -84.646  1.00 34.97  ? 295 ILE B HG13   1 
ATOM   9675  H  HG21   . ILE B 1 315 ? 17.708  33.794 -86.193  1.00 34.63  ? 295 ILE B HG21   1 
ATOM   9676  H  HG22   . ILE B 1 315 ? 18.940  33.744 -85.191  1.00 34.63  ? 295 ILE B HG22   1 
ATOM   9677  H  HG23   . ILE B 1 315 ? 17.500  33.289 -84.701  1.00 34.63  ? 295 ILE B HG23   1 
ATOM   9678  H  HD11   . ILE B 1 315 ? 14.754  35.809 -86.442  1.00 35.95  ? 295 ILE B HD11   1 
ATOM   9679  H  HD12   . ILE B 1 315 ? 16.192  36.257 -86.948  1.00 35.95  ? 295 ILE B HD12   1 
ATOM   9680  H  HD13   . ILE B 1 315 ? 15.853  34.714 -86.785  1.00 35.95  ? 295 ILE B HD13   1 
ATOM   9681  N  N      . GLU B 1 316 ? 19.992  34.508 -82.211  1.00 26.71  ? 296 GLU B N      1 
ATOM   9682  C  CA     . GLU B 1 316 ? 21.401  34.249 -81.941  1.00 30.79  ? 296 GLU B CA     1 
ATOM   9683  C  C      . GLU B 1 316 ? 21.978  33.294 -82.981  1.00 32.46  ? 296 GLU B C      1 
ATOM   9684  O  O      . GLU B 1 316 ? 21.329  32.324 -83.382  1.00 32.33  ? 296 GLU B O      1 
ATOM   9685  C  CB     . GLU B 1 316 ? 21.554  33.670 -80.534  1.00 32.54  ? 296 GLU B CB     1 
ATOM   9686  C  CG     . GLU B 1 316 ? 22.984  33.468 -80.069  1.00 33.84  ? 296 GLU B CG     1 
ATOM   9687  C  CD     . GLU B 1 316 ? 23.048  32.883 -78.670  1.00 30.96  ? 296 GLU B CD     1 
ATOM   9688  O  OE1    . GLU B 1 316 ? 21.977  32.547 -78.124  1.00 28.55  ? 296 GLU B OE1    1 
ATOM   9689  O  OE2    . GLU B 1 316 ? 24.160  32.766 -78.111  1.00 29.38  ? 296 GLU B OE2    1 
ATOM   9690  H  H      . GLU B 1 316 ? 19.451  34.108 -81.676  1.00 32.17  ? 296 GLU B H      1 
ATOM   9691  H  HA     . GLU B 1 316 ? 21.895  35.082 -81.984  1.00 37.07  ? 296 GLU B HA     1 
ATOM   9692  H  HB2    . GLU B 1 316 ? 21.126  34.272 -79.905  1.00 39.16  ? 296 GLU B HB2    1 
ATOM   9693  H  HB3    . GLU B 1 316 ? 21.114  32.806 -80.507  1.00 39.16  ? 296 GLU B HB3    1 
ATOM   9694  H  HG2    . GLU B 1 316 ? 23.432  32.856 -80.674  1.00 40.73  ? 296 GLU B HG2    1 
ATOM   9695  H  HG3    . GLU B 1 316 ? 23.440  34.324 -80.060  1.00 40.73  ? 296 GLU B HG3    1 
ATOM   9696  N  N      . ASP B 1 317 ? 23.267  33.586 -83.440  1.00 38.24  ? 297 ASP B N      1 
ATOM   9697  C  CA     . ASP B 1 317 ? 23.926  32.716 -84.412  1.00 43.27  ? 297 ASP B CA     1 
ATOM   9698  C  C      . ASP B 1 317 ? 24.675  31.590 -83.696  1.00 48.37  ? 297 ASP B C      1 
ATOM   9699  O  O      . ASP B 1 317 ? 25.286  31.822 -82.648  1.00 49.12  ? 297 ASP B O      1 
ATOM   9700  C  CB     . ASP B 1 317 ? 24.901  33.515 -85.274  1.00 40.86  ? 297 ASP B CB     1 
ATOM   9701  C  CG     . ASP B 1 317 ? 25.448  32.712 -86.439  1.00 36.55  ? 297 ASP B CG     1 
ATOM   9702  O  OD1    . ASP B 1 317 ? 26.285  31.813 -86.211  1.00 35.21  ? 297 ASP B OD1    1 
ATOM   9703  O  OD2    . ASP B 1 317 ? 25.041  32.981 -87.588  1.00 35.20  ? 297 ASP B OD2    1 
ATOM   9704  H  H      . ASP B 1 317 ? 23.735  34.264 -83.193  1.00 46.01  ? 297 ASP B H      1 
ATOM   9705  H  HA     . ASP B 1 317 ? 23.258  32.319 -84.993  1.00 52.05  ? 297 ASP B HA     1 
ATOM   9706  H  HB2    . ASP B 1 317 ? 24.443  34.291 -85.633  1.00 49.16  ? 297 ASP B HB2    1 
ATOM   9707  H  HB3    . ASP B 1 317 ? 25.650  33.797 -84.726  1.00 49.16  ? 297 ASP B HB3    1 
ATOM   9708  N  N      . PRO B 1 318 ? 24.658  30.363 -84.230  1.00 49.96  ? 298 PRO B N      1 
ATOM   9709  C  CA     . PRO B 1 318 ? 25.268  29.239 -83.496  1.00 49.79  ? 298 PRO B CA     1 
ATOM   9710  C  C      . PRO B 1 318 ? 26.790  29.244 -83.468  1.00 44.94  ? 298 PRO B C      1 
ATOM   9711  O  O      . PRO B 1 318 ? 27.365  28.648 -82.548  1.00 46.53  ? 298 PRO B O      1 
ATOM   9712  C  CB     . PRO B 1 318 ? 24.733  28.007 -84.238  1.00 50.81  ? 298 PRO B CB     1 
ATOM   9713  C  CG     . PRO B 1 318 ? 24.426  28.494 -85.606  1.00 49.17  ? 298 PRO B CG     1 
ATOM   9714  C  CD     . PRO B 1 318 ? 23.957  29.908 -85.443  1.00 49.25  ? 298 PRO B CD     1 
ATOM   9715  H  HA     . PRO B 1 318 ? 24.938  29.224 -82.584  1.00 59.87  ? 298 PRO B HA     1 
ATOM   9716  H  HB2    . PRO B 1 318 ? 25.415  27.317 -84.264  1.00 61.09  ? 298 PRO B HB2    1 
ATOM   9717  H  HB3    . PRO B 1 318 ? 23.930  27.683 -83.800  1.00 61.09  ? 298 PRO B HB3    1 
ATOM   9718  H  HG2    . PRO B 1 318 ? 25.229  28.462 -86.149  1.00 59.12  ? 298 PRO B HG2    1 
ATOM   9719  H  HG3    . PRO B 1 318 ? 23.727  27.946 -85.996  1.00 59.12  ? 298 PRO B HG3    1 
ATOM   9720  H  HD2    . PRO B 1 318 ? 24.221  30.442 -86.207  1.00 59.21  ? 298 PRO B HD2    1 
ATOM   9721  H  HD3    . PRO B 1 318 ? 22.996  29.932 -85.307  1.00 59.21  ? 298 PRO B HD3    1 
ATOM   9722  N  N      . TYR B 1 319 ? 27.462  29.879 -84.427  1.00 35.63  ? 299 TYR B N      1 
ATOM   9723  C  CA     . TYR B 1 319 ? 28.921  29.793 -84.501  1.00 36.18  ? 299 TYR B CA     1 
ATOM   9724  C  C      . TYR B 1 319 ? 29.610  31.148 -84.518  1.00 39.25  ? 299 TYR B C      1 
ATOM   9725  O  O      . TYR B 1 319 ? 30.661  31.301 -83.889  1.00 35.91  ? 299 TYR B O      1 
ATOM   9726  C  CB     . TYR B 1 319 ? 29.351  28.996 -85.745  1.00 36.57  ? 299 TYR B CB     1 
ATOM   9727  C  CG     . TYR B 1 319 ? 28.922  27.547 -85.731  1.00 35.36  ? 299 TYR B CG     1 
ATOM   9728  C  CD1    . TYR B 1 319 ? 29.513  26.636 -84.866  1.00 33.71  ? 299 TYR B CD1    1 
ATOM   9729  C  CD2    . TYR B 1 319 ? 27.937  27.088 -86.592  1.00 36.46  ? 299 TYR B CD2    1 
ATOM   9730  C  CE1    . TYR B 1 319 ? 29.127  25.308 -84.853  1.00 31.83  ? 299 TYR B CE1    1 
ATOM   9731  C  CE2    . TYR B 1 319 ? 27.545  25.763 -86.588  1.00 34.79  ? 299 TYR B CE2    1 
ATOM   9732  C  CZ     . TYR B 1 319 ? 28.143  24.878 -85.717  1.00 30.39  ? 299 TYR B CZ     1 
ATOM   9733  O  OH     . TYR B 1 319 ? 27.753  23.559 -85.711  1.00 26.22  ? 299 TYR B OH     1 
ATOM   9734  H  H      . TYR B 1 319 ? 27.102  30.361 -85.041  1.00 42.88  ? 299 TYR B H      1 
ATOM   9735  H  HA     . TYR B 1 319 ? 29.240  29.313 -83.721  1.00 43.53  ? 299 TYR B HA     1 
ATOM   9736  H  HB2    . TYR B 1 319 ? 28.962  29.411 -86.530  1.00 44.00  ? 299 TYR B HB2    1 
ATOM   9737  H  HB3    . TYR B 1 319 ? 30.319  29.017 -85.808  1.00 44.00  ? 299 TYR B HB3    1 
ATOM   9738  H  HD1    . TYR B 1 319 ? 30.177  26.924 -84.282  1.00 40.57  ? 299 TYR B HD1    1 
ATOM   9739  H  HD2    . TYR B 1 319 ? 27.531  27.682 -87.181  1.00 43.87  ? 299 TYR B HD2    1 
ATOM   9740  H  HE1    . TYR B 1 319 ? 29.530  24.709 -84.266  1.00 38.31  ? 299 TYR B HE1    1 
ATOM   9741  H  HE2    . TYR B 1 319 ? 26.881  25.470 -87.169  1.00 41.87  ? 299 TYR B HE2    1 
ATOM   9742  H  HH     . TYR B 1 319 ? 28.194  23.132 -85.137  1.00 31.58  ? 299 TYR B HH     1 
ATOM   9743  N  N      . GLU B 1 320 ? 29.055  32.134 -85.218  1.00 51.47  ? 300 GLU B N      1 
ATOM   9744  C  CA     . GLU B 1 320 ? 29.682  33.445 -85.252  1.00 55.40  ? 300 GLU B CA     1 
ATOM   9745  C  C      . GLU B 1 320 ? 29.676  34.052 -83.851  1.00 55.88  ? 300 GLU B C      1 
ATOM   9746  O  O      . GLU B 1 320 ? 28.892  33.667 -82.980  1.00 55.35  ? 300 GLU B O      1 
ATOM   9747  C  CB     . GLU B 1 320 ? 28.964  34.360 -86.245  1.00 56.58  ? 300 GLU B CB     1 
ATOM   9748  C  CG     . GLU B 1 320 ? 29.901  35.241 -87.060  1.00 60.04  ? 300 GLU B CG     1 
ATOM   9749  C  CD     . GLU B 1 320 ? 30.686  34.462 -88.100  1.00 61.48  ? 300 GLU B CD     1 
ATOM   9750  O  OE1    . GLU B 1 320 ? 30.065  33.684 -88.855  1.00 61.77  ? 300 GLU B OE1    1 
ATOM   9751  O  OE2    . GLU B 1 320 ? 31.923  34.625 -88.161  1.00 61.71  ? 300 GLU B OE2    1 
ATOM   9752  H  H      . GLU B 1 320 ? 28.329  32.069 -85.674  1.00 61.89  ? 300 GLU B H      1 
ATOM   9753  H  HA     . GLU B 1 320 ? 30.604  33.351 -85.538  1.00 66.60  ? 300 GLU B HA     1 
ATOM   9754  H  HB2    . GLU B 1 320 ? 28.458  33.812 -86.865  1.00 68.01  ? 300 GLU B HB2    1 
ATOM   9755  H  HB3    . GLU B 1 320 ? 28.362  34.942 -85.754  1.00 68.01  ? 300 GLU B HB3    1 
ATOM   9756  H  HG2    . GLU B 1 320 ? 29.379  35.916 -87.521  1.00 72.16  ? 300 GLU B HG2    1 
ATOM   9757  H  HG3    . GLU B 1 320 ? 30.536  35.665 -86.461  1.00 72.16  ? 300 GLU B HG3    1 
ATOM   9758  N  N      . LEU B 1 321 ? 30.565  35.018 -83.636  1.00 56.45  ? 301 LEU B N      1 
ATOM   9759  C  CA     . LEU B 1 321 ? 30.801  35.560 -82.302  1.00 57.78  ? 301 LEU B CA     1 
ATOM   9760  C  C      . LEU B 1 321 ? 29.888  36.759 -82.073  1.00 54.69  ? 301 LEU B C      1 
ATOM   9761  O  O      . LEU B 1 321 ? 30.070  37.816 -82.687  1.00 53.33  ? 301 LEU B O      1 
ATOM   9762  C  CB     . LEU B 1 321 ? 32.268  35.956 -82.146  1.00 63.06  ? 301 LEU B CB     1 
ATOM   9763  C  CG     . LEU B 1 321 ? 32.674  36.587 -80.812  1.00 68.26  ? 301 LEU B CG     1 
ATOM   9764  C  CD1    . LEU B 1 321 ? 32.360  35.652 -79.650  1.00 68.78  ? 301 LEU B CD1    1 
ATOM   9765  C  CD2    . LEU B 1 321 ? 34.147  36.969 -80.825  1.00 70.97  ? 301 LEU B CD2    1 
ATOM   9766  H  H      . LEU B 1 321 ? 31.048  35.378 -84.251  1.00 67.85  ? 301 LEU B H      1 
ATOM   9767  H  HA     . LEU B 1 321 ? 30.594  34.884 -81.638  1.00 69.45  ? 301 LEU B HA     1 
ATOM   9768  H  HB2    . LEU B 1 321 ? 32.810  35.161 -82.264  1.00 75.78  ? 301 LEU B HB2    1 
ATOM   9769  H  HB3    . LEU B 1 321 ? 32.483  36.596 -82.842  1.00 75.78  ? 301 LEU B HB3    1 
ATOM   9770  H  HG     . LEU B 1 321 ? 32.160  37.399 -80.683  1.00 82.03  ? 301 LEU B HG     1 
ATOM   9771  H  HD11   . LEU B 1 321 ? 32.628  36.078 -78.821  1.00 82.65  ? 301 LEU B HD11   1 
ATOM   9772  H  HD12   . LEU B 1 321 ? 31.406  35.474 -79.638  1.00 82.65  ? 301 LEU B HD12   1 
ATOM   9773  H  HD13   . LEU B 1 321 ? 32.850  34.824 -79.770  1.00 82.65  ? 301 LEU B HD13   1 
ATOM   9774  H  HD21   . LEU B 1 321 ? 34.377  37.365 -79.970  1.00 85.28  ? 301 LEU B HD21   1 
ATOM   9775  H  HD22   . LEU B 1 321 ? 34.678  36.171 -80.975  1.00 85.28  ? 301 LEU B HD22   1 
ATOM   9776  H  HD23   . LEU B 1 321 ? 34.300  37.608 -81.539  1.00 85.28  ? 301 LEU B HD23   1 
ATOM   9777  N  N      . ASN B 1 322 ? 28.911  36.593 -81.183  1.00 50.06  ? 302 ASN B N      1 
ATOM   9778  C  CA     . ASN B 1 322 ? 28.048  37.682 -80.729  1.00 46.48  ? 302 ASN B CA     1 
ATOM   9779  C  C      . ASN B 1 322 ? 27.405  38.409 -81.912  1.00 41.49  ? 302 ASN B C      1 
ATOM   9780  O  O      . ASN B 1 322 ? 27.516  39.626 -82.065  1.00 42.46  ? 302 ASN B O      1 
ATOM   9781  C  CB     . ASN B 1 322 ? 28.829  38.655 -79.845  1.00 52.08  ? 302 ASN B CB     1 
ATOM   9782  C  CG     . ASN B 1 322 ? 27.923  39.580 -79.057  1.00 58.45  ? 302 ASN B CG     1 
ATOM   9783  O  OD1    . ASN B 1 322 ? 26.838  39.185 -78.628  1.00 61.13  ? 302 ASN B OD1    1 
ATOM   9784  N  ND2    . ASN B 1 322 ? 28.363  40.818 -78.862  1.00 59.84  ? 302 ASN B ND2    1 
ATOM   9785  H  H      . ASN B 1 322 ? 28.725  35.838 -80.817  1.00 60.19  ? 302 ASN B H      1 
ATOM   9786  H  HA     . ASN B 1 322 ? 27.333  37.306 -80.192  1.00 55.89  ? 302 ASN B HA     1 
ATOM   9787  H  HB2    . ASN B 1 322 ? 29.365  38.150 -79.214  1.00 62.61  ? 302 ASN B HB2    1 
ATOM   9788  H  HB3    . ASN B 1 322 ? 29.402  39.202 -80.405  1.00 62.61  ? 302 ASN B HB3    1 
ATOM   9789  H  HD21   . ASN B 1 322 ? 27.884  41.380 -78.420  1.00 71.92  ? 302 ASN B HD21   1 
ATOM   9790  H  HD22   . ASN B 1 322 ? 29.126  41.058 -79.177  1.00 71.92  ? 302 ASN B HD22   1 
ATOM   9791  N  N      . LEU B 1 323 ? 26.723  37.637 -82.755  1.00 40.37  ? 303 LEU B N      1 
ATOM   9792  C  CA     . LEU B 1 323 ? 26.115  38.161 -83.973  1.00 43.40  ? 303 LEU B CA     1 
ATOM   9793  C  C      . LEU B 1 323 ? 24.628  37.829 -83.978  1.00 40.92  ? 303 LEU B C      1 
ATOM   9794  O  O      . LEU B 1 323 ? 24.248  36.657 -83.885  1.00 44.90  ? 303 LEU B O      1 
ATOM   9795  C  CB     . LEU B 1 323 ? 26.799  37.594 -85.220  1.00 42.29  ? 303 LEU B CB     1 
ATOM   9796  C  CG     . LEU B 1 323 ? 26.319  38.180 -86.550  1.00 40.94  ? 303 LEU B CG     1 
ATOM   9797  C  CD1    . LEU B 1 323 ? 26.620  39.672 -86.623  1.00 41.35  ? 303 LEU B CD1    1 
ATOM   9798  C  CD2    . LEU B 1 323 ? 26.955  37.457 -87.722  1.00 40.64  ? 303 LEU B CD2    1 
ATOM   9799  H  H      . LEU B 1 323 ? 26.598  36.794 -82.642  1.00 48.56  ? 303 LEU B H      1 
ATOM   9800  H  HA     . LEU B 1 323 ? 26.210  39.126 -83.988  1.00 52.20  ? 303 LEU B HA     1 
ATOM   9801  H  HB2    . LEU B 1 323 ? 27.751  37.765 -85.153  1.00 50.86  ? 303 LEU B HB2    1 
ATOM   9802  H  HB3    . LEU B 1 323 ? 26.642  36.637 -85.249  1.00 50.86  ? 303 LEU B HB3    1 
ATOM   9803  H  HG     . LEU B 1 323 ? 25.357  38.066 -86.615  1.00 49.24  ? 303 LEU B HG     1 
ATOM   9804  H  HD11   . LEU B 1 323 ? 26.306  40.017 -87.474  1.00 49.74  ? 303 LEU B HD11   1 
ATOM   9805  H  HD12   . LEU B 1 323 ? 26.163  40.122 -85.895  1.00 49.74  ? 303 LEU B HD12   1 
ATOM   9806  H  HD13   . LEU B 1 323 ? 27.577  39.805 -86.545  1.00 49.74  ? 303 LEU B HD13   1 
ATOM   9807  H  HD21   . LEU B 1 323 ? 26.632  37.849 -88.548  1.00 48.89  ? 303 LEU B HD21   1 
ATOM   9808  H  HD22   . LEU B 1 323 ? 27.919  37.551 -87.665  1.00 48.89  ? 303 LEU B HD22   1 
ATOM   9809  H  HD23   . LEU B 1 323 ? 26.711  36.519 -87.683  1.00 48.89  ? 303 LEU B HD23   1 
ATOM   9810  N  N      . ASN B 1 324 ? 23.795  38.862 -84.086  1.00 33.88  ? 304 ASN B N      1 
ATOM   9811  C  CA     . ASN B 1 324 ? 22.348  38.702 -84.151  1.00 30.85  ? 304 ASN B CA     1 
ATOM   9812  C  C      . ASN B 1 324 ? 21.902  38.660 -85.609  1.00 32.39  ? 304 ASN B C      1 
ATOM   9813  O  O      . ASN B 1 324 ? 22.131  39.613 -86.363  1.00 34.57  ? 304 ASN B O      1 
ATOM   9814  C  CB     . ASN B 1 324 ? 21.649  39.840 -83.407  1.00 29.44  ? 304 ASN B CB     1 
ATOM   9815  C  CG     . ASN B 1 324 ? 20.137  39.770 -83.518  1.00 28.21  ? 304 ASN B CG     1 
ATOM   9816  O  OD1    . ASN B 1 324 ? 19.576  38.733 -83.871  1.00 26.23  ? 304 ASN B OD1    1 
ATOM   9817  N  ND2    . ASN B 1 324 ? 19.469  40.877 -83.214  1.00 29.15  ? 304 ASN B ND2    1 
ATOM   9818  H  H      . ASN B 1 324 ? 24.052  39.682 -84.125  1.00 40.78  ? 304 ASN B H      1 
ATOM   9819  H  HA     . ASN B 1 324 ? 22.098  37.864 -83.731  1.00 37.13  ? 304 ASN B HA     1 
ATOM   9820  H  HB2    . ASN B 1 324 ? 21.884  39.794 -82.467  1.00 35.45  ? 304 ASN B HB2    1 
ATOM   9821  H  HB3    . ASN B 1 324 ? 21.939  40.687 -83.781  1.00 35.45  ? 304 ASN B HB3    1 
ATOM   9822  H  HD21   . ASN B 1 324 ? 18.611  40.888 -83.261  1.00 35.10  ? 304 ASN B HD21   1 
ATOM   9823  H  HD22   . ASN B 1 324 ? 19.896  41.583 -82.969  1.00 35.10  ? 304 ASN B HD22   1 
ATOM   9824  N  N      . VAL B 1 325 ? 21.269  37.552 -86.004  1.00 31.66  ? 305 VAL B N      1 
ATOM   9825  C  CA     . VAL B 1 325 ? 20.809  37.394 -87.379  1.00 30.02  ? 305 VAL B CA     1 
ATOM   9826  C  C      . VAL B 1 325 ? 19.640  38.319 -87.692  1.00 28.49  ? 305 VAL B C      1 
ATOM   9827  O  O      . VAL B 1 325 ? 19.349  38.568 -88.868  1.00 25.60  ? 305 VAL B O      1 
ATOM   9828  C  CB     . VAL B 1 325 ? 20.424  35.925 -87.642  1.00 32.72  ? 305 VAL B CB     1 
ATOM   9829  C  CG1    . VAL B 1 325 ? 20.025  35.716 -89.101  1.00 35.13  ? 305 VAL B CG1    1 
ATOM   9830  C  CG2    . VAL B 1 325 ? 21.569  34.994 -87.260  1.00 33.51  ? 305 VAL B CG2    1 
ATOM   9831  H  H      . VAL B 1 325 ? 21.095  36.882 -85.494  1.00 38.12  ? 305 VAL B H      1 
ATOM   9832  H  HA     . VAL B 1 325 ? 21.536  37.622 -87.980  1.00 36.14  ? 305 VAL B HA     1 
ATOM   9833  H  HB     . VAL B 1 325 ? 19.660  35.698 -87.089  1.00 39.38  ? 305 VAL B HB     1 
ATOM   9834  H  HG11   . VAL B 1 325 ? 19.789  34.785 -89.233  1.00 42.28  ? 305 VAL B HG11   1 
ATOM   9835  H  HG12   . VAL B 1 325 ? 19.265  36.283 -89.304  1.00 42.28  ? 305 VAL B HG12   1 
ATOM   9836  H  HG13   . VAL B 1 325 ? 20.775  35.952 -89.670  1.00 42.28  ? 305 VAL B HG13   1 
ATOM   9837  H  HG21   . VAL B 1 325 ? 21.302  34.078 -87.434  1.00 40.33  ? 305 VAL B HG21   1 
ATOM   9838  H  HG22   . VAL B 1 325 ? 22.349  35.219 -87.792  1.00 40.33  ? 305 VAL B HG22   1 
ATOM   9839  H  HG23   . VAL B 1 325 ? 21.767  35.108 -86.317  1.00 40.33  ? 305 VAL B HG23   1 
ATOM   9840  N  N      . GLY B 1 326 ? 18.960  38.837 -86.671  1.00 31.06  ? 306 GLY B N      1 
ATOM   9841  C  CA     . GLY B 1 326 ? 17.883  39.786 -86.877  1.00 35.84  ? 306 GLY B CA     1 
ATOM   9842  C  C      . GLY B 1 326 ? 18.319  41.213 -86.625  1.00 38.86  ? 306 GLY B C      1 
ATOM   9843  O  O      . GLY B 1 326 ? 17.513  42.055 -86.217  1.00 42.64  ? 306 GLY B O      1 
ATOM   9844  H  H      . GLY B 1 326 ? 19.108  38.649 -85.845  1.00 37.39  ? 306 GLY B H      1 
ATOM   9845  H  HA2    . GLY B 1 326 ? 17.563  39.718 -87.790  1.00 43.13  ? 306 GLY B HA2    1 
ATOM   9846  H  HA3    . GLY B 1 326 ? 17.150  39.578 -86.277  1.00 43.13  ? 306 GLY B HA3    1 
ATOM   9847  N  N      . ARG B 1 327 ? 19.601  41.499 -86.867  1.00 38.55  ? 307 ARG B N      1 
ATOM   9848  C  CA     . ARG B 1 327 ? 20.139  42.827 -86.598  1.00 38.45  ? 307 ARG B CA     1 
ATOM   9849  C  C      . ARG B 1 327 ? 19.536  43.900 -87.496  1.00 40.47  ? 307 ARG B C      1 
ATOM   9850  O  O      . ARG B 1 327 ? 19.648  45.088 -87.175  1.00 38.15  ? 307 ARG B O      1 
ATOM   9851  C  CB     . ARG B 1 327 ? 21.659  42.829 -86.767  1.00 34.95  ? 307 ARG B CB     1 
ATOM   9852  C  CG     . ARG B 1 327 ? 22.139  42.415 -88.148  1.00 32.06  ? 307 ARG B CG     1 
ATOM   9853  C  CD     . ARG B 1 327 ? 23.644  42.218 -88.163  1.00 33.50  ? 307 ARG B CD     1 
ATOM   9854  N  NE     . ARG B 1 327 ? 24.123  41.707 -89.444  1.00 38.22  ? 307 ARG B NE     1 
ATOM   9855  C  CZ     . ARG B 1 327 ? 24.222  40.417 -89.756  1.00 41.78  ? 307 ARG B CZ     1 
ATOM   9856  N  NH1    . ARG B 1 327 ? 23.872  39.482 -88.882  1.00 42.88  ? 307 ARG B NH1    1 
ATOM   9857  N  NH2    . ARG B 1 327 ? 24.673  40.059 -90.951  1.00 42.20  ? 307 ARG B NH2    1 
ATOM   9858  H  H      . ARG B 1 327 ? 20.174  40.942 -87.186  1.00 46.37  ? 307 ARG B H      1 
ATOM   9859  H  HA     . ARG B 1 327 ? 19.942  43.064 -85.679  1.00 46.26  ? 307 ARG B HA     1 
ATOM   9860  H  HB2    . ARG B 1 327 ? 21.989  43.725 -86.597  1.00 42.06  ? 307 ARG B HB2    1 
ATOM   9861  H  HB3    . ARG B 1 327 ? 22.043  42.212 -86.124  1.00 42.06  ? 307 ARG B HB3    1 
ATOM   9862  H  HG2    . ARG B 1 327 ? 21.719  41.577 -88.397  1.00 38.59  ? 307 ARG B HG2    1 
ATOM   9863  H  HG3    . ARG B 1 327 ? 21.915  43.109 -88.788  1.00 38.59  ? 307 ARG B HG3    1 
ATOM   9864  H  HD2    . ARG B 1 327 ? 24.078  43.070 -87.997  1.00 40.31  ? 307 ARG B HD2    1 
ATOM   9865  H  HD3    . ARG B 1 327 ? 23.888  41.580 -87.474  1.00 40.31  ? 307 ARG B HD3    1 
ATOM   9866  H  HE     . ARG B 1 327 ? 24.358  42.280 -90.040  1.00 45.99  ? 307 ARG B HE     1 
ATOM   9867  H  HH11   . ARG B 1 327 ? 23.580  39.707 -88.105  1.00 51.57  ? 307 ARG B HH11   1 
ATOM   9868  H  HH12   . ARG B 1 327 ? 23.939  38.651 -89.092  1.00 51.57  ? 307 ARG B HH12   1 
ATOM   9869  H  HH21   . ARG B 1 327 ? 24.901  40.660 -91.522  1.00 50.76  ? 307 ARG B HH21   1 
ATOM   9870  H  HH22   . ARG B 1 327 ? 24.737  39.226 -91.154  1.00 50.76  ? 307 ARG B HH22   1 
ATOM   9871  N  N      . ASN B 1 328 ? 18.904  43.519 -88.605  1.00 43.85  ? 308 ASN B N      1 
ATOM   9872  C  CA     . ASN B 1 328 ? 18.345  44.479 -89.547  1.00 46.59  ? 308 ASN B CA     1 
ATOM   9873  C  C      . ASN B 1 328 ? 16.851  44.697 -89.349  1.00 46.68  ? 308 ASN B C      1 
ATOM   9874  O  O      . ASN B 1 328 ? 16.231  45.416 -90.140  1.00 50.15  ? 308 ASN B O      1 
ATOM   9875  C  CB     . ASN B 1 328 ? 18.620  44.023 -90.982  1.00 47.96  ? 308 ASN B CB     1 
ATOM   9876  C  CG     . ASN B 1 328 ? 20.085  44.129 -91.356  1.00 51.76  ? 308 ASN B CG     1 
ATOM   9877  O  OD1    . ASN B 1 328 ? 20.779  45.055 -90.937  1.00 54.67  ? 308 ASN B OD1    1 
ATOM   9878  N  ND2    . ASN B 1 328 ? 20.566  43.174 -92.142  1.00 53.06  ? 308 ASN B ND2    1 
ATOM   9879  H  H      . ASN B 1 328 ? 18.786  42.699 -88.835  1.00 52.73  ? 308 ASN B H      1 
ATOM   9880  H  HA     . ASN B 1 328 ? 18.787  45.333 -89.419  1.00 56.02  ? 308 ASN B HA     1 
ATOM   9881  H  HB2    . ASN B 1 328 ? 18.352  43.096 -91.077  1.00 57.67  ? 308 ASN B HB2    1 
ATOM   9882  H  HB3    . ASN B 1 328 ? 18.112  44.580 -91.594  1.00 57.67  ? 308 ASN B HB3    1 
ATOM   9883  H  HD21   . ASN B 1 328 ? 21.392  43.190 -92.382  1.00 63.79  ? 308 ASN B HD21   1 
ATOM   9884  H  HD22   . ASN B 1 328 ? 20.052  42.539 -92.411  1.00 63.79  ? 308 ASN B HD22   1 
ATOM   9885  N  N      . VAL B 1 329 ? 16.260  44.100 -88.317  1.00 45.33  ? 309 VAL B N      1 
ATOM   9886  C  CA     . VAL B 1 329 ? 14.843  44.281 -88.022  1.00 44.90  ? 309 VAL B CA     1 
ATOM   9887  C  C      . VAL B 1 329 ? 14.733  45.491 -87.100  1.00 44.28  ? 309 VAL B C      1 
ATOM   9888  O  O      . VAL B 1 329 ? 15.041  45.414 -85.910  1.00 40.33  ? 309 VAL B O      1 
ATOM   9889  C  CB     . VAL B 1 329 ? 14.223  43.030 -87.396  1.00 45.11  ? 309 VAL B CB     1 
ATOM   9890  C  CG1    . VAL B 1 329 ? 12.755  43.275 -87.058  1.00 46.86  ? 309 VAL B CG1    1 
ATOM   9891  C  CG2    . VAL B 1 329 ? 14.358  41.841 -88.336  1.00 43.04  ? 309 VAL B CG2    1 
ATOM   9892  H  H      . VAL B 1 329 ? 16.664  43.579 -87.766  1.00 54.52  ? 309 VAL B H      1 
ATOM   9893  H  HA     . VAL B 1 329 ? 14.366  44.478 -88.844  1.00 54.00  ? 309 VAL B HA     1 
ATOM   9894  H  HB     . VAL B 1 329 ? 14.692  42.820 -86.573  1.00 54.25  ? 309 VAL B HB     1 
ATOM   9895  H  HG11   . VAL B 1 329 ? 12.384  42.471 -86.663  1.00 56.34  ? 309 VAL B HG11   1 
ATOM   9896  H  HG12   . VAL B 1 329 ? 12.695  44.011 -86.429  1.00 56.34  ? 309 VAL B HG12   1 
ATOM   9897  H  HG13   . VAL B 1 329 ? 12.277  43.495 -87.872  1.00 56.34  ? 309 VAL B HG13   1 
ATOM   9898  H  HG21   . VAL B 1 329 ? 13.959  41.062 -87.918  1.00 51.77  ? 309 VAL B HG21   1 
ATOM   9899  H  HG22   . VAL B 1 329 ? 13.900  42.042 -89.167  1.00 51.77  ? 309 VAL B HG22   1 
ATOM   9900  H  HG23   . VAL B 1 329 ? 15.299  41.679 -88.508  1.00 51.77  ? 309 VAL B HG23   1 
ATOM   9901  N  N      . THR B 1 330 ? 14.287  46.612 -87.653  1.00 48.23  ? 310 THR B N      1 
ATOM   9902  C  CA     . THR B 1 330 ? 14.035  47.805 -86.863  1.00 48.83  ? 310 THR B CA     1 
ATOM   9903  C  C      . THR B 1 330 ? 12.704  47.656 -86.137  1.00 49.41  ? 310 THR B C      1 
ATOM   9904  O  O      . THR B 1 330 ? 11.927  46.741 -86.418  1.00 52.87  ? 310 THR B O      1 
ATOM   9905  C  CB     . THR B 1 330 ? 14.045  49.034 -87.769  1.00 48.96  ? 310 THR B CB     1 
ATOM   9906  O  OG1    . THR B 1 330 ? 12.955  48.960 -88.699  1.00 47.06  ? 310 THR B OG1    1 
ATOM   9907  C  CG2    . THR B 1 330 ? 15.364  49.121 -88.538  1.00 49.44  ? 310 THR B CG2    1 
ATOM   9908  H  H      . THR B 1 330 ? 14.122  46.706 -88.492  1.00 58.00  ? 310 THR B H      1 
ATOM   9909  H  HA     . THR B 1 330 ? 14.736  47.907 -86.200  1.00 58.72  ? 310 THR B HA     1 
ATOM   9910  H  HB     . THR B 1 330 ? 13.953  49.834 -87.228  1.00 58.87  ? 310 THR B HB     1 
ATOM   9911  H  HG1    . THR B 1 330 ? 12.958  49.635 -89.199  1.00 56.59  ? 310 THR B HG1    1 
ATOM   9912  H  HG21   . THR B 1 330 ? 15.363  49.904 -89.110  1.00 59.44  ? 310 THR B HG21   1 
ATOM   9913  H  HG22   . THR B 1 330 ? 16.106  49.187 -87.916  1.00 59.44  ? 310 THR B HG22   1 
ATOM   9914  H  HG23   . THR B 1 330 ? 15.481  48.330 -89.086  1.00 59.44  ? 310 THR B HG23   1 
ATOM   9915  N  N      . PRO B 1 331 ? 12.405  48.544 -85.185  1.00 44.59  ? 311 PRO B N      1 
ATOM   9916  C  CA     . PRO B 1 331 ? 11.092  48.463 -84.517  1.00 42.05  ? 311 PRO B CA     1 
ATOM   9917  C  C      . PRO B 1 331 ? 9.934   48.553 -85.495  1.00 42.58  ? 311 PRO B C      1 
ATOM   9918  O  O      . PRO B 1 331 ? 8.940   47.815 -85.386  1.00 40.24  ? 311 PRO B O      1 
ATOM   9919  C  CB     . PRO B 1 331 ? 11.119  49.667 -83.561  1.00 39.36  ? 311 PRO B CB     1 
ATOM   9920  C  CG     . PRO B 1 331 ? 12.579  49.983 -83.363  1.00 38.02  ? 311 PRO B CG     1 
ATOM   9921  C  CD     . PRO B 1 331 ? 13.243  49.633 -84.653  1.00 40.88  ? 311 PRO B CD     1 
ATOM   9922  H  HA     . PRO B 1 331 ? 11.022  47.643 -84.004  1.00 50.58  ? 311 PRO B HA     1 
ATOM   9923  H  HB2    . PRO B 1 331 ? 10.658  50.417 -83.968  1.00 47.35  ? 311 PRO B HB2    1 
ATOM   9924  H  HB3    . PRO B 1 331 ? 10.703  49.425 -82.719  1.00 47.35  ? 311 PRO B HB3    1 
ATOM   9925  H  HG2    . PRO B 1 331 ? 12.684  50.928 -83.170  1.00 45.74  ? 311 PRO B HG2    1 
ATOM   9926  H  HG3    . PRO B 1 331 ? 12.933  49.444 -82.638  1.00 45.74  ? 311 PRO B HG3    1 
ATOM   9927  H  HD2    . PRO B 1 331 ? 13.233  50.393 -85.255  1.00 49.17  ? 311 PRO B HD2    1 
ATOM   9928  H  HD3    . PRO B 1 331 ? 14.146  49.317 -84.493  1.00 49.17  ? 311 PRO B HD3    1 
ATOM   9929  N  N      . LEU B 1 332 ? 10.093  49.397 -86.511  1.00 46.06  ? 312 LEU B N      1 
ATOM   9930  C  CA     . LEU B 1 332 ? 9.032   49.631 -87.480  1.00 50.44  ? 312 LEU B CA     1 
ATOM   9931  C  C      . LEU B 1 332 ? 8.805   48.386 -88.338  1.00 50.12  ? 312 LEU B C      1 
ATOM   9932  O  O      . LEU B 1 332 ? 7.672   47.893 -88.461  1.00 51.66  ? 312 LEU B O      1 
ATOM   9933  C  CB     . LEU B 1 332 ? 9.410   50.858 -88.312  1.00 55.18  ? 312 LEU B CB     1 
ATOM   9934  C  CG     . LEU B 1 332 ? 8.322   51.836 -88.742  1.00 60.08  ? 312 LEU B CG     1 
ATOM   9935  C  CD1    . LEU B 1 332 ? 7.597   52.375 -87.510  1.00 61.38  ? 312 LEU B CD1    1 
ATOM   9936  C  CD2    . LEU B 1 332 ? 8.955   52.993 -89.494  1.00 61.17  ? 312 LEU B CD2    1 
ATOM   9937  H  H      . LEU B 1 332 ? 10.810  49.848 -86.661  1.00 55.39  ? 312 LEU B H      1 
ATOM   9938  H  HA     . LEU B 1 332 ? 8.207   49.827 -87.009  1.00 60.65  ? 312 LEU B HA     1 
ATOM   9939  H  HB2    . LEU B 1 332 ? 10.056  51.369 -87.801  1.00 66.33  ? 312 LEU B HB2    1 
ATOM   9940  H  HB3    . LEU B 1 332 ? 9.834   50.541 -89.125  1.00 66.33  ? 312 LEU B HB3    1 
ATOM   9941  H  HG     . LEU B 1 332 ? 7.682   51.393 -89.320  1.00 72.21  ? 312 LEU B HG     1 
ATOM   9942  H  HD11   . LEU B 1 332 ? 6.908   52.996 -87.795  1.00 73.78  ? 312 LEU B HD11   1 
ATOM   9943  H  HD12   . LEU B 1 332 ? 7.196   51.633 -87.030  1.00 73.78  ? 312 LEU B HD12   1 
ATOM   9944  H  HD13   . LEU B 1 332 ? 8.237   52.830 -86.941  1.00 73.78  ? 312 LEU B HD13   1 
ATOM   9945  H  HD21   . LEU B 1 332 ? 8.258   53.612 -89.765  1.00 73.53  ? 312 LEU B HD21   1 
ATOM   9946  H  HD22   . LEU B 1 332 ? 9.587   53.440 -88.910  1.00 73.53  ? 312 LEU B HD22   1 
ATOM   9947  H  HD23   . LEU B 1 332 ? 9.413   52.647 -90.276  1.00 73.53  ? 312 LEU B HD23   1 
ATOM   9948  N  N      . LYS B 1 333 ? 9.877   47.853 -88.932  1.00 48.96  ? 313 LYS B N      1 
ATOM   9949  C  CA     . LYS B 1 333 ? 9.756   46.617 -89.694  1.00 52.87  ? 313 LYS B CA     1 
ATOM   9950  C  C      . LYS B 1 333 ? 9.311   45.456 -88.818  1.00 55.57  ? 313 LYS B C      1 
ATOM   9951  O  O      . LYS B 1 333 ? 8.751   44.482 -89.335  1.00 56.64  ? 313 LYS B O      1 
ATOM   9952  C  CB     . LYS B 1 333 ? 11.078  46.275 -90.385  1.00 51.50  ? 313 LYS B CB     1 
ATOM   9953  C  CG     . LYS B 1 333 ? 11.511  47.288 -91.431  1.00 51.20  ? 313 LYS B CG     1 
ATOM   9954  C  CD     . LYS B 1 333 ? 12.855  46.927 -92.038  1.00 51.12  ? 313 LYS B CD     1 
ATOM   9955  C  CE     . LYS B 1 333 ? 13.293  47.965 -93.059  1.00 52.78  ? 313 LYS B CE     1 
ATOM   9956  N  NZ     . LYS B 1 333 ? 14.744  47.867 -93.373  1.00 53.61  ? 313 LYS B NZ     1 
ATOM   9957  H  H      . LYS B 1 333 ? 10.671  48.184 -88.907  1.00 58.87  ? 313 LYS B H      1 
ATOM   9958  H  HA     . LYS B 1 333 ? 9.085   46.740 -90.383  1.00 63.56  ? 313 LYS B HA     1 
ATOM   9959  H  HB2    . LYS B 1 333 ? 11.777  46.226 -89.714  1.00 61.92  ? 313 LYS B HB2    1 
ATOM   9960  H  HB3    . LYS B 1 333 ? 10.986  45.416 -90.826  1.00 61.92  ? 313 LYS B HB3    1 
ATOM   9961  H  HG2    . LYS B 1 333 ? 10.853  47.313 -92.143  1.00 61.56  ? 313 LYS B HG2    1 
ATOM   9962  H  HG3    . LYS B 1 333 ? 11.589  48.161 -91.016  1.00 61.56  ? 313 LYS B HG3    1 
ATOM   9963  H  HD2    . LYS B 1 333 ? 13.524  46.888 -91.337  1.00 61.46  ? 313 LYS B HD2    1 
ATOM   9964  H  HD3    . LYS B 1 333 ? 12.786  46.070 -92.486  1.00 61.46  ? 313 LYS B HD3    1 
ATOM   9965  H  HE2    . LYS B 1 333 ? 12.796  47.831 -93.881  1.00 63.45  ? 313 LYS B HE2    1 
ATOM   9966  H  HE3    . LYS B 1 333 ? 13.120  48.852 -92.705  1.00 63.45  ? 313 LYS B HE3    1 
ATOM   9967  H  HZ1    . LYS B 1 333 ? 14.968  48.486 -93.972  1.00 64.45  ? 313 LYS B HZ1    1 
ATOM   9968  H  HZ2    . LYS B 1 333 ? 15.224  47.991 -92.634  1.00 64.45  ? 313 LYS B HZ2    1 
ATOM   9969  H  HZ3    . LYS B 1 333 ? 14.929  47.062 -93.705  1.00 64.45  ? 313 LYS B HZ3    1 
ATOM   9970  N  N      . ARG B 1 334 ? 9.544   45.532 -87.506  1.00 56.25  ? 314 ARG B N      1 
ATOM   9971  C  CA     . ARG B 1 334 ? 8.947   44.550 -86.609  1.00 58.21  ? 314 ARG B CA     1 
ATOM   9972  C  C      . ARG B 1 334 ? 7.429   44.675 -86.611  1.00 57.69  ? 314 ARG B C      1 
ATOM   9973  O  O      . ARG B 1 334 ? 6.718   43.663 -86.673  1.00 56.36  ? 314 ARG B O      1 
ATOM   9974  C  CB     . ARG B 1 334 ? 9.508   44.708 -85.195  1.00 62.52  ? 314 ARG B CB     1 
ATOM   9975  C  CG     . ARG B 1 334 ? 8.675   44.042 -84.096  1.00 66.05  ? 314 ARG B CG     1 
ATOM   9976  C  CD     . ARG B 1 334 ? 9.502   43.105 -83.242  1.00 68.44  ? 314 ARG B CD     1 
ATOM   9977  N  NE     . ARG B 1 334 ? 8.897   42.903 -81.928  1.00 71.80  ? 314 ARG B NE     1 
ATOM   9978  C  CZ     . ARG B 1 334 ? 7.779   42.214 -81.710  1.00 73.65  ? 314 ARG B CZ     1 
ATOM   9979  N  NH1    . ARG B 1 334 ? 7.117   41.656 -82.719  1.00 75.99  ? 314 ARG B NH1    1 
ATOM   9980  N  NH2    . ARG B 1 334 ? 7.313   42.089 -80.476  1.00 69.82  ? 314 ARG B NH2    1 
ATOM   9981  H  H      . ARG B 1 334 ? 10.032  46.126 -87.121  1.00 67.61  ? 314 ARG B H      1 
ATOM   9982  H  HA     . ARG B 1 334 ? 9.173   43.660 -86.921  1.00 69.97  ? 314 ARG B HA     1 
ATOM   9983  H  HB2    . ARG B 1 334 ? 10.395  44.317 -85.169  1.00 75.14  ? 314 ARG B HB2    1 
ATOM   9984  H  HB3    . ARG B 1 334 ? 9.563   45.654 -84.988  1.00 75.14  ? 314 ARG B HB3    1 
ATOM   9985  H  HG2    . ARG B 1 334 ? 8.303   44.727 -83.519  1.00 79.38  ? 314 ARG B HG2    1 
ATOM   9986  H  HG3    . ARG B 1 334 ? 7.962   43.527 -84.505  1.00 79.38  ? 314 ARG B HG3    1 
ATOM   9987  H  HD2    . ARG B 1 334 ? 9.567   42.244 -83.683  1.00 82.25  ? 314 ARG B HD2    1 
ATOM   9988  H  HD3    . ARG B 1 334 ? 10.385  43.485 -83.114  1.00 82.25  ? 314 ARG B HD3    1 
ATOM   9989  H  HE     . ARG B 1 334 ? 9.290   43.253 -81.249  1.00 86.28  ? 314 ARG B HE     1 
ATOM   9990  H  HH11   . ARG B 1 334 ? 7.413   41.734 -83.522  1.00 91.31  ? 314 ARG B HH11   1 
ATOM   9991  H  HH12   . ARG B 1 334 ? 6.395   41.215 -82.567  1.00 91.31  ? 314 ARG B HH12   1 
ATOM   9992  H  HH21   . ARG B 1 334 ? 7.735   42.449 -79.818  1.00 83.90  ? 314 ARG B HH21   1 
ATOM   9993  H  HH22   . ARG B 1 334 ? 6.590   41.647 -80.332  1.00 83.90  ? 314 ARG B HH22   1 
ATOM   9994  N  N      . ASP B 1 335 ? 6.909   45.904 -86.549  1.00 59.21  ? 315 ASP B N      1 
ATOM   9995  C  CA     . ASP B 1 335 ? 5.468   46.072 -86.715  1.00 61.34  ? 315 ASP B CA     1 
ATOM   9996  C  C      . ASP B 1 335 ? 4.997   45.454 -88.030  1.00 62.29  ? 315 ASP B C      1 
ATOM   9997  O  O      . ASP B 1 335 ? 3.996   44.721 -88.060  1.00 62.41  ? 315 ASP B O      1 
ATOM   9998  C  CB     . ASP B 1 335 ? 5.091   47.553 -86.640  1.00 62.22  ? 315 ASP B CB     1 
ATOM   9999  C  CG     . ASP B 1 335 ? 5.235   48.118 -85.238  1.00 62.54  ? 315 ASP B CG     1 
ATOM   10000 O  OD1    . ASP B 1 335 ? 4.999   47.366 -84.267  1.00 61.04  ? 315 ASP B OD1    1 
ATOM   10001 O  OD2    . ASP B 1 335 ? 5.582   49.310 -85.104  1.00 63.88  ? 315 ASP B OD2    1 
ATOM   10002 H  H      . ASP B 1 335 ? 7.352   46.629 -86.416  1.00 71.17  ? 315 ASP B H      1 
ATOM   10003 H  HA     . ASP B 1 335 ? 5.014   45.612 -85.992  1.00 73.72  ? 315 ASP B HA     1 
ATOM   10004 H  HB2    . ASP B 1 335 ? 5.673   48.058 -87.229  1.00 74.79  ? 315 ASP B HB2    1 
ATOM   10005 H  HB3    . ASP B 1 335 ? 4.167   47.659 -86.914  1.00 74.79  ? 315 ASP B HB3    1 
ATOM   10006 N  N      . PHE B 1 336 ? 5.720   45.715 -89.126  1.00 61.52  ? 316 PHE B N      1 
ATOM   10007 C  CA     . PHE B 1 336 ? 5.365   45.096 -90.404  1.00 65.39  ? 316 PHE B CA     1 
ATOM   10008 C  C      . PHE B 1 336 ? 5.258   43.578 -90.265  1.00 54.00  ? 316 PHE B C      1 
ATOM   10009 O  O      . PHE B 1 336 ? 4.229   42.972 -90.606  1.00 48.88  ? 316 PHE B O      1 
ATOM   10010 C  CB     . PHE B 1 336 ? 6.407   45.451 -91.474  1.00 81.81  ? 316 PHE B CB     1 
ATOM   10011 C  CG     . PHE B 1 336 ? 6.467   46.918 -91.829  1.00 99.32  ? 316 PHE B CG     1 
ATOM   10012 C  CD1    . PHE B 1 336 ? 5.432   47.779 -91.510  1.00 107.03 ? 316 PHE B CD1    1 
ATOM   10013 C  CD2    . PHE B 1 336 ? 7.568   47.430 -92.501  1.00 106.16 ? 316 PHE B CD2    1 
ATOM   10014 C  CE1    . PHE B 1 336 ? 5.496   49.122 -91.846  1.00 110.87 ? 316 PHE B CE1    1 
ATOM   10015 C  CE2    . PHE B 1 336 ? 7.637   48.770 -92.837  1.00 110.13 ? 316 PHE B CE2    1 
ATOM   10016 C  CZ     . PHE B 1 336 ? 6.599   49.616 -92.509  1.00 111.76 ? 316 PHE B CZ     1 
ATOM   10017 H  H      . PHE B 1 336 ? 6.404   46.234 -89.155  1.00 73.94  ? 316 PHE B H      1 
ATOM   10018 H  HA     . PHE B 1 336 ? 4.504   45.436 -90.695  1.00 78.59  ? 316 PHE B HA     1 
ATOM   10019 H  HB2    . PHE B 1 336 ? 7.284   45.190 -91.152  1.00 98.29  ? 316 PHE B HB2    1 
ATOM   10020 H  HB3    . PHE B 1 336 ? 6.199   44.961 -92.285  1.00 98.29  ? 316 PHE B HB3    1 
ATOM   10021 H  HD1    . PHE B 1 336 ? 4.685   47.453 -91.062  1.00 128.55 ? 316 PHE B HD1    1 
ATOM   10022 H  HD2    . PHE B 1 336 ? 8.272   46.864 -92.724  1.00 127.51 ? 316 PHE B HD2    1 
ATOM   10023 H  HE1    . PHE B 1 336 ? 4.794   49.691 -91.623  1.00 133.16 ? 316 PHE B HE1    1 
ATOM   10024 H  HE2    . PHE B 1 336 ? 8.382   49.100 -93.285  1.00 132.27 ? 316 PHE B HE2    1 
ATOM   10025 H  HZ     . PHE B 1 336 ? 6.643   50.517 -92.735  1.00 134.22 ? 316 PHE B HZ     1 
ATOM   10026 N  N      . LEU B 1 337 ? 6.319   42.951 -89.748  1.00 49.30  ? 317 LEU B N      1 
ATOM   10027 C  CA     . LEU B 1 337 ? 6.321   41.504 -89.565  1.00 44.20  ? 317 LEU B CA     1 
ATOM   10028 C  C      . LEU B 1 337 ? 5.098   41.046 -88.789  1.00 35.75  ? 317 LEU B C      1 
ATOM   10029 O  O      . LEU B 1 337 ? 4.450   40.060 -89.161  1.00 29.83  ? 317 LEU B O      1 
ATOM   10030 C  CB     . LEU B 1 337 ? 7.598   41.071 -88.843  1.00 45.06  ? 317 LEU B CB     1 
ATOM   10031 C  CG     . LEU B 1 337 ? 7.677   39.599 -88.420  1.00 47.10  ? 317 LEU B CG     1 
ATOM   10032 C  CD1    . LEU B 1 337 ? 7.545   38.671 -89.617  1.00 47.59  ? 317 LEU B CD1    1 
ATOM   10033 C  CD2    . LEU B 1 337 ? 8.974   39.333 -87.671  1.00 47.21  ? 317 LEU B CD2    1 
ATOM   10034 H  H      . LEU B 1 337 ? 7.044   43.341 -89.498  1.00 59.28  ? 317 LEU B H      1 
ATOM   10035 H  HA     . LEU B 1 337 ? 6.306   41.074 -90.434  1.00 53.16  ? 317 LEU B HA     1 
ATOM   10036 H  HB2    . LEU B 1 337 ? 8.352   41.242 -89.429  1.00 54.19  ? 317 LEU B HB2    1 
ATOM   10037 H  HB3    . LEU B 1 337 ? 7.689   41.606 -88.039  1.00 54.19  ? 317 LEU B HB3    1 
ATOM   10038 H  HG     . LEU B 1 337 ? 6.942   39.409 -87.816  1.00 56.63  ? 317 LEU B HG     1 
ATOM   10039 H  HD11   . LEU B 1 337 ? 7.599   37.752 -89.311  1.00 57.22  ? 317 LEU B HD11   1 
ATOM   10040 H  HD12   . LEU B 1 337 ? 6.689   38.827 -90.045  1.00 57.22  ? 317 LEU B HD12   1 
ATOM   10041 H  HD13   . LEU B 1 337 ? 8.266   38.855 -90.240  1.00 57.22  ? 317 LEU B HD13   1 
ATOM   10042 H  HD21   . LEU B 1 337 ? 9.003   38.399 -87.414  1.00 56.77  ? 317 LEU B HD21   1 
ATOM   10043 H  HD22   . LEU B 1 337 ? 9.722   39.540 -88.253  1.00 56.77  ? 317 LEU B HD22   1 
ATOM   10044 H  HD23   . LEU B 1 337 ? 9.002   39.896 -86.881  1.00 56.77  ? 317 LEU B HD23   1 
ATOM   10045 N  N      . ARG B 1 338 ? 4.762   41.750 -87.708  1.00 37.62  ? 318 ARG B N      1 
ATOM   10046 C  CA     . ARG B 1 338 ? 3.601   41.361 -86.917  1.00 45.57  ? 318 ARG B CA     1 
ATOM   10047 C  C      . ARG B 1 338 ? 2.339   41.356 -87.771  1.00 49.79  ? 318 ARG B C      1 
ATOM   10048 O  O      . ARG B 1 338 ? 1.614   40.352 -87.828  1.00 49.01  ? 318 ARG B O      1 
ATOM   10049 C  CB     . ARG B 1 338 ? 3.437   42.303 -85.725  1.00 57.64  ? 318 ARG B CB     1 
ATOM   10050 C  CG     . ARG B 1 338 ? 2.972   41.592 -84.474  1.00 70.63  ? 318 ARG B CG     1 
ATOM   10051 C  CD     . ARG B 1 338 ? 2.155   42.489 -83.566  1.00 81.79  ? 318 ARG B CD     1 
ATOM   10052 N  NE     . ARG B 1 338 ? 1.489   41.704 -82.532  1.00 89.31  ? 318 ARG B NE     1 
ATOM   10053 C  CZ     . ARG B 1 338 ? 2.088   41.236 -81.441  1.00 94.00  ? 318 ARG B CZ     1 
ATOM   10054 N  NH1    . ARG B 1 338 ? 3.375   41.474 -81.226  1.00 95.48  ? 318 ARG B NH1    1 
ATOM   10055 N  NH2    . ARG B 1 338 ? 1.396   40.525 -80.562  1.00 95.55  ? 318 ARG B NH2    1 
ATOM   10056 H  H      . ARG B 1 338 ? 5.181   42.443 -87.419  1.00 45.26  ? 318 ARG B H      1 
ATOM   10057 H  HA     . ARG B 1 338 ? 3.737   40.464 -86.575  1.00 54.81  ? 318 ARG B HA     1 
ATOM   10058 H  HB2    . ARG B 1 338 ? 4.291   42.720 -85.533  1.00 69.28  ? 318 ARG B HB2    1 
ATOM   10059 H  HB3    . ARG B 1 338 ? 2.779   42.980 -85.947  1.00 69.28  ? 318 ARG B HB3    1 
ATOM   10060 H  HG2    . ARG B 1 338 ? 2.419   40.836 -84.727  1.00 84.87  ? 318 ARG B HG2    1 
ATOM   10061 H  HG3    . ARG B 1 338 ? 3.746   41.286 -83.977  1.00 84.87  ? 318 ARG B HG3    1 
ATOM   10062 H  HD2    . ARG B 1 338 ? 2.740   43.131 -83.135  1.00 98.27  ? 318 ARG B HD2    1 
ATOM   10063 H  HD3    . ARG B 1 338 ? 1.477   42.946 -84.088  1.00 98.27  ? 318 ARG B HD3    1 
ATOM   10064 H  HE     . ARG B 1 338 ? 0.653   41.532 -82.635  1.00 107.29 ? 318 ARG B HE     1 
ATOM   10065 H  HH11   . ARG B 1 338 ? 3.828   41.934 -81.795  1.00 114.70 ? 318 ARG B HH11   1 
ATOM   10066 H  HH12   . ARG B 1 338 ? 3.757   41.170 -80.519  1.00 114.70 ? 318 ARG B HH12   1 
ATOM   10067 H  HH21   . ARG B 1 338 ? 0.561   40.369 -80.696  1.00 114.78 ? 318 ARG B HH21   1 
ATOM   10068 H  HH22   . ARG B 1 338 ? 1.782   40.224 -79.854  1.00 114.78 ? 318 ARG B HH22   1 
ATOM   10069 N  N      . ARG B 1 339 ? 2.067   42.470 -88.456  1.00 53.92  ? 319 ARG B N      1 
ATOM   10070 C  CA     . ARG B 1 339 ? 0.839   42.554 -89.241  1.00 56.95  ? 319 ARG B CA     1 
ATOM   10071 C  C      . ARG B 1 339 ? 0.762   41.423 -90.261  1.00 56.70  ? 319 ARG B C      1 
ATOM   10072 O  O      . ARG B 1 339 ? -0.296  40.798 -90.426  1.00 52.11  ? 319 ARG B O      1 
ATOM   10073 C  CB     . ARG B 1 339 ? 0.737   43.918 -89.920  1.00 64.08  ? 319 ARG B CB     1 
ATOM   10074 C  CG     . ARG B 1 339 ? 0.654   45.060 -88.919  1.00 71.96  ? 319 ARG B CG     1 
ATOM   10075 C  CD     . ARG B 1 339 ? 0.251   46.378 -89.553  1.00 80.61  ? 319 ARG B CD     1 
ATOM   10076 N  NE     . ARG B 1 339 ? 1.179   47.445 -89.186  1.00 87.07  ? 319 ARG B NE     1 
ATOM   10077 C  CZ     . ARG B 1 339 ? 2.144   47.916 -89.972  1.00 92.67  ? 319 ARG B CZ     1 
ATOM   10078 N  NH1    . ARG B 1 339 ? 2.318   47.430 -91.193  1.00 94.85  ? 319 ARG B NH1    1 
ATOM   10079 N  NH2    . ARG B 1 339 ? 2.939   48.882 -89.533  1.00 94.49  ? 319 ARG B NH2    1 
ATOM   10080 H  H      . ARG B 1 339 ? 2.563   43.172 -88.482  1.00 64.83  ? 319 ARG B H      1 
ATOM   10081 H  HA     . ARG B 1 339 ? 0.081   42.464 -88.643  1.00 68.46  ? 319 ARG B HA     1 
ATOM   10082 H  HB2    . ARG B 1 339 ? 1.522   44.058 -90.471  1.00 77.01  ? 319 ARG B HB2    1 
ATOM   10083 H  HB3    . ARG B 1 339 ? -0.063  43.940 -90.468  1.00 77.01  ? 319 ARG B HB3    1 
ATOM   10084 H  HG2    . ARG B 1 339 ? -0.006  44.839 -88.244  1.00 86.47  ? 319 ARG B HG2    1 
ATOM   10085 H  HG3    . ARG B 1 339 ? 1.523   45.180 -88.506  1.00 86.47  ? 319 ARG B HG3    1 
ATOM   10086 H  HD2    . ARG B 1 339 ? 0.259   46.286 -90.519  1.00 96.85  ? 319 ARG B HD2    1 
ATOM   10087 H  HD3    . ARG B 1 339 ? -0.635  46.625 -89.246  1.00 96.85  ? 319 ARG B HD3    1 
ATOM   10088 H  HE     . ARG B 1 339 ? 1.095   47.794 -88.405  1.00 104.61 ? 319 ARG B HE     1 
ATOM   10089 H  HH11   . ARG B 1 339 ? 1.807   46.802 -91.483  1.00 113.93 ? 319 ARG B HH11   1 
ATOM   10090 H  HH12   . ARG B 1 339 ? 2.943   47.742 -91.694  1.00 113.93 ? 319 ARG B HH12   1 
ATOM   10091 H  HH21   . ARG B 1 339 ? 2.830   49.204 -88.743  1.00 113.51 ? 319 ARG B HH21   1 
ATOM   10092 H  HH22   . ARG B 1 339 ? 3.560   49.192 -90.040  1.00 113.51 ? 319 ARG B HH22   1 
ATOM   10093 N  N      . HIS B 1 340 ? 1.869   41.133 -90.955  1.00 59.89  ? 320 HIS B N      1 
ATOM   10094 C  CA     . HIS B 1 340 ? 1.830   40.041 -91.927  1.00 56.42  ? 320 HIS B CA     1 
ATOM   10095 C  C      . HIS B 1 340 ? 1.575   38.702 -91.244  1.00 51.81  ? 320 HIS B C      1 
ATOM   10096 O  O      . HIS B 1 340 ? 0.813   37.871 -91.757  1.00 51.03  ? 320 HIS B O      1 
ATOM   10097 C  CB     . HIS B 1 340 ? 3.123   39.995 -92.739  1.00 54.54  ? 320 HIS B CB     1 
ATOM   10098 C  CG     . HIS B 1 340 ? 3.118   40.906 -93.925  1.00 55.89  ? 320 HIS B CG     1 
ATOM   10099 N  ND1    . HIS B 1 340 ? 2.404   40.625 -95.070  1.00 56.95  ? 320 HIS B ND1    1 
ATOM   10100 C  CD2    . HIS B 1 340 ? 3.732   42.093 -94.146  1.00 56.55  ? 320 HIS B CD2    1 
ATOM   10101 C  CE1    . HIS B 1 340 ? 2.580   41.597 -95.947  1.00 58.11  ? 320 HIS B CE1    1 
ATOM   10102 N  NE2    . HIS B 1 340 ? 3.382   42.500 -95.411  1.00 57.66  ? 320 HIS B NE2    1 
ATOM   10103 H  H      . HIS B 1 340 ? 2.625   41.537 -90.885  1.00 71.98  ? 320 HIS B H      1 
ATOM   10104 H  HA     . HIS B 1 340 ? 1.100   40.201 -92.545  1.00 67.83  ? 320 HIS B HA     1 
ATOM   10105 H  HB2    . HIS B 1 340 ? 3.862   40.256 -92.167  1.00 65.56  ? 320 HIS B HB2    1 
ATOM   10106 H  HB3    . HIS B 1 340 ? 3.259   39.090 -93.060  1.00 65.56  ? 320 HIS B HB3    1 
ATOM   10107 H  HD2    . HIS B 1 340 ? 4.287   42.546 -93.554  1.00 67.98  ? 320 HIS B HD2    1 
ATOM   10108 H  HE1    . HIS B 1 340 ? 2.204   41.639 -96.796  1.00 69.85  ? 320 HIS B HE1    1 
ATOM   10109 H  HE2    . HIS B 1 340 ? 3.642   43.226 -95.792  1.00 69.31  ? 320 HIS B HE2    1 
ATOM   10110 N  N      . LEU B 1 341 ? 2.187   38.479 -90.078  1.00 48.50  ? 321 LEU B N      1 
ATOM   10111 C  CA     . LEU B 1 341 ? 1.882   37.273 -89.316  1.00 46.03  ? 321 LEU B CA     1 
ATOM   10112 C  C      . LEU B 1 341 ? 0.385   37.163 -89.062  1.00 44.81  ? 321 LEU B C      1 
ATOM   10113 O  O      . LEU B 1 341 ? -0.180  36.064 -89.100  1.00 33.18  ? 321 LEU B O      1 
ATOM   10114 C  CB     . LEU B 1 341 ? 2.653   37.265 -87.994  1.00 45.09  ? 321 LEU B CB     1 
ATOM   10115 C  CG     . LEU B 1 341 ? 4.170   37.062 -88.060  1.00 41.71  ? 321 LEU B CG     1 
ATOM   10116 C  CD1    . LEU B 1 341 ? 4.769   37.177 -86.670  1.00 39.60  ? 321 LEU B CD1    1 
ATOM   10117 C  CD2    . LEU B 1 341 ? 4.528   35.721 -88.684  1.00 39.55  ? 321 LEU B CD2    1 
ATOM   10118 H  H      . LEU B 1 341 ? 2.769   38.999 -89.716  1.00 58.32  ? 321 LEU B H      1 
ATOM   10119 H  HA     . LEU B 1 341 ? 2.157   36.497 -89.828  1.00 55.35  ? 321 LEU B HA     1 
ATOM   10120 H  HB2    . LEU B 1 341 ? 2.500   38.114 -87.552  1.00 54.23  ? 321 LEU B HB2    1 
ATOM   10121 H  HB3    . LEU B 1 341 ? 2.295   36.551 -87.443  1.00 54.23  ? 321 LEU B HB3    1 
ATOM   10122 H  HG     . LEU B 1 341 ? 4.556   37.760 -88.611  1.00 50.17  ? 321 LEU B HG     1 
ATOM   10123 H  HD11   . LEU B 1 341 ? 5.729   37.046 -86.728  1.00 47.63  ? 321 LEU B HD11   1 
ATOM   10124 H  HD12   . LEU B 1 341 ? 4.576   38.059 -86.315  1.00 47.63  ? 321 LEU B HD12   1 
ATOM   10125 H  HD13   . LEU B 1 341 ? 4.377   36.497 -86.100  1.00 47.63  ? 321 LEU B HD13   1 
ATOM   10126 H  HD21   . LEU B 1 341 ? 5.494   35.632 -88.707  1.00 47.58  ? 321 LEU B HD21   1 
ATOM   10127 H  HD22   . LEU B 1 341 ? 4.143   35.010 -88.147  1.00 47.58  ? 321 LEU B HD22   1 
ATOM   10128 H  HD23   . LEU B 1 341 ? 4.171   35.686 -89.585  1.00 47.58  ? 321 LEU B HD23   1 
ATOM   10129 N  N      . GLU B 1 342 ? -0.276  38.294 -88.801  1.00 57.18  ? 322 GLU B N      1 
ATOM   10130 C  CA     . GLU B 1 342 ? -1.721  38.268 -88.592  1.00 66.55  ? 322 GLU B CA     1 
ATOM   10131 C  C      . GLU B 1 342 ? -2.466  37.925 -89.879  1.00 62.86  ? 322 GLU B C      1 
ATOM   10132 O  O      . GLU B 1 342 ? -3.406  37.122 -89.859  1.00 64.33  ? 322 GLU B O      1 
ATOM   10133 C  CB     . GLU B 1 342 ? -2.195  39.607 -88.033  1.00 71.43  ? 322 GLU B CB     1 
ATOM   10134 C  CG     . GLU B 1 342 ? -1.799  39.829 -86.584  1.00 73.58  ? 322 GLU B CG     1 
ATOM   10135 C  CD     . GLU B 1 342 ? -2.060  41.246 -86.116  1.00 76.50  ? 322 GLU B CD     1 
ATOM   10136 O  OE1    . GLU B 1 342 ? -2.345  42.113 -86.969  1.00 77.20  ? 322 GLU B OE1    1 
ATOM   10137 O  OE2    . GLU B 1 342 ? -1.982  41.492 -84.893  1.00 77.50  ? 322 GLU B OE2    1 
ATOM   10138 H  H      . GLU B 1 342 ? 0.083   39.073 -88.741  1.00 68.74  ? 322 GLU B H      1 
ATOM   10139 H  HA     . GLU B 1 342 ? -1.929  37.583 -87.937  1.00 79.98  ? 322 GLU B HA     1 
ATOM   10140 H  HB2    . GLU B 1 342 ? -1.808  40.322 -88.561  1.00 85.84  ? 322 GLU B HB2    1 
ATOM   10141 H  HB3    . GLU B 1 342 ? -3.163  39.644 -88.086  1.00 85.84  ? 322 GLU B HB3    1 
ATOM   10142 H  HG2    . GLU B 1 342 ? -2.312  39.228 -86.021  1.00 88.41  ? 322 GLU B HG2    1 
ATOM   10143 H  HG3    . GLU B 1 342 ? -0.851  39.649 -86.485  1.00 88.41  ? 322 GLU B HG3    1 
ATOM   10144 N  N      . LYS B 1 343 ? -2.067  38.520 -91.008  1.00 53.10  ? 323 LYS B N      1 
ATOM   10145 C  CA     . LYS B 1 343 ? -2.763  38.243 -92.264  1.00 53.71  ? 323 LYS B CA     1 
ATOM   10146 C  C      . LYS B 1 343 ? -2.627  36.782 -92.674  1.00 53.60  ? 323 LYS B C      1 
ATOM   10147 O  O      . LYS B 1 343 ? -3.523  36.229 -93.330  1.00 48.09  ? 323 LYS B O      1 
ATOM   10148 C  CB     . LYS B 1 343 ? -2.218  39.136 -93.381  1.00 61.77  ? 323 LYS B CB     1 
ATOM   10149 C  CG     . LYS B 1 343 ? -2.948  40.452 -93.571  1.00 71.06  ? 323 LYS B CG     1 
ATOM   10150 C  CD     . LYS B 1 343 ? -2.252  41.308 -94.623  1.00 78.96  ? 323 LYS B CD     1 
ATOM   10151 C  CE     . LYS B 1 343 ? -3.232  41.851 -95.654  1.00 84.40  ? 323 LYS B CE     1 
ATOM   10152 N  NZ     . LYS B 1 343 ? -3.829  40.773 -96.494  1.00 84.56  ? 323 LYS B NZ     1 
ATOM   10153 H  H      . LYS B 1 343 ? -1.412  39.073 -91.072  1.00 63.84  ? 323 LYS B H      1 
ATOM   10154 H  HA     . LYS B 1 343 ? -3.707  38.439 -92.154  1.00 64.57  ? 323 LYS B HA     1 
ATOM   10155 H  HB2    . LYS B 1 343 ? -1.291  39.342 -93.186  1.00 74.24  ? 323 LYS B HB2    1 
ATOM   10156 H  HB3    . LYS B 1 343 ? -2.273  38.649 -94.219  1.00 74.24  ? 323 LYS B HB3    1 
ATOM   10157 H  HG2    . LYS B 1 343 ? -3.855  40.279 -93.868  1.00 85.39  ? 323 LYS B HG2    1 
ATOM   10158 H  HG3    . LYS B 1 343 ? -2.954  40.941 -92.733  1.00 85.39  ? 323 LYS B HG3    1 
ATOM   10159 H  HD2    . LYS B 1 343 ? -1.822  42.061 -94.188  1.00 94.87  ? 323 LYS B HD2    1 
ATOM   10160 H  HD3    . LYS B 1 343 ? -1.592  40.769 -95.087  1.00 94.87  ? 323 LYS B HD3    1 
ATOM   10161 H  HE2    . LYS B 1 343 ? -3.953  42.310 -95.195  1.00 101.39 ? 323 LYS B HE2    1 
ATOM   10162 H  HE3    . LYS B 1 343 ? -2.766  42.467 -96.241  1.00 101.39 ? 323 LYS B HE3    1 
ATOM   10163 H  HZ1    . LYS B 1 343 ? -4.395  41.125 -97.084  1.00 101.59 ? 323 LYS B HZ1    1 
ATOM   10164 H  HZ2    . LYS B 1 343 ? -3.188  40.339 -96.933  1.00 101.59 ? 323 LYS B HZ2    1 
ATOM   10165 H  HZ3    . LYS B 1 343 ? -4.270  40.196 -95.980  1.00 101.59 ? 323 LYS B HZ3    1 
ATOM   10166 N  N      . ALA B 1 344 ? -1.522  36.138 -92.290  1.00 59.52  ? 324 ALA B N      1 
ATOM   10167 C  CA     . ALA B 1 344 ? -1.270  34.779 -92.752  1.00 58.60  ? 324 ALA B CA     1 
ATOM   10168 C  C      . ALA B 1 344 ? -2.331  33.805 -92.251  1.00 54.96  ? 324 ALA B C      1 
ATOM   10169 O  O      . ALA B 1 344 ? -2.675  32.850 -92.958  1.00 51.27  ? 324 ALA B O      1 
ATOM   10170 C  CB     . ALA B 1 344 ? 0.124   34.331 -92.312  1.00 56.14  ? 324 ALA B CB     1 
ATOM   10171 H  H      . ALA B 1 344 ? -0.916  36.462 -91.774  1.00 71.55  ? 324 ALA B H      1 
ATOM   10172 H  HA     . ALA B 1 344 ? -1.293  34.768 -93.722  1.00 70.43  ? 324 ALA B HA     1 
ATOM   10173 H  HB1    . ALA B 1 344 ? 0.278   33.426 -92.626  1.00 67.49  ? 324 ALA B HB1    1 
ATOM   10174 H  HB2    . ALA B 1 344 ? 0.783   34.930 -92.695  1.00 67.49  ? 324 ALA B HB2    1 
ATOM   10175 H  HB3    . ALA B 1 344 ? 0.173   34.358 -91.344  1.00 67.49  ? 324 ALA B HB3    1 
ATOM   10176 N  N      . ARG B 1 345 ? -2.861  34.019 -91.042  1.00 56.23  ? 325 ARG B N      1 
ATOM   10177 C  CA     . ARG B 1 345 ? -3.813  33.063 -90.485  1.00 58.22  ? 325 ARG B CA     1 
ATOM   10178 C  C      . ARG B 1 345 ? -5.127  33.061 -91.252  1.00 67.52  ? 325 ARG B C      1 
ATOM   10179 O  O      . ARG B 1 345 ? -5.823  32.039 -91.284  1.00 63.86  ? 325 ARG B O      1 
ATOM   10180 C  CB     . ARG B 1 345 ? -4.105  33.387 -89.021  1.00 56.29  ? 325 ARG B CB     1 
ATOM   10181 C  CG     . ARG B 1 345 ? -2.895  33.481 -88.116  1.00 56.98  ? 325 ARG B CG     1 
ATOM   10182 C  CD     . ARG B 1 345 ? -3.300  34.030 -86.754  1.00 59.28  ? 325 ARG B CD     1 
ATOM   10183 N  NE     . ARG B 1 345 ? -3.842  35.384 -86.857  1.00 61.03  ? 325 ARG B NE     1 
ATOM   10184 C  CZ     . ARG B 1 345 ? -4.457  36.026 -85.869  1.00 62.26  ? 325 ARG B CZ     1 
ATOM   10185 N  NH1    . ARG B 1 345 ? -4.617  35.445 -84.687  1.00 62.36  ? 325 ARG B NH1    1 
ATOM   10186 N  NH2    . ARG B 1 345 ? -4.915  37.255 -86.064  1.00 63.74  ? 325 ARG B NH2    1 
ATOM   10187 H  H      . ARG B 1 345 ? -2.689  34.695 -90.537  1.00 67.59  ? 325 ARG B H      1 
ATOM   10188 H  HA     . ARG B 1 345 ? -3.434  32.171 -90.529  1.00 69.98  ? 325 ARG B HA     1 
ATOM   10189 H  HB2    . ARG B 1 345 ? -4.563  34.241 -88.982  1.00 67.66  ? 325 ARG B HB2    1 
ATOM   10190 H  HB3    . ARG B 1 345 ? -4.682  32.695 -88.663  1.00 67.66  ? 325 ARG B HB3    1 
ATOM   10191 H  HG2    . ARG B 1 345 ? -2.514  32.598 -87.992  1.00 68.49  ? 325 ARG B HG2    1 
ATOM   10192 H  HG3    . ARG B 1 345 ? -2.242  34.082 -88.509  1.00 68.49  ? 325 ARG B HG3    1 
ATOM   10193 H  HD2    . ARG B 1 345 ? -3.983  33.458 -86.370  1.00 71.26  ? 325 ARG B HD2    1 
ATOM   10194 H  HD3    . ARG B 1 345 ? -2.521  34.058 -86.177  1.00 71.26  ? 325 ARG B HD3    1 
ATOM   10195 H  HE     . ARG B 1 345 ? -3.756  35.793 -87.608  1.00 73.35  ? 325 ARG B HE     1 
ATOM   10196 H  HH11   . ARG B 1 345 ? -4.322  34.648 -84.557  1.00 74.95  ? 325 ARG B HH11   1 
ATOM   10197 H  HH12   . ARG B 1 345 ? -5.016  35.865 -84.052  1.00 74.95  ? 325 ARG B HH12   1 
ATOM   10198 H  HH21   . ARG B 1 345 ? -4.814  37.636 -86.829  1.00 76.61  ? 325 ARG B HH21   1 
ATOM   10199 H  HH22   . ARG B 1 345 ? -5.313  37.672 -85.426  1.00 76.61  ? 325 ARG B HH22   1 
ATOM   10200 N  N      . ASP B 1 346 ? -5.480  34.183 -91.877  1.00 79.38  ? 326 ASP B N      1 
ATOM   10201 C  CA     . ASP B 1 346 ? -6.729  34.295 -92.616  1.00 88.14  ? 326 ASP B CA     1 
ATOM   10202 C  C      . ASP B 1 346 ? -6.563  34.079 -94.110  1.00 85.02  ? 326 ASP B C      1 
ATOM   10203 O  O      . ASP B 1 346 ? -7.525  33.681 -94.775  1.00 88.15  ? 326 ASP B O      1 
ATOM   10204 C  CB     . ASP B 1 346 ? -7.368  35.668 -92.376  1.00 93.76  ? 326 ASP B CB     1 
ATOM   10205 C  CG     . ASP B 1 346 ? -7.794  35.867 -90.934  1.00 95.16  ? 326 ASP B CG     1 
ATOM   10206 O  OD1    . ASP B 1 346 ? -8.708  35.147 -90.479  1.00 96.10  ? 326 ASP B OD1    1 
ATOM   10207 O  OD2    . ASP B 1 346 ? -7.216  36.741 -90.256  1.00 94.18  ? 326 ASP B OD2    1 
ATOM   10208 H  H      . ASP B 1 346 ? -5.005  34.900 -91.886  1.00 95.37  ? 326 ASP B H      1 
ATOM   10209 H  HA     . ASP B 1 346 ? -7.345  33.622 -92.288  1.00 105.89 ? 326 ASP B HA     1 
ATOM   10210 H  HB2    . ASP B 1 346 ? -6.724  36.359 -92.597  1.00 112.63 ? 326 ASP B HB2    1 
ATOM   10211 H  HB3    . ASP B 1 346 ? -8.154  35.754 -92.937  1.00 112.63 ? 326 ASP B HB3    1 
ATOM   10212 N  N      . THR B 1 347 ? -5.372  34.325 -94.656  1.00 75.95  ? 327 THR B N      1 
ATOM   10213 C  CA     . THR B 1 347 ? -5.132  34.133 -96.079  1.00 73.09  ? 327 THR B CA     1 
ATOM   10214 C  C      . THR B 1 347 ? -4.436  32.816 -96.396  1.00 68.78  ? 327 THR B C      1 
ATOM   10215 O  O      . THR B 1 347 ? -4.197  32.528 -97.573  1.00 66.74  ? 327 THR B O      1 
ATOM   10216 C  CB     . THR B 1 347 ? -4.295  35.291 -96.628  1.00 76.48  ? 327 THR B CB     1 
ATOM   10217 O  OG1    . THR B 1 347 ? -3.003  35.276 -96.008  1.00 76.56  ? 327 THR B OG1    1 
ATOM   10218 C  CG2    . THR B 1 347 ? -4.974  36.625 -96.351  1.00 79.28  ? 327 THR B CG2    1 
ATOM   10219 H  H      . THR B 1 347 ? -4.687  34.605 -94.219  1.00 91.26  ? 327 THR B H      1 
ATOM   10220 H  HA     . THR B 1 347 ? -5.984  34.137 -96.543  1.00 87.83  ? 327 THR B HA     1 
ATOM   10221 H  HB     . THR B 1 347 ? -4.194  35.190 -97.587  1.00 91.90  ? 327 THR B HB     1 
ATOM   10222 H  HG1    . THR B 1 347 ? -3.082  35.361 -95.176  1.00 91.99  ? 327 THR B HG1    1 
ATOM   10223 H  HG21   . THR B 1 347 ? -4.435  37.351 -96.703  1.00 95.25  ? 327 THR B HG21   1 
ATOM   10224 H  HG22   . THR B 1 347 ? -5.847  36.647 -96.775  1.00 95.25  ? 327 THR B HG22   1 
ATOM   10225 H  HG23   . THR B 1 347 ? -5.085  36.749 -95.395  1.00 95.25  ? 327 THR B HG23   1 
ATOM   10226 N  N      . ALA B 1 348 ? -4.114  32.010 -95.387  1.00 67.54  ? 328 ALA B N      1 
ATOM   10227 C  CA     . ALA B 1 348 ? -3.424  30.738 -95.581  1.00 65.01  ? 328 ALA B CA     1 
ATOM   10228 C  C      . ALA B 1 348 ? -2.153  30.935 -96.409  1.00 61.33  ? 328 ALA B C      1 
ATOM   10229 O  O      . ALA B 1 348 ? -1.948  30.316 -97.454  1.00 61.58  ? 328 ALA B O      1 
ATOM   10230 C  CB     . ALA B 1 348 ? -4.352  29.710 -96.232  1.00 66.69  ? 328 ALA B CB     1 
ATOM   10231 H  H      . ALA B 1 348 ? -4.289  32.183 -94.563  1.00 81.17  ? 328 ALA B H      1 
ATOM   10232 H  HA     . ALA B 1 348 ? -3.161  30.391 -94.715  1.00 78.13  ? 328 ALA B HA     1 
ATOM   10233 H  HB1    . ALA B 1 348 ? -3.868  28.877 -96.349  1.00 80.14  ? 328 ALA B HB1    1 
ATOM   10234 H  HB2    . ALA B 1 348 ? -5.120  29.569 -95.656  1.00 80.14  ? 328 ALA B HB2    1 
ATOM   10235 H  HB3    . ALA B 1 348 ? -4.642  30.048 -97.094  1.00 80.14  ? 328 ALA B HB3    1 
ATOM   10236 N  N      . LEU B 1 349 ? -1.292  31.822 -95.912  1.00 59.25  ? 329 LEU B N      1 
ATOM   10237 C  CA     . LEU B 1 349 ? -0.022  32.136 -96.567  1.00 56.84  ? 329 LEU B CA     1 
ATOM   10238 C  C      . LEU B 1 349 ? -0.242  32.627 -97.997  1.00 59.05  ? 329 LEU B C      1 
ATOM   10239 O  O      . LEU B 1 349 ? 0.520   32.299 -98.909  1.00 57.92  ? 329 LEU B O      1 
ATOM   10240 C  CB     . LEU B 1 349 ? 0.916   30.925 -96.546  1.00 56.85  ? 329 LEU B CB     1 
ATOM   10241 C  CG     . LEU B 1 349 ? 1.341   30.415 -95.163  1.00 54.87  ? 329 LEU B CG     1 
ATOM   10242 C  CD1    . LEU B 1 349 ? 2.123   29.113 -95.285  1.00 53.06  ? 329 LEU B CD1    1 
ATOM   10243 C  CD2    . LEU B 1 349 ? 2.164   31.458 -94.421  1.00 53.45  ? 329 LEU B CD2    1 
ATOM   10244 H  H      . LEU B 1 349 ? -1.423  32.263 -95.185  1.00 71.21  ? 329 LEU B H      1 
ATOM   10245 H  HA     . LEU B 1 349 ? 0.411   32.851 -96.074  1.00 68.33  ? 329 LEU B HA     1 
ATOM   10246 H  HB2    . LEU B 1 349 ? 0.474   30.191 -97.000  1.00 68.34  ? 329 LEU B HB2    1 
ATOM   10247 H  HB3    . LEU B 1 349 ? 1.725   31.160 -97.027  1.00 68.34  ? 329 LEU B HB3    1 
ATOM   10248 H  HG     . LEU B 1 349 ? 0.546   30.235 -94.638  1.00 65.96  ? 329 LEU B HG     1 
ATOM   10249 H  HD11   . LEU B 1 349 ? 2.378   28.814 -94.398  1.00 63.79  ? 329 LEU B HD11   1 
ATOM   10250 H  HD12   . LEU B 1 349 ? 1.561   28.446 -95.710  1.00 63.79  ? 329 LEU B HD12   1 
ATOM   10251 H  HD13   . LEU B 1 349 ? 2.915   29.270 -95.822  1.00 63.79  ? 329 LEU B HD13   1 
ATOM   10252 H  HD21   . LEU B 1 349 ? 2.416   31.103 -93.554  1.00 64.26  ? 329 LEU B HD21   1 
ATOM   10253 H  HD22   . LEU B 1 349 ? 2.959   31.659 -94.940  1.00 64.26  ? 329 LEU B HD22   1 
ATOM   10254 H  HD23   . LEU B 1 349 ? 1.630   32.260 -94.309  1.00 64.26  ? 329 LEU B HD23   1 
ATOM   10255 N  N      . LEU B 1 350 ? -1.296  33.421 -98.197  1.00 65.26  ? 330 LEU B N      1 
ATOM   10256 C  CA     . LEU B 1 350 ? -1.580  34.052 -99.491  1.00 69.66  ? 330 LEU B CA     1 
ATOM   10257 C  C      . LEU B 1 350 ? -1.811  33.018 -100.595 1.00 74.12  ? 330 LEU B C      1 
ATOM   10258 O  O      . LEU B 1 350 ? -1.246  33.108 -101.687 1.00 75.72  ? 330 LEU B O      1 
ATOM   10259 C  CB     . LEU B 1 350 ? -0.469  35.033 -99.888  1.00 66.09  ? 330 LEU B CB     1 
ATOM   10260 C  CG     . LEU B 1 350 ? -0.478  36.435 -99.267  1.00 63.91  ? 330 LEU B CG     1 
ATOM   10261 C  CD1    . LEU B 1 350 ? -0.957  36.437 -97.828  1.00 63.42  ? 330 LEU B CD1    1 
ATOM   10262 C  CD2    . LEU B 1 350 ? 0.898   37.075 -99.374  1.00 62.52  ? 330 LEU B CD2    1 
ATOM   10263 H  H      . LEU B 1 350 ? -1.873  33.613 -97.588  1.00 78.43  ? 330 LEU B H      1 
ATOM   10264 H  HA     . LEU B 1 350 ? -2.398  34.565 -99.404  1.00 83.71  ? 330 LEU B HA     1 
ATOM   10265 H  HB2    . LEU B 1 350 ? 0.381   34.628 -99.655  1.00 79.43  ? 330 LEU B HB2    1 
ATOM   10266 H  HB3    . LEU B 1 350 ? -0.509  35.152 -100.850 1.00 79.43  ? 330 LEU B HB3    1 
ATOM   10267 H  HG     . LEU B 1 350 ? -1.093  36.988 -99.775  1.00 76.81  ? 330 LEU B HG     1 
ATOM   10268 H  HD11   . LEU B 1 350 ? -0.940  37.347 -97.491  1.00 76.22  ? 330 LEU B HD11   1 
ATOM   10269 H  HD12   . LEU B 1 350 ? -1.861  36.088 -97.795  1.00 76.22  ? 330 LEU B HD12   1 
ATOM   10270 H  HD13   . LEU B 1 350 ? -0.367  35.878 -97.298  1.00 76.22  ? 330 LEU B HD13   1 
ATOM   10271 H  HD21   . LEU B 1 350 ? 0.868   37.959 -98.976  1.00 75.14  ? 330 LEU B HD21   1 
ATOM   10272 H  HD22   . LEU B 1 350 ? 1.541   36.521 -98.903  1.00 75.14  ? 330 LEU B HD22   1 
ATOM   10273 H  HD23   . LEU B 1 350 ? 1.143   37.142 -100.311 1.00 75.14  ? 330 LEU B HD23   1 
ATOM   10274 N  N      . THR B 1 351 ? -2.651  32.027 -100.307 1.00 75.01  ? 331 THR B N      1 
ATOM   10275 C  CA     . THR B 1 351 ? -3.044  31.059 -101.325 1.00 73.22  ? 331 THR B CA     1 
ATOM   10276 C  C      . THR B 1 351 ? -4.534  31.083 -101.620 1.00 73.56  ? 331 THR B C      1 
ATOM   10277 O  O      . THR B 1 351 ? -4.931  30.896 -102.772 1.00 73.23  ? 331 THR B O      1 
ATOM   10278 C  CB     . THR B 1 351 ? -2.640  29.640 -100.899 1.00 70.50  ? 331 THR B CB     1 
ATOM   10279 O  OG1    . THR B 1 351 ? -3.286  29.303 -99.664  1.00 70.28  ? 331 THR B OG1    1 
ATOM   10280 C  CG2    . THR B 1 351 ? -1.130  29.538 -100.727 1.00 66.84  ? 331 THR B CG2    1 
ATOM   10281 H  H      . THR B 1 351 ? -3.005  31.894 -99.535  1.00 90.13  ? 331 THR B H      1 
ATOM   10282 H  HA     . THR B 1 351 ? -2.576  31.265 -102.150 1.00 87.98  ? 331 THR B HA     1 
ATOM   10283 H  HB     . THR B 1 351 ? -2.912  29.009 -101.584 1.00 84.72  ? 331 THR B HB     1 
ATOM   10284 H  HG1    . THR B 1 351 ? -3.059  29.845 -99.064  1.00 84.46  ? 331 THR B HG1    1 
ATOM   10285 H  HG21   . THR B 1 351 ? -0.887  28.639 -100.458 1.00 80.33  ? 331 THR B HG21   1 
ATOM   10286 H  HG22   . THR B 1 351 ? -0.687  29.747 -101.565 1.00 80.33  ? 331 THR B HG22   1 
ATOM   10287 H  HG23   .