data_5KE6
# 
_entry.id   5KE6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KE6         
WWPDB D_1000221910 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5KEA PDB . 
unspecified 5KE9 PDB . 
unspecified 5KEB PDB . 
unspecified 5K5I PDB . 
unspecified 5K5J PDB . 
unspecified 5K5L PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KE6 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hashimoto, H.' 1 
'Cheng, X.'     2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            44 
_citation.language                  ? 
_citation.page_first                10177 
_citation.page_last                 10185 
_citation.title                     'Distinctive Klf4 mutants determine preference for DNA methylation status.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkw774 
_citation.pdbx_database_id_PubMed   27596594 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hashimoto, H.'    1 ? 
primary 'Wang, D.'         2 ? 
primary 'Steves, A.N.'     3 ? 
primary 'Jin, P.'          4 ? 
primary 'Blumenthal, R.M.' 5 ? 
primary 'Zhang, X.'        6 ? 
primary 'Cheng, X.'        7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5KE6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     50.870 
_cell.length_a_esd                 ? 
_cell.length_b                     50.870 
_cell.length_b_esd                 ? 
_cell.length_c                     130.540 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5KE6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Krueppel-like factor 4'                       10840.261 1  ? ? 'unp residues 396-483' ? 
2 polymer     syn 
;DNA (5'-D(*GP*AP*GP*GP*TP*GP*TP*GP*GP*C)-3')
;
3141.051  1  ? ? ?                      ? 
3 polymer     syn 
;DNA (5'-D(*GP*CP*CP*AP*CP*AP*CP*CP*TP*C)-3')
;
2949.946  1  ? ? ?                      ? 
4 non-polymer syn 'ZINC ION'                                     65.409    3  ? ? ?                      ? 
5 water       nat water                                          18.015    81 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Epithelial zinc finger protein EZF,Gut-enriched krueppel-like factor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPLGSRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFS
RSDHLALHMKRHF
;
;GPLGSRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFS
RSDHLALHMKRHF
;
A ? 
2 polydeoxyribonucleotide no no '(DG)(DA)(DG)(DG)(DT)(DG)(DT)(DG)(DG)(DC)'                                                       
GAGGTGTGGC                                                                                       B ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DA)(DC)(DA)(DC)(DC)(DT)(DC)'                                                       
GCCACACCTC                                                                                       C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  ARG n 
1 7  THR n 
1 8  ALA n 
1 9  THR n 
1 10 HIS n 
1 11 THR n 
1 12 CYS n 
1 13 ASP n 
1 14 TYR n 
1 15 ALA n 
1 16 GLY n 
1 17 CYS n 
1 18 GLY n 
1 19 LYS n 
1 20 THR n 
1 21 TYR n 
1 22 THR n 
1 23 LYS n 
1 24 SER n 
1 25 SER n 
1 26 HIS n 
1 27 LEU n 
1 28 LYS n 
1 29 ALA n 
1 30 HIS n 
1 31 LEU n 
1 32 ARG n 
1 33 THR n 
1 34 HIS n 
1 35 THR n 
1 36 GLY n 
1 37 GLU n 
1 38 LYS n 
1 39 PRO n 
1 40 TYR n 
1 41 HIS n 
1 42 CYS n 
1 43 ASP n 
1 44 TRP n 
1 45 ASP n 
1 46 GLY n 
1 47 CYS n 
1 48 GLY n 
1 49 TRP n 
1 50 LYS n 
1 51 PHE n 
1 52 ALA n 
1 53 ARG n 
1 54 SER n 
1 55 ASP n 
1 56 GLU n 
1 57 LEU n 
1 58 THR n 
1 59 ARG n 
1 60 HIS n 
1 61 TYR n 
1 62 ARG n 
1 63 LYS n 
1 64 HIS n 
1 65 THR n 
1 66 GLY n 
1 67 HIS n 
1 68 ARG n 
1 69 PRO n 
1 70 PHE n 
1 71 GLN n 
1 72 CYS n 
1 73 GLN n 
1 74 LYS n 
1 75 CYS n 
1 76 ASP n 
1 77 ARG n 
1 78 ALA n 
1 79 PHE n 
1 80 SER n 
1 81 ARG n 
1 82 SER n 
1 83 ASP n 
1 84 HIS n 
1 85 LEU n 
1 86 ALA n 
1 87 LEU n 
1 88 HIS n 
1 89 MET n 
1 90 LYS n 
1 91 ARG n 
1 92 HIS n 
1 93 PHE n 
2 1  DG  n 
2 2  DA  n 
2 3  DG  n 
2 4  DG  n 
2 5  DT  n 
2 6  DG  n 
2 7  DT  n 
2 8  DG  n 
2 9  DG  n 
2 10 DC  n 
3 1  DG  n 
3 2  DC  n 
3 3  DC  n 
3 4  DA  n 
3 5  DC  n 
3 6  DA  n 
3 7  DC  n 
3 8  DC  n 
3 9  DT  n 
3 10 DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   93 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Klf4, Ezf, Gklf, Zie' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) codon plus' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pGEX-6p-1 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pXC1248 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 10 'synthetic construct' ? 32630 ? 
3 1 sample 1 10 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP KLF4_MOUSE Q60793 ? 1 
;RTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHL
ALHMKRHF
;
396 
2 PDB 5KE6       5KE6   ? 2 ?                                                                                           1   
3 PDB 5KE6       5KE6   ? 3 ?                                                                                           1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KE6 A 6 ? 93 ? Q60793 396 ? 483 ? 396 483 
2 2 5KE6 B 1 ? 10 ? 5KE6   1   ? 10  ? 1   10  
3 3 5KE6 C 1 ? 10 ? 5KE6   1   ? 10  ? 1   10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KE6 GLY A 1 ? UNP Q60793 ? ? 'expression tag' 391 1 
1 5KE6 PRO A 2 ? UNP Q60793 ? ? 'expression tag' 392 2 
1 5KE6 LEU A 3 ? UNP Q60793 ? ? 'expression tag' 393 3 
1 5KE6 GLY A 4 ? UNP Q60793 ? ? 'expression tag' 394 4 
1 5KE6 SER A 5 ? UNP Q60793 ? ? 'expression tag' 395 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KE6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.49 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.68 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M Tris-HCl pH8.5 , 0.25M NaCl and 20% polyethylene glycol 8000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-03-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5KE6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.990 
_reflns.d_resolution_low                 34.678 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       12435 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.0 
_reflns.pdbx_Rmerge_I_obs                0.073 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.58 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.906 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.99 
_reflns_shell.d_res_low                   2.04 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.32 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.982 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5KE6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.990 
_refine.ls_d_res_low                             34.678 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12416 
_refine.ls_number_reflns_R_free                  622 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.79 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1997 
_refine.ls_R_factor_R_free                       0.2337 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1979 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.44 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4M9E 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.84 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.22 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        707 
_refine_hist.pdbx_number_atoms_nucleic_acid   404 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             81 
_refine_hist.number_atoms_total               1195 
_refine_hist.d_res_high                       1.990 
_refine_hist.d_res_low                        34.678 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 1195 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.874  ? 1674 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 25.440 ? 614  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.040  ? 170  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 145  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9899 2.1902  . . 151 2867 100.00 . . . 0.2958 . 0.2654 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1902 2.5070  . . 152 2885 100.00 . . . 0.2536 . 0.2289 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5070 3.1582  . . 155 2948 100.00 . . . 0.2772 . 0.2250 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1582 34.6833 . . 164 3094 99.00  . . . 0.2026 . 0.1700 . . . . . . . . . . 
# 
_struct.entry_id                     5KE6 
_struct.title                        'mouse Klf4 ZnF1-3 and TpG/CpA sequence DNA complex structure' 
_struct.pdbx_descriptor              'Krueppel-like factor 4/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KE6 
_struct_keywords.text            'klf4, zinc finger, Kruppel-like factors, transcription-DNA complex' 
_struct_keywords.pdbx_keywords   transcription/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 LYS A 23 ? GLY A 36 ? LYS A 413 GLY A 426 1 ? 14 
HELX_P HELX_P2 AA2 ARG A 53 ? GLY A 66 ? ARG A 443 GLY A 456 1 ? 14 
HELX_P HELX_P3 AA3 ARG A 81 ? ARG A 91 ? ARG A 471 ARG A 481 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 12 SG  ? ? ? 1_555 F ZN .  ZN ? ? A CYS 402 A ZN 503 1_555 ? ? ? ? ? ? ?            2.269 ? 
metalc2  metalc ? ? A CYS 17 SG  ? ? ? 1_555 F ZN .  ZN ? ? A CYS 407 A ZN 503 1_555 ? ? ? ? ? ? ?            2.375 ? 
metalc3  metalc ? ? A HIS 30 NE2 ? ? ? 1_555 F ZN .  ZN ? ? A HIS 420 A ZN 503 1_555 ? ? ? ? ? ? ?            2.075 ? 
metalc4  metalc ? ? A HIS 34 NE2 ? ? ? 1_555 F ZN .  ZN ? ? A HIS 424 A ZN 503 1_555 ? ? ? ? ? ? ?            2.040 ? 
metalc5  metalc ? ? A CYS 42 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 432 A ZN 502 1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc6  metalc ? ? A CYS 47 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 437 A ZN 502 1_555 ? ? ? ? ? ? ?            2.289 ? 
metalc7  metalc ? ? A HIS 60 NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 450 A ZN 502 1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc8  metalc ? ? A HIS 64 NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 454 A ZN 502 1_555 ? ? ? ? ? ? ?            2.111 ? 
metalc9  metalc ? ? A CYS 72 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 462 A ZN 501 1_555 ? ? ? ? ? ? ?            2.253 ? 
metalc10 metalc ? ? A CYS 75 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 465 A ZN 501 1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc11 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 478 A ZN 501 1_555 ? ? ? ? ? ? ?            2.056 ? 
metalc12 metalc ? ? A HIS 92 NE2 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 482 A ZN 501 1_555 ? ? ? ? ? ? ?            2.027 ? 
hydrog1  hydrog ? ? B DG  1  N1  ? ? ? 1_555 C DC 10 N3 ? ? B DG  1   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1  N2  ? ? ? 1_555 C DC 10 O2 ? ? B DG  1   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1  O6  ? ? ? 1_555 C DC 10 N4 ? ? B DG  1   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  2  N1  ? ? ? 1_555 C DT 9  N3 ? ? B DA  2   C DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA  2  N6  ? ? ? 1_555 C DT 9  O4 ? ? B DA  2   C DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  3  N1  ? ? ? 1_555 C DC 8  N3 ? ? B DG  3   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3  N2  ? ? ? 1_555 C DC 8  O2 ? ? B DG  3   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3  O6  ? ? ? 1_555 C DC 8  N4 ? ? B DG  3   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  4  N1  ? ? ? 1_555 C DC 7  N3 ? ? B DG  4   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  4  N2  ? ? ? 1_555 C DC 7  O2 ? ? B DG  4   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  4  O6  ? ? ? 1_555 C DC 7  N4 ? ? B DG  4   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DT  5  N3  ? ? ? 1_555 C DA 6  N1 ? ? B DT  5   C DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DT  5  O4  ? ? ? 1_555 C DA 6  N6 ? ? B DT  5   C DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  6  N1  ? ? ? 1_555 C DC 5  N3 ? ? B DG  6   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  6  N2  ? ? ? 1_555 C DC 5  O2 ? ? B DG  6   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  6  O6  ? ? ? 1_555 C DC 5  N4 ? ? B DG  6   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  7  N3  ? ? ? 1_555 C DA 4  N1 ? ? B DT  7   C DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  7  O4  ? ? ? 1_555 C DA 4  N6 ? ? B DT  7   C DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  8  N1  ? ? ? 1_555 C DC 3  N3 ? ? B DG  8   C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  8  N2  ? ? ? 1_555 C DC 3  O2 ? ? B DG  8   C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  8  O6  ? ? ? 1_555 C DC 3  N4 ? ? B DG  8   C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  9  N1  ? ? ? 1_555 C DC 2  N3 ? ? B DG  9   C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9  N2  ? ? ? 1_555 C DC 2  O2 ? ? B DG  9   C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  9  O6  ? ? ? 1_555 C DC 2  N4 ? ? B DG  9   C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  10 N3  ? ? ? 1_555 C DG 1  N1 ? ? B DC  10  C DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  10 N4  ? ? ? 1_555 C DG 1  O6 ? ? B DC  10  C DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  10 O2  ? ? ? 1_555 C DG 1  N2 ? ? B DC  10  C DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 10 ? THR A 11 ? HIS A 400 THR A 401 
AA1 2 THR A 20 ? TYR A 21 ? THR A 410 TYR A 411 
AA2 1 TYR A 40 ? HIS A 41 ? TYR A 430 HIS A 431 
AA2 2 LYS A 50 ? PHE A 51 ? LYS A 440 PHE A 441 
AA3 1 PHE A 70 ? GLN A 71 ? PHE A 460 GLN A 461 
AA3 2 ALA A 78 ? PHE A 79 ? ALA A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 10 ? N HIS A 400 O TYR A 21 ? O TYR A 411 
AA2 1 2 N TYR A 40 ? N TYR A 430 O PHE A 51 ? O PHE A 441 
AA3 1 2 N PHE A 70 ? N PHE A 460 O PHE A 79 ? O PHE A 469 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 501 ? 4 'binding site for residue ZN A 501' 
AC2 Software A ZN 502 ? 4 'binding site for residue ZN A 502' 
AC3 Software A ZN 503 ? 4 'binding site for residue ZN A 503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 72 ? CYS A 462 . ? 1_555 ? 
2  AC1 4 CYS A 75 ? CYS A 465 . ? 1_555 ? 
3  AC1 4 HIS A 88 ? HIS A 478 . ? 1_555 ? 
4  AC1 4 HIS A 92 ? HIS A 482 . ? 1_555 ? 
5  AC2 4 CYS A 42 ? CYS A 432 . ? 1_555 ? 
6  AC2 4 CYS A 47 ? CYS A 437 . ? 1_555 ? 
7  AC2 4 HIS A 60 ? HIS A 450 . ? 1_555 ? 
8  AC2 4 HIS A 64 ? HIS A 454 . ? 1_555 ? 
9  AC3 4 CYS A 12 ? CYS A 402 . ? 1_555 ? 
10 AC3 4 CYS A 17 ? CYS A 407 . ? 1_555 ? 
11 AC3 4 HIS A 30 ? HIS A 420 . ? 1_555 ? 
12 AC3 4 HIS A 34 ? HIS A 424 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KE6 
_atom_sites.fract_transf_matrix[1][1]   0.019658 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019658 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007660 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N      . THR A 1 9  ? -16.005 -37.690 256.338 1.00 81.71  ? 399 THR A N      1 
ATOM   2    C  CA     . THR A 1 9  ? -17.016 -38.692 256.653 1.00 77.19  ? 399 THR A CA     1 
ATOM   3    C  C      . THR A 1 9  ? -18.353 -38.005 256.913 1.00 72.20  ? 399 THR A C      1 
ATOM   4    O  O      . THR A 1 9  ? -18.628 -36.947 256.348 1.00 74.13  ? 399 THR A O      1 
ATOM   5    C  CB     . THR A 1 9  ? -16.613 -39.551 257.878 1.00 79.81  ? 399 THR A CB     1 
ATOM   6    O  OG1    . THR A 1 9  ? -16.689 -38.765 259.077 1.00 79.80  ? 399 THR A OG1    1 
ATOM   7    C  CG2    . THR A 1 9  ? -15.195 -40.089 257.705 1.00 86.00  ? 399 THR A CG2    1 
ATOM   8    H  HA     . THR A 1 9  ? -17.124 -39.284 255.892 1.00 92.65  ? 399 THR A HA     1 
ATOM   9    H  HB     . THR A 1 9  ? -17.217 -40.306 257.951 1.00 95.80  ? 399 THR A HB     1 
ATOM   10   H  HG1    . THR A 1 9  ? -16.470 -39.231 259.740 1.00 95.79  ? 399 THR A HG1    1 
ATOM   11   H  HG21   . THR A 1 9  ? -14.948 -40.626 258.475 1.00 103.23 ? 399 THR A HG21   1 
ATOM   12   H  HG22   . THR A 1 9  ? -15.144 -40.639 256.908 1.00 103.23 ? 399 THR A HG22   1 
ATOM   13   H  HG23   . THR A 1 9  ? -14.569 -39.353 257.621 1.00 103.23 ? 399 THR A HG23   1 
ATOM   14   N  N      . HIS A 1 10 ? -19.174 -38.596 257.783 1.00 59.08  ? 400 HIS A N      1 
ATOM   15   C  CA     . HIS A 1 10 ? -20.570 -38.190 257.952 1.00 53.64  ? 400 HIS A CA     1 
ATOM   16   C  C      . HIS A 1 10 ? -20.674 -37.269 259.164 1.00 49.89  ? 400 HIS A C      1 
ATOM   17   O  O      . HIS A 1 10 ? -20.815 -37.727 260.301 1.00 46.80  ? 400 HIS A O      1 
ATOM   18   C  CB     . HIS A 1 10 ? -21.468 -39.413 258.103 1.00 49.29  ? 400 HIS A CB     1 
ATOM   19   C  CG     . HIS A 1 10 ? -21.287 -40.435 257.023 1.00 50.95  ? 400 HIS A CG     1 
ATOM   20   N  ND1    . HIS A 1 10 ? -21.988 -40.396 255.835 1.00 52.10  ? 400 HIS A ND1    1 
ATOM   21   C  CD2    . HIS A 1 10 ? -20.483 -41.523 256.950 1.00 52.70  ? 400 HIS A CD2    1 
ATOM   22   C  CE1    . HIS A 1 10 ? -21.628 -41.419 255.080 1.00 53.19  ? 400 HIS A CE1    1 
ATOM   23   N  NE2    . HIS A 1 10 ? -20.714 -42.117 255.731 1.00 54.02  ? 400 HIS A NE2    1 
ATOM   24   H  H      . HIS A 1 10 ? -18.941 -39.246 258.296 1.00 70.92  ? 400 HIS A H      1 
ATOM   25   H  HA     . HIS A 1 10 ? -20.857 -37.695 257.169 1.00 64.39  ? 400 HIS A HA     1 
ATOM   26   H  HB2    . HIS A 1 10 ? -21.274 -39.841 258.951 1.00 59.17  ? 400 HIS A HB2    1 
ATOM   27   H  HB3    . HIS A 1 10 ? -22.394 -39.124 258.085 1.00 59.17  ? 400 HIS A HB3    1 
ATOM   28   H  HD2    . HIS A 1 10 ? -19.887 -41.814 257.602 1.00 63.27  ? 400 HIS A HD2    1 
ATOM   29   H  HE1    . HIS A 1 10 ? -21.957 -41.612 254.232 1.00 63.86  ? 400 HIS A HE1    1 
ATOM   30   H  HE2    . HIS A 1 10 ? -20.327 -42.828 255.440 1.00 64.85  ? 400 HIS A HE2    1 
ATOM   31   N  N      . THR A 1 11 ? -20.644 -35.969 258.910 1.00 49.12  ? 401 THR A N      1 
ATOM   32   C  CA     . THR A 1 11 ? -20.655 -34.971 259.965 1.00 51.32  ? 401 THR A CA     1 
ATOM   33   C  C      . THR A 1 11 ? -22.043 -34.377 260.139 1.00 48.22  ? 401 THR A C      1 
ATOM   34   O  O      . THR A 1 11 ? -22.770 -34.166 259.164 1.00 43.51  ? 401 THR A O      1 
ATOM   35   C  CB     . THR A 1 11 ? -19.670 -33.855 259.656 1.00 58.08  ? 401 THR A CB     1 
ATOM   36   O  OG1    . THR A 1 11 ? -18.431 -34.435 259.235 1.00 62.55  ? 401 THR A OG1    1 
ATOM   37   C  CG2    . THR A 1 11 ? -19.454 -32.988 260.900 1.00 58.85  ? 401 THR A CG2    1 
ATOM   38   H  H      . THR A 1 11 ? -20.615 -35.634 258.119 1.00 58.97  ? 401 THR A H      1 
ATOM   39   H  HA     . THR A 1 11 ? -20.394 -35.386 260.802 1.00 61.62  ? 401 THR A HA     1 
ATOM   40   H  HB     . THR A 1 11 ? -20.024 -33.295 258.947 1.00 69.72  ? 401 THR A HB     1 
ATOM   41   H  HG1    . THR A 1 11 ? -17.875 -33.829 259.060 1.00 75.09  ? 401 THR A HG1    1 
ATOM   42   H  HG21   . THR A 1 11 ? -18.825 -32.276 260.703 1.00 70.65  ? 401 THR A HG21   1 
ATOM   43   H  HG22   . THR A 1 11 ? -20.295 -32.597 261.182 1.00 70.65  ? 401 THR A HG22   1 
ATOM   44   H  HG23   . THR A 1 11 ? -19.100 -33.530 261.623 1.00 70.65  ? 401 THR A HG23   1 
ATOM   45   N  N      . CYS A 1 12 ? -22.395 -34.101 261.390 1.00 42.12  ? 402 CYS A N      1 
ATOM   46   C  CA     . CYS A 1 12 ? -23.640 -33.420 261.705 1.00 40.21  ? 402 CYS A CA     1 
ATOM   47   C  C      . CYS A 1 12 ? -23.459 -31.929 261.484 1.00 46.11  ? 402 CYS A C      1 
ATOM   48   O  O      . CYS A 1 12 ? -22.508 -31.327 261.994 1.00 46.48  ? 402 CYS A O      1 
ATOM   49   C  CB     . CYS A 1 12 ? -24.059 -33.688 263.152 1.00 37.79  ? 402 CYS A CB     1 
ATOM   50   S  SG     . CYS A 1 12 ? -25.595 -32.848 263.621 1.00 35.87  ? 402 CYS A SG     1 
ATOM   51   H  H      . CYS A 1 12 ? -21.923 -34.302 262.080 1.00 50.41  ? 402 CYS A H      1 
ATOM   52   H  HA     . CYS A 1 12 ? -24.342 -33.736 261.116 1.00 48.12  ? 402 CYS A HA     1 
ATOM   53   H  HB2    . CYS A 1 12 ? -24.193 -34.642 263.269 1.00 45.21  ? 402 CYS A HB2    1 
ATOM   54   H  HB3    . CYS A 1 12 ? -23.357 -33.378 263.745 1.00 45.21  ? 402 CYS A HB3    1 
ATOM   55   N  N      . ASP A 1 13 ? -24.380 -31.331 260.732 1.00 47.74  ? 403 ASP A N      1 
ATOM   56   C  CA     . ASP A 1 13 ? -24.273 -29.935 260.343 1.00 52.10  ? 403 ASP A CA     1 
ATOM   57   C  C      . ASP A 1 13 ? -25.311 -29.058 261.035 1.00 50.09  ? 403 ASP A C      1 
ATOM   58   O  O      . ASP A 1 13 ? -25.600 -27.962 260.560 1.00 52.52  ? 403 ASP A O      1 
ATOM   59   C  CB     . ASP A 1 13 ? -24.384 -29.824 258.823 1.00 57.51  ? 403 ASP A CB     1 
ATOM   60   C  CG     . ASP A 1 13 ? -23.236 -30.529 258.107 1.00 62.69  ? 403 ASP A CG     1 
ATOM   61   O  OD1    . ASP A 1 13 ? -22.066 -30.325 258.500 1.00 66.06  ? 403 ASP A OD1    1 
ATOM   62   O  OD2    . ASP A 1 13 ? -23.505 -31.303 257.165 1.00 63.69  ? 403 ASP A OD2    1 
ATOM   63   H  H      . ASP A 1 13 ? -25.084 -31.722 260.432 1.00 57.31  ? 403 ASP A H      1 
ATOM   64   H  HA     . ASP A 1 13 ? -23.396 -29.608 260.598 1.00 62.54  ? 403 ASP A HA     1 
ATOM   65   H  HB2    . ASP A 1 13 ? -25.215 -30.232 258.534 1.00 69.04  ? 403 ASP A HB2    1 
ATOM   66   H  HB3    . ASP A 1 13 ? -24.366 -28.888 258.571 1.00 69.04  ? 403 ASP A HB3    1 
ATOM   67   N  N      . TYR A 1 14 ? -25.862 -29.508 262.157 1.00 45.58  ? 404 TYR A N      1 
ATOM   68   C  CA     . TYR A 1 14 ? -26.871 -28.748 262.885 1.00 48.29  ? 404 TYR A CA     1 
ATOM   69   C  C      . TYR A 1 14 ? -26.191 -27.894 263.951 1.00 52.97  ? 404 TYR A C      1 
ATOM   70   O  O      . TYR A 1 14 ? -25.471 -28.425 264.804 1.00 55.11  ? 404 TYR A O      1 
ATOM   71   C  CB     . TYR A 1 14 ? -27.890 -29.694 263.523 1.00 46.46  ? 404 TYR A CB     1 
ATOM   72   C  CG     . TYR A 1 14 ? -29.112 -29.005 264.085 1.00 47.29  ? 404 TYR A CG     1 
ATOM   73   C  CD1    . TYR A 1 14 ? -30.209 -28.741 263.280 1.00 48.88  ? 404 TYR A CD1    1 
ATOM   74   C  CD2    . TYR A 1 14 ? -29.174 -28.625 265.420 1.00 47.68  ? 404 TYR A CD2    1 
ATOM   75   C  CE1    . TYR A 1 14 ? -31.331 -28.113 263.779 1.00 49.98  ? 404 TYR A CE1    1 
ATOM   76   C  CE2    . TYR A 1 14 ? -30.299 -27.993 265.933 1.00 47.77  ? 404 TYR A CE2    1 
ATOM   77   C  CZ     . TYR A 1 14 ? -31.374 -27.738 265.103 1.00 49.60  ? 404 TYR A CZ     1 
ATOM   78   O  OH     . TYR A 1 14 ? -32.505 -27.110 265.580 1.00 50.99  ? 404 TYR A OH     1 
ATOM   79   H  H      . TYR A 1 14 ? -25.666 -30.261 262.521 1.00 54.72  ? 404 TYR A H      1 
ATOM   80   H  HA     . TYR A 1 14 ? -27.338 -28.159 262.272 1.00 57.97  ? 404 TYR A HA     1 
ATOM   81   H  HB2    . TYR A 1 14 ? -28.191 -30.325 262.852 1.00 55.78  ? 404 TYR A HB2    1 
ATOM   82   H  HB3    . TYR A 1 14 ? -27.460 -30.170 264.251 1.00 55.78  ? 404 TYR A HB3    1 
ATOM   83   H  HD1    . TYR A 1 14 ? -30.186 -28.989 262.383 1.00 58.68  ? 404 TYR A HD1    1 
ATOM   84   H  HD2    . TYR A 1 14 ? -28.449 -28.794 265.979 1.00 57.24  ? 404 TYR A HD2    1 
ATOM   85   H  HE1    . TYR A 1 14 ? -32.056 -27.941 263.222 1.00 60.00  ? 404 TYR A HE1    1 
ATOM   86   H  HE2    . TYR A 1 14 ? -30.327 -27.740 266.827 1.00 57.35  ? 404 TYR A HE2    1 
ATOM   87   H  HH     . TYR A 1 14 ? -32.412 -26.931 266.395 1.00 61.22  ? 404 TYR A HH     1 
ATOM   88   N  N      . ALA A 1 15 ? -26.409 -26.580 263.892 1.00 57.79  ? 405 ALA A N      1 
ATOM   89   C  CA     . ALA A 1 15 ? -25.999 -25.647 264.947 1.00 60.62  ? 405 ALA A CA     1 
ATOM   90   C  C      . ALA A 1 15 ? -24.603 -25.967 265.471 1.00 64.60  ? 405 ALA A C      1 
ATOM   91   O  O      . ALA A 1 15 ? -24.372 -26.078 266.678 1.00 65.32  ? 405 ALA A O      1 
ATOM   92   C  CB     . ALA A 1 15 ? -27.008 -25.644 266.095 1.00 57.73  ? 405 ALA A CB     1 
ATOM   93   H  H      . ALA A 1 15 ? -26.804 -26.193 263.233 1.00 69.37  ? 405 ALA A H      1 
ATOM   94   H  HA     . ALA A 1 15 ? -25.974 -24.751 264.576 1.00 72.77  ? 405 ALA A HA     1 
ATOM   95   H  HB1    . ALA A 1 15 ? -26.710 -25.019 266.775 1.00 69.30  ? 405 ALA A HB1    1 
ATOM   96   H  HB2    . ALA A 1 15 ? -27.874 -25.373 265.753 1.00 69.30  ? 405 ALA A HB2    1 
ATOM   97   H  HB3    . ALA A 1 15 ? -27.063 -26.538 266.468 1.00 69.30  ? 405 ALA A HB3    1 
ATOM   98   N  N      . GLY A 1 16 ? -23.666 -26.138 264.542 1.00 70.99  ? 406 GLY A N      1 
ATOM   99   C  CA     . GLY A 1 16 ? -22.280 -26.386 264.909 1.00 73.03  ? 406 GLY A CA     1 
ATOM   100  C  C      . GLY A 1 16 ? -22.064 -27.583 265.810 1.00 70.12  ? 406 GLY A C      1 
ATOM   101  O  O      . GLY A 1 16 ? -21.099 -27.602 266.581 1.00 72.51  ? 406 GLY A O      1 
ATOM   102  H  H      . GLY A 1 16 ? -23.809 -26.114 263.695 1.00 85.21  ? 406 GLY A H      1 
ATOM   103  H  HA2    . GLY A 1 16 ? -21.761 -26.522 264.101 1.00 87.67  ? 406 GLY A HA2    1 
ATOM   104  H  HA3    . GLY A 1 16 ? -21.929 -25.603 265.362 1.00 87.67  ? 406 GLY A HA3    1 
ATOM   105  N  N      . CYS A 1 17 ? -22.932 -28.593 265.730 1.00 59.13  ? 407 CYS A N      1 
ATOM   106  C  CA     . CYS A 1 17 ? -22.765 -29.785 266.556 1.00 55.84  ? 407 CYS A CA     1 
ATOM   107  C  C      . CYS A 1 17 ? -21.403 -30.427 266.316 1.00 57.03  ? 407 CYS A C      1 
ATOM   108  O  O      . CYS A 1 17 ? -20.569 -30.513 267.224 1.00 60.26  ? 407 CYS A O      1 
ATOM   109  C  CB     . CYS A 1 17 ? -23.890 -30.777 266.260 1.00 41.71  ? 407 CYS A CB     1 
ATOM   110  S  SG     . CYS A 1 17 ? -23.665 -32.412 267.008 1.00 39.18  ? 407 CYS A SG     1 
ATOM   111  H  H      . CYS A 1 17 ? -23.618 -28.612 265.212 1.00 70.98  ? 407 CYS A H      1 
ATOM   112  H  HA     . CYS A 1 17 ? -22.821 -29.534 267.491 1.00 67.04  ? 407 CYS A HA     1 
ATOM   113  H  HB2    . CYS A 1 17 ? -24.722 -30.411 266.596 1.00 49.92  ? 407 CYS A HB2    1 
ATOM   114  H  HB3    . CYS A 1 17 ? -23.951 -30.899 265.300 1.00 49.92  ? 407 CYS A HB3    1 
ATOM   115  N  N      . GLY A 1 18 ? -21.165 -30.895 265.095 1.00 60.74  ? 408 GLY A N      1 
ATOM   116  C  CA     . GLY A 1 18 ? -19.878 -31.431 264.722 1.00 66.45  ? 408 GLY A CA     1 
ATOM   117  C  C      . GLY A 1 18 ? -19.696 -32.918 264.938 1.00 66.11  ? 408 GLY A C      1 
ATOM   118  O  O      . GLY A 1 18 ? -18.729 -33.484 264.414 1.00 70.56  ? 408 GLY A O      1 
ATOM   119  H  H      . GLY A 1 18 ? -21.746 -30.910 264.461 1.00 72.92  ? 408 GLY A H      1 
ATOM   120  H  HA2    . GLY A 1 18 ? -19.724 -31.248 263.782 1.00 79.76  ? 408 GLY A HA2    1 
ATOM   121  H  HA3    . GLY A 1 18 ? -19.190 -30.973 265.231 1.00 79.76  ? 408 GLY A HA3    1 
ATOM   122  N  N      . LYS A 1 19 ? -20.570 -33.571 265.701 1.00 59.04  ? 409 LYS A N      1 
ATOM   123  C  CA     . LYS A 1 19 ? -20.451 -35.010 265.886 1.00 54.62  ? 409 LYS A CA     1 
ATOM   124  C  C      . LYS A 1 19 ? -20.333 -35.702 264.536 1.00 53.38  ? 409 LYS A C      1 
ATOM   125  O  O      . LYS A 1 19 ? -21.037 -35.361 263.581 1.00 51.45  ? 409 LYS A O      1 
ATOM   126  C  CB     . LYS A 1 19 ? -21.657 -35.548 266.652 1.00 51.05  ? 409 LYS A CB     1 
ATOM   127  C  CG     . LYS A 1 19 ? -21.535 -35.417 268.158 1.00 53.77  ? 409 LYS A CG     1 
ATOM   128  C  CD     . LYS A 1 19 ? -22.652 -36.167 268.867 1.00 53.67  ? 409 LYS A CD     1 
ATOM   129  C  CE     . LYS A 1 19 ? -22.306 -36.443 270.325 1.00 60.54  ? 409 LYS A CE     1 
ATOM   130  N  NZ     . LYS A 1 19 ? -23.357 -37.271 270.981 1.00 61.40  ? 409 LYS A NZ     1 
ATOM   131  H  H      . LYS A 1 19 ? -21.231 -33.208 266.115 1.00 70.88  ? 409 LYS A H      1 
ATOM   132  H  HA     . LYS A 1 19 ? -19.652 -35.203 266.400 1.00 65.57  ? 409 LYS A HA     1 
ATOM   133  H  HB2    . LYS A 1 19 ? -22.447 -35.058 266.375 1.00 61.29  ? 409 LYS A HB2    1 
ATOM   134  H  HB3    . LYS A 1 19 ? -21.765 -36.489 266.444 1.00 61.29  ? 409 LYS A HB3    1 
ATOM   135  H  HG2    . LYS A 1 19 ? -20.687 -35.790 268.445 1.00 64.55  ? 409 LYS A HG2    1 
ATOM   136  H  HG3    . LYS A 1 19 ? -21.591 -34.480 268.405 1.00 64.55  ? 409 LYS A HG3    1 
ATOM   137  H  HD2    . LYS A 1 19 ? -23.461 -35.632 268.844 1.00 64.43  ? 409 LYS A HD2    1 
ATOM   138  H  HD3    . LYS A 1 19 ? -22.799 -37.017 268.424 1.00 64.43  ? 409 LYS A HD3    1 
ATOM   139  H  HE2    . LYS A 1 19 ? -21.466 -36.926 270.369 1.00 72.67  ? 409 LYS A HE2    1 
ATOM   140  H  HE3    . LYS A 1 19 ? -22.237 -35.603 270.804 1.00 72.67  ? 409 LYS A HE3    1 
ATOM   141  H  HZ1    . LYS A 1 19 ? -23.138 -37.423 271.830 1.00 73.71  ? 409 LYS A HZ1    1 
ATOM   142  H  HZ2    . LYS A 1 19 ? -24.139 -36.847 270.955 1.00 73.71  ? 409 LYS A HZ2    1 
ATOM   143  H  HZ3    . LYS A 1 19 ? -23.437 -38.051 270.559 1.00 73.71  ? 409 LYS A HZ3    1 
ATOM   144  N  N      . THR A 1 20 ? -19.426 -36.674 264.455 1.00 54.19  ? 410 THR A N      1 
ATOM   145  C  CA     . THR A 1 20 ? -19.150 -37.384 263.215 1.00 52.76  ? 410 THR A CA     1 
ATOM   146  C  C      . THR A 1 20 ? -19.383 -38.874 263.402 1.00 47.75  ? 410 THR A C      1 
ATOM   147  O  O      . THR A 1 20 ? -19.128 -39.431 264.474 1.00 46.64  ? 410 THR A O      1 
ATOM   148  C  CB     . THR A 1 20 ? -17.712 -37.167 262.745 1.00 57.50  ? 410 THR A CB     1 
ATOM   149  O  OG1    . THR A 1 20 ? -16.814 -37.511 263.809 1.00 60.67  ? 410 THR A OG1    1 
ATOM   150  C  CG2    . THR A 1 20 ? -17.504 -35.732 262.337 1.00 60.88  ? 410 THR A CG2    1 
ATOM   151  H  H      . THR A 1 20 ? -18.950 -36.942 265.119 1.00 65.05  ? 410 THR A H      1 
ATOM   152  H  HA     . THR A 1 20 ? -19.750 -37.066 262.522 1.00 63.34  ? 410 THR A HA     1 
ATOM   153  H  HB     . THR A 1 20 ? -17.535 -37.733 261.978 1.00 69.02  ? 410 THR A HB     1 
ATOM   154  H  HG1    . THR A 1 20 ? -16.019 -37.396 263.562 1.00 72.83  ? 410 THR A HG1    1 
ATOM   155  H  HG21   . THR A 1 20 ? -16.590 -35.602 262.040 1.00 73.09  ? 410 THR A HG21   1 
ATOM   156  H  HG22   . THR A 1 20 ? -18.107 -35.503 261.612 1.00 73.09  ? 410 THR A HG22   1 
ATOM   157  H  HG23   . THR A 1 20 ? -17.678 -35.145 263.089 1.00 73.09  ? 410 THR A HG23   1 
ATOM   158  N  N      . TYR A 1 21 ? -19.839 -39.520 262.331 1.00 42.31  ? 411 TYR A N      1 
ATOM   159  C  CA     . TYR A 1 21 ? -20.198 -40.925 262.372 1.00 42.04  ? 411 TYR A CA     1 
ATOM   160  C  C      . TYR A 1 21 ? -19.565 -41.646 261.194 1.00 45.38  ? 411 TYR A C      1 
ATOM   161  O  O      . TYR A 1 21 ? -19.109 -41.022 260.231 1.00 45.74  ? 411 TYR A O      1 
ATOM   162  C  CB     . TYR A 1 21 ? -21.723 -41.094 262.377 1.00 37.52  ? 411 TYR A CB     1 
ATOM   163  C  CG     . TYR A 1 21 ? -22.330 -40.498 263.625 1.00 34.76  ? 411 TYR A CG     1 
ATOM   164  C  CD1    . TYR A 1 21 ? -22.409 -41.239 264.798 1.00 38.46  ? 411 TYR A CD1    1 
ATOM   165  C  CD2    . TYR A 1 21 ? -22.765 -39.180 263.653 1.00 35.79  ? 411 TYR A CD2    1 
ATOM   166  C  CE1    . TYR A 1 21 ? -22.934 -40.697 265.959 1.00 34.81  ? 411 TYR A CE1    1 
ATOM   167  C  CE2    . TYR A 1 21 ? -23.291 -38.628 264.810 1.00 34.59  ? 411 TYR A CE2    1 
ATOM   168  C  CZ     . TYR A 1 21 ? -23.374 -39.395 265.958 1.00 34.56  ? 411 TYR A CZ     1 
ATOM   169  O  OH     . TYR A 1 21 ? -23.891 -38.850 267.108 1.00 34.15  ? 411 TYR A OH     1 
ATOM   170  H  H      . TYR A 1 21 ? -19.949 -39.156 261.559 1.00 50.80  ? 411 TYR A H      1 
ATOM   171  H  HA     . TYR A 1 21 ? -19.849 -41.318 263.188 1.00 50.48  ? 411 TYR A HA     1 
ATOM   172  H  HB2    . TYR A 1 21 ? -22.099 -40.640 261.607 1.00 45.06  ? 411 TYR A HB2    1 
ATOM   173  H  HB3    . TYR A 1 21 ? -21.942 -42.038 262.352 1.00 45.06  ? 411 TYR A HB3    1 
ATOM   174  H  HD1    . TYR A 1 21 ? -22.112 -42.120 264.800 1.00 46.18  ? 411 TYR A HD1    1 
ATOM   175  H  HD2    . TYR A 1 21 ? -22.711 -38.662 262.882 1.00 42.97  ? 411 TYR A HD2    1 
ATOM   176  H  HE1    . TYR A 1 21 ? -22.989 -41.210 266.733 1.00 41.80  ? 411 TYR A HE1    1 
ATOM   177  H  HE2    . TYR A 1 21 ? -23.589 -37.747 264.814 1.00 41.53  ? 411 TYR A HE2    1 
ATOM   178  H  HH     . TYR A 1 21 ? -23.878 -39.418 267.727 1.00 41.00  ? 411 TYR A HH     1 
ATOM   179  N  N      . THR A 1 22 ? -19.526 -42.976 261.292 1.00 49.14  ? 412 THR A N      1 
ATOM   180  C  CA     . THR A 1 22 ? -18.927 -43.797 260.247 1.00 53.53  ? 412 THR A CA     1 
ATOM   181  C  C      . THR A 1 22 ? -19.915 -44.174 259.154 1.00 50.55  ? 412 THR A C      1 
ATOM   182  O  O      . THR A 1 22 ? -19.488 -44.480 258.041 1.00 52.26  ? 412 THR A O      1 
ATOM   183  C  CB     . THR A 1 22 ? -18.337 -45.081 260.837 1.00 54.40  ? 412 THR A CB     1 
ATOM   184  O  OG1    . THR A 1 22 ? -19.393 -45.892 261.367 1.00 54.09  ? 412 THR A OG1    1 
ATOM   185  C  CG2    . THR A 1 22 ? -17.330 -44.758 261.932 1.00 59.02  ? 412 THR A CG2    1 
ATOM   186  H  H      . THR A 1 22 ? -19.840 -43.425 261.955 1.00 58.99  ? 412 THR A H      1 
ATOM   187  H  HA     . THR A 1 22 ? -18.203 -43.299 259.835 1.00 64.26  ? 412 THR A HA     1 
ATOM   188  H  HB     . THR A 1 22 ? -17.878 -45.572 260.137 1.00 65.30  ? 412 THR A HB     1 
ATOM   189  H  HG1    . THR A 1 22 ? -19.077 -46.599 261.693 1.00 64.94  ? 412 THR A HG1    1 
ATOM   190  H  HG21   . THR A 1 22 ? -16.964 -45.579 262.297 1.00 70.85  ? 412 THR A HG21   1 
ATOM   191  H  HG22   . THR A 1 22 ? -16.606 -44.224 261.569 1.00 70.85  ? 412 THR A HG22   1 
ATOM   192  H  HG23   . THR A 1 22 ? -17.762 -44.261 262.644 1.00 70.85  ? 412 THR A HG23   1 
ATOM   193  N  N      . LYS A 1 23 ? -21.213 -44.193 259.456 1.00 45.94  ? 413 LYS A N      1 
ATOM   194  C  CA     . LYS A 1 23 ? -22.265 -44.479 258.490 1.00 45.21  ? 413 LYS A CA     1 
ATOM   195  C  C      . LYS A 1 23 ? -23.253 -43.325 258.481 1.00 42.51  ? 413 LYS A C      1 
ATOM   196  O  O      . LYS A 1 23 ? -23.486 -42.685 259.513 1.00 37.66  ? 413 LYS A O      1 
ATOM   197  C  CB     . LYS A 1 23 ? -23.050 -45.762 258.818 1.00 46.45  ? 413 LYS A CB     1 
ATOM   198  C  CG     . LYS A 1 23 ? -22.279 -47.051 258.740 1.00 50.41  ? 413 LYS A CG     1 
ATOM   199  C  CD     . LYS A 1 23 ? -23.079 -48.199 259.356 1.00 52.09  ? 413 LYS A CD     1 
ATOM   200  C  CE     . LYS A 1 23 ? -24.318 -48.538 258.534 1.00 53.62  ? 413 LYS A CE     1 
ATOM   201  N  NZ     . LYS A 1 23 ? -24.911 -49.830 258.985 1.00 55.75  ? 413 LYS A NZ     1 
ATOM   202  H  H      . LYS A 1 23 ? -21.516 -44.036 260.245 1.00 55.15  ? 413 LYS A H      1 
ATOM   203  H  HA     . LYS A 1 23 ? -21.880 -44.567 257.603 1.00 54.28  ? 413 LYS A HA     1 
ATOM   204  H  HB2    . LYS A 1 23 ? -23.393 -45.685 259.722 1.00 55.76  ? 413 LYS A HB2    1 
ATOM   205  H  HB3    . LYS A 1 23 ? -23.792 -45.831 258.197 1.00 55.76  ? 413 LYS A HB3    1 
ATOM   206  H  HG2    . LYS A 1 23 ? -22.102 -47.265 257.811 1.00 60.52  ? 413 LYS A HG2    1 
ATOM   207  H  HG3    . LYS A 1 23 ? -21.447 -46.959 259.230 1.00 60.52  ? 413 LYS A HG3    1 
ATOM   208  H  HD2    . LYS A 1 23 ? -22.519 -48.990 259.399 1.00 62.54  ? 413 LYS A HD2    1 
ATOM   209  H  HD3    . LYS A 1 23 ? -23.367 -47.945 260.247 1.00 62.54  ? 413 LYS A HD3    1 
ATOM   210  H  HE2    . LYS A 1 23 ? -24.981 -47.839 258.648 1.00 64.37  ? 413 LYS A HE2    1 
ATOM   211  H  HE3    . LYS A 1 23 ? -24.072 -48.622 257.600 1.00 64.37  ? 413 LYS A HE3    1 
ATOM   212  H  HZ1    . LYS A 1 23 ? -25.633 -50.019 258.500 1.00 66.92  ? 413 LYS A HZ1    1 
ATOM   213  H  HZ2    . LYS A 1 23 ? -24.318 -50.487 258.889 1.00 66.92  ? 413 LYS A HZ2    1 
ATOM   214  H  HZ3    . LYS A 1 23 ? -25.145 -49.775 259.842 1.00 66.92  ? 413 LYS A HZ3    1 
ATOM   215  N  N      . SER A 1 24 ? -23.837 -43.069 257.305 1.00 43.69  ? 414 SER A N      1 
ATOM   216  C  CA     . SER A 1 24 ? -24.889 -42.062 257.212 1.00 44.06  ? 414 SER A CA     1 
ATOM   217  C  C      . SER A 1 24 ? -26.100 -42.469 258.030 1.00 39.89  ? 414 SER A C      1 
ATOM   218  O  O      . SER A 1 24 ? -26.803 -41.610 258.571 1.00 40.99  ? 414 SER A O      1 
ATOM   219  C  CB     . SER A 1 24 ? -25.298 -41.835 255.750 1.00 49.13  ? 414 SER A CB     1 
ATOM   220  O  OG     . SER A 1 24 ? -25.962 -42.971 255.230 1.00 50.96  ? 414 SER A OG     1 
ATOM   221  H  H      . SER A 1 24 ? -23.645 -43.458 256.562 1.00 52.46  ? 414 SER A H      1 
ATOM   222  H  HA     . SER A 1 24 ? -24.556 -41.222 257.565 1.00 52.90  ? 414 SER A HA     1 
ATOM   223  H  HB2    . SER A 1 24 ? -25.894 -41.072 255.704 1.00 58.98  ? 414 SER A HB2    1 
ATOM   224  H  HB3    . SER A 1 24 ? -24.502 -41.666 255.223 1.00 58.98  ? 414 SER A HB3    1 
ATOM   225  H  HG     . SER A 1 24 ? -26.181 -42.835 254.430 1.00 61.17  ? 414 SER A HG     1 
ATOM   226  N  N      . SER A 1 25 ? -26.353 -43.769 258.146 1.00 36.97  ? 415 SER A N      1 
ATOM   227  C  CA     . SER A 1 25 ? -27.501 -44.223 258.918 1.00 39.04  ? 415 SER A CA     1 
ATOM   228  C  C      . SER A 1 25 ? -27.353 -43.842 260.393 1.00 35.12  ? 415 SER A C      1 
ATOM   229  O  O      . SER A 1 25 ? -28.338 -43.499 261.064 1.00 32.26  ? 415 SER A O      1 
ATOM   230  C  CB     . SER A 1 25 ? -27.656 -45.732 258.745 1.00 45.23  ? 415 SER A CB     1 
ATOM   231  O  OG     . SER A 1 25 ? -28.628 -46.226 259.636 1.00 49.44  ? 415 SER A OG     1 
ATOM   232  H  H      . SER A 1 25 ? -25.883 -44.397 257.794 1.00 44.39  ? 415 SER A H      1 
ATOM   233  H  HA     . SER A 1 25 ? -28.302 -43.796 258.576 1.00 46.88  ? 415 SER A HA     1 
ATOM   234  H  HB2    . SER A 1 25 ? -27.935 -45.920 257.835 1.00 54.31  ? 415 SER A HB2    1 
ATOM   235  H  HB3    . SER A 1 25 ? -26.807 -46.162 258.930 1.00 54.31  ? 415 SER A HB3    1 
ATOM   236  H  HG     . SER A 1 25 ? -28.712 -47.057 259.538 1.00 59.35  ? 415 SER A HG     1 
ATOM   237  N  N      . HIS A 1 26 ? -26.124 -43.885 260.912 1.00 32.21  ? 416 HIS A N      1 
ATOM   238  C  CA     . HIS A 1 26 ? -25.885 -43.415 262.273 1.00 33.64  ? 416 HIS A CA     1 
ATOM   239  C  C      . HIS A 1 26 ? -26.128 -41.918 262.379 1.00 31.62  ? 416 HIS A C      1 
ATOM   240  O  O      . HIS A 1 26 ? -26.707 -41.442 263.360 1.00 29.93  ? 416 HIS A O      1 
ATOM   241  C  CB     . HIS A 1 26 ? -24.458 -43.735 262.711 1.00 36.17  ? 416 HIS A CB     1 
ATOM   242  C  CG     . HIS A 1 26 ? -24.151 -45.198 262.757 1.00 39.05  ? 416 HIS A CG     1 
ATOM   243  N  ND1    . HIS A 1 26 ? -22.865 -45.681 262.875 1.00 42.00  ? 416 HIS A ND1    1 
ATOM   244  C  CD2    . HIS A 1 26 ? -24.961 -46.282 262.715 1.00 39.56  ? 416 HIS A CD2    1 
ATOM   245  C  CE1    . HIS A 1 26 ? -22.896 -47.002 262.889 1.00 43.15  ? 416 HIS A CE1    1 
ATOM   246  N  NE2    . HIS A 1 26 ? -24.154 -47.392 262.795 1.00 41.89  ? 416 HIS A NE2    1 
ATOM   247  H  H      . HIS A 1 26 ? -25.425 -44.176 260.504 1.00 38.68  ? 416 HIS A H      1 
ATOM   248  H  HA     . HIS A 1 26 ? -26.496 -43.865 262.878 1.00 40.40  ? 416 HIS A HA     1 
ATOM   249  H  HB2    . HIS A 1 26 ? -23.840 -43.323 262.087 1.00 43.44  ? 416 HIS A HB2    1 
ATOM   250  H  HB3    . HIS A 1 26 ? -24.315 -43.375 263.600 1.00 43.44  ? 416 HIS A HB3    1 
ATOM   251  H  HD2    . HIS A 1 26 ? -25.888 -46.277 262.638 1.00 47.50  ? 416 HIS A HD2    1 
ATOM   252  H  HE1    . HIS A 1 26 ? -22.157 -47.562 262.959 1.00 51.81  ? 416 HIS A HE1    1 
ATOM   253  H  HE2    . HIS A 1 26 ? -24.425 -48.208 262.787 1.00 50.30  ? 416 HIS A HE2    1 
ATOM   254  N  N      . LEU A 1 27 ? -25.669 -41.156 261.390 1.00 34.16  ? 417 LEU A N      1 
ATOM   255  C  CA     . LEU A 1 27 ? -25.909 -39.718 261.402 1.00 34.65  ? 417 LEU A CA     1 
ATOM   256  C  C      . LEU A 1 27 ? -27.397 -39.419 261.348 1.00 32.89  ? 417 LEU A C      1 
ATOM   257  O  O      . LEU A 1 27 ? -27.894 -38.563 262.091 1.00 30.56  ? 417 LEU A O      1 
ATOM   258  C  CB     . LEU A 1 27 ? -25.180 -39.047 260.234 1.00 35.98  ? 417 LEU A CB     1 
ATOM   259  C  CG     . LEU A 1 27 ? -25.361 -37.529 260.081 1.00 37.30  ? 417 LEU A CG     1 
ATOM   260  C  CD1    . LEU A 1 27 ? -25.079 -36.783 261.369 1.00 33.64  ? 417 LEU A CD1    1 
ATOM   261  C  CD2    . LEU A 1 27 ? -24.460 -36.990 258.966 1.00 40.50  ? 417 LEU A CD2    1 
ATOM   262  H  H      . LEU A 1 27 ? -25.223 -41.441 260.712 1.00 41.02  ? 417 LEU A H      1 
ATOM   263  H  HA     . LEU A 1 27 ? -25.559 -39.346 262.227 1.00 41.60  ? 417 LEU A HA     1 
ATOM   264  H  HB2    . LEU A 1 27 ? -24.230 -39.213 260.336 1.00 43.21  ? 417 LEU A HB2    1 
ATOM   265  H  HB3    . LEU A 1 27 ? -25.489 -39.456 259.411 1.00 43.21  ? 417 LEU A HB3    1 
ATOM   266  H  HG     . LEU A 1 27 ? -26.280 -37.349 259.831 1.00 44.78  ? 417 LEU A HG     1 
ATOM   267  H  HD11   . LEU A 1 27 ? -25.207 -35.834 261.218 1.00 40.23  ? 417 LEU A HD11   1 
ATOM   268  H  HD12   . LEU A 1 27 ? -25.690 -37.095 262.054 1.00 40.23  ? 417 LEU A HD12   1 
ATOM   269  H  HD13   . LEU A 1 27 ? -24.163 -36.956 261.639 1.00 40.23  ? 417 LEU A HD13   1 
ATOM   270  H  HD21   . LEU A 1 27 ? -24.592 -36.032 258.889 1.00 48.62  ? 417 LEU A HD21   1 
ATOM   271  H  HD22   . LEU A 1 27 ? -23.535 -37.180 259.188 1.00 48.62  ? 417 LEU A HD22   1 
ATOM   272  H  HD23   . LEU A 1 27 ? -24.696 -37.425 258.132 1.00 48.62  ? 417 LEU A HD23   1 
ATOM   273  N  N      . LYS A 1 28 ? -28.132 -40.110 260.472 1.00 35.72  ? 418 LYS A N      1 
ATOM   274  C  CA     . LYS A 1 28 ? -29.567 -39.872 260.384 1.00 35.53  ? 418 LYS A CA     1 
ATOM   275  C  C      . LYS A 1 28 ? -30.225 -40.050 261.750 1.00 31.60  ? 418 LYS A C      1 
ATOM   276  O  O      . LYS A 1 28 ? -31.009 -39.204 262.191 1.00 30.42  ? 418 LYS A O      1 
ATOM   277  C  CB     . LYS A 1 28 ? -30.203 -40.802 259.354 1.00 36.35  ? 418 LYS A CB     1 
ATOM   278  C  CG     . LYS A 1 28 ? -31.701 -40.557 259.167 1.00 39.16  ? 418 LYS A CG     1 
ATOM   279  C  CD     . LYS A 1 28 ? -32.266 -41.289 257.960 1.00 43.51  ? 418 LYS A CD     1 
ATOM   280  C  CE     . LYS A 1 28 ? -33.646 -40.752 257.594 1.00 46.55  ? 418 LYS A CE     1 
ATOM   281  N  NZ     . LYS A 1 28 ? -34.262 -41.467 256.445 1.00 48.73  ? 418 LYS A NZ     1 
ATOM   282  H  H      . LYS A 1 28 ? -27.829 -40.706 259.931 1.00 42.89  ? 418 LYS A H      1 
ATOM   283  H  HA     . LYS A 1 28 ? -29.718 -38.958 260.096 1.00 42.67  ? 418 LYS A HA     1 
ATOM   284  H  HB2    . LYS A 1 28 ? -29.769 -40.666 258.497 1.00 43.65  ? 418 LYS A HB2    1 
ATOM   285  H  HB3    . LYS A 1 28 ? -30.084 -41.720 259.643 1.00 43.65  ? 418 LYS A HB3    1 
ATOM   286  H  HG2    . LYS A 1 28 ? -32.173 -40.869 259.955 1.00 47.01  ? 418 LYS A HG2    1 
ATOM   287  H  HG3    . LYS A 1 28 ? -31.853 -39.608 259.042 1.00 47.01  ? 418 LYS A HG3    1 
ATOM   288  H  HD2    . LYS A 1 28 ? -31.676 -41.159 257.200 1.00 52.24  ? 418 LYS A HD2    1 
ATOM   289  H  HD3    . LYS A 1 28 ? -32.350 -42.233 258.165 1.00 52.24  ? 418 LYS A HD3    1 
ATOM   290  H  HE2    . LYS A 1 28 ? -34.235 -40.850 258.358 1.00 55.89  ? 418 LYS A HE2    1 
ATOM   291  H  HE3    . LYS A 1 28 ? -33.566 -39.815 257.355 1.00 55.89  ? 418 LYS A HE3    1 
ATOM   292  H  HZ1    . LYS A 1 28 ? -35.063 -41.122 256.266 1.00 58.50  ? 418 LYS A HZ1    1 
ATOM   293  H  HZ2    . LYS A 1 28 ? -33.746 -41.387 255.724 1.00 58.50  ? 418 LYS A HZ2    1 
ATOM   294  H  HZ3    . LYS A 1 28 ? -34.356 -42.330 256.639 1.00 58.50  ? 418 LYS A HZ3    1 
ATOM   295  N  N      . ALA A 1 29 ? -29.909 -41.155 262.431 1.00 30.35  ? 419 ALA A N      1 
ATOM   296  C  CA     . ALA A 1 29 ? -30.450 -41.378 263.771 1.00 29.83  ? 419 ALA A CA     1 
ATOM   297  C  C      . ALA A 1 29 ? -30.028 -40.274 264.740 1.00 29.30  ? 419 ALA A C      1 
ATOM   298  O  O      . ALA A 1 29 ? -30.839 -39.818 265.556 1.00 29.77  ? 419 ALA A O      1 
ATOM   299  C  CB     . ALA A 1 29 ? -30.010 -42.751 264.288 1.00 29.98  ? 419 ALA A CB     1 
ATOM   300  H  H      . ALA A 1 29 ? -29.392 -41.779 262.145 1.00 36.44  ? 419 ALA A H      1 
ATOM   301  H  HA     . ALA A 1 29 ? -31.419 -41.375 263.722 1.00 35.82  ? 419 ALA A HA     1 
ATOM   302  H  HB1    . ALA A 1 29 ? -30.376 -42.886 265.176 1.00 36.00  ? 419 ALA A HB1    1 
ATOM   303  H  HB2    . ALA A 1 29 ? -30.342 -43.435 263.686 1.00 36.00  ? 419 ALA A HB2    1 
ATOM   304  H  HB3    . ALA A 1 29 ? -29.041 -42.780 264.320 1.00 36.00  ? 419 ALA A HB3    1 
ATOM   305  N  N      . HIS A 1 30 ? -28.763 -39.832 264.679 1.00 26.51  ? 420 HIS A N      1 
ATOM   306  C  CA     . HIS A 1 30 ? -28.329 -38.772 265.593 1.00 27.22  ? 420 HIS A CA     1 
ATOM   307  C  C      . HIS A 1 30 ? -29.085 -37.478 265.341 1.00 26.59  ? 420 HIS A C      1 
ATOM   308  O  O      . HIS A 1 30 ? -29.352 -36.724 266.284 1.00 26.25  ? 420 HIS A O      1 
ATOM   309  C  CB     . HIS A 1 30 ? -26.827 -38.498 265.466 1.00 31.63  ? 420 HIS A CB     1 
ATOM   310  C  CG     . HIS A 1 30 ? -26.417 -37.167 266.028 1.00 39.16  ? 420 HIS A CG     1 
ATOM   311  N  ND1    . HIS A 1 30 ? -26.274 -36.938 267.380 1.00 40.39  ? 420 HIS A ND1    1 
ATOM   312  C  CD2    . HIS A 1 30 ? -26.153 -35.984 265.419 1.00 42.33  ? 420 HIS A CD2    1 
ATOM   313  C  CE1    . HIS A 1 30 ? -25.924 -35.680 267.577 1.00 43.15  ? 420 HIS A CE1    1 
ATOM   314  N  NE2    . HIS A 1 30 ? -25.846 -35.078 266.403 1.00 46.35  ? 420 HIS A NE2    1 
ATOM   315  H  H      . HIS A 1 30 ? -28.159 -40.118 264.138 1.00 31.67  ? 420 HIS A H      1 
ATOM   316  H  HA     . HIS A 1 30 ? -28.507 -39.050 266.505 1.00 32.69  ? 420 HIS A HA     1 
ATOM   317  H  HB2    . HIS A 1 30 ? -26.340 -39.186 265.945 1.00 37.98  ? 420 HIS A HB2    1 
ATOM   318  H  HB3    . HIS A 1 30 ? -26.583 -38.513 264.527 1.00 37.98  ? 420 HIS A HB3    1 
ATOM   319  H  HD1    . HIS A 1 30 ? -26.388 -37.526 267.998 1.00 48.50  ? 420 HIS A HD1    1 
ATOM   320  H  HD2    . HIS A 1 30 ? -26.171 -35.820 264.504 1.00 50.82  ? 420 HIS A HD2    1 
ATOM   321  H  HE1    . HIS A 1 30 ? -25.762 -35.283 268.403 1.00 51.80  ? 420 HIS A HE1    1 
ATOM   322  N  N      . LEU A 1 31 ? -29.420 -37.194 264.080 1.00 27.04  ? 421 LEU A N      1 
ATOM   323  C  CA     . LEU A 1 31 ? -30.113 -35.948 263.760 1.00 30.80  ? 421 LEU A CA     1 
ATOM   324  C  C      . LEU A 1 31 ? -31.470 -35.860 264.450 1.00 28.57  ? 421 LEU A C      1 
ATOM   325  O  O      . LEU A 1 31 ? -31.963 -34.755 264.694 1.00 30.88  ? 421 LEU A O      1 
ATOM   326  C  CB     . LEU A 1 31 ? -30.263 -35.814 262.236 1.00 32.62  ? 421 LEU A CB     1 
ATOM   327  C  CG     . LEU A 1 31 ? -28.977 -35.416 261.486 1.00 33.94  ? 421 LEU A CG     1 
ATOM   328  C  CD1    . LEU A 1 31 ? -29.115 -35.547 259.974 1.00 35.22  ? 421 LEU A CD1    1 
ATOM   329  C  CD2    . LEU A 1 31 ? -28.583 -33.999 261.808 1.00 36.28  ? 421 LEU A CD2    1 
ATOM   330  H  H      . LEU A 1 31 ? -29.259 -37.698 263.402 1.00 32.31  ? 421 LEU A H      1 
ATOM   331  H  HA     . LEU A 1 31 ? -29.575 -35.204 264.071 1.00 36.99  ? 421 LEU A HA     1 
ATOM   332  H  HB2    . LEU A 1 31 ? -30.558 -36.666 261.878 1.00 39.17  ? 421 LEU A HB2    1 
ATOM   333  H  HB3    . LEU A 1 31 ? -30.931 -35.135 262.050 1.00 39.17  ? 421 LEU A HB3    1 
ATOM   334  H  HG     . LEU A 1 31 ? -28.256 -35.998 261.771 1.00 40.75  ? 421 LEU A HG     1 
ATOM   335  H  HD11   . LEU A 1 31 ? -28.279 -35.284 259.557 1.00 42.30  ? 421 LEU A HD11   1 
ATOM   336  H  HD12   . LEU A 1 31 ? -29.319 -36.470 259.755 1.00 42.30  ? 421 LEU A HD12   1 
ATOM   337  H  HD13   . LEU A 1 31 ? -29.832 -34.968 259.671 1.00 42.30  ? 421 LEU A HD13   1 
ATOM   338  H  HD21   . LEU A 1 31 ? -27.772 -33.780 261.322 1.00 43.57  ? 421 LEU A HD21   1 
ATOM   339  H  HD22   . LEU A 1 31 ? -29.300 -33.404 261.542 1.00 43.57  ? 421 LEU A HD22   1 
ATOM   340  H  HD23   . LEU A 1 31 ? -28.427 -33.924 262.763 1.00 43.57  ? 421 LEU A HD23   1 
ATOM   341  N  N      . ARG A 1 32 ? -32.077 -36.999 264.780 1.00 26.77  ? 422 ARG A N      1 
ATOM   342  C  CA     . ARG A 1 32 ? -33.339 -36.994 265.520 1.00 30.70  ? 422 ARG A CA     1 
ATOM   343  C  C      . ARG A 1 32 ? -33.199 -36.353 266.896 1.00 30.51  ? 422 ARG A C      1 
ATOM   344  O  O      . ARG A 1 32 ? -34.176 -35.805 267.424 1.00 32.42  ? 422 ARG A O      1 
ATOM   345  C  CB     . ARG A 1 32 ? -33.864 -38.425 265.646 1.00 30.08  ? 422 ARG A CB     1 
ATOM   346  C  CG     . ARG A 1 32 ? -34.000 -39.097 264.315 1.00 32.09  ? 422 ARG A CG     1 
ATOM   347  C  CD     . ARG A 1 32 ? -34.819 -40.347 264.366 1.00 33.93  ? 422 ARG A CD     1 
ATOM   348  N  NE     . ARG A 1 32 ? -34.890 -40.925 263.032 1.00 37.58  ? 422 ARG A NE     1 
ATOM   349  C  CZ     . ARG A 1 32 ? -34.340 -42.079 262.659 1.00 39.98  ? 422 ARG A CZ     1 
ATOM   350  N  NH1    . ARG A 1 32 ? -33.685 -42.848 263.523 1.00 39.24  ? 422 ARG A NH1    1 
ATOM   351  N  NH2    . ARG A 1 32 ? -34.470 -42.473 261.403 1.00 41.47  ? 422 ARG A NH2    1 
ATOM   352  H  H      . ARG A 1 32 ? -31.782 -37.783 264.589 1.00 32.16  ? 422 ARG A H      1 
ATOM   353  H  HA     . ARG A 1 32 ? -33.992 -36.481 265.019 1.00 36.87  ? 422 ARG A HA     1 
ATOM   354  H  HB2    . ARG A 1 32 ? -33.247 -38.944 266.185 1.00 36.12  ? 422 ARG A HB2    1 
ATOM   355  H  HB3    . ARG A 1 32 ? -34.739 -38.406 266.065 1.00 36.12  ? 422 ARG A HB3    1 
ATOM   356  H  HG2    . ARG A 1 32 ? -34.428 -38.485 263.696 1.00 38.54  ? 422 ARG A HG2    1 
ATOM   357  H  HG3    . ARG A 1 32 ? -33.117 -39.332 263.990 1.00 38.54  ? 422 ARG A HG3    1 
ATOM   358  H  HD2    . ARG A 1 32 ? -34.401 -40.988 264.961 1.00 40.74  ? 422 ARG A HD2    1 
ATOM   359  H  HD3    . ARG A 1 32 ? -35.718 -40.137 264.663 1.00 40.74  ? 422 ARG A HD3    1 
ATOM   360  H  HE     . ARG A 1 32 ? -35.324 -40.484 262.435 1.00 45.12  ? 422 ARG A HE     1 
ATOM   361  H  HH11   . ARG A 1 32 ? -33.593 -42.596 264.340 1.00 47.12  ? 422 ARG A HH11   1 
ATOM   362  H  HH12   . ARG A 1 32 ? -33.342 -43.593 263.262 1.00 47.12  ? 422 ARG A HH12   1 
ATOM   363  H  HH21   . ARG A 1 32 ? -34.900 -41.985 260.841 1.00 49.79  ? 422 ARG A HH21   1 
ATOM   364  H  HH22   . ARG A 1 32 ? -34.131 -43.222 261.151 1.00 49.79  ? 422 ARG A HH22   1 
ATOM   365  N  N      . THR A 1 33 ? -32.009 -36.402 267.503 1.00 32.38  ? 423 THR A N      1 
ATOM   366  C  CA     . THR A 1 33 ? -31.828 -35.680 268.757 1.00 32.69  ? 423 THR A CA     1 
ATOM   367  C  C      . THR A 1 33 ? -31.983 -34.182 268.570 1.00 32.89  ? 423 THR A C      1 
ATOM   368  O  O      . THR A 1 33 ? -32.284 -33.481 269.537 1.00 33.31  ? 423 THR A O      1 
ATOM   369  C  CB     . THR A 1 33 ? -30.455 -35.947 269.390 1.00 37.34  ? 423 THR A CB     1 
ATOM   370  O  OG1    . THR A 1 33 ? -29.429 -35.331 268.599 1.00 39.64  ? 423 THR A OG1    1 
ATOM   371  C  CG2    . THR A 1 33 ? -30.192 -37.437 269.545 1.00 38.81  ? 423 THR A CG2    1 
ATOM   372  H  H      . THR A 1 33 ? -31.319 -36.830 267.220 1.00 38.88  ? 423 THR A H      1 
ATOM   373  H  HA     . THR A 1 33 ? -32.507 -35.973 269.386 1.00 39.26  ? 423 THR A HA     1 
ATOM   374  H  HB     . THR A 1 33 ? -30.441 -35.553 270.277 1.00 44.84  ? 423 THR A HB     1 
ATOM   375  H  HG1    . THR A 1 33 ? -29.439 -35.646 267.820 1.00 47.59  ? 423 THR A HG1    1 
ATOM   376  H  HG21   . THR A 1 33 ? -29.320 -37.580 269.946 1.00 46.60  ? 423 THR A HG21   1 
ATOM   377  H  HG22   . THR A 1 33 ? -30.870 -37.836 270.112 1.00 46.60  ? 423 THR A HG22   1 
ATOM   378  H  HG23   . THR A 1 33 ? -30.214 -37.869 268.676 1.00 46.60  ? 423 THR A HG23   1 
ATOM   379  N  N      . HIS A 1 34 ? -31.776 -33.668 267.354 1.00 29.79  ? 424 HIS A N      1 
ATOM   380  C  CA     . HIS A 1 34 ? -31.962 -32.243 267.111 1.00 36.32  ? 424 HIS A CA     1 
ATOM   381  C  C      . HIS A 1 34 ? -33.381 -31.925 266.644 1.00 37.42  ? 424 HIS A C      1 
ATOM   382  O  O      . HIS A 1 34 ? -33.905 -30.849 266.961 1.00 40.53  ? 424 HIS A O      1 
ATOM   383  C  CB     . HIS A 1 34 ? -30.951 -31.726 266.067 1.00 40.12  ? 424 HIS A CB     1 
ATOM   384  C  CG     . HIS A 1 34 ? -29.510 -31.871 266.469 1.00 45.17  ? 424 HIS A CG     1 
ATOM   385  N  ND1    . HIS A 1 34 ? -28.960 -31.196 267.538 1.00 47.97  ? 424 HIS A ND1    1 
ATOM   386  C  CD2    . HIS A 1 34 ? -28.498 -32.588 265.921 1.00 47.23  ? 424 HIS A CD2    1 
ATOM   387  C  CE1    . HIS A 1 34 ? -27.679 -31.506 267.642 1.00 49.97  ? 424 HIS A CE1    1 
ATOM   388  N  NE2    . HIS A 1 34 ? -27.372 -32.346 266.671 1.00 50.89  ? 424 HIS A NE2    1 
ATOM   389  H  H      . HIS A 1 34 ? -31.531 -34.119 266.664 1.00 35.78  ? 424 HIS A H      1 
ATOM   390  H  HA     . HIS A 1 34 ? -31.807 -31.761 267.938 1.00 43.61  ? 424 HIS A HA     1 
ATOM   391  H  HB2    . HIS A 1 34 ? -31.078 -32.221 265.242 1.00 48.17  ? 424 HIS A HB2    1 
ATOM   392  H  HB3    . HIS A 1 34 ? -31.120 -30.784 265.912 1.00 48.17  ? 424 HIS A HB3    1 
ATOM   393  H  HD1    . HIS A 1 34 ? -29.386 -30.663 268.062 1.00 57.59  ? 424 HIS A HD1    1 
ATOM   394  H  HD2    . HIS A 1 34 ? -28.556 -33.146 265.179 1.00 56.71  ? 424 HIS A HD2    1 
ATOM   395  H  HE1    . HIS A 1 34 ? -27.092 -31.183 268.287 1.00 59.99  ? 424 HIS A HE1    1 
ATOM   396  N  N      . THR A 1 35 ? -34.014 -32.837 265.902 1.00 39.56  ? 425 THR A N      1 
ATOM   397  C  CA     . THR A 1 35 ? -35.321 -32.584 265.304 1.00 40.59  ? 425 THR A CA     1 
ATOM   398  C  C      . THR A 1 35 ? -36.489 -33.031 266.177 1.00 40.68  ? 425 THR A C      1 
ATOM   399  O  O      . THR A 1 35 ? -37.613 -32.562 265.961 1.00 41.77  ? 425 THR A O      1 
ATOM   400  C  CB     . THR A 1 35 ? -35.440 -33.292 263.946 1.00 41.44  ? 425 THR A CB     1 
ATOM   401  O  OG1    . THR A 1 35 ? -35.336 -34.714 264.120 1.00 40.91  ? 425 THR A OG1    1 
ATOM   402  C  CG2    . THR A 1 35 ? -34.361 -32.841 263.003 1.00 41.01  ? 425 THR A CG2    1 
ATOM   403  H  H      . THR A 1 35 ? -33.700 -33.619 265.729 1.00 47.50  ? 425 THR A H      1 
ATOM   404  H  HA     . THR A 1 35 ? -35.414 -31.631 265.151 1.00 48.74  ? 425 THR A HA     1 
ATOM   405  H  HB     . THR A 1 35 ? -36.299 -33.080 263.548 1.00 49.76  ? 425 THR A HB     1 
ATOM   406  H  HG1    . THR A 1 35 ? -35.401 -35.100 263.376 1.00 49.11  ? 425 THR A HG1    1 
ATOM   407  H  HG21   . THR A 1 35 ? -34.452 -33.298 262.152 1.00 49.24  ? 425 THR A HG21   1 
ATOM   408  H  HG22   . THR A 1 35 ? -34.428 -31.884 262.856 1.00 49.24  ? 425 THR A HG22   1 
ATOM   409  H  HG23   . THR A 1 35 ? -33.489 -33.042 263.377 1.00 49.24  ? 425 THR A HG23   1 
ATOM   410  N  N      . GLY A 1 36 ? -36.261 -33.928 267.138 1.00 38.38  ? 426 GLY A N      1 
ATOM   411  C  CA     . GLY A 1 36 ? -37.351 -34.528 267.891 1.00 37.64  ? 426 GLY A CA     1 
ATOM   412  C  C      . GLY A 1 36 ? -38.146 -35.567 267.134 1.00 37.46  ? 426 GLY A C      1 
ATOM   413  O  O      . GLY A 1 36 ? -39.182 -36.023 267.625 1.00 38.17  ? 426 GLY A O      1 
ATOM   414  H  H      . GLY A 1 36 ? -35.480 -34.203 267.370 1.00 46.08  ? 426 GLY A H      1 
ATOM   415  H  HA2    . GLY A 1 36 ? -36.990 -34.948 268.687 1.00 45.20  ? 426 GLY A HA2    1 
ATOM   416  H  HA3    . GLY A 1 36 ? -37.962 -33.829 268.172 1.00 45.20  ? 426 GLY A HA3    1 
ATOM   417  N  N      . GLU A 1 37 ? -37.697 -35.949 265.948 1.00 34.98  ? 427 GLU A N      1 
ATOM   418  C  CA     . GLU A 1 37 ? -38.375 -36.979 265.184 1.00 36.89  ? 427 GLU A CA     1 
ATOM   419  C  C      . GLU A 1 37 ? -38.269 -38.320 265.903 1.00 34.99  ? 427 GLU A C      1 
ATOM   420  O  O      . GLU A 1 37 ? -37.183 -38.709 266.350 1.00 29.68  ? 427 GLU A O      1 
ATOM   421  C  CB     . GLU A 1 37 ? -37.760 -37.062 263.788 1.00 39.23  ? 427 GLU A CB     1 
ATOM   422  C  CG     . GLU A 1 37 ? -38.590 -37.795 262.803 1.00 44.27  ? 427 GLU A CG     1 
ATOM   423  C  CD     . GLU A 1 37 ? -39.739 -36.954 262.261 1.00 47.99  ? 427 GLU A CD     1 
ATOM   424  O  OE1    . GLU A 1 37 ? -40.892 -37.425 262.330 1.00 49.38  ? 427 GLU A OE1    1 
ATOM   425  O  OE2    . GLU A 1 37 ? -39.483 -35.830 261.770 1.00 48.45  ? 427 GLU A OE2    1 
ATOM   426  H  H      . GLU A 1 37 ? -36.999 -35.626 265.563 1.00 42.01  ? 427 GLU A H      1 
ATOM   427  H  HA     . GLU A 1 37 ? -39.314 -36.750 265.094 1.00 44.30  ? 427 GLU A HA     1 
ATOM   428  H  HB2    . GLU A 1 37 ? -37.628 -36.162 263.451 1.00 47.10  ? 427 GLU A HB2    1 
ATOM   429  H  HB3    . GLU A 1 37 ? -36.905 -37.517 263.851 1.00 47.10  ? 427 GLU A HB3    1 
ATOM   430  H  HG2    . GLU A 1 37 ? -38.033 -38.061 262.055 1.00 53.15  ? 427 GLU A HG2    1 
ATOM   431  H  HG3    . GLU A 1 37 ? -38.968 -38.580 263.230 1.00 53.15  ? 427 GLU A HG3    1 
ATOM   432  N  N      . LYS A 1 38 ? -39.399 -39.030 266.006 1.00 31.59  ? 428 LYS A N      1 
ATOM   433  C  CA     . LYS A 1 38 ? -39.481 -40.315 266.712 1.00 32.80  ? 428 LYS A CA     1 
ATOM   434  C  C      . LYS A 1 38 ? -40.284 -41.283 265.854 1.00 31.36  ? 428 LYS A C      1 
ATOM   435  O  O      . LYS A 1 38 ? -41.501 -41.433 266.025 1.00 31.36  ? 428 LYS A O      1 
ATOM   436  C  CB     . LYS A 1 38 ? -40.114 -40.149 268.098 1.00 36.59  ? 428 LYS A CB     1 
ATOM   437  C  CG     . LYS A 1 38 ? -39.279 -39.323 269.055 1.00 39.40  ? 428 LYS A CG     1 
ATOM   438  C  CD     . LYS A 1 38 ? -39.878 -39.274 270.447 1.00 43.09  ? 428 LYS A CD     1 
ATOM   439  C  CE     . LYS A 1 38 ? -38.983 -38.499 271.410 1.00 49.50  ? 428 LYS A CE     1 
ATOM   440  N  NZ     . LYS A 1 38 ? -39.531 -38.496 272.808 1.00 55.52  ? 428 LYS A NZ     1 
ATOM   441  H  H      . LYS A 1 38 ? -40.149 -38.781 265.666 1.00 37.94  ? 428 LYS A H      1 
ATOM   442  H  HA     . LYS A 1 38 ? -38.588 -40.676 266.826 1.00 39.38  ? 428 LYS A HA     1 
ATOM   443  H  HB2    . LYS A 1 38 ? -40.973 -39.710 267.999 1.00 43.93  ? 428 LYS A HB2    1 
ATOM   444  H  HB3    . LYS A 1 38 ? -40.237 -41.027 268.493 1.00 43.93  ? 428 LYS A HB3    1 
ATOM   445  H  HG2    . LYS A 1 38 ? -38.393 -39.714 269.122 1.00 47.31  ? 428 LYS A HG2    1 
ATOM   446  H  HG3    . LYS A 1 38 ? -39.218 -38.415 268.720 1.00 47.31  ? 428 LYS A HG3    1 
ATOM   447  H  HD2    . LYS A 1 38 ? -40.740 -38.831 270.409 1.00 51.73  ? 428 LYS A HD2    1 
ATOM   448  H  HD3    . LYS A 1 38 ? -39.979 -40.178 270.785 1.00 51.73  ? 428 LYS A HD3    1 
ATOM   449  H  HE2    . LYS A 1 38 ? -38.105 -38.910 271.430 1.00 59.42  ? 428 LYS A HE2    1 
ATOM   450  H  HE3    . LYS A 1 38 ? -38.914 -37.579 271.111 1.00 59.42  ? 428 LYS A HE3    1 
ATOM   451  H  HZ1    . LYS A 1 38 ? -38.990 -38.038 273.346 1.00 66.66  ? 428 LYS A HZ1    1 
ATOM   452  H  HZ2    . LYS A 1 38 ? -40.337 -38.118 272.818 1.00 66.66  ? 428 LYS A HZ2    1 
ATOM   453  H  HZ3    . LYS A 1 38 ? -39.600 -39.331 273.109 1.00 66.66  ? 428 LYS A HZ3    1 
ATOM   454  N  N      . PRO A 1 39 ? -39.634 -41.951 264.898 1.00 31.93  ? 429 PRO A N      1 
ATOM   455  C  CA     . PRO A 1 39 ? -40.388 -42.724 263.901 1.00 30.28  ? 429 PRO A CA     1 
ATOM   456  C  C      . PRO A 1 39 ? -40.938 -44.056 264.380 1.00 29.07  ? 429 PRO A C      1 
ATOM   457  O  O      . PRO A 1 39 ? -41.707 -44.671 263.632 1.00 30.80  ? 429 PRO A O      1 
ATOM   458  C  CB     . PRO A 1 39 ? -39.353 -42.965 262.788 1.00 31.21  ? 429 PRO A CB     1 
ATOM   459  C  CG     . PRO A 1 39 ? -38.234 -42.035 263.060 1.00 31.82  ? 429 PRO A CG     1 
ATOM   460  C  CD     . PRO A 1 39 ? -38.208 -41.859 264.538 1.00 31.33  ? 429 PRO A CD     1 
ATOM   461  H  HA     . PRO A 1 39 ? -41.116 -42.190 263.547 1.00 36.36  ? 429 PRO A HA     1 
ATOM   462  H  HB2    . PRO A 1 39 ? -39.047 -43.885 262.822 1.00 37.48  ? 429 PRO A HB2    1 
ATOM   463  H  HB3    . PRO A 1 39 ? -39.754 -42.772 261.926 1.00 37.48  ? 429 PRO A HB3    1 
ATOM   464  H  HG2    . PRO A 1 39 ? -37.403 -42.425 262.748 1.00 38.21  ? 429 PRO A HG2    1 
ATOM   465  H  HG3    . PRO A 1 39 ? -38.401 -41.187 262.619 1.00 38.21  ? 429 PRO A HG3    1 
ATOM   466  H  HD2    . PRO A 1 39 ? -37.705 -42.575 264.956 1.00 37.63  ? 429 PRO A HD2    1 
ATOM   467  H  HD3    . PRO A 1 39 ? -37.854 -40.987 264.770 1.00 37.63  ? 429 PRO A HD3    1 
ATOM   468  N  N      . TYR A 1 40 ? -40.555 -44.548 265.553 1.00 24.83  ? 430 TYR A N      1 
ATOM   469  C  CA     . TYR A 1 40 ? -40.896 -45.906 265.971 1.00 27.08  ? 430 TYR A CA     1 
ATOM   470  C  C      . TYR A 1 40 ? -41.951 -45.836 267.076 1.00 26.19  ? 430 TYR A C      1 
ATOM   471  O  O      . TYR A 1 40 ? -41.637 -45.494 268.218 1.00 27.09  ? 430 TYR A O      1 
ATOM   472  C  CB     . TYR A 1 40 ? -39.639 -46.659 266.409 1.00 25.79  ? 430 TYR A CB     1 
ATOM   473  C  CG     . TYR A 1 40 ? -38.594 -46.666 265.305 1.00 26.48  ? 430 TYR A CG     1 
ATOM   474  C  CD1    . TYR A 1 40 ? -38.607 -47.640 264.318 1.00 26.37  ? 430 TYR A CD1    1 
ATOM   475  C  CD2    . TYR A 1 40 ? -37.620 -45.673 265.237 1.00 26.88  ? 430 TYR A CD2    1 
ATOM   476  C  CE1    . TYR A 1 40 ? -37.671 -47.631 263.304 1.00 29.72  ? 430 TYR A CE1    1 
ATOM   477  C  CE2    . TYR A 1 40 ? -36.686 -45.663 264.241 1.00 28.17  ? 430 TYR A CE2    1 
ATOM   478  C  CZ     . TYR A 1 40 ? -36.713 -46.636 263.267 1.00 29.17  ? 430 TYR A CZ     1 
ATOM   479  O  OH     . TYR A 1 40 ? -35.774 -46.624 262.268 1.00 31.44  ? 430 TYR A OH     1 
ATOM   480  H  H      . TYR A 1 40 ? -40.091 -44.112 266.132 1.00 29.82  ? 430 TYR A H      1 
ATOM   481  H  HA     . TYR A 1 40 ? -41.281 -46.381 265.218 1.00 32.52  ? 430 TYR A HA     1 
ATOM   482  H  HB2    . TYR A 1 40 ? -39.257 -46.223 267.187 1.00 30.98  ? 430 TYR A HB2    1 
ATOM   483  H  HB3    . TYR A 1 40 ? -39.870 -47.578 266.617 1.00 30.98  ? 430 TYR A HB3    1 
ATOM   484  H  HD1    . TYR A 1 40 ? -39.255 -48.307 264.339 1.00 31.67  ? 430 TYR A HD1    1 
ATOM   485  H  HD2    . TYR A 1 40 ? -37.598 -45.010 265.888 1.00 32.28  ? 430 TYR A HD2    1 
ATOM   486  H  HE1    . TYR A 1 40 ? -37.685 -48.292 262.649 1.00 35.69  ? 430 TYR A HE1    1 
ATOM   487  H  HE2    . TYR A 1 40 ? -36.041 -44.994 264.214 1.00 33.83  ? 430 TYR A HE2    1 
ATOM   488  H  HH     . TYR A 1 40 ? -35.897 -47.274 261.750 1.00 37.75  ? 430 TYR A HH     1 
ATOM   489  N  N      . HIS A 1 41 ? -43.192 -46.172 266.717 1.00 26.04  ? 431 HIS A N      1 
ATOM   490  C  CA     . HIS A 1 41 ? -44.367 -45.994 267.565 1.00 30.53  ? 431 HIS A CA     1 
ATOM   491  C  C      . HIS A 1 41 ? -44.819 -47.316 268.182 1.00 29.39  ? 431 HIS A C      1 
ATOM   492  O  O      . HIS A 1 41 ? -45.090 -48.280 267.459 1.00 30.81  ? 431 HIS A O      1 
ATOM   493  C  CB     . HIS A 1 41 ? -45.514 -45.413 266.737 1.00 29.66  ? 431 HIS A CB     1 
ATOM   494  C  CG     . HIS A 1 41 ? -45.192 -44.113 266.065 1.00 32.11  ? 431 HIS A CG     1 
ATOM   495  N  ND1    . HIS A 1 41 ? -46.086 -43.462 265.239 1.00 36.32  ? 431 HIS A ND1    1 
ATOM   496  C  CD2    . HIS A 1 41 ? -44.069 -43.353 266.078 1.00 31.96  ? 431 HIS A CD2    1 
ATOM   497  C  CE1    . HIS A 1 41 ? -45.532 -42.351 264.782 1.00 36.26  ? 431 HIS A CE1    1 
ATOM   498  N  NE2    . HIS A 1 41 ? -44.311 -42.260 265.280 1.00 32.64  ? 431 HIS A NE2    1 
ATOM   499  H  H      . HIS A 1 41 ? -43.382 -46.520 265.954 1.00 31.27  ? 431 HIS A H      1 
ATOM   500  H  HA     . HIS A 1 41 ? -44.158 -45.374 268.281 1.00 36.66  ? 431 HIS A HA     1 
ATOM   501  H  HB2    . HIS A 1 41 ? -45.753 -46.051 266.047 1.00 35.62  ? 431 HIS A HB2    1 
ATOM   502  H  HB3    . HIS A 1 41 ? -46.274 -45.263 267.321 1.00 35.62  ? 431 HIS A HB3    1 
ATOM   503  H  HD1    . HIS A 1 41 ? -46.880 -43.734 265.055 1.00 43.61  ? 431 HIS A HD1    1 
ATOM   504  H  HD2    . HIS A 1 41 ? -43.287 -43.531 266.549 1.00 38.38  ? 431 HIS A HD2    1 
ATOM   505  H  HE1    . HIS A 1 41 ? -45.935 -41.737 264.211 1.00 43.54  ? 431 HIS A HE1    1 
ATOM   506  N  N      . CYS A 1 42 ? -44.945 -47.350 269.509 1.00 28.66  ? 432 CYS A N      1 
ATOM   507  C  CA     . CYS A 1 42 ? -45.578 -48.483 270.171 1.00 29.53  ? 432 CYS A CA     1 
ATOM   508  C  C      . CYS A 1 42 ? -47.031 -48.637 269.728 1.00 32.02  ? 432 CYS A C      1 
ATOM   509  O  O      . CYS A 1 42 ? -47.791 -47.664 269.712 1.00 33.12  ? 432 CYS A O      1 
ATOM   510  C  CB     . CYS A 1 42 ? -45.522 -48.307 271.687 1.00 32.42  ? 432 CYS A CB     1 
ATOM   511  S  SG     . CYS A 1 42 ? -46.224 -49.704 272.533 1.00 33.19  ? 432 CYS A SG     1 
ATOM   512  H  H      . CYS A 1 42 ? -44.674 -46.732 270.042 1.00 34.42  ? 432 CYS A H      1 
ATOM   513  H  HA     . CYS A 1 42 ? -45.101 -49.296 269.941 1.00 35.47  ? 432 CYS A HA     1 
ATOM   514  H  HB2    . CYS A 1 42 ? -44.598 -48.216 271.965 1.00 38.93  ? 432 CYS A HB2    1 
ATOM   515  H  HB3    . CYS A 1 42 ? -46.027 -47.516 271.936 1.00 38.93  ? 432 CYS A HB3    1 
ATOM   516  N  N      . ASP A 1 43 ? -47.427 -49.870 269.389 1.00 34.02  ? 433 ASP A N      1 
ATOM   517  C  CA     . ASP A 1 43 ? -48.801 -50.175 268.992 1.00 41.25  ? 433 ASP A CA     1 
ATOM   518  C  C      . ASP A 1 43 ? -49.593 -50.852 270.098 1.00 39.50  ? 433 ASP A C      1 
ATOM   519  O  O      . ASP A 1 43 ? -50.701 -51.331 269.847 1.00 43.10  ? 433 ASP A O      1 
ATOM   520  C  CB     . ASP A 1 43 ? -48.834 -51.077 267.751 1.00 54.11  ? 433 ASP A CB     1 
ATOM   521  C  CG     . ASP A 1 43 ? -48.115 -50.478 266.556 1.00 67.03  ? 433 ASP A CG     1 
ATOM   522  O  OD1    . ASP A 1 43 ? -48.130 -49.236 266.398 1.00 71.42  ? 433 ASP A OD1    1 
ATOM   523  O  OD2    . ASP A 1 43 ? -47.539 -51.262 265.765 1.00 71.54  ? 433 ASP A OD2    1 
ATOM   524  H  H      . ASP A 1 43 ? -46.907 -50.555 269.382 1.00 40.85  ? 433 ASP A H      1 
ATOM   525  H  HA     . ASP A 1 43 ? -49.252 -49.346 268.768 1.00 49.53  ? 433 ASP A HA     1 
ATOM   526  H  HB2    . ASP A 1 43 ? -48.406 -51.921 267.965 1.00 64.96  ? 433 ASP A HB2    1 
ATOM   527  H  HB3    . ASP A 1 43 ? -49.758 -51.229 267.498 1.00 64.96  ? 433 ASP A HB3    1 
ATOM   528  N  N      . TRP A 1 44 ? -49.044 -50.932 271.303 1.00 38.08  ? 434 TRP A N      1 
ATOM   529  C  CA     . TRP A 1 44 ? -49.759 -51.544 272.413 1.00 40.56  ? 434 TRP A CA     1 
ATOM   530  C  C      . TRP A 1 44 ? -51.014 -50.742 272.714 1.00 44.68  ? 434 TRP A C      1 
ATOM   531  O  O      . TRP A 1 44 ? -50.970 -49.514 272.799 1.00 46.03  ? 434 TRP A O      1 
ATOM   532  C  CB     . TRP A 1 44 ? -48.849 -51.598 273.640 1.00 37.18  ? 434 TRP A CB     1 
ATOM   533  C  CG     . TRP A 1 44 ? -49.284 -52.575 274.716 1.00 39.63  ? 434 TRP A CG     1 
ATOM   534  C  CD1    . TRP A 1 44 ? -50.062 -52.308 275.806 1.00 42.25  ? 434 TRP A CD1    1 
ATOM   535  C  CD2    . TRP A 1 44 ? -48.942 -53.963 274.800 1.00 39.97  ? 434 TRP A CD2    1 
ATOM   536  N  NE1    . TRP A 1 44 ? -50.233 -53.446 276.559 1.00 43.24  ? 434 TRP A NE1    1 
ATOM   537  C  CE2    . TRP A 1 44 ? -49.554 -54.475 275.964 1.00 42.41  ? 434 TRP A CE2    1 
ATOM   538  C  CE3    . TRP A 1 44 ? -48.181 -54.826 274.002 1.00 38.58  ? 434 TRP A CE3    1 
ATOM   539  C  CZ2    . TRP A 1 44 ? -49.433 -55.807 276.348 1.00 44.37  ? 434 TRP A CZ2    1 
ATOM   540  C  CZ3    . TRP A 1 44 ? -48.056 -56.153 274.390 1.00 39.74  ? 434 TRP A CZ3    1 
ATOM   541  C  CH2    . TRP A 1 44 ? -48.681 -56.628 275.552 1.00 43.38  ? 434 TRP A CH2    1 
ATOM   542  H  H      . TRP A 1 44 ? -48.261 -50.640 271.503 1.00 45.72  ? 434 TRP A H      1 
ATOM   543  H  HA     . TRP A 1 44 ? -50.017 -52.449 272.177 1.00 48.70  ? 434 TRP A HA     1 
ATOM   544  H  HB2    . TRP A 1 44 ? -47.959 -51.855 273.353 1.00 44.64  ? 434 TRP A HB2    1 
ATOM   545  H  HB3    . TRP A 1 44 ? -48.819 -50.715 274.041 1.00 44.64  ? 434 TRP A HB3    1 
ATOM   546  H  HD1    . TRP A 1 44 ? -50.427 -51.476 276.007 1.00 50.73  ? 434 TRP A HD1    1 
ATOM   547  H  HE1    . TRP A 1 44 ? -50.690 -53.501 277.285 1.00 51.92  ? 434 TRP A HE1    1 
ATOM   548  H  HE3    . TRP A 1 44 ? -47.765 -54.515 273.230 1.00 46.32  ? 434 TRP A HE3    1 
ATOM   549  H  HZ2    . TRP A 1 44 ? -49.843 -56.127 277.119 1.00 53.28  ? 434 TRP A HZ2    1 
ATOM   550  H  HZ3    . TRP A 1 44 ? -47.554 -56.737 273.869 1.00 47.72  ? 434 TRP A HZ3    1 
ATOM   551  H  HH2    . TRP A 1 44 ? -48.582 -57.522 275.787 1.00 52.08  ? 434 TRP A HH2    1 
ATOM   552  N  N      . ASP A 1 45 ? -52.135 -51.437 272.865 1.00 51.33  ? 435 ASP A N      1 
ATOM   553  C  CA     . ASP A 1 45 ? -53.405 -50.773 273.135 1.00 55.76  ? 435 ASP A CA     1 
ATOM   554  C  C      . ASP A 1 45 ? -53.264 -49.756 274.265 1.00 55.03  ? 435 ASP A C      1 
ATOM   555  O  O      . ASP A 1 45 ? -52.815 -50.088 275.364 1.00 54.99  ? 435 ASP A O      1 
ATOM   556  C  CB     . ASP A 1 45 ? -54.460 -51.822 273.489 1.00 61.00  ? 435 ASP A CB     1 
ATOM   557  C  CG     . ASP A 1 45 ? -55.870 -51.270 273.443 1.00 67.46  ? 435 ASP A CG     1 
ATOM   558  O  OD1    . ASP A 1 45 ? -56.094 -50.267 272.727 1.00 69.07  ? 435 ASP A OD1    1 
ATOM   559  O  OD2    . ASP A 1 45 ? -56.755 -51.843 274.113 1.00 71.65  ? 435 ASP A OD2    1 
ATOM   560  H  H      . ASP A 1 45 ? -52.188 -52.293 272.816 1.00 61.62  ? 435 ASP A H      1 
ATOM   561  H  HA     . ASP A 1 45 ? -53.697 -50.304 272.338 1.00 66.94  ? 435 ASP A HA     1 
ATOM   562  H  HB2    . ASP A 1 45 ? -54.404 -52.554 272.855 1.00 73.23  ? 435 ASP A HB2    1 
ATOM   563  H  HB3    . ASP A 1 45 ? -54.294 -52.147 274.388 1.00 73.23  ? 435 ASP A HB3    1 
ATOM   564  N  N      . GLY A 1 46 ? -53.636 -48.507 273.985 1.00 51.83  ? 436 GLY A N      1 
ATOM   565  C  CA     . GLY A 1 46 ? -53.639 -47.472 274.995 1.00 51.91  ? 436 GLY A CA     1 
ATOM   566  C  C      . GLY A 1 46 ? -52.333 -46.728 275.177 1.00 50.15  ? 436 GLY A C      1 
ATOM   567  O  O      . GLY A 1 46 ? -52.323 -45.696 275.863 1.00 50.75  ? 436 GLY A O      1 
ATOM   568  H  H      . GLY A 1 46 ? -53.891 -48.239 273.208 1.00 62.22  ? 436 GLY A H      1 
ATOM   569  H  HA2    . GLY A 1 46 ? -54.322 -46.820 274.771 1.00 62.32  ? 436 GLY A HA2    1 
ATOM   570  H  HA3    . GLY A 1 46 ? -53.875 -47.869 275.848 1.00 62.32  ? 436 GLY A HA3    1 
ATOM   571  N  N      . CYS A 1 47 ? -51.235 -47.211 274.596 1.00 48.08  ? 437 CYS A N      1 
ATOM   572  C  CA     . CYS A 1 47 ? -49.920 -46.605 274.767 1.00 45.61  ? 437 CYS A CA     1 
ATOM   573  C  C      . CYS A 1 47 ? -49.580 -45.718 273.573 1.00 45.27  ? 437 CYS A C      1 
ATOM   574  O  O      . CYS A 1 47 ? -49.771 -46.106 272.413 1.00 46.23  ? 437 CYS A O      1 
ATOM   575  C  CB     . CYS A 1 47 ? -48.854 -47.691 274.943 1.00 43.16  ? 437 CYS A CB     1 
ATOM   576  S  SG     . CYS A 1 47 ? -47.198 -47.084 275.333 1.00 40.67  ? 437 CYS A SG     1 
ATOM   577  H  H      . CYS A 1 47 ? -51.229 -47.905 274.088 1.00 57.72  ? 437 CYS A H      1 
ATOM   578  H  HA     . CYS A 1 47 ? -49.925 -46.052 275.564 1.00 54.76  ? 437 CYS A HA     1 
ATOM   579  H  HB2    . CYS A 1 47 ? -49.128 -48.277 275.666 1.00 51.82  ? 437 CYS A HB2    1 
ATOM   580  H  HB3    . CYS A 1 47 ? -48.793 -48.198 274.119 1.00 51.82  ? 437 CYS A HB3    1 
ATOM   581  N  N      . GLY A 1 48 ? -49.067 -44.527 273.863 1.00 43.34  ? 438 GLY A N      1 
ATOM   582  C  CA     . GLY A 1 48 ? -48.716 -43.589 272.819 1.00 42.69  ? 438 GLY A CA     1 
ATOM   583  C  C      . GLY A 1 48 ? -47.241 -43.251 272.788 1.00 38.75  ? 438 GLY A C      1 
ATOM   584  O  O      . GLY A 1 48 ? -46.849 -42.215 272.243 1.00 38.08  ? 438 GLY A O      1 
ATOM   585  H  H      . GLY A 1 48 ? -48.914 -44.242 274.660 1.00 52.03  ? 438 GLY A H      1 
ATOM   586  H  HA2    . GLY A 1 48 ? -48.961 -43.963 271.958 1.00 51.26  ? 438 GLY A HA2    1 
ATOM   587  H  HA3    . GLY A 1 48 ? -49.214 -42.767 272.947 1.00 51.26  ? 438 GLY A HA3    1 
ATOM   588  N  N      . TRP A 1 49 ? -46.413 -44.119 273.358 1.00 33.67  ? 439 TRP A N      1 
ATOM   589  C  CA     . TRP A 1 49 ? -44.981 -43.881 273.348 1.00 32.42  ? 439 TRP A CA     1 
ATOM   590  C  C      . TRP A 1 49 ? -44.396 -44.070 271.951 1.00 29.45  ? 439 TRP A C      1 
ATOM   591  O  O      . TRP A 1 49 ? -44.805 -44.956 271.190 1.00 27.48  ? 439 TRP A O      1 
ATOM   592  C  CB     . TRP A 1 49 ? -44.288 -44.805 274.356 1.00 35.63  ? 439 TRP A CB     1 
ATOM   593  C  CG     . TRP A 1 49 ? -44.292 -44.238 275.740 1.00 41.31  ? 439 TRP A CG     1 
ATOM   594  C  CD1    . TRP A 1 49 ? -45.254 -44.406 276.696 1.00 44.86  ? 439 TRP A CD1    1 
ATOM   595  C  CD2    . TRP A 1 49 ? -43.293 -43.394 276.319 1.00 43.94  ? 439 TRP A CD2    1 
ATOM   596  N  NE1    . TRP A 1 49 ? -44.911 -43.722 277.837 1.00 46.71  ? 439 TRP A NE1    1 
ATOM   597  C  CE2    . TRP A 1 49 ? -43.711 -43.091 277.631 1.00 47.37  ? 439 TRP A CE2    1 
ATOM   598  C  CE3    . TRP A 1 49 ? -42.083 -42.865 275.857 1.00 45.26  ? 439 TRP A CE3    1 
ATOM   599  C  CZ2    . TRP A 1 49 ? -42.961 -42.286 278.488 1.00 50.36  ? 439 TRP A CZ2    1 
ATOM   600  C  CZ3    . TRP A 1 49 ? -41.339 -42.071 276.706 1.00 48.09  ? 439 TRP A CZ3    1 
ATOM   601  C  CH2    . TRP A 1 49 ? -41.781 -41.786 278.009 1.00 49.53  ? 439 TRP A CH2    1 
ATOM   602  H  H      . TRP A 1 49 ? -46.653 -44.845 273.751 1.00 40.43  ? 439 TRP A H      1 
ATOM   603  H  HA     . TRP A 1 49 ? -44.813 -42.965 273.619 1.00 38.94  ? 439 TRP A HA     1 
ATOM   604  H  HB2    . TRP A 1 49 ? -44.752 -45.656 274.377 1.00 42.79  ? 439 TRP A HB2    1 
ATOM   605  H  HB3    . TRP A 1 49 ? -43.365 -44.935 274.085 1.00 42.79  ? 439 TRP A HB3    1 
ATOM   606  H  HD1    . TRP A 1 49 ? -46.029 -44.909 276.589 1.00 53.86  ? 439 TRP A HD1    1 
ATOM   607  H  HE1    . TRP A 1 49 ? -45.373 -43.693 278.562 1.00 56.08  ? 439 TRP A HE1    1 
ATOM   608  H  HE3    . TRP A 1 49 ? -41.783 -43.050 274.996 1.00 54.34  ? 439 TRP A HE3    1 
ATOM   609  H  HZ2    . TRP A 1 49 ? -43.250 -42.098 279.351 1.00 60.46  ? 439 TRP A HZ2    1 
ATOM   610  H  HZ3    . TRP A 1 49 ? -40.534 -41.713 276.409 1.00 57.74  ? 439 TRP A HZ3    1 
ATOM   611  H  HH2    . TRP A 1 49 ? -41.260 -41.246 278.558 1.00 59.46  ? 439 TRP A HH2    1 
ATOM   612  N  N      . LYS A 1 50 ? -43.439 -43.207 271.621 1.00 28.77  ? 440 LYS A N      1 
ATOM   613  C  CA     . LYS A 1 50 ? -42.674 -43.262 270.388 1.00 28.62  ? 440 LYS A CA     1 
ATOM   614  C  C      . LYS A 1 50 ? -41.194 -43.097 270.717 1.00 29.39  ? 440 LYS A C      1 
ATOM   615  O  O      . LYS A 1 50 ? -40.827 -42.571 271.771 1.00 31.52  ? 440 LYS A O      1 
ATOM   616  C  CB     . LYS A 1 50 ? -43.128 -42.162 269.414 1.00 30.64  ? 440 LYS A CB     1 
ATOM   617  C  CG     . LYS A 1 50 ? -44.643 -42.116 269.233 1.00 33.93  ? 440 LYS A CG     1 
ATOM   618  C  CD     . LYS A 1 50 ? -45.070 -40.937 268.399 1.00 38.36  ? 440 LYS A CD     1 
ATOM   619  C  CE     . LYS A 1 50 ? -46.581 -40.825 268.399 1.00 43.99  ? 440 LYS A CE     1 
ATOM   620  N  NZ     . LYS A 1 50 ? -47.042 -39.721 267.525 1.00 47.34  ? 440 LYS A NZ     1 
ATOM   621  H  H      . LYS A 1 50 ? -43.207 -42.550 272.125 1.00 34.55  ? 440 LYS A H      1 
ATOM   622  H  HA     . LYS A 1 50 ? -42.803 -44.124 269.964 1.00 34.37  ? 440 LYS A HA     1 
ATOM   623  H  HB2    . LYS A 1 50 ? -42.841 -41.300 269.754 1.00 36.80  ? 440 LYS A HB2    1 
ATOM   624  H  HB3    . LYS A 1 50 ? -42.728 -42.325 268.545 1.00 36.80  ? 440 LYS A HB3    1 
ATOM   625  H  HG2    . LYS A 1 50 ? -44.936 -42.926 268.786 1.00 40.74  ? 440 LYS A HG2    1 
ATOM   626  H  HG3    . LYS A 1 50 ? -45.067 -42.042 270.102 1.00 40.74  ? 440 LYS A HG3    1 
ATOM   627  H  HD2    . LYS A 1 50 ? -44.700 -40.123 268.773 1.00 46.06  ? 440 LYS A HD2    1 
ATOM   628  H  HD3    . LYS A 1 50 ? -44.769 -41.059 267.485 1.00 46.06  ? 440 LYS A HD3    1 
ATOM   629  H  HE2    . LYS A 1 50 ? -46.963 -41.654 268.071 1.00 52.81  ? 440 LYS A HE2    1 
ATOM   630  H  HE3    . LYS A 1 50 ? -46.889 -40.647 269.302 1.00 52.81  ? 440 LYS A HE3    1 
ATOM   631  H  HZ1    . LYS A 1 50 ? -47.931 -39.673 267.539 1.00 56.84  ? 440 LYS A HZ1    1 
ATOM   632  H  HZ2    . LYS A 1 50 ? -46.706 -38.948 267.808 1.00 56.84  ? 440 LYS A HZ2    1 
ATOM   633  H  HZ3    . LYS A 1 50 ? -46.774 -39.864 266.688 1.00 56.84  ? 440 LYS A HZ3    1 
ATOM   634  N  N      . PHE A 1 51 ? -40.338 -43.521 269.789 1.00 30.37  ? 441 PHE A N      1 
ATOM   635  C  CA     . PHE A 1 51 ? -38.906 -43.574 270.045 1.00 29.53  ? 441 PHE A CA     1 
ATOM   636  C  C      . PHE A 1 51 ? -38.127 -43.199 268.794 1.00 28.49  ? 441 PHE A C      1 
ATOM   637  O  O      . PHE A 1 51 ? -38.602 -43.361 267.663 1.00 26.77  ? 441 PHE A O      1 
ATOM   638  C  CB     . PHE A 1 51 ? -38.500 -44.973 270.525 1.00 27.83  ? 441 PHE A CB     1 
ATOM   639  C  CG     . PHE A 1 51 ? -39.201 -45.389 271.759 1.00 26.52  ? 441 PHE A CG     1 
ATOM   640  C  CD1    . PHE A 1 51 ? -40.405 -46.068 271.697 1.00 26.11  ? 441 PHE A CD1    1 
ATOM   641  C  CD2    . PHE A 1 51 ? -38.668 -45.082 273.002 1.00 30.05  ? 441 PHE A CD2    1 
ATOM   642  C  CE1    . PHE A 1 51 ? -41.062 -46.442 272.860 1.00 29.30  ? 441 PHE A CE1    1 
ATOM   643  C  CE2    . PHE A 1 51 ? -39.317 -45.453 274.159 1.00 30.65  ? 441 PHE A CE2    1 
ATOM   644  C  CZ     . PHE A 1 51 ? -40.517 -46.129 274.088 1.00 30.38  ? 441 PHE A CZ     1 
ATOM   645  H  H      . PHE A 1 51 ? -40.564 -43.784 269.002 1.00 36.47  ? 441 PHE A H      1 
ATOM   646  H  HA     . PHE A 1 51 ? -38.683 -42.937 270.743 1.00 35.47  ? 441 PHE A HA     1 
ATOM   647  H  HB2    . PHE A 1 51 ? -38.709 -45.617 269.831 1.00 33.42  ? 441 PHE A HB2    1 
ATOM   648  H  HB3    . PHE A 1 51 ? -37.547 -44.979 270.706 1.00 33.42  ? 441 PHE A HB3    1 
ATOM   649  H  HD1    . PHE A 1 51 ? -40.775 -46.276 270.870 1.00 31.36  ? 441 PHE A HD1    1 
ATOM   650  H  HD2    . PHE A 1 51 ? -37.862 -44.622 273.054 1.00 36.09  ? 441 PHE A HD2    1 
ATOM   651  H  HE1    . PHE A 1 51 ? -41.869 -46.901 272.811 1.00 35.19  ? 441 PHE A HE1    1 
ATOM   652  H  HE2    . PHE A 1 51 ? -38.949 -45.243 274.987 1.00 36.81  ? 441 PHE A HE2    1 
ATOM   653  H  HZ     . PHE A 1 51 ? -40.954 -46.383 274.869 1.00 36.49  ? 441 PHE A HZ     1 
ATOM   654  N  N      . ALA A 1 52 ? -36.905 -42.715 269.013 1.00 28.15  ? 442 ALA A N      1 
ATOM   655  C  CA     . ALA A 1 52 ? -36.044 -42.328 267.906 1.00 29.74  ? 442 ALA A CA     1 
ATOM   656  C  C      . ALA A 1 52 ? -35.334 -43.520 267.273 1.00 26.72  ? 442 ALA A C      1 
ATOM   657  O  O      . ALA A 1 52 ? -34.879 -43.419 266.124 1.00 26.88  ? 442 ALA A O      1 
ATOM   658  C  CB     . ALA A 1 52 ? -35.023 -41.291 268.390 1.00 33.98  ? 442 ALA A CB     1 
ATOM   659  H  H      . ALA A 1 52 ? -36.555 -42.602 269.790 1.00 33.81  ? 442 ALA A H      1 
ATOM   660  H  HA     . ALA A 1 52 ? -36.588 -41.910 267.220 1.00 35.71  ? 442 ALA A HA     1 
ATOM   661  H  HB1    . ALA A 1 52 ? -34.453 -41.039 267.647 1.00 40.81  ? 442 ALA A HB1    1 
ATOM   662  H  HB2    . ALA A 1 52 ? -35.497 -40.513 268.723 1.00 40.81  ? 442 ALA A HB2    1 
ATOM   663  H  HB3    . ALA A 1 52 ? -34.489 -41.682 269.099 1.00 40.81  ? 442 ALA A HB3    1 
ATOM   664  N  N      . ARG A 1 53 ? -35.238 -44.648 267.980 1.00 23.39  ? 443 ARG A N      1 
ATOM   665  C  CA     . ARG A 1 53 ? -34.554 -45.836 267.477 1.00 22.84  ? 443 ARG A CA     1 
ATOM   666  C  C      . ARG A 1 53 ? -35.449 -47.061 267.612 1.00 24.29  ? 443 ARG A C      1 
ATOM   667  O  O      . ARG A 1 53 ? -36.181 -47.203 268.599 1.00 24.98  ? 443 ARG A O      1 
ATOM   668  C  CB     . ARG A 1 53 ? -33.228 -46.070 268.226 1.00 24.46  ? 443 ARG A CB     1 
ATOM   669  C  CG     . ARG A 1 53 ? -32.178 -45.020 267.931 1.00 24.83  ? 443 ARG A CG     1 
ATOM   670  C  CD     . ARG A 1 53 ? -30.995 -45.061 268.893 1.00 30.21  ? 443 ARG A CD     1 
ATOM   671  N  NE     . ARG A 1 53 ? -30.502 -46.422 269.164 1.00 29.87  ? 443 ARG A NE     1 
ATOM   672  C  CZ     . ARG A 1 53 ? -29.226 -46.743 269.360 1.00 31.19  ? 443 ARG A CZ     1 
ATOM   673  N  NH1    . ARG A 1 53 ? -28.886 -48.005 269.614 1.00 31.76  ? 443 ARG A NH1    1 
ATOM   674  N  NH2    . ARG A 1 53 ? -28.283 -45.812 269.302 1.00 29.71  ? 443 ARG A NH2    1 
ATOM   675  H  H      . ARG A 1 53 ? -35.567 -44.748 268.768 1.00 28.10  ? 443 ARG A H      1 
ATOM   676  H  HA     . ARG A 1 53 ? -34.352 -45.712 266.537 1.00 27.44  ? 443 ARG A HA     1 
ATOM   677  H  HB2    . ARG A 1 53 ? -33.401 -46.060 269.181 1.00 29.38  ? 443 ARG A HB2    1 
ATOM   678  H  HB3    . ARG A 1 53 ? -32.869 -46.933 267.965 1.00 29.38  ? 443 ARG A HB3    1 
ATOM   679  H  HG2    . ARG A 1 53 ? -31.837 -45.159 267.034 1.00 29.82  ? 443 ARG A HG2    1 
ATOM   680  H  HG3    . ARG A 1 53 ? -32.585 -44.142 267.998 1.00 29.82  ? 443 ARG A HG3    1 
ATOM   681  H  HD2    . ARG A 1 53 ? -30.263 -44.551 268.511 1.00 36.28  ? 443 ARG A HD2    1 
ATOM   682  H  HD3    . ARG A 1 53 ? -31.264 -44.669 269.738 1.00 36.28  ? 443 ARG A HD3    1 
ATOM   683  H  HE     . ARG A 1 53 ? -31.082 -47.056 269.198 1.00 35.87  ? 443 ARG A HE     1 
ATOM   684  H  HH11   . ARG A 1 53 ? -29.492 -48.615 269.650 1.00 38.14  ? 443 ARG A HH11   1 
ATOM   685  H  HH12   . ARG A 1 53 ? -28.060 -48.212 269.734 1.00 38.14  ? 443 ARG A HH12   1 
ATOM   686  H  HH21   . ARG A 1 53 ? -28.496 -44.994 269.142 1.00 35.67  ? 443 ARG A HH21   1 
ATOM   687  H  HH22   . ARG A 1 53 ? -27.460 -46.026 269.427 1.00 35.67  ? 443 ARG A HH22   1 
ATOM   688  N  N      . SER A 1 54 ? -35.358 -47.960 266.628 1.00 24.14  ? 444 SER A N      1 
ATOM   689  C  CA     . SER A 1 54 ? -36.154 -49.183 266.655 1.00 24.92  ? 444 SER A CA     1 
ATOM   690  C  C      . SER A 1 54 ? -35.867 -50.005 267.903 1.00 24.40  ? 444 SER A C      1 
ATOM   691  O  O      . SER A 1 54 ? -36.788 -50.581 268.506 1.00 23.89  ? 444 SER A O      1 
ATOM   692  C  CB     . SER A 1 54 ? -35.866 -50.024 265.406 1.00 26.58  ? 444 SER A CB     1 
ATOM   693  O  OG     . SER A 1 54 ? -34.499 -50.438 265.368 1.00 26.46  ? 444 SER A OG     1 
ATOM   694  H  H      . SER A 1 54 ? -34.847 -47.884 265.941 1.00 29.00  ? 444 SER A H      1 
ATOM   695  H  HA     . SER A 1 54 ? -37.096 -48.952 266.654 1.00 29.94  ? 444 SER A HA     1 
ATOM   696  H  HB2    . SER A 1 54 ? -36.433 -50.811 265.419 1.00 31.92  ? 444 SER A HB2    1 
ATOM   697  H  HB3    . SER A 1 54 ? -36.056 -49.492 264.618 1.00 31.92  ? 444 SER A HB3    1 
ATOM   698  H  HG     . SER A 1 54 ? -34.357 -50.897 264.679 1.00 31.78  ? 444 SER A HG     1 
ATOM   699  N  N      . ASP A 1 55 ? -34.591 -50.081 268.298 1.00 25.71  ? 445 ASP A N      1 
ATOM   700  C  CA     . ASP A 1 55 ? -34.195 -50.918 269.433 1.00 26.71  ? 445 ASP A CA     1 
ATOM   701  C  C      . ASP A 1 55 ? -34.682 -50.335 270.752 1.00 28.14  ? 445 ASP A C      1 
ATOM   702  O  O      . ASP A 1 55 ? -34.882 -51.074 271.724 1.00 29.55  ? 445 ASP A O      1 
ATOM   703  C  CB     . ASP A 1 55 ? -32.675 -51.095 269.466 1.00 27.25  ? 445 ASP A CB     1 
ATOM   704  C  CG     . ASP A 1 55 ? -31.921 -49.796 269.188 1.00 33.17  ? 445 ASP A CG     1 
ATOM   705  O  OD1    . ASP A 1 55 ? -31.849 -49.367 268.012 1.00 33.87  ? 445 ASP A OD1    1 
ATOM   706  O  OD2    . ASP A 1 55 ? -31.389 -49.212 270.139 1.00 35.44  ? 445 ASP A OD2    1 
ATOM   707  H  H      . ASP A 1 55 ? -33.940 -49.660 267.926 1.00 30.88  ? 445 ASP A H      1 
ATOM   708  H  HA     . ASP A 1 55 ? -34.595 -51.796 269.330 1.00 32.08  ? 445 ASP A HA     1 
ATOM   709  H  HB2    . ASP A 1 55 ? -32.413 -51.411 270.345 1.00 32.73  ? 445 ASP A HB2    1 
ATOM   710  H  HB3    . ASP A 1 55 ? -32.418 -51.741 268.791 1.00 32.73  ? 445 ASP A HB3    1 
ATOM   711  N  N      . GLU A 1 56 ? -34.872 -49.019 270.804 1.00 27.69  ? 446 GLU A N      1 
ATOM   712  C  CA     . GLU A 1 56 ? -35.530 -48.412 271.951 1.00 26.09  ? 446 GLU A CA     1 
ATOM   713  C  C      . GLU A 1 56 ? -36.980 -48.867 272.050 1.00 27.18  ? 446 GLU A C      1 
ATOM   714  O  O      . GLU A 1 56 ? -37.473 -49.139 273.150 1.00 28.18  ? 446 GLU A O      1 
ATOM   715  C  CB     . GLU A 1 56 ? -35.428 -46.890 271.856 1.00 24.63  ? 446 GLU A CB     1 
ATOM   716  C  CG     . GLU A 1 56 ? -34.046 -46.367 272.160 1.00 28.22  ? 446 GLU A CG     1 
ATOM   717  C  CD     . GLU A 1 56 ? -33.872 -44.878 271.879 1.00 31.61  ? 446 GLU A CD     1 
ATOM   718  O  OE1    . GLU A 1 56 ? -32.934 -44.285 272.451 1.00 33.88  ? 446 GLU A OE1    1 
ATOM   719  O  OE2    . GLU A 1 56 ? -34.645 -44.306 271.070 1.00 30.88  ? 446 GLU A OE2    1 
ATOM   720  H  H      . GLU A 1 56 ? -34.632 -48.463 270.194 1.00 33.25  ? 446 GLU A H      1 
ATOM   721  H  HA     . GLU A 1 56 ? -35.074 -48.692 272.760 1.00 31.33  ? 446 GLU A HA     1 
ATOM   722  H  HB2    . GLU A 1 56 ? -35.660 -46.615 270.956 1.00 29.59  ? 446 GLU A HB2    1 
ATOM   723  H  HB3    . GLU A 1 56 ? -36.044 -46.493 272.492 1.00 29.59  ? 446 GLU A HB3    1 
ATOM   724  H  HG2    . GLU A 1 56 ? -33.855 -46.515 273.100 1.00 33.89  ? 446 GLU A HG2    1 
ATOM   725  H  HG3    . GLU A 1 56 ? -33.403 -46.848 271.615 1.00 33.89  ? 446 GLU A HG3    1 
ATOM   726  N  N      . LEU A 1 57 ? -37.675 -48.985 270.910 1.00 25.36  ? 447 LEU A N      1 
ATOM   727  C  CA     . LEU A 1 57 ? -39.039 -49.517 270.935 1.00 23.95  ? 447 LEU A CA     1 
ATOM   728  C  C      . LEU A 1 57 ? -39.046 -50.979 271.360 1.00 25.55  ? 447 LEU A C      1 
ATOM   729  O  O      . LEU A 1 57 ? -39.955 -51.430 272.073 1.00 25.21  ? 447 LEU A O      1 
ATOM   730  C  CB     . LEU A 1 57 ? -39.707 -49.355 269.567 1.00 23.67  ? 447 LEU A CB     1 
ATOM   731  C  CG     . LEU A 1 57 ? -41.117 -49.954 269.417 1.00 26.25  ? 447 LEU A CG     1 
ATOM   732  C  CD1    . LEU A 1 57 ? -42.080 -49.413 270.468 1.00 28.71  ? 447 LEU A CD1    1 
ATOM   733  C  CD2    . LEU A 1 57 ? -41.697 -49.739 268.011 1.00 27.39  ? 447 LEU A CD2    1 
ATOM   734  H  H      . LEU A 1 57 ? -37.386 -48.768 270.130 1.00 30.46  ? 447 LEU A H      1 
ATOM   735  H  HA     . LEU A 1 57 ? -39.560 -49.016 271.582 1.00 28.76  ? 447 LEU A HA     1 
ATOM   736  H  HB2    . LEU A 1 57 ? -39.775 -48.407 269.373 1.00 28.43  ? 447 LEU A HB2    1 
ATOM   737  H  HB3    . LEU A 1 57 ? -39.142 -49.779 268.902 1.00 28.43  ? 447 LEU A HB3    1 
ATOM   738  H  HG     . LEU A 1 57 ? -41.052 -50.912 269.555 1.00 31.53  ? 447 LEU A HG     1 
ATOM   739  H  HD11   . LEU A 1 57 ? -42.952 -49.817 270.335 1.00 34.48  ? 447 LEU A HD11   1 
ATOM   740  H  HD12   . LEU A 1 57 ? -41.742 -49.636 271.350 1.00 34.48  ? 447 LEU A HD12   1 
ATOM   741  H  HD13   . LEU A 1 57 ? -42.143 -48.450 270.372 1.00 34.48  ? 447 LEU A HD13   1 
ATOM   742  H  HD21   . LEU A 1 57 ? -42.582 -50.134 267.971 1.00 32.90  ? 447 LEU A HD21   1 
ATOM   743  H  HD22   . LEU A 1 57 ? -41.751 -48.787 267.834 1.00 32.90  ? 447 LEU A HD22   1 
ATOM   744  H  HD23   . LEU A 1 57 ? -41.115 -50.164 267.361 1.00 32.90  ? 447 LEU A HD23   1 
ATOM   745  N  N      . THR A 1 58 ? -38.038 -51.738 270.937 1.00 26.77  ? 448 THR A N      1 
ATOM   746  C  CA     . THR A 1 58 ? -37.956 -53.130 271.348 1.00 27.66  ? 448 THR A CA     1 
ATOM   747  C  C      . THR A 1 58 ? -37.827 -53.230 272.861 1.00 28.80  ? 448 THR A C      1 
ATOM   748  O  O      . THR A 1 58 ? -38.488 -54.059 273.493 1.00 29.68  ? 448 THR A O      1 
ATOM   749  C  CB     . THR A 1 58 ? -36.786 -53.801 270.634 1.00 30.13  ? 448 THR A CB     1 
ATOM   750  O  OG1    . THR A 1 58 ? -37.050 -53.816 269.217 1.00 28.86  ? 448 THR A OG1    1 
ATOM   751  C  CG2    . THR A 1 58 ? -36.557 -55.224 271.136 1.00 33.75  ? 448 THR A CG2    1 
ATOM   752  H  H      . THR A 1 58 ? -37.402 -51.475 270.422 1.00 32.15  ? 448 THR A H      1 
ATOM   753  H  HA     . THR A 1 58 ? -38.770 -53.587 271.086 1.00 33.22  ? 448 THR A HA     1 
ATOM   754  H  HB     . THR A 1 58 ? -35.979 -53.290 270.800 1.00 36.18  ? 448 THR A HB     1 
ATOM   755  H  HG1    . THR A 1 58 ? -37.138 -53.031 268.933 1.00 34.66  ? 448 THR A HG1    1 
ATOM   756  H  HG21   . THR A 1 58 ? -35.809 -55.625 270.665 1.00 40.52  ? 448 THR A HG21   1 
ATOM   757  H  HG22   . THR A 1 58 ? -36.362 -55.213 272.086 1.00 40.52  ? 448 THR A HG22   1 
ATOM   758  H  HG23   . THR A 1 58 ? -37.350 -55.761 270.983 1.00 40.52  ? 448 THR A HG23   1 
ATOM   759  N  N      . ARG A 1 59 ? -36.998 -52.372 273.461 1.00 25.03  ? 449 ARG A N      1 
ATOM   760  C  CA     . ARG A 1 59 ? -36.874 -52.354 274.918 1.00 27.70  ? 449 ARG A CA     1 
ATOM   761  C  C      . ARG A 1 59 ? -38.204 -52.002 275.574 1.00 28.13  ? 449 ARG A C      1 
ATOM   762  O  O      . ARG A 1 59 ? -38.611 -52.637 276.556 1.00 27.59  ? 449 ARG A O      1 
ATOM   763  C  CB     . ARG A 1 59 ? -35.796 -51.358 275.329 1.00 26.43  ? 449 ARG A CB     1 
ATOM   764  C  CG     . ARG A 1 59 ? -34.374 -51.813 275.073 1.00 30.41  ? 449 ARG A CG     1 
ATOM   765  C  CD     . ARG A 1 59 ? -33.428 -50.652 275.285 1.00 28.11  ? 449 ARG A CD     1 
ATOM   766  N  NE     . ARG A 1 59 ? -32.048 -51.086 275.380 1.00 30.56  ? 449 ARG A NE     1 
ATOM   767  C  CZ     . ARG A 1 59 ? -31.037 -50.292 275.704 1.00 32.36  ? 449 ARG A CZ     1 
ATOM   768  N  NH1    . ARG A 1 59 ? -29.811 -50.784 275.772 1.00 35.19  ? 449 ARG A NH1    1 
ATOM   769  N  NH2    . ARG A 1 59 ? -31.255 -49.006 275.958 1.00 31.85  ? 449 ARG A NH2    1 
ATOM   770  H  H      . ARG A 1 59 ? -36.503 -51.799 273.052 1.00 30.06  ? 449 ARG A H      1 
ATOM   771  H  HA     . ARG A 1 59 ? -36.608 -53.234 275.226 1.00 33.27  ? 449 ARG A HA     1 
ATOM   772  H  HB2    . ARG A 1 59 ? -35.933 -50.534 274.837 1.00 31.75  ? 449 ARG A HB2    1 
ATOM   773  H  HB3    . ARG A 1 59 ? -35.881 -51.187 276.280 1.00 31.75  ? 449 ARG A HB3    1 
ATOM   774  H  HG2    . ARG A 1 59 ? -34.141 -52.521 275.693 1.00 36.52  ? 449 ARG A HG2    1 
ATOM   775  H  HG3    . ARG A 1 59 ? -34.290 -52.119 274.156 1.00 36.52  ? 449 ARG A HG3    1 
ATOM   776  H  HD2    . ARG A 1 59 ? -33.502 -50.040 274.536 1.00 33.59  ? 449 ARG A HD2    1 
ATOM   777  H  HD3    . ARG A 1 59 ? -33.660 -50.199 276.111 1.00 33.59  ? 449 ARG A HD3    1 
ATOM   778  H  HE     . ARG A 1 59 ? -31.874 -51.912 275.214 1.00 36.53  ? 449 ARG A HE     1 
ATOM   779  H  HH11   . ARG A 1 59 ? -29.671 -51.616 275.605 1.00 42.09  ? 449 ARG A HH11   1 
ATOM   780  H  HH12   . ARG A 1 59 ? -29.152 -50.270 275.978 1.00 42.09  ? 449 ARG A HH12   1 
ATOM   781  H  HH21   . ARG A 1 59 ? -32.053 -48.689 275.915 1.00 38.08  ? 449 ARG A HH21   1 
ATOM   782  H  HH22   . ARG A 1 59 ? -30.598 -48.492 276.167 1.00 38.08  ? 449 ARG A HH22   1 
ATOM   783  N  N      . HIS A 1 60 ? -38.902 -51.003 275.035 1.00 27.66  ? 450 HIS A N      1 
ATOM   784  C  CA     . HIS A 1 60 ? -40.224 -50.635 275.533 1.00 29.85  ? 450 HIS A CA     1 
ATOM   785  C  C      . HIS A 1 60 ? -41.214 -51.800 275.430 1.00 30.07  ? 450 HIS A C      1 
ATOM   786  O  O      . HIS A 1 60 ? -41.926 -52.102 276.387 1.00 32.28  ? 450 HIS A O      1 
ATOM   787  C  CB     . HIS A 1 60 ? -40.724 -49.407 274.763 1.00 32.13  ? 450 HIS A CB     1 
ATOM   788  C  CG     . HIS A 1 60 ? -42.094 -48.936 275.153 1.00 37.57  ? 450 HIS A CG     1 
ATOM   789  N  ND1    . HIS A 1 60 ? -42.332 -48.202 276.294 1.00 40.67  ? 450 HIS A ND1    1 
ATOM   790  C  CD2    . HIS A 1 60 ? -43.294 -49.076 274.540 1.00 39.21  ? 450 HIS A CD2    1 
ATOM   791  C  CE1    . HIS A 1 60 ? -43.621 -47.919 276.373 1.00 42.64  ? 450 HIS A CE1    1 
ATOM   792  N  NE2    . HIS A 1 60 ? -44.227 -48.439 275.321 1.00 43.23  ? 450 HIS A NE2    1 
ATOM   793  H  H      . HIS A 1 60 ? -38.629 -50.521 274.377 1.00 33.22  ? 450 HIS A H      1 
ATOM   794  H  HA     . HIS A 1 60 ? -40.150 -50.390 276.469 1.00 35.85  ? 450 HIS A HA     1 
ATOM   795  H  HB2    . HIS A 1 60 ? -40.108 -48.674 274.915 1.00 38.58  ? 450 HIS A HB2    1 
ATOM   796  H  HB3    . HIS A 1 60 ? -40.747 -49.623 273.817 1.00 38.58  ? 450 HIS A HB3    1 
ATOM   797  H  HD1    . HIS A 1 60 ? -41.736 -47.967 276.868 1.00 48.83  ? 450 HIS A HD1    1 
ATOM   798  H  HD2    . HIS A 1 60 ? -43.457 -49.525 273.742 1.00 47.08  ? 450 HIS A HD2    1 
ATOM   799  H  HE1    . HIS A 1 60 ? -44.031 -47.437 277.054 1.00 51.20  ? 450 HIS A HE1    1 
ATOM   800  N  N      . TYR A 1 61 ? -41.274 -52.475 274.275 1.00 29.86  ? 451 TYR A N      1 
ATOM   801  C  CA     . TYR A 1 61 ? -42.218 -53.587 274.144 1.00 32.32  ? 451 TYR A CA     1 
ATOM   802  C  C      . TYR A 1 61 ? -41.975 -54.664 275.193 1.00 34.33  ? 451 TYR A C      1 
ATOM   803  O  O      . TYR A 1 61 ? -42.914 -55.371 275.580 1.00 33.35  ? 451 TYR A O      1 
ATOM   804  C  CB     . TYR A 1 61 ? -42.145 -54.223 272.753 1.00 35.80  ? 451 TYR A CB     1 
ATOM   805  C  CG     . TYR A 1 61 ? -43.098 -53.636 271.732 1.00 37.22  ? 451 TYR A CG     1 
ATOM   806  C  CD1    . TYR A 1 61 ? -44.441 -53.448 272.032 1.00 39.33  ? 451 TYR A CD1    1 
ATOM   807  C  CD2    . TYR A 1 61 ? -42.652 -53.279 270.464 1.00 35.82  ? 451 TYR A CD2    1 
ATOM   808  C  CE1    . TYR A 1 61 ? -45.313 -52.913 271.102 1.00 39.77  ? 451 TYR A CE1    1 
ATOM   809  C  CE2    . TYR A 1 61 ? -43.512 -52.735 269.524 1.00 36.91  ? 451 TYR A CE2    1 
ATOM   810  C  CZ     . TYR A 1 61 ? -44.838 -52.551 269.845 1.00 38.32  ? 451 TYR A CZ     1 
ATOM   811  O  OH     . TYR A 1 61 ? -45.691 -52.019 268.909 1.00 37.49  ? 451 TYR A OH     1 
ATOM   812  H  H      . TYR A 1 61 ? -40.796 -52.316 273.578 1.00 35.86  ? 451 TYR A H      1 
ATOM   813  H  HA     . TYR A 1 61 ? -43.118 -53.248 274.269 1.00 38.81  ? 451 TYR A HA     1 
ATOM   814  H  HB2    . TYR A 1 61 ? -41.245 -54.113 272.410 1.00 42.99  ? 451 TYR A HB2    1 
ATOM   815  H  HB3    . TYR A 1 61 ? -42.349 -55.168 272.834 1.00 42.99  ? 451 TYR A HB3    1 
ATOM   816  H  HD1    . TYR A 1 61 ? -44.758 -53.683 272.874 1.00 47.22  ? 451 TYR A HD1    1 
ATOM   817  H  HD2    . TYR A 1 61 ? -41.755 -53.396 270.247 1.00 43.01  ? 451 TYR A HD2    1 
ATOM   818  H  HE1    . TYR A 1 61 ? -46.209 -52.788 271.318 1.00 47.75  ? 451 TYR A HE1    1 
ATOM   819  H  HE2    . TYR A 1 61 ? -43.197 -52.498 268.682 1.00 44.32  ? 451 TYR A HE2    1 
ATOM   820  H  HH     . TYR A 1 61 ? -45.271 -51.848 268.202 1.00 45.02  ? 451 TYR A HH     1 
ATOM   821  N  N      . ARG A 1 62 ? -40.733 -54.827 275.656 1.00 37.49  ? 452 ARG A N      1 
ATOM   822  C  CA     . ARG A 1 62 ? -40.491 -55.842 276.672 1.00 43.19  ? 452 ARG A CA     1 
ATOM   823  C  C      . ARG A 1 62 ? -40.993 -55.408 278.045 1.00 45.26  ? 452 ARG A C      1 
ATOM   824  O  O      . ARG A 1 62 ? -41.258 -56.269 278.892 1.00 46.09  ? 452 ARG A O      1 
ATOM   825  C  CB     . ARG A 1 62 ? -39.002 -56.217 276.690 1.00 46.09  ? 452 ARG A CB     1 
ATOM   826  C  CG     . ARG A 1 62 ? -38.650 -57.045 275.444 1.00 47.24  ? 452 ARG A CG     1 
ATOM   827  C  CD     . ARG A 1 62 ? -37.223 -57.563 275.355 1.00 50.70  ? 452 ARG A CD     1 
ATOM   828  N  NE     . ARG A 1 62 ? -37.075 -58.261 274.078 1.00 53.50  ? 452 ARG A NE     1 
ATOM   829  C  CZ     . ARG A 1 62 ? -35.941 -58.394 273.388 1.00 55.82  ? 452 ARG A CZ     1 
ATOM   830  N  NH1    . ARG A 1 62 ? -35.961 -59.035 272.224 1.00 56.06  ? 452 ARG A NH1    1 
ATOM   831  N  NH2    . ARG A 1 62 ? -34.795 -57.892 273.840 1.00 57.21  ? 452 ARG A NH2    1 
ATOM   832  H  H      . ARG A 1 62 ? -40.041 -54.381 275.407 1.00 45.01  ? 452 ARG A H      1 
ATOM   833  H  HA     . ARG A 1 62 ? -40.985 -56.640 276.427 1.00 51.86  ? 452 ARG A HA     1 
ATOM   834  H  HB2    . ARG A 1 62 ? -38.464 -55.410 276.687 1.00 55.33  ? 452 ARG A HB2    1 
ATOM   835  H  HB3    . ARG A 1 62 ? -38.811 -56.750 277.478 1.00 55.33  ? 452 ARG A HB3    1 
ATOM   836  H  HG2    . ARG A 1 62 ? -39.237 -57.816 275.415 1.00 56.72  ? 452 ARG A HG2    1 
ATOM   837  H  HG3    . ARG A 1 62 ? -38.805 -56.495 274.660 1.00 56.72  ? 452 ARG A HG3    1 
ATOM   838  H  HD2    . ARG A 1 62 ? -36.599 -56.821 275.382 1.00 60.87  ? 452 ARG A HD2    1 
ATOM   839  H  HD3    . ARG A 1 62 ? -37.052 -58.187 276.077 1.00 60.87  ? 452 ARG A HD3    1 
ATOM   840  H  HE     . ARG A 1 62 ? -37.781 -58.619 273.743 1.00 64.23  ? 452 ARG A HE     1 
ATOM   841  H  HH11   . ARG A 1 62 ? -36.697 -59.366 271.929 1.00 67.29  ? 452 ARG A HH11   1 
ATOM   842  H  HH12   . ARG A 1 62 ? -35.234 -59.134 271.776 1.00 67.29  ? 452 ARG A HH12   1 
ATOM   843  H  HH21   . ARG A 1 62 ? -34.776 -57.469 274.589 1.00 68.68  ? 452 ARG A HH21   1 
ATOM   844  H  HH22   . ARG A 1 62 ? -34.073 -57.989 273.383 1.00 68.68  ? 452 ARG A HH22   1 
ATOM   845  N  N      . LYS A 1 63 ? -41.181 -54.104 278.273 1.00 46.46  ? 453 LYS A N      1 
ATOM   846  C  CA     . LYS A 1 63 ? -41.937 -53.676 279.447 1.00 49.46  ? 453 LYS A CA     1 
ATOM   847  C  C      . LYS A 1 63 ? -43.367 -54.200 279.387 1.00 51.69  ? 453 LYS A C      1 
ATOM   848  O  O      . LYS A 1 63 ? -43.924 -54.628 280.404 1.00 52.74  ? 453 LYS A O      1 
ATOM   849  C  CB     . LYS A 1 63 ? -41.943 -52.151 279.553 1.00 49.66  ? 453 LYS A CB     1 
ATOM   850  C  CG     . LYS A 1 63 ? -40.675 -51.540 280.120 1.00 51.78  ? 453 LYS A CG     1 
ATOM   851  C  CD     . LYS A 1 63 ? -40.635 -50.029 279.882 1.00 52.24  ? 453 LYS A CD     1 
ATOM   852  C  CE     . LYS A 1 63 ? -40.687 -49.220 281.176 1.00 56.01  ? 453 LYS A CE     1 
ATOM   853  N  NZ     . LYS A 1 63 ? -40.511 -47.753 280.907 1.00 54.97  ? 453 LYS A NZ     1 
ATOM   854  H  H      . LYS A 1 63 ? -40.889 -53.466 277.777 1.00 55.78  ? 453 LYS A H      1 
ATOM   855  H  HA     . LYS A 1 63 ? -41.517 -54.034 280.244 1.00 59.37  ? 453 LYS A HA     1 
ATOM   856  H  HB2    . LYS A 1 63 ? -42.074 -51.781 278.666 1.00 59.62  ? 453 LYS A HB2    1 
ATOM   857  H  HB3    . LYS A 1 63 ? -42.678 -51.886 280.127 1.00 59.62  ? 453 LYS A HB3    1 
ATOM   858  H  HG2    . LYS A 1 63 ? -40.642 -51.699 281.076 1.00 62.16  ? 453 LYS A HG2    1 
ATOM   859  H  HG3    . LYS A 1 63 ? -39.905 -51.937 279.686 1.00 62.16  ? 453 LYS A HG3    1 
ATOM   860  H  HD2    . LYS A 1 63 ? -39.812 -49.804 279.422 1.00 62.71  ? 453 LYS A HD2    1 
ATOM   861  H  HD3    . LYS A 1 63 ? -41.398 -49.775 279.340 1.00 62.71  ? 453 LYS A HD3    1 
ATOM   862  H  HE2    . LYS A 1 63 ? -41.548 -49.351 281.603 1.00 67.24  ? 453 LYS A HE2    1 
ATOM   863  H  HE3    . LYS A 1 63 ? -39.972 -49.509 281.765 1.00 67.24  ? 453 LYS A HE3    1 
ATOM   864  H  HZ1    . LYS A 1 63 ? -40.544 -47.297 281.671 1.00 65.99  ? 453 LYS A HZ1    1 
ATOM   865  H  HZ2    . LYS A 1 63 ? -39.724 -47.608 280.517 1.00 65.99  ? 453 LYS A HZ2    1 
ATOM   866  H  HZ3    . LYS A 1 63 ? -41.158 -47.463 280.369 1.00 65.99  ? 453 LYS A HZ3    1 
ATOM   867  N  N      . HIS A 1 64 ? -43.971 -54.187 278.193 1.00 39.80  ? 454 HIS A N      1 
ATOM   868  C  CA     . HIS A 1 64 ? -45.347 -54.655 278.038 1.00 42.68  ? 454 HIS A CA     1 
ATOM   869  C  C      . HIS A 1 64 ? -45.438 -56.173 278.161 1.00 41.05  ? 454 HIS A C      1 
ATOM   870  O  O      . HIS A 1 64 ? -46.379 -56.699 278.768 1.00 41.24  ? 454 HIS A O      1 
ATOM   871  C  CB     . HIS A 1 64 ? -45.913 -54.219 276.678 1.00 45.67  ? 454 HIS A CB     1 
ATOM   872  C  CG     . HIS A 1 64 ? -46.182 -52.749 276.554 1.00 47.90  ? 454 HIS A CG     1 
ATOM   873  N  ND1    . HIS A 1 64 ? -47.113 -52.092 277.328 1.00 50.40  ? 454 HIS A ND1    1 
ATOM   874  C  CD2    . HIS A 1 64 ? -45.674 -51.819 275.707 1.00 46.98  ? 454 HIS A CD2    1 
ATOM   875  C  CE1    . HIS A 1 64 ? -47.146 -50.815 276.984 1.00 50.37  ? 454 HIS A CE1    1 
ATOM   876  N  NE2    . HIS A 1 64 ? -46.283 -50.623 276.002 1.00 48.20  ? 454 HIS A NE2    1 
ATOM   877  H  H      . HIS A 1 64 ? -43.606 -53.914 277.464 1.00 47.79  ? 454 HIS A H      1 
ATOM   878  H  HA     . HIS A 1 64 ? -45.897 -54.262 278.734 1.00 51.24  ? 454 HIS A HA     1 
ATOM   879  H  HB2    . HIS A 1 64 ? -45.277 -54.460 275.986 1.00 54.83  ? 454 HIS A HB2    1 
ATOM   880  H  HB3    . HIS A 1 64 ? -46.750 -54.685 276.527 1.00 54.83  ? 454 HIS A HB3    1 
ATOM   881  H  HD1    . HIS A 1 64 ? -47.588 -52.452 277.948 1.00 60.50  ? 454 HIS A HD1    1 
ATOM   882  H  HD2    . HIS A 1 64 ? -45.023 -51.962 275.059 1.00 56.41  ? 454 HIS A HD2    1 
ATOM   883  H  HE1    . HIS A 1 64 ? -47.688 -50.163 277.367 1.00 60.48  ? 454 HIS A HE1    1 
ATOM   884  N  N      . THR A 1 65 ? -44.484 -56.896 277.577 1.00 48.26  ? 455 THR A N      1 
ATOM   885  C  CA     . THR A 1 65 ? -44.573 -58.350 277.518 1.00 53.18  ? 455 THR A CA     1 
ATOM   886  C  C      . THR A 1 65 ? -43.902 -59.051 278.687 1.00 56.04  ? 455 THR A C      1 
ATOM   887  O  O      . THR A 1 65 ? -44.176 -60.238 278.913 1.00 59.33  ? 455 THR A O      1 
ATOM   888  C  CB     . THR A 1 65 ? -43.938 -58.876 276.226 1.00 53.94  ? 455 THR A CB     1 
ATOM   889  O  OG1    . THR A 1 65 ? -42.548 -58.524 276.194 1.00 51.45  ? 455 THR A OG1    1 
ATOM   890  C  CG2    . THR A 1 65 ? -44.644 -58.311 274.998 1.00 54.05  ? 455 THR A CG2    1 
ATOM   891  H  H      . THR A 1 65 ? -43.779 -56.569 277.209 1.00 57.95  ? 455 THR A H      1 
ATOM   892  H  HA     . THR A 1 65 ? -45.508 -58.606 277.515 1.00 63.85  ? 455 THR A HA     1 
ATOM   893  H  HB     . THR A 1 65 ? -44.021 -59.842 276.203 1.00 64.75  ? 455 THR A HB     1 
ATOM   894  H  HG1    . THR A 1 65 ? -42.195 -58.810 275.488 1.00 61.77  ? 455 THR A HG1    1 
ATOM   895  H  HG21   . THR A 1 65 ? -44.230 -58.654 274.190 1.00 64.89  ? 455 THR A HG21   1 
ATOM   896  H  HG22   . THR A 1 65 ? -45.579 -58.567 275.006 1.00 64.89  ? 455 THR A HG22   1 
ATOM   897  H  HG23   . THR A 1 65 ? -44.583 -57.343 274.997 1.00 64.89  ? 455 THR A HG23   1 
ATOM   898  N  N      . GLY A 1 66 ? -43.032 -58.366 279.427 1.00 54.98  ? 456 GLY A N      1 
ATOM   899  C  CA     . GLY A 1 66 ? -42.214 -59.052 280.409 1.00 57.94  ? 456 GLY A CA     1 
ATOM   900  C  C      . GLY A 1 66 ? -41.281 -60.095 279.829 1.00 58.12  ? 456 GLY A C      1 
ATOM   901  O  O      . GLY A 1 66 ? -40.693 -60.876 280.584 1.00 60.44  ? 456 GLY A O      1 
ATOM   902  H  H      . GLY A 1 66 ? -42.902 -57.518 279.378 1.00 66.00  ? 456 GLY A H      1 
ATOM   903  H  HA2    . GLY A 1 66 ? -41.676 -58.399 280.884 1.00 69.56  ? 456 GLY A HA2    1 
ATOM   904  H  HA3    . GLY A 1 66 ? -42.792 -59.491 281.052 1.00 69.56  ? 456 GLY A HA3    1 
ATOM   905  N  N      . HIS A 1 67 ? -41.131 -60.121 278.507 1.00 60.69  ? 457 HIS A N      1 
ATOM   906  C  CA     . HIS A 1 67 ? -40.292 -61.100 277.824 1.00 62.44  ? 457 HIS A CA     1 
ATOM   907  C  C      . HIS A 1 67 ? -38.833 -60.955 278.250 1.00 64.19  ? 457 HIS A C      1 
ATOM   908  O  O      . HIS A 1 67 ? -38.296 -59.845 278.299 1.00 62.34  ? 457 HIS A O      1 
ATOM   909  C  CB     . HIS A 1 67 ? -40.450 -60.895 276.314 1.00 61.87  ? 457 HIS A CB     1 
ATOM   910  C  CG     . HIS A 1 67 ? -39.781 -61.930 275.462 1.00 64.40  ? 457 HIS A CG     1 
ATOM   911  N  ND1    . HIS A 1 67 ? -39.705 -63.262 275.813 1.00 68.47  ? 457 HIS A ND1    1 
ATOM   912  C  CD2    . HIS A 1 67 ? -39.194 -61.827 274.246 1.00 63.29  ? 457 HIS A CD2    1 
ATOM   913  C  CE1    . HIS A 1 67 ? -39.076 -63.929 274.860 1.00 69.23  ? 457 HIS A CE1    1 
ATOM   914  N  NE2    . HIS A 1 67 ? -38.756 -63.082 273.898 1.00 66.13  ? 457 HIS A NE2    1 
ATOM   915  H  H      . HIS A 1 67 ? -41.516 -59.568 277.972 1.00 72.85  ? 457 HIS A H      1 
ATOM   916  H  HA     . HIS A 1 67 ? -40.591 -61.996 278.047 1.00 74.95  ? 457 HIS A HA     1 
ATOM   917  H  HB2    . HIS A 1 67 ? -41.396 -60.905 276.098 1.00 74.27  ? 457 HIS A HB2    1 
ATOM   918  H  HB3    . HIS A 1 67 ? -40.072 -60.033 276.078 1.00 74.27  ? 457 HIS A HB3    1 
ATOM   919  H  HD2    . HIS A 1 67 ? -39.093 -61.049 273.747 1.00 75.98  ? 457 HIS A HD2    1 
ATOM   920  H  HE1    . HIS A 1 67 ? -38.893 -64.840 274.865 1.00 83.10  ? 457 HIS A HE1    1 
ATOM   921  H  HE2    . HIS A 1 67 ? -38.342 -63.284 273.172 1.00 79.38  ? 457 HIS A HE2    1 
ATOM   922  N  N      . ARG A 1 68 ? -38.195 -62.083 278.573 1.00 69.16  ? 458 ARG A N      1 
ATOM   923  C  CA     . ARG A 1 68 ? -36.808 -62.122 279.048 1.00 65.31  ? 458 ARG A CA     1 
ATOM   924  C  C      . ARG A 1 68 ? -36.056 -63.124 278.197 1.00 61.97  ? 458 ARG A C      1 
ATOM   925  O  O      . ARG A 1 68 ? -35.856 -64.283 278.606 1.00 62.19  ? 458 ARG A O      1 
ATOM   926  C  CB     . ARG A 1 68 ? -36.736 -62.494 280.529 1.00 69.51  ? 458 ARG A CB     1 
ATOM   927  C  CG     . ARG A 1 68 ? -37.589 -61.633 281.436 1.00 73.72  ? 458 ARG A CG     1 
ATOM   928  C  CD     . ARG A 1 68 ? -36.981 -60.262 281.654 1.00 72.11  ? 458 ARG A CD     1 
ATOM   929  N  NE     . ARG A 1 68 ? -37.638 -59.568 282.758 1.00 76.11  ? 458 ARG A NE     1 
ATOM   930  C  CZ     . ARG A 1 68 ? -37.467 -59.876 284.041 1.00 77.48  ? 458 ARG A CZ     1 
ATOM   931  N  NH1    . ARG A 1 68 ? -36.659 -60.871 284.386 1.00 76.02  ? 458 ARG A NH1    1 
ATOM   932  N  NH2    . ARG A 1 68 ? -38.108 -59.192 284.982 1.00 80.71  ? 458 ARG A NH2    1 
ATOM   933  H  H      . ARG A 1 68 ? -38.556 -62.862 278.523 1.00 83.02  ? 458 ARG A H      1 
ATOM   934  H  HA     . ARG A 1 68 ? -36.401 -61.249 278.930 1.00 78.40  ? 458 ARG A HA     1 
ATOM   935  H  HB2    . ARG A 1 68 ? -37.032 -63.413 280.632 1.00 83.44  ? 458 ARG A HB2    1 
ATOM   936  H  HB3    . ARG A 1 68 ? -35.816 -62.413 280.825 1.00 83.44  ? 458 ARG A HB3    1 
ATOM   937  H  HG2    . ARG A 1 68 ? -38.464 -61.515 281.034 1.00 88.49  ? 458 ARG A HG2    1 
ATOM   938  H  HG3    . ARG A 1 68 ? -37.674 -62.066 282.300 1.00 88.49  ? 458 ARG A HG3    1 
ATOM   939  H  HD2    . ARG A 1 68 ? -36.040 -60.358 281.870 1.00 86.56  ? 458 ARG A HD2    1 
ATOM   940  H  HD3    . ARG A 1 68 ? -37.090 -59.731 280.850 1.00 86.56  ? 458 ARG A HD3    1 
ATOM   941  H  HE     . ARG A 1 68 ? -38.206 -58.951 282.564 1.00 91.36  ? 458 ARG A HE     1 
ATOM   942  H  HH11   . ARG A 1 68 ? -36.243 -61.318 283.780 1.00 91.25  ? 458 ARG A HH11   1 
ATOM   943  H  HH12   . ARG A 1 68 ? -36.551 -61.069 285.216 1.00 91.25  ? 458 ARG A HH12   1 
ATOM   944  H  HH21   . ARG A 1 68 ? -38.633 -58.547 284.763 1.00 96.88  ? 458 ARG A HH21   1 
ATOM   945  H  HH22   . ARG A 1 68 ? -37.996 -59.393 285.811 1.00 96.88  ? 458 ARG A HH22   1 
ATOM   946  N  N      . PRO A 1 69 ? -35.600 -62.731 277.007 1.00 59.52  ? 459 PRO A N      1 
ATOM   947  C  CA     . PRO A 1 69 ? -35.028 -63.708 276.070 1.00 58.81  ? 459 PRO A CA     1 
ATOM   948  C  C      . PRO A 1 69 ? -33.710 -64.308 276.526 1.00 53.46  ? 459 PRO A C      1 
ATOM   949  O  O      . PRO A 1 69 ? -33.311 -65.350 275.994 1.00 55.29  ? 459 PRO A O      1 
ATOM   950  C  CB     . PRO A 1 69 ? -34.839 -62.903 274.775 1.00 58.85  ? 459 PRO A CB     1 
ATOM   951  C  CG     . PRO A 1 69 ? -35.596 -61.624 274.967 1.00 59.32  ? 459 PRO A CG     1 
ATOM   952  C  CD     . PRO A 1 69 ? -35.617 -61.367 276.442 1.00 58.61  ? 459 PRO A CD     1 
ATOM   953  H  HA     . PRO A 1 69 ? -35.663 -64.423 275.908 1.00 70.60  ? 459 PRO A HA     1 
ATOM   954  H  HB2    . PRO A 1 69 ? -33.895 -62.722 274.641 1.00 70.65  ? 459 PRO A HB2    1 
ATOM   955  H  HB3    . PRO A 1 69 ? -35.200 -63.403 274.027 1.00 70.65  ? 459 PRO A HB3    1 
ATOM   956  H  HG2    . PRO A 1 69 ? -35.139 -60.905 274.504 1.00 71.21  ? 459 PRO A HG2    1 
ATOM   957  H  HG3    . PRO A 1 69 ? -36.498 -61.728 274.627 1.00 71.21  ? 459 PRO A HG3    1 
ATOM   958  H  HD2    . PRO A 1 69 ? -34.826 -60.877 276.714 1.00 70.36  ? 459 PRO A HD2    1 
ATOM   959  H  HD3    . PRO A 1 69 ? -36.431 -60.904 276.695 1.00 70.36  ? 459 PRO A HD3    1 
ATOM   960  N  N      . PHE A 1 70 ? -33.021 -63.698 277.480 1.00 50.06  ? 460 PHE A N      1 
ATOM   961  C  CA     . PHE A 1 70 ? -31.639 -64.049 277.798 1.00 47.16  ? 460 PHE A CA     1 
ATOM   962  C  C      . PHE A 1 70 ? -31.613 -64.790 279.129 1.00 45.50  ? 460 PHE A C      1 
ATOM   963  O  O      . PHE A 1 70 ? -31.498 -64.182 280.194 1.00 44.34  ? 460 PHE A O      1 
ATOM   964  C  CB     . PHE A 1 70 ? -30.780 -62.797 277.828 1.00 45.46  ? 460 PHE A CB     1 
ATOM   965  C  CG     . PHE A 1 70 ? -30.743 -62.074 276.512 1.00 47.50  ? 460 PHE A CG     1 
ATOM   966  C  CD1    . PHE A 1 70 ? -29.796 -62.399 275.555 1.00 49.20  ? 460 PHE A CD1    1 
ATOM   967  C  CD2    . PHE A 1 70 ? -31.672 -61.086 276.225 1.00 48.93  ? 460 PHE A CD2    1 
ATOM   968  C  CE1    . PHE A 1 70 ? -29.766 -61.742 274.339 1.00 50.47  ? 460 PHE A CE1    1 
ATOM   969  C  CE2    . PHE A 1 70 ? -31.650 -60.423 275.014 1.00 49.09  ? 460 PHE A CE2    1 
ATOM   970  C  CZ     . PHE A 1 70 ? -30.696 -60.747 274.070 1.00 49.88  ? 460 PHE A CZ     1 
ATOM   971  H  H      . PHE A 1 70 ? -33.336 -63.064 277.969 1.00 60.11  ? 460 PHE A H      1 
ATOM   972  H  HA     . PHE A 1 70 ? -31.292 -64.640 277.112 1.00 56.62  ? 460 PHE A HA     1 
ATOM   973  H  HB2    . PHE A 1 70 ? -31.135 -62.188 278.493 1.00 54.58  ? 460 PHE A HB2    1 
ATOM   974  H  HB3    . PHE A 1 70 ? -29.871 -63.045 278.058 1.00 54.58  ? 460 PHE A HB3    1 
ATOM   975  H  HD1    . PHE A 1 70 ? -29.170 -63.063 275.735 1.00 59.06  ? 460 PHE A HD1    1 
ATOM   976  H  HD2    . PHE A 1 70 ? -32.314 -60.862 276.859 1.00 58.74  ? 460 PHE A HD2    1 
ATOM   977  H  HE1    . PHE A 1 70 ? -29.122 -61.963 273.705 1.00 60.59  ? 460 PHE A HE1    1 
ATOM   978  H  HE2    . PHE A 1 70 ? -32.275 -59.758 274.836 1.00 58.93  ? 460 PHE A HE2    1 
ATOM   979  H  HZ     . PHE A 1 70 ? -30.679 -60.303 273.253 1.00 59.89  ? 460 PHE A HZ     1 
ATOM   980  N  N      . GLN A 1 71 ? -31.710 -66.115 279.056 1.00 50.00  ? 461 GLN A N      1 
ATOM   981  C  CA     . GLN A 1 71 ? -31.727 -66.962 280.241 1.00 53.38  ? 461 GLN A CA     1 
ATOM   982  C  C      . GLN A 1 71 ? -30.303 -67.337 280.637 1.00 50.30  ? 461 GLN A C      1 
ATOM   983  O  O      . GLN A 1 71 ? -29.539 -67.855 279.815 1.00 48.14  ? 461 GLN A O      1 
ATOM   984  C  CB     . GLN A 1 71 ? -32.553 -68.225 279.978 1.00 58.80  ? 461 GLN A CB     1 
ATOM   985  C  CG     . GLN A 1 71 ? -32.532 -69.255 281.104 1.00 64.45  ? 461 GLN A CG     1 
ATOM   986  C  CD     . GLN A 1 71 ? -33.374 -68.839 282.288 1.00 67.80  ? 461 GLN A CD     1 
ATOM   987  O  OE1    . GLN A 1 71 ? -34.525 -68.421 282.126 1.00 69.74  ? 461 GLN A OE1    1 
ATOM   988  N  NE2    . GLN A 1 71 ? -32.811 -68.955 283.493 1.00 67.33  ? 461 GLN A NE2    1 
ATOM   989  H  H      . GLN A 1 71 ? -31.768 -66.552 278.318 1.00 60.02  ? 461 GLN A H      1 
ATOM   990  H  HA     . GLN A 1 71 ? -32.133 -66.479 280.977 1.00 64.08  ? 461 GLN A HA     1 
ATOM   991  H  HB2    . GLN A 1 71 ? -33.477 -67.965 279.837 1.00 70.59  ? 461 GLN A HB2    1 
ATOM   992  H  HB3    . GLN A 1 71 ? -32.211 -68.657 279.180 1.00 70.59  ? 461 GLN A HB3    1 
ATOM   993  H  HG2    . GLN A 1 71 ? -32.879 -70.097 280.769 1.00 77.37  ? 461 GLN A HG2    1 
ATOM   994  H  HG3    . GLN A 1 71 ? -31.619 -69.370 281.410 1.00 77.37  ? 461 GLN A HG3    1 
ATOM   995  H  HE21   . GLN A 1 71 ? -32.007 -69.253 283.565 1.00 80.83  ? 461 GLN A HE21   1 
ATOM   996  H  HE22   . GLN A 1 71 ? -33.251 -68.730 284.197 1.00 80.83  ? 461 GLN A HE22   1 
ATOM   997  N  N      . CYS A 1 72 ? -29.953 -67.083 281.897 1.00 45.27  ? 462 CYS A N      1 
ATOM   998  C  CA     . CYS A 1 72 ? -28.687 -67.583 282.419 1.00 44.60  ? 462 CYS A CA     1 
ATOM   999  C  C      . CYS A 1 72 ? -28.708 -69.105 282.459 1.00 45.24  ? 462 CYS A C      1 
ATOM   1000 O  O      . CYS A 1 72 ? -29.636 -69.707 283.007 1.00 47.53  ? 462 CYS A O      1 
ATOM   1001 C  CB     . CYS A 1 72 ? -28.423 -67.037 283.819 1.00 46.22  ? 462 CYS A CB     1 
ATOM   1002 S  SG     . CYS A 1 72 ? -26.948 -67.767 284.566 1.00 46.44  ? 462 CYS A SG     1 
ATOM   1003 H  H      . CYS A 1 72 ? -30.422 -66.631 282.459 1.00 54.36  ? 462 CYS A H      1 
ATOM   1004 H  HA     . CYS A 1 72 ? -27.964 -67.301 281.838 1.00 53.55  ? 462 CYS A HA     1 
ATOM   1005 H  HB2    . CYS A 1 72 ? -28.291 -66.078 283.766 1.00 55.49  ? 462 CYS A HB2    1 
ATOM   1006 H  HB3    . CYS A 1 72 ? -29.181 -67.239 284.388 1.00 55.49  ? 462 CYS A HB3    1 
ATOM   1007 N  N      . GLN A 1 73 ? -27.675 -69.730 281.893 1.00 43.94  ? 463 GLN A N      1 
ATOM   1008 C  CA     . GLN A 1 73 ? -27.589 -71.186 281.859 1.00 46.89  ? 463 GLN A CA     1 
ATOM   1009 C  C      . GLN A 1 73 ? -26.939 -71.782 283.104 1.00 47.68  ? 463 GLN A C      1 
ATOM   1010 O  O      . GLN A 1 73 ? -26.741 -72.998 283.147 1.00 50.22  ? 463 GLN A O      1 
ATOM   1011 C  CB     . GLN A 1 73 ? -26.817 -71.651 280.617 1.00 47.14  ? 463 GLN A CB     1 
ATOM   1012 C  CG     . GLN A 1 73 ? -27.370 -71.139 279.284 1.00 51.49  ? 463 GLN A CG     1 
ATOM   1013 C  CD     . GLN A 1 73 ? -28.764 -71.666 278.966 1.00 53.64  ? 463 GLN A CD     1 
ATOM   1014 O  OE1    . GLN A 1 73 ? -28.955 -72.860 278.750 1.00 56.09  ? 463 GLN A OE1    1 
ATOM   1015 N  NE2    . GLN A 1 73 ? -29.747 -70.766 278.933 1.00 49.08  ? 463 GLN A NE2    1 
ATOM   1016 H  H      . GLN A 1 73 ? -27.010 -69.331 281.522 1.00 52.59  ? 463 GLN A H      1 
ATOM   1017 H  HA     . GLN A 1 73 ? -28.487 -71.546 281.798 1.00 56.13  ? 463 GLN A HA     1 
ATOM   1018 H  HB2    . GLN A 1 73 ? -25.899 -71.344 280.690 1.00 56.43  ? 463 GLN A HB2    1 
ATOM   1019 H  HB3    . GLN A 1 73 ? -26.834 -72.621 280.588 1.00 56.43  ? 463 GLN A HB3    1 
ATOM   1020 H  HG2    . GLN A 1 73 ? -27.417 -70.171 279.315 1.00 61.81  ? 463 GLN A HG2    1 
ATOM   1021 H  HG3    . GLN A 1 73 ? -26.776 -71.418 278.570 1.00 61.81  ? 463 GLN A HG3    1 
ATOM   1022 H  HE21   . GLN A 1 73 ? -29.576 -69.937 279.088 1.00 58.75  ? 463 GLN A HE21   1 
ATOM   1023 H  HE22   . GLN A 1 73 ? -30.551 -71.014 278.758 1.00 58.75  ? 463 GLN A HE22   1 
ATOM   1024 N  N      . LYS A 1 74 ? -26.601 -70.968 284.110 1.00 54.12  ? 464 LYS A N      1 
ATOM   1025 C  CA     . LYS A 1 74 ? -26.046 -71.469 285.362 1.00 57.50  ? 464 LYS A CA     1 
ATOM   1026 C  C      . LYS A 1 74 ? -26.949 -71.219 286.561 1.00 59.56  ? 464 LYS A C      1 
ATOM   1027 O  O      . LYS A 1 74 ? -26.590 -71.607 287.678 1.00 62.72  ? 464 LYS A O      1 
ATOM   1028 C  CB     . LYS A 1 74 ? -24.668 -70.848 285.636 1.00 57.03  ? 464 LYS A CB     1 
ATOM   1029 C  CG     . LYS A 1 74 ? -23.530 -71.471 284.832 1.00 58.09  ? 464 LYS A CG     1 
ATOM   1030 C  CD     . LYS A 1 74 ? -22.211 -71.480 285.604 1.00 58.78  ? 464 LYS A CD     1 
ATOM   1031 C  CE     . LYS A 1 74 ? -22.144 -72.629 286.600 1.00 61.25  ? 464 LYS A CE     1 
ATOM   1032 N  NZ     . LYS A 1 74 ? -20.951 -72.570 287.509 1.00 59.78  ? 464 LYS A NZ     1 
ATOM   1033 H  H      . LYS A 1 74 ? -26.688 -70.113 284.087 1.00 64.97  ? 464 LYS A H      1 
ATOM   1034 H  HA     . LYS A 1 74 ? -25.925 -72.428 285.283 1.00 69.02  ? 464 LYS A HA     1 
ATOM   1035 H  HB2    . LYS A 1 74 ? -24.703 -69.904 285.416 1.00 68.47  ? 464 LYS A HB2    1 
ATOM   1036 H  HB3    . LYS A 1 74 ? -24.459 -70.957 286.577 1.00 68.47  ? 464 LYS A HB3    1 
ATOM   1037 H  HG2    . LYS A 1 74 ? -23.759 -72.388 284.616 1.00 69.74  ? 464 LYS A HG2    1 
ATOM   1038 H  HG3    . LYS A 1 74 ? -23.399 -70.959 284.018 1.00 69.74  ? 464 LYS A HG3    1 
ATOM   1039 H  HD2    . LYS A 1 74 ? -21.476 -71.577 284.979 1.00 70.56  ? 464 LYS A HD2    1 
ATOM   1040 H  HD3    . LYS A 1 74 ? -22.124 -70.648 286.096 1.00 70.56  ? 464 LYS A HD3    1 
ATOM   1041 H  HE2    . LYS A 1 74 ? -22.941 -72.611 287.153 1.00 73.52  ? 464 LYS A HE2    1 
ATOM   1042 H  HE3    . LYS A 1 74 ? -22.103 -73.466 286.110 1.00 73.52  ? 464 LYS A HE3    1 
ATOM   1043 H  HZ1    . LYS A 1 74 ? -20.960 -73.262 288.068 1.00 71.77  ? 464 LYS A HZ1    1 
ATOM   1044 H  HZ2    . LYS A 1 74 ? -20.202 -72.596 287.029 1.00 71.77  ? 464 LYS A HZ2    1 
ATOM   1045 H  HZ3    . LYS A 1 74 ? -20.966 -71.816 287.981 1.00 71.77  ? 464 LYS A HZ3    1 
ATOM   1046 N  N      . CYS A 1 75 ? -28.102 -70.593 286.368 1.00 51.09  ? 465 CYS A N      1 
ATOM   1047 C  CA     . CYS A 1 75 ? -29.058 -70.380 287.448 1.00 51.89  ? 465 CYS A CA     1 
ATOM   1048 C  C      . CYS A 1 75 ? -30.396 -70.013 286.811 1.00 52.60  ? 465 CYS A C      1 
ATOM   1049 O  O      . CYS A 1 75 ? -30.542 -70.029 285.586 1.00 51.11  ? 465 CYS A O      1 
ATOM   1050 C  CB     . CYS A 1 75 ? -28.561 -69.310 288.427 1.00 49.50  ? 465 CYS A CB     1 
ATOM   1051 S  SG     . CYS A 1 75 ? -28.825 -67.592 287.883 1.00 46.78  ? 465 CYS A SG     1 
ATOM   1052 H  H      . CYS A 1 75 ? -28.359 -70.277 285.611 1.00 61.33  ? 465 CYS A H      1 
ATOM   1053 H  HA     . CYS A 1 75 ? -29.173 -71.208 287.940 1.00 62.29  ? 465 CYS A HA     1 
ATOM   1054 H  HB2    . CYS A 1 75 ? -29.024 -69.424 289.271 1.00 59.31  ? 465 CYS A HB2    1 
ATOM   1055 H  HB3    . CYS A 1 75 ? -27.608 -69.431 288.560 1.00 59.31  ? 465 CYS A HB3    1 
ATOM   1056 N  N      . ASP A 1 76 ? -31.378 -69.682 287.654 1.00 59.69  ? 466 ASP A N      1 
ATOM   1057 C  CA     . ASP A 1 76 ? -32.741 -69.461 287.183 1.00 63.88  ? 466 ASP A CA     1 
ATOM   1058 C  C      . ASP A 1 76 ? -32.960 -68.071 286.599 1.00 62.80  ? 466 ASP A C      1 
ATOM   1059 O  O      . ASP A 1 76 ? -33.983 -67.850 285.944 1.00 64.27  ? 466 ASP A O      1 
ATOM   1060 C  CB     . ASP A 1 76 ? -33.732 -69.678 288.327 1.00 68.48  ? 466 ASP A CB     1 
ATOM   1061 C  CG     . ASP A 1 76 ? -33.807 -71.131 288.765 1.00 74.10  ? 466 ASP A CG     1 
ATOM   1062 O  OD1    . ASP A 1 76 ? -32.907 -71.917 288.394 1.00 73.54  ? 466 ASP A OD1    1 
ATOM   1063 O  OD2    . ASP A 1 76 ? -34.765 -71.485 289.484 1.00 79.06  ? 466 ASP A OD2    1 
ATOM   1064 H  H      . ASP A 1 76 ? -31.277 -69.579 288.501 1.00 71.65  ? 466 ASP A H      1 
ATOM   1065 H  HA     . ASP A 1 76 ? -32.941 -70.109 286.489 1.00 76.68  ? 466 ASP A HA     1 
ATOM   1066 H  HB2    . ASP A 1 76 ? -33.456 -69.148 289.090 1.00 82.21  ? 466 ASP A HB2    1 
ATOM   1067 H  HB3    . ASP A 1 76 ? -34.617 -69.406 288.035 1.00 82.21  ? 466 ASP A HB3    1 
ATOM   1068 N  N      . ARG A 1 77 ? -32.035 -67.139 286.817 1.00 57.22  ? 467 ARG A N      1 
ATOM   1069 C  CA     . ARG A 1 77 ? -32.283 -65.745 286.473 1.00 56.85  ? 467 ARG A CA     1 
ATOM   1070 C  C      . ARG A 1 77 ? -32.315 -65.538 284.959 1.00 52.07  ? 467 ARG A C      1 
ATOM   1071 O  O      . ARG A 1 77 ? -31.541 -66.146 284.215 1.00 48.33  ? 467 ARG A O      1 
ATOM   1072 C  CB     . ARG A 1 77 ? -31.213 -64.861 287.113 1.00 58.92  ? 467 ARG A CB     1 
ATOM   1073 C  CG     . ARG A 1 77 ? -31.211 -64.911 288.645 1.00 65.27  ? 467 ARG A CG     1 
ATOM   1074 C  CD     . ARG A 1 77 ? -30.545 -63.687 289.264 1.00 68.72  ? 467 ARG A CD     1 
ATOM   1075 N  NE     . ARG A 1 77 ? -31.162 -62.448 288.800 1.00 73.37  ? 467 ARG A NE     1 
ATOM   1076 C  CZ     . ARG A 1 77 ? -30.823 -61.232 289.218 1.00 76.97  ? 467 ARG A CZ     1 
ATOM   1077 N  NH1    . ARG A 1 77 ? -31.445 -60.164 288.727 1.00 76.65  ? 467 ARG A NH1    1 
ATOM   1078 N  NH2    . ARG A 1 77 ? -29.867 -61.084 290.129 1.00 80.01  ? 467 ARG A NH2    1 
ATOM   1079 H  H      . ARG A 1 77 ? -31.261 -67.287 287.160 1.00 68.70  ? 467 ARG A H      1 
ATOM   1080 H  HA     . ARG A 1 77 ? -33.145 -65.479 286.830 1.00 68.25  ? 467 ARG A HA     1 
ATOM   1081 H  HB2    . ARG A 1 77 ? -30.340 -65.154 286.805 1.00 70.73  ? 467 ARG A HB2    1 
ATOM   1082 H  HB3    . ARG A 1 77 ? -31.365 -63.942 286.845 1.00 70.73  ? 467 ARG A HB3    1 
ATOM   1083 H  HG2    . ARG A 1 77 ? -32.127 -64.947 288.962 1.00 78.35  ? 467 ARG A HG2    1 
ATOM   1084 H  HG3    . ARG A 1 77 ? -30.726 -65.698 288.936 1.00 78.35  ? 467 ARG A HG3    1 
ATOM   1085 H  HD2    . ARG A 1 77 ? -30.634 -63.728 290.229 1.00 82.50  ? 467 ARG A HD2    1 
ATOM   1086 H  HD3    . ARG A 1 77 ? -29.608 -63.672 289.014 1.00 82.50  ? 467 ARG A HD3    1 
ATOM   1087 H  HE     . ARG A 1 77 ? -31.789 -62.508 288.214 1.00 88.07  ? 467 ARG A HE     1 
ATOM   1088 H  HH11   . ARG A 1 77 ? -32.065 -60.260 288.139 1.00 92.00  ? 467 ARG A HH11   1 
ATOM   1089 H  HH12   . ARG A 1 77 ? -31.229 -59.377 288.999 1.00 92.00  ? 467 ARG A HH12   1 
ATOM   1090 H  HH21   . ARG A 1 77 ? -29.464 -61.775 290.446 1.00 96.04  ? 467 ARG A HH21   1 
ATOM   1091 H  HH22   . ARG A 1 77 ? -29.650 -60.297 290.400 1.00 96.04  ? 467 ARG A HH22   1 
ATOM   1092 N  N      . ALA A 1 78 ? -33.230 -64.675 284.504 1.00 52.89  ? 468 ALA A N      1 
ATOM   1093 C  CA     . ALA A 1 78 ? -33.328 -64.290 283.098 1.00 50.47  ? 468 ALA A CA     1 
ATOM   1094 C  C      . ALA A 1 78 ? -33.352 -62.770 282.968 1.00 49.78  ? 468 ALA A C      1 
ATOM   1095 O  O      . ALA A 1 78 ? -33.667 -62.044 283.918 1.00 51.39  ? 468 ALA A O      1 
ATOM   1096 C  CB     . ALA A 1 78 ? -34.578 -64.880 282.428 1.00 51.66  ? 468 ALA A CB     1 
ATOM   1097 H  H      . ALA A 1 78 ? -33.816 -64.294 285.004 1.00 63.49  ? 468 ALA A H      1 
ATOM   1098 H  HA     . ALA A 1 78 ? -32.549 -64.621 282.624 1.00 60.60  ? 468 ALA A HA     1 
ATOM   1099 H  HB1    . ALA A 1 78 ? -34.601 -64.598 281.500 1.00 62.02  ? 468 ALA A HB1    1 
ATOM   1100 H  HB2    . ALA A 1 78 ? -34.537 -65.847 282.480 1.00 62.02  ? 468 ALA A HB2    1 
ATOM   1101 H  HB3    . ALA A 1 78 ? -35.366 -64.556 282.892 1.00 62.02  ? 468 ALA A HB3    1 
ATOM   1102 N  N      . PHE A 1 79 ? -33.037 -62.293 281.763 1.00 46.26  ? 469 PHE A N      1 
ATOM   1103 C  CA     . PHE A 1 79 ? -32.801 -60.874 281.532 1.00 45.38  ? 469 PHE A CA     1 
ATOM   1104 C  C      . PHE A 1 79 ? -33.394 -60.447 280.190 1.00 45.02  ? 469 PHE A C      1 
ATOM   1105 O  O      . PHE A 1 79 ? -33.588 -61.256 279.280 1.00 45.03  ? 469 PHE A O      1 
ATOM   1106 C  CB     . PHE A 1 79 ? -31.296 -60.570 281.585 1.00 42.31  ? 469 PHE A CB     1 
ATOM   1107 C  CG     . PHE A 1 79 ? -30.637 -61.012 282.872 1.00 41.81  ? 469 PHE A CG     1 
ATOM   1108 C  CD1    . PHE A 1 79 ? -30.200 -62.316 283.032 1.00 42.59  ? 469 PHE A CD1    1 
ATOM   1109 C  CD2    . PHE A 1 79 ? -30.466 -60.123 283.918 1.00 41.68  ? 469 PHE A CD2    1 
ATOM   1110 C  CE1    . PHE A 1 79 ? -29.608 -62.732 284.220 1.00 44.35  ? 469 PHE A CE1    1 
ATOM   1111 C  CE2    . PHE A 1 79 ? -29.870 -60.526 285.100 1.00 43.93  ? 469 PHE A CE2    1 
ATOM   1112 C  CZ     . PHE A 1 79 ? -29.441 -61.837 285.252 1.00 45.04  ? 469 PHE A CZ     1 
ATOM   1113 H  H      . PHE A 1 79 ? -32.955 -62.778 281.058 1.00 55.54  ? 469 PHE A H      1 
ATOM   1114 H  HA     . PHE A 1 79 ? -33.237 -60.362 282.231 1.00 54.48  ? 469 PHE A HA     1 
ATOM   1115 H  HB2    . PHE A 1 79 ? -30.856 -61.030 280.853 1.00 50.80  ? 469 PHE A HB2    1 
ATOM   1116 H  HB3    . PHE A 1 79 ? -31.166 -59.613 281.498 1.00 50.80  ? 469 PHE A HB3    1 
ATOM   1117 H  HD1    . PHE A 1 79 ? -30.314 -62.926 282.339 1.00 51.14  ? 469 PHE A HD1    1 
ATOM   1118 H  HD2    . PHE A 1 79 ? -30.755 -59.243 283.826 1.00 50.04  ? 469 PHE A HD2    1 
ATOM   1119 H  HE1    . PHE A 1 79 ? -29.317 -63.610 284.313 1.00 53.24  ? 469 PHE A HE1    1 
ATOM   1120 H  HE2    . PHE A 1 79 ? -29.761 -59.919 285.796 1.00 52.74  ? 469 PHE A HE2    1 
ATOM   1121 H  HZ     . PHE A 1 79 ? -29.039 -62.109 286.045 1.00 54.07  ? 469 PHE A HZ     1 
ATOM   1122 N  N      . SER A 1 80 ? -33.676 -59.147 280.077 1.00 47.64  ? 470 SER A N      1 
ATOM   1123 C  CA     . SER A 1 80 ? -34.234 -58.586 278.849 1.00 48.43  ? 470 SER A CA     1 
ATOM   1124 C  C      . SER A 1 80 ? -33.170 -58.189 277.837 1.00 44.59  ? 470 SER A C      1 
ATOM   1125 O  O      . SER A 1 80 ? -33.500 -57.973 276.665 1.00 43.72  ? 470 SER A O      1 
ATOM   1126 C  CB     . SER A 1 80 ? -35.087 -57.353 279.166 1.00 49.73  ? 470 SER A CB     1 
ATOM   1127 O  OG     . SER A 1 80 ? -34.273 -56.274 279.596 1.00 48.30  ? 470 SER A OG     1 
ATOM   1128 H  H      . SER A 1 80 ? -33.552 -58.568 280.700 1.00 57.20  ? 470 SER A H      1 
ATOM   1129 H  HA     . SER A 1 80 ? -34.809 -59.249 278.434 1.00 58.14  ? 470 SER A HA     1 
ATOM   1130 H  HB2    . SER A 1 80 ? -35.568 -57.087 278.366 1.00 59.71  ? 470 SER A HB2    1 
ATOM   1131 H  HB3    . SER A 1 80 ? -35.715 -57.576 279.871 1.00 59.71  ? 470 SER A HB3    1 
ATOM   1132 H  HG     . SER A 1 80 ? -34.750 -55.604 279.767 1.00 57.99  ? 470 SER A HG     1 
ATOM   1133 N  N      . ARG A 1 81 ? -31.913 -58.081 278.268 1.00 40.41  ? 471 ARG A N      1 
ATOM   1134 C  CA     . ARG A 1 81 ? -30.820 -57.617 277.428 1.00 37.35  ? 471 ARG A CA     1 
ATOM   1135 C  C      . ARG A 1 81 ? -29.603 -58.496 277.671 1.00 37.60  ? 471 ARG A C      1 
ATOM   1136 O  O      . ARG A 1 81 ? -29.362 -58.961 278.790 1.00 39.07  ? 471 ARG A O      1 
ATOM   1137 C  CB     . ARG A 1 81 ? -30.463 -56.153 277.721 1.00 36.83  ? 471 ARG A CB     1 
ATOM   1138 C  CG     . ARG A 1 81 ? -31.573 -55.169 277.403 1.00 37.44  ? 471 ARG A CG     1 
ATOM   1139 C  CD     . ARG A 1 81 ? -31.475 -53.890 278.222 1.00 37.16  ? 471 ARG A CD     1 
ATOM   1140 N  NE     . ARG A 1 81 ? -30.104 -53.398 278.402 1.00 33.71  ? 471 ARG A NE     1 
ATOM   1141 C  CZ     . ARG A 1 81 ? -29.802 -52.149 278.759 1.00 31.19  ? 471 ARG A CZ     1 
ATOM   1142 N  NH1    . ARG A 1 81 ? -30.757 -51.253 278.938 1.00 30.67  ? 471 ARG A NH1    1 
ATOM   1143 N  NH2    . ARG A 1 81 ? -28.544 -51.781 278.909 1.00 28.58  ? 471 ARG A NH2    1 
ATOM   1144 H  H      . ARG A 1 81 ? -31.666 -58.278 279.068 1.00 48.52  ? 471 ARG A H      1 
ATOM   1145 H  HA     . ARG A 1 81 ? -31.073 -57.692 276.495 1.00 44.84  ? 471 ARG A HA     1 
ATOM   1146 H  HB2    . ARG A 1 81 ? -30.253 -56.066 278.664 1.00 44.22  ? 471 ARG A HB2    1 
ATOM   1147 H  HB3    . ARG A 1 81 ? -29.690 -55.908 277.189 1.00 44.22  ? 471 ARG A HB3    1 
ATOM   1148 H  HG2    . ARG A 1 81 ? -31.523 -54.929 276.465 1.00 44.96  ? 471 ARG A HG2    1 
ATOM   1149 H  HG3    . ARG A 1 81 ? -32.428 -55.584 277.596 1.00 44.96  ? 471 ARG A HG3    1 
ATOM   1150 H  HD2    . ARG A 1 81 ? -31.983 -53.195 277.776 1.00 44.61  ? 471 ARG A HD2    1 
ATOM   1151 H  HD3    . ARG A 1 81 ? -31.848 -54.055 279.102 1.00 44.61  ? 471 ARG A HD3    1 
ATOM   1152 H  HE     . ARG A 1 81 ? -29.462 -53.967 278.346 1.00 40.48  ? 471 ARG A HE     1 
ATOM   1153 H  HH11   . ARG A 1 81 ? -31.582 -51.479 278.844 1.00 36.66  ? 471 ARG A HH11   1 
ATOM   1154 H  HH12   . ARG A 1 81 ? -30.554 -50.448 279.162 1.00 36.66  ? 471 ARG A HH12   1 
ATOM   1155 H  HH21   . ARG A 1 81 ? -27.911 -52.352 278.789 1.00 34.16  ? 471 ARG A HH21   1 
ATOM   1156 H  HH22   . ARG A 1 81 ? -28.356 -50.971 279.129 1.00 34.16  ? 471 ARG A HH22   1 
ATOM   1157 N  N      . SER A 1 82 ? -28.835 -58.705 276.606 1.00 37.58  ? 472 SER A N      1 
ATOM   1158 C  CA     . SER A 1 82 ? -27.657 -59.557 276.675 1.00 37.95  ? 472 SER A CA     1 
ATOM   1159 C  C      . SER A 1 82 ? -26.576 -58.960 277.558 1.00 33.55  ? 472 SER A C      1 
ATOM   1160 O  O      . SER A 1 82 ? -25.801 -59.707 278.165 1.00 35.43  ? 472 SER A O      1 
ATOM   1161 C  CB     . SER A 1 82 ? -27.096 -59.794 275.267 1.00 42.65  ? 472 SER A CB     1 
ATOM   1162 O  OG     . SER A 1 82 ? -26.531 -58.603 274.733 1.00 43.48  ? 472 SER A OG     1 
ATOM   1163 H  H      . SER A 1 82 ? -28.976 -58.362 275.830 1.00 45.12  ? 472 SER A H      1 
ATOM   1164 H  HA     . SER A 1 82 ? -27.909 -60.416 277.048 1.00 45.57  ? 472 SER A HA     1 
ATOM   1165 H  HB2    . SER A 1 82 ? -26.407 -60.476 275.313 1.00 51.20  ? 472 SER A HB2    1 
ATOM   1166 H  HB3    . SER A 1 82 ? -27.815 -60.089 274.687 1.00 51.20  ? 472 SER A HB3    1 
ATOM   1167 H  HG     . SER A 1 82 ? -26.228 -58.749 273.963 1.00 52.21  ? 472 SER A HG     1 
ATOM   1168 N  N      . ASP A 1 83 ? -26.479 -57.630 277.636 1.00 32.62  ? 473 ASP A N      1 
ATOM   1169 C  CA     . ASP A 1 83 ? -25.424 -57.053 278.459 1.00 31.44  ? 473 ASP A CA     1 
ATOM   1170 C  C      . ASP A 1 83 ? -25.725 -57.234 279.939 1.00 31.09  ? 473 ASP A C      1 
ATOM   1171 O  O      . ASP A 1 83 ? -24.797 -57.424 280.736 1.00 32.04  ? 473 ASP A O      1 
ATOM   1172 C  CB     . ASP A 1 83 ? -25.202 -55.573 278.115 1.00 34.67  ? 473 ASP A CB     1 
ATOM   1173 C  CG     . ASP A 1 83 ? -26.440 -54.714 278.294 1.00 34.91  ? 473 ASP A CG     1 
ATOM   1174 O  OD1    . ASP A 1 83 ? -27.566 -55.203 278.120 1.00 37.05  ? 473 ASP A OD1    1 
ATOM   1175 O  OD2    . ASP A 1 83 ? -26.278 -53.520 278.587 1.00 35.58  ? 473 ASP A OD2    1 
ATOM   1176 H  H      . ASP A 1 83 ? -26.991 -57.064 277.239 1.00 39.17  ? 473 ASP A H      1 
ATOM   1177 H  HA     . ASP A 1 83 ? -24.597 -57.523 278.271 1.00 37.76  ? 473 ASP A HA     1 
ATOM   1178 H  HB2    . ASP A 1 83 ? -24.508 -55.218 278.692 1.00 41.63  ? 473 ASP A HB2    1 
ATOM   1179 H  HB3    . ASP A 1 83 ? -24.925 -55.505 277.188 1.00 41.63  ? 473 ASP A HB3    1 
ATOM   1180 N  N      . HIS A 1 84 ? -27.004 -57.212 280.319 1.00 28.57  ? 474 HIS A N      1 
ATOM   1181 C  CA     . HIS A 1 84 ? -27.378 -57.546 281.692 1.00 30.18  ? 474 HIS A CA     1 
ATOM   1182 C  C      . HIS A 1 84 ? -26.956 -58.968 282.045 1.00 31.08  ? 474 HIS A C      1 
ATOM   1183 O  O      . HIS A 1 84 ? -26.422 -59.219 283.132 1.00 31.62  ? 474 HIS A O      1 
ATOM   1184 C  CB     . HIS A 1 84 ? -28.885 -57.380 281.871 1.00 31.63  ? 474 HIS A CB     1 
ATOM   1185 C  CG     . HIS A 1 84 ? -29.347 -55.956 281.862 1.00 31.83  ? 474 HIS A CG     1 
ATOM   1186 N  ND1    . HIS A 1 84 ? -30.672 -55.609 281.720 1.00 33.12  ? 474 HIS A ND1    1 
ATOM   1187 C  CD2    . HIS A 1 84 ? -28.663 -54.791 281.977 1.00 31.45  ? 474 HIS A CD2    1 
ATOM   1188 C  CE1    . HIS A 1 84 ? -30.786 -54.293 281.751 1.00 41.86  ? 474 HIS A CE1    1 
ATOM   1189 N  NE2    . HIS A 1 84 ? -29.579 -53.775 281.900 1.00 32.41  ? 474 HIS A NE2    1 
ATOM   1190 H  H      . HIS A 1 84 ? -27.665 -57.010 279.808 1.00 34.27  ? 474 HIS A H      1 
ATOM   1191 H  HA     . HIS A 1 84 ? -26.931 -56.937 282.301 1.00 36.20  ? 474 HIS A HA     1 
ATOM   1192 H  HB2    . HIS A 1 84 ? -29.338 -57.842 281.147 1.00 37.99  ? 474 HIS A HB2    1 
ATOM   1193 H  HB3    . HIS A 1 84 ? -29.143 -57.769 282.721 1.00 37.99  ? 474 HIS A HB3    1 
ATOM   1194 H  HD2    . HIS A 1 84 ? -27.744 -54.700 282.083 1.00 37.60  ? 474 HIS A HD2    1 
ATOM   1195 H  HE1    . HIS A 1 84 ? -31.578 -53.813 281.673 1.00 50.26  ? 474 HIS A HE1    1 
ATOM   1196 H  HE2    . HIS A 1 84 ? -29.399 -52.935 281.948 1.00 38.75  ? 474 HIS A HE2    1 
ATOM   1197 N  N      . LEU A 1 85 ? -27.190 -59.920 281.138 1.00 34.88  ? 475 LEU A N      1 
ATOM   1198 C  CA     . LEU A 1 85 ? -26.810 -61.302 281.419 1.00 37.42  ? 475 LEU A CA     1 
ATOM   1199 C  C      . LEU A 1 85 ? -25.294 -61.444 281.508 1.00 37.30  ? 475 LEU A C      1 
ATOM   1200 O  O      . LEU A 1 85 ? -24.766 -62.042 282.456 1.00 36.86  ? 475 LEU A O      1 
ATOM   1201 C  CB     . LEU A 1 85 ? -27.380 -62.232 280.348 1.00 38.70  ? 475 LEU A CB     1 
ATOM   1202 C  CG     . LEU A 1 85 ? -26.926 -63.692 280.407 1.00 41.63  ? 475 LEU A CG     1 
ATOM   1203 C  CD1    . LEU A 1 85 ? -27.285 -64.326 281.744 1.00 43.50  ? 475 LEU A CD1    1 
ATOM   1204 C  CD2    . LEU A 1 85 ? -27.543 -64.468 279.275 1.00 45.14  ? 475 LEU A CD2    1 
ATOM   1205 H  H      . LEU A 1 85 ? -27.559 -59.795 280.372 1.00 41.88  ? 475 LEU A H      1 
ATOM   1206 H  HA     . LEU A 1 85 ? -27.186 -61.564 282.274 1.00 44.93  ? 475 LEU A HA     1 
ATOM   1207 H  HB2    . LEU A 1 85 ? -28.347 -62.228 280.426 1.00 46.47  ? 475 LEU A HB2    1 
ATOM   1208 H  HB3    . LEU A 1 85 ? -27.126 -61.886 279.478 1.00 46.47  ? 475 LEU A HB3    1 
ATOM   1209 H  HG     . LEU A 1 85 ? -25.962 -63.728 280.306 1.00 49.98  ? 475 LEU A HG     1 
ATOM   1210 H  HD11   . LEU A 1 85 ? -26.983 -65.248 281.747 1.00 52.22  ? 475 LEU A HD11   1 
ATOM   1211 H  HD12   . LEU A 1 85 ? -26.846 -63.832 282.455 1.00 52.22  ? 475 LEU A HD12   1 
ATOM   1212 H  HD13   . LEU A 1 85 ? -28.247 -64.292 281.862 1.00 52.22  ? 475 LEU A HD13   1 
ATOM   1213 H  HD21   . LEU A 1 85 ? -27.246 -65.390 279.326 1.00 54.20  ? 475 LEU A HD21   1 
ATOM   1214 H  HD22   . LEU A 1 85 ? -28.509 -64.427 279.353 1.00 54.20  ? 475 LEU A HD22   1 
ATOM   1215 H  HD23   . LEU A 1 85 ? -27.262 -64.076 278.433 1.00 54.20  ? 475 LEU A HD23   1 
ATOM   1216 N  N      . ALA A 1 86 ? -24.577 -60.884 280.532 1.00 37.71  ? 476 ALA A N      1 
ATOM   1217 C  CA     . ALA A 1 86 ? -23.121 -60.965 280.538 1.00 39.24  ? 476 ALA A CA     1 
ATOM   1218 C  C      . ALA A 1 86 ? -22.531 -60.466 281.853 1.00 42.18  ? 476 ALA A C      1 
ATOM   1219 O  O      . ALA A 1 86 ? -21.585 -61.061 282.385 1.00 42.14  ? 476 ALA A O      1 
ATOM   1220 C  CB     . ALA A 1 86 ? -22.565 -60.176 279.358 1.00 37.49  ? 476 ALA A CB     1 
ATOM   1221 H  H      . ALA A 1 86 ? -24.908 -60.456 279.863 1.00 45.28  ? 476 ALA A H      1 
ATOM   1222 H  HA     . ALA A 1 86 ? -22.858 -61.892 280.427 1.00 47.12  ? 476 ALA A HA     1 
ATOM   1223 H  HB1    . ALA A 1 86 ? -21.597 -60.235 279.368 1.00 45.02  ? 476 ALA A HB1    1 
ATOM   1224 H  HB2    . ALA A 1 86 ? -22.911 -60.554 278.535 1.00 45.02  ? 476 ALA A HB2    1 
ATOM   1225 H  HB3    . ALA A 1 86 ? -22.842 -59.250 279.440 1.00 45.02  ? 476 ALA A HB3    1 
ATOM   1226 N  N      . LEU A 1 87 ? -23.081 -59.383 282.409 1.00 43.05  ? 477 LEU A N      1 
ATOM   1227 C  CA     . LEU A 1 87 ? -22.596 -58.902 283.699 1.00 46.95  ? 477 LEU A CA     1 
ATOM   1228 C  C      . LEU A 1 87 ? -22.886 -59.906 284.806 1.00 48.76  ? 477 LEU A C      1 
ATOM   1229 O  O      . LEU A 1 87 ? -22.006 -60.238 285.602 1.00 50.42  ? 477 LEU A O      1 
ATOM   1230 C  CB     . LEU A 1 87 ? -23.222 -57.555 284.045 1.00 50.77  ? 477 LEU A CB     1 
ATOM   1231 C  CG     . LEU A 1 87 ? -22.492 -56.288 283.611 1.00 52.76  ? 477 LEU A CG     1 
ATOM   1232 C  CD1    . LEU A 1 87 ? -23.137 -55.105 284.307 1.00 53.65  ? 477 LEU A CD1    1 
ATOM   1233 C  CD2    . LEU A 1 87 ? -20.992 -56.328 283.914 1.00 54.00  ? 477 LEU A CD2    1 
ATOM   1234 H  H      . LEU A 1 87 ? -23.721 -58.921 282.067 1.00 51.69  ? 477 LEU A H      1 
ATOM   1235 H  HA     . LEU A 1 87 ? -21.635 -58.781 283.649 1.00 56.37  ? 477 LEU A HA     1 
ATOM   1236 H  HB2    . LEU A 1 87 ? -24.103 -57.524 283.642 1.00 60.95  ? 477 LEU A HB2    1 
ATOM   1237 H  HB3    . LEU A 1 87 ? -23.314 -57.509 285.010 1.00 60.95  ? 477 LEU A HB3    1 
ATOM   1238 H  HG     . LEU A 1 87 ? -22.603 -56.171 282.654 1.00 63.34  ? 477 LEU A HG     1 
ATOM   1239 H  HD11   . LEU A 1 87 ? -22.679 -54.293 284.037 1.00 64.40  ? 477 LEU A HD11   1 
ATOM   1240 H  HD12   . LEU A 1 87 ? -24.071 -55.059 284.051 1.00 64.40  ? 477 LEU A HD12   1 
ATOM   1241 H  HD13   . LEU A 1 87 ? -23.061 -55.224 285.266 1.00 64.40  ? 477 LEU A HD13   1 
ATOM   1242 H  HD21   . LEU A 1 87 ? -20.588 -55.498 283.616 1.00 64.82  ? 477 LEU A HD21   1 
ATOM   1243 H  HD22   . LEU A 1 87 ? -20.866 -56.432 284.871 1.00 64.82  ? 477 LEU A HD22   1 
ATOM   1244 H  HD23   . LEU A 1 87 ? -20.595 -57.077 283.444 1.00 64.82  ? 477 LEU A HD23   1 
ATOM   1245 N  N      . HIS A 1 88 ? -24.125 -60.392 284.874 1.00 45.16  ? 478 HIS A N      1 
ATOM   1246 C  CA     . HIS A 1 88 ? -24.478 -61.400 285.865 1.00 52.66  ? 478 HIS A CA     1 
ATOM   1247 C  C      . HIS A 1 88 ? -23.599 -62.636 285.732 1.00 48.13  ? 478 HIS A C      1 
ATOM   1248 O  O      . HIS A 1 88 ? -23.101 -63.165 286.737 1.00 36.64  ? 478 HIS A O      1 
ATOM   1249 C  CB     . HIS A 1 88 ? -25.949 -61.775 285.708 1.00 62.32  ? 478 HIS A CB     1 
ATOM   1250 C  CG     . HIS A 1 88 ? -26.345 -63.007 286.457 1.00 72.81  ? 478 HIS A CG     1 
ATOM   1251 N  ND1    . HIS A 1 88 ? -26.691 -62.988 287.790 1.00 77.74  ? 478 HIS A ND1    1 
ATOM   1252 C  CD2    . HIS A 1 88 ? -26.460 -64.295 286.057 1.00 76.02  ? 478 HIS A CD2    1 
ATOM   1253 C  CE1    . HIS A 1 88 ? -26.999 -64.212 288.180 1.00 80.06  ? 478 HIS A CE1    1 
ATOM   1254 N  NE2    . HIS A 1 88 ? -26.865 -65.025 287.147 1.00 78.65  ? 478 HIS A NE2    1 
ATOM   1255 H  H      . HIS A 1 88 ? -24.774 -60.155 284.361 1.00 54.22  ? 478 HIS A H      1 
ATOM   1256 H  HA     . HIS A 1 88 ? -24.352 -61.032 286.754 1.00 63.22  ? 478 HIS A HA     1 
ATOM   1257 H  HB2    . HIS A 1 88 ? -26.495 -61.042 286.035 1.00 74.81  ? 478 HIS A HB2    1 
ATOM   1258 H  HB3    . HIS A 1 88 ? -26.134 -61.928 284.768 1.00 74.81  ? 478 HIS A HB3    1 
ATOM   1259 H  HD1    . HIS A 1 88 ? -26.705 -62.289 288.290 1.00 93.32  ? 478 HIS A HD1    1 
ATOM   1260 H  HD2    . HIS A 1 88 ? -26.292 -64.624 285.204 1.00 91.25  ? 478 HIS A HD2    1 
ATOM   1261 H  HE1    . HIS A 1 88 ? -27.262 -64.460 289.036 1.00 96.10  ? 478 HIS A HE1    1 
ATOM   1262 N  N      . MET A 1 89 ? -23.398 -63.113 284.499 1.00 43.85  ? 479 MET A N      1 
ATOM   1263 C  CA     . MET A 1 89 ? -22.655 -64.351 284.285 1.00 44.59  ? 479 MET A CA     1 
ATOM   1264 C  C      . MET A 1 89 ? -21.264 -64.273 284.898 1.00 43.73  ? 479 MET A C      1 
ATOM   1265 O  O      . MET A 1 89 ? -20.726 -65.294 285.343 1.00 43.49  ? 479 MET A O      1 
ATOM   1266 C  CB     . MET A 1 89 ? -22.564 -64.658 282.786 1.00 44.39  ? 479 MET A CB     1 
ATOM   1267 C  CG     . MET A 1 89 ? -22.016 -66.054 282.434 1.00 49.88  ? 479 MET A CG     1 
ATOM   1268 S  SD     . MET A 1 89 ? -23.007 -67.463 283.012 1.00 53.03  ? 479 MET A SD     1 
ATOM   1269 C  CE     . MET A 1 89 ? -24.531 -67.180 282.108 1.00 53.11  ? 479 MET A CE     1 
ATOM   1270 H  H      . MET A 1 89 ? -23.681 -62.740 283.777 1.00 52.65  ? 479 MET A H      1 
ATOM   1271 H  HA     . MET A 1 89 ? -23.139 -65.079 284.705 1.00 53.54  ? 479 MET A HA     1 
ATOM   1272 H  HB2    . MET A 1 89 ? -23.452 -64.588 282.403 1.00 53.30  ? 479 MET A HB2    1 
ATOM   1273 H  HB3    . MET A 1 89 ? -21.980 -64.003 282.372 1.00 53.30  ? 479 MET A HB3    1 
ATOM   1274 H  HG2    . MET A 1 89 ? -21.951 -66.123 281.468 1.00 59.88  ? 479 MET A HG2    1 
ATOM   1275 H  HG3    . MET A 1 89 ? -21.132 -66.143 282.823 1.00 59.88  ? 479 MET A HG3    1 
ATOM   1276 H  HE1    . MET A 1 89 ? -25.164 -67.880 282.331 1.00 63.75  ? 479 MET A HE1    1 
ATOM   1277 H  HE2    . MET A 1 89 ? -24.891 -66.315 282.360 1.00 63.75  ? 479 MET A HE2    1 
ATOM   1278 H  HE3    . MET A 1 89 ? -24.341 -67.195 281.157 1.00 63.75  ? 479 MET A HE3    1 
ATOM   1279 N  N      . LYS A 1 90 ? -20.679 -63.073 284.958 1.00 51.34  ? 480 LYS A N      1 
ATOM   1280 C  CA     . LYS A 1 90 ? -19.367 -62.917 285.579 1.00 53.64  ? 480 LYS A CA     1 
ATOM   1281 C  C      . LYS A 1 90 ? -19.385 -63.322 287.046 1.00 55.90  ? 480 LYS A C      1 
ATOM   1282 O  O      . LYS A 1 90 ? -18.373 -63.808 287.567 1.00 57.40  ? 480 LYS A O      1 
ATOM   1283 C  CB     . LYS A 1 90 ? -18.885 -61.470 285.437 1.00 55.65  ? 480 LYS A CB     1 
ATOM   1284 C  CG     . LYS A 1 90 ? -18.430 -61.113 284.020 1.00 57.51  ? 480 LYS A CG     1 
ATOM   1285 C  CD     . LYS A 1 90 ? -17.866 -59.701 283.937 1.00 62.57  ? 480 LYS A CD     1 
ATOM   1286 C  CE     . LYS A 1 90 ? -17.003 -59.519 282.687 1.00 64.98  ? 480 LYS A CE     1 
ATOM   1287 N  NZ     . LYS A 1 90 ? -17.630 -60.065 281.443 1.00 64.32  ? 480 LYS A NZ     1 
ATOM   1288 H  H      . LYS A 1 90 ? -21.018 -62.345 284.650 1.00 61.64  ? 480 LYS A H      1 
ATOM   1289 H  HA     . LYS A 1 90 ? -18.732 -63.489 285.120 1.00 64.39  ? 480 LYS A HA     1 
ATOM   1290 H  HB2    . LYS A 1 90 ? -19.611 -60.873 285.676 1.00 66.81  ? 480 LYS A HB2    1 
ATOM   1291 H  HB3    . LYS A 1 90 ? -18.133 -61.331 286.035 1.00 66.81  ? 480 LYS A HB3    1 
ATOM   1292 H  HG2    . LYS A 1 90 ? -17.736 -61.732 283.744 1.00 69.04  ? 480 LYS A HG2    1 
ATOM   1293 H  HG3    . LYS A 1 90 ? -19.188 -61.171 283.419 1.00 69.04  ? 480 LYS A HG3    1 
ATOM   1294 H  HD2    . LYS A 1 90 ? -18.597 -59.065 283.897 1.00 75.12  ? 480 LYS A HD2    1 
ATOM   1295 H  HD3    . LYS A 1 90 ? -17.313 -59.530 284.715 1.00 75.12  ? 480 LYS A HD3    1 
ATOM   1296 H  HE2    . LYS A 1 90 ? -16.847 -58.571 282.550 1.00 78.00  ? 480 LYS A HE2    1 
ATOM   1297 H  HE3    . LYS A 1 90 ? -16.158 -59.976 282.819 1.00 78.00  ? 480 LYS A HE3    1 
ATOM   1298 H  HZ1    . LYS A 1 90 ? -17.090 -59.933 280.747 1.00 77.21  ? 480 LYS A HZ1    1 
ATOM   1299 H  HZ2    . LYS A 1 90 ? -17.777 -60.938 281.534 1.00 77.21  ? 480 LYS A HZ2    1 
ATOM   1300 H  HZ3    . LYS A 1 90 ? -18.405 -59.655 281.288 1.00 77.21  ? 480 LYS A HZ3    1 
ATOM   1301 N  N      . ARG A 1 91 ? -20.520 -63.151 287.723 1.00 53.71  ? 481 ARG A N      1 
ATOM   1302 C  CA     . ARG A 1 91 ? -20.621 -63.469 289.144 1.00 59.50  ? 481 ARG A CA     1 
ATOM   1303 C  C      . ARG A 1 91 ? -20.731 -64.965 289.419 1.00 61.68  ? 481 ARG A C      1 
ATOM   1304 O  O      . ARG A 1 91 ? -20.810 -65.358 290.591 1.00 59.39  ? 481 ARG A O      1 
ATOM   1305 C  CB     . ARG A 1 91 ? -21.819 -62.736 289.751 1.00 63.17  ? 481 ARG A CB     1 
ATOM   1306 C  CG     . ARG A 1 91 ? -21.836 -61.249 289.402 1.00 64.82  ? 481 ARG A CG     1 
ATOM   1307 C  CD     . ARG A 1 91 ? -23.102 -60.543 289.846 1.00 67.58  ? 481 ARG A CD     1 
ATOM   1308 N  NE     . ARG A 1 91 ? -22.995 -60.014 291.208 1.00 73.33  ? 481 ARG A NE     1 
ATOM   1309 C  CZ     . ARG A 1 91 ? -23.734 -60.404 292.247 1.00 77.33  ? 481 ARG A CZ     1 
ATOM   1310 N  NH1    . ARG A 1 91 ? -24.672 -61.339 292.121 1.00 78.14  ? 481 ARG A NH1    1 
ATOM   1311 N  NH2    . ARG A 1 91 ? -23.535 -59.843 293.429 1.00 80.93  ? 481 ARG A NH2    1 
ATOM   1312 H  H      . ARG A 1 91 ? -21.249 -62.850 287.379 1.00 64.49  ? 481 ARG A H      1 
ATOM   1313 H  HA     . ARG A 1 91 ? -19.822 -63.147 289.590 1.00 71.43  ? 481 ARG A HA     1 
ATOM   1314 H  HB2    . ARG A 1 91 ? -22.637 -63.133 289.414 1.00 75.83  ? 481 ARG A HB2    1 
ATOM   1315 H  HB3    . ARG A 1 91 ? -21.783 -62.817 290.717 1.00 75.83  ? 481 ARG A HB3    1 
ATOM   1316 H  HG2    . ARG A 1 91 ? -21.084 -60.816 289.836 1.00 77.81  ? 481 ARG A HG2    1 
ATOM   1317 H  HG3    . ARG A 1 91 ? -21.762 -61.152 288.439 1.00 77.81  ? 481 ARG A HG3    1 
ATOM   1318 H  HD2    . ARG A 1 91 ? -23.279 -59.801 289.247 1.00 81.12  ? 481 ARG A HD2    1 
ATOM   1319 H  HD3    . ARG A 1 91 ? -23.841 -61.172 289.824 1.00 81.12  ? 481 ARG A HD3    1 
ATOM   1320 H  HE     . ARG A 1 91 ? -22.408 -59.401 291.349 1.00 88.02  ? 481 ARG A HE     1 
ATOM   1321 H  HH11   . ARG A 1 91 ? -24.810 -61.710 291.357 1.00 93.79  ? 481 ARG A HH11   1 
ATOM   1322 H  HH12   . ARG A 1 91 ? -25.138 -61.575 292.804 1.00 93.79  ? 481 ARG A HH12   1 
ATOM   1323 H  HH21   . ARG A 1 91 ? -22.932 -59.236 293.521 1.00 97.15  ? 481 ARG A HH21   1 
ATOM   1324 H  HH22   . ARG A 1 91 ? -24.007 -60.086 294.105 1.00 97.15  ? 481 ARG A HH22   1 
ATOM   1325 N  N      . HIS A 1 92 ? -20.734 -65.806 288.382 1.00 41.28  ? 482 HIS A N      1 
ATOM   1326 C  CA     . HIS A 1 92 ? -20.733 -67.253 288.546 1.00 50.14  ? 482 HIS A CA     1 
ATOM   1327 C  C      . HIS A 1 92 ? -19.333 -67.850 288.545 1.00 45.68  ? 482 HIS A C      1 
ATOM   1328 O  O      . HIS A 1 92 ? -19.191 -69.053 288.786 1.00 47.19  ? 482 HIS A O      1 
ATOM   1329 C  CB     . HIS A 1 92 ? -21.540 -67.922 287.428 1.00 60.28  ? 482 HIS A CB     1 
ATOM   1330 C  CG     . HIS A 1 92 ? -23.022 -67.856 287.621 1.00 67.80  ? 482 HIS A CG     1 
ATOM   1331 N  ND1    . HIS A 1 92 ? -23.711 -68.764 288.393 1.00 72.18  ? 482 HIS A ND1    1 
ATOM   1332 C  CD2    . HIS A 1 92 ? -23.949 -67.005 287.124 1.00 68.67  ? 482 HIS A CD2    1 
ATOM   1333 C  CE1    . HIS A 1 92 ? -24.998 -68.470 288.373 1.00 72.66  ? 482 HIS A CE1    1 
ATOM   1334 N  NE2    . HIS A 1 92 ? -25.169 -67.406 287.610 1.00 69.24  ? 482 HIS A NE2    1 
ATOM   1335 H  H      . HIS A 1 92 ? -20.737 -65.552 287.561 1.00 49.57  ? 482 HIS A H      1 
ATOM   1336 H  HA     . HIS A 1 92 ? -21.152 -67.475 289.392 1.00 60.19  ? 482 HIS A HA     1 
ATOM   1337 H  HB2    . HIS A 1 92 ? -21.332 -67.483 286.588 1.00 72.37  ? 482 HIS A HB2    1 
ATOM   1338 H  HB3    . HIS A 1 92 ? -21.290 -68.858 287.380 1.00 72.37  ? 482 HIS A HB3    1 
ATOM   1339 H  HD1    . HIS A 1 92 ? -23.358 -69.419 288.824 1.00 86.65  ? 482 HIS A HD1    1 
ATOM   1340 H  HD2    . HIS A 1 92 ? -23.789 -66.280 286.564 1.00 82.43  ? 482 HIS A HD2    1 
ATOM   1341 H  HE1    . HIS A 1 92 ? -25.669 -68.933 288.820 1.00 87.22  ? 482 HIS A HE1    1 
ATOM   1342 N  N      . PHE A 1 93 ? -18.309 -67.050 288.275 1.00 68.34  ? 483 PHE A N      1 
ATOM   1343 C  CA     . PHE A 1 93 ? -16.959 -67.567 288.124 1.00 68.40  ? 483 PHE A CA     1 
ATOM   1344 C  C      . PHE A 1 93 ? -15.974 -66.775 288.985 1.00 71.38  ? 483 PHE A C      1 
ATOM   1345 O  O      . PHE A 1 93 ? -15.260 -65.899 288.494 1.00 70.97  ? 483 PHE A O      1 
ATOM   1346 C  CB     . PHE A 1 93 ? -16.541 -67.526 286.648 1.00 65.79  ? 483 PHE A CB     1 
ATOM   1347 C  CG     . PHE A 1 93 ? -17.451 -68.319 285.728 1.00 62.43  ? 483 PHE A CG     1 
ATOM   1348 C  CD1    . PHE A 1 93 ? -17.273 -69.685 285.560 1.00 62.56  ? 483 PHE A CD1    1 
ATOM   1349 C  CD2    . PHE A 1 93 ? -18.476 -67.696 285.028 1.00 58.18  ? 483 PHE A CD2    1 
ATOM   1350 C  CE1    . PHE A 1 93 ? -18.103 -70.417 284.716 1.00 60.50  ? 483 PHE A CE1    1 
ATOM   1351 C  CE2    . PHE A 1 93 ? -19.308 -68.425 284.180 1.00 55.71  ? 483 PHE A CE2    1 
ATOM   1352 C  CZ     . PHE A 1 93 ? -19.120 -69.787 284.028 1.00 56.99  ? 483 PHE A CZ     1 
ATOM   1353 H  H      . PHE A 1 93 ? -18.372 -66.198 288.173 1.00 82.03  ? 483 PHE A H      1 
ATOM   1354 H  HA     . PHE A 1 93 ? -16.939 -68.491 288.417 1.00 82.11  ? 483 PHE A HA     1 
ATOM   1355 H  HB2    . PHE A 1 93 ? -16.548 -66.603 286.348 1.00 78.98  ? 483 PHE A HB2    1 
ATOM   1356 H  HB3    . PHE A 1 93 ? -15.646 -67.891 286.567 1.00 78.98  ? 483 PHE A HB3    1 
ATOM   1357 H  HD1    . PHE A 1 93 ? -16.591 -70.118 286.021 1.00 75.10  ? 483 PHE A HD1    1 
ATOM   1358 H  HD2    . PHE A 1 93 ? -18.610 -66.781 285.126 1.00 69.84  ? 483 PHE A HD2    1 
ATOM   1359 H  HE1    . PHE A 1 93 ? -17.972 -71.332 284.615 1.00 72.62  ? 483 PHE A HE1    1 
ATOM   1360 H  HE2    . PHE A 1 93 ? -19.992 -67.996 283.719 1.00 66.89  ? 483 PHE A HE2    1 
ATOM   1361 H  HZ     . PHE A 1 93 ? -19.674 -70.275 283.463 1.00 68.41  ? 483 PHE A HZ     1 
ATOM   1362 O  "O5'"  . DG  B 2 1  ? -31.765 -56.086 286.091 1.00 53.63  ? 1   DG  B "O5'"  1 
ATOM   1363 C  "C5'"  . DG  B 2 1  ? -32.624 -55.687 287.172 1.00 49.65  ? 1   DG  B "C5'"  1 
ATOM   1364 C  "C4'"  . DG  B 2 1  ? -33.309 -54.355 286.874 1.00 40.74  ? 1   DG  B "C4'"  1 
ATOM   1365 O  "O4'"  . DG  B 2 1  ? -32.365 -53.260 287.036 1.00 38.03  ? 1   DG  B "O4'"  1 
ATOM   1366 C  "C3'"  . DG  B 2 1  ? -33.862 -54.186 285.457 1.00 37.72  ? 1   DG  B "C3'"  1 
ATOM   1367 O  "O3'"  . DG  B 2 1  ? -35.010 -53.363 285.505 1.00 37.87  ? 1   DG  B "O3'"  1 
ATOM   1368 C  "C2'"  . DG  B 2 1  ? -32.704 -53.533 284.710 1.00 38.17  ? 1   DG  B "C2'"  1 
ATOM   1369 C  "C1'"  . DG  B 2 1  ? -32.133 -52.612 285.780 1.00 37.63  ? 1   DG  B "C1'"  1 
ATOM   1370 N  N9     . DG  B 2 1  ? -30.702 -52.353 285.693 1.00 37.00  ? 1   DG  B N9     1 
ATOM   1371 C  C8     . DG  B 2 1  ? -29.698 -53.268 285.473 1.00 38.12  ? 1   DG  B C8     1 
ATOM   1372 N  N7     . DG  B 2 1  ? -28.503 -52.745 285.525 1.00 36.84  ? 1   DG  B N7     1 
ATOM   1373 C  C5     . DG  B 2 1  ? -28.734 -51.406 285.815 1.00 36.67  ? 1   DG  B C5     1 
ATOM   1374 C  C6     . DG  B 2 1  ? -27.823 -50.338 285.991 1.00 34.68  ? 1   DG  B C6     1 
ATOM   1375 O  O6     . DG  B 2 1  ? -26.595 -50.361 285.937 1.00 33.31  ? 1   DG  B O6     1 
ATOM   1376 N  N1     . DG  B 2 1  ? -28.473 -49.148 286.265 1.00 34.85  ? 1   DG  B N1     1 
ATOM   1377 C  C2     . DG  B 2 1  ? -29.828 -49.003 286.382 1.00 35.76  ? 1   DG  B C2     1 
ATOM   1378 N  N2     . DG  B 2 1  ? -30.269 -47.772 286.670 1.00 35.31  ? 1   DG  B N2     1 
ATOM   1379 N  N3     . DG  B 2 1  ? -30.693 -49.987 286.212 1.00 36.65  ? 1   DG  B N3     1 
ATOM   1380 C  C4     . DG  B 2 1  ? -30.077 -51.156 285.930 1.00 36.60  ? 1   DG  B C4     1 
ATOM   1381 H  "H5'"  . DG  B 2 1  ? -32.096 -55.598 287.980 1.00 59.61  ? 1   DG  B "H5'"  1 
ATOM   1382 H  "H5''" . DG  B 2 1  ? -33.300 -56.368 287.308 1.00 59.61  ? 1   DG  B "H5''" 1 
ATOM   1383 H  "H4'"  . DG  B 2 1  ? -34.035 -54.234 287.506 1.00 48.92  ? 1   DG  B "H4'"  1 
ATOM   1384 H  "H3'"  . DG  B 2 1  ? -34.074 -55.049 285.069 1.00 45.29  ? 1   DG  B "H3'"  1 
ATOM   1385 H  "H2'"  . DG  B 2 1  ? -32.049 -54.195 284.438 1.00 45.83  ? 1   DG  B "H2'"  1 
ATOM   1386 H  "H2''" . DG  B 2 1  ? -33.025 -53.024 283.950 1.00 45.83  ? 1   DG  B "H2''" 1 
ATOM   1387 H  "H1'"  . DG  B 2 1  ? -32.612 -51.768 285.764 1.00 45.18  ? 1   DG  B "H1'"  1 
ATOM   1388 H  H8     . DG  B 2 1  ? -29.855 -54.167 285.296 1.00 45.77  ? 1   DG  B H8     1 
ATOM   1389 H  H1     . DG  B 2 1  ? -27.987 -48.451 286.396 1.00 41.85  ? 1   DG  B H1     1 
ATOM   1390 H  H21    . DG  B 2 1  ? -31.112 -47.624 286.745 1.00 42.39  ? 1   DG  B H21    1 
ATOM   1391 H  H22    . DG  B 2 1  ? -29.708 -47.129 286.781 1.00 42.39  ? 1   DG  B H22    1 
ATOM   1392 H  "HO5'" . DG  B 2 1  ? -31.359 -56.821 286.127 1.00 64.39  ? 1   DG  B "HO5'" 1 
ATOM   1393 P  P      . DA  B 2 2  ? -35.878 -53.039 284.198 1.00 38.54  ? 2   DA  B P      1 
ATOM   1394 O  OP1    . DA  B 2 2  ? -37.255 -52.868 284.727 1.00 38.67  ? 2   DA  B OP1    1 
ATOM   1395 O  OP2    . DA  B 2 2  ? -35.553 -53.946 283.084 1.00 37.64  ? 2   DA  B OP2    1 
ATOM   1396 O  "O5'"  . DA  B 2 2  ? -35.331 -51.635 283.744 1.00 35.86  ? 2   DA  B "O5'"  1 
ATOM   1397 C  "C5'"  . DA  B 2 2  ? -35.564 -50.523 284.532 1.00 36.24  ? 2   DA  B "C5'"  1 
ATOM   1398 C  "C4'"  . DA  B 2 2  ? -34.865 -49.333 283.934 1.00 34.12  ? 2   DA  B "C4'"  1 
ATOM   1399 O  "O4'"  . DA  B 2 2  ? -33.444 -49.531 284.010 1.00 32.55  ? 2   DA  B "O4'"  1 
ATOM   1400 C  "C3'"  . DA  B 2 2  ? -35.170 -49.089 282.450 1.00 30.74  ? 2   DA  B "C3'"  1 
ATOM   1401 O  "O3'"  . DA  B 2 2  ? -35.984 -47.931 282.312 1.00 32.79  ? 2   DA  B "O3'"  1 
ATOM   1402 C  "C2'"  . DA  B 2 2  ? -33.788 -48.941 281.787 1.00 29.44  ? 2   DA  B "C2'"  1 
ATOM   1403 C  "C1'"  . DA  B 2 2  ? -32.843 -48.813 282.969 1.00 31.51  ? 2   DA  B "C1'"  1 
ATOM   1404 N  N9     . DA  B 2 2  ? -31.512 -49.369 282.768 1.00 31.09  ? 2   DA  B N9     1 
ATOM   1405 C  C8     . DA  B 2 2  ? -31.194 -50.658 282.490 1.00 29.51  ? 2   DA  B C8     1 
ATOM   1406 N  N7     . DA  B 2 2  ? -29.911 -50.877 282.415 1.00 29.26  ? 2   DA  B N7     1 
ATOM   1407 C  C5     . DA  B 2 2  ? -29.349 -49.645 282.695 1.00 29.31  ? 2   DA  B C5     1 
ATOM   1408 C  C6     . DA  B 2 2  ? -28.020 -49.208 282.779 1.00 28.91  ? 2   DA  B C6     1 
ATOM   1409 N  N6     . DA  B 2 2  ? -26.977 -50.010 282.591 1.00 30.18  ? 2   DA  B N6     1 
ATOM   1410 N  N1     . DA  B 2 2  ? -27.800 -47.914 283.075 1.00 30.66  ? 2   DA  B N1     1 
ATOM   1411 C  C2     . DA  B 2 2  ? -28.847 -47.122 283.288 1.00 32.66  ? 2   DA  B C2     1 
ATOM   1412 N  N3     . DA  B 2 2  ? -30.144 -47.422 283.236 1.00 33.84  ? 2   DA  B N3     1 
ATOM   1413 C  C4     . DA  B 2 2  ? -30.321 -48.710 282.921 1.00 31.23  ? 2   DA  B C4     1 
ATOM   1414 H  "H5'"  . DA  B 2 2  ? -35.224 -50.682 285.426 1.00 43.52  ? 2   DA  B "H5'"  1 
ATOM   1415 H  "H5''" . DA  B 2 2  ? -36.517 -50.350 284.575 1.00 43.52  ? 2   DA  B "H5''" 1 
ATOM   1416 H  "H4'"  . DA  B 2 2  ? -35.101 -48.540 284.440 1.00 40.97  ? 2   DA  B "H4'"  1 
ATOM   1417 H  "H3'"  . DA  B 2 2  ? -35.629 -49.859 282.080 1.00 36.92  ? 2   DA  B "H3'"  1 
ATOM   1418 H  "H2'"  . DA  B 2 2  ? -33.574 -49.729 281.263 1.00 35.35  ? 2   DA  B "H2'"  1 
ATOM   1419 H  "H2''" . DA  B 2 2  ? -33.757 -48.143 281.237 1.00 35.35  ? 2   DA  B "H2''" 1 
ATOM   1420 H  "H1'"  . DA  B 2 2  ? -32.768 -47.880 283.223 1.00 37.83  ? 2   DA  B "H1'"  1 
ATOM   1421 H  H8     . DA  B 2 2  ? -31.832 -51.318 282.340 1.00 35.45  ? 2   DA  B H8     1 
ATOM   1422 H  H61    . DA  B 2 2  ? -26.178 -49.699 282.658 1.00 36.24  ? 2   DA  B H61    1 
ATOM   1423 H  H62    . DA  B 2 2  ? -27.101 -50.839 282.401 1.00 36.24  ? 2   DA  B H62    1 
ATOM   1424 H  H2     . DA  B 2 2  ? -28.647 -46.237 283.490 1.00 39.22  ? 2   DA  B H2     1 
ATOM   1425 P  P      . DG  B 2 3  ? -36.428 -47.387 280.862 1.00 31.94  ? 3   DG  B P      1 
ATOM   1426 O  OP1    . DG  B 2 3  ? -37.599 -46.525 281.101 1.00 35.18  ? 3   DG  B OP1    1 
ATOM   1427 O  OP2    . DG  B 2 3  ? -36.519 -48.502 279.881 1.00 30.08  ? 3   DG  B OP2    1 
ATOM   1428 O  "O5'"  . DG  B 2 3  ? -35.215 -46.449 280.468 1.00 30.17  ? 3   DG  B "O5'"  1 
ATOM   1429 C  "C5'"  . DG  B 2 3  ? -35.012 -45.255 281.177 1.00 30.15  ? 3   DG  B "C5'"  1 
ATOM   1430 C  "C4'"  . DG  B 2 3  ? -33.821 -44.504 280.630 1.00 32.12  ? 3   DG  B "C4'"  1 
ATOM   1431 O  "O4'"  . DG  B 2 3  ? -32.610 -45.276 280.866 1.00 33.39  ? 3   DG  B "O4'"  1 
ATOM   1432 C  "C3'"  . DG  B 2 3  ? -33.874 -44.225 279.117 1.00 32.08  ? 3   DG  B "C3'"  1 
ATOM   1433 O  "O3'"  . DG  B 2 3  ? -33.742 -42.822 278.896 1.00 32.65  ? 3   DG  B "O3'"  1 
ATOM   1434 C  "C2'"  . DG  B 2 3  ? -32.710 -45.035 278.547 1.00 31.61  ? 3   DG  B "C2'"  1 
ATOM   1435 C  "C1'"  . DG  B 2 3  ? -31.772 -45.183 279.746 1.00 31.50  ? 3   DG  B "C1'"  1 
ATOM   1436 N  N9     . DG  B 2 3  ? -30.905 -46.369 279.700 1.00 29.86  ? 3   DG  B N9     1 
ATOM   1437 C  C8     . DG  B 2 3  ? -31.302 -47.686 279.592 1.00 28.71  ? 3   DG  B C8     1 
ATOM   1438 N  N7     . DG  B 2 3  ? -30.312 -48.530 279.583 1.00 26.93  ? 3   DG  B N7     1 
ATOM   1439 C  C5     . DG  B 2 3  ? -29.180 -47.726 279.689 1.00 28.75  ? 3   DG  B C5     1 
ATOM   1440 C  C6     . DG  B 2 3  ? -27.810 -48.081 279.710 1.00 31.33  ? 3   DG  B C6     1 
ATOM   1441 O  O6     . DG  B 2 3  ? -27.307 -49.212 279.656 1.00 32.35  ? 3   DG  B O6     1 
ATOM   1442 N  N1     . DG  B 2 3  ? -26.984 -46.959 279.808 1.00 32.08  ? 3   DG  B N1     1 
ATOM   1443 C  C2     . DG  B 2 3  ? -27.428 -45.660 279.870 1.00 30.53  ? 3   DG  B C2     1 
ATOM   1444 N  N2     . DG  B 2 3  ? -26.482 -44.719 279.967 1.00 31.64  ? 3   DG  B N2     1 
ATOM   1445 N  N3     . DG  B 2 3  ? -28.712 -45.311 279.858 1.00 29.65  ? 3   DG  B N3     1 
ATOM   1446 C  C4     . DG  B 2 3  ? -29.529 -46.393 279.758 1.00 28.74  ? 3   DG  B C4     1 
ATOM   1447 H  "H5'"  . DG  B 2 3  ? -34.858 -45.461 282.112 1.00 36.21  ? 3   DG  B "H5'"  1 
ATOM   1448 H  "H5''" . DG  B 2 3  ? -35.803 -44.699 281.099 1.00 36.21  ? 3   DG  B "H5''" 1 
ATOM   1449 H  "H4'"  . DG  B 2 3  ? -33.746 -43.658 281.099 1.00 38.57  ? 3   DG  B "H4'"  1 
ATOM   1450 H  "H3'"  . DG  B 2 3  ? -34.714 -44.544 278.750 1.00 38.52  ? 3   DG  B "H3'"  1 
ATOM   1451 H  "H2'"  . DG  B 2 3  ? -33.015 -45.904 278.241 1.00 37.96  ? 3   DG  B "H2'"  1 
ATOM   1452 H  "H2''" . DG  B 2 3  ? -32.274 -44.550 277.829 1.00 37.96  ? 3   DG  B "H2''" 1 
ATOM   1453 H  "H1'"  . DG  B 2 3  ? -31.223 -44.387 279.823 1.00 37.83  ? 3   DG  B "H1'"  1 
ATOM   1454 H  H8     . DG  B 2 3  ? -32.194 -47.948 279.552 1.00 34.48  ? 3   DG  B H8     1 
ATOM   1455 H  H1     . DG  B 2 3  ? -26.135 -47.091 279.834 1.00 38.52  ? 3   DG  B H1     1 
ATOM   1456 H  H21    . DG  B 2 3  ? -26.704 -43.890 280.022 1.00 38.00  ? 3   DG  B H21    1 
ATOM   1457 H  H22    . DG  B 2 3  ? -25.652 -44.943 279.975 1.00 38.00  ? 3   DG  B H22    1 
ATOM   1458 P  P      . DG  B 2 4  ? -33.823 -42.182 277.428 1.00 34.11  ? 4   DG  B P      1 
ATOM   1459 O  OP1    . DG  B 2 4  ? -34.261 -40.785 277.617 1.00 34.96  ? 4   DG  B OP1    1 
ATOM   1460 O  OP2    . DG  B 2 4  ? -34.594 -43.094 276.553 1.00 35.17  ? 4   DG  B OP2    1 
ATOM   1461 O  "O5'"  . DG  B 2 4  ? -32.306 -42.168 276.955 1.00 33.03  ? 4   DG  B "O5'"  1 
ATOM   1462 C  "C5'"  . DG  B 2 4  ? -31.367 -41.400 277.657 1.00 31.74  ? 4   DG  B "C5'"  1 
ATOM   1463 C  "C4'"  . DG  B 2 4  ? -29.995 -41.550 277.044 1.00 31.84  ? 4   DG  B "C4'"  1 
ATOM   1464 O  "O4'"  . DG  B 2 4  ? -29.496 -42.866 277.344 1.00 31.63  ? 4   DG  B "O4'"  1 
ATOM   1465 C  "C3'"  . DG  B 2 4  ? -29.960 -41.410 275.510 1.00 33.02  ? 4   DG  B "C3'"  1 
ATOM   1466 O  "O3'"  . DG  B 2 4  ? -29.083 -40.355 275.118 1.00 31.47  ? 4   DG  B "O3'"  1 
ATOM   1467 C  "C2'"  . DG  B 2 4  ? -29.488 -42.781 275.015 1.00 32.74  ? 4   DG  B "C2'"  1 
ATOM   1468 C  "C1'"  . DG  B 2 4  ? -28.789 -43.357 276.241 1.00 31.82  ? 4   DG  B "C1'"  1 
ATOM   1469 N  N9     . DG  B 2 4  ? -28.770 -44.820 276.289 1.00 28.48  ? 4   DG  B N9     1 
ATOM   1470 C  C8     . DG  B 2 4  ? -29.850 -45.677 276.250 1.00 27.10  ? 4   DG  B C8     1 
ATOM   1471 N  N7     . DG  B 2 4  ? -29.508 -46.941 276.296 1.00 27.50  ? 4   DG  B N7     1 
ATOM   1472 C  C5     . DG  B 2 4  ? -28.120 -46.920 276.360 1.00 26.36  ? 4   DG  B C5     1 
ATOM   1473 C  C6     . DG  B 2 4  ? -27.188 -47.985 276.405 1.00 25.56  ? 4   DG  B C6     1 
ATOM   1474 O  O6     . DG  B 2 4  ? -27.407 -49.204 276.410 1.00 25.03  ? 4   DG  B O6     1 
ATOM   1475 N  N1     . DG  B 2 4  ? -25.879 -47.520 276.463 1.00 27.70  ? 4   DG  B N1     1 
ATOM   1476 C  C2     . DG  B 2 4  ? -25.514 -46.189 276.456 1.00 31.40  ? 4   DG  B C2     1 
ATOM   1477 N  N2     . DG  B 2 4  ? -24.205 -45.935 276.511 1.00 33.74  ? 4   DG  B N2     1 
ATOM   1478 N  N3     . DG  B 2 4  ? -26.371 -45.182 276.399 1.00 29.68  ? 4   DG  B N3     1 
ATOM   1479 C  C4     . DG  B 2 4  ? -27.653 -45.620 276.351 1.00 28.91  ? 4   DG  B C4     1 
ATOM   1480 H  "H5'"  . DG  B 2 4  ? -31.338 -41.696 278.580 1.00 38.11  ? 4   DG  B "H5'"  1 
ATOM   1481 H  "H5''" . DG  B 2 4  ? -31.630 -40.467 277.627 1.00 38.11  ? 4   DG  B "H5''" 1 
ATOM   1482 H  "H4'"  . DG  B 2 4  ? -29.401 -40.890 277.434 1.00 38.24  ? 4   DG  B "H4'"  1 
ATOM   1483 H  "H3'"  . DG  B 2 4  ? -30.855 -41.233 275.178 1.00 39.65  ? 4   DG  B "H3'"  1 
ATOM   1484 H  "H2'"  . DG  B 2 4  ? -30.244 -43.333 274.760 1.00 39.32  ? 4   DG  B "H2'"  1 
ATOM   1485 H  "H2''" . DG  B 2 4  ? -28.865 -42.685 274.278 1.00 39.32  ? 4   DG  B "H2''" 1 
ATOM   1486 H  "H1'"  . DG  B 2 4  ? -27.878 -43.025 276.273 1.00 38.21  ? 4   DG  B "H1'"  1 
ATOM   1487 H  H8     . DG  B 2 4  ? -30.732 -45.387 276.205 1.00 32.55  ? 4   DG  B H8     1 
ATOM   1488 H  H1     . DG  B 2 4  ? -25.250 -48.105 276.500 1.00 33.26  ? 4   DG  B H1     1 
ATOM   1489 H  H21    . DG  B 2 4  ? -23.924 -45.122 276.509 1.00 40.51  ? 4   DG  B H21    1 
ATOM   1490 H  H22    . DG  B 2 4  ? -23.642 -46.584 276.549 1.00 40.51  ? 4   DG  B H22    1 
ATOM   1491 P  P      . DT  B 2 5  ? -28.991 -39.916 273.568 1.00 35.86  ? 5   DT  B P      1 
ATOM   1492 O  OP1    . DT  B 2 5  ? -28.470 -38.535 273.559 1.00 38.29  ? 5   DT  B OP1    1 
ATOM   1493 O  OP2    . DT  B 2 5  ? -30.263 -40.288 272.899 1.00 33.65  ? 5   DT  B OP2    1 
ATOM   1494 O  "O5'"  . DT  B 2 5  ? -27.848 -40.865 272.992 1.00 34.68  ? 5   DT  B "O5'"  1 
ATOM   1495 C  "C5'"  . DT  B 2 5  ? -26.600 -40.875 273.613 1.00 34.49  ? 5   DT  B "C5'"  1 
ATOM   1496 C  "C4'"  . DT  B 2 5  ? -25.728 -41.988 273.070 1.00 35.22  ? 5   DT  B "C4'"  1 
ATOM   1497 O  "O4'"  . DT  B 2 5  ? -26.180 -43.293 273.564 1.00 33.29  ? 5   DT  B "O4'"  1 
ATOM   1498 C  "C3'"  . DT  B 2 5  ? -25.719 -42.117 271.534 1.00 37.97  ? 5   DT  B "C3'"  1 
ATOM   1499 O  "O3'"  . DT  B 2 5  ? -24.397 -42.241 271.078 1.00 43.46  ? 5   DT  B "O3'"  1 
ATOM   1500 C  "C2'"  . DT  B 2 5  ? -26.493 -43.401 271.299 1.00 35.14  ? 5   DT  B "C2'"  1 
ATOM   1501 C  "C1'"  . DT  B 2 5  ? -26.022 -44.192 272.493 1.00 35.51  ? 5   DT  B "C1'"  1 
ATOM   1502 N  N1     . DT  B 2 5  ? -26.747 -45.463 272.725 1.00 34.11  ? 5   DT  B N1     1 
ATOM   1503 C  C2     . DT  B 2 5  ? -26.007 -46.599 272.966 1.00 32.31  ? 5   DT  B C2     1 
ATOM   1504 O  O2     . DT  B 2 5  ? -24.789 -46.603 273.028 1.00 32.50  ? 5   DT  B O2     1 
ATOM   1505 N  N3     . DT  B 2 5  ? -26.738 -47.737 273.143 1.00 29.64  ? 5   DT  B N3     1 
ATOM   1506 C  C4     . DT  B 2 5  ? -28.102 -47.865 273.087 1.00 27.90  ? 5   DT  B C4     1 
ATOM   1507 O  O4     . DT  B 2 5  ? -28.650 -48.939 273.256 1.00 27.47  ? 5   DT  B O4     1 
ATOM   1508 C  C5     . DT  B 2 5  ? -28.835 -46.640 272.823 1.00 30.37  ? 5   DT  B C5     1 
ATOM   1509 C  C7     . DT  B 2 5  ? -30.334 -46.655 272.758 1.00 31.78  ? 5   DT  B C7     1 
ATOM   1510 C  C6     . DT  B 2 5  ? -28.125 -45.505 272.641 1.00 32.34  ? 5   DT  B C6     1 
ATOM   1511 H  "H5'"  . DT  B 2 5  ? -26.721 -41.003 274.567 1.00 41.42  ? 5   DT  B "H5'"  1 
ATOM   1512 H  "H5''" . DT  B 2 5  ? -26.161 -40.024 273.459 1.00 41.42  ? 5   DT  B "H5''" 1 
ATOM   1513 H  "H4'"  . DT  B 2 5  ? -24.818 -41.841 273.373 1.00 42.29  ? 5   DT  B "H4'"  1 
ATOM   1514 H  "H3'"  . DT  B 2 5  ? -26.164 -41.362 271.119 1.00 45.59  ? 5   DT  B "H3'"  1 
ATOM   1515 H  "H2'"  . DT  B 2 5  ? -27.450 -43.247 271.333 1.00 42.20  ? 5   DT  B "H2'"  1 
ATOM   1516 H  "H2''" . DT  B 2 5  ? -26.227 -43.825 270.468 1.00 42.20  ? 5   DT  B "H2''" 1 
ATOM   1517 H  "H1'"  . DT  B 2 5  ? -25.077 -44.387 272.386 1.00 42.64  ? 5   DT  B "H1'"  1 
ATOM   1518 H  H3     . DT  B 2 5  ? -26.293 -48.457 273.297 1.00 35.60  ? 5   DT  B H3     1 
ATOM   1519 H  H71    . DT  B 2 5  ? -30.694 -46.063 273.437 1.00 38.16  ? 5   DT  B H71    1 
ATOM   1520 H  H72    . DT  B 2 5  ? -30.623 -46.355 271.882 1.00 38.16  ? 5   DT  B H72    1 
ATOM   1521 H  H73    . DT  B 2 5  ? -30.655 -47.557 272.913 1.00 38.16  ? 5   DT  B H73    1 
ATOM   1522 H  H6     . DT  B 2 5  ? -28.585 -44.714 272.474 1.00 38.83  ? 5   DT  B H6     1 
ATOM   1523 P  P      . DG  B 2 6  ? -23.732 -41.168 270.092 1.00 42.74  ? 6   DG  B P      1 
ATOM   1524 O  OP1    . DG  B 2 6  ? -23.159 -40.107 270.952 1.00 43.47  ? 6   DG  B OP1    1 
ATOM   1525 O  OP2    . DG  B 2 6  ? -24.664 -40.820 269.010 1.00 41.54  ? 6   DG  B OP2    1 
ATOM   1526 O  "O5'"  . DG  B 2 6  ? -22.489 -41.988 269.511 1.00 39.67  ? 6   DG  B "O5'"  1 
ATOM   1527 C  "C5'"  . DG  B 2 6  ? -21.424 -42.340 270.397 1.00 37.00  ? 6   DG  B "C5'"  1 
ATOM   1528 C  "C4'"  . DG  B 2 6  ? -20.778 -43.651 270.001 1.00 35.51  ? 6   DG  B "C4'"  1 
ATOM   1529 O  "O4'"  . DG  B 2 6  ? -21.620 -44.766 270.404 1.00 32.41  ? 6   DG  B "O4'"  1 
ATOM   1530 C  "C3'"  . DG  B 2 6  ? -20.545 -43.823 268.506 1.00 34.89  ? 6   DG  B "C3'"  1 
ATOM   1531 O  "O3'"  . DG  B 2 6  ? -19.268 -44.393 268.304 1.00 34.37  ? 6   DG  B "O3'"  1 
ATOM   1532 C  "C2'"  . DG  B 2 6  ? -21.688 -44.746 268.081 1.00 34.56  ? 6   DG  B "C2'"  1 
ATOM   1533 C  "C1'"  . DG  B 2 6  ? -21.828 -45.624 269.308 1.00 32.48  ? 6   DG  B "C1'"  1 
ATOM   1534 N  N9     . DG  B 2 6  ? -23.124 -46.276 269.461 1.00 31.67  ? 6   DG  B N9     1 
ATOM   1535 C  C8     . DG  B 2 6  ? -24.361 -45.680 269.513 1.00 29.86  ? 6   DG  B C8     1 
ATOM   1536 N  N7     . DG  B 2 6  ? -25.341 -46.526 269.685 1.00 27.81  ? 6   DG  B N7     1 
ATOM   1537 C  C5     . DG  B 2 6  ? -24.715 -47.760 269.773 1.00 29.35  ? 6   DG  B C5     1 
ATOM   1538 C  C6     . DG  B 2 6  ? -25.264 -49.052 269.961 1.00 29.49  ? 6   DG  B C6     1 
ATOM   1539 O  O6     . DG  B 2 6  ? -26.457 -49.371 270.095 1.00 29.33  ? 6   DG  B O6     1 
ATOM   1540 N  N1     . DG  B 2 6  ? -24.275 -50.034 269.978 1.00 28.54  ? 6   DG  B N1     1 
ATOM   1541 C  C2     . DG  B 2 6  ? -22.928 -49.794 269.842 1.00 29.72  ? 6   DG  B C2     1 
ATOM   1542 N  N2     . DG  B 2 6  ? -22.124 -50.863 269.902 1.00 32.63  ? 6   DG  B N2     1 
ATOM   1543 N  N3     . DG  B 2 6  ? -22.401 -48.590 269.665 1.00 29.63  ? 6   DG  B N3     1 
ATOM   1544 C  C4     . DG  B 2 6  ? -23.350 -47.624 269.641 1.00 30.64  ? 6   DG  B C4     1 
ATOM   1545 H  "H5'"  . DG  B 2 6  ? -21.776 -42.420 271.297 1.00 44.43  ? 6   DG  B "H5'"  1 
ATOM   1546 H  "H5''" . DG  B 2 6  ? -20.754 -41.640 270.380 1.00 44.43  ? 6   DG  B "H5''" 1 
ATOM   1547 H  "H4'"  . DG  B 2 6  ? -19.925 -43.726 270.458 1.00 42.64  ? 6   DG  B "H4'"  1 
ATOM   1548 H  "H3'"  . DG  B 2 6  ? -20.612 -42.968 268.053 1.00 41.89  ? 6   DG  B "H3'"  1 
ATOM   1549 H  "H2'"  . DG  B 2 6  ? -22.500 -44.241 267.920 1.00 41.51  ? 6   DG  B "H2'"  1 
ATOM   1550 H  "H2''" . DG  B 2 6  ? -21.440 -45.271 267.304 1.00 41.51  ? 6   DG  B "H2''" 1 
ATOM   1551 H  "H1'"  . DG  B 2 6  ? -21.131 -46.300 269.296 1.00 39.00  ? 6   DG  B "H1'"  1 
ATOM   1552 H  H8     . DG  B 2 6  ? -24.489 -44.763 269.422 1.00 35.86  ? 6   DG  B H8     1 
ATOM   1553 H  H1     . DG  B 2 6  ? -24.525 -50.849 270.093 1.00 34.27  ? 6   DG  B H1     1 
ATOM   1554 H  H21    . DG  B 2 6  ? -21.273 -50.765 269.826 1.00 39.18  ? 6   DG  B H21    1 
ATOM   1555 H  H22    . DG  B 2 6  ? -22.459 -51.647 270.016 1.00 39.18  ? 6   DG  B H22    1 
ATOM   1556 P  P      . DT  B 2 7  ? -18.669 -44.572 266.833 1.00 36.42  ? 7   DT  B P      1 
ATOM   1557 O  OP1    . DT  B 2 7  ? -17.200 -44.459 266.910 1.00 38.90  ? 7   DT  B OP1    1 
ATOM   1558 O  OP2    . DT  B 2 7  ? -19.417 -43.683 265.917 1.00 36.70  ? 7   DT  B OP2    1 
ATOM   1559 O  "O5'"  . DT  B 2 7  ? -19.035 -46.072 266.477 1.00 33.82  ? 7   DT  B "O5'"  1 
ATOM   1560 C  "C5'"  . DT  B 2 7  ? -18.631 -47.093 267.335 1.00 35.62  ? 7   DT  B "C5'"  1 
ATOM   1561 C  "C4'"  . DT  B 2 7  ? -19.250 -48.406 266.939 1.00 34.66  ? 7   DT  B "C4'"  1 
ATOM   1562 O  "O4'"  . DT  B 2 7  ? -20.658 -48.373 267.210 1.00 34.59  ? 7   DT  B "O4'"  1 
ATOM   1563 C  "C3'"  . DT  B 2 7  ? -19.132 -48.757 265.454 1.00 35.63  ? 7   DT  B "C3'"  1 
ATOM   1564 O  "O3'"  . DT  B 2 7  ? -18.061 -49.697 265.282 1.00 39.72  ? 7   DT  B "O3'"  1 
ATOM   1565 C  "C2'"  . DT  B 2 7  ? -20.528 -49.324 265.092 1.00 34.17  ? 7   DT  B "C2'"  1 
ATOM   1566 C  "C1'"  . DT  B 2 7  ? -21.259 -49.369 266.438 1.00 34.14  ? 7   DT  B "C1'"  1 
ATOM   1567 N  N1     . DT  B 2 7  ? -22.760 -49.106 266.414 1.00 33.75  ? 7   DT  B N1     1 
ATOM   1568 C  C2     . DT  B 2 7  ? -23.632 -50.170 266.563 1.00 31.21  ? 7   DT  B C2     1 
ATOM   1569 O  O2     . DT  B 2 7  ? -23.267 -51.329 266.659 1.00 32.60  ? 7   DT  B O2     1 
ATOM   1570 N  N3     . DT  B 2 7  ? -24.952 -49.830 266.574 1.00 29.09  ? 7   DT  B N3     1 
ATOM   1571 C  C4     . DT  B 2 7  ? -25.491 -48.565 266.466 1.00 29.96  ? 7   DT  B C4     1 
ATOM   1572 O  O4     . DT  B 2 7  ? -26.701 -48.362 266.486 1.00 30.91  ? 7   DT  B O4     1 
ATOM   1573 C  C5     . DT  B 2 7  ? -24.537 -47.493 266.331 1.00 31.43  ? 7   DT  B C5     1 
ATOM   1574 C  C7     . DT  B 2 7  ? -25.020 -46.081 266.211 1.00 33.29  ? 7   DT  B C7     1 
ATOM   1575 C  C6     . DT  B 2 7  ? -23.231 -47.806 266.321 1.00 32.86  ? 7   DT  B C6     1 
ATOM   1576 H  "H5'"  . DT  B 2 7  ? -18.901 -46.873 268.241 1.00 42.77  ? 7   DT  B "H5'"  1 
ATOM   1577 H  "H5''" . DT  B 2 7  ? -17.665 -47.174 267.302 1.00 42.77  ? 7   DT  B "H5''" 1 
ATOM   1578 H  "H4'"  . DT  B 2 7  ? -18.846 -49.115 267.463 1.00 41.62  ? 7   DT  B "H4'"  1 
ATOM   1579 H  "H3'"  . DT  B 2 7  ? -18.956 -47.955 264.938 1.00 42.78  ? 7   DT  B "H3'"  1 
ATOM   1580 H  "H2'"  . DT  B 2 7  ? -20.987 -48.733 264.474 1.00 41.03  ? 7   DT  B "H2'"  1 
ATOM   1581 H  "H2''" . DT  B 2 7  ? -20.448 -50.215 264.717 1.00 41.03  ? 7   DT  B "H2''" 1 
ATOM   1582 H  "H1'"  . DT  B 2 7  ? -21.098 -50.230 266.854 1.00 41.00  ? 7   DT  B "H1'"  1 
ATOM   1583 H  H3     . DT  B 2 7  ? -25.512 -50.478 266.648 1.00 34.93  ? 7   DT  B H3     1 
ATOM   1584 H  H71    . DT  B 2 7  ? -24.666 -45.554 266.945 1.00 39.98  ? 7   DT  B H71    1 
ATOM   1585 H  H72    . DT  B 2 7  ? -24.718 -45.706 265.369 1.00 39.98  ? 7   DT  B H72    1 
ATOM   1586 H  H73    . DT  B 2 7  ? -25.990 -46.067 266.242 1.00 39.98  ? 7   DT  B H73    1 
ATOM   1587 H  H6     . DT  B 2 7  ? -22.612 -47.116 266.240 1.00 39.46  ? 7   DT  B H6     1 
ATOM   1588 P  P      . DG  B 2 8  ? -17.324 -49.903 263.866 1.00 45.61  ? 8   DG  B P      1 
ATOM   1589 O  OP1    . DG  B 2 8  ? -15.941 -50.317 264.179 1.00 48.37  ? 8   DG  B OP1    1 
ATOM   1590 O  OP2    . DG  B 2 8  ? -17.591 -48.766 262.956 1.00 43.91  ? 8   DG  B OP2    1 
ATOM   1591 O  "O5'"  . DG  B 2 8  ? -18.065 -51.160 263.265 1.00 43.34  ? 8   DG  B "O5'"  1 
ATOM   1592 C  "C5'"  . DG  B 2 8  ? -18.106 -52.338 264.018 1.00 42.76  ? 8   DG  B "C5'"  1 
ATOM   1593 C  "C4'"  . DG  B 2 8  ? -18.998 -53.360 263.359 1.00 38.58  ? 8   DG  B "C4'"  1 
ATOM   1594 O  "O4'"  . DG  B 2 8  ? -20.394 -53.053 263.644 1.00 34.46  ? 8   DG  B "O4'"  1 
ATOM   1595 C  "C3'"  . DG  B 2 8  ? -18.899 -53.417 261.837 1.00 40.64  ? 8   DG  B "C3'"  1 
ATOM   1596 O  "O3'"  . DG  B 2 8  ? -19.088 -54.736 261.426 1.00 43.52  ? 8   DG  B "O3'"  1 
ATOM   1597 C  "C2'"  . DG  B 2 8  ? -20.047 -52.526 261.406 1.00 37.49  ? 8   DG  B "C2'"  1 
ATOM   1598 C  "C1'"  . DG  B 2 8  ? -21.095 -52.944 262.422 1.00 34.75  ? 8   DG  B "C1'"  1 
ATOM   1599 N  N9     . DG  B 2 8  ? -22.202 -52.019 262.601 1.00 30.58  ? 8   DG  B N9     1 
ATOM   1600 C  C8     . DG  B 2 8  ? -22.184 -50.652 262.475 1.00 30.88  ? 8   DG  B C8     1 
ATOM   1601 N  N7     . DG  B 2 8  ? -23.343 -50.097 262.720 1.00 29.49  ? 8   DG  B N7     1 
ATOM   1602 C  C5     . DG  B 2 8  ? -24.165 -51.165 263.046 1.00 28.54  ? 8   DG  B C5     1 
ATOM   1603 C  C6     . DG  B 2 8  ? -25.532 -51.182 263.395 1.00 29.82  ? 8   DG  B C6     1 
ATOM   1604 O  O6     . DG  B 2 8  ? -26.311 -50.219 263.493 1.00 30.48  ? 8   DG  B O6     1 
ATOM   1605 N  N1     . DG  B 2 8  ? -25.985 -52.473 263.620 1.00 29.54  ? 8   DG  B N1     1 
ATOM   1606 C  C2     . DG  B 2 8  ? -25.210 -53.606 263.540 1.00 31.04  ? 8   DG  B C2     1 
ATOM   1607 N  N2     . DG  B 2 8  ? -25.822 -54.773 263.814 1.00 32.38  ? 8   DG  B N2     1 
ATOM   1608 N  N3     . DG  B 2 8  ? -23.929 -53.600 263.208 1.00 29.23  ? 8   DG  B N3     1 
ATOM   1609 C  C4     . DG  B 2 8  ? -23.479 -52.349 262.977 1.00 28.61  ? 8   DG  B C4     1 
ATOM   1610 H  "H5'"  . DG  B 2 8  ? -18.448 -52.140 264.904 1.00 51.34  ? 8   DG  B "H5'"  1 
ATOM   1611 H  "H5''" . DG  B 2 8  ? -17.209 -52.700 264.096 1.00 51.34  ? 8   DG  B "H5''" 1 
ATOM   1612 H  "H4'"  . DG  B 2 8  ? -18.790 -54.236 263.720 1.00 46.32  ? 8   DG  B "H4'"  1 
ATOM   1613 H  "H3'"  . DG  B 2 8  ? -18.048 -53.069 261.529 1.00 48.79  ? 8   DG  B "H3'"  1 
ATOM   1614 H  "H2'"  . DG  B 2 8  ? -19.818 -51.588 261.502 1.00 45.02  ? 8   DG  B "H2'"  1 
ATOM   1615 H  "H2''" . DG  B 2 8  ? -20.331 -52.732 260.502 1.00 45.02  ? 8   DG  B "H2''" 1 
ATOM   1616 H  "H1'"  . DG  B 2 8  ? -21.445 -53.815 262.177 1.00 41.72  ? 8   DG  B "H1'"  1 
ATOM   1617 H  H8     . DG  B 2 8  ? -21.426 -50.170 262.234 1.00 37.08  ? 8   DG  B H8     1 
ATOM   1618 H  H1     . DG  B 2 8  ? -26.808 -52.571 263.851 1.00 35.48  ? 8   DG  B H1     1 
ATOM   1619 H  H21    . DG  B 2 8  ? -25.380 -55.510 263.773 1.00 38.88  ? 8   DG  B H21    1 
ATOM   1620 H  H22    . DG  B 2 8  ? -26.654 -54.781 264.030 1.00 38.88  ? 8   DG  B H22    1 
ATOM   1621 P  P      . DG  B 2 9  ? -18.326 -55.363 260.170 1.00 47.13  ? 9   DG  B P      1 
ATOM   1622 O  OP1    . DG  B 2 9  ? -17.027 -55.892 260.627 1.00 49.85  ? 9   DG  B OP1    1 
ATOM   1623 O  OP2    . DG  B 2 9  ? -18.415 -54.420 259.024 1.00 46.23  ? 9   DG  B OP2    1 
ATOM   1624 O  "O5'"  . DG  B 2 9  ? -19.236 -56.634 259.880 1.00 46.32  ? 9   DG  B "O5'"  1 
ATOM   1625 C  "C5'"  . DG  B 2 9  ? -19.530 -57.505 260.966 1.00 43.12  ? 9   DG  B "C5'"  1 
ATOM   1626 C  "C4'"  . DG  B 2 9  ? -20.779 -58.299 260.690 1.00 39.86  ? 9   DG  B "C4'"  1 
ATOM   1627 O  "O4'"  . DG  B 2 9  ? -21.952 -57.482 260.969 1.00 37.11  ? 9   DG  B "O4'"  1 
ATOM   1628 C  "C3'"  . DG  B 2 9  ? -20.919 -58.760 259.254 1.00 40.04  ? 9   DG  B "C3'"  1 
ATOM   1629 O  "O3'"  . DG  B 2 9  ? -21.482 -60.052 259.228 1.00 42.51  ? 9   DG  B "O3'"  1 
ATOM   1630 C  "C2'"  . DG  B 2 9  ? -21.823 -57.701 258.634 1.00 37.55  ? 9   DG  B "C2'"  1 
ATOM   1631 C  "C1'"  . DG  B 2 9  ? -22.730 -57.331 259.791 1.00 35.80  ? 9   DG  B "C1'"  1 
ATOM   1632 N  N9     . DG  B 2 9  ? -23.222 -55.957 259.773 1.00 33.75  ? 9   DG  B N9     1 
ATOM   1633 C  C8     . DG  B 2 9  ? -22.490 -54.814 259.534 1.00 33.24  ? 9   DG  B C8     1 
ATOM   1634 N  N7     . DG  B 2 9  ? -23.195 -53.725 259.625 1.00 32.31  ? 9   DG  B N7     1 
ATOM   1635 C  C5     . DG  B 2 9  ? -24.467 -54.173 259.956 1.00 31.19  ? 9   DG  B C5     1 
ATOM   1636 C  C6     . DG  B 2 9  ? -25.651 -53.447 260.190 1.00 31.59  ? 9   DG  B C6     1 
ATOM   1637 O  O6     . DG  B 2 9  ? -25.822 -52.223 260.146 1.00 32.77  ? 9   DG  B O6     1 
ATOM   1638 N  N1     . DG  B 2 9  ? -26.719 -54.285 260.485 1.00 31.95  ? 9   DG  B N1     1 
ATOM   1639 C  C2     . DG  B 2 9  ? -26.642 -55.658 260.564 1.00 32.77  ? 9   DG  B C2     1 
ATOM   1640 N  N2     . DG  B 2 9  ? -27.778 -56.302 260.876 1.00 33.74  ? 9   DG  B N2     1 
ATOM   1641 N  N3     . DG  B 2 9  ? -25.531 -56.349 260.359 1.00 32.44  ? 9   DG  B N3     1 
ATOM   1642 C  C4     . DG  B 2 9  ? -24.491 -55.543 260.058 1.00 30.86  ? 9   DG  B C4     1 
ATOM   1643 H  "H5'"  . DG  B 2 9  ? -19.658 -56.979 261.771 1.00 51.77  ? 9   DG  B "H5'"  1 
ATOM   1644 H  "H5''" . DG  B 2 9  ? -18.787 -58.114 261.098 1.00 51.77  ? 9   DG  B "H5''" 1 
ATOM   1645 H  "H4'"  . DG  B 2 9  ? -20.791 -59.075 261.271 1.00 47.86  ? 9   DG  B "H4'"  1 
ATOM   1646 H  "H3'"  . DG  B 2 9  ? -20.053 -58.760 258.817 1.00 48.07  ? 9   DG  B "H3'"  1 
ATOM   1647 H  "H2'"  . DG  B 2 9  ? -21.306 -56.934 258.343 1.00 45.08  ? 9   DG  B "H2'"  1 
ATOM   1648 H  "H2''" . DG  B 2 9  ? -22.336 -58.073 257.900 1.00 45.08  ? 9   DG  B "H2''" 1 
ATOM   1649 H  "H1'"  . DG  B 2 9  ? -23.482 -57.943 259.821 1.00 42.99  ? 9   DG  B "H1'"  1 
ATOM   1650 H  H8     . DG  B 2 9  ? -21.583 -54.821 259.328 1.00 39.92  ? 9   DG  B H8     1 
ATOM   1651 H  H1     . DG  B 2 9  ? -27.482 -53.920 260.643 1.00 38.36  ? 9   DG  B H1     1 
ATOM   1652 H  H21    . DG  B 2 9  ? -27.782 -57.160 260.942 1.00 40.52  ? 9   DG  B H21    1 
ATOM   1653 H  H22    . DG  B 2 9  ? -28.502 -55.857 261.010 1.00 40.52  ? 9   DG  B H22    1 
ATOM   1654 P  P      . DC  B 2 10 ? -21.530 -60.906 257.879 1.00 44.28  ? 10  DC  B P      1 
ATOM   1655 O  OP1    . DC  B 2 10 ? -21.546 -62.333 258.275 1.00 47.16  ? 10  DC  B OP1    1 
ATOM   1656 O  OP2    . DC  B 2 10 ? -20.481 -60.429 256.948 1.00 44.18  ? 10  DC  B OP2    1 
ATOM   1657 O  "O5'"  . DC  B 2 10 ? -22.962 -60.547 257.289 1.00 40.45  ? 10  DC  B "O5'"  1 
ATOM   1658 C  "C5'"  . DC  B 2 10 ? -24.106 -61.007 257.942 1.00 38.71  ? 10  DC  B "C5'"  1 
ATOM   1659 C  "C4'"  . DC  B 2 10 ? -25.331 -60.256 257.481 1.00 37.13  ? 10  DC  B "C4'"  1 
ATOM   1660 O  "O4'"  . DC  B 2 10 ? -25.260 -58.882 257.908 1.00 34.38  ? 10  DC  B "O4'"  1 
ATOM   1661 C  "C3'"  . DC  B 2 10 ? -25.515 -60.143 255.977 1.00 37.39  ? 10  DC  B "C3'"  1 
ATOM   1662 O  "O3'"  . DC  B 2 10 ? -26.072 -61.341 255.432 1.00 40.09  ? 10  DC  B "O3'"  1 
ATOM   1663 C  "C2'"  . DC  B 2 10 ? -26.458 -58.928 255.861 1.00 35.22  ? 10  DC  B "C2'"  1 
ATOM   1664 C  "C1'"  . DC  B 2 10 ? -26.246 -58.166 257.186 1.00 33.85  ? 10  DC  B "C1'"  1 
ATOM   1665 N  N1     . DC  B 2 10 ? -25.811 -56.738 256.997 1.00 33.90  ? 10  DC  B N1     1 
ATOM   1666 C  C2     . DC  B 2 10 ? -26.731 -55.714 257.209 1.00 33.10  ? 10  DC  B C2     1 
ATOM   1667 O  O2     . DC  B 2 10 ? -27.877 -56.001 257.576 1.00 33.29  ? 10  DC  B O2     1 
ATOM   1668 N  N3     . DC  B 2 10 ? -26.348 -54.433 257.016 1.00 32.78  ? 10  DC  B N3     1 
ATOM   1669 C  C4     . DC  B 2 10 ? -25.109 -54.153 256.635 1.00 33.68  ? 10  DC  B C4     1 
ATOM   1670 N  N4     . DC  B 2 10 ? -24.795 -52.872 256.470 1.00 32.93  ? 10  DC  B N4     1 
ATOM   1671 C  C5     . DC  B 2 10 ? -24.142 -55.178 256.406 1.00 35.85  ? 10  DC  B C5     1 
ATOM   1672 C  C6     . DC  B 2 10 ? -24.534 -56.450 256.594 1.00 36.62  ? 10  DC  B C6     1 
ATOM   1673 H  "H5'"  . DC  B 2 10 ? -23.999 -60.884 258.898 1.00 46.48  ? 10  DC  B "H5'"  1 
ATOM   1674 H  "H5''" . DC  B 2 10 ? -24.222 -61.951 257.753 1.00 46.48  ? 10  DC  B "H5''" 1 
ATOM   1675 H  "H4'"  . DC  B 2 10 ? -26.120 -60.668 257.867 1.00 44.59  ? 10  DC  B "H4'"  1 
ATOM   1676 H  "H3'"  . DC  B 2 10 ? -24.665 -59.947 255.552 1.00 44.89  ? 10  DC  B "H3'"  1 
ATOM   1677 H  "HO3'" . DC  B 2 10 ? -26.807 -61.316 255.027 1.00 48.14  ? 10  DC  B "HO3'" 1 
ATOM   1678 H  "H2'"  . DC  B 2 10 ? -26.206 -58.374 255.106 1.00 42.29  ? 10  DC  B "H2'"  1 
ATOM   1679 H  "H2''" . DC  B 2 10 ? -27.379 -59.219 255.779 1.00 42.29  ? 10  DC  B "H2''" 1 
ATOM   1680 H  "H1'"  . DC  B 2 10 ? -27.075 -58.178 257.691 1.00 40.65  ? 10  DC  B "H1'"  1 
ATOM   1681 H  H41    . DC  B 2 10 ? -24.001 -52.653 256.223 1.00 39.55  ? 10  DC  B H41    1 
ATOM   1682 H  H42    . DC  B 2 10 ? -25.385 -52.263 256.610 1.00 39.55  ? 10  DC  B H42    1 
ATOM   1683 H  H5     . DC  B 2 10 ? -23.277 -54.973 256.132 1.00 43.04  ? 10  DC  B H5     1 
ATOM   1684 H  H6     . DC  B 2 10 ? -23.931 -57.143 256.448 1.00 43.97  ? 10  DC  B H6     1 
ATOM   1685 O  "O5'"  . DG  C 3 1  ? -33.542 -46.734 255.078 1.00 52.86  ? 1   DG  C "O5'"  1 
ATOM   1686 C  "C5'"  . DG  C 3 1  ? -33.813 -46.746 256.459 1.00 43.71  ? 1   DG  C "C5'"  1 
ATOM   1687 C  "C4'"  . DG  C 3 1  ? -34.180 -48.140 256.918 1.00 38.87  ? 1   DG  C "C4'"  1 
ATOM   1688 O  "O4'"  . DG  C 3 1  ? -33.080 -49.051 256.649 1.00 37.07  ? 1   DG  C "O4'"  1 
ATOM   1689 C  "C3'"  . DG  C 3 1  ? -34.462 -48.269 258.412 1.00 32.39  ? 1   DG  C "C3'"  1 
ATOM   1690 O  "O3'"  . DG  C 3 1  ? -35.441 -49.254 258.618 1.00 31.97  ? 1   DG  C "O3'"  1 
ATOM   1691 C  "C2'"  . DG  C 3 1  ? -33.103 -48.657 258.982 1.00 32.67  ? 1   DG  C "C2'"  1 
ATOM   1692 C  "C1'"  . DG  C 3 1  ? -32.535 -49.535 257.875 1.00 33.99  ? 1   DG  C "C1'"  1 
ATOM   1693 N  N9     . DG  C 3 1  ? -31.079 -49.522 257.758 1.00 33.43  ? 1   DG  C N9     1 
ATOM   1694 C  C8     . DG  C 3 1  ? -30.248 -48.429 257.683 1.00 33.90  ? 1   DG  C C8     1 
ATOM   1695 N  N7     . DG  C 3 1  ? -28.992 -48.746 257.527 1.00 33.82  ? 1   DG  C N7     1 
ATOM   1696 C  C5     . DG  C 3 1  ? -28.997 -50.134 257.482 1.00 34.15  ? 1   DG  C C5     1 
ATOM   1697 C  C6     . DG  C 3 1  ? -27.930 -51.049 257.332 1.00 34.20  ? 1   DG  C C6     1 
ATOM   1698 O  O6     . DG  C 3 1  ? -26.728 -50.806 257.181 1.00 35.80  ? 1   DG  C O6     1 
ATOM   1699 N  N1     . DG  C 3 1  ? -28.378 -52.366 257.326 1.00 36.40  ? 1   DG  C N1     1 
ATOM   1700 C  C2     . DG  C 3 1  ? -29.692 -52.750 257.446 1.00 37.57  ? 1   DG  C C2     1 
ATOM   1701 N  N2     . DG  C 3 1  ? -29.936 -54.067 257.419 1.00 36.34  ? 1   DG  C N2     1 
ATOM   1702 N  N3     . DG  C 3 1  ? -30.698 -51.902 257.603 1.00 37.45  ? 1   DG  C N3     1 
ATOM   1703 C  C4     . DG  C 3 1  ? -30.276 -50.619 257.609 1.00 34.62  ? 1   DG  C C4     1 
ATOM   1704 H  "H5'"  . DG  C 3 1  ? -34.549 -46.144 256.645 1.00 52.48  ? 1   DG  C "H5'"  1 
ATOM   1705 H  "H5''" . DG  C 3 1  ? -33.026 -46.448 256.941 1.00 52.48  ? 1   DG  C "H5''" 1 
ATOM   1706 H  "H4'"  . DG  C 3 1  ? -34.961 -48.437 256.424 1.00 46.67  ? 1   DG  C "H4'"  1 
ATOM   1707 H  "H3'"  . DG  C 3 1  ? -34.753 -47.419 258.776 1.00 38.90  ? 1   DG  C "H3'"  1 
ATOM   1708 H  "H2'"  . DG  C 3 1  ? -32.549 -47.872 259.119 1.00 39.24  ? 1   DG  C "H2'"  1 
ATOM   1709 H  "H2''" . DG  C 3 1  ? -33.204 -49.160 259.805 1.00 39.24  ? 1   DG  C "H2''" 1 
ATOM   1710 H  "H1'"  . DG  C 3 1  ? -32.832 -50.448 258.014 1.00 40.82  ? 1   DG  C "H1'"  1 
ATOM   1711 H  H8     . DG  C 3 1  ? -30.548 -47.552 257.754 1.00 40.70  ? 1   DG  C H8     1 
ATOM   1712 H  H1     . DG  C 3 1  ? -27.790 -52.986 257.229 1.00 43.70  ? 1   DG  C H1     1 
ATOM   1713 H  H21    . DG  C 3 1  ? -30.741 -54.358 257.503 1.00 43.63  ? 1   DG  C H21    1 
ATOM   1714 H  H22    . DG  C 3 1  ? -29.287 -54.622 257.318 1.00 43.63  ? 1   DG  C H22    1 
ATOM   1715 H  "HO5'" . DG  C 3 1  ? -33.113 -47.366 254.729 1.00 63.46  ? 1   DG  C "HO5'" 1 
ATOM   1716 P  P      . DC  C 3 2  ? -35.977 -49.629 260.080 1.00 34.38  ? 2   DC  C P      1 
ATOM   1717 O  OP1    . DC  C 3 2  ? -37.432 -49.882 259.937 1.00 34.09  ? 2   DC  C OP1    1 
ATOM   1718 O  OP2    . DC  C 3 2  ? -35.450 -48.656 261.065 1.00 33.66  ? 2   DC  C OP2    1 
ATOM   1719 O  "O5'"  . DC  C 3 2  ? -35.320 -51.054 260.337 1.00 33.13  ? 2   DC  C "O5'"  1 
ATOM   1720 C  "C5'"  . DC  C 3 2  ? -35.583 -52.095 259.434 1.00 35.17  ? 2   DC  C "C5'"  1 
ATOM   1721 C  "C4'"  . DC  C 3 2  ? -34.977 -53.380 259.922 1.00 35.89  ? 2   DC  C "C4'"  1 
ATOM   1722 O  "O4'"  . DC  C 3 2  ? -33.537 -53.342 259.737 1.00 35.26  ? 2   DC  C "O4'"  1 
ATOM   1723 C  "C3'"  . DC  C 3 2  ? -35.215 -53.640 261.401 1.00 35.15  ? 2   DC  C "C3'"  1 
ATOM   1724 O  "O3'"  . DC  C 3 2  ? -35.632 -54.973 261.603 1.00 37.92  ? 2   DC  C "O3'"  1 
ATOM   1725 C  "C2'"  . DC  C 3 2  ? -33.869 -53.332 262.052 1.00 32.78  ? 2   DC  C "C2'"  1 
ATOM   1726 C  "C1'"  . DC  C 3 2  ? -32.889 -53.668 260.949 1.00 34.32  ? 2   DC  C "C1'"  1 
ATOM   1727 N  N1     . DC  C 3 2  ? -31.623 -52.912 260.980 1.00 33.68  ? 2   DC  C N1     1 
ATOM   1728 C  C2     . DC  C 3 2  ? -30.415 -53.599 260.895 1.00 34.29  ? 2   DC  C C2     1 
ATOM   1729 O  O2     . DC  C 3 2  ? -30.427 -54.828 260.840 1.00 36.89  ? 2   DC  C O2     1 
ATOM   1730 N  N3     . DC  C 3 2  ? -29.264 -52.897 260.881 1.00 34.54  ? 2   DC  C N3     1 
ATOM   1731 C  C4     . DC  C 3 2  ? -29.294 -51.566 260.935 1.00 33.28  ? 2   DC  C C4     1 
ATOM   1732 N  N4     . DC  C 3 2  ? -28.127 -50.917 260.903 1.00 32.83  ? 2   DC  C N4     1 
ATOM   1733 C  C5     . DC  C 3 2  ? -30.520 -50.843 261.010 1.00 30.96  ? 2   DC  C C5     1 
ATOM   1734 C  C6     . DC  C 3 2  ? -31.649 -51.549 261.022 1.00 30.62  ? 2   DC  C C6     1 
ATOM   1735 H  "H5'"  . DC  C 3 2  ? -35.207 -51.871 258.569 1.00 42.23  ? 2   DC  C "H5'"  1 
ATOM   1736 H  "H5''" . DC  C 3 2  ? -36.543 -52.207 259.346 1.00 42.23  ? 2   DC  C "H5''" 1 
ATOM   1737 H  "H4'"  . DC  C 3 2  ? -35.342 -54.117 259.408 1.00 43.10  ? 2   DC  C "H4'"  1 
ATOM   1738 H  "H3'"  . DC  C 3 2  ? -35.889 -53.029 261.737 1.00 42.20  ? 2   DC  C "H3'"  1 
ATOM   1739 H  "H2'"  . DC  C 3 2  ? -33.809 -52.394 262.291 1.00 39.37  ? 2   DC  C "H2'"  1 
ATOM   1740 H  "H2''" . DC  C 3 2  ? -33.724 -53.898 262.826 1.00 39.37  ? 2   DC  C "H2''" 1 
ATOM   1741 H  "H1'"  . DC  C 3 2  ? -32.698 -54.619 260.966 1.00 41.21  ? 2   DC  C "H1'"  1 
ATOM   1742 H  H41    . DC  C 3 2  ? -28.112 -50.058 260.936 1.00 39.43  ? 2   DC  C H41    1 
ATOM   1743 H  H42    . DC  C 3 2  ? -27.391 -51.358 260.848 1.00 39.43  ? 2   DC  C H42    1 
ATOM   1744 H  H5     . DC  C 3 2  ? -30.531 -49.914 261.045 1.00 37.17  ? 2   DC  C H5     1 
ATOM   1745 H  H6     . DC  C 3 2  ? -32.466 -51.106 261.064 1.00 36.77  ? 2   DC  C H6     1 
ATOM   1746 P  P      . DC  C 3 3  ? -36.241 -55.396 263.024 1.00 39.16  ? 3   DC  C P      1 
ATOM   1747 O  OP1    . DC  C 3 3  ? -37.109 -56.566 262.797 1.00 43.83  ? 3   DC  C OP1    1 
ATOM   1748 O  OP2    . DC  C 3 3  ? -36.776 -54.197 263.725 1.00 39.59  ? 3   DC  C OP2    1 
ATOM   1749 O  "O5'"  . DC  C 3 3  ? -34.954 -55.836 263.837 1.00 36.66  ? 3   DC  C "O5'"  1 
ATOM   1750 C  "C5'"  . DC  C 3 3  ? -34.105 -56.835 263.318 1.00 36.79  ? 3   DC  C "C5'"  1 
ATOM   1751 C  "C4'"  . DC  C 3 3  ? -32.796 -56.878 264.079 1.00 35.89  ? 3   DC  C "C4'"  1 
ATOM   1752 O  "O4'"  . DC  C 3 3  ? -31.980 -55.746 263.730 1.00 32.71  ? 3   DC  C "O4'"  1 
ATOM   1753 C  "C3'"  . DC  C 3 3  ? -32.936 -56.811 265.598 1.00 35.96  ? 3   DC  C "C3'"  1 
ATOM   1754 O  "O3'"  . DC  C 3 3  ? -32.863 -58.108 266.128 1.00 42.14  ? 3   DC  C "O3'"  1 
ATOM   1755 C  "C2'"  . DC  C 3 3  ? -31.774 -55.908 266.059 1.00 32.57  ? 3   DC  C "C2'"  1 
ATOM   1756 C  "C1'"  . DC  C 3 3  ? -31.052 -55.542 264.769 1.00 33.12  ? 3   DC  C "C1'"  1 
ATOM   1757 N  N1     . DC  C 3 3  ? -30.567 -54.124 264.679 1.00 33.55  ? 3   DC  C N1     1 
ATOM   1758 C  C2     . DC  C 3 3  ? -29.235 -53.877 264.342 1.00 34.61  ? 3   DC  C C2     1 
ATOM   1759 O  O2     . DC  C 3 3  ? -28.478 -54.833 264.177 1.00 37.11  ? 3   DC  C O2     1 
ATOM   1760 N  N3     . DC  C 3 3  ? -28.808 -52.589 264.222 1.00 33.78  ? 3   DC  C N3     1 
ATOM   1761 C  C4     . DC  C 3 3  ? -29.667 -51.581 264.421 1.00 34.26  ? 3   DC  C C4     1 
ATOM   1762 N  N4     . DC  C 3 3  ? -29.207 -50.332 264.309 1.00 35.23  ? 3   DC  C N4     1 
ATOM   1763 C  C5     . DC  C 3 3  ? -31.034 -51.813 264.753 1.00 33.57  ? 3   DC  C C5     1 
ATOM   1764 C  C6     . DC  C 3 3  ? -31.440 -53.088 264.860 1.00 33.95  ? 3   DC  C C6     1 
ATOM   1765 H  "H5'"  . DC  C 3 3  ? -33.925 -56.647 262.384 1.00 44.17  ? 3   DC  C "H5'"  1 
ATOM   1766 H  "H5''" . DC  C 3 3  ? -34.544 -57.697 263.391 1.00 44.17  ? 3   DC  C "H5''" 1 
ATOM   1767 H  "H4'"  . DC  C 3 3  ? -32.323 -57.691 263.842 1.00 43.09  ? 3   DC  C "H4'"  1 
ATOM   1768 H  "H3'"  . DC  C 3 3  ? -33.784 -56.404 265.834 1.00 43.17  ? 3   DC  C "H3'"  1 
ATOM   1769 H  "H2'"  . DC  C 3 3  ? -32.116 -55.111 266.494 1.00 39.11  ? 3   DC  C "H2'"  1 
ATOM   1770 H  "H2''" . DC  C 3 3  ? -31.181 -56.394 266.653 1.00 39.11  ? 3   DC  C "H2''" 1 
ATOM   1771 H  "H1'"  . DC  C 3 3  ? -30.301 -56.143 264.645 1.00 39.77  ? 3   DC  C "H1'"  1 
ATOM   1772 H  H41    . DC  C 3 3  ? -29.737 -49.666 264.432 1.00 42.31  ? 3   DC  C H41    1 
ATOM   1773 H  H42    . DC  C 3 3  ? -28.381 -50.194 264.113 1.00 42.31  ? 3   DC  C H42    1 
ATOM   1774 H  H5     . DC  C 3 3  ? -31.624 -51.107 264.886 1.00 40.31  ? 3   DC  C H5     1 
ATOM   1775 H  H6     . DC  C 3 3  ? -32.328 -53.269 265.069 1.00 40.76  ? 3   DC  C H6     1 
ATOM   1776 P  P      . DA  C 3 4  ? -33.025 -58.367 267.705 1.00 46.73  ? 4   DA  C P      1 
ATOM   1777 O  OP1    . DA  C 3 4  ? -33.557 -59.740 267.806 1.00 51.43  ? 4   DA  C OP1    1 
ATOM   1778 O  OP2    . DA  C 3 4  ? -33.703 -57.226 268.375 1.00 45.73  ? 4   DA  C OP2    1 
ATOM   1779 O  "O5'"  . DA  C 3 4  ? -31.524 -58.330 268.222 1.00 44.62  ? 4   DA  C "O5'"  1 
ATOM   1780 C  "C5'"  . DA  C 3 4  ? -30.558 -59.082 267.563 1.00 43.38  ? 4   DA  C "C5'"  1 
ATOM   1781 C  "C4'"  . DA  C 3 4  ? -29.172 -58.638 267.975 1.00 41.23  ? 4   DA  C "C4'"  1 
ATOM   1782 O  "O4'"  . DA  C 3 4  ? -28.927 -57.284 267.495 1.00 36.96  ? 4   DA  C "O4'"  1 
ATOM   1783 C  "C3'"  . DA  C 3 4  ? -28.934 -58.597 269.490 1.00 39.92  ? 4   DA  C "C3'"  1 
ATOM   1784 O  "O3'"  . DA  C 3 4  ? -27.696 -59.172 269.788 1.00 44.22  ? 4   DA  C "O3'"  1 
ATOM   1785 C  "C2'"  . DA  C 3 4  ? -28.962 -57.121 269.811 1.00 37.44  ? 4   DA  C "C2'"  1 
ATOM   1786 C  "C1'"  . DA  C 3 4  ? -28.377 -56.524 268.547 1.00 35.75  ? 4   DA  C "C1'"  1 
ATOM   1787 N  N9     . DA  C 3 4  ? -28.707 -55.120 268.349 1.00 33.06  ? 4   DA  C N9     1 
ATOM   1788 C  C8     . DA  C 3 4  ? -29.912 -54.517 268.593 1.00 32.33  ? 4   DA  C C8     1 
ATOM   1789 N  N7     . DA  C 3 4  ? -29.921 -53.235 268.332 1.00 33.67  ? 4   DA  C N7     1 
ATOM   1790 C  C5     . DA  C 3 4  ? -28.630 -52.980 267.865 1.00 32.38  ? 4   DA  C C5     1 
ATOM   1791 C  C6     . DA  C 3 4  ? -27.999 -51.802 267.427 1.00 31.41  ? 4   DA  C C6     1 
ATOM   1792 N  N6     . DA  C 3 4  ? -28.621 -50.616 267.378 1.00 30.32  ? 4   DA  C N6     1 
ATOM   1793 N  N1     . DA  C 3 4  ? -26.701 -51.881 267.064 1.00 32.41  ? 4   DA  C N1     1 
ATOM   1794 C  C2     . DA  C 3 4  ? -26.088 -53.070 267.124 1.00 33.93  ? 4   DA  C C2     1 
ATOM   1795 N  N3     . DA  C 3 4  ? -26.581 -54.248 267.515 1.00 32.92  ? 4   DA  C N3     1 
ATOM   1796 C  C4     . DA  C 3 4  ? -27.867 -54.128 267.881 1.00 31.67  ? 4   DA  C C4     1 
ATOM   1797 H  "H5'"  . DA  C 3 4  ? -30.660 -58.965 266.605 1.00 52.09  ? 4   DA  C "H5'"  1 
ATOM   1798 H  "H5''" . DA  C 3 4  ? -30.674 -60.018 267.786 1.00 52.09  ? 4   DA  C "H5''" 1 
ATOM   1799 H  "H4'"  . DA  C 3 4  ? -28.521 -59.235 267.573 1.00 49.50  ? 4   DA  C "H4'"  1 
ATOM   1800 H  "H3'"  . DA  C 3 4  ? -29.647 -59.060 269.958 1.00 47.94  ? 4   DA  C "H3'"  1 
ATOM   1801 H  "H2'"  . DA  C 3 4  ? -29.872 -56.814 269.951 1.00 44.96  ? 4   DA  C "H2'"  1 
ATOM   1802 H  "H2''" . DA  C 3 4  ? -28.404 -56.922 270.579 1.00 44.96  ? 4   DA  C "H2''" 1 
ATOM   1803 H  "H1'"  . DA  C 3 4  ? -27.413 -56.632 268.555 1.00 42.92  ? 4   DA  C "H1'"  1 
ATOM   1804 H  H8     . DA  C 3 4  ? -30.655 -54.976 268.914 1.00 38.83  ? 4   DA  C H8     1 
ATOM   1805 H  H61    . DA  C 3 4  ? -28.193 -49.917 267.118 1.00 36.41  ? 4   DA  C H61    1 
ATOM   1806 H  H62    . DA  C 3 4  ? -29.447 -50.554 267.607 1.00 36.41  ? 4   DA  C H62    1 
ATOM   1807 H  H2     . DA  C 3 4  ? -25.199 -53.077 266.850 1.00 40.74  ? 4   DA  C H2     1 
ATOM   1808 P  P      . DC  C 3 5  ? -27.305 -59.594 271.284 1.00 45.76  ? 5   DC  C P      1 
ATOM   1809 O  OP1    . DC  C 3 5  ? -27.298 -61.073 271.301 1.00 49.32  ? 5   DC  C OP1    1 
ATOM   1810 O  OP2    . DC  C 3 5  ? -28.092 -58.819 272.270 1.00 48.75  ? 5   DC  C OP2    1 
ATOM   1811 O  "O5'"  . DC  C 3 5  ? -25.805 -59.089 271.410 1.00 44.76  ? 5   DC  C "O5'"  1 
ATOM   1812 C  "C5'"  . DC  C 3 5  ? -24.867 -59.423 270.391 1.00 43.77  ? 5   DC  C "C5'"  1 
ATOM   1813 C  "C4'"  . DC  C 3 5  ? -23.761 -58.389 270.334 1.00 41.94  ? 5   DC  C "C4'"  1 
ATOM   1814 O  "O4'"  . DC  C 3 5  ? -24.320 -57.112 269.937 1.00 35.94  ? 5   DC  C "O4'"  1 
ATOM   1815 C  "C3'"  . DC  C 3 5  ? -23.051 -58.152 271.664 1.00 42.92  ? 5   DC  C "C3'"  1 
ATOM   1816 O  "O3'"  . DC  C 3 5  ? -21.670 -58.383 271.519 1.00 47.52  ? 5   DC  C "O3'"  1 
ATOM   1817 C  "C2'"  . DC  C 3 5  ? -23.366 -56.699 272.023 1.00 39.11  ? 5   DC  C "C2'"  1 
ATOM   1818 C  "C1'"  . DC  C 3 5  ? -23.719 -56.086 270.680 1.00 36.55  ? 5   DC  C "C1'"  1 
ATOM   1819 N  N1     . DC  C 3 5  ? -24.676 -54.963 270.744 1.00 35.08  ? 5   DC  C N1     1 
ATOM   1820 C  C2     . DC  C 3 5  ? -24.257 -53.679 270.383 1.00 34.61  ? 5   DC  C C2     1 
ATOM   1821 O  O2     . DC  C 3 5  ? -23.081 -53.510 270.040 1.00 35.67  ? 5   DC  C O2     1 
ATOM   1822 N  N3     . DC  C 3 5  ? -25.152 -52.654 270.437 1.00 29.67  ? 5   DC  C N3     1 
ATOM   1823 C  C4     . DC  C 3 5  ? -26.411 -52.892 270.797 1.00 28.11  ? 5   DC  C C4     1 
ATOM   1824 N  N4     . DC  C 3 5  ? -27.262 -51.865 270.811 1.00 27.83  ? 5   DC  C N4     1 
ATOM   1825 C  C5     . DC  C 3 5  ? -26.857 -54.199 271.156 1.00 28.99  ? 5   DC  C C5     1 
ATOM   1826 C  C6     . DC  C 3 5  ? -25.966 -55.194 271.112 1.00 33.03  ? 5   DC  C C6     1 
ATOM   1827 H  "H5'"  . DC  C 3 5  ? -25.321 -59.455 269.535 1.00 52.55  ? 5   DC  C "H5'"  1 
ATOM   1828 H  "H5''" . DC  C 3 5  ? -24.483 -60.293 270.582 1.00 52.55  ? 5   DC  C "H5''" 1 
ATOM   1829 H  "H4'"  . DC  C 3 5  ? -23.106 -58.665 269.673 1.00 50.35  ? 5   DC  C "H4'"  1 
ATOM   1830 H  "H3'"  . DC  C 3 5  ? -23.415 -58.745 272.340 1.00 51.53  ? 5   DC  C "H3'"  1 
ATOM   1831 H  "H2'"  . DC  C 3 5  ? -24.121 -56.652 272.630 1.00 46.96  ? 5   DC  C "H2'"  1 
ATOM   1832 H  "H2''" . DC  C 3 5  ? -22.588 -56.263 272.405 1.00 46.96  ? 5   DC  C "H2''" 1 
ATOM   1833 H  "H1'"  . DC  C 3 5  ? -22.909 -55.796 270.234 1.00 43.89  ? 5   DC  C "H1'"  1 
ATOM   1834 H  H41    . DC  C 3 5  ? -28.082 -51.988 271.040 1.00 33.43  ? 5   DC  C H41    1 
ATOM   1835 H  H42    . DC  C 3 5  ? -26.991 -51.079 270.591 1.00 33.43  ? 5   DC  C H42    1 
ATOM   1836 H  H5     . DC  C 3 5  ? -27.738 -54.353 271.413 1.00 34.81  ? 5   DC  C H5     1 
ATOM   1837 H  H6     . DC  C 3 5  ? -26.230 -56.057 271.340 1.00 39.67  ? 5   DC  C H6     1 
ATOM   1838 P  P      . DA  C 3 6  ? -20.773 -58.619 272.823 1.00 50.75  ? 6   DA  C P      1 
ATOM   1839 O  OP1    . DA  C 3 6  ? -19.549 -59.344 272.420 1.00 53.92  ? 6   DA  C OP1    1 
ATOM   1840 O  OP2    . DA  C 3 6  ? -21.648 -59.131 273.911 1.00 51.79  ? 6   DA  C OP2    1 
ATOM   1841 O  "O5'"  . DA  C 3 6  ? -20.379 -57.148 273.269 1.00 47.91  ? 6   DA  C "O5'"  1 
ATOM   1842 C  "C5'"  . DA  C 3 6  ? -19.777 -56.270 272.351 1.00 45.58  ? 6   DA  C "C5'"  1 
ATOM   1843 C  "C4'"  . DA  C 3 6  ? -19.746 -54.868 272.919 1.00 44.57  ? 6   DA  C "C4'"  1 
ATOM   1844 O  "O4'"  . DA  C 3 6  ? -21.051 -54.264 272.783 1.00 40.60  ? 6   DA  C "O4'"  1 
ATOM   1845 C  "C3'"  . DA  C 3 6  ? -19.397 -54.789 274.409 1.00 47.90  ? 6   DA  C "C3'"  1 
ATOM   1846 O  "O3'"  . DA  C 3 6  ? -18.154 -54.122 274.576 1.00 50.69  ? 6   DA  C "O3'"  1 
ATOM   1847 C  "C2'"  . DA  C 3 6  ? -20.580 -54.027 275.044 1.00 45.25  ? 6   DA  C "C2'"  1 
ATOM   1848 C  "C1'"  . DA  C 3 6  ? -21.255 -53.373 273.850 1.00 40.34  ? 6   DA  C "C1'"  1 
ATOM   1849 N  N9     . DA  C 3 6  ? -22.700 -53.145 273.991 1.00 34.83  ? 6   DA  C N9     1 
ATOM   1850 C  C8     . DA  C 3 6  ? -23.649 -54.072 274.305 1.00 33.88  ? 6   DA  C C8     1 
ATOM   1851 N  N7     . DA  C 3 6  ? -24.869 -53.593 274.321 1.00 32.73  ? 6   DA  C N7     1 
ATOM   1852 C  C5     . DA  C 3 6  ? -24.712 -52.262 273.985 1.00 30.67  ? 6   DA  C C5     1 
ATOM   1853 C  C6     . DA  C 3 6  ? -25.632 -51.210 273.843 1.00 28.70  ? 6   DA  C C6     1 
ATOM   1854 N  N6     . DA  C 3 6  ? -26.950 -51.357 274.029 1.00 27.28  ? 6   DA  C N6     1 
ATOM   1855 N  N1     . DA  C 3 6  ? -25.147 -49.996 273.502 1.00 26.79  ? 6   DA  C N1     1 
ATOM   1856 C  C2     . DA  C 3 6  ? -23.832 -49.865 273.319 1.00 28.43  ? 6   DA  C C2     1 
ATOM   1857 N  N3     . DA  C 3 6  ? -22.876 -50.781 273.426 1.00 31.07  ? 6   DA  C N3     1 
ATOM   1858 C  C4     . DA  C 3 6  ? -23.386 -51.968 273.770 1.00 31.64  ? 6   DA  C C4     1 
ATOM   1859 H  "H5'"  . DA  C 3 6  ? -20.285 -56.271 271.525 1.00 54.72  ? 6   DA  C "H5'"  1 
ATOM   1860 H  "H5''" . DA  C 3 6  ? -18.871 -56.564 272.171 1.00 54.72  ? 6   DA  C "H5''" 1 
ATOM   1861 H  "H4'"  . DA  C 3 6  ? -19.103 -54.341 272.418 1.00 53.51  ? 6   DA  C "H4'"  1 
ATOM   1862 H  "H3'"  . DA  C 3 6  ? -19.344 -55.683 274.781 1.00 57.50  ? 6   DA  C "H3'"  1 
ATOM   1863 H  "H2'"  . DA  C 3 6  ? -21.186 -54.643 275.485 1.00 54.33  ? 6   DA  C "H2'"  1 
ATOM   1864 H  "H2''" . DA  C 3 6  ? -20.259 -53.355 275.667 1.00 54.33  ? 6   DA  C "H2''" 1 
ATOM   1865 H  "H1'"  . DA  C 3 6  ? -20.814 -52.531 273.654 1.00 48.43  ? 6   DA  C "H1'"  1 
ATOM   1866 H  H8     . DA  C 3 6  ? -23.449 -54.961 274.491 1.00 40.69  ? 6   DA  C H8     1 
ATOM   1867 H  H61    . DA  C 3 6  ? -27.476 -50.683 273.932 1.00 32.77  ? 6   DA  C H61    1 
ATOM   1868 H  H62    . DA  C 3 6  ? -27.270 -52.125 274.247 1.00 32.77  ? 6   DA  C H62    1 
ATOM   1869 H  H2     . DA  C 3 6  ? -23.545 -49.013 273.082 1.00 34.14  ? 6   DA  C H2     1 
ATOM   1870 P  P      . DC  C 3 7  ? -17.423 -54.060 276.008 1.00 53.05  ? 7   DC  C P      1 
ATOM   1871 O  OP1    . DC  C 3 7  ? -15.976 -54.190 275.759 1.00 57.41  ? 7   DC  C OP1    1 
ATOM   1872 O  OP2    . DC  C 3 7  ? -18.089 -54.952 276.981 1.00 54.09  ? 7   DC  C OP2    1 
ATOM   1873 O  "O5'"  . DC  C 3 7  ? -17.686 -52.566 276.478 1.00 49.78  ? 7   DC  C "O5'"  1 
ATOM   1874 C  "C5'"  . DC  C 3 7  ? -17.421 -51.505 275.596 1.00 47.14  ? 7   DC  C "C5'"  1 
ATOM   1875 C  "C4'"  . DC  C 3 7  ? -18.053 -50.227 276.102 1.00 44.00  ? 7   DC  C "C4'"  1 
ATOM   1876 O  "O4'"  . DC  C 3 7  ? -19.472 -50.286 275.891 1.00 40.96  ? 7   DC  C "O4'"  1 
ATOM   1877 C  "C3'"  . DC  C 3 7  ? -17.865 -49.971 277.601 1.00 43.33  ? 7   DC  C "C3'"  1 
ATOM   1878 O  "O3'"  . DC  C 3 7  ? -17.062 -48.833 277.801 1.00 45.55  ? 7   DC  C "O3'"  1 
ATOM   1879 C  "C2'"  . DC  C 3 7  ? -19.284 -49.782 278.154 1.00 40.02  ? 7   DC  C "C2'"  1 
ATOM   1880 C  "C1'"  . DC  C 3 7  ? -20.106 -49.553 276.911 1.00 38.01  ? 7   DC  C "C1'"  1 
ATOM   1881 N  N1     . DC  C 3 7  ? -21.514 -50.011 276.992 1.00 34.00  ? 7   DC  C N1     1 
ATOM   1882 C  C2     . DC  C 3 7  ? -22.538 -49.120 276.650 1.00 30.51  ? 7   DC  C C2     1 
ATOM   1883 O  O2     . DC  C 3 7  ? -22.249 -47.955 276.347 1.00 30.62  ? 7   DC  C O2     1 
ATOM   1884 N  N3     . DC  C 3 7  ? -23.815 -49.545 276.692 1.00 28.54  ? 7   DC  C N3     1 
ATOM   1885 C  C4     . DC  C 3 7  ? -24.092 -50.805 277.027 1.00 30.34  ? 7   DC  C C4     1 
ATOM   1886 N  N4     . DC  C 3 7  ? -25.376 -51.164 277.059 1.00 27.71  ? 7   DC  C N4     1 
ATOM   1887 C  C5     . DC  C 3 7  ? -23.062 -51.741 277.368 1.00 33.06  ? 7   DC  C C5     1 
ATOM   1888 C  C6     . DC  C 3 7  ? -21.796 -51.304 277.327 1.00 33.13  ? 7   DC  C C6     1 
ATOM   1889 H  "H5'"  . DC  C 3 7  ? -17.782 -51.717 274.722 1.00 56.60  ? 7   DC  C "H5'"  1 
ATOM   1890 H  "H5''" . DC  C 3 7  ? -16.461 -51.380 275.525 1.00 56.60  ? 7   DC  C "H5''" 1 
ATOM   1891 H  "H4'"  . DC  C 3 7  ? -17.691 -49.476 275.606 1.00 52.83  ? 7   DC  C "H4'"  1 
ATOM   1892 H  "H3'"  . DC  C 3 7  ? -17.451 -50.744 278.016 1.00 52.02  ? 7   DC  C "H3'"  1 
ATOM   1893 H  "H2'"  . DC  C 3 7  ? -19.580 -50.581 278.617 1.00 48.05  ? 7   DC  C "H2'"  1 
ATOM   1894 H  "H2''" . DC  C 3 7  ? -19.324 -49.009 278.738 1.00 48.05  ? 7   DC  C "H2''" 1 
ATOM   1895 H  "H1'"  . DC  C 3 7  ? -20.088 -48.610 276.685 1.00 45.64  ? 7   DC  C "H1'"  1 
ATOM   1896 H  H41    . DC  C 3 7  ? -25.593 -51.969 277.270 1.00 33.11  ? 7   DC  C H41    1 
ATOM   1897 H  H42    . DC  C 3 7  ? -25.987 -50.590 276.867 1.00 33.11  ? 7   DC  C H42    1 
ATOM   1898 H  H5     . DC  C 3 7  ? -23.263 -52.618 277.604 1.00 39.70  ? 7   DC  C H5     1 
ATOM   1899 H  H6     . DC  C 3 7  ? -21.102 -51.888 277.532 1.00 39.78  ? 7   DC  C H6     1 
ATOM   1900 P  P      . DC  C 3 8  ? -16.617 -48.405 279.278 1.00 49.32  ? 8   DC  C P      1 
ATOM   1901 O  OP1    . DC  C 3 8  ? -15.239 -47.894 279.143 1.00 52.26  ? 8   DC  C OP1    1 
ATOM   1902 O  OP2    . DC  C 3 8  ? -16.927 -49.501 280.230 1.00 51.38  ? 8   DC  C OP2    1 
ATOM   1903 O  "O5'"  . DC  C 3 8  ? -17.597 -47.199 279.609 1.00 48.29  ? 8   DC  C "O5'"  1 
ATOM   1904 C  "C5'"  . DC  C 3 8  ? -17.781 -46.187 278.661 1.00 44.98  ? 8   DC  C "C5'"  1 
ATOM   1905 C  "C4'"  . DC  C 3 8  ? -18.895 -45.256 279.074 1.00 40.49  ? 8   DC  C "C4'"  1 
ATOM   1906 O  "O4'"  . DC  C 3 8  ? -20.163 -45.900 278.850 1.00 38.27  ? 8   DC  C "O4'"  1 
ATOM   1907 C  "C3'"  . DC  C 3 8  ? -18.871 -44.834 280.547 1.00 41.49  ? 8   DC  C "C3'"  1 
ATOM   1908 O  "O3'"  . DC  C 3 8  ? -18.836 -43.412 280.642 1.00 42.98  ? 8   DC  C "O3'"  1 
ATOM   1909 C  "C2'"  . DC  C 3 8  ? -20.147 -45.430 281.139 1.00 39.08  ? 8   DC  C "C2'"  1 
ATOM   1910 C  "C1'"  . DC  C 3 8  ? -21.036 -45.623 279.919 1.00 37.58  ? 8   DC  C "C1'"  1 
ATOM   1911 N  N1     . DC  C 3 8  ? -21.998 -46.763 280.030 1.00 35.23  ? 8   DC  C N1     1 
ATOM   1912 C  C2     . DC  C 3 8  ? -23.381 -46.525 280.022 1.00 32.78  ? 8   DC  C C2     1 
ATOM   1913 O  O2     . DC  C 3 8  ? -23.801 -45.354 279.951 1.00 31.73  ? 8   DC  C O2     1 
ATOM   1914 N  N3     . DC  C 3 8  ? -24.224 -47.589 280.113 1.00 30.59  ? 8   DC  C N3     1 
ATOM   1915 C  C4     . DC  C 3 8  ? -23.733 -48.829 280.196 1.00 32.57  ? 8   DC  C C4     1 
ATOM   1916 N  N4     . DC  C 3 8  ? -24.598 -49.848 280.266 1.00 33.60  ? 8   DC  C N4     1 
ATOM   1917 C  C5     . DC  C 3 8  ? -22.332 -49.083 280.200 1.00 34.69  ? 8   DC  C C5     1 
ATOM   1918 C  C6     . DC  C 3 8  ? -21.512 -48.033 280.109 1.00 35.02  ? 8   DC  C C6     1 
ATOM   1919 H  "H5'"  . DC  C 3 8  ? -18.002 -46.588 277.806 1.00 54.00  ? 8   DC  C "H5'"  1 
ATOM   1920 H  "H5''" . DC  C 3 8  ? -16.958 -45.680 278.572 1.00 54.00  ? 8   DC  C "H5''" 1 
ATOM   1921 H  "H4'"  . DC  C 3 8  ? -18.851 -44.458 278.524 1.00 48.61  ? 8   DC  C "H4'"  1 
ATOM   1922 H  "H3'"  . DC  C 3 8  ? -18.094 -45.215 280.987 1.00 49.81  ? 8   DC  C "H3'"  1 
ATOM   1923 H  "H2'"  . DC  C 3 8  ? -19.961 -46.282 281.565 1.00 46.93  ? 8   DC  C "H2'"  1 
ATOM   1924 H  "H2''" . DC  C 3 8  ? -20.555 -44.813 281.766 1.00 46.93  ? 8   DC  C "H2''" 1 
ATOM   1925 H  "H1'"  . DC  C 3 8  ? -21.521 -44.803 279.738 1.00 45.12  ? 8   DC  C "H1'"  1 
ATOM   1926 H  H41    . DC  C 3 8  ? -24.308 -50.655 280.320 1.00 40.35  ? 8   DC  C H41    1 
ATOM   1927 H  H42    . DC  C 3 8  ? -25.444 -49.695 280.256 1.00 40.35  ? 8   DC  C H42    1 
ATOM   1928 H  H5     . DC  C 3 8  ? -22.001 -49.950 280.250 1.00 41.66  ? 8   DC  C H5     1 
ATOM   1929 H  H6     . DC  C 3 8  ? -20.592 -48.171 280.106 1.00 42.05  ? 8   DC  C H6     1 
ATOM   1930 P  P      . DT  C 3 9  ? -18.612 -42.682 282.056 1.00 47.60  ? 9   DT  C P      1 
ATOM   1931 O  OP1    . DT  C 3 9  ? -18.123 -41.320 281.720 1.00 49.78  ? 9   DT  C OP1    1 
ATOM   1932 O  OP2    . DT  C 3 9  ? -17.841 -43.575 282.951 1.00 46.89  ? 9   DT  C OP2    1 
ATOM   1933 O  "O5'"  . DT  C 3 9  ? -20.095 -42.536 282.638 1.00 42.57  ? 9   DT  C "O5'"  1 
ATOM   1934 C  "C5'"  . DT  C 3 9  ? -21.012 -41.721 281.962 1.00 38.70  ? 9   DT  C "C5'"  1 
ATOM   1935 C  "C4'"  . DT  C 3 9  ? -22.361 -41.751 282.638 1.00 37.48  ? 9   DT  C "C4'"  1 
ATOM   1936 O  "O4'"  . DT  C 3 9  ? -22.975 -43.040 282.427 1.00 36.56  ? 9   DT  C "O4'"  1 
ATOM   1937 C  "C3'"  . DT  C 3 9  ? -22.323 -41.534 284.154 1.00 40.42  ? 9   DT  C "C3'"  1 
ATOM   1938 O  "O3'"  . DT  C 3 9  ? -23.085 -40.365 284.487 1.00 42.48  ? 9   DT  C "O3'"  1 
ATOM   1939 C  "C2'"  . DT  C 3 9  ? -22.913 -42.827 284.740 1.00 39.26  ? 9   DT  C "C2'"  1 
ATOM   1940 C  "C1'"  . DT  C 3 9  ? -23.702 -43.395 283.581 1.00 37.38  ? 9   DT  C "C1'"  1 
ATOM   1941 N  N1     . DT  C 3 9  ? -23.866 -44.876 283.571 1.00 36.00  ? 9   DT  C N1     1 
ATOM   1942 C  C2     . DT  C 3 9  ? -25.125 -45.404 283.428 1.00 35.63  ? 9   DT  C C2     1 
ATOM   1943 O  O2     . DT  C 3 9  ? -26.126 -44.720 283.355 1.00 35.41  ? 9   DT  C O2     1 
ATOM   1944 N  N3     . DT  C 3 9  ? -25.176 -46.776 283.385 1.00 34.84  ? 9   DT  C N3     1 
ATOM   1945 C  C4     . DT  C 3 9  ? -24.114 -47.649 283.458 1.00 36.17  ? 9   DT  C C4     1 
ATOM   1946 O  O4     . DT  C 3 9  ? -24.267 -48.863 283.407 1.00 38.76  ? 9   DT  C O4     1 
ATOM   1947 C  C5     . DT  C 3 9  ? -22.813 -47.032 283.603 1.00 39.21  ? 9   DT  C C5     1 
ATOM   1948 C  C7     . DT  C 3 9  ? -21.578 -47.883 283.702 1.00 43.73  ? 9   DT  C C7     1 
ATOM   1949 C  C6     . DT  C 3 9  ? -22.750 -45.689 283.640 1.00 36.04  ? 9   DT  C C6     1 
ATOM   1950 H  "H5'"  . DT  C 3 9  ? -21.106 -42.037 281.049 1.00 46.47  ? 9   DT  C "H5'"  1 
ATOM   1951 H  "H5''" . DT  C 3 9  ? -20.681 -40.810 281.951 1.00 46.47  ? 9   DT  C "H5''" 1 
ATOM   1952 H  "H4'"  . DT  C 3 9  ? -22.923 -41.068 282.239 1.00 45.00  ? 9   DT  C "H4'"  1 
ATOM   1953 H  "H3'"  . DT  C 3 9  ? -21.405 -41.426 284.449 1.00 48.53  ? 9   DT  C "H3'"  1 
ATOM   1954 H  "H2'"  . DT  C 3 9  ? -22.207 -43.436 285.006 1.00 47.15  ? 9   DT  C "H2'"  1 
ATOM   1955 H  "H2''" . DT  C 3 9  ? -23.498 -42.628 285.488 1.00 47.15  ? 9   DT  C "H2''" 1 
ATOM   1956 H  "H1'"  . DT  C 3 9  ? -24.576 -42.975 283.551 1.00 44.88  ? 9   DT  C "H1'"  1 
ATOM   1957 H  H3     . DT  C 3 9  ? -25.957 -47.128 283.304 1.00 41.84  ? 9   DT  C H3     1 
ATOM   1958 H  H71    . DT  C 3 9  ? -20.978 -47.669 282.971 1.00 52.50  ? 9   DT  C H71    1 
ATOM   1959 H  H72    . DT  C 3 9  ? -21.133 -47.711 284.546 1.00 52.50  ? 9   DT  C H72    1 
ATOM   1960 H  H73    . DT  C 3 9  ? -21.826 -48.820 283.652 1.00 52.50  ? 9   DT  C H73    1 
ATOM   1961 H  H6     . DT  C 3 9  ? -21.915 -45.288 283.726 1.00 43.27  ? 9   DT  C H6     1 
ATOM   1962 P  P      . DC  C 3 10 ? -23.054 -39.725 285.963 1.00 44.64  ? 10  DC  C P      1 
ATOM   1963 O  OP1    . DC  C 3 10 ? -23.272 -38.259 285.832 1.00 43.82  ? 10  DC  C OP1    1 
ATOM   1964 O  OP2    . DC  C 3 10 ? -21.843 -40.178 286.678 1.00 45.09  ? 10  DC  C OP2    1 
ATOM   1965 O  "O5'"  . DC  C 3 10 ? -24.374 -40.334 286.618 1.00 43.74  ? 10  DC  C "O5'"  1 
ATOM   1966 C  "C5'"  . DC  C 3 10 ? -25.627 -40.107 285.989 1.00 39.32  ? 10  DC  C "C5'"  1 
ATOM   1967 C  "C4'"  . DC  C 3 10 ? -26.704 -41.000 286.570 1.00 38.68  ? 10  DC  C "C4'"  1 
ATOM   1968 O  "O4'"  . DC  C 3 10 ? -26.580 -42.327 286.023 1.00 37.78  ? 10  DC  C "O4'"  1 
ATOM   1969 C  "C3'"  . DC  C 3 10 ? -26.641 -41.193 288.092 1.00 40.22  ? 10  DC  C "C3'"  1 
ATOM   1970 O  "O3'"  . DC  C 3 10 ? -27.433 -40.226 288.756 1.00 43.96  ? 10  DC  C "O3'"  1 
ATOM   1971 C  "C2'"  . DC  C 3 10 ? -27.174 -42.607 288.315 1.00 40.98  ? 10  DC  C "C2'"  1 
ATOM   1972 C  "C1'"  . DC  C 3 10 ? -27.209 -43.233 286.907 1.00 40.61  ? 10  DC  C "C1'"  1 
ATOM   1973 N  N1     . DC  C 3 10 ? -26.513 -44.530 286.836 1.00 41.23  ? 10  DC  C N1     1 
ATOM   1974 C  C2     . DC  C 3 10 ? -27.250 -45.679 286.588 1.00 41.51  ? 10  DC  C C2     1 
ATOM   1975 O  O2     . DC  C 3 10 ? -28.468 -45.579 286.426 1.00 37.72  ? 10  DC  C O2     1 
ATOM   1976 N  N3     . DC  C 3 10 ? -26.613 -46.869 286.539 1.00 42.54  ? 10  DC  C N3     1 
ATOM   1977 C  C4     . DC  C 3 10 ? -25.298 -46.930 286.738 1.00 44.38  ? 10  DC  C C4     1 
ATOM   1978 N  N4     . DC  C 3 10 ? -24.714 -48.128 286.677 1.00 46.68  ? 10  DC  C N4     1 
ATOM   1979 C  C5     . DC  C 3 10 ? -24.524 -45.764 287.005 1.00 43.81  ? 10  DC  C C5     1 
ATOM   1980 C  C6     . DC  C 3 10 ? -25.168 -44.596 287.053 1.00 41.68  ? 10  DC  C C6     1 
ATOM   1981 H  "H5'"  . DC  C 3 10 ? -25.544 -40.287 285.039 1.00 47.22  ? 10  DC  C "H5'"  1 
ATOM   1982 H  "H5''" . DC  C 3 10 ? -25.882 -39.179 286.115 1.00 47.22  ? 10  DC  C "H5''" 1 
ATOM   1983 H  "H4'"  . DC  C 3 10 ? -27.573 -40.641 286.334 1.00 46.44  ? 10  DC  C "H4'"  1 
ATOM   1984 H  "H3'"  . DC  C 3 10 ? -25.722 -41.134 288.395 1.00 48.29  ? 10  DC  C "H3'"  1 
ATOM   1985 H  "HO3'" . DC  C 3 10 ? -28.071 -40.469 289.246 1.00 52.78  ? 10  DC  C "HO3'" 1 
ATOM   1986 H  "H2'"  . DC  C 3 10 ? -26.575 -43.107 288.893 1.00 49.20  ? 10  DC  C "H2'"  1 
ATOM   1987 H  "H2''" . DC  C 3 10 ? -28.066 -42.577 288.694 1.00 49.20  ? 10  DC  C "H2''" 1 
ATOM   1988 H  "H1'"  . DC  C 3 10 ? -28.132 -43.352 286.635 1.00 48.76  ? 10  DC  C "H1'"  1 
ATOM   1989 H  H41    . DC  C 3 10 ? -23.866 -48.199 286.801 1.00 56.05  ? 10  DC  C H41    1 
ATOM   1990 H  H42    . DC  C 3 10 ? -25.185 -48.828 286.514 1.00 56.05  ? 10  DC  C H42    1 
ATOM   1991 H  H5     . DC  C 3 10 ? -23.605 -45.814 287.136 1.00 52.59  ? 10  DC  C H5     1 
ATOM   1992 H  H6     . DC  C 3 10 ? -24.691 -43.815 287.218 1.00 50.04  ? 10  DC  C H6     1 
HETATM 1993 ZN ZN     . ZN  D 4 .  ? -26.938 -67.029 286.695 1.00 46.44  ? 501 ZN  A ZN     1 
HETATM 1994 ZN ZN     . ZN  E 4 .  ? -46.091 -48.981 274.689 1.00 33.39  ? 502 ZN  A ZN     1 
HETATM 1995 ZN ZN     . ZN  F 4 .  ? -25.643 -33.081 265.877 1.00 36.05  ? 503 ZN  A ZN     1 
HETATM 1996 O  O      . HOH G 5 .  ? -38.986 -58.230 280.058 1.00 44.28  ? 601 HOH A O      1 
HETATM 1997 O  O      . HOH G 5 .  ? -45.074 -51.151 266.642 1.00 39.21  ? 602 HOH A O      1 
HETATM 1998 O  O      . HOH G 5 .  ? -49.354 -43.732 276.228 1.00 63.00  ? 603 HOH A O      1 
HETATM 1999 O  O      . HOH G 5 .  ? -15.204 -39.649 260.910 1.00 61.81  ? 604 HOH A O      1 
HETATM 2000 O  O      . HOH G 5 .  ? -17.650 -41.448 264.786 1.00 41.03  ? 605 HOH A O      1 
HETATM 2001 O  O      . HOH G 5 .  ? -32.519 -57.269 282.180 1.00 46.45  ? 606 HOH A O      1 
HETATM 2002 O  O      . HOH G 5 .  ? -28.885 -47.834 261.641 1.00 66.86  ? 607 HOH A O      1 
HETATM 2003 O  O      . HOH G 5 .  ? -34.616 -52.986 265.789 1.00 31.19  ? 608 HOH A O      1 
HETATM 2004 O  O      . HOH G 5 .  ? -32.364 -41.104 254.713 1.00 72.08  ? 609 HOH A O      1 
HETATM 2005 O  O      . HOH G 5 .  ? -37.148 -53.377 278.639 1.00 36.89  ? 610 HOH A O      1 
HETATM 2006 O  O      . HOH G 5 .  ? -31.230 -40.402 268.135 1.00 52.61  ? 611 HOH A O      1 
HETATM 2007 O  O      . HOH G 5 .  ? -19.513 -63.943 292.461 1.00 54.24  ? 612 HOH A O      1 
HETATM 2008 O  O      . HOH G 5 .  ? -38.878 -41.555 273.367 1.00 37.36  ? 613 HOH A O      1 
HETATM 2009 O  O      . HOH G 5 .  ? -32.809 -44.979 275.115 1.00 27.30  ? 614 HOH A O      1 
HETATM 2010 O  O      . HOH G 5 .  ? -19.643 -62.264 280.824 1.00 47.22  ? 615 HOH A O      1 
HETATM 2011 O  O      . HOH G 5 .  ? -47.314 -44.956 270.021 1.00 35.04  ? 616 HOH A O      1 
HETATM 2012 O  O      . HOH G 5 .  ? -30.755 -47.936 265.908 1.00 30.48  ? 617 HOH A O      1 
HETATM 2013 O  O      . HOH G 5 .  ? -24.006 -38.492 255.633 1.00 56.30  ? 618 HOH A O      1 
HETATM 2014 O  O      . HOH G 5 .  ? -33.061 -37.788 260.916 1.00 35.40  ? 619 HOH A O      1 
HETATM 2015 O  O      . HOH G 5 .  ? -40.256 -47.231 277.917 1.00 36.76  ? 620 HOH A O      1 
HETATM 2016 O  O      . HOH G 5 .  ? -34.691 -36.389 261.955 1.00 31.74  ? 621 HOH A O      1 
HETATM 2017 O  O      . HOH G 5 .  ? -39.521 -64.555 278.810 1.00 51.91  ? 622 HOH A O      1 
HETATM 2018 O  O      . HOH G 5 .  ? -34.425 -54.249 268.259 1.00 29.99  ? 623 HOH A O      1 
HETATM 2019 O  O      . HOH G 5 .  ? -36.548 -47.665 275.395 1.00 30.65  ? 624 HOH A O      1 
HETATM 2020 O  O      . HOH G 5 .  ? -26.265 -48.406 261.178 1.00 38.64  ? 625 HOH A O      1 
HETATM 2021 O  O      . HOH G 5 .  ? -32.237 -58.006 272.562 1.00 47.82  ? 626 HOH A O      1 
HETATM 2022 O  O      . HOH G 5 .  ? -25.538 -33.261 258.943 1.00 32.88  ? 627 HOH A O      1 
HETATM 2023 O  O      . HOH G 5 .  ? -36.030 -37.677 268.776 1.00 31.05  ? 628 HOH A O      1 
HETATM 2024 O  O      . HOH G 5 .  ? -36.342 -41.920 271.730 1.00 29.99  ? 629 HOH A O      1 
HETATM 2025 O  O      . HOH G 5 .  ? -34.946 -53.986 277.883 1.00 30.85  ? 630 HOH A O      1 
HETATM 2026 O  O      . HOH G 5 .  ? -33.678 -51.538 278.759 1.00 29.32  ? 631 HOH A O      1 
HETATM 2027 O  O      . HOH G 5 .  ? -22.630 -44.704 255.172 1.00 40.37  ? 632 HOH A O      1 
HETATM 2028 O  O      . HOH G 5 .  ? -31.650 -53.478 273.698 1.00 42.85  ? 633 HOH A O      1 
HETATM 2029 O  O      . HOH G 5 .  ? -43.780 -47.336 264.064 1.00 35.73  ? 634 HOH A O      1 
HETATM 2030 O  O      . HOH G 5 .  ? -41.805 -37.454 265.227 1.00 37.38  ? 635 HOH A O      1 
HETATM 2031 O  O      . HOH G 5 .  ? -33.197 -28.360 268.464 1.00 69.42  ? 636 HOH A O      1 
HETATM 2032 O  O      . HOH G 5 .  ? -33.838 -47.482 275.897 1.00 24.81  ? 637 HOH A O      1 
HETATM 2033 O  O      . HOH G 5 .  ? -18.527 -37.455 267.224 1.00 46.54  ? 638 HOH A O      1 
HETATM 2034 O  O      . HOH G 5 .  ? -43.269 -40.473 263.023 1.00 35.50  ? 639 HOH A O      1 
HETATM 2035 O  O      . HOH G 5 .  ? -41.223 -58.835 273.438 1.00 52.61  ? 640 HOH A O      1 
HETATM 2036 O  O      . HOH G 5 .  ? -33.205 -47.196 264.544 1.00 27.99  ? 641 HOH A O      1 
HETATM 2037 O  O      . HOH G 5 .  ? -43.452 -40.503 273.202 1.00 35.86  ? 642 HOH A O      1 
HETATM 2038 O  O      . HOH G 5 .  ? -28.191 -43.279 267.435 1.00 37.94  ? 643 HOH A O      1 
HETATM 2039 O  O      . HOH G 5 .  ? -34.535 -55.194 275.461 1.00 45.39  ? 644 HOH A O      1 
HETATM 2040 O  O      . HOH G 5 .  ? -32.739 -45.641 262.392 1.00 41.76  ? 645 HOH A O      1 
HETATM 2041 O  O      . HOH G 5 .  ? -43.726 -39.038 265.655 1.00 45.91  ? 646 HOH A O      1 
HETATM 2042 O  O      . HOH G 5 .  ? -47.221 -41.146 275.746 1.00 62.09  ? 647 HOH A O      1 
HETATM 2043 O  O      . HOH G 5 .  ? -19.936 -38.790 268.065 1.00 47.91  ? 648 HOH A O      1 
HETATM 2044 O  O      . HOH G 5 .  ? -28.689 -46.422 263.602 1.00 42.16  ? 649 HOH A O      1 
HETATM 2045 O  O      . HOH G 5 .  ? -17.403 -64.834 292.797 1.00 70.85  ? 650 HOH A O      1 
HETATM 2046 O  O      . HOH G 5 .  ? -29.035 -41.221 268.961 1.00 54.77  ? 651 HOH A O      1 
HETATM 2047 O  O      . HOH H 5 .  ? -25.546 -42.611 267.910 1.00 39.32  ? 101 HOH B O      1 
HETATM 2048 O  O      . HOH H 5 .  ? -36.458 -44.565 276.144 1.00 36.73  ? 102 HOH B O      1 
HETATM 2049 O  O      . HOH H 5 .  ? -19.639 -48.486 261.708 1.00 36.92  ? 103 HOH B O      1 
HETATM 2050 O  O      . HOH H 5 .  ? -20.216 -43.973 263.559 1.00 44.47  ? 104 HOH B O      1 
HETATM 2051 O  O      . HOH H 5 .  ? -26.721 -38.019 271.696 1.00 38.80  ? 105 HOH B O      1 
HETATM 2052 O  O      . HOH H 5 .  ? -22.335 -51.361 258.897 1.00 36.55  ? 106 HOH B O      1 
HETATM 2053 O  O      . HOH H 5 .  ? -30.767 -50.441 272.618 1.00 35.17  ? 107 HOH B O      1 
HETATM 2054 O  O      . HOH H 5 .  ? -25.196 -42.788 276.850 1.00 27.61  ? 108 HOH B O      1 
HETATM 2055 O  O      . HOH H 5 .  ? -30.444 -42.732 271.739 1.00 36.27  ? 109 HOH B O      1 
HETATM 2056 O  O      . HOH H 5 .  ? -26.647 -38.983 269.318 1.00 35.93  ? 110 HOH B O      1 
HETATM 2057 O  O      . HOH H 5 .  ? -38.046 -48.385 277.587 1.00 36.55  ? 111 HOH B O      1 
HETATM 2058 O  O      . HOH H 5 .  ? -31.805 -45.207 283.861 1.00 39.95  ? 112 HOH B O      1 
HETATM 2059 O  O      . HOH H 5 .  ? -22.202 -45.409 273.190 1.00 42.02  ? 113 HOH B O      1 
HETATM 2060 O  O      . HOH H 5 .  ? -29.235 -42.678 280.873 1.00 43.92  ? 114 HOH B O      1 
HETATM 2061 O  O      . HOH H 5 .  ? -19.915 -47.953 270.953 1.00 37.04  ? 115 HOH B O      1 
HETATM 2062 O  O      . HOH H 5 .  ? -34.067 -48.834 278.351 1.00 30.52  ? 116 HOH B O      1 
HETATM 2063 O  O      . HOH H 5 .  ? -33.513 -52.726 281.335 1.00 26.42  ? 117 HOH B O      1 
HETATM 2064 O  O      . HOH H 5 .  ? -28.847 -46.408 265.761 1.00 30.35  ? 118 HOH B O      1 
HETATM 2065 O  O      . HOH H 5 .  ? -33.251 -46.824 286.326 1.00 55.64  ? 119 HOH B O      1 
HETATM 2066 O  O      . HOH I 5 .  ? -20.721 -46.617 274.793 1.00 44.73  ? 101 HOH C O      1 
HETATM 2067 O  O      . HOH I 5 .  ? -22.979 -51.087 283.881 1.00 37.98  ? 102 HOH C O      1 
HETATM 2068 O  O      . HOH I 5 .  ? -33.637 -49.622 262.873 1.00 30.75  ? 103 HOH C O      1 
HETATM 2069 O  O      . HOH I 5 .  ? -32.624 -55.335 258.035 1.00 39.46  ? 104 HOH C O      1 
HETATM 2070 O  O      . HOH I 5 .  ? -23.808 -57.704 275.113 1.00 34.62  ? 105 HOH C O      1 
HETATM 2071 O  O      . HOH I 5 .  ? -20.209 -49.856 272.943 1.00 40.43  ? 106 HOH C O      1 
HETATM 2072 O  O      . HOH I 5 .  ? -29.686 -57.288 274.116 1.00 42.60  ? 107 HOH C O      1 
HETATM 2073 O  O      . HOH I 5 .  ? -28.171 -42.649 282.952 1.00 36.53  ? 108 HOH C O      1 
HETATM 2074 O  O      . HOH I 5 .  ? -33.099 -59.798 270.810 1.00 70.60  ? 109 HOH C O      1 
HETATM 2075 O  O      . HOH I 5 .  ? -28.752 -53.635 275.048 1.00 44.26  ? 110 HOH C O      1 
HETATM 2076 O  O      . HOH I 5 .  ? -25.259 -38.173 289.562 1.00 52.96  ? 111 HOH C O      1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . THR A 9  ? 0.7128 1.3219 1.0699 -0.1253 0.1497  0.1785  399 THR A N     
2    C CA    . THR A 9  ? 0.7027 1.2599 0.9702 -0.0909 0.1170  0.1645  399 THR A CA    
3    C C     . THR A 9  ? 0.6810 1.1573 0.9049 -0.1073 0.0966  0.1667  399 THR A C     
4    O O     . THR A 9  ? 0.7164 1.1604 0.9399 -0.1292 0.1169  0.1897  399 THR A O     
5    C CB    . THR A 9  ? 0.7178 1.3115 1.0030 -0.0690 0.0818  0.1299  399 THR A CB    
6    O OG1   . THR A 9  ? 0.7008 1.2938 1.0376 -0.0955 0.0497  0.1097  399 THR A OG1   
7    C CG2   . THR A 9  ? 0.7457 1.4355 1.0866 -0.0492 0.0991  0.1250  399 THR A CG2   
14   N N     . HIS A 10 ? 0.5399 0.9808 0.7240 -0.0936 0.0607  0.1435  400 HIS A N     
15   C CA    . HIS A 10 ? 0.5104 0.8817 0.6458 -0.1000 0.0428  0.1434  400 HIS A CA    
16   C C     . HIS A 10 ? 0.4523 0.8103 0.6330 -0.1257 0.0179  0.1314  400 HIS A C     
17   O O     . HIS A 10 ? 0.4156 0.7671 0.5954 -0.1160 -0.0101 0.1068  400 HIS A O     
18   C CB    . HIS A 10 ? 0.4896 0.8269 0.5561 -0.0732 0.0274  0.1245  400 HIS A CB    
19   C CG    . HIS A 10 ? 0.5241 0.8699 0.5419 -0.0467 0.0480  0.1290  400 HIS A CG    
20   N ND1   . HIS A 10 ? 0.5642 0.8861 0.5292 -0.0383 0.0592  0.1412  400 HIS A ND1   
21   C CD2   . HIS A 10 ? 0.5413 0.9137 0.5475 -0.0212 0.0582  0.1214  400 HIS A CD2   
22   C CE1   . HIS A 10 ? 0.5892 0.9194 0.5126 -0.0122 0.0747  0.1397  400 HIS A CE1   
23   N NE2   . HIS A 10 ? 0.5825 0.9409 0.5289 -0.0017 0.0766  0.1294  400 HIS A NE2   
31   N N     . THR A 11 ? 0.4387 0.7804 0.6470 -0.1549 0.0307  0.1494  401 THR A N     
32   C CA    . THR A 11 ? 0.4593 0.7819 0.7088 -0.1822 0.0101  0.1381  401 THR A CA    
33   C C     . THR A 11 ? 0.4638 0.7115 0.6569 -0.1803 -0.0034 0.1447  401 THR A C     
34   O O     . THR A 11 ? 0.4320 0.6481 0.5732 -0.1697 0.0134  0.1663  401 THR A O     
35   C CB    . THR A 11 ? 0.5143 0.8586 0.8339 -0.2210 0.0377  0.1503  401 THR A CB    
36   O OG1   . THR A 11 ? 0.5256 0.9513 0.8999 -0.2196 0.0585  0.1478  401 THR A OG1   
37   C CG2   . THR A 11 ? 0.5094 0.8447 0.8819 -0.2508 0.0101  0.1268  401 THR A CG2   
45   N N     . CYS A 12 ? 0.3924 0.6149 0.5931 -0.1850 -0.0346 0.1248  402 CYS A N     
46   C CA    . CYS A 12 ? 0.4053 0.5615 0.5612 -0.1827 -0.0470 0.1300  402 CYS A CA    
47   C C     . CYS A 12 ? 0.4878 0.6056 0.6585 -0.2112 -0.0312 0.1488  402 CYS A C     
48   O O     . CYS A 12 ? 0.4682 0.5991 0.6988 -0.2413 -0.0317 0.1389  402 CYS A O     
49   C CB    . CYS A 12 ? 0.3835 0.5186 0.5338 -0.1725 -0.0811 0.1036  402 CYS A CB    
50   S SG    . CYS A 12 ? 0.4014 0.4610 0.5006 -0.1656 -0.0940 0.1098  402 CYS A SG    
55   N N     . ASP A 13 ? 0.5440 0.6124 0.6575 -0.2000 -0.0168 0.1729  403 ASP A N     
56   C CA    . ASP A 13 ? 0.6211 0.6329 0.7254 -0.2197 0.0088  0.1968  403 ASP A CA    
57   C C     . ASP A 13 ? 0.6340 0.5742 0.6949 -0.2122 -0.0100 0.1972  403 ASP A C     
58   O O     . ASP A 13 ? 0.7004 0.5749 0.7201 -0.2129 0.0126  0.2215  403 ASP A O     
59   C CB    . ASP A 13 ? 0.7096 0.7101 0.7656 -0.2020 0.0472  0.2292  403 ASP A CB    
60   C CG    . ASP A 13 ? 0.7400 0.8038 0.8380 -0.2102 0.0738  0.2331  403 ASP A CG    
61   O OD1   . ASP A 13 ? 0.7458 0.8429 0.9215 -0.2465 0.0845  0.2241  403 ASP A OD1   
62   O OD2   . ASP A 13 ? 0.7596 0.8449 0.8153 -0.1790 0.0822  0.2418  403 ASP A OD2   
67   N N     . TYR A 14 ? 0.5752 0.5192 0.6373 -0.2011 -0.0467 0.1724  404 TYR A N     
68   C CA    . TYR A 14 ? 0.6448 0.5247 0.6653 -0.1889 -0.0641 0.1720  404 TYR A CA    
69   C C     . TYR A 14 ? 0.7051 0.5477 0.7596 -0.2198 -0.0759 0.1578  404 TYR A C     
70   O O     . TYR A 14 ? 0.7027 0.5844 0.8069 -0.2312 -0.0978 0.1300  404 TYR A O     
71   C CB    . TYR A 14 ? 0.6217 0.5209 0.6227 -0.1592 -0.0905 0.1533  404 TYR A CB    
72   C CG    . TYR A 14 ? 0.6661 0.5104 0.6204 -0.1377 -0.1030 0.1563  404 TYR A CG    
73   C CD1   . TYR A 14 ? 0.7050 0.5418 0.6104 -0.1086 -0.0955 0.1723  404 TYR A CD1   
74   C CD2   . TYR A 14 ? 0.6841 0.4876 0.6399 -0.1404 -0.1238 0.1414  404 TYR A CD2   
75   C CE1   . TYR A 14 ? 0.7457 0.5422 0.6111 -0.0835 -0.1061 0.1746  404 TYR A CE1   
76   C CE2   . TYR A 14 ? 0.7176 0.4702 0.6271 -0.1163 -0.1321 0.1459  404 TYR A CE2   
77   C CZ    . TYR A 14 ? 0.7548 0.5073 0.6224 -0.0883 -0.1220 0.1632  404 TYR A CZ    
78   O OH    . TYR A 14 ? 0.8004 0.5125 0.6246 -0.0589 -0.1294 0.1674  404 TYR A OH    
88   N N     . ALA A 15 ? 0.8034 0.5671 0.8251 -0.2297 -0.0620 0.1743  405 ALA A N     
89   C CA    . ALA A 15 ? 0.8515 0.5611 0.8906 -0.2572 -0.0763 0.1574  405 ALA A CA    
90   C C     . ALA A 15 ? 0.8513 0.6221 0.9812 -0.2953 -0.0883 0.1262  405 ALA A C     
91   O O     . ALA A 15 ? 0.8506 0.6301 1.0013 -0.2929 -0.1232 0.0922  405 ALA A O     
92   C CB    . ALA A 15 ? 0.8419 0.5139 0.8377 -0.2261 -0.1111 0.1438  405 ALA A CB    
98   N N     . GLY A 16 ? 0.8986 0.7202 1.0783 -0.3200 -0.0566 0.1344  406 GLY A N     
99   C CA    . GLY A 16 ? 0.8686 0.7668 1.1396 -0.3473 -0.0604 0.0995  406 GLY A CA    
100  C C     . GLY A 16 ? 0.7983 0.7685 1.0974 -0.3249 -0.1055 0.0688  406 GLY A C     
101  O O     . GLY A 16 ? 0.7934 0.8117 1.1501 -0.3351 -0.1243 0.0294  406 GLY A O     
105  N N     . CYS A 17 ? 0.6731 0.6511 0.9225 -0.2855 -0.1172 0.0802  407 CYS A N     
106  C CA    . CYS A 17 ? 0.6121 0.6409 0.8688 -0.2554 -0.1493 0.0526  407 CYS A CA    
107  C C     . CYS A 17 ? 0.5698 0.6949 0.9022 -0.2667 -0.1465 0.0356  407 CYS A C     
108  O O     . CYS A 17 ? 0.5813 0.7481 0.9602 -0.2674 -0.1757 -0.0005 407 CYS A O     
109  C CB    . CYS A 17 ? 0.4584 0.4771 0.6494 -0.2151 -0.1446 0.0673  407 CYS A CB    
110  S SG    . CYS A 17 ? 0.4137 0.4780 0.5969 -0.1763 -0.1653 0.0409  407 CYS A SG    
115  N N     . GLY A 18 ? 0.6009 0.7655 0.9414 -0.2683 -0.1118 0.0589  408 GLY A N     
116  C CA    . GLY A 18 ? 0.6179 0.8761 1.0307 -0.2776 -0.1013 0.0478  408 GLY A CA    
117  C C     . GLY A 18 ? 0.6017 0.9126 0.9976 -0.2334 -0.1161 0.0341  408 GLY A C     
118  O O     . GLY A 18 ? 0.6167 1.0053 1.0591 -0.2317 -0.1013 0.0315  408 GLY A O     
122  N N     . LYS A 19 ? 0.5494 0.8161 0.8778 -0.1963 -0.1400 0.0256  409 LYS A N     
123  C CA    . LYS A 19 ? 0.4947 0.7895 0.7911 -0.1529 -0.1454 0.0148  409 LYS A CA    
124  C C     . LYS A 19 ? 0.4716 0.7977 0.7591 -0.1491 -0.1097 0.0382  409 LYS A C     
125  O O     . LYS A 19 ? 0.4671 0.7604 0.7275 -0.1622 -0.0857 0.0651  409 LYS A O     
126  C CB    . LYS A 19 ? 0.5015 0.7221 0.7163 -0.1208 -0.1583 0.0114  409 LYS A CB    
127  C CG    . LYS A 19 ? 0.5471 0.7442 0.7518 -0.0998 -0.1952 -0.0178 409 LYS A CG    
128  C CD    . LYS A 19 ? 0.5990 0.7218 0.7184 -0.0629 -0.1953 -0.0185 409 LYS A CD    
129  C CE    . LYS A 19 ? 0.7025 0.8047 0.7929 -0.0224 -0.2266 -0.0478 409 LYS A CE    
130  N NZ    . LYS A 19 ? 0.7700 0.7911 0.7719 0.0148  -0.2139 -0.0453 409 LYS A NZ    
144  N N     . THR A 20 ? 0.4555 0.8444 0.7591 -0.1248 -0.1075 0.0267  410 THR A N     
145  C CA    . THR A 20 ? 0.4302 0.8512 0.7233 -0.1161 -0.0742 0.0462  410 THR A CA    
146  C C     . THR A 20 ? 0.3956 0.7999 0.6190 -0.0691 -0.0754 0.0369  410 THR A C     
147  O O     . THR A 20 ? 0.3874 0.7903 0.5945 -0.0379 -0.0984 0.0128  410 THR A O     
148  C CB    . THR A 20 ? 0.4297 0.9455 0.8094 -0.1305 -0.0591 0.0444  410 THR A CB    
149  O OG1   . THR A 20 ? 0.4361 1.0119 0.8572 -0.1089 -0.0906 0.0093  410 THR A OG1   
150  C CG2   . THR A 20 ? 0.4511 0.9686 0.8937 -0.1835 -0.0420 0.0578  410 THR A CG2   
158  N N     . TYR A 21 ? 0.3486 0.7346 0.5242 -0.0614 -0.0487 0.0548  411 TYR A N     
159  C CA    . TYR A 21 ? 0.3817 0.7332 0.4825 -0.0241 -0.0426 0.0461  411 TYR A CA    
160  C C     . TYR A 21 ? 0.4149 0.8045 0.5047 -0.0089 -0.0147 0.0583  411 TYR A C     
161  O O     . TYR A 21 ? 0.3917 0.8235 0.5227 -0.0285 0.0037  0.0781  411 TYR A O     
162  C CB    . TYR A 21 ? 0.3710 0.6435 0.4113 -0.0307 -0.0414 0.0467  411 TYR A CB    
163  C CG    . TYR A 21 ? 0.3491 0.5802 0.3916 -0.0371 -0.0651 0.0353  411 TYR A CG    
164  C CD1   . TYR A 21 ? 0.4232 0.6141 0.4240 -0.0063 -0.0744 0.0156  411 TYR A CD1   
165  C CD2   . TYR A 21 ? 0.3528 0.5773 0.4296 -0.0679 -0.0754 0.0456  411 TYR A CD2   
166  C CE1   . TYR A 21 ? 0.3933 0.5414 0.3880 -0.0060 -0.0941 0.0063  411 TYR A CE1   
167  C CE2   . TYR A 21 ? 0.3528 0.5357 0.4256 -0.0695 -0.0968 0.0353  411 TYR A CE2   
168  C CZ    . TYR A 21 ? 0.3778 0.5248 0.4107 -0.0383 -0.1066 0.0156  411 TYR A CZ    
169  O OH    . TYR A 21 ? 0.3922 0.4925 0.4127 -0.0343 -0.1256 0.0066  411 TYR A OH    
179  N N     . THR A 22 ? 0.4923 0.8569 0.5179 0.0293  -0.0073 0.0473  412 THR A N     
180  C CA    . THR A 22 ? 0.5479 0.9382 0.5477 0.0521  0.0189  0.0567  412 THR A CA    
181  C C     . THR A 22 ? 0.5477 0.8861 0.4868 0.0439  0.0367  0.0658  412 THR A C     
182  O O     . THR A 22 ? 0.5666 0.9280 0.4909 0.0549  0.0586  0.0793  412 THR A O     
183  C CB    . THR A 22 ? 0.5796 0.9601 0.5271 0.1038  0.0208  0.0397  412 THR A CB    
184  O OG1   . THR A 22 ? 0.6371 0.9182 0.5000 0.1143  0.0224  0.0260  412 THR A OG1   
185  C CG2   . THR A 22 ? 0.5984 1.0414 0.6025 0.1227  -0.0039 0.0241  412 THR A CG2   
193  N N     . LYS A 23 ? 0.5227 0.7960 0.4267 0.0280  0.0273  0.0555  413 LYS A N     
194  C CA    . LYS A 23 ? 0.5416 0.7773 0.3990 0.0180  0.0359  0.0546  413 LYS A CA    
195  C C     . LYS A 23 ? 0.4995 0.7293 0.3863 -0.0135 0.0206  0.0602  413 LYS A C     
196  O O     . LYS A 23 ? 0.4305 0.6515 0.3490 -0.0265 0.0041  0.0566  413 LYS A O     
197  C CB    . LYS A 23 ? 0.6046 0.7688 0.3913 0.0286  0.0429  0.0286  413 LYS A CB    
198  C CG    . LYS A 23 ? 0.6805 0.8246 0.4103 0.0656  0.0628  0.0217  413 LYS A CG    
199  C CD    . LYS A 23 ? 0.7556 0.8083 0.4153 0.0706  0.0755  -0.0046 413 LYS A CD    
200  C CE    . LYS A 23 ? 0.7957 0.8131 0.4285 0.0428  0.0806  -0.0226 413 LYS A CE    
201  N NZ    . LYS A 23 ? 0.8769 0.8012 0.4400 0.0448  0.1047  -0.0506 413 LYS A NZ    
215  N N     . SER A 24 ? 0.5203 0.7523 0.3877 -0.0188 0.0251  0.0681  414 SER A N     
216  C CA    . SER A 24 ? 0.5234 0.7470 0.4037 -0.0380 0.0103  0.0716  414 SER A CA    
217  C C     . SER A 24 ? 0.4876 0.6725 0.3555 -0.0481 -0.0032 0.0441  414 SER A C     
218  O O     . SER A 24 ? 0.4957 0.6738 0.3878 -0.0620 -0.0176 0.0454  414 SER A O     
219  C CB    . SER A 24 ? 0.5960 0.8284 0.4422 -0.0286 0.0159  0.0816  414 SER A CB    
220  O OG    . SER A 24 ? 0.6420 0.8565 0.4376 -0.0184 0.0144  0.0545  414 SER A OG    
226  N N     . SER A 25 ? 0.4740 0.6281 0.3027 -0.0413 0.0060  0.0195  415 SER A N     
227  C CA    . SER A 25 ? 0.5164 0.6298 0.3372 -0.0553 0.0037  -0.0077 415 SER A CA    
228  C C     . SER A 25 ? 0.4670 0.5570 0.3103 -0.0567 -0.0009 -0.0041 415 SER A C     
229  O O     . SER A 25 ? 0.4329 0.5031 0.2898 -0.0704 -0.0071 -0.0137 415 SER A O     
230  C CB    . SER A 25 ? 0.6265 0.6970 0.3951 -0.0503 0.0238  -0.0345 415 SER A CB    
231  O OG    . SER A 25 ? 0.6974 0.7196 0.4614 -0.0668 0.0327  -0.0598 415 SER A OG    
237  N N     . HIS A 26 ? 0.4266 0.5232 0.2740 -0.0387 0.0007  0.0076  416 HIS A N     
238  C CA    . HIS A 26 ? 0.4440 0.5243 0.3100 -0.0338 -0.0108 0.0086  416 HIS A CA    
239  C C     . HIS A 26 ? 0.3931 0.4993 0.3091 -0.0536 -0.0314 0.0236  416 HIS A C     
240  O O     . HIS A 26 ? 0.3796 0.4561 0.3015 -0.0579 -0.0418 0.0190  416 HIS A O     
241  C CB    . HIS A 26 ? 0.4693 0.5696 0.3356 -0.0059 -0.0114 0.0120  416 HIS A CB    
242  C CG    . HIS A 26 ? 0.5404 0.6013 0.3421 0.0239  0.0107  -0.0008 416 HIS A CG    
243  N ND1   . HIS A 26 ? 0.5721 0.6597 0.3639 0.0590  0.0131  0.0011  416 HIS A ND1   
244  C CD2   . HIS A 26 ? 0.5893 0.5826 0.3312 0.0246  0.0342  -0.0175 416 HIS A CD2   
245  C CE1   . HIS A 26 ? 0.6314 0.6605 0.3477 0.0855  0.0374  -0.0103 416 HIS A CE1   
246  N NE2   . HIS A 26 ? 0.6469 0.6130 0.3318 0.0617  0.0525  -0.0223 416 HIS A NE2   
254  N N     . LEU A 27 ? 0.4005 0.5524 0.3449 -0.0628 -0.0330 0.0432  417 LEU A N     
255  C CA    . LEU A 27 ? 0.3924 0.5526 0.3713 -0.0805 -0.0457 0.0593  417 LEU A CA    
256  C C     . LEU A 27 ? 0.3839 0.5193 0.3464 -0.0872 -0.0522 0.0533  417 LEU A C     
257  O O     . LEU A 27 ? 0.3571 0.4717 0.3323 -0.0936 -0.0647 0.0558  417 LEU A O     
258  C CB    . LEU A 27 ? 0.3898 0.5888 0.3887 -0.0867 -0.0345 0.0835  417 LEU A CB    
259  C CG    . LEU A 27 ? 0.4013 0.5931 0.4227 -0.1039 -0.0378 0.1041  417 LEU A CG    
260  C CD1   . LEU A 27 ? 0.3483 0.5245 0.4053 -0.1173 -0.0549 0.0987  417 LEU A CD1   
261  C CD2   . LEU A 27 ? 0.4277 0.6470 0.4640 -0.1091 -0.0140 0.1298  417 LEU A CD2   
273  N N     . LYS A 28 ? 0.4267 0.5681 0.3622 -0.0840 -0.0452 0.0421  418 LYS A N     
274  C CA    . LYS A 28 ? 0.4271 0.5644 0.3585 -0.0887 -0.0538 0.0294  418 LYS A CA    
275  C C     . LYS A 28 ? 0.3873 0.4880 0.3253 -0.0940 -0.0547 0.0137  418 LYS A C     
276  O O     . LYS A 28 ? 0.3701 0.4649 0.3210 -0.0962 -0.0652 0.0167  418 LYS A O     
277  C CB    . LYS A 28 ? 0.4395 0.5948 0.3470 -0.0862 -0.0491 0.0075  418 LYS A CB    
278  C CG    . LYS A 28 ? 0.4660 0.6395 0.3822 -0.0899 -0.0621 -0.0130 418 LYS A CG    
279  C CD    . LYS A 28 ? 0.5168 0.7222 0.4140 -0.0859 -0.0658 -0.0391 418 LYS A CD    
280  C CE    . LYS A 28 ? 0.5360 0.7835 0.4492 -0.0811 -0.0869 -0.0583 418 LYS A CE    
281  N NZ    . LYS A 28 ? 0.5549 0.8427 0.4539 -0.0759 -0.0980 -0.0937 418 LYS A NZ    
295  N N     . ALA A 29 ? 0.3882 0.4567 0.3081 -0.0906 -0.0399 -0.0013 419 ALA A N     
296  C CA    . ALA A 29 ? 0.4002 0.4199 0.3132 -0.0894 -0.0328 -0.0130 419 ALA A CA    
297  C C     . ALA A 29 ? 0.3937 0.3994 0.3204 -0.0820 -0.0506 0.0037  419 ALA A C     
298  O O     . ALA A 29 ? 0.4081 0.3865 0.3364 -0.0817 -0.0530 0.0012  419 ALA A O     
299  C CB    . ALA A 29 ? 0.4313 0.4038 0.3038 -0.0780 -0.0085 -0.0277 419 ALA A CB    
305  N N     . HIS A 30 ? 0.3474 0.3730 0.2868 -0.0767 -0.0623 0.0181  420 HIS A N     
306  C CA    . HIS A 30 ? 0.3549 0.3679 0.3116 -0.0745 -0.0821 0.0266  420 HIS A CA    
307  C C     . HIS A 30 ? 0.3411 0.3553 0.3140 -0.0874 -0.0929 0.0402  420 HIS A C     
308  O O     . HIS A 30 ? 0.3486 0.3290 0.3197 -0.0840 -0.1052 0.0414  420 HIS A O     
309  C CB    . HIS A 30 ? 0.3892 0.4388 0.3738 -0.0739 -0.0919 0.0333  420 HIS A CB    
310  C CG    . HIS A 30 ? 0.4745 0.5223 0.4910 -0.0848 -0.1131 0.0396  420 HIS A CG    
311  N ND1   . HIS A 30 ? 0.5044 0.5182 0.5123 -0.0709 -0.1319 0.0263  420 HIS A ND1   
312  C CD2   . HIS A 30 ? 0.4978 0.5632 0.5473 -0.1078 -0.1159 0.0564  420 HIS A CD2   
313  C CE1   . HIS A 30 ? 0.5280 0.5433 0.5681 -0.0887 -0.1492 0.0311  420 HIS A CE1   
314  N NE2   . HIS A 30 ? 0.5510 0.5935 0.6168 -0.1133 -0.1366 0.0504  420 HIS A NE2   
322  N N     . LEU A 31 ? 0.3341 0.3808 0.3125 -0.0957 -0.0885 0.0507  421 LEU A N     
323  C CA    . LEU A 31 ? 0.3829 0.4251 0.3624 -0.0981 -0.0967 0.0658  421 LEU A CA    
324  C C     . LEU A 31 ? 0.3654 0.3855 0.3347 -0.0900 -0.1001 0.0547  421 LEU A C     
325  O O     . LEU A 31 ? 0.4031 0.4031 0.3671 -0.0850 -0.1094 0.0663  421 LEU A O     
326  C CB    . LEU A 31 ? 0.3968 0.4745 0.3679 -0.0961 -0.0900 0.0772  421 LEU A CB    
327  C CG    . LEU A 31 ? 0.4055 0.4973 0.3866 -0.1036 -0.0800 0.0984  421 LEU A CG    
328  C CD1   . LEU A 31 ? 0.4209 0.5399 0.3776 -0.0924 -0.0687 0.1084  421 LEU A CD1   
329  C CD2   . LEU A 31 ? 0.4419 0.5028 0.4339 -0.1145 -0.0822 0.1182  421 LEU A CD2   
341  N N     . ARG A 32 ? 0.3444 0.3634 0.3095 -0.0888 -0.0881 0.0324  422 ARG A N     
342  C CA    . ARG A 32 ? 0.4001 0.4017 0.3648 -0.0839 -0.0833 0.0201  422 ARG A CA    
343  C C     . ARG A 32 ? 0.4208 0.3665 0.3720 -0.0730 -0.0896 0.0276  422 ARG A C     
344  O O     . ARG A 32 ? 0.4510 0.3812 0.3995 -0.0640 -0.0898 0.0279  422 ARG A O     
345  C CB    . ARG A 32 ? 0.3926 0.3930 0.3572 -0.0915 -0.0593 -0.0068 422 ARG A CB    
346  C CG    . ARG A 32 ? 0.3982 0.4493 0.3718 -0.1022 -0.0566 -0.0203 422 ARG A CG    
347  C CD    . ARG A 32 ? 0.4193 0.4697 0.4000 -0.1171 -0.0320 -0.0530 422 ARG A CD    
348  N NE    . ARG A 32 ? 0.4481 0.5464 0.4332 -0.1260 -0.0358 -0.0697 422 ARG A NE    
349  C CZ    . ARG A 32 ? 0.4915 0.5729 0.4546 -0.1334 -0.0196 -0.0828 422 ARG A CZ    
350  N NH1   . ARG A 32 ? 0.5138 0.5309 0.4464 -0.1306 0.0041  -0.0812 422 ARG A NH1   
351  N NH2   . ARG A 32 ? 0.4961 0.6208 0.4586 -0.1377 -0.0276 -0.0989 422 ARG A NH2   
365  N N     . THR A 33 ? 0.4567 0.3753 0.3983 -0.0695 -0.0966 0.0309  423 THR A N     
366  C CA    . THR A 33 ? 0.4837 0.3504 0.4082 -0.0560 -0.1100 0.0341  423 THR A CA    
367  C C     . THR A 33 ? 0.4865 0.3468 0.4164 -0.0600 -0.1276 0.0512  423 THR A C     
368  O O     . THR A 33 ? 0.5148 0.3267 0.4241 -0.0471 -0.1369 0.0529  423 THR A O     
369  C CB    . THR A 33 ? 0.5491 0.4023 0.4675 -0.0481 -0.1222 0.0277  423 THR A CB    
370  O OG1   . THR A 33 ? 0.5529 0.4476 0.5056 -0.0668 -0.1359 0.0371  423 THR A OG1   
371  C CG2   . THR A 33 ? 0.5766 0.4245 0.4734 -0.0356 -0.1022 0.0135  423 THR A CG2   
379  N N     . HIS A 34 ? 0.4296 0.3264 0.3760 -0.0737 -0.1291 0.0651  424 HIS A N     
380  C CA    . HIS A 34 ? 0.5229 0.3972 0.4598 -0.0741 -0.1378 0.0840  424 HIS A CA    
381  C C     . HIS A 34 ? 0.5380 0.4245 0.4595 -0.0568 -0.1332 0.0889  424 HIS A C     
382  O O     . HIS A 34 ? 0.5981 0.4465 0.4953 -0.0430 -0.1393 0.1006  424 HIS A O     
383  C CB    . HIS A 34 ? 0.5597 0.4527 0.5120 -0.0931 -0.1347 0.0999  424 HIS A CB    
384  C CG    . HIS A 34 ? 0.6120 0.5100 0.5944 -0.1115 -0.1406 0.0923  424 HIS A CG    
385  N ND1   . HIS A 34 ? 0.6589 0.5175 0.6461 -0.1172 -0.1581 0.0841  424 HIS A ND1   
386  C CD2   . HIS A 34 ? 0.6126 0.5578 0.6243 -0.1228 -0.1334 0.0887  424 HIS A CD2   
387  C CE1   . HIS A 34 ? 0.6606 0.5517 0.6863 -0.1319 -0.1638 0.0723  424 HIS A CE1   
388  N NE2   . HIS A 34 ? 0.6494 0.5936 0.6906 -0.1345 -0.1471 0.0770  424 HIS A NE2   
396  N N     . THR A 35 ? 0.5424 0.4835 0.4773 -0.0551 -0.1240 0.0769  425 THR A N     
397  C CA    . THR A 35 ? 0.5448 0.5214 0.4761 -0.0368 -0.1247 0.0742  425 THR A CA    
398  C C     . THR A 35 ? 0.5396 0.5221 0.4841 -0.0280 -0.1173 0.0548  425 THR A C     
399  O O     . THR A 35 ? 0.5432 0.5548 0.4891 -0.0080 -0.1208 0.0523  425 THR A O     
400  C CB    . THR A 35 ? 0.5300 0.5718 0.4728 -0.0394 -0.1225 0.0642  425 THR A CB    
401  O OG1   . THR A 35 ? 0.5082 0.5708 0.4752 -0.0575 -0.1108 0.0393  425 THR A OG1   
402  C CG2   . THR A 35 ? 0.5325 0.5674 0.4581 -0.0436 -0.1219 0.0866  425 THR A CG2   
410  N N     . GLY A 36 ? 0.5170 0.4727 0.4684 -0.0385 -0.1039 0.0412  426 GLY A N     
411  C CA    . GLY A 36 ? 0.5022 0.4602 0.4679 -0.0344 -0.0845 0.0224  426 GLY A CA    
412  C C     . GLY A 36 ? 0.4635 0.4905 0.4693 -0.0497 -0.0701 -0.0056 426 GLY A C     
413  O O     . GLY A 36 ? 0.4590 0.5006 0.4907 -0.0521 -0.0490 -0.0249 426 GLY A O     
417  N N     . GLU A 37 ? 0.4153 0.4852 0.4287 -0.0610 -0.0790 -0.0107 427 GLU A N     
418  C CA    . GLU A 37 ? 0.4068 0.5395 0.4555 -0.0777 -0.0695 -0.0436 427 GLU A CA    
419  C C     . GLU A 37 ? 0.3941 0.4879 0.4476 -0.1005 -0.0356 -0.0636 427 GLU A C     
420  O O     . GLU A 37 ? 0.3577 0.3928 0.3772 -0.1013 -0.0281 -0.0513 427 GLU A O     
421  C CB    . GLU A 37 ? 0.4271 0.5979 0.4655 -0.0782 -0.0870 -0.0415 427 GLU A CB    
422  C CG    . GLU A 37 ? 0.4553 0.7016 0.5252 -0.0868 -0.0902 -0.0780 427 GLU A CG    
423  C CD    . GLU A 37 ? 0.4727 0.7897 0.5608 -0.0610 -0.1131 -0.0869 427 GLU A CD    
424  O OE1   . GLU A 37 ? 0.4533 0.8302 0.5928 -0.0704 -0.1084 -0.1245 427 GLU A OE1   
425  O OE2   . GLU A 37 ? 0.4928 0.8046 0.5434 -0.0301 -0.1331 -0.0578 427 GLU A OE2   
432  N N     . LYS A 38 ? 0.5414 0.3418 0.3172 0.0088  0.0236  0.0367  428 LYS A N     
433  C CA    . LYS A 38 ? 0.5274 0.3798 0.3390 0.0022  0.0065  0.0363  428 LYS A CA    
434  C C     . LYS A 38 ? 0.4860 0.3765 0.3289 0.0089  -0.0138 0.0527  428 LYS A C     
435  O O     . LYS A 38 ? 0.4693 0.3870 0.3352 0.0258  -0.0169 0.0702  428 LYS A O     
436  C CB    . LYS A 38 ? 0.5738 0.4307 0.3855 0.0122  0.0186  0.0383  428 LYS A CB    
437  C CG    . LYS A 38 ? 0.6359 0.4545 0.4068 -0.0036 0.0359  0.0178  428 LYS A CG    
438  C CD    . LYS A 38 ? 0.6861 0.5047 0.4464 0.0029  0.0491  0.0179  428 LYS A CD    
439  C CE    . LYS A 38 ? 0.7978 0.5767 0.5061 -0.0215 0.0628  -0.0060 428 LYS A CE    
440  N NZ    . LYS A 38 ? 0.8840 0.6567 0.5689 -0.0185 0.0770  -0.0078 428 LYS A NZ    
454  N N     . PRO A 39 ? 0.4921 0.3855 0.3357 -0.0066 -0.0261 0.0467  429 PRO A N     
455  C CA    . PRO A 39 ? 0.4589 0.3758 0.3158 -0.0069 -0.0444 0.0589  429 PRO A CA    
456  C C     . PRO A 39 ? 0.4182 0.3762 0.3101 -0.0131 -0.0571 0.0630  429 PRO A C     
457  O O     . PRO A 39 ? 0.4297 0.4091 0.3314 -0.0186 -0.0727 0.0721  429 PRO A O     
458  C CB    . PRO A 39 ? 0.4869 0.3783 0.3206 -0.0245 -0.0451 0.0462  429 PRO A CB    
459  C CG    . PRO A 39 ? 0.5128 0.3705 0.3257 -0.0292 -0.0262 0.0324  429 PRO A CG    
460  C CD    . PRO A 39 ? 0.4976 0.3682 0.3248 -0.0254 -0.0202 0.0288  429 PRO A CD    
468  N N     . TYR A 40 ? 0.3565 0.3242 0.2627 -0.0157 -0.0517 0.0571  430 TYR A N     
469  C CA    . TYR A 40 ? 0.3673 0.3617 0.2999 -0.0236 -0.0596 0.0609  430 TYR A CA    
470  C C     . TYR A 40 ? 0.3407 0.3611 0.2933 -0.0118 -0.0543 0.0737  430 TYR A C     
471  O O     . TYR A 40 ? 0.3569 0.3709 0.3013 -0.0059 -0.0428 0.0706  430 TYR A O     
472  C CB    . TYR A 40 ? 0.3535 0.3395 0.2869 -0.0326 -0.0566 0.0500  430 TYR A CB    
473  C CG    . TYR A 40 ? 0.3750 0.3372 0.2939 -0.0419 -0.0548 0.0379  430 TYR A CG    
474  C CD1   . TYR A 40 ? 0.3776 0.3296 0.2946 -0.0531 -0.0580 0.0350  430 TYR A CD1   
475  C CD2   . TYR A 40 ? 0.3909 0.3365 0.2937 -0.0427 -0.0462 0.0278  430 TYR A CD2   
476  C CE1   . TYR A 40 ? 0.4350 0.3602 0.3341 -0.0609 -0.0503 0.0234  430 TYR A CE1   
477  C CE2   . TYR A 40 ? 0.4174 0.3433 0.3097 -0.0518 -0.0398 0.0175  430 TYR A CE2   
478  C CZ    . TYR A 40 ? 0.4344 0.3495 0.3243 -0.0589 -0.0407 0.0158  430 TYR A CZ    
479  O OH    . TYR A 40 ? 0.4763 0.3668 0.3514 -0.0674 -0.0284 0.0048  430 TYR A OH    
489  N N     . HIS A 41 ? 0.3198 0.3720 0.2975 -0.0110 -0.0624 0.0879  431 HIS A N     
490  C CA    . HIS A 41 ? 0.3569 0.4411 0.3619 0.0024  -0.0536 0.1033  431 HIS A CA    
491  C C     . HIS A 41 ? 0.3259 0.4345 0.3563 -0.0122 -0.0549 0.1077  431 HIS A C     
492  O O     . HIS A 41 ? 0.3355 0.4570 0.3782 -0.0324 -0.0689 0.1080  431 HIS A O     
493  C CB    . HIS A 41 ? 0.3276 0.4445 0.3548 0.0142  -0.0619 0.1211  431 HIS A CB    
494  C CG    . HIS A 41 ? 0.3783 0.4647 0.3772 0.0316  -0.0583 0.1221  431 HIS A CG    
495  N ND1   . HIS A 41 ? 0.4187 0.5299 0.4314 0.0483  -0.0669 0.1428  431 HIS A ND1   
496  C CD2   . HIS A 41 ? 0.4079 0.4412 0.3652 0.0336  -0.0465 0.1068  431 HIS A CD2   
497  C CE1   . HIS A 41 ? 0.4459 0.5109 0.4211 0.0624  -0.0577 0.1410  431 HIS A CE1   
498  N NE2   . HIS A 41 ? 0.4275 0.4440 0.3689 0.0511  -0.0442 0.1174  431 HIS A NE2   
506  N N     . CYS A 42 ? 0.3161 0.4254 0.3477 -0.0044 -0.0380 0.1110  432 CYS A N     
507  C CA    . CYS A 42 ? 0.3121 0.4431 0.3670 -0.0159 -0.0337 0.1198  432 CYS A CA    
508  C C     . CYS A 42 ? 0.3105 0.4939 0.4120 -0.0199 -0.0375 0.1353  432 CYS A C     
509  O O     . CYS A 42 ? 0.3091 0.5187 0.4305 0.0005  -0.0305 0.1467  432 CYS A O     
510  C CB    . CYS A 42 ? 0.3576 0.4776 0.3965 -0.0051 -0.0124 0.1224  432 CYS A CB    
511  S SG    . CYS A 42 ? 0.3550 0.4917 0.4142 -0.0197 -0.0025 0.1352  432 CYS A SG    
516  N N     . ASP A 43 ? 0.3241 0.5236 0.4447 -0.0468 -0.0470 0.1370  433 ASP A N     
517  C CA    . ASP A 43 ? 0.3792 0.6392 0.5491 -0.0604 -0.0542 0.1512  433 ASP A CA    
518  C C     . ASP A 43 ? 0.3394 0.6229 0.5385 -0.0678 -0.0335 0.1622  433 ASP A C     
519  O O     . ASP A 43 ? 0.3513 0.6893 0.5970 -0.0874 -0.0381 0.1731  433 ASP A O     
520  C CB    . ASP A 43 ? 0.5423 0.8045 0.7093 -0.0957 -0.0788 0.1430  433 ASP A CB    
521  C CG    . ASP A 43 ? 0.7253 0.9629 0.8586 -0.0919 -0.0974 0.1328  433 ASP A CG    
522  O OD1   . ASP A 43 ? 0.7780 1.0248 0.9109 -0.0638 -0.0982 0.1401  433 ASP A OD1   
523  O OD2   . ASP A 43 ? 0.8041 1.0068 0.9074 -0.1173 -0.1072 0.1176  433 ASP A OD2   
528  N N     . TRP A 44 ? 0.3433 0.5890 0.5143 -0.0561 -0.0116 0.1601  434 TRP A N     
529  C CA    . TRP A 44 ? 0.3643 0.6239 0.5530 -0.0623 0.0124  0.1718  434 TRP A CA    
530  C C     . TRP A 44 ? 0.3800 0.6993 0.6184 -0.0450 0.0287  0.1882  434 TRP A C     
531  O O     . TRP A 44 ? 0.3994 0.7177 0.6319 -0.0141 0.0364  0.1896  434 TRP A O     
532  C CB    . TRP A 44 ? 0.3566 0.5624 0.4936 -0.0495 0.0298  0.1683  434 TRP A CB    
533  C CG    . TRP A 44 ? 0.3904 0.5894 0.5261 -0.0618 0.0526  0.1797  434 TRP A CG    
534  C CD1   . TRP A 44 ? 0.4159 0.6306 0.5588 -0.0523 0.0824  0.1915  434 TRP A CD1   
535  C CD2   . TRP A 44 ? 0.4109 0.5766 0.5313 -0.0847 0.0521  0.1812  434 TRP A CD2   
536  N NE1   . TRP A 44 ? 0.4384 0.6341 0.5705 -0.0700 0.0988  0.2010  434 TRP A NE1   
537  C CE2   . TRP A 44 ? 0.4432 0.6067 0.5614 -0.0891 0.0805  0.1958  434 TRP A CE2   
538  C CE3   . TRP A 44 ? 0.4099 0.5406 0.5152 -0.1004 0.0353  0.1723  434 TRP A CE3   
539  C CZ2   . TRP A 44 ? 0.4865 0.6125 0.5870 -0.1086 0.0908  0.2035  434 TRP A CZ2   
540  C CZ3   . TRP A 44 ? 0.4431 0.5345 0.5324 -0.1175 0.0478  0.1792  434 TRP A CZ3   
541  C CH2   . TRP A 44 ? 0.4910 0.5795 0.5776 -0.1214 0.0744  0.1956  434 TRP A CH2   
552  N N     . ASP A 45 ? 0.4302 0.8004 0.7195 -0.0651 0.0373  0.2013  435 ASP A N     
553  C CA    . ASP A 45 ? 0.4420 0.8826 0.7939 -0.0477 0.0557  0.2209  435 ASP A CA    
554  C C     . ASP A 45 ? 0.4525 0.8619 0.7764 -0.0089 0.0914  0.2230  435 ASP A C     
555  O O     . ASP A 45 ? 0.4842 0.8438 0.7613 -0.0103 0.1137  0.2176  435 ASP A O     
556  C CB    . ASP A 45 ? 0.4748 0.9647 0.8783 -0.0796 0.0689  0.2330  435 ASP A CB    
557  C CG    . ASP A 45 ? 0.5100 1.0735 0.9798 -0.0640 0.0768  0.2471  435 ASP A CG    
558  O OD1   . ASP A 45 ? 0.5129 1.1077 1.0037 -0.0376 0.0616  0.2541  435 ASP A OD1   
559  O OD2   . ASP A 45 ? 0.5471 1.1313 1.0439 -0.0771 0.0986  0.2512  435 ASP A OD2   
564  N N     . GLY A 46 ? 0.3967 0.8299 0.7426 0.0254  0.0976  0.2313  436 GLY A N     
565  C CA    . GLY A 46 ? 0.4186 0.8173 0.7365 0.0609  0.1376  0.2318  436 GLY A CA    
566  C C     . GLY A 46 ? 0.4523 0.7668 0.6865 0.0732  0.1354  0.2104  436 GLY A C     
567  O O     . GLY A 46 ? 0.4821 0.7606 0.6854 0.1007  0.1680  0.2077  436 GLY A O     
571  N N     . CYS A 47 ? 0.4496 0.7309 0.6462 0.0520  0.1014  0.1945  437 CYS A N     
572  C CA    . CYS A 47 ? 0.4655 0.6775 0.5900 0.0570  0.0968  0.1742  437 CYS A CA    
573  C C     . CYS A 47 ? 0.4626 0.6698 0.5878 0.0693  0.0772  0.1703  437 CYS A C     
574  O O     . CYS A 47 ? 0.4514 0.6941 0.6108 0.0586  0.0485  0.1758  437 CYS A O     
575  C CB    . CYS A 47 ? 0.4571 0.6383 0.5443 0.0301  0.0763  0.1625  437 CYS A CB    
576  S SG    . CYS A 47 ? 0.4741 0.5886 0.4827 0.0310  0.0687  0.1404  437 CYS A SG    
581  N N     . GLY A 48 ? 0.4701 0.6270 0.5496 0.0887  0.0944  0.1600  438 GLY A N     
582  C CA    . GLY A 48 ? 0.4704 0.6103 0.5414 0.1015  0.0826  0.1573  438 GLY A CA    
583  C C     . GLY A 48 ? 0.4626 0.5408 0.4690 0.0879  0.0728  0.1328  438 GLY A C     
584  O O     . GLY A 48 ? 0.4739 0.5172 0.4557 0.0992  0.0761  0.1271  438 GLY A O     
588  N N     . TRP A 49 ? 0.4104 0.4771 0.3917 0.0639  0.0614  0.1206  439 TRP A N     
589  C CA    . TRP A 49 ? 0.4250 0.4497 0.3572 0.0493  0.0494  0.1001  439 TRP A CA    
590  C C     . TRP A 49 ? 0.3808 0.4114 0.3266 0.0404  0.0222  0.0966  439 TRP A C     
591  O O     . TRP A 49 ? 0.3320 0.3972 0.3150 0.0334  0.0043  0.1060  439 TRP A O     
592  C CB    . TRP A 49 ? 0.4746 0.4959 0.3833 0.0310  0.0430  0.0947  439 TRP A CB    
593  C CG    . TRP A 49 ? 0.5731 0.5638 0.4328 0.0331  0.0683  0.0883  439 TRP A CG    
594  C CD1   . TRP A 49 ? 0.6162 0.6124 0.4760 0.0415  0.0943  0.0988  439 TRP A CD1   
595  C CD2   . TRP A 49 ? 0.6415 0.5888 0.4391 0.0224  0.0721  0.0683  439 TRP A CD2   
596  N NE1   . TRP A 49 ? 0.6763 0.6285 0.4699 0.0379  0.1151  0.0856  439 TRP A NE1   
597  C CE2   . TRP A 49 ? 0.7079 0.6304 0.4615 0.0239  0.0999  0.0661  439 TRP A CE2   
598  C CE3   . TRP A 49 ? 0.6728 0.6005 0.4465 0.0078  0.0561  0.0511  439 TRP A CE3   
599  C CZ2   . TRP A 49 ? 0.7859 0.6619 0.4656 0.0082  0.1091  0.0455  439 TRP A CZ2   
600  C CZ3   . TRP A 49 ? 0.7426 0.6319 0.4527 -0.0086 0.0642  0.0319  439 TRP A CZ3   
601  C CH2   . TRP A 49 ? 0.7864 0.6487 0.4467 -0.0097 0.0891  0.0283  439 TRP A CH2   
612  N N     . LYS A 50 ? 0.3970 0.3892 0.3070 0.0374  0.0220  0.0815  440 LYS A N     
613  C CA    . LYS A 50 ? 0.3967 0.3834 0.3072 0.0274  0.0026  0.0750  440 LYS A CA    
614  C C     . LYS A 50 ? 0.4266 0.3870 0.3031 0.0092  -0.0009 0.0553  440 LYS A C     
615  O O     . LYS A 50 ? 0.4715 0.4111 0.3150 0.0046  0.0113  0.0454  440 LYS A O     
616  C CB    . LYS A 50 ? 0.4292 0.3990 0.3361 0.0443  0.0093  0.0815  440 LYS A CB    
617  C CG    . LYS A 50 ? 0.4451 0.4521 0.3919 0.0670  0.0137  0.1056  440 LYS A CG    
618  C CD    . LYS A 50 ? 0.5092 0.4981 0.4500 0.0908  0.0219  0.1178  440 LYS A CD    
619  C CE    . LYS A 50 ? 0.5478 0.5856 0.5379 0.1184  0.0282  0.1462  440 LYS A CE    
620  N NZ    . LYS A 50 ? 0.5948 0.6206 0.5834 0.1479  0.0336  0.1656  440 LYS A NZ    
634  N N     . PHE A 51 ? 0.4357 0.3987 0.3193 -0.0030 -0.0168 0.0492  441 PHE A N     
635  C CA    . PHE A 51 ? 0.4319 0.3890 0.3012 -0.0203 -0.0226 0.0345  441 PHE A CA    
636  C C     . PHE A 51 ? 0.4254 0.3661 0.2911 -0.0282 -0.0248 0.0256  441 PHE A C     
637  O O     . PHE A 51 ? 0.4013 0.3397 0.2763 -0.0228 -0.0284 0.0320  441 PHE A O     
638  C CB    . PHE A 51 ? 0.3922 0.3803 0.2847 -0.0254 -0.0364 0.0408  441 PHE A CB    
639  C CG    . PHE A 51 ? 0.3728 0.3724 0.2624 -0.0197 -0.0324 0.0510  441 PHE A CG    
640  C CD1   . PHE A 51 ? 0.3550 0.3689 0.2682 -0.0111 -0.0296 0.0654  441 PHE A CD1   
641  C CD2   . PHE A 51 ? 0.4284 0.4255 0.2880 -0.0266 -0.0308 0.0460  441 PHE A CD2   
642  C CE1   . PHE A 51 ? 0.3939 0.4162 0.3031 -0.0071 -0.0208 0.0753  441 PHE A CE1   
643  C CE2   . PHE A 51 ? 0.4386 0.4403 0.2857 -0.0222 -0.0241 0.0557  441 PHE A CE2   
644  C CZ    . PHE A 51 ? 0.4229 0.4356 0.2960 -0.0111 -0.0168 0.0707  441 PHE A CZ    
654  N N     . ALA A 52 ? 0.4290 0.3611 0.2796 -0.0444 -0.0229 0.0108  442 ALA A N     
655  C CA    . ALA A 52 ? 0.4555 0.3717 0.3027 -0.0551 -0.0197 0.0013  442 ALA A CA    
656  C C     . ALA A 52 ? 0.3975 0.3402 0.2775 -0.0588 -0.0298 0.0032  442 ALA A C     
657  O O     . ALA A 52 ? 0.4055 0.3326 0.2833 -0.0640 -0.0241 -0.0019 442 ALA A O     
658  C CB    . ALA A 52 ? 0.5232 0.4230 0.3450 -0.0761 -0.0107 -0.0163 442 ALA A CB    
664  N N     . ARG A 53 ? 0.3359 0.3112 0.2417 -0.0548 -0.0404 0.0113  443 ARG A N     
665  C CA    . ARG A 53 ? 0.3131 0.3054 0.2493 -0.0536 -0.0437 0.0149  443 ARG A CA    
666  C C     . ARG A 53 ? 0.3257 0.3225 0.2749 -0.0431 -0.0488 0.0283  443 ARG A C     
667  O O     . ARG A 53 ? 0.3319 0.3388 0.2786 -0.0376 -0.0531 0.0373  443 ARG A O     
668  C CB    . ARG A 53 ? 0.3137 0.3425 0.2734 -0.0590 -0.0492 0.0146  443 ARG A CB    
669  C CG    . ARG A 53 ? 0.3190 0.3498 0.2746 -0.0770 -0.0430 -0.0004 443 ARG A CG    
670  C CD    . ARG A 53 ? 0.3618 0.4441 0.3420 -0.0874 -0.0548 0.0008  443 ARG A CD    
671  N NE    . ARG A 53 ? 0.3297 0.4516 0.3536 -0.0701 -0.0630 0.0190  443 ARG A NE    
672  C CZ    . ARG A 53 ? 0.3142 0.4890 0.3818 -0.0711 -0.0687 0.0254  443 ARG A CZ    
673  N NH1   . ARG A 53 ? 0.2992 0.5025 0.4050 -0.0479 -0.0726 0.0467  443 ARG A NH1   
674  N NH2   . ARG A 53 ? 0.2840 0.4846 0.3602 -0.0951 -0.0688 0.0123  443 ARG A NH2   
688  N N     . SER A 54 ? 0.3247 0.3091 0.2835 -0.0432 -0.0446 0.0284  444 SER A N     
689  C CA    . SER A 54 ? 0.3334 0.3134 0.3002 -0.0401 -0.0462 0.0381  444 SER A CA    
690  C C     . SER A 54 ? 0.3140 0.3139 0.2993 -0.0305 -0.0487 0.0515  444 SER A C     
691  O O     . SER A 54 ? 0.3072 0.3080 0.2923 -0.0287 -0.0506 0.0621  444 SER A O     
692  C CB    . SER A 54 ? 0.3647 0.3165 0.3287 -0.0461 -0.0365 0.0315  444 SER A CB    
693  O OG    . SER A 54 ? 0.3556 0.3102 0.3395 -0.0392 -0.0250 0.0300  444 SER A OG    
699  N N     . ASP A 55 ? 0.3181 0.3377 0.3210 -0.0246 -0.0487 0.0537  445 ASP A N     
700  C CA    . ASP A 55 ? 0.3180 0.3596 0.3375 -0.0120 -0.0537 0.0718  445 ASP A CA    
701  C C     . ASP A 55 ? 0.3362 0.3966 0.3365 -0.0140 -0.0655 0.0776  445 ASP A C     
702  O O     . ASP A 55 ? 0.3521 0.4195 0.3513 -0.0053 -0.0689 0.0950  445 ASP A O     
703  C CB    . ASP A 55 ? 0.3042 0.3758 0.3553 -0.0034 -0.0537 0.0765  445 ASP A CB    
704  C CG    . ASP A 55 ? 0.3722 0.4647 0.4235 -0.0180 -0.0573 0.0601  445 ASP A CG    
705  O OD1   . ASP A 55 ? 0.3911 0.4593 0.4365 -0.0264 -0.0448 0.0447  445 ASP A OD1   
706  O OD2   . ASP A 55 ? 0.3880 0.5181 0.4404 -0.0242 -0.0719 0.0624  445 ASP A OD2   
711  N N     . GLU A 56 ? 0.3377 0.3980 0.3162 -0.0252 -0.0678 0.0635  446 GLU A N     
712  C CA    . GLU A 56 ? 0.3262 0.3890 0.2761 -0.0281 -0.0708 0.0652  446 GLU A CA    
713  C C     . GLU A 56 ? 0.3468 0.3935 0.2923 -0.0224 -0.0627 0.0737  446 GLU A C     
714  O O     . GLU A 56 ? 0.3625 0.4136 0.2947 -0.0192 -0.0616 0.0847  446 GLU A O     
715  C CB    . GLU A 56 ? 0.3203 0.3718 0.2439 -0.0406 -0.0673 0.0466  446 GLU A CB    
716  C CG    . GLU A 56 ? 0.3578 0.4330 0.2814 -0.0546 -0.0765 0.0380  446 GLU A CG    
717  C CD    . GLU A 56 ? 0.4185 0.4697 0.3128 -0.0722 -0.0677 0.0167  446 GLU A CD    
718  O OE1   . GLU A 56 ? 0.4452 0.5142 0.3279 -0.0921 -0.0752 0.0071  446 GLU A OE1   
719  O OE2   . GLU A 56 ? 0.4255 0.4403 0.3077 -0.0675 -0.0535 0.0109  446 GLU A OE2   
726  N N     . LEU A 57 ? 0.3252 0.3569 0.2816 -0.0236 -0.0573 0.0697  447 LEU A N     
727  C CA    . LEU A 57 ? 0.3059 0.3353 0.2687 -0.0230 -0.0522 0.0790  447 LEU A CA    
728  C C     . LEU A 57 ? 0.3233 0.3500 0.2975 -0.0217 -0.0502 0.0932  447 LEU A C     
729  O O     . LEU A 57 ? 0.3181 0.3476 0.2921 -0.0221 -0.0441 0.1046  447 LEU A O     
730  C CB    . LEU A 57 ? 0.3022 0.3243 0.2728 -0.0291 -0.0529 0.0729  447 LEU A CB    
731  C CG    . LEU A 57 ? 0.3260 0.3589 0.3125 -0.0349 -0.0519 0.0825  447 LEU A CG    
732  C CD1   . LEU A 57 ? 0.3500 0.4018 0.3392 -0.0263 -0.0436 0.0922  447 LEU A CD1   
733  C CD2   . LEU A 57 ? 0.3390 0.3730 0.3290 -0.0441 -0.0598 0.0778  447 LEU A CD2   
745  N N     . THR A 58 ? 0.3384 0.3559 0.3228 -0.0189 -0.0510 0.0939  448 THR A N     
746  C CA    . THR A 58 ? 0.3519 0.3557 0.3433 -0.0133 -0.0444 0.1099  448 THR A CA    
747  C C     . THR A 58 ? 0.3652 0.3844 0.3445 -0.0034 -0.0479 0.1275  448 THR A C     
748  O O     . THR A 58 ? 0.3826 0.3891 0.3561 -0.0028 -0.0395 0.1426  448 THR A O     
749  C CB    . THR A 58 ? 0.3831 0.3725 0.3891 -0.0054 -0.0393 0.1090  448 THR A CB    
750  O OG1   . THR A 58 ? 0.3759 0.3406 0.3799 -0.0188 -0.0329 0.0918  448 THR A OG1   
751  C CG2   . THR A 58 ? 0.4345 0.4018 0.4459 0.0072  -0.0281 0.1296  448 THR A CG2   
759  N N     . ARG A 59 ? 0.3121 0.3570 0.2820 0.0004  -0.0600 0.1252  449 ARG A N     
760  C CA    . ARG A 59 ? 0.3490 0.4088 0.2946 0.0050  -0.0667 0.1402  449 ARG A CA    
761  C C     . ARG A 59 ? 0.3662 0.4156 0.2870 -0.0017 -0.0556 0.1399  449 ARG A C     
762  O O     . ARG A 59 ? 0.3675 0.4104 0.2705 0.0019  -0.0498 0.1577  449 ARG A O     
763  C CB    . ARG A 59 ? 0.3264 0.4167 0.2612 0.0006  -0.0836 0.1320  449 ARG A CB    
764  C CG    . ARG A 59 ? 0.3569 0.4754 0.3233 0.0104  -0.0955 0.1409  449 ARG A CG    
765  C CD    . ARG A 59 ? 0.3178 0.4717 0.2784 -0.0041 -0.1117 0.1269  449 ARG A CD    
766  N NE    . ARG A 59 ? 0.3213 0.5221 0.3176 0.0053  -0.1270 0.1419  449 ARG A NE    
767  C CZ    . ARG A 59 ? 0.3278 0.5738 0.3279 -0.0099 -0.1450 0.1344  449 ARG A CZ    
768  N NH1   . ARG A 59 ? 0.3341 0.6253 0.3777 0.0017  -0.1542 0.1479  449 ARG A NH1   
769  N NH2   . ARG A 59 ? 0.3375 0.5749 0.2978 -0.0372 -0.1474 0.1099  449 ARG A NH2   
783  N N     . HIS A 60 ? 0.3612 0.4081 0.2816 -0.0093 -0.0495 0.1223  450 HIS A N     
784  C CA    . HIS A 60 ? 0.3942 0.4368 0.3032 -0.0112 -0.0339 0.1236  450 HIS A CA    
785  C C     . HIS A 60 ? 0.3915 0.4289 0.3223 -0.0137 -0.0225 0.1378  450 HIS A C     
786  O O     . HIS A 60 ? 0.4246 0.4597 0.3421 -0.0138 -0.0090 0.1501  450 HIS A O     
787  C CB    . HIS A 60 ? 0.4212 0.4638 0.3356 -0.0126 -0.0291 0.1069  450 HIS A CB    
788  C CG    . HIS A 60 ? 0.4893 0.5342 0.4040 -0.0085 -0.0097 0.1106  450 HIS A CG    
789  N ND1   . HIS A 60 ? 0.5445 0.5787 0.4221 -0.0050 0.0056  0.1090  450 HIS A ND1   
790  C CD2   . HIS A 60 ? 0.4932 0.5536 0.4429 -0.0076 -0.0018 0.1164  450 HIS A CD2   
791  C CE1   . HIS A 60 ? 0.5616 0.6029 0.4557 0.0025  0.0268  0.1147  450 HIS A CE1   
792  N NE2   . HIS A 60 ? 0.5452 0.6092 0.4880 0.0010  0.0202  0.1208  450 HIS A NE2   
800  N N     . TYR A 61 ? 0.3812 0.4127 0.3405 -0.0197 -0.0253 0.1349  451 TYR A N     
801  C CA    . TYR A 61 ? 0.4096 0.4326 0.3857 -0.0305 -0.0139 0.1450  451 TYR A CA    
802  C C     . TYR A 61 ? 0.4478 0.4503 0.4064 -0.0257 -0.0050 0.1652  451 TYR A C     
803  O O     . TYR A 61 ? 0.4368 0.4315 0.3990 -0.0356 0.0108  0.1763  451 TYR A O     
804  C CB    . TYR A 61 ? 0.4522 0.4608 0.4473 -0.0429 -0.0182 0.1357  451 TYR A CB    
805  C CG    . TYR A 61 ? 0.4563 0.4868 0.4712 -0.0562 -0.0236 0.1246  451 TYR A CG    
806  C CD1   . TYR A 61 ? 0.4664 0.5268 0.5012 -0.0635 -0.0169 0.1318  451 TYR A CD1   
807  C CD2   . TYR A 61 ? 0.4404 0.4654 0.4553 -0.0603 -0.0351 0.1099  451 TYR A CD2   
808  C CE1   . TYR A 61 ? 0.4531 0.5452 0.5126 -0.0724 -0.0257 0.1274  451 TYR A CE1   
809  C CE2   . TYR A 61 ? 0.4422 0.4899 0.4704 -0.0709 -0.0440 0.1043  451 TYR A CE2   
810  C CZ    . TYR A 61 ? 0.4393 0.5243 0.4923 -0.0758 -0.0414 0.1145  451 TYR A CZ    
811  O OH    . TYR A 61 ? 0.4112 0.5297 0.4837 -0.0832 -0.0540 0.1143  451 TYR A OH    
821  N N     . ARG A 62 ? 0.4954 0.4918 0.4371 -0.0110 -0.0146 0.1730  452 ARG A N     
822  C CA    . ARG A 62 ? 0.5808 0.5578 0.5025 -0.0018 -0.0076 0.1982  452 ARG A CA    
823  C C     . ARG A 62 ? 0.6160 0.6014 0.5023 -0.0012 -0.0018 0.2083  452 ARG A C     
824  O O     . ARG A 62 ? 0.6405 0.6048 0.5059 0.0012  0.0107  0.2305  452 ARG A O     
825  C CB    . ARG A 62 ? 0.6170 0.5945 0.5396 0.0174  -0.0215 0.2089  452 ARG A CB    
826  C CG    . ARG A 62 ? 0.6313 0.5813 0.5823 0.0185  -0.0136 0.2037  452 ARG A CG    
827  C CD    . ARG A 62 ? 0.6708 0.6208 0.6349 0.0428  -0.0191 0.2177  452 ARG A CD    
828  N NE    . ARG A 62 ? 0.7122 0.6246 0.6960 0.0405  -0.0029 0.2068  452 ARG A NE    
829  C CZ    . ARG A 62 ? 0.7335 0.6474 0.7401 0.0564  -0.0018 0.2048  452 ARG A CZ    
830  N NH1   . ARG A 62 ? 0.7501 0.6176 0.7622 0.0501  0.0187  0.1916  452 ARG A NH1   
831  N NH2   . ARG A 62 ? 0.7296 0.6918 0.7525 0.0756  -0.0198 0.2152  452 ARG A NH2   
845  N N     . LYS A 63 ? 0.6283 0.6353 0.5017 -0.0042 -0.0057 0.1925  453 LYS A N     
846  C CA    . LYS A 63 ? 0.6787 0.6840 0.5163 -0.0067 0.0101  0.1977  453 LYS A CA    
847  C C     . LYS A 63 ? 0.7008 0.7015 0.5615 -0.0163 0.0363  0.2038  453 LYS A C     
848  O O     . LYS A 63 ? 0.7273 0.7147 0.5619 -0.0182 0.0557  0.2198  453 LYS A O     
849  C CB    . LYS A 63 ? 0.6835 0.7007 0.5026 -0.0082 0.0086  0.1763  453 LYS A CB    
850  C CG    . LYS A 63 ? 0.7223 0.7444 0.5006 -0.0078 -0.0129 0.1710  453 LYS A CG    
851  C CD    . LYS A 63 ? 0.7327 0.7550 0.4972 -0.0139 -0.0113 0.1446  453 LYS A CD    
852  C CE    . LYS A 63 ? 0.8095 0.8144 0.5043 -0.0215 -0.0012 0.1382  453 LYS A CE    
853  N NZ    . LYS A 63 ? 0.8072 0.7992 0.4823 -0.0292 0.0034  0.1108  453 LYS A NZ    
867  N N     . HIS A 64 ? 0.5297 0.5441 0.4386 -0.0251 0.0368  0.1923  454 HIS A N     
868  C CA    . HIS A 64 ? 0.5517 0.5767 0.4932 -0.0397 0.0575  0.1977  454 HIS A CA    
869  C C     . HIS A 64 ? 0.5414 0.5359 0.4824 -0.0515 0.0677  0.2141  454 HIS A C     
870  O O     . HIS A 64 ? 0.5440 0.5356 0.4873 -0.0631 0.0917  0.2267  454 HIS A O     
871  C CB    . HIS A 64 ? 0.5632 0.6184 0.5536 -0.0487 0.0482  0.1827  454 HIS A CB    
872  C CG    . HIS A 64 ? 0.5808 0.6623 0.5770 -0.0359 0.0474  0.1717  454 HIS A CG    
873  N ND1   . HIS A 64 ? 0.6060 0.7047 0.6042 -0.0285 0.0713  0.1769  454 HIS A ND1   
874  C CD2   . HIS A 64 ? 0.5662 0.6535 0.5655 -0.0282 0.0305  0.1568  454 HIS A CD2   
875  C CE1   . HIS A 64 ? 0.6012 0.7107 0.6020 -0.0144 0.0698  0.1662  454 HIS A CE1   
876  N NE2   . HIS A 64 ? 0.5761 0.6786 0.5765 -0.0151 0.0442  0.1542  454 HIS A NE2   
884  N N     . THR A 65 ? 0.6428 0.6100 0.5810 -0.0487 0.0546  0.2145  455 THR A N     
885  C CA    . THR A 65 ? 0.7200 0.6446 0.6561 -0.0596 0.0692  0.2281  455 THR A CA    
886  C C     . THR A 65 ? 0.7828 0.6713 0.6753 -0.0416 0.0768  0.2550  455 THR A C     
887  O O     . THR A 65 ? 0.8420 0.6879 0.7242 -0.0497 0.0947  0.2643  455 THR A O     
888  C CB    . THR A 65 ? 0.7319 0.6335 0.6839 -0.0642 0.0593  0.2156  455 THR A CB    
889  O OG1   . THR A 65 ? 0.7046 0.6057 0.6446 -0.0378 0.0413  0.2158  455 THR A OG1   
890  C CG2   . THR A 65 ? 0.7109 0.6449 0.6980 -0.0856 0.0495  0.1919  455 THR A CG2   
898  N N     . GLY A 66 ? 0.7740 0.6777 0.6373 -0.0197 0.0596  0.2581  456 GLY A N     
899  C CA    . GLY A 66 ? 0.8329 0.7103 0.6583 -0.0017 0.0545  0.2734  456 GLY A CA    
900  C C     . GLY A 66 ? 0.8411 0.6882 0.6789 0.0118  0.0503  0.2809  456 GLY A C     
901  O O     . GLY A 66 ? 0.8859 0.7102 0.7002 0.0275  0.0489  0.2984  456 GLY A O     
905  N N     . HIS A 67 ? 0.8627 0.7074 0.7358 0.0065  0.0499  0.2689  457 HIS A N     
906  C CA    . HIS A 67 ? 0.8932 0.7013 0.7779 0.0193  0.0539  0.2725  457 HIS A CA    
907  C C     . HIS A 67 ? 0.9076 0.7399 0.7916 0.0515  0.0323  0.2829  457 HIS A C     
908  O O     . HIS A 67 ? 0.8653 0.7474 0.7558 0.0563  0.0095  0.2749  457 HIS A O     
909  C CB    . HIS A 67 ? 0.8773 0.6803 0.7931 0.0030  0.0573  0.2531  457 HIS A CB    
910  C CG    . HIS A 67 ? 0.9242 0.6763 0.8463 0.0104  0.0710  0.2501  457 HIS A CG    
911  N ND1   . HIS A 67 ? 0.9989 0.6983 0.9042 0.0165  0.0903  0.2612  457 HIS A ND1   
912  C CD2   . HIS A 67 ? 0.9075 0.6491 0.8482 0.0115  0.0717  0.2354  457 HIS A CD2   
913  C CE1   . HIS A 67 ? 1.0189 0.6788 0.9327 0.0232  0.1033  0.2526  457 HIS A CE1   
914  N NE2   . HIS A 67 ? 0.9654 0.6485 0.8987 0.0196  0.0931  0.2359  457 HIS A NE2   
922  N N     . ARG A 68 ? 0.6152 0.7649 1.2478 -0.0080 0.0132  0.2975  458 ARG A N     
923  C CA    . ARG A 68 ? 0.6129 0.7227 1.1458 0.0111  0.0254  0.2501  458 ARG A CA    
924  C C     . ARG A 68 ? 0.5889 0.6592 1.1066 -0.0198 -0.0182 0.2078  458 ARG A C     
925  O O     . ARG A 68 ? 0.5908 0.6420 1.1302 -0.0233 -0.0210 0.2158  458 ARG A O     
926  C CB    . ARG A 68 ? 0.6668 0.7797 1.1947 0.0466  0.0707  0.2824  458 ARG A CB    
927  C CG    . ARG A 68 ? 0.7052 0.8514 1.2444 0.0858  0.1194  0.3307  458 ARG A CG    
928  C CD    . ARG A 68 ? 0.7272 0.8510 1.1615 0.1146  0.1364  0.2961  458 ARG A CD    
929  N NE    . ARG A 68 ? 0.7791 0.9151 1.1977 0.1643  0.1890  0.3383  458 ARG A NE    
930  C CZ    . ARG A 68 ? 0.8123 0.9366 1.1951 0.2020  0.2271  0.3594  458 ARG A CZ    
931  N NH1   . ARG A 68 ? 0.8053 0.9100 1.1732 0.1922  0.2167  0.3438  458 ARG A NH1   
932  N NH2   . ARG A 68 ? 0.8628 0.9924 1.2115 0.2455  0.2752  0.3912  458 ARG A NH2   
946  N N     . PRO A 69 ? 0.5776 0.6311 1.0529 -0.0390 -0.0513 0.1630  459 PRO A N     
947  C CA    . PRO A 69 ? 0.5891 0.5995 1.0460 -0.0637 -0.0929 0.1252  459 PRO A CA    
948  C C     . PRO A 69 ? 0.5527 0.5314 0.9472 -0.0455 -0.0810 0.0937  459 PRO A C     
949  O O     . PRO A 69 ? 0.5925 0.5300 0.9782 -0.0579 -0.1078 0.0712  459 PRO A O     
950  C CB    . PRO A 69 ? 0.6049 0.6121 1.0189 -0.0782 -0.1206 0.0893  459 PRO A CB    
951  C CG    . PRO A 69 ? 0.5886 0.6402 1.0250 -0.0697 -0.1007 0.1174  459 PRO A CG    
952  C CD    . PRO A 69 ? 0.5728 0.6425 1.0117 -0.0359 -0.0512 0.1474  459 PRO A CD    
960  N N     . PHE A 70 ? 0.5209 0.5124 0.8689 -0.0159 -0.0444 0.0921  460 PHE A N     
961  C CA    . PHE A 70 ? 0.5124 0.4821 0.7974 0.0004  -0.0369 0.0615  460 PHE A CA    
962  C C     . PHE A 70 ? 0.4856 0.4533 0.7899 0.0199  -0.0100 0.0914  460 PHE A C     
963  O O     . PHE A 70 ? 0.4742 0.4570 0.7534 0.0449  0.0213  0.1080  460 PHE A O     
964  C CB    . PHE A 70 ? 0.5096 0.4921 0.7257 0.0142  -0.0258 0.0380  460 PHE A CB    
965  C CG    . PHE A 70 ? 0.5403 0.5275 0.7371 -0.0036 -0.0501 0.0120  460 PHE A CG    
966  C CD1   . PHE A 70 ? 0.5802 0.5515 0.7375 -0.0092 -0.0696 -0.0241 460 PHE A CD1   
967  C CD2   . PHE A 70 ? 0.5443 0.5526 0.7620 -0.0109 -0.0509 0.0273  460 PHE A CD2   
968  C CE1   . PHE A 70 ? 0.6019 0.5786 0.7370 -0.0225 -0.0895 -0.0446 460 PHE A CE1   
969  C CE2   . PHE A 70 ? 0.5507 0.5640 0.7504 -0.0269 -0.0738 0.0063  460 PHE A CE2   
970  C CZ    . PHE A 70 ? 0.5803 0.5779 0.7371 -0.0333 -0.0932 -0.0296 460 PHE A CZ    
980  N N     . GLN A 71 ? 0.5385 0.4804 0.8807 0.0095  -0.0245 0.0980  461 GLN A N     
981  C CA    . GLN A 71 ? 0.5737 0.5125 0.9421 0.0255  -0.0016 0.1306  461 GLN A CA    
982  C C     . GLN A 71 ? 0.5620 0.4812 0.8680 0.0459  0.0062  0.1031  461 GLN A C     
983  O O     . GLN A 71 ? 0.5532 0.4436 0.8324 0.0396  -0.0161 0.0673  461 GLN A O     
984  C CB    . GLN A 71 ? 0.6234 0.5402 1.0705 0.0012  -0.0251 0.1562  461 GLN A CB    
985  C CG    . GLN A 71 ? 0.6864 0.5960 1.1665 0.0150  -0.0049 0.1920  461 GLN A CG    
986  C CD    . GLN A 71 ? 0.6995 0.6559 1.2208 0.0342  0.0361  0.2502  461 GLN A CD    
987  O OE1   . GLN A 71 ? 0.6930 0.6817 1.2750 0.0228  0.0373  0.2849  461 GLN A OE1   
988  N NE2   . GLN A 71 ? 0.7038 0.6644 1.1901 0.0668  0.0709  0.2642  461 GLN A NE2   
997  N N     . CYS A 72 ? 0.5019 0.4360 0.7823 0.0730  0.0379  0.1222  462 CYS A N     
998  C CA    . CYS A 72 ? 0.5129 0.4330 0.7487 0.0914  0.0436  0.1074  462 CYS A CA    
999  C C     . CYS A 72 ? 0.5165 0.4069 0.7954 0.0875  0.0355  0.1190  462 CYS A C     
1000 O O     . CYS A 72 ? 0.5255 0.4166 0.8640 0.0842  0.0445  0.1603  462 CYS A O     
1001 C CB    . CYS A 72 ? 0.5417 0.4768 0.7377 0.1202  0.0738  0.1291  462 CYS A CB    
1002 S SG    . CYS A 72 ? 0.5626 0.4855 0.7163 0.1411  0.0769  0.1212  462 CYS A SG    
1007 N N     . GLN A 73 ? 0.5186 0.3823 0.7687 0.0900  0.0199  0.0864  463 GLN A N     
1008 C CA    . GLN A 73 ? 0.5600 0.3817 0.8398 0.0894  0.0095  0.0918  463 GLN A CA    
1009 C C     . GLN A 73 ? 0.5711 0.3960 0.8445 0.1156  0.0331  0.1153  463 GLN A C     
1010 O O     . GLN A 73 ? 0.6088 0.3965 0.9030 0.1189  0.0264  0.1206  463 GLN A O     
1011 C CB    . GLN A 73 ? 0.5881 0.3705 0.8326 0.0875  -0.0156 0.0461  463 GLN A CB    
1012 C CG    . GLN A 73 ? 0.6487 0.4204 0.8871 0.0635  -0.0429 0.0194  463 GLN A CG    
1013 C CD    . GLN A 73 ? 0.6636 0.4082 0.9663 0.0328  -0.0683 0.0405  463 GLN A CD    
1014 O OE1   . GLN A 73 ? 0.7060 0.3945 1.0307 0.0246  -0.0901 0.0417  463 GLN A OE1   
1015 N NE2   . GLN A 73 ? 0.5819 0.3650 0.9178 0.0153  -0.0680 0.0600  463 GLN A NE2   
1024 N N     . LYS A 74 ? 0.6518 0.5130 0.8914 0.1347  0.0575  0.1293  464 LYS A N     
1025 C CA    . LYS A 74 ? 0.6974 0.5622 0.9250 0.1599  0.0778  0.1550  464 LYS A CA    
1026 C C     . LYS A 74 ? 0.7117 0.5959 0.9552 0.1714  0.1057  0.2021  464 LYS A C     
1027 O O     . LYS A 74 ? 0.7562 0.6425 0.9843 0.1945  0.1242  0.2279  464 LYS A O     
1028 C CB    . LYS A 74 ? 0.7076 0.5908 0.8686 0.1775  0.0784  0.1334  464 LYS A CB    
1029 C CG    . LYS A 74 ? 0.7289 0.5989 0.8795 0.1814  0.0629  0.1038  464 LYS A CG    
1030 C CD    . LYS A 74 ? 0.7426 0.6331 0.8576 0.2046  0.0685  0.1093  464 LYS A CD    
1031 C CE    . LYS A 74 ? 0.7722 0.6465 0.9084 0.2229  0.0814  0.1417  464 LYS A CE    
1032 N NZ    . LYS A 74 ? 0.7572 0.6554 0.8589 0.2448  0.0845  0.1539  464 LYS A NZ    
1046 N N     . CYS A 75 ? 0.5897 0.4894 0.8619 0.1597  0.1113  0.2171  465 CYS A N     
1047 C CA    . CYS A 75 ? 0.5863 0.5075 0.8776 0.1768  0.1442  0.2681  465 CYS A CA    
1048 C C     . CYS A 75 ? 0.5686 0.5074 0.9226 0.1558  0.1418  0.2859  465 CYS A C     
1049 O O     . CYS A 75 ? 0.5449 0.4732 0.9239 0.1260  0.1104  0.2576  465 CYS A O     
1050 C CB    . CYS A 75 ? 0.5822 0.5132 0.7855 0.2080  0.1656  0.2656  465 CYS A CB    
1051 S SG    . CYS A 75 ? 0.5607 0.5018 0.7148 0.2040  0.1613  0.2366  465 CYS A SG    
1056 N N     . ASP A 76 ? 0.6411 0.6079 1.0188 0.1743  0.1759  0.3362  466 ASP A N     
1057 C CA    . ASP A 76 ? 0.6586 0.6529 1.1155 0.1569  0.1775  0.3690  466 ASP A CA    
1058 C C     . ASP A 76 ? 0.6533 0.6606 1.0724 0.1559  0.1748  0.3422  466 ASP A C     
1059 O O     . ASP A 76 ? 0.6422 0.6721 1.1278 0.1358  0.1666  0.3610  466 ASP A O     
1060 C CB    . ASP A 76 ? 0.6887 0.7283 1.1850 0.1750  0.2187  0.4264  466 ASP A CB    
1061 C CG    . ASP A 76 ? 0.7393 0.7811 1.2951 0.1637  0.2157  0.4526  466 ASP A CG    
1062 O OD1   . ASP A 76 ? 0.7512 0.7481 1.2950 0.1515  0.1878  0.4262  466 ASP A OD1   
1063 O OD2   . ASP A 76 ? 0.7657 0.8559 1.3825 0.1706  0.2421  0.5003  466 ASP A OD2   
1068 N N     . ARG A 77 ? 0.6207 0.6139 0.9396 0.1749  0.1780  0.3022  467 ARG A N     
1069 C CA    . ARG A 77 ? 0.6272 0.6281 0.9048 0.1797  0.1804  0.2841  467 ARG A CA    
1070 C C     . ARG A 77 ? 0.5571 0.5581 0.8632 0.1406  0.1409  0.2478  467 ARG A C     
1071 O O     . ARG A 77 ? 0.5172 0.4985 0.8205 0.1185  0.1098  0.2125  467 ARG A O     
1072 C CB    . ARG A 77 ? 0.7000 0.6762 0.8625 0.2053  0.1855  0.2518  467 ARG A CB    
1073 C CG    . ARG A 77 ? 0.8003 0.7674 0.9123 0.2490  0.2230  0.2853  467 ARG A CG    
1074 C CD    . ARG A 77 ? 0.8950 0.8296 0.8866 0.2755  0.2253  0.2586  467 ARG A CD    
1075 N NE    . ARG A 77 ? 0.9602 0.8935 0.9339 0.2778  0.2281  0.2495  467 ARG A NE    
1076 C CZ    . ARG A 77 ? 1.0521 0.9483 0.9242 0.2995  0.2280  0.2279  467 ARG A CZ    
1077 N NH1   . ARG A 77 ? 1.0515 0.9451 0.9157 0.3015  0.2309  0.2221  467 ARG A NH1   
1078 N NH2   . ARG A 77 ? 1.1353 0.9924 0.9125 0.3184  0.2213  0.2133  467 ARG A NH2   
1092 N N     . ALA A 78 ? 0.5522 0.5747 0.8826 0.1361  0.1440  0.2589  468 ALA A N     
1093 C CA    . ALA A 78 ? 0.5155 0.5394 0.8628 0.1026  0.1080  0.2270  468 ALA A CA    
1094 C C     . ALA A 78 ? 0.5241 0.5524 0.8147 0.1155  0.1159  0.2106  468 ALA A C     
1095 O O     . ALA A 78 ? 0.5556 0.5862 0.8107 0.1501  0.1505  0.2329  468 ALA A O     
1096 C CB    . ALA A 78 ? 0.4873 0.5334 0.9421 0.0739  0.0916  0.2621  468 ALA A CB    
1102 N N     . PHE A 79 ? 0.4851 0.5095 0.7631 0.0895  0.0835  0.1722  469 PHE A N     
1103 C CA    . PHE A 79 ? 0.4954 0.5162 0.7127 0.0972  0.0838  0.1497  469 PHE A CA    
1104 C C     . PHE A 79 ? 0.4722 0.5096 0.7288 0.0684  0.0571  0.1410  469 PHE A C     
1105 O O     . PHE A 79 ? 0.4551 0.4950 0.7607 0.0390  0.0283  0.1351  469 PHE A O     
1106 C CB    . PHE A 79 ? 0.4927 0.4885 0.6266 0.0990  0.0707  0.1064  469 PHE A CB    
1107 C CG    . PHE A 79 ? 0.5060 0.4845 0.5982 0.1248  0.0898  0.1141  469 PHE A CG    
1108 C CD1   . PHE A 79 ? 0.5076 0.4839 0.6267 0.1200  0.0857  0.1166  469 PHE A CD1   
1109 C CD2   . PHE A 79 ? 0.5354 0.4929 0.5553 0.1552  0.1093  0.1189  469 PHE A CD2   
1110 C CE1   . PHE A 79 ? 0.5467 0.5095 0.6288 0.1441  0.1023  0.1271  469 PHE A CE1   
1111 C CE2   . PHE A 79 ? 0.5856 0.5238 0.5597 0.1789  0.1228  0.1265  469 PHE A CE2   
1112 C CZ    . PHE A 79 ? 0.5855 0.5311 0.5947 0.1728  0.1200  0.1323  469 PHE A CZ    
1122 N N     . SER A 80 ? 0.5138 0.5553 0.7411 0.0785  0.0646  0.1397  470 SER A N     
1123 C CA    . SER A 80 ? 0.5077 0.5664 0.7660 0.0544  0.0406  0.1340  470 SER A CA    
1124 C C     . SER A 80 ? 0.4812 0.5258 0.6871 0.0339  0.0098  0.0855  470 SER A C     
1125 O O     . SER A 80 ? 0.4589 0.5150 0.6873 0.0103  -0.0159 0.0766  470 SER A O     
1126 C CB    . SER A 80 ? 0.5215 0.5914 0.7768 0.0779  0.0651  0.1597  470 SER A CB    
1127 O OG    . SER A 80 ? 0.5454 0.5824 0.7074 0.0978  0.0730  0.1334  470 SER A OG    
1133 N N     . ARG A 81 ? 0.4577 0.4812 0.5966 0.0432  0.0115  0.0588  471 ARG A N     
1134 C CA    . ARG A 81 ? 0.4358 0.4547 0.5286 0.0282  -0.0119 0.0220  471 ARG A CA    
1135 C C     . ARG A 81 ? 0.4505 0.4597 0.5185 0.0298  -0.0161 0.0034  471 ARG A C     
1136 O O     . ARG A 81 ? 0.4763 0.4747 0.5337 0.0480  0.0013  0.0148  471 ARG A O     
1137 C CB    . ARG A 81 ? 0.4523 0.4595 0.4876 0.0386  -0.0078 0.0156  471 ARG A CB    
1138 C CG    . ARG A 81 ? 0.4518 0.4656 0.5052 0.0410  -0.0030 0.0326  471 ARG A CG    
1139 C CD    . ARG A 81 ? 0.4792 0.4621 0.4705 0.0648  0.0110  0.0350  471 ARG A CD    
1140 N NE    . ARG A 81 ? 0.4658 0.4246 0.3906 0.0595  -0.0058 0.0089  471 ARG A NE    
1141 C CZ    . ARG A 81 ? 0.4660 0.3890 0.3300 0.0679  -0.0109 0.0028  471 ARG A CZ    
1142 N NH1   . ARG A 81 ? 0.4693 0.3728 0.3231 0.0869  0.0036  0.0172  471 ARG A NH1   
1143 N NH2   . ARG A 81 ? 0.4551 0.3601 0.2707 0.0571  -0.0328 -0.0153 471 ARG A NH2   
1157 N N     . SER A 82 ? 0.4523 0.4667 0.5089 0.0142  -0.0373 -0.0227 472 SER A N     
1158 C CA    . SER A 82 ? 0.4647 0.4748 0.5024 0.0191  -0.0397 -0.0380 472 SER A CA    
1159 C C     . SER A 82 ? 0.4237 0.4349 0.4161 0.0313  -0.0330 -0.0387 472 SER A C     
1160 O O     . SER A 82 ? 0.4512 0.4593 0.4358 0.0423  -0.0277 -0.0382 472 SER A O     
1161 C CB    . SER A 82 ? 0.5254 0.5416 0.5533 0.0070  -0.0591 -0.0627 472 SER A CB    
1162 O OG    . SER A 82 ? 0.5397 0.5751 0.5373 0.0008  -0.0659 -0.0705 472 SER A OG    
1168 N N     . ASP A 83 ? 0.4221 0.4338 0.3836 0.0286  -0.0372 -0.0387 473 ASP A N     
1169 C CA    . ASP A 83 ? 0.4246 0.4292 0.3408 0.0349  -0.0411 -0.0389 473 ASP A CA    
1170 C C     . ASP A 83 ? 0.4367 0.4134 0.3312 0.0570  -0.0243 -0.0236 473 ASP A C     
1171 O O     . ASP A 83 ? 0.4609 0.4304 0.3261 0.0646  -0.0282 -0.0223 473 ASP A O     
1172 C CB    . ASP A 83 ? 0.4767 0.4784 0.3622 0.0231  -0.0567 -0.0431 473 ASP A CB    
1173 C CG    . ASP A 83 ? 0.4895 0.4684 0.3687 0.0293  -0.0480 -0.0348 473 ASP A CG    
1174 O OD1   . ASP A 83 ? 0.5017 0.4861 0.4199 0.0342  -0.0336 -0.0253 473 ASP A OD1   
1175 O OD2   . ASP A 83 ? 0.5202 0.4746 0.3571 0.0293  -0.0574 -0.0354 473 ASP A OD2   
1180 N N     . HIS A 84 ? 0.4037 0.3680 0.3138 0.0693  -0.0049 -0.0077 474 HIS A N     
1181 C CA    . HIS A 84 ? 0.4378 0.3797 0.3293 0.0964  0.0182  0.0123  474 HIS A CA    
1182 C C     . HIS A 84 ? 0.4369 0.3883 0.3557 0.1004  0.0240  0.0181  474 HIS A C     
1183 O O     . HIS A 84 ? 0.4611 0.3964 0.3439 0.1178  0.0304  0.0255  474 HIS A O     
1184 C CB    . HIS A 84 ? 0.4464 0.3877 0.3679 0.1106  0.0430  0.0370  474 HIS A CB    
1185 C CG    . HIS A 84 ? 0.4686 0.3898 0.3511 0.1189  0.0447  0.0365  474 HIS A CG    
1186 N ND1   . HIS A 84 ? 0.4703 0.4005 0.3876 0.1299  0.0645  0.0595  474 HIS A ND1   
1187 C CD2   . HIS A 84 ? 0.4971 0.3869 0.3110 0.1181  0.0274  0.0185  474 HIS A CD2   
1188 C CE1   . HIS A 84 ? 0.6071 0.5095 0.4737 0.1396  0.0627  0.0533  474 HIS A CE1   
1189 N NE2   . HIS A 84 ? 0.5188 0.3921 0.3204 0.1309  0.0382  0.0271  474 HIS A NE2   
1197 N N     . LEU A 85 ? 0.4592 0.4300 0.4360 0.0852  0.0191  0.0147  475 LEU A N     
1198 C CA    . LEU A 85 ? 0.4830 0.4539 0.4849 0.0900  0.0232  0.0196  475 LEU A CA    
1199 C C     . LEU A 85 ? 0.4912 0.4668 0.4591 0.0916  0.0108  0.0039  475 LEU A C     
1200 O O     . LEU A 85 ? 0.4921 0.4611 0.4474 0.1070  0.0183  0.0148  475 LEU A O     
1201 C CB    . LEU A 85 ? 0.4785 0.4536 0.5384 0.0727  0.0135  0.0153  475 LEU A CB    
1202 C CG    . LEU A 85 ? 0.5120 0.4755 0.5942 0.0762  0.0121  0.0148  475 LEU A CG    
1203 C CD1   . LEU A 85 ? 0.5332 0.4892 0.6303 0.0947  0.0346  0.0469  475 LEU A CD1   
1204 C CD2   . LEU A 85 ? 0.5465 0.4974 0.6713 0.0573  -0.0059 0.0061  475 LEU A CD2   
1216 N N     . ALA A 86 ? 0.4948 0.4866 0.4513 0.0767  -0.0077 -0.0165 476 ALA A N     
1217 C CA    . ALA A 86 ? 0.5150 0.5237 0.4522 0.0780  -0.0188 -0.0231 476 ALA A CA    
1218 C C     . ALA A 86 ? 0.5704 0.5681 0.4643 0.0881  -0.0220 -0.0108 476 ALA A C     
1219 O O     . ALA A 86 ? 0.5682 0.5746 0.4583 0.0968  -0.0248 -0.0038 476 ALA A O     
1220 C CB    . ALA A 86 ? 0.4862 0.5196 0.4187 0.0614  -0.0350 -0.0378 476 ALA A CB    
1226 N N     . LEU A 87 ? 0.6024 0.5754 0.4578 0.0894  -0.0233 -0.0077 477 LEU A N     
1227 C CA    . LEU A 87 ? 0.6805 0.6261 0.4772 0.1014  -0.0308 0.0009  477 LEU A CA    
1228 C C     . LEU A 87 ? 0.7094 0.6402 0.5032 0.1261  -0.0093 0.0186  477 LEU A C     
1229 O O     . LEU A 87 ? 0.7397 0.6674 0.5087 0.1340  -0.0185 0.0261  477 LEU A O     
1230 C CB    . LEU A 87 ? 0.7597 0.6663 0.5029 0.1042  -0.0348 -0.0019 477 LEU A CB    
1231 C CG    . LEU A 87 ? 0.7970 0.6982 0.5096 0.0821  -0.0681 -0.0135 477 LEU A CG    
1232 C CD1   . LEU A 87 ? 0.8520 0.6928 0.4936 0.0948  -0.0702 -0.0155 477 LEU A CD1   
1233 C CD2   . LEU A 87 ? 0.8116 0.7274 0.5125 0.0697  -0.0987 -0.0098 477 LEU A CD2   
1245 N N     . HIS A 88 ? 0.6557 0.5806 0.4795 0.1376  0.0181  0.0304  478 HIS A N     
1246 C CA    . HIS A 88 ? 0.7510 0.6672 0.5828 0.1605  0.0415  0.0539  478 HIS A CA    
1247 C C     . HIS A 88 ? 0.6750 0.6112 0.5424 0.1576  0.0360  0.0546  478 HIS A C     
1248 O O     . HIS A 88 ? 0.5393 0.4676 0.3850 0.1745  0.0400  0.0694  478 HIS A O     
1249 C CB    . HIS A 88 ? 0.8551 0.7748 0.7378 0.1662  0.0686  0.0729  478 HIS A CB    
1250 C CG    . HIS A 88 ? 0.9764 0.8972 0.8930 0.1830  0.0917  0.1024  478 HIS A CG    
1251 N ND1   . HIS A 88 ? 1.0583 0.9607 0.9349 0.2145  0.1165  0.1298  478 HIS A ND1   
1252 C CD2   . HIS A 88 ? 0.9906 0.9237 0.9743 0.1738  0.0931  0.1105  478 HIS A CD2   
1253 C CE1   . HIS A 88 ? 1.0680 0.9798 0.9941 0.2223  0.1339  0.1573  478 HIS A CE1   
1254 N NE2   . HIS A 88 ? 1.0228 0.9501 1.0154 0.1963  0.1180  0.1455  478 HIS A NE2   
1262 N N     . MET A 89 ? 0.5974 0.5553 0.5135 0.1398  0.0273  0.0391  479 MET A N     
1263 C CA    . MET A 89 ? 0.5926 0.5615 0.5402 0.1434  0.0262  0.0391  479 MET A CA    
1264 C C     . MET A 89 ? 0.5880 0.5699 0.5036 0.1509  0.0131  0.0428  479 MET A C     
1265 O O     . MET A 89 ? 0.5791 0.5640 0.5093 0.1647  0.0184  0.0549  479 MET A O     
1266 C CB    . MET A 89 ? 0.5748 0.5554 0.5565 0.1282  0.0169  0.0169  479 MET A CB    
1267 C CG    . MET A 89 ? 0.6360 0.6127 0.6464 0.1378  0.0193  0.0146  479 MET A CG    
1268 S SD    . MET A 89 ? 0.6730 0.6159 0.7261 0.1461  0.0344  0.0359  479 MET A SD    
1269 C CE    . MET A 89 ? 0.6672 0.5970 0.7536 0.1227  0.0287  0.0302  479 MET A CE    
1279 N N     . LYS A 90 ? 0.6957 0.6841 0.5710 0.1408  -0.0072 0.0359  480 LYS A N     
1280 C CA    . LYS A 90 ? 0.7285 0.7311 0.5785 0.1426  -0.0279 0.0451  480 LYS A CA    
1281 C C     . LYS A 90 ? 0.7776 0.7544 0.5918 0.1634  -0.0222 0.0652  480 LYS A C     
1282 O O     . LYS A 90 ? 0.7915 0.7840 0.6053 0.1701  -0.0335 0.0789  480 LYS A O     
1283 C CB    . LYS A 90 ? 0.7659 0.7698 0.5787 0.1228  -0.0572 0.0375  480 LYS A CB    
1284 C CG    . LYS A 90 ? 0.7637 0.8074 0.6142 0.1033  -0.0661 0.0257  480 LYS A CG    
1285 C CD    . LYS A 90 ? 0.8365 0.8831 0.6580 0.0807  -0.0986 0.0252  480 LYS A CD    
1286 C CE    . LYS A 90 ? 0.8331 0.9359 0.6998 0.0652  -0.1072 0.0269  480 LYS A CE    
1287 N NZ    . LYS A 90 ? 0.8090 0.9249 0.7099 0.0702  -0.0815 0.0109  480 LYS A NZ    
1301 N N     . ARG A 91 ? 0.7716 0.7125 0.5568 0.1769  -0.0029 0.0714  481 ARG A N     
1302 C CA    . ARG A 91 ? 0.8693 0.7826 0.6089 0.2020  0.0067  0.0930  481 ARG A CA    
1303 C C     . ARG A 91 ? 0.8766 0.8014 0.6657 0.2175  0.0298  0.1135  481 ARG A C     
1304 O O     . ARG A 91 ? 0.8645 0.7708 0.6211 0.2403  0.0409  0.1362  481 ARG A O     
1305 C CB    . ARG A 91 ? 0.9462 0.8191 0.6349 0.2183  0.0260  0.0974  481 ARG A CB    
1306 C CG    . ARG A 91 ? 0.9906 0.8419 0.6303 0.2044  0.0042  0.0758  481 ARG A CG    
1307 C CD    . ARG A 91 ? 1.0536 0.8656 0.6484 0.2263  0.0295  0.0805  481 ARG A CD    
1308 N NE    . ARG A 91 ? 1.1809 0.9361 0.6690 0.2548  0.0259  0.0873  481 ARG A NE    
1309 C CZ    . ARG A 91 ? 1.2514 0.9829 0.7039 0.2933  0.0610  0.1120  481 ARG A CZ    
1310 N NH1   . ARG A 91 ? 1.2253 0.9904 0.7531 0.3045  0.1021  0.1376  481 ARG A NH1   
1311 N NH2   . ARG A 91 ? 1.3408 1.0232 0.7110 0.3111  0.0529  0.1051  481 ARG A NH2   
1325 N N     . HIS A 92 ? 0.5869 0.5348 0.4468 0.2075  0.0359  0.1064  482 HIS A N     
1326 C CA    . HIS A 92 ? 0.6827 0.6325 0.5897 0.2202  0.0520  0.1236  482 HIS A CA    
1327 C C     . HIS A 92 ? 0.6154 0.5881 0.5322 0.2255  0.0375  0.1262  482 HIS A C     
1328 O O     . HIS A 92 ? 0.6247 0.5944 0.5738 0.2399  0.0494  0.1419  482 HIS A O     
1329 C CB    . HIS A 92 ? 0.7912 0.7378 0.7615 0.2085  0.0622  0.1137  482 HIS A CB    
1330 C CG    . HIS A 92 ? 0.8856 0.8163 0.8743 0.2077  0.0818  0.1287  482 HIS A CG    
1331 N ND1   . HIS A 92 ? 0.9354 0.8545 0.9526 0.2219  0.1036  0.1621  482 HIS A ND1   
1332 C CD2   . HIS A 92 ? 0.8961 0.8263 0.8867 0.1954  0.0838  0.1207  482 HIS A CD2   
1333 C CE1   . HIS A 92 ? 0.9345 0.8515 0.9748 0.2183  0.1192  0.1771  482 HIS A CE1   
1334 N NE2   . HIS A 92 ? 0.8946 0.8176 0.9185 0.2031  0.1074  0.1516  482 HIS A NE2   
1342 N N     . PHE A 93 ? 0.9010 0.8985 0.7971 0.2144  0.0121  0.1157  483 PHE A N     
1343 C CA    . PHE A 93 ? 0.8824 0.9148 0.8018 0.2198  -0.0001 0.1239  483 PHE A CA    
1344 C C     . PHE A 93 ? 0.9298 0.9767 0.8056 0.2153  -0.0310 0.1379  483 PHE A C     
1345 O O     . PHE A 93 ? 0.9162 0.9904 0.7902 0.1967  -0.0561 0.1318  483 PHE A O     
1346 C CB    . PHE A 93 ? 0.8269 0.8882 0.7847 0.2097  -0.0018 0.1041  483 PHE A CB    
1347 C CG    . PHE A 93 ? 0.7817 0.8179 0.7724 0.2122  0.0192  0.0870  483 PHE A CG    
1348 C CD1   . PHE A 93 ? 0.7768 0.8006 0.7998 0.2317  0.0333  0.0922  483 PHE A CD1   
1349 C CD2   . PHE A 93 ? 0.7344 0.7542 0.7219 0.1944  0.0204  0.0668  483 PHE A CD2   
1350 C CE1   . PHE A 93 ? 0.7548 0.7426 0.8012 0.2307  0.0435  0.0754  483 PHE A CE1   
1351 C CE2   . PHE A 93 ? 0.7022 0.6955 0.7193 0.1925  0.0308  0.0529  483 PHE A CE2   
1352 C CZ    . PHE A 93 ? 0.7160 0.6893 0.7599 0.2093  0.0399  0.0561  483 PHE A CZ    
1362 O "O5'" . DG  B 1  ? 0.9680 0.6489 0.4209 0.0612  0.0115  0.0879  1   DG  B "O5'" 
1363 C "C5'" . DG  B 1  ? 0.9237 0.6045 0.3582 0.0484  0.0270  0.0879  1   DG  B "C5'" 
1364 C "C4'" . DG  B 1  ? 0.7856 0.5111 0.2513 0.0402  0.0359  0.0809  1   DG  B "C4'" 
1365 O "O4'" . DG  B 1  ? 0.7360 0.4889 0.2200 0.0614  0.0180  0.0728  1   DG  B "O4'" 
1366 C "C3'" . DG  B 1  ? 0.7216 0.4769 0.2346 0.0279  0.0411  0.0786  1   DG  B "C3'" 
1367 O "O3'" . DG  B 1  ? 0.6997 0.4932 0.2460 0.0119  0.0568  0.0706  1   DG  B "O3'" 
1368 C "C2'" . DG  B 1  ? 0.7054 0.4881 0.2566 0.0479  0.0189  0.0733  1   DG  B "C2'" 
1369 C "C1'" . DG  B 1  ? 0.6972 0.4908 0.2417 0.0625  0.0102  0.0665  1   DG  B "C1'" 
1370 N N9    . DG  B 1  ? 0.6847 0.4854 0.2357 0.0850  -0.0124 0.0617  1   DG  B N9    
1371 C C8    . DG  B 1  ? 0.7129 0.4906 0.2447 0.1001  -0.0269 0.0649  1   DG  B C8    
1372 N N7    . DG  B 1  ? 0.6835 0.4833 0.2329 0.1180  -0.0453 0.0551  1   DG  B N7    
1373 C C5    . DG  B 1  ? 0.6621 0.4947 0.2365 0.1141  -0.0428 0.0465  1   DG  B C5    
1374 C C6    . DG  B 1  ? 0.6169 0.4826 0.2182 0.1245  -0.0560 0.0327  1   DG  B C6    
1375 O O6    . DG  B 1  ? 0.5946 0.4711 0.1999 0.1406  -0.0736 0.0246  1   DG  B O6    
1376 N N1    . DG  B 1  ? 0.6034 0.4917 0.2292 0.1139  -0.0467 0.0263  1   DG  B N1    
1377 C C2    . DG  B 1  ? 0.6157 0.5008 0.2423 0.0979  -0.0279 0.0311  1   DG  B C2    
1378 N N2    . DG  B 1  ? 0.5935 0.5024 0.2455 0.0931  -0.0226 0.0218  1   DG  B N2    
1379 N N3    . DG  B 1  ? 0.6418 0.5033 0.2473 0.0871  -0.0150 0.0424  1   DG  B N3    
1380 C C4    . DG  B 1  ? 0.6593 0.4931 0.2382 0.0949  -0.0230 0.0502  1   DG  B C4    
1393 P P     . DA  B 2  ? 0.6753 0.5103 0.2788 -0.0021 0.0632  0.0649  2   DA  B P     
1394 O OP1   . DA  B 2  ? 0.6702 0.5224 0.2769 -0.0220 0.0854  0.0585  2   DA  B OP1   
1395 O OP2   . DA  B 2  ? 0.6680 0.4881 0.2739 -0.0040 0.0575  0.0709  2   DA  B OP2   
1396 O "O5'" . DA  B 2  ? 0.6113 0.4875 0.2636 0.0139  0.0476  0.0570  2   DA  B "O5'" 
1397 C "C5'" . DA  B 2  ? 0.6053 0.5030 0.2687 0.0185  0.0497  0.0483  2   DA  B "C5'" 
1398 C "C4'" . DA  B 2  ? 0.5556 0.4808 0.2599 0.0325  0.0337  0.0424  2   DA  B "C4'" 
1399 O "O4'" . DA  B 2  ? 0.5471 0.4549 0.2349 0.0475  0.0168  0.0452  2   DA  B "O4'" 
1400 C "C3'" . DA  B 2  ? 0.4901 0.4401 0.2378 0.0284  0.0305  0.0427  2   DA  B "C3'" 
1401 O "O3'" . DA  B 2  ? 0.4935 0.4756 0.2768 0.0280  0.0343  0.0340  2   DA  B "O3'" 
1402 C "C2'" . DA  B 2  ? 0.4720 0.4187 0.2277 0.0409  0.0124  0.0450  2   DA  B "C2'" 
1403 C "C1'" . DA  B 2  ? 0.5132 0.4437 0.2402 0.0532  0.0049  0.0422  2   DA  B "C1'" 
1404 N N9    . DA  B 2  ? 0.5172 0.4338 0.2304 0.0648  -0.0098 0.0444  2   DA  B N9    
1405 C C8    . DA  B 2  ? 0.5143 0.4052 0.2019 0.0662  -0.0119 0.0519  2   DA  B C8    
1406 N N7    . DA  B 2  ? 0.5144 0.4015 0.1960 0.0811  -0.0275 0.0495  2   DA  B N7    
1407 C C5    . DA  B 2  ? 0.4987 0.4116 0.2032 0.0871  -0.0349 0.0394  2   DA  B C5    
1408 C C6    . DA  B 2  ? 0.4857 0.4133 0.1993 0.1002  -0.0505 0.0296  2   DA  B C6    
1409 N N6    . DA  B 2  ? 0.5081 0.4292 0.2094 0.1132  -0.0630 0.0281  2   DA  B N6    
1410 N N1    . DA  B 2  ? 0.4927 0.4432 0.2292 0.0995  -0.0526 0.0195  2   DA  B N1    
1411 C C2    . DA  B 2  ? 0.5126 0.4680 0.2604 0.0897  -0.0410 0.0197  2   DA  B C2    
1412 N N3    . DA  B 2  ? 0.5317 0.4789 0.2749 0.0796  -0.0270 0.0274  2   DA  B N3    
1413 C C4    . DA  B 2  ? 0.5124 0.4397 0.2344 0.0774  -0.0242 0.0369  2   DA  B C4    
1425 P P     . DG  B 3  ? 0.4590 0.4686 0.2861 0.0272  0.0294  0.0333  3   DG  B P     
1426 O OP1   . DG  B 3  ? 0.4828 0.5198 0.3340 0.0268  0.0373  0.0233  3   DG  B OP1   
1427 O OP2   . DG  B 3  ? 0.4380 0.4421 0.2630 0.0177  0.0304  0.0405  3   DG  B OP2   
1428 O "O5'" . DG  B 3  ? 0.4327 0.4410 0.2727 0.0401  0.0132  0.0335  3   DG  B "O5'" 
1429 C "C5'" . DG  B 3  ? 0.4288 0.4414 0.2754 0.0488  0.0102  0.0255  3   DG  B "C5'" 
1430 C "C4'" . DG  B 3  ? 0.4508 0.4607 0.3090 0.0556  -0.0034 0.0255  3   DG  B "C4'" 
1431 O "O4'" . DG  B 3  ? 0.4792 0.4745 0.3151 0.0580  -0.0103 0.0281  3   DG  B "O4'" 
1432 C "C3'" . DG  B 3  ? 0.4389 0.4579 0.3220 0.0534  -0.0087 0.0310  3   DG  B "C3'" 
1433 O "O3'" . DG  B 3  ? 0.4394 0.4606 0.3404 0.0586  -0.0139 0.0266  3   DG  B "O3'" 
1434 C "C2'" . DG  B 3  ? 0.4390 0.4496 0.3123 0.0517  -0.0157 0.0364  3   DG  B "C2'" 
1435 C "C1'" . DG  B 3  ? 0.4489 0.4481 0.2998 0.0578  -0.0192 0.0310  3   DG  B "C1'" 
1436 N N9    . DG  B 3  ? 0.4384 0.4267 0.2692 0.0601  -0.0243 0.0344  3   DG  B N9    
1437 C C8    . DG  B 3  ? 0.4348 0.4098 0.2462 0.0566  -0.0194 0.0415  3   DG  B C8    
1438 N N7    . DG  B 3  ? 0.4221 0.3850 0.2160 0.0631  -0.0272 0.0424  3   DG  B N7    
1439 C C5    . DG  B 3  ? 0.4370 0.4126 0.2428 0.0706  -0.0376 0.0340  3   DG  B C5    
1440 C C6    . DG  B 3  ? 0.4709 0.4486 0.2709 0.0808  -0.0497 0.0280  3   DG  B C6    
1441 O O6    . DG  B 3  ? 0.4946 0.4594 0.2752 0.0886  -0.0550 0.0300  3   DG  B O6    
1442 N N1    . DG  B 3  ? 0.4671 0.4647 0.2870 0.0821  -0.0560 0.0171  3   DG  B N1    
1443 C C2    . DG  B 3  ? 0.4386 0.4443 0.2772 0.0749  -0.0513 0.0140  3   DG  B C2    
1444 N N2    . DG  B 3  ? 0.4428 0.4631 0.2964 0.0744  -0.0572 0.0023  3   DG  B N2    
1445 N N3    . DG  B 3  ? 0.4279 0.4283 0.2703 0.0689  -0.0414 0.0202  3   DG  B N3    
1446 C C4    . DG  B 3  ? 0.4252 0.4142 0.2525 0.0669  -0.0351 0.0294  3   DG  B C4    
1458 P P     . DG  B 4  ? 0.4502 0.4745 0.3713 0.0581  -0.0198 0.0325  4   DG  B P     
1459 O OP1   . DG  B 4  ? 0.4583 0.4790 0.3910 0.0657  -0.0213 0.0268  4   DG  B OP1   
1460 O OP2   . DG  B 4  ? 0.4581 0.4941 0.3841 0.0533  -0.0173 0.0391  4   DG  B OP2   
1461 O "O5'" . DG  B 4  ? 0.4410 0.4565 0.3575 0.0541  -0.0269 0.0345  4   DG  B "O5'" 
1462 C "C5'" . DG  B 4  ? 0.4282 0.4362 0.3415 0.0555  -0.0301 0.0263  4   DG  B "C5'" 
1463 C "C4'" . DG  B 4  ? 0.4292 0.4380 0.3426 0.0494  -0.0355 0.0261  4   DG  B "C4'" 
1464 O "O4'" . DG  B 4  ? 0.4290 0.4432 0.3296 0.0511  -0.0370 0.0262  4   DG  B "O4'" 
1465 C "C3'" . DG  B 4  ? 0.4410 0.4500 0.3637 0.0425  -0.0367 0.0349  4   DG  B "C3'" 
1466 O "O3'" . DG  B 4  ? 0.4224 0.4238 0.3498 0.0354  -0.0385 0.0314  4   DG  B "O3'" 
1467 C "C2'" . DG  B 4  ? 0.4359 0.4548 0.3534 0.0400  -0.0378 0.0383  4   DG  B "C2'" 
1468 C "C1'" . DG  B 4  ? 0.4278 0.4481 0.3331 0.0459  -0.0400 0.0297  4   DG  B "C1'" 
1469 N N9    . DG  B 4  ? 0.3900 0.4103 0.2817 0.0493  -0.0403 0.0330  4   DG  B N9    
1470 C C8    . DG  B 4  ? 0.3772 0.3921 0.2606 0.0488  -0.0348 0.0403  4   DG  B C8    
1471 N N7    . DG  B 4  ? 0.3896 0.3980 0.2571 0.0513  -0.0361 0.0418  4   DG  B N7    
1472 C C5    . DG  B 4  ? 0.3734 0.3874 0.2408 0.0565  -0.0444 0.0344  4   DG  B C5    
1473 C C6    . DG  B 4  ? 0.3686 0.3799 0.2228 0.0644  -0.0510 0.0309  4   DG  B C6    
1474 O O6    . DG  B 4  ? 0.3733 0.3690 0.2085 0.0681  -0.0504 0.0356  4   DG  B O6    
1475 N N1    . DG  B 4  ? 0.3866 0.4147 0.2510 0.0686  -0.0590 0.0194  4   DG  B N1    
1476 C C2    . DG  B 4  ? 0.4227 0.4645 0.3058 0.0618  -0.0588 0.0126  4   DG  B C2    
1477 N N2    . DG  B 4  ? 0.4426 0.5038 0.3354 0.0638  -0.0657 -0.0010 4   DG  B N2    
1478 N N3    . DG  B 4  ? 0.3999 0.4364 0.2914 0.0540  -0.0524 0.0175  4   DG  B N3    
1479 C C4    . DG  B 4  ? 0.3968 0.4209 0.2806 0.0535  -0.0463 0.0281  4   DG  B C4    
1491 P P     . DT  B 5  ? 0.4792 0.4737 0.4096 0.0264  -0.0386 0.0410  5   DT  B P     
1492 O OP1   . DT  B 5  ? 0.5164 0.4920 0.4462 0.0195  -0.0377 0.0369  5   DT  B OP1   
1493 O OP2   . DT  B 5  ? 0.4504 0.4465 0.3818 0.0323  -0.0389 0.0516  5   DT  B OP2   
1494 O "O5'" . DT  B 5  ? 0.4584 0.4700 0.3891 0.0185  -0.0391 0.0388  5   DT  B "O5'" 
1495 C "C5'" . DT  B 5  ? 0.4518 0.4739 0.3848 0.0151  -0.0404 0.0258  5   DT  B "C5'" 
1496 C "C4'" . DT  B 5  ? 0.4536 0.4961 0.3884 0.0131  -0.0421 0.0227  5   DT  B "C4'" 
1497 O "O4'" . DT  B 5  ? 0.4308 0.4768 0.3575 0.0253  -0.0449 0.0250  5   DT  B "O4'" 
1498 C "C3'" . DT  B 5  ? 0.4874 0.5318 0.4234 0.0031  -0.0391 0.0314  5   DT  B "C3'" 
1499 O "O3'" . DT  B 5  ? 0.5483 0.6117 0.4911 -0.0063 -0.0380 0.0210  5   DT  B "O3'" 
1500 C "C2'" . DT  B 5  ? 0.4521 0.5000 0.3832 0.0118  -0.0406 0.0388  5   DT  B "C2'" 
1501 C "C1'" . DT  B 5  ? 0.4559 0.5104 0.3830 0.0225  -0.0447 0.0293  5   DT  B "C1'" 
1502 N N1    . DT  B 5  ? 0.4434 0.4929 0.3596 0.0313  -0.0453 0.0348  5   DT  B N1    
1503 C C2    . DT  B 5  ? 0.4214 0.4761 0.3301 0.0389  -0.0496 0.0287  5   DT  B C2    
1504 O O2    . DT  B 5  ? 0.4171 0.4866 0.3312 0.0409  -0.0541 0.0173  5   DT  B O2    
1505 N N3    . DT  B 5  ? 0.3968 0.4386 0.2908 0.0444  -0.0486 0.0348  5   DT  B N3    
1506 C C4    . DT  B 5  ? 0.3796 0.4109 0.2698 0.0407  -0.0427 0.0443  5   DT  B C4    
1507 O O4    . DT  B 5  ? 0.3827 0.4022 0.2588 0.0425  -0.0403 0.0478  5   DT  B O4    
1508 C C5    . DT  B 5  ? 0.4054 0.4398 0.3086 0.0348  -0.0396 0.0485  5   DT  B C5    
1509 C C7    . DT  B 5  ? 0.4237 0.4554 0.3283 0.0328  -0.0345 0.0552  5   DT  B C7    
1510 C C6    . DT  B 5  ? 0.4252 0.4648 0.3386 0.0314  -0.0415 0.0446  5   DT  B C6    
1523 P P     . DG  B 6  ? 0.5398 0.5998 0.4844 -0.0267 -0.0310 0.0203  6   DG  B P     
1524 O OP1   . DG  B 6  ? 0.5492 0.6043 0.4982 -0.0331 -0.0297 0.0088  6   DG  B OP1   
1525 O OP2   . DG  B 6  ? 0.5354 0.5742 0.4687 -0.0306 -0.0284 0.0376  6   DG  B OP2   
1526 O "O5'" . DG  B 6  ? 0.4867 0.5798 0.4407 -0.0328 -0.0298 0.0080  6   DG  B "O5'" 
1527 C "C5'" . DG  B 6  ? 0.4400 0.5597 0.4062 -0.0274 -0.0343 -0.0115 6   DG  B "C5'" 
1528 C "C4'" . DG  B 6  ? 0.4098 0.5575 0.3819 -0.0194 -0.0380 -0.0198 6   DG  B "C4'" 
1529 O "O4'" . DG  B 6  ? 0.3785 0.5136 0.3394 0.0000  -0.0448 -0.0106 6   DG  B "O4'" 
1530 C "C3'" . DG  B 6  ? 0.3985 0.5556 0.3714 -0.0332 -0.0303 -0.0165 6   DG  B "C3'" 
1531 O "O3'" . DG  B 6  ? 0.3741 0.5696 0.3622 -0.0337 -0.0308 -0.0365 6   DG  B "O3'" 
1532 C "C2'" . DG  B 6  ? 0.4045 0.5443 0.3645 -0.0218 -0.0333 -0.0001 6   DG  B "C2'" 
1533 C "C1'" . DG  B 6  ? 0.3793 0.5176 0.3370 -0.0006 -0.0428 -0.0045 6   DG  B "C1'" 
1534 N N9    . DG  B 6  ? 0.3817 0.4962 0.3255 0.0094  -0.0448 0.0105  6   DG  B N9    
1535 C C8    . DG  B 6  ? 0.3685 0.4606 0.3056 0.0068  -0.0423 0.0248  6   DG  B C8    
1536 N N7    . DG  B 6  ? 0.3494 0.4297 0.2774 0.0152  -0.0437 0.0328  6   DG  B N7    
1537 C C5    . DG  B 6  ? 0.3676 0.4557 0.2919 0.0241  -0.0475 0.0251  6   DG  B C5    
1538 C C6    . DG  B 6  ? 0.3782 0.4533 0.2891 0.0332  -0.0492 0.0285  6   DG  B C6    
1539 O O6    . DG  B 6  ? 0.3845 0.4433 0.2867 0.0326  -0.0463 0.0382  6   DG  B O6    
1540 N N1    . DG  B 6  ? 0.3647 0.4471 0.2724 0.0432  -0.0545 0.0178  6   DG  B N1    
1541 C C2    . DG  B 6  ? 0.3668 0.4748 0.2877 0.0449  -0.0579 0.0031  6   DG  B C2    
1542 N N2    . DG  B 6  ? 0.4028 0.5171 0.3199 0.0590  -0.0646 -0.0080 6   DG  B N2    
1543 N N3    . DG  B 6  ? 0.3546 0.4802 0.2908 0.0331  -0.0547 -0.0017 6   DG  B N3    
1544 C C4    . DG  B 6  ? 0.3730 0.4834 0.3078 0.0228  -0.0494 0.0109  6   DG  B C4    
1556 P P     . DT  B 7  ? 0.3915 0.6084 0.3840 -0.0501 -0.0212 -0.0408 7   DT  B P     
1557 O OP1   . DT  B 7  ? 0.4011 0.6617 0.4154 -0.0581 -0.0185 -0.0670 7   DT  B OP1   
1558 O OP2   . DT  B 7  ? 0.4104 0.5976 0.3865 -0.0683 -0.0118 -0.0216 7   DT  B OP2   
1559 O "O5'" . DT  B 7  ? 0.3594 0.5789 0.3468 -0.0313 -0.0278 -0.0375 7   DT  B "O5'" 
1560 C "C5'" . DT  B 7  ? 0.3762 0.6083 0.3687 -0.0082 -0.0392 -0.0495 7   DT  B "C5'" 
1561 C "C4'" . DT  B 7  ? 0.3727 0.5914 0.3529 0.0064  -0.0435 -0.0417 7   DT  B "C4'" 
1562 O "O4'" . DT  B 7  ? 0.3902 0.5711 0.3530 0.0087  -0.0442 -0.0204 7   DT  B "O4'" 
1563 C "C3'" . DT  B 7  ? 0.3803 0.6120 0.3613 -0.0052 -0.0356 -0.0420 7   DT  B "C3'" 
1564 O "O3'" . DT  B 7  ? 0.4174 0.6811 0.4106 0.0065  -0.0395 -0.0633 7   DT  B "O3'" 
1565 C "C2'" . DT  B 7  ? 0.3793 0.5776 0.3413 -0.0015 -0.0364 -0.0217 7   DT  B "C2'" 
1566 C "C1'" . DT  B 7  ? 0.3909 0.5623 0.3440 0.0122  -0.0438 -0.0133 7   DT  B "C1'" 
1567 N N1    . DT  B 7  ? 0.4003 0.5415 0.3404 0.0082  -0.0417 0.0071  7   DT  B N1    
1568 C C2    . DT  B 7  ? 0.3788 0.5008 0.3063 0.0178  -0.0446 0.0139  7   DT  B C2    
1569 O O2    . DT  B 7  ? 0.3984 0.5194 0.3207 0.0294  -0.0487 0.0063  7   DT  B O2    
1570 N N3    . DT  B 7  ? 0.3603 0.4638 0.2812 0.0130  -0.0423 0.0287  7   DT  B N3    
1571 C C4    . DT  B 7  ? 0.3717 0.4711 0.2956 0.0039  -0.0393 0.0378  7   DT  B C4    
1572 O O4    . DT  B 7  ? 0.3893 0.4760 0.3091 0.0032  -0.0388 0.0485  7   DT  B O4    
1573 C C5    . DT  B 7  ? 0.3836 0.4947 0.3158 -0.0049 -0.0368 0.0322  7   DT  B C5    
1574 C C7    . DT  B 7  ? 0.4120 0.5102 0.3427 -0.0142 -0.0338 0.0420  7   DT  B C7    
1575 C C6    . DT  B 7  ? 0.3918 0.5244 0.3323 -0.0042 -0.0372 0.0170  7   DT  B C6    
1588 P P     . DG  B 8  ? 0.4776 0.7746 0.4808 -0.0070 -0.0298 -0.0758 8   DG  B P     
1589 O OP1   . DG  B 8  ? 0.4905 0.8314 0.5159 0.0046  -0.0345 -0.1044 8   DG  B OP1   
1590 O OP2   . DG  B 8  ? 0.4594 0.7520 0.4570 -0.0358 -0.0160 -0.0644 8   DG  B OP2   
1591 O "O5'" . DG  B 8  ? 0.4606 0.7377 0.4484 0.0048  -0.0331 -0.0678 8   DG  B "O5'" 
1592 C "C5'" . DG  B 8  ? 0.4599 0.7233 0.4415 0.0313  -0.0453 -0.0724 8   DG  B "C5'" 
1593 C "C4'" . DG  B 8  ? 0.4215 0.6588 0.3856 0.0352  -0.0453 -0.0624 8   DG  B "C4'" 
1594 O "O4'" . DG  B 8  ? 0.3871 0.5872 0.3349 0.0288  -0.0443 -0.0389 8   DG  B "O4'" 
1595 C "C3'" . DG  B 8  ? 0.4402 0.6971 0.4068 0.0190  -0.0352 -0.0658 8   DG  B "C3'" 
1596 O "O3'" . DG  B 8  ? 0.4834 0.7295 0.4409 0.0318  -0.0389 -0.0709 8   DG  B "O3'" 
1597 C "C2'" . DG  B 8  ? 0.4113 0.6471 0.3661 -0.0006 -0.0286 -0.0428 8   DG  B "C2'" 
1598 C "C1'" . DG  B 8  ? 0.3934 0.5915 0.3353 0.0124  -0.0366 -0.0292 8   DG  B "C1'" 
1599 N N9    . DG  B 8  ? 0.3499 0.5273 0.2846 0.0016  -0.0343 -0.0093 8   DG  B N9    
1600 C C8    . DG  B 8  ? 0.3510 0.5330 0.2893 -0.0131 -0.0291 -0.0023 8   DG  B C8    
1601 N N7    . DG  B 8  ? 0.3441 0.5026 0.2739 -0.0159 -0.0299 0.0146  8   DG  B N7    
1602 C C5    . DG  B 8  ? 0.3401 0.4819 0.2624 -0.0049 -0.0345 0.0180  8   DG  B C5    
1603 C C6    . DG  B 8  ? 0.3660 0.4864 0.2806 -0.0038 -0.0360 0.0311  8   DG  B C6    
1604 O O6    . DG  B 8  ? 0.3770 0.4900 0.2912 -0.0088 -0.0354 0.0424  8   DG  B O6    
1605 N N1    . DG  B 8  ? 0.3695 0.4769 0.2761 0.0039  -0.0380 0.0288  8   DG  B N1    
1606 C C2    . DG  B 8  ? 0.3891 0.4976 0.2925 0.0127  -0.0400 0.0164  8   DG  B C2    
1607 N N2    . DG  B 8  ? 0.4182 0.5036 0.3085 0.0183  -0.0411 0.0167  8   DG  B N2    
1608 N N3    . DG  B 8  ? 0.3561 0.4865 0.2682 0.0156  -0.0404 0.0033  8   DG  B N3    
1609 C C4    . DG  B 8  ? 0.3385 0.4873 0.2611 0.0051  -0.0369 0.0044  8   DG  B C4    
1621 P P     . DG  B 9  ? 0.5159 0.7938 0.4812 0.0296  -0.0335 -0.0900 9   DG  B P     
1622 O OP1   . DG  B 9  ? 0.5353 0.8417 0.5173 0.0502  -0.0404 -0.1156 9   DG  B OP1   
1623 O OP2   . DG  B 9  ? 0.4978 0.7947 0.4640 0.0020  -0.0203 -0.0841 9   DG  B OP2   
1624 O "O5'" . DG  B 9  ? 0.5240 0.7665 0.4693 0.0391  -0.0375 -0.0841 9   DG  B "O5'" 
1625 C "C5'" . DG  B 9  ? 0.5001 0.7060 0.4322 0.0610  -0.0483 -0.0816 9   DG  B "C5'" 
1626 C "C4'" . DG  B 9  ? 0.4792 0.6456 0.3898 0.0575  -0.0475 -0.0689 9   DG  B "C4'" 
1627 O "O4'" . DG  B 9  ? 0.4519 0.6017 0.3566 0.0417  -0.0440 -0.0468 9   DG  B "O4'" 
1628 C "C3'" . DG  B 9  ? 0.4774 0.6569 0.3870 0.0464  -0.0408 -0.0757 9   DG  B "C3'" 
1629 O "O3'" . DG  B 9  ? 0.5268 0.6704 0.4180 0.0552  -0.0440 -0.0774 9   DG  B "O3'" 
1630 C "C2'" . DG  B 9  ? 0.4437 0.6300 0.3529 0.0217  -0.0333 -0.0579 9   DG  B "C2'" 
1631 C "C1'" . DG  B 9  ? 0.4342 0.5898 0.3362 0.0231  -0.0371 -0.0400 9   DG  B "C1'" 
1632 N N9    . DG  B 9  ? 0.4038 0.5679 0.3107 0.0078  -0.0333 -0.0247 9   DG  B N9    
1633 C C8    . DG  B 9  ? 0.3847 0.5754 0.3031 -0.0014 -0.0290 -0.0259 9   DG  B C8    
1634 N N7    . DG  B 9  ? 0.3761 0.5596 0.2921 -0.0125 -0.0272 -0.0096 9   DG  B N7    
1635 C C5    . DG  B 9  ? 0.3739 0.5312 0.2801 -0.0097 -0.0307 0.0015  9   DG  B C5    
1636 C C6    . DG  B 9  ? 0.3847 0.5285 0.2872 -0.0156 -0.0314 0.0180  9   DG  B C6    
1637 O O6    . DG  B 9  ? 0.3982 0.5446 0.3023 -0.0228 -0.0301 0.0278  9   DG  B O6    
1638 N N1    . DG  B 9  ? 0.3978 0.5226 0.2934 -0.0126 -0.0335 0.0214  9   DG  B N1    
1639 C C2    . DG  B 9  ? 0.4147 0.5269 0.3033 -0.0058 -0.0343 0.0119  9   DG  B C2    
1640 N N2    . DG  B 9  ? 0.4365 0.5285 0.3172 -0.0080 -0.0340 0.0163  9   DG  B N2    
1641 N N3    . DG  B 9  ? 0.4084 0.5268 0.2974 0.0025  -0.0350 -0.0023 9   DG  B N3    
1642 C C4    . DG  B 9  ? 0.3760 0.5207 0.2760 0.0006  -0.0334 -0.0075 9   DG  B C4    
1654 P P     . DC  B 10 ? 0.5482 0.6990 0.4352 0.0499  -0.0395 -0.0901 10  DC  B P     
1655 O OP1   . DC  B 10 ? 0.6042 0.7143 0.4734 0.0689  -0.0458 -0.0989 10  DC  B OP1   
1656 O OP2   . DC  B 10 ? 0.5240 0.7252 0.4293 0.0449  -0.0340 -0.1056 10  DC  B OP2   
1657 O "O5'" . DC  B 10 ? 0.5056 0.6471 0.3841 0.0263  -0.0339 -0.0723 10  DC  B "O5'" 
1658 C "C5'" . DC  B 10 ? 0.5020 0.6033 0.3655 0.0246  -0.0356 -0.0600 10  DC  B "C5'" 
1659 C "C4'" . DC  B 10 ? 0.4793 0.5880 0.3436 0.0036  -0.0316 -0.0444 10  DC  B "C4'" 
1660 O "O4'" . DC  B 10 ? 0.4352 0.5606 0.3103 -0.0004 -0.0315 -0.0318 10  DC  B "O4'" 
1661 C "C3'" . DC  B 10 ? 0.4728 0.6093 0.3384 -0.0108 -0.0275 -0.0491 10  DC  B "C3'" 
1662 O "O3'" . DC  B 10 ? 0.5163 0.6362 0.3707 -0.0138 -0.0269 -0.0585 10  DC  B "O3'" 
1663 C "C2'" . DC  B 10 ? 0.4407 0.5882 0.3094 -0.0248 -0.0271 -0.0305 10  DC  B "C2'" 
1664 C "C1'" . DC  B 10 ? 0.4245 0.5619 0.2998 -0.0169 -0.0292 -0.0202 10  DC  B "C1'" 
1665 N N1    . DC  B 10 ? 0.4147 0.5752 0.2981 -0.0230 -0.0275 -0.0121 10  DC  B N1    
1666 C C2    . DC  B 10 ? 0.4056 0.5629 0.2891 -0.0299 -0.0287 0.0046  10  DC  B C2    
1667 O O2    . DC  B 10 ? 0.4139 0.5563 0.2948 -0.0308 -0.0310 0.0109  10  DC  B O2    
1668 N N3    . DC  B 10 ? 0.3965 0.5664 0.2825 -0.0359 -0.0268 0.0123  10  DC  B N3    
1669 C C4    . DC  B 10 ? 0.4006 0.5889 0.2902 -0.0384 -0.0221 0.0034  10  DC  B C4    
1670 N N4    . DC  B 10 ? 0.3892 0.5843 0.2778 -0.0477 -0.0186 0.0116  10  DC  B N4    
1671 C C5    . DC  B 10 ? 0.4225 0.6229 0.3165 -0.0318 -0.0204 -0.0158 10  DC  B C5    
1672 C C6    . DC  B 10 ? 0.4391 0.6233 0.3291 -0.0225 -0.0241 -0.0226 10  DC  B C6    
1685 O "O5'" . DG  C 1  ? 0.7686 0.8169 0.4227 -0.1151 -0.0806 0.0654  1   DG  C "O5'" 
1686 C "C5'" . DG  C 1  ? 0.6286 0.6841 0.3481 -0.1052 -0.0769 0.0619  1   DG  C "C5'" 
1687 C "C4'" . DG  C 1  ? 0.5358 0.6262 0.3148 -0.0872 -0.0700 0.0367  1   DG  C "C4'" 
1688 O "O4'" . DG  C 1  ? 0.5001 0.6307 0.2776 -0.0934 -0.0462 0.0246  1   DG  C "O4'" 
1689 C "C3'" . DG  C 1  ? 0.4320 0.5280 0.2709 -0.0798 -0.0622 0.0334  1   DG  C "C3'" 
1690 O "O3'" . DG  C 1  ? 0.4085 0.5137 0.2926 -0.0639 -0.0689 0.0142  1   DG  C "O3'" 
1691 C "C2'" . DG  C 1  ? 0.4237 0.5483 0.2695 -0.0898 -0.0349 0.0330  1   DG  C "C2'" 
1692 C "C1'" . DG  C 1  ? 0.4381 0.5899 0.2636 -0.0912 -0.0285 0.0187  1   DG  C "C1'" 
1693 N N9    . DG  C 1  ? 0.4260 0.6071 0.2370 -0.1063 -0.0059 0.0169  1   DG  C N9    
1694 C C8    . DG  C 1  ? 0.4439 0.6208 0.2232 -0.1282 0.0056  0.0334  1   DG  C C8    
1695 N N7    . DG  C 1  ? 0.4290 0.6456 0.2105 -0.1394 0.0276  0.0209  1   DG  C N7    
1696 C C5    . DG  C 1  ? 0.4125 0.6582 0.2271 -0.1208 0.0272  -0.0057 1   DG  C C5    
1697 C C6    . DG  C 1  ? 0.3894 0.6836 0.2267 -0.1185 0.0418  -0.0338 1   DG  C C6    
1698 O O6    . DG  C 1  ? 0.3983 0.7276 0.2345 -0.1342 0.0618  -0.0433 1   DG  C O6    
1699 N N1    . DG  C 1  ? 0.4043 0.7063 0.2723 -0.0956 0.0297  -0.0554 1   DG  C N1    
1700 C C2    . DG  C 1  ? 0.4267 0.6968 0.3040 -0.0808 0.0101  -0.0501 1   DG  C C2    
1701 N N2    . DG  C 1  ? 0.3973 0.6769 0.3063 -0.0628 0.0005  -0.0728 1   DG  C N2    
1702 N N3    . DG  C 1  ? 0.4429 0.6751 0.3050 -0.0835 -0.0008 -0.0271 1   DG  C N3    
1703 C C4    . DG  C 1  ? 0.4214 0.6425 0.2515 -0.1020 0.0070  -0.0062 1   DG  C C4    
1716 P P     . DC  C 2  ? 0.4183 0.5281 0.3599 -0.0585 -0.0589 0.0078  2   DC  C P     
1717 O OP1   . DC  C 2  ? 0.4044 0.5095 0.3813 -0.0466 -0.0762 -0.0082 2   DC  C OP1   
1718 O OP2   . DC  C 2  ? 0.4140 0.5141 0.3510 -0.0665 -0.0493 0.0233  2   DC  C OP2   
1719 O "O5'" . DC  C 2  ? 0.3886 0.5220 0.3482 -0.0575 -0.0418 -0.0037 2   DC  C "O5'" 
1720 C "C5'" . DC  C 2  ? 0.4085 0.5539 0.3739 -0.0499 -0.0498 -0.0210 2   DC  C "C5'" 
1721 C "C4'" . DC  C 2  ? 0.4055 0.5649 0.3934 -0.0477 -0.0377 -0.0319 2   DC  C "C4'" 
1722 O "O4'" . DC  C 2  ? 0.3998 0.5771 0.3627 -0.0524 -0.0268 -0.0306 2   DC  C "O4'" 
1723 C "C3'" . DC  C 2  ? 0.3908 0.5366 0.4080 -0.0504 -0.0265 -0.0266 2   DC  C "C3'" 
1724 O "O3'" . DC  C 2  ? 0.4173 0.5596 0.4640 -0.0466 -0.0276 -0.0400 2   DC  C "O3'" 
1725 C "C2'" . DC  C 2  ? 0.3660 0.5153 0.3644 -0.0550 -0.0142 -0.0166 2   DC  C "C2'" 
1726 C "C1'" . DC  C 2  ? 0.3832 0.5577 0.3630 -0.0532 -0.0157 -0.0278 2   DC  C "C1'" 
1727 N N1    . DC  C 2  ? 0.3776 0.5670 0.3350 -0.0616 -0.0052 -0.0212 2   DC  C N1    
1728 C C2    . DC  C 2  ? 0.3747 0.5899 0.3381 -0.0586 0.0002  -0.0375 2   DC  C C2    
1729 O O2    . DC  C 2  ? 0.3995 0.6186 0.3835 -0.0468 -0.0069 -0.0554 2   DC  C O2    
1730 N N3    . DC  C 2  ? 0.3752 0.6108 0.3262 -0.0686 0.0117  -0.0361 2   DC  C N3    
1731 C C4    . DC  C 2  ? 0.3705 0.5951 0.2990 -0.0828 0.0170  -0.0155 2   DC  C C4    
1732 N N4    . DC  C 2  ? 0.3605 0.6062 0.2809 -0.0961 0.0296  -0.0157 2   DC  C N4    
1733 C C5    . DC  C 2  ? 0.3554 0.5474 0.2733 -0.0840 0.0077  0.0027  2   DC  C C5    
1734 C C6    . DC  C 2  ? 0.3498 0.5287 0.2849 -0.0725 -0.0029 -0.0028 2   DC  C C6    
1746 P P     . DC  C 3  ? 0.4318 0.5525 0.5034 -0.0540 -0.0156 -0.0348 3   DC  C P     
1747 O OP1   . DC  C 3  ? 0.4817 0.5974 0.5861 -0.0540 -0.0209 -0.0499 3   DC  C OP1   
1748 O OP2   . DC  C 3  ? 0.4387 0.5548 0.5105 -0.0600 -0.0079 -0.0238 3   DC  C OP2   
1749 O "O5'" . DC  C 3  ? 0.4100 0.5202 0.4626 -0.0539 -0.0089 -0.0276 3   DC  C "O5'" 
1750 C "C5'" . DC  C 3  ? 0.4099 0.5265 0.4614 -0.0451 -0.0181 -0.0406 3   DC  C "C5'" 
1751 C "C4'" . DC  C 3  ? 0.4059 0.5168 0.4408 -0.0419 -0.0161 -0.0365 3   DC  C "C4'" 
1752 O "O4'" . DC  C 3  ? 0.3630 0.4996 0.3804 -0.0433 -0.0108 -0.0325 3   DC  C "O4'" 
1753 C "C3'" . DC  C 3  ? 0.4218 0.4974 0.4469 -0.0486 -0.0081 -0.0201 3   DC  C "C3'" 
1754 O "O3'" . DC  C 3  ? 0.5107 0.5534 0.5371 -0.0462 -0.0166 -0.0235 3   DC  C "O3'" 
1755 C "C2'" . DC  C 3  ? 0.3821 0.4672 0.3880 -0.0462 -0.0052 -0.0138 3   DC  C "C2'" 
1756 C "C1'" . DC  C 3  ? 0.3745 0.5012 0.3827 -0.0424 -0.0079 -0.0264 3   DC  C "C1'" 
1757 N N1    . DC  C 3  ? 0.3788 0.5233 0.3727 -0.0499 0.0007  -0.0166 3   DC  C N1    
1758 C C2    . DC  C 3  ? 0.3835 0.5566 0.3750 -0.0493 0.0023  -0.0267 3   DC  C C2    
1759 O O2    . DC  C 3  ? 0.4065 0.5926 0.4107 -0.0392 -0.0048 -0.0466 3   DC  C O2    
1760 N N3    . DC  C 3  ? 0.3730 0.5588 0.3518 -0.0606 0.0109  -0.0166 3   DC  C N3    
1761 C C4    . DC  C 3  ? 0.3891 0.5561 0.3566 -0.0684 0.0131  0.0023  3   DC  C C4    
1762 N N4    . DC  C 3  ? 0.4040 0.5766 0.3581 -0.0799 0.0180  0.0125  3   DC  C N4    
1763 C C5    . DC  C 3  ? 0.3863 0.5290 0.3602 -0.0653 0.0097  0.0084  3   DC  C C5    
1764 C C6    . DC  C 3  ? 0.3892 0.5236 0.3769 -0.0580 0.0058  -0.0012 3   DC  C C6    
1776 P P     . DA  C 4  ? 0.5933 0.5861 0.5959 -0.0553 -0.0102 -0.0058 4   DA  C P     
1777 O OP1   . DA  C 4  ? 0.6629 0.6195 0.6718 -0.0601 -0.0179 -0.0086 4   DA  C OP1   
1778 O OP2   . DA  C 4  ? 0.5821 0.5784 0.5770 -0.0674 0.0095  0.0082  4   DA  C OP2   
1779 O "O5'" . DA  C 4  ? 0.5762 0.5618 0.5575 -0.0415 -0.0234 -0.0077 4   DA  C "O5'" 
1780 C "C5'" . DA  C 4  ? 0.5522 0.5500 0.5463 -0.0252 -0.0435 -0.0282 4   DA  C "C5'" 
1781 C "C4'" . DA  C 4  ? 0.5240 0.5329 0.5097 -0.0130 -0.0522 -0.0349 4   DA  C "C4'" 
1782 O "O4'" . DA  C 4  ? 0.4524 0.5082 0.4439 -0.0187 -0.0361 -0.0335 4   DA  C "O4'" 
1783 C "C3'" . DA  C 4  ? 0.5360 0.4940 0.4869 -0.0131 -0.0573 -0.0186 4   DA  C "C3'" 
1784 O "O3'" . DA  C 4  ? 0.5947 0.5408 0.5447 0.0064  -0.0838 -0.0352 4   DA  C "O3'" 
1785 C "C2'" . DA  C 4  ? 0.4989 0.4809 0.4428 -0.0216 -0.0382 -0.0068 4   DA  C "C2'" 
1786 C "C1'" . DA  C 4  ? 0.4472 0.4905 0.4206 -0.0188 -0.0343 -0.0234 4   DA  C "C1'" 
1787 N N9    . DA  C 4  ? 0.4050 0.4737 0.3775 -0.0309 -0.0161 -0.0118 4   DA  C N9    
1788 C C8    . DA  C 4  ? 0.4020 0.4592 0.3673 -0.0429 -0.0024 0.0050  4   DA  C C8    
1789 N N7    . DA  C 4  ? 0.4111 0.4904 0.3776 -0.0495 0.0060  0.0109  4   DA  C N7    
1790 C C5    . DA  C 4  ? 0.3831 0.4913 0.3561 -0.0456 0.0016  -0.0007 4   DA  C C5    
1791 C C6    . DA  C 4  ? 0.3609 0.4969 0.3358 -0.0536 0.0076  0.0003  4   DA  C C6    
1792 N N6    . DA  C 4  ? 0.3510 0.4831 0.3178 -0.0640 0.0141  0.0154  4   DA  C N6    
1793 N N1    . DA  C 4  ? 0.3591 0.5258 0.3466 -0.0515 0.0056  -0.0168 4   DA  C N1    
1794 C C2    . DA  C 4  ? 0.3729 0.5430 0.3733 -0.0374 -0.0061 -0.0366 4   DA  C C2    
1795 N N3    . DA  C 4  ? 0.3719 0.5101 0.3687 -0.0261 -0.0178 -0.0381 4   DA  C N3    
1796 C C4    . DA  C 4  ? 0.3719 0.4789 0.3526 -0.0333 -0.0113 -0.0175 4   DA  C C4    
1808 P P     . DC  C 5  ? 0.6522 0.5285 0.5580 0.0134  -0.1037 -0.0233 5   DC  C P     
1809 O OP1   . DC  C 5  ? 0.7161 0.5424 0.6154 0.0224  -0.1312 -0.0299 5   DC  C OP1   
1810 O OP2   . DC  C 5  ? 0.7109 0.5618 0.5796 -0.0045 -0.0813 0.0046  5   DC  C OP2   
1811 O "O5'" . DC  C 5  ? 0.6239 0.5311 0.5458 0.0332  -0.1209 -0.0456 5   DC  C "O5'" 
1812 C "C5'" . DC  C 5  ? 0.5783 0.5373 0.5473 0.0489  -0.1340 -0.0805 5   DC  C "C5'" 
1813 C "C4'" . DC  C 5  ? 0.5288 0.5420 0.5227 0.0537  -0.1297 -0.0979 5   DC  C "C4'" 
1814 O "O4'" . DC  C 5  ? 0.4404 0.4904 0.4347 0.0316  -0.0952 -0.0801 5   DC  C "O4'" 
1815 C "C3'" . DC  C 5  ? 0.5619 0.5366 0.5320 0.0663  -0.1509 -0.0959 5   DC  C "C3'" 
1816 O "O3'" . DC  C 5  ? 0.5962 0.6033 0.6061 0.0884  -0.1762 -0.1349 5   DC  C "O3'" 
1817 C "C2'" . DC  C 5  ? 0.5120 0.5042 0.4697 0.0483  -0.1229 -0.0747 5   DC  C "C2'" 
1818 C "C1'" . DC  C 5  ? 0.4479 0.5036 0.4371 0.0309  -0.0931 -0.0767 5   DC  C "C1'" 
1819 N N1    . DC  C 5  ? 0.4347 0.4921 0.4061 0.0099  -0.0655 -0.0488 5   DC  C N1    
1820 C C2    . DC  C 5  ? 0.4084 0.5096 0.3971 -0.0011 -0.0499 -0.0501 5   DC  C C2    
1821 O O2    . DC  C 5  ? 0.3981 0.5398 0.4175 0.0036  -0.0548 -0.0745 5   DC  C O2    
1822 N N3    . DC  C 5  ? 0.3522 0.4492 0.3258 -0.0173 -0.0310 -0.0268 5   DC  C N3    
1823 C C4    . DC  C 5  ? 0.3522 0.4140 0.3019 -0.0224 -0.0245 -0.0074 5   DC  C C4    
1824 N N4    . DC  C 5  ? 0.3501 0.4137 0.2937 -0.0352 -0.0090 0.0087  5   DC  C N4    
1825 C C5    . DC  C 5  ? 0.3818 0.4042 0.3155 -0.0155 -0.0345 -0.0058 5   DC  C C5    
1826 C C6    . DC  C 5  ? 0.4320 0.4491 0.3740 0.0004  -0.0562 -0.0247 5   DC  C C6    
1838 P P     . DA  C 6  ? 0.6604 0.6173 0.6506 0.1128  -0.2166 -0.1448 6   DA  C P     
1839 O OP1   . DA  C 6  ? 0.6729 0.6605 0.7152 0.1401  -0.2501 -0.1934 6   DA  C OP1   
1840 O OP2   . DA  C 6  ? 0.7295 0.5914 0.6467 0.1096  -0.2273 -0.1085 6   DA  C OP2   
1841 O "O5'" . DA  C 6  ? 0.6114 0.6017 0.6072 0.1032  -0.1983 -0.1401 6   DA  C "O5'" 
1842 C "C5'" . DA  C 6  ? 0.5348 0.6107 0.5861 0.0923  -0.1745 -0.1611 6   DA  C "C5'" 
1843 C "C4'" . DA  C 6  ? 0.5219 0.6072 0.5643 0.0783  -0.1569 -0.1449 6   DA  C "C4'" 
1844 O "O4'" . DA  C 6  ? 0.4879 0.5588 0.4959 0.0541  -0.1251 -0.1063 6   DA  C "O4'" 
1845 C "C3'" . DA  C 6  ? 0.5951 0.6226 0.6021 0.0962  -0.1869 -0.1409 6   DA  C "C3'" 
1846 O "O3'" . DA  C 6  ? 0.6003 0.6717 0.6538 0.1050  -0.1983 -0.1724 6   DA  C "O3'" 
1847 C "C2'" . DA  C 6  ? 0.5924 0.5818 0.5452 0.0771  -0.1630 -0.0986 6   DA  C "C2'" 
1848 C "C1'" . DA  C 6  ? 0.5047 0.5460 0.4819 0.0507  -0.1235 -0.0873 6   DA  C "C1'" 
1849 N N9    . DA  C 6  ? 0.4588 0.4692 0.3956 0.0335  -0.1006 -0.0523 6   DA  C N9    
1850 C C8    . DA  C 6  ? 0.4770 0.4361 0.3744 0.0327  -0.1019 -0.0343 6   DA  C C8    
1851 N N7    . DA  C 6  ? 0.4711 0.4229 0.3495 0.0144  -0.0762 -0.0103 6   DA  C N7    
1852 C C5    . DA  C 6  ? 0.4223 0.4175 0.3255 0.0048  -0.0610 -0.0112 6   DA  C C5    
1853 C C6    . DA  C 6  ? 0.3938 0.4008 0.2957 -0.0117 -0.0381 0.0051  6   DA  C C6    
1854 N N6    . DA  C 6  ? 0.3906 0.3750 0.2711 -0.0215 -0.0233 0.0219  6   DA  C N6    
1855 N N1    . DA  C 6  ? 0.3496 0.3919 0.2763 -0.0183 -0.0326 0.0009  6   DA  C N1    
1856 C C2    . DA  C 6  ? 0.3519 0.4220 0.3063 -0.0121 -0.0441 -0.0192 6   DA  C C2    
1857 N N3    . DA  C 6  ? 0.3811 0.4525 0.3469 0.0041  -0.0638 -0.0404 6   DA  C N3    
1858 C C4    . DA  C 6  ? 0.4117 0.4416 0.3488 0.0138  -0.0738 -0.0346 6   DA  C C4    
1870 P P     . DC  C 7  ? 0.6532 0.6772 0.6852 0.1309  -0.2393 -0.1833 7   DC  C P     
1871 O OP1   . DC  C 7  ? 0.6667 0.7442 0.7706 0.1502  -0.2642 -0.2355 7   DC  C OP1   
1872 O OP2   . DC  C 7  ? 0.7243 0.6530 0.6779 0.1440  -0.2640 -0.1578 7   DC  C OP2   
1873 O "O5'" . DC  C 7  ? 0.6120 0.6461 0.6334 0.1121  -0.2152 -0.1631 7   DC  C "O5'" 
1874 C "C5'" . DC  C 7  ? 0.5363 0.6437 0.6112 0.0883  -0.1831 -0.1705 7   DC  C "C5'" 
1875 C "C4'" . DC  C 7  ? 0.5100 0.6039 0.5580 0.0708  -0.1633 -0.1418 7   DC  C "C4'" 
1876 O "O4'" . DC  C 7  ? 0.4965 0.5613 0.4984 0.0550  -0.1386 -0.1045 7   DC  C "O4'" 
1877 C "C3'" . DC  C 7  ? 0.5321 0.5730 0.5412 0.0905  -0.1920 -0.1403 7   DC  C "C3'" 
1878 O "O3'" . DC  C 7  ? 0.5338 0.6113 0.5857 0.0869  -0.1939 -0.1586 7   DC  C "O3'" 
1879 C "C2'" . DC  C 7  ? 0.5308 0.5194 0.4703 0.0798  -0.1742 -0.0994 7   DC  C "C2'" 
1880 C "C1'" . DC  C 7  ? 0.4869 0.5120 0.4453 0.0531  -0.1365 -0.0825 7   DC  C "C1'" 
1881 N N1    . DC  C 7  ? 0.4663 0.4515 0.3739 0.0443  -0.1198 -0.0518 7   DC  C N1    
1882 C C2    . DC  C 7  ? 0.4190 0.4164 0.3238 0.0232  -0.0906 -0.0309 7   DC  C C2    
1883 O O2    . DC  C 7  ? 0.3987 0.4299 0.3346 0.0128  -0.0821 -0.0344 7   DC  C O2    
1884 N N3    . DC  C 7  ? 0.4148 0.3846 0.2849 0.0148  -0.0747 -0.0092 7   DC  C N3    
1885 C C4    . DC  C 7  ? 0.4629 0.3913 0.2984 0.0222  -0.0839 -0.0042 7   DC  C C4    
1886 N N4    . DC  C 7  ? 0.4465 0.3523 0.2540 0.0093  -0.0645 0.0155  7   DC  C N4    
1887 C C5    . DC  C 7  ? 0.5067 0.4127 0.3368 0.0432  -0.1160 -0.0211 7   DC  C C5    
1888 C C6    . DC  C 7  ? 0.4838 0.4217 0.3531 0.0555  -0.1341 -0.0466 7   DC  C C6    
1900 P P     . DC  C 8  ? 0.6044 0.6400 0.6296 0.1094  -0.2274 -0.1671 8   DC  C P     
1901 O OP1   . DC  C 8  ? 0.5976 0.6884 0.6998 0.1145  -0.2426 -0.2087 8   DC  C OP1   
1902 O OP2   . DC  C 8  ? 0.6802 0.6392 0.6329 0.1343  -0.2574 -0.1576 8   DC  C OP2   
1903 O "O5'" . DC  C 8  ? 0.6059 0.6286 0.6002 0.0896  -0.2012 -0.1361 8   DC  C "O5'" 
1904 C "C5'" . DC  C 8  ? 0.5334 0.6054 0.5702 0.0604  -0.1690 -0.1289 8   DC  C "C5'" 
1905 C "C4'" . DC  C 8  ? 0.4978 0.5439 0.4967 0.0484  -0.1519 -0.1002 8   DC  C "C4'" 
1906 O "O4'" . DC  C 8  ? 0.4942 0.5131 0.4467 0.0421  -0.1331 -0.0726 8   DC  C "O4'" 
1907 C "C3'" . DC  C 8  ? 0.5376 0.5410 0.4976 0.0680  -0.1753 -0.1036 8   DC  C "C3'" 
1908 O "O3'" . DC  C 8  ? 0.5411 0.5629 0.5288 0.0562  -0.1694 -0.1051 8   DC  C "O3'" 
1909 C "C2'" . DC  C 8  ? 0.5501 0.5011 0.4337 0.0710  -0.1658 -0.0766 8   DC  C "C2'" 
1910 C "C1'" . DC  C 8  ? 0.5188 0.4931 0.4159 0.0477  -0.1330 -0.0568 8   DC  C "C1'" 
1911 N N1    . DC  C 8  ? 0.5190 0.4558 0.3637 0.0482  -0.1239 -0.0378 8   DC  C N1    
1912 C C2    . DC  C 8  ? 0.5002 0.4268 0.3185 0.0335  -0.0974 -0.0161 8   DC  C C2    
1913 O O2    . DC  C 8  ? 0.4745 0.4199 0.3111 0.0239  -0.0856 -0.0136 8   DC  C O2    
1914 N N3    . DC  C 8  ? 0.4968 0.3920 0.2735 0.0301  -0.0873 -0.0009 8   DC  C N3    
1915 C C4    . DC  C 8  ? 0.5379 0.4053 0.2943 0.0413  -0.1053 -0.0037 8   DC  C C4    
1916 N N4    . DC  C 8  ? 0.5763 0.4084 0.2921 0.0342  -0.0949 0.0130  8   DC  C N4    
1917 C C5    . DC  C 8  ? 0.5539 0.4286 0.3357 0.0602  -0.1367 -0.0268 8   DC  C C5    
1918 C C6    . DC  C 8  ? 0.5295 0.4431 0.3578 0.0625  -0.1433 -0.0445 8   DC  C C6    
1930 P P     . DT  C 9  ? 0.6174 0.6090 0.5820 0.0755  -0.1949 -0.1170 9   DT  C P     
1931 O OP1   . DT  C 9  ? 0.6129 0.6403 0.6381 0.0597  -0.1923 -0.1277 9   DT  C OP1   
1932 O OP2   . DT  C 9  ? 0.6276 0.5888 0.5652 0.1055  -0.2305 -0.1364 9   DT  C OP2   
1933 O "O5'" . DT  C 9  ? 0.5888 0.5417 0.4870 0.0733  -0.1775 -0.0906 9   DT  C "O5'" 
1934 C "C5'" . DT  C 9  ? 0.5282 0.4991 0.4432 0.0512  -0.1507 -0.0738 9   DT  C "C5'" 
1935 C "C4'" . DT  C 9  ? 0.5423 0.4820 0.3998 0.0531  -0.1363 -0.0582 9   DT  C "C4'" 
1936 O "O4'" . DT  C 9  ? 0.5495 0.4714 0.3683 0.0506  -0.1223 -0.0424 9   DT  C "O4'" 
1937 C "C3'" . DT  C 9  ? 0.6079 0.5124 0.4154 0.0740  -0.1546 -0.0696 9   DT  C "C3'" 
1938 O "O3'" . DT  C 9  ? 0.6307 0.5405 0.4427 0.0702  -0.1461 -0.0715 9   DT  C "O3'" 
1939 C "C2'" . DT  C 9  ? 0.6326 0.4949 0.3644 0.0797  -0.1480 -0.0559 9   DT  C "C2'" 
1940 C "C1'" . DT  C 9  ? 0.5967 0.4774 0.3461 0.0592  -0.1194 -0.0367 9   DT  C "C1'" 
1941 N N1    . DT  C 9  ? 0.6043 0.4540 0.3097 0.0599  -0.1171 -0.0242 9   DT  C N1    
1942 C C2    . DT  C 9  ? 0.6126 0.4521 0.2890 0.0446  -0.0884 -0.0060 9   DT  C C2    
1943 O O2    . DT  C 9  ? 0.6005 0.4582 0.2867 0.0329  -0.0655 -0.0028 9   DT  C O2    
1944 N N3    . DT  C 9  ? 0.6260 0.4325 0.2653 0.0439  -0.0898 0.0055  9   DT  C N3    
1945 C C4    . DT  C 9  ? 0.6547 0.4363 0.2834 0.0599  -0.1201 -0.0008 9   DT  C C4    
1946 O O4    . DT  C 9  ? 0.7105 0.4570 0.3051 0.0588  -0.1231 0.0101  9   DT  C O4    
1947 C C5    . DT  C 9  ? 0.6751 0.4744 0.3402 0.0782  -0.1504 -0.0241 9   DT  C C5    
1948 C C7    . DT  C 9  ? 0.7384 0.5182 0.4050 0.1000  -0.1887 -0.0402 9   DT  C C7    
1949 C C6    . DT  C 9  ? 0.6112 0.4446 0.3135 0.0756  -0.1456 -0.0338 9   DT  C C6    
1962 P P     . DC  C 10 ? 0.6792 0.5644 0.4524 0.0904  -0.1641 -0.0895 10  DC  C P     
1963 O OP1   . DC  C 10 ? 0.6454 0.5528 0.4669 0.0858  -0.1664 -0.1000 10  DC  C OP1   
1964 O OP2   . DC  C 10 ? 0.6987 0.5619 0.4526 0.1116  -0.1970 -0.1049 10  DC  C OP2   
1965 O "O5'" . DC  C 10 ? 0.7005 0.5605 0.4010 0.0880  -0.1385 -0.0770 10  DC  C "O5'" 
1966 C "C5'" . DC  C 10 ? 0.6313 0.5130 0.3499 0.0702  -0.1077 -0.0666 10  DC  C "C5'" 
1967 C "C4'" . DC  C 10 ? 0.6527 0.5125 0.3043 0.0639  -0.0809 -0.0561 10  DC  C "C4'" 
1968 O "O4'" . DC  C 10 ? 0.6527 0.4968 0.2861 0.0555  -0.0744 -0.0367 10  DC  C "O4'" 
1969 C "C3'" . DC  C 10 ? 0.7124 0.5334 0.2824 0.0779  -0.0876 -0.0649 10  DC  C "C3'" 
1970 O "O3'" . DC  C 10 ? 0.7556 0.5924 0.3224 0.0802  -0.0759 -0.0829 10  DC  C "O3'" 
1971 C "C2'" . DC  C 10 ? 0.7572 0.5426 0.2573 0.0658  -0.0670 -0.0440 10  DC  C "C2'" 
1972 C "C1'" . DC  C 10 ? 0.7281 0.5339 0.2811 0.0517  -0.0586 -0.0275 10  DC  C "C1'" 
1973 N N1    . DC  C 10 ? 0.7610 0.5279 0.2778 0.0551  -0.0739 -0.0137 10  DC  C N1    
1974 C C2    . DC  C 10 ? 0.7822 0.5286 0.2662 0.0379  -0.0515 0.0061  10  DC  C C2    
1975 O O2    . DC  C 10 ? 0.7254 0.4921 0.2157 0.0191  -0.0171 0.0100  10  DC  C O2    
1976 N N3    . DC  C 10 ? 0.8203 0.5251 0.2711 0.0430  -0.0707 0.0172  10  DC  C N3    
1977 C C4    . DC  C 10 ? 0.8486 0.5366 0.3011 0.0662  -0.1109 0.0062  10  DC  C C4    
1978 N N4    . DC  C 10 ? 0.9007 0.5474 0.3256 0.0736  -0.1332 0.0134  10  DC  C N4    
1979 C C5    . DC  C 10 ? 0.8203 0.5342 0.3099 0.0831  -0.1321 -0.0160 10  DC  C C5    
1980 C C6    . DC  C 10 ? 0.7717 0.5220 0.2900 0.0759  -0.1124 -0.0236 10  DC  C C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  391 ?   ?   ?   A . n 
A 1 2  PRO 2  392 ?   ?   ?   A . n 
A 1 3  LEU 3  393 ?   ?   ?   A . n 
A 1 4  GLY 4  394 ?   ?   ?   A . n 
A 1 5  SER 5  395 ?   ?   ?   A . n 
A 1 6  ARG 6  396 ?   ?   ?   A . n 
A 1 7  THR 7  397 ?   ?   ?   A . n 
A 1 8  ALA 8  398 ?   ?   ?   A . n 
A 1 9  THR 9  399 399 THR THR A . n 
A 1 10 HIS 10 400 400 HIS HIS A . n 
A 1 11 THR 11 401 401 THR THR A . n 
A 1 12 CYS 12 402 402 CYS CYS A . n 
A 1 13 ASP 13 403 403 ASP ASP A . n 
A 1 14 TYR 14 404 404 TYR TYR A . n 
A 1 15 ALA 15 405 405 ALA ALA A . n 
A 1 16 GLY 16 406 406 GLY GLY A . n 
A 1 17 CYS 17 407 407 CYS CYS A . n 
A 1 18 GLY 18 408 408 GLY GLY A . n 
A 1 19 LYS 19 409 409 LYS LYS A . n 
A 1 20 THR 20 410 410 THR THR A . n 
A 1 21 TYR 21 411 411 TYR TYR A . n 
A 1 22 THR 22 412 412 THR THR A . n 
A 1 23 LYS 23 413 413 LYS LYS A . n 
A 1 24 SER 24 414 414 SER SER A . n 
A 1 25 SER 25 415 415 SER SER A . n 
A 1 26 HIS 26 416 416 HIS HIS A . n 
A 1 27 LEU 27 417 417 LEU LEU A . n 
A 1 28 LYS 28 418 418 LYS LYS A . n 
A 1 29 ALA 29 419 419 ALA ALA A . n 
A 1 30 HIS 30 420 420 HIS HIS A . n 
A 1 31 LEU 31 421 421 LEU LEU A . n 
A 1 32 ARG 32 422 422 ARG ARG A . n 
A 1 33 THR 33 423 423 THR THR A . n 
A 1 34 HIS 34 424 424 HIS HIS A . n 
A 1 35 THR 35 425 425 THR THR A . n 
A 1 36 GLY 36 426 426 GLY GLY A . n 
A 1 37 GLU 37 427 427 GLU GLU A . n 
A 1 38 LYS 38 428 428 LYS LYS A . n 
A 1 39 PRO 39 429 429 PRO PRO A . n 
A 1 40 TYR 40 430 430 TYR TYR A . n 
A 1 41 HIS 41 431 431 HIS HIS A . n 
A 1 42 CYS 42 432 432 CYS CYS A . n 
A 1 43 ASP 43 433 433 ASP ASP A . n 
A 1 44 TRP 44 434 434 TRP TRP A . n 
A 1 45 ASP 45 435 435 ASP ASP A . n 
A 1 46 GLY 46 436 436 GLY GLY A . n 
A 1 47 CYS 47 437 437 CYS CYS A . n 
A 1 48 GLY 48 438 438 GLY GLY A . n 
A 1 49 TRP 49 439 439 TRP TRP A . n 
A 1 50 LYS 50 440 440 LYS LYS A . n 
A 1 51 PHE 51 441 441 PHE PHE A . n 
A 1 52 ALA 52 442 442 ALA ALA A . n 
A 1 53 ARG 53 443 443 ARG ARG A . n 
A 1 54 SER 54 444 444 SER SER A . n 
A 1 55 ASP 55 445 445 ASP ASP A . n 
A 1 56 GLU 56 446 446 GLU GLU A . n 
A 1 57 LEU 57 447 447 LEU LEU A . n 
A 1 58 THR 58 448 448 THR THR A . n 
A 1 59 ARG 59 449 449 ARG ARG A . n 
A 1 60 HIS 60 450 450 HIS HIS A . n 
A 1 61 TYR 61 451 451 TYR TYR A . n 
A 1 62 ARG 62 452 452 ARG ARG A . n 
A 1 63 LYS 63 453 453 LYS LYS A . n 
A 1 64 HIS 64 454 454 HIS HIS A . n 
A 1 65 THR 65 455 455 THR THR A . n 
A 1 66 GLY 66 456 456 GLY GLY A . n 
A 1 67 HIS 67 457 457 HIS HIS A . n 
A 1 68 ARG 68 458 458 ARG ARG A . n 
A 1 69 PRO 69 459 459 PRO PRO A . n 
A 1 70 PHE 70 460 460 PHE PHE A . n 
A 1 71 GLN 71 461 461 GLN GLN A . n 
A 1 72 CYS 72 462 462 CYS CYS A . n 
A 1 73 GLN 73 463 463 GLN GLN A . n 
A 1 74 LYS 74 464 464 LYS LYS A . n 
A 1 75 CYS 75 465 465 CYS CYS A . n 
A 1 76 ASP 76 466 466 ASP ASP A . n 
A 1 77 ARG 77 467 467 ARG ARG A . n 
A 1 78 ALA 78 468 468 ALA ALA A . n 
A 1 79 PHE 79 469 469 PHE PHE A . n 
A 1 80 SER 80 470 470 SER SER A . n 
A 1 81 ARG 81 471 471 ARG ARG A . n 
A 1 82 SER 82 472 472 SER SER A . n 
A 1 83 ASP 83 473 473 ASP ASP A . n 
A 1 84 HIS 84 474 474 HIS HIS A . n 
A 1 85 LEU 85 475 475 LEU LEU A . n 
A 1 86 ALA 86 476 476 ALA ALA A . n 
A 1 87 LEU 87 477 477 LEU LEU A . n 
A 1 88 HIS 88 478 478 HIS HIS A . n 
A 1 89 MET 89 479 479 MET MET A . n 
A 1 90 LYS 90 480 480 LYS LYS A . n 
A 1 91 ARG 91 481 481 ARG ARG A . n 
A 1 92 HIS 92 482 482 HIS HIS A . n 
A 1 93 PHE 93 483 483 PHE PHE A . n 
B 2 1  DG  1  1   1   DG  DG  B . n 
B 2 2  DA  2  2   2   DA  DA  B . n 
B 2 3  DG  3  3   3   DG  DG  B . n 
B 2 4  DG  4  4   4   DG  DG  B . n 
B 2 5  DT  5  5   5   DT  DT  B . n 
B 2 6  DG  6  6   6   DG  DG  B . n 
B 2 7  DT  7  7   7   DT  DT  B . n 
B 2 8  DG  8  8   8   DG  DG  B . n 
B 2 9  DG  9  9   9   DG  DG  B . n 
B 2 10 DC  10 10  10  DC  DC  B . n 
C 3 1  DG  1  1   1   DG  DG  C . n 
C 3 2  DC  2  2   2   DC  DC  C . n 
C 3 3  DC  3  3   3   DC  DC  C . n 
C 3 4  DA  4  4   4   DA  DA  C . n 
C 3 5  DC  5  5   5   DC  DC  C . n 
C 3 6  DA  6  6   6   DA  DA  C . n 
C 3 7  DC  7  7   7   DC  DC  C . n 
C 3 8  DC  8  8   8   DC  DC  C . n 
C 3 9  DT  9  9   9   DT  DT  C . n 
C 3 10 DC  10 10  10  DC  DC  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1  501 503 ZN  ZN  A . 
E 4 ZN  1  502 504 ZN  ZN  A . 
F 4 ZN  1  503 505 ZN  ZN  A . 
G 5 HOH 1  601 27  HOH HOH A . 
G 5 HOH 2  602 57  HOH HOH A . 
G 5 HOH 3  603 46  HOH HOH A . 
G 5 HOH 4  604 80  HOH HOH A . 
G 5 HOH 5  605 66  HOH HOH A . 
G 5 HOH 6  606 11  HOH HOH A . 
G 5 HOH 7  607 76  HOH HOH A . 
G 5 HOH 8  608 22  HOH HOH A . 
G 5 HOH 9  609 48  HOH HOH A . 
G 5 HOH 10 610 15  HOH HOH A . 
G 5 HOH 11 611 54  HOH HOH A . 
G 5 HOH 12 612 81  HOH HOH A . 
G 5 HOH 13 613 29  HOH HOH A . 
G 5 HOH 14 614 6   HOH HOH A . 
G 5 HOH 15 615 33  HOH HOH A . 
G 5 HOH 16 616 21  HOH HOH A . 
G 5 HOH 17 617 72  HOH HOH A . 
G 5 HOH 18 618 58  HOH HOH A . 
G 5 HOH 19 619 34  HOH HOH A . 
G 5 HOH 20 620 14  HOH HOH A . 
G 5 HOH 21 621 44  HOH HOH A . 
G 5 HOH 22 622 12  HOH HOH A . 
G 5 HOH 23 623 56  HOH HOH A . 
G 5 HOH 24 624 8   HOH HOH A . 
G 5 HOH 25 625 28  HOH HOH A . 
G 5 HOH 26 626 47  HOH HOH A . 
G 5 HOH 27 627 19  HOH HOH A . 
G 5 HOH 28 628 3   HOH HOH A . 
G 5 HOH 29 629 38  HOH HOH A . 
G 5 HOH 30 630 42  HOH HOH A . 
G 5 HOH 31 631 23  HOH HOH A . 
G 5 HOH 32 632 73  HOH HOH A . 
G 5 HOH 33 633 37  HOH HOH A . 
G 5 HOH 34 634 4   HOH HOH A . 
G 5 HOH 35 635 20  HOH HOH A . 
G 5 HOH 36 636 75  HOH HOH A . 
G 5 HOH 37 637 7   HOH HOH A . 
G 5 HOH 38 638 83  HOH HOH A . 
G 5 HOH 39 639 70  HOH HOH A . 
G 5 HOH 40 640 35  HOH HOH A . 
G 5 HOH 41 641 13  HOH HOH A . 
G 5 HOH 42 642 5   HOH HOH A . 
G 5 HOH 43 643 85  HOH HOH A . 
G 5 HOH 44 644 74  HOH HOH A . 
G 5 HOH 45 645 65  HOH HOH A . 
G 5 HOH 46 646 41  HOH HOH A . 
G 5 HOH 47 647 61  HOH HOH A . 
G 5 HOH 48 648 84  HOH HOH A . 
G 5 HOH 49 649 64  HOH HOH A . 
G 5 HOH 50 650 82  HOH HOH A . 
G 5 HOH 51 651 52  HOH HOH A . 
H 5 HOH 1  101 86  HOH HOH B . 
H 5 HOH 2  102 50  HOH HOH B . 
H 5 HOH 3  103 2   HOH HOH B . 
H 5 HOH 4  104 77  HOH HOH B . 
H 5 HOH 5  105 24  HOH HOH B . 
H 5 HOH 6  106 31  HOH HOH B . 
H 5 HOH 7  107 59  HOH HOH B . 
H 5 HOH 8  108 18  HOH HOH B . 
H 5 HOH 9  109 45  HOH HOH B . 
H 5 HOH 10 110 1   HOH HOH B . 
H 5 HOH 11 111 30  HOH HOH B . 
H 5 HOH 12 112 39  HOH HOH B . 
H 5 HOH 13 113 62  HOH HOH B . 
H 5 HOH 14 114 55  HOH HOH B . 
H 5 HOH 15 115 25  HOH HOH B . 
H 5 HOH 16 116 9   HOH HOH B . 
H 5 HOH 17 117 10  HOH HOH B . 
H 5 HOH 18 118 63  HOH HOH B . 
H 5 HOH 19 119 36  HOH HOH B . 
I 5 HOH 1  101 78  HOH HOH C . 
I 5 HOH 2  102 71  HOH HOH C . 
I 5 HOH 3  103 43  HOH HOH C . 
I 5 HOH 4  104 79  HOH HOH C . 
I 5 HOH 5  105 32  HOH HOH C . 
I 5 HOH 6  106 26  HOH HOH C . 
I 5 HOH 7  107 60  HOH HOH C . 
I 5 HOH 8  108 17  HOH HOH C . 
I 5 HOH 9  109 49  HOH HOH C . 
I 5 HOH 10 110 16  HOH HOH C . 
I 5 HOH 11 111 40  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2910 ? 
1 MORE         -15  ? 
1 'SSA (A^2)'  8540 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 12 ? A CYS 402 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 SG  ? A CYS 17 ? A CYS 407 ? 1_555 115.3 ? 
2  SG  ? A CYS 12 ? A CYS 402 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 30 ? A HIS 420 ? 1_555 110.7 ? 
3  SG  ? A CYS 17 ? A CYS 407 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 30 ? A HIS 420 ? 1_555 103.4 ? 
4  SG  ? A CYS 12 ? A CYS 402 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 34 ? A HIS 424 ? 1_555 111.6 ? 
5  SG  ? A CYS 17 ? A CYS 407 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 34 ? A HIS 424 ? 1_555 114.8 ? 
6  NE2 ? A HIS 30 ? A HIS 420 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 34 ? A HIS 424 ? 1_555 99.5  ? 
7  SG  ? A CYS 42 ? A CYS 432 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 SG  ? A CYS 47 ? A CYS 437 ? 1_555 120.1 ? 
8  SG  ? A CYS 42 ? A CYS 432 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 60 ? A HIS 450 ? 1_555 115.5 ? 
9  SG  ? A CYS 47 ? A CYS 437 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 60 ? A HIS 450 ? 1_555 97.7  ? 
10 SG  ? A CYS 42 ? A CYS 432 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64 ? A HIS 454 ? 1_555 109.7 ? 
11 SG  ? A CYS 47 ? A CYS 437 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64 ? A HIS 454 ? 1_555 115.2 ? 
12 NE2 ? A HIS 60 ? A HIS 450 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64 ? A HIS 454 ? 1_555 95.6  ? 
13 SG  ? A CYS 72 ? A CYS 462 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG  ? A CYS 75 ? A CYS 465 ? 1_555 113.8 ? 
14 SG  ? A CYS 72 ? A CYS 462 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 478 ? 1_555 121.8 ? 
15 SG  ? A CYS 75 ? A CYS 465 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 478 ? 1_555 98.9  ? 
16 SG  ? A CYS 72 ? A CYS 462 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 92 ? A HIS 482 ? 1_555 111.7 ? 
17 SG  ? A CYS 75 ? A CYS 465 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 92 ? A HIS 482 ? 1_555 115.9 ? 
18 NE2 ? A HIS 88 ? A HIS 478 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 92 ? A HIS 482 ? 1_555 92.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-09-14 
2 'Structure model' 1 1 2016-09-21 
3 'Structure model' 1 2 2016-12-14 
4 'Structure model' 1 3 2017-09-20 
5 'Structure model' 1 4 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_audit_support 
2 5 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_audit_support.funding_organization' 
2 5 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -26.3160 -36.8602 262.8873 0.3371 0.4586 0.3708 -0.1100 -0.0790 0.0769 3.0543 6.8262 8.6627 
-4.3790 -2.8146 2.3430  -0.1346 0.6547  0.6351  -0.1078 0.0060 -0.6810 -0.1979 0.6544  0.0887  
'X-RAY DIFFRACTION' 2 ? refined -41.7697 -49.4253 272.1995 0.2627 0.3127 0.2322 -0.0184 -0.0338 0.0989 3.8014 6.0494 7.0540 1.3026 
-2.9944 -1.4023 -0.0343 -0.3633 -0.2872 0.3537  0.1849 0.3576  -0.0120 -0.3007 -0.2129 
'X-RAY DIFFRACTION' 3 ? refined -27.6379 -63.4492 283.0868 0.4399 0.3971 0.5015 0.1176  0.0594  0.0717 3.8323 6.5886 5.3338 
-2.0739 1.5319  -4.5413 -0.3637 -0.3973 -1.0016 0.5515  0.6965 0.9446  0.0634  -0.0862 -0.2926 
'X-RAY DIFFRACTION' 4 ? refined -26.4226 -49.4529 271.3599 0.3103 0.3580 0.2026 0.0417  -0.0488 0.0361 1.9133 2.1940 4.0823 0.0410 
-0.1055 1.8838  -0.1080 0.0175  0.0797  0.2341  0.2808 -0.1027 0.2191  0.2818  -0.1714 
'X-RAY DIFFRACTION' 5 ? refined -26.0895 -50.9288 272.2980 0.3100 0.3606 0.2425 -0.0262 -0.0209 0.0057 3.7654 5.4861 3.8610 0.3119 
2.2678  3.4050  0.0157  0.2396  -0.2281 0.5605  0.3569 -0.3489 0.3820  0.3890  -0.3613 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 399:427)' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 428:457)' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(chain A and resid 458:483)' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(chain B and resid 1:10)'    
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(chain C and resid 1:10)'    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_2400: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .                 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 638 ? ? O A HOH 648 ? ? 2.12 
2 1 O A HOH 649 ? ? O B HOH 118 ? ? 2.16 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_1              5 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_2              5 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DT 
_pdbx_validate_rmsd_angle.auth_seq_id_3              5 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                111.96 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.66 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 391 ? A GLY 1 
2 1 Y 1 A PRO 392 ? A PRO 2 
3 1 Y 1 A LEU 393 ? A LEU 3 
4 1 Y 1 A GLY 394 ? A GLY 4 
5 1 Y 1 A SER 395 ? A SER 5 
6 1 Y 1 A ARG 396 ? A ARG 6 
7 1 Y 1 A THR 397 ? A THR 7 
8 1 Y 1 A ALA 398 ? A ALA 8 
# 
_ndb_struct_conf_na.entry_id   5KE6 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 10 1_555 -0.422 -0.119 -0.100 -0.540  -12.634 1.540  1  B_DG1:DC10_C B 1  ? C 10 ? 19 1 
1 B DA 2  1_555 C DT 9  1_555 0.051  -0.087 0.161  0.594   -12.965 -0.111 2  B_DA2:DT9_C  B 2  ? C 9  ? 20 1 
1 B DG 3  1_555 C DC 8  1_555 -0.257 -0.222 0.373  2.739   -7.884  -1.649 3  B_DG3:DC8_C  B 3  ? C 8  ? 19 1 
1 B DG 4  1_555 C DC 7  1_555 -0.225 -0.121 -0.222 -9.590  -11.485 0.249  4  B_DG4:DC7_C  B 4  ? C 7  ? 19 1 
1 B DT 5  1_555 C DA 6  1_555 0.061  -0.150 -0.020 1.653   -9.590  3.373  5  B_DT5:DA6_C  B 5  ? C 6  ? 20 1 
1 B DG 6  1_555 C DC 5  1_555 -0.091 -0.233 -0.094 -5.631  -8.514  -2.541 6  B_DG6:DC5_C  B 6  ? C 5  ? 19 1 
1 B DT 7  1_555 C DA 4  1_555 -0.128 -0.137 0.183  -14.531 -6.307  4.988  7  B_DT7:DA4_C  B 7  ? C 4  ? 20 1 
1 B DG 8  1_555 C DC 3  1_555 -0.455 -0.166 -0.044 2.163   -4.004  2.704  8  B_DG8:DC3_C  B 8  ? C 3  ? 19 1 
1 B DG 9  1_555 C DC 2  1_555 -0.087 -0.148 0.260  8.451   -9.196  -5.356 9  B_DG9:DC2_C  B 9  ? C 2  ? 19 1 
1 B DC 10 1_555 C DG 1  1_555 0.176  -0.119 -0.002 1.330   -11.413 0.107  10 B_DC10:DG1_C B 10 ? C 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1 1_555 C DC 10 1_555 B DA 2  1_555 C DT 9 1_555 -0.070 -0.359 3.239 -1.971 0.788  34.393 -0.728 -0.185 3.229 1.330  3.330  
34.457 1 BB_DG1DA2:DT9DC10_CC B 1 ? C 10 ? B 2  ? C 9 ? 
1 B DA 2 1_555 C DT 9  1_555 B DG 3  1_555 C DC 8 1_555 -0.103 -0.546 3.141 -3.534 7.045  31.030 -2.194 -0.416 2.943 12.910 6.475  
31.991 2 BB_DA2DG3:DC8DT9_CC  B 2 ? C 9  ? B 3  ? C 8 ? 
1 B DG 3 1_555 C DC 8  1_555 B DG 4  1_555 C DC 7 1_555 0.304  -0.604 3.666 4.850  7.052  33.533 -2.224 0.319  3.480 11.981 -8.240 
34.577 3 BB_DG3DG4:DC7DC8_CC  B 3 ? C 8  ? B 4  ? C 7 ? 
1 B DG 4 1_555 C DC 7  1_555 B DT 5  1_555 C DA 6 1_555 0.703  -0.537 2.998 -0.433 5.892  28.201 -2.264 -1.500 2.819 11.927 0.877  
28.800 4 BB_DG4DT5:DA6DC7_CC  B 4 ? C 7  ? B 5  ? C 6 ? 
1 B DT 5 1_555 C DA 6  1_555 B DG 6  1_555 C DC 5 1_555 -1.232 -0.083 3.464 -4.778 7.409  36.140 -1.198 1.244  3.509 11.728 7.564  
37.165 5 BB_DT5DG6:DC5DA6_CC  B 5 ? C 6  ? B 6  ? C 5 ? 
1 B DG 6 1_555 C DC 5  1_555 B DT 7  1_555 C DA 4 1_555 0.997  -0.764 3.513 0.132  -0.271 34.079 -1.257 -1.678 3.522 -0.463 -0.225 
34.081 6 BB_DG6DT7:DA4DC5_CC  B 6 ? C 5  ? B 7  ? C 4 ? 
1 B DT 7 1_555 C DA 4  1_555 B DG 8  1_555 C DC 3 1_555 -0.608 0.499  3.060 1.078  7.081  28.055 -0.493 1.444  3.066 14.313 -2.179 
28.938 7 BB_DT7DG8:DC3DA4_CC  B 7 ? C 4  ? B 8  ? C 3 ? 
1 B DG 8 1_555 C DC 3  1_555 B DG 9  1_555 C DC 2 1_555 -1.574 0.351  3.149 -6.250 2.348  35.820 0.234  1.645  3.382 3.778  10.055 
36.417 8 BB_DG8DG9:DC2DC3_CC  B 8 ? C 3  ? B 9  ? C 2 ? 
1 B DG 9 1_555 C DC 2  1_555 B DC 10 1_555 C DG 1 1_555 0.985  -0.466 3.450 3.208  -2.049 35.813 -0.442 -1.105 3.542 -3.320 -5.199 
36.008 9 BB_DG9DC10:DG1DC2_CC B 9 ? C 2  ? B 10 ? C 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM049245 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#