data_5KEA
# 
_entry.id   5KEA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KEA         
WWPDB D_1000222053 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5KE6 PDB . 
unspecified 5KE7 PDB . 
unspecified 5KE8 PDB . 
unspecified 5KE9 PDB . 
unspecified 5KEB PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KEA 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Hashimoto, H.' 1 ? 
'Cheng, X.'     2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            44 
_citation.language                  ? 
_citation.page_first                10177 
_citation.page_last                 10185 
_citation.title                     'Distinctive Klf4 mutants determine preference for DNA methylation status.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkw774 
_citation.pdbx_database_id_PubMed   27596594 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hashimoto, H.'    1 ? 
primary 'Wang, D.'         2 ? 
primary 'Steves, A.N.'     3 ? 
primary 'Jin, P.'          4 ? 
primary 'Blumenthal, R.M.' 5 ? 
primary 'Zhang, X.'        6 ? 
primary 'Cheng, X.'        7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5KEA 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     50.850 
_cell.length_a_esd                 ? 
_cell.length_b                     50.850 
_cell.length_b_esd                 ? 
_cell.length_c                     131.050 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5KEA 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Krueppel-like factor 4'                       10826.235 1  ? E446D 'unp residues 396-483' ? 
2 polymer     syn 
;DNA (5'-D(*GP*AP*GP*GP*CP*GP*TP*GP*GP*C)-3')
;
3126.040  1  ? ?     ?                      ? 
3 polymer     syn 
;DNA (5'-D(*GP*CP*CP*AP*CP*GP*CP*CP*TP*C)-3')
;
2965.945  1  ? ?     ?                      ? 
4 non-polymer syn 'ZINC ION'                                     65.409    3  ? ?     ?                      ? 
5 water       nat water                                          18.015    15 ? ?     ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Epithelial zinc finger protein EZF,Gut-enriched krueppel-like factor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPLGSRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDDLTRHYRKHTGHRPFQCQKCDRAFS
RSDHLALHMKRHF
;
;GPLGSRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDDLTRHYRKHTGHRPFQCQKCDRAFS
RSDHLALHMKRHF
;
A ? 
2 polydeoxyribonucleotide no no '(DG)(DA)(DG)(DG)(DC)(DG)(DT)(DG)(DG)(DC)'                                                       
GAGGCGTGGC                                                                                       B ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DA)(DC)(DG)(DC)(DC)(DT)(DC)'                                                       
GCCACGCCTC                                                                                       C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  ARG n 
1 7  THR n 
1 8  ALA n 
1 9  THR n 
1 10 HIS n 
1 11 THR n 
1 12 CYS n 
1 13 ASP n 
1 14 TYR n 
1 15 ALA n 
1 16 GLY n 
1 17 CYS n 
1 18 GLY n 
1 19 LYS n 
1 20 THR n 
1 21 TYR n 
1 22 THR n 
1 23 LYS n 
1 24 SER n 
1 25 SER n 
1 26 HIS n 
1 27 LEU n 
1 28 LYS n 
1 29 ALA n 
1 30 HIS n 
1 31 LEU n 
1 32 ARG n 
1 33 THR n 
1 34 HIS n 
1 35 THR n 
1 36 GLY n 
1 37 GLU n 
1 38 LYS n 
1 39 PRO n 
1 40 TYR n 
1 41 HIS n 
1 42 CYS n 
1 43 ASP n 
1 44 TRP n 
1 45 ASP n 
1 46 GLY n 
1 47 CYS n 
1 48 GLY n 
1 49 TRP n 
1 50 LYS n 
1 51 PHE n 
1 52 ALA n 
1 53 ARG n 
1 54 SER n 
1 55 ASP n 
1 56 ASP n 
1 57 LEU n 
1 58 THR n 
1 59 ARG n 
1 60 HIS n 
1 61 TYR n 
1 62 ARG n 
1 63 LYS n 
1 64 HIS n 
1 65 THR n 
1 66 GLY n 
1 67 HIS n 
1 68 ARG n 
1 69 PRO n 
1 70 PHE n 
1 71 GLN n 
1 72 CYS n 
1 73 GLN n 
1 74 LYS n 
1 75 CYS n 
1 76 ASP n 
1 77 ARG n 
1 78 ALA n 
1 79 PHE n 
1 80 SER n 
1 81 ARG n 
1 82 SER n 
1 83 ASP n 
1 84 HIS n 
1 85 LEU n 
1 86 ALA n 
1 87 LEU n 
1 88 HIS n 
1 89 MET n 
1 90 LYS n 
1 91 ARG n 
1 92 HIS n 
1 93 PHE n 
2 1  DG  n 
2 2  DA  n 
2 3  DG  n 
2 4  DG  n 
2 5  DC  n 
2 6  DG  n 
2 7  DT  n 
2 8  DG  n 
2 9  DG  n 
2 10 DC  n 
3 1  DG  n 
3 2  DC  n 
3 3  DC  n 
3 4  DA  n 
3 5  DC  n 
3 6  DG  n 
3 7  DC  n 
3 8  DC  n 
3 9  DT  n 
3 10 DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   93 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Klf4, Ezf, Gklf, Zie' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) codon plus' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pGEX-6p-11 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pXC1411 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 10 'synthetic construct' ? 32630 ? 
3 1 sample 1 10 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP KLF4_MOUSE Q60793 ? 1 
;RTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHL
ALHMKRHF
;
396 
2 PDB 5KEA       5KEA   ? 2 ?                                                                                           1   
3 PDB 5KEA       5KEA   ? 3 ?                                                                                           1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KEA A 6 ? 93 ? Q60793 396 ? 483 ? 396 483 
2 2 5KEA B 1 ? 10 ? 5KEA   1   ? 10  ? 1   10  
3 3 5KEA C 1 ? 10 ? 5KEA   1   ? 10  ? 1   10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KEA GLY A 1  ? UNP Q60793 ?   ?   'expression tag'      391 1 
1 5KEA PRO A 2  ? UNP Q60793 ?   ?   'expression tag'      392 2 
1 5KEA LEU A 3  ? UNP Q60793 ?   ?   'expression tag'      393 3 
1 5KEA GLY A 4  ? UNP Q60793 ?   ?   'expression tag'      394 4 
1 5KEA SER A 5  ? UNP Q60793 ?   ?   'expression tag'      395 5 
1 5KEA ASP A 56 ? UNP Q60793 GLU 446 'engineered mutation' 446 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KEA 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.51 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.92 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M Tris-HCl pH8.5 , 0.25M NaCl and 20% polyethylene glycol 8000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-04-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5KEA 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.45 
_reflns.d_resolution_low                 47.7 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       6808 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3 
_reflns.percent_possible_obs             98 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.1 
_reflns.pdbx_Rmerge_I_obs                0.054 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.37 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.46 
_reflns_shell.d_res_low                   2.52 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.03 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        7.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5KEA 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.458 
_refine.ls_d_res_low                             47.406 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     5174 
_refine.ls_number_reflns_R_free                  518 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    76.23 
_refine.ls_percent_reflns_R_free                 10.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2346 
_refine.ls_R_factor_R_free                       0.2828 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2289 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4M9E 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.32 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.37 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        718 
_refine_hist.pdbx_number_atoms_nucleic_acid   404 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             15 
_refine_hist.number_atoms_total               1140 
_refine_hist.d_res_high                       2.458 
_refine_hist.d_res_low                        47.406 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.020  ? 1207 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.540  ? 1690 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 23.046 ? 458  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.036  ? 173  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 147  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4582 2.7055 . . 33  292  20.00 5 . . 0.5378 . 0.4140 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7055 3.0969 . . 140 1264 85.00 5 . . 0.3612 . 0.3314 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0969 3.9015 . . 166 1495 99.00 5 . . 0.3135 . 0.2318 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9015 47.4   . . 179 1605 99.00 5 . . 0.2355 . 0.1913 . . . . . . . . . . 
# 
_struct.entry_id                     5KEA 
_struct.title                        'mouse Klf4 ZnF1-3 (E446D) and CpG/CpG sequence DNA complex structure: Form I' 
_struct.pdbx_descriptor              'Krueppel-like factor 4/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KEA 
_struct_keywords.text            'Klf4, zinc finger, unmethylated cytosine specific, transcription factor-DNA complex' 
_struct_keywords.pdbx_keywords   'transcription factor/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 LYS A 23 ? THR A 35 ? LYS A 413 THR A 425 1 ? 13 
HELX_P HELX_P2 AA2 ARG A 53 ? GLY A 66 ? ARG A 443 GLY A 456 1 ? 14 
HELX_P HELX_P3 AA3 ARG A 81 ? LYS A 90 ? ARG A 471 LYS A 480 1 ? 10 
HELX_P HELX_P4 AA4 ARG A 91 ? PHE A 93 ? ARG A 481 PHE A 483 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 12 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 402 A ZN 501 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc2  metalc ? ? A CYS 17 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 407 A ZN 501 1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc3  metalc ? ? A HIS 30 NE2 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 420 A ZN 501 1_555 ? ? ? ? ? ? ?            2.027 ? 
metalc4  metalc ? ? A HIS 34 NE2 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 424 A ZN 501 1_555 ? ? ? ? ? ? ?            2.022 ? 
metalc5  metalc ? ? A CYS 42 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 432 A ZN 502 1_555 ? ? ? ? ? ? ?            2.245 ? 
metalc6  metalc ? ? A CYS 47 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 437 A ZN 502 1_555 ? ? ? ? ? ? ?            2.253 ? 
metalc7  metalc ? ? A HIS 60 NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 450 A ZN 502 1_555 ? ? ? ? ? ? ?            2.022 ? 
metalc8  metalc ? ? A HIS 64 NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 454 A ZN 502 1_555 ? ? ? ? ? ? ?            2.016 ? 
metalc9  metalc ? ? A CYS 72 SG  ? ? ? 1_555 F ZN .  ZN ? ? A CYS 462 A ZN 503 1_555 ? ? ? ? ? ? ?            2.394 ? 
metalc10 metalc ? ? A CYS 75 SG  ? ? ? 1_555 F ZN .  ZN ? ? A CYS 465 A ZN 503 1_555 ? ? ? ? ? ? ?            2.927 ? 
metalc11 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 F ZN .  ZN ? ? A HIS 478 A ZN 503 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc12 metalc ? ? A HIS 92 NE2 ? ? ? 1_555 F ZN .  ZN ? ? A HIS 482 A ZN 503 1_555 ? ? ? ? ? ? ?            2.043 ? 
hydrog1  hydrog ? ? B DG  1  N1  ? ? ? 1_555 C DC 10 N3 ? ? B DG  1   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1  N2  ? ? ? 1_555 C DC 10 O2 ? ? B DG  1   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1  O6  ? ? ? 1_555 C DC 10 N4 ? ? B DG  1   C DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  2  N1  ? ? ? 1_555 C DT 9  N3 ? ? B DA  2   C DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA  2  N6  ? ? ? 1_555 C DT 9  O4 ? ? B DA  2   C DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  3  N1  ? ? ? 1_555 C DC 8  N3 ? ? B DG  3   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3  N2  ? ? ? 1_555 C DC 8  O2 ? ? B DG  3   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3  O6  ? ? ? 1_555 C DC 8  N4 ? ? B DG  3   C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  4  N1  ? ? ? 1_555 C DC 7  N3 ? ? B DG  4   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  4  N2  ? ? ? 1_555 C DC 7  O2 ? ? B DG  4   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  4  O6  ? ? ? 1_555 C DC 7  N4 ? ? B DG  4   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  5  O2  ? ? ? 1_555 C DG 6  N2 ? ? B DC  5   C DG 6   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog13 hydrog ? ? B DG  6  N1  ? ? ? 1_555 C DC 5  N3 ? ? B DG  6   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  6  N2  ? ? ? 1_555 C DC 5  O2 ? ? B DG  6   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  6  O6  ? ? ? 1_555 C DC 5  N4 ? ? B DG  6   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DT  7  N3  ? ? ? 1_555 C DA 4  N1 ? ? B DT  7   C DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  7  O4  ? ? ? 1_555 C DA 4  N6 ? ? B DT  7   C DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  8  N1  ? ? ? 1_555 C DC 3  N3 ? ? B DG  8   C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  8  N2  ? ? ? 1_555 C DC 3  O2 ? ? B DG  8   C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  8  O6  ? ? ? 1_555 C DC 3  N4 ? ? B DG  8   C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  9  N1  ? ? ? 1_555 C DC 2  N3 ? ? B DG  9   C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  9  N2  ? ? ? 1_555 C DC 2  O2 ? ? B DG  9   C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9  O6  ? ? ? 1_555 C DC 2  N4 ? ? B DG  9   C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  10 N3  ? ? ? 1_555 C DG 1  N1 ? ? B DC  10  C DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  10 N4  ? ? ? 1_555 C DG 1  O6 ? ? B DC  10  C DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  10 O2  ? ? ? 1_555 C DG 1  N2 ? ? B DC  10  C DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 10 ? THR A 11 ? HIS A 400 THR A 401 
AA1 2 THR A 20 ? TYR A 21 ? THR A 410 TYR A 411 
AA2 1 TYR A 40 ? HIS A 41 ? TYR A 430 HIS A 431 
AA2 2 LYS A 50 ? PHE A 51 ? LYS A 440 PHE A 441 
AA3 1 PHE A 70 ? GLN A 71 ? PHE A 460 GLN A 461 
AA3 2 ALA A 78 ? PHE A 79 ? ALA A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 10 ? N HIS A 400 O TYR A 21 ? O TYR A 411 
AA2 1 2 N TYR A 40 ? N TYR A 430 O PHE A 51 ? O PHE A 441 
AA3 1 2 N PHE A 70 ? N PHE A 460 O PHE A 79 ? O PHE A 469 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 501 ? 4 'binding site for residue ZN A 501' 
AC2 Software A ZN 502 ? 4 'binding site for residue ZN A 502' 
AC3 Software A ZN 503 ? 4 'binding site for residue ZN A 503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 12 ? CYS A 402 . ? 1_555 ? 
2  AC1 4 CYS A 17 ? CYS A 407 . ? 1_555 ? 
3  AC1 4 HIS A 30 ? HIS A 420 . ? 1_555 ? 
4  AC1 4 HIS A 34 ? HIS A 424 . ? 1_555 ? 
5  AC2 4 CYS A 42 ? CYS A 432 . ? 1_555 ? 
6  AC2 4 CYS A 47 ? CYS A 437 . ? 1_555 ? 
7  AC2 4 HIS A 60 ? HIS A 450 . ? 1_555 ? 
8  AC2 4 HIS A 64 ? HIS A 454 . ? 1_555 ? 
9  AC3 4 CYS A 72 ? CYS A 462 . ? 1_555 ? 
10 AC3 4 CYS A 75 ? CYS A 465 . ? 1_555 ? 
11 AC3 4 HIS A 88 ? HIS A 478 . ? 1_555 ? 
12 AC3 4 HIS A 92 ? HIS A 482 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KEA 
_atom_sites.fract_transf_matrix[1][1]   0.019666 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019666 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007631 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N      . THR A 1 7  ? 8.456   -14.108 -13.735 1.00 97.28  ? 397 THR A N      1 
ATOM   2    C  CA     . THR A 1 7  ? 9.709   -14.768 -13.384 1.00 101.47 ? 397 THR A CA     1 
ATOM   3    C  C      . THR A 1 7  ? 10.218  -14.308 -12.018 1.00 97.74  ? 397 THR A C      1 
ATOM   4    O  O      . THR A 1 7  ? 11.259  -14.768 -11.548 1.00 98.20  ? 397 THR A O      1 
ATOM   5    C  CB     . THR A 1 7  ? 10.801  -14.499 -14.440 1.00 106.30 ? 397 THR A CB     1 
ATOM   6    O  OG1    . THR A 1 7  ? 11.072  -13.094 -14.508 1.00 109.90 ? 397 THR A OG1    1 
ATOM   7    C  CG2    . THR A 1 7  ? 10.360  -14.988 -15.811 1.00 106.96 ? 397 THR A CG2    1 
ATOM   8    H  HA     . THR A 1 7  ? 9.561   -15.726 -13.342 1.00 121.71 ? 397 THR A HA     1 
ATOM   9    H  HB     . THR A 1 7  ? 11.611  -14.971 -14.193 1.00 127.51 ? 397 THR A HB     1 
ATOM   10   H  HG1    . THR A 1 7  ? 10.375  -12.677 -14.722 1.00 131.83 ? 397 THR A HG1    1 
ATOM   11   H  HG21   . THR A 1 7  ? 11.069  -14.844 -16.458 1.00 128.30 ? 397 THR A HG21   1 
ATOM   12   H  HG22   . THR A 1 7  ? 10.154  -15.935 -15.774 1.00 128.30 ? 397 THR A HG22   1 
ATOM   13   H  HG23   . THR A 1 7  ? 9.569   -14.505 -16.097 1.00 128.30 ? 397 THR A HG23   1 
ATOM   14   N  N      . ALA A 1 8  ? 9.479   -13.403 -11.381 1.00 93.27  ? 398 ALA A N      1 
ATOM   15   C  CA     . ALA A 1 8  ? 9.889   -12.857 -10.095 1.00 83.24  ? 398 ALA A CA     1 
ATOM   16   C  C      . ALA A 1 8  ? 9.542   -13.814 -8.960  1.00 74.88  ? 398 ALA A C      1 
ATOM   17   O  O      . ALA A 1 8  ? 8.619   -14.628 -9.062  1.00 71.22  ? 398 ALA A O      1 
ATOM   18   C  CB     . ALA A 1 8  ? 9.220   -11.503 -9.851  1.00 72.90  ? 398 ALA A CB     1 
ATOM   19   H  H      . ALA A 1 8  ? 8.734   -13.087 -11.671 1.00 111.87 ? 398 ALA A H      1 
ATOM   20   H  HA     . ALA A 1 8  ? 10.850  -12.724 -10.096 1.00 99.83  ? 398 ALA A HA     1 
ATOM   21   H  HB1    . ALA A 1 8  ? 9.516   -11.154 -8.996  1.00 87.43  ? 398 ALA A HB1    1 
ATOM   22   H  HB2    . ALA A 1 8  ? 9.472   -10.894 -10.562 1.00 87.43  ? 398 ALA A HB2    1 
ATOM   23   H  HB3    . ALA A 1 8  ? 8.258   -11.624 -9.844  1.00 87.43  ? 398 ALA A HB3    1 
ATOM   24   N  N      . THR A 1 9  ? 10.303  -13.712 -7.873  1.00 90.36  ? 399 THR A N      1 
ATOM   25   C  CA     . THR A 1 9  ? 9.991   -14.448 -6.656  1.00 88.12  ? 399 THR A CA     1 
ATOM   26   C  C      . THR A 1 9  ? 8.961   -13.679 -5.839  1.00 81.49  ? 399 THR A C      1 
ATOM   27   O  O      . THR A 1 9  ? 9.071   -12.463 -5.656  1.00 80.23  ? 399 THR A O      1 
ATOM   28   C  CB     . THR A 1 9  ? 11.253  -14.682 -5.824  1.00 94.07  ? 399 THR A CB     1 
ATOM   29   O  OG1    . THR A 1 9  ? 11.918  -13.434 -5.592  1.00 96.08  ? 399 THR A OG1    1 
ATOM   30   C  CG2    . THR A 1 9  ? 12.196  -15.638 -6.542  1.00 97.99  ? 399 THR A CG2    1 
ATOM   31   H  H      . THR A 1 9  ? 11.007  -13.221 -7.817  1.00 108.38 ? 399 THR A H      1 
ATOM   32   H  HA     . THR A 1 9  ? 9.614   -15.311 -6.889  1.00 105.69 ? 399 THR A HA     1 
ATOM   33   H  HB     . THR A 1 9  ? 11.008  -15.078 -4.973  1.00 112.83 ? 399 THR A HB     1 
ATOM   34   H  HG1    . THR A 1 9  ? 12.612  -13.559 -5.135  1.00 115.24 ? 399 THR A HG1    1 
ATOM   35   H  HG21   . THR A 1 9  ? 12.991  -15.785 -6.005  1.00 117.53 ? 399 THR A HG21   1 
ATOM   36   H  HG22   . THR A 1 9  ? 11.755  -16.489 -6.691  1.00 117.53 ? 399 THR A HG22   1 
ATOM   37   H  HG23   . THR A 1 9  ? 12.458  -15.264 -7.398  1.00 117.53 ? 399 THR A HG23   1 
ATOM   38   N  N      . HIS A 1 10 ? 7.965   -14.400 -5.338  1.00 78.37  ? 400 HIS A N      1 
ATOM   39   C  CA     . HIS A 1 10 ? 6.795   -13.779 -4.722  1.00 75.81  ? 400 HIS A CA     1 
ATOM   40   C  C      . HIS A 1 10 ? 7.203   -13.121 -3.411  1.00 75.23  ? 400 HIS A C      1 
ATOM   41   O  O      . HIS A 1 10 ? 7.382   -13.790 -2.392  1.00 76.14  ? 400 HIS A O      1 
ATOM   42   C  CB     . HIS A 1 10 ? 5.707   -14.821 -4.504  1.00 74.74  ? 400 HIS A CB     1 
ATOM   43   C  CG     . HIS A 1 10 ? 5.518   -15.742 -5.668  1.00 73.11  ? 400 HIS A CG     1 
ATOM   44   N  ND1    . HIS A 1 10 ? 6.121   -16.980 -5.741  1.00 72.59  ? 400 HIS A ND1    1 
ATOM   45   C  CD2    . HIS A 1 10 ? 4.808   -15.601 -6.812  1.00 71.51  ? 400 HIS A CD2    1 
ATOM   46   C  CE1    . HIS A 1 10 ? 5.782   -17.566 -6.875  1.00 71.78  ? 400 HIS A CE1    1 
ATOM   47   N  NE2    . HIS A 1 10 ? 4.987   -16.750 -7.543  1.00 73.68  ? 400 HIS A NE2    1 
ATOM   48   H  H      . HIS A 1 10 ? 7.949   -15.259 -5.336  1.00 93.99  ? 400 HIS A H      1 
ATOM   49   H  HA     . HIS A 1 10 ? 6.447   -13.093 -5.313  1.00 90.92  ? 400 HIS A HA     1 
ATOM   50   H  HB2    . HIS A 1 10 ? 5.940   -15.361 -3.733  1.00 89.63  ? 400 HIS A HB2    1 
ATOM   51   H  HB3    . HIS A 1 10 ? 4.865   -14.366 -4.345  1.00 89.63  ? 400 HIS A HB3    1 
ATOM   52   H  HD2    . HIS A 1 10 ? 4.292   -14.866 -7.055  1.00 85.76  ? 400 HIS A HD2    1 
ATOM   53   H  HE1    . HIS A 1 10 ? 6.058   -18.408 -7.156  1.00 86.09  ? 400 HIS A HE1    1 
ATOM   54   H  HE2    . HIS A 1 10 ? 4.637   -16.912 -8.312  1.00 88.37  ? 400 HIS A HE2    1 
ATOM   55   N  N      . THR A 1 11 ? 7.337   -11.798 -3.434  1.00 75.34  ? 401 THR A N      1 
ATOM   56   C  CA     . THR A 1 11 ? 7.716   -11.019 -2.266  1.00 73.28  ? 401 THR A CA     1 
ATOM   57   C  C      . THR A 1 11 ? 6.665   -9.950  -2.005  1.00 65.88  ? 401 THR A C      1 
ATOM   58   O  O      . THR A 1 11 ? 6.105   -9.374  -2.944  1.00 63.79  ? 401 THR A O      1 
ATOM   59   C  CB     . THR A 1 11 ? 9.088   -10.363 -2.459  1.00 77.45  ? 401 THR A CB     1 
ATOM   60   O  OG1    . THR A 1 11 ? 10.058  -11.365 -2.787  1.00 76.50  ? 401 THR A OG1    1 
ATOM   61   C  CG2    . THR A 1 11 ? 9.525   -9.634  -1.191  1.00 81.41  ? 401 THR A CG2    1 
ATOM   62   H  H      . THR A 1 11 ? 7.209   -11.318 -4.136  1.00 90.35  ? 401 THR A H      1 
ATOM   63   H  HA     . THR A 1 11 ? 7.761   -11.598 -1.489  1.00 87.88  ? 401 THR A HA     1 
ATOM   64   H  HB     . THR A 1 11 ? 9.037   -9.717  -3.181  1.00 92.89  ? 401 THR A HB     1 
ATOM   65   H  HG1    . THR A 1 11 ? 10.812  -11.011 -2.894  1.00 91.75  ? 401 THR A HG1    1 
ATOM   66   H  HG21   . THR A 1 11 ? 10.456  -9.372  -1.264  1.00 97.64  ? 401 THR A HG21   1 
ATOM   67   H  HG22   . THR A 1 11 ? 8.985   -8.839  -1.060  1.00 97.64  ? 401 THR A HG22   1 
ATOM   68   H  HG23   . THR A 1 11 ? 9.422   -10.217 -0.423  1.00 97.64  ? 401 THR A HG23   1 
ATOM   69   N  N      . CYS A 1 12 ? 6.403   -9.689  -0.728  1.00 68.02  ? 402 CYS A N      1 
ATOM   70   C  CA     . CYS A 1 12 ? 5.424   -8.678  -0.360  1.00 67.54  ? 402 CYS A CA     1 
ATOM   71   C  C      . CYS A 1 12 ? 5.982   -7.283  -0.611  1.00 68.74  ? 402 CYS A C      1 
ATOM   72   O  O      . CYS A 1 12 ? 7.144   -6.996  -0.311  1.00 69.97  ? 402 CYS A O      1 
ATOM   73   C  CB     . CYS A 1 12 ? 5.030   -8.830  1.107   1.00 66.96  ? 402 CYS A CB     1 
ATOM   74   S  SG     . CYS A 1 12 ? 3.731   -7.695  1.626   1.00 66.37  ? 402 CYS A SG     1 
ATOM   75   H  H      . CYS A 1 12 ? 6.777   -10.082 -0.061  1.00 81.57  ? 402 CYS A H      1 
ATOM   76   H  HA     . CYS A 1 12 ? 4.628   -8.790  -0.903  1.00 80.99  ? 402 CYS A HA     1 
ATOM   77   H  HB2    . CYS A 1 12 ? 4.736   -9.739  1.275   1.00 80.30  ? 402 CYS A HB2    1 
ATOM   78   H  HB3    . CYS A 1 12 ? 5.826   -8.631  1.611   1.00 80.30  ? 402 CYS A HB3    1 
ATOM   79   N  N      . ASP A 1 13 ? 5.138   -6.409  -1.155  1.00 70.45  ? 403 ASP A N      1 
ATOM   80   C  CA     . ASP A 1 13 ? 5.535   -5.053  -1.504  1.00 85.02  ? 403 ASP A CA     1 
ATOM   81   C  C      . ASP A 1 13 ? 4.887   -4.019  -0.586  1.00 90.79  ? 403 ASP A C      1 
ATOM   82   O  O      . ASP A 1 13 ? 4.573   -2.907  -1.016  1.00 92.42  ? 403 ASP A O      1 
ATOM   83   C  CB     . ASP A 1 13 ? 5.199   -4.762  -2.965  1.00 86.22  ? 403 ASP A CB     1 
ATOM   84   C  CG     . ASP A 1 13 ? 3.778   -5.145  -3.324  1.00 86.40  ? 403 ASP A CG     1 
ATOM   85   O  OD1    . ASP A 1 13 ? 3.171   -5.945  -2.580  1.00 81.44  ? 403 ASP A OD1    1 
ATOM   86   O  OD2    . ASP A 1 13 ? 3.270   -4.659  -4.356  1.00 88.77  ? 403 ASP A OD2    1 
ATOM   87   H  H      . ASP A 1 13 ? 4.315   -6.585  -1.330  1.00 84.49  ? 403 ASP A H      1 
ATOM   88   H  HA     . ASP A 1 13 ? 6.496   -4.972  -1.404  1.00 101.98 ? 403 ASP A HA     1 
ATOM   89   H  HB2    . ASP A 1 13 ? 5.308   -3.813  -3.135  1.00 103.42 ? 403 ASP A HB2    1 
ATOM   90   H  HB3    . ASP A 1 13 ? 5.798   -5.271  -3.533  1.00 103.42 ? 403 ASP A HB3    1 
ATOM   91   N  N      . TYR A 1 14 ? 4.684   -4.378  0.678   1.00 76.35  ? 404 TYR A N      1 
ATOM   92   C  CA     . TYR A 1 14 ? 4.246   -3.440  1.703   1.00 80.17  ? 404 TYR A CA     1 
ATOM   93   C  C      . TYR A 1 14 ? 5.461   -2.974  2.492   1.00 82.67  ? 404 TYR A C      1 
ATOM   94   O  O      . TYR A 1 14 ? 6.261   -3.798  2.948   1.00 81.25  ? 404 TYR A O      1 
ATOM   95   C  CB     . TYR A 1 14 ? 3.225   -4.085  2.642   1.00 82.74  ? 404 TYR A CB     1 
ATOM   96   C  CG     . TYR A 1 14 ? 1.808   -4.106  2.112   1.00 83.09  ? 404 TYR A CG     1 
ATOM   97   C  CD1    . TYR A 1 14 ? 0.863   -3.197  2.569   1.00 82.09  ? 404 TYR A CD1    1 
ATOM   98   C  CD2    . TYR A 1 14 ? 1.413   -5.037  1.159   1.00 82.38  ? 404 TYR A CD2    1 
ATOM   99   C  CE1    . TYR A 1 14 ? -0.436  -3.212  2.092   1.00 78.84  ? 404 TYR A CE1    1 
ATOM   100  C  CE2    . TYR A 1 14 ? 0.116   -5.059  0.675   1.00 77.35  ? 404 TYR A CE2    1 
ATOM   101  C  CZ     . TYR A 1 14 ? -0.803  -4.143  1.146   1.00 75.79  ? 404 TYR A CZ     1 
ATOM   102  O  OH     . TYR A 1 14 ? -2.094  -4.157  0.670   1.00 74.08  ? 404 TYR A OH     1 
ATOM   103  H  H      . TYR A 1 14 ? 4.796   -5.178  0.972   1.00 91.57  ? 404 TYR A H      1 
ATOM   104  H  HA     . TYR A 1 14 ? 3.834   -2.668  1.285   1.00 96.15  ? 404 TYR A HA     1 
ATOM   105  H  HB2    . TYR A 1 14 ? 3.491   -5.003  2.806   1.00 99.24  ? 404 TYR A HB2    1 
ATOM   106  H  HB3    . TYR A 1 14 ? 3.219   -3.593  3.478   1.00 99.24  ? 404 TYR A HB3    1 
ATOM   107  H  HD1    . TYR A 1 14 ? 1.107   -2.567  3.208   1.00 98.46  ? 404 TYR A HD1    1 
ATOM   108  H  HD2    . TYR A 1 14 ? 2.030   -5.655  0.840   1.00 98.80  ? 404 TYR A HD2    1 
ATOM   109  H  HE1    . TYR A 1 14 ? -1.057  -2.596  2.407   1.00 94.56  ? 404 TYR A HE1    1 
ATOM   110  H  HE2    . TYR A 1 14 ? -0.134  -5.687  0.036   1.00 92.76  ? 404 TYR A HE2    1 
ATOM   111  H  HH     . TYR A 1 14 ? -2.184  -4.769  0.102   1.00 88.84  ? 404 TYR A HH     1 
ATOM   112  N  N      . ALA A 1 15 ? 5.606   -1.657  2.638   1.00 72.26  ? 405 ALA A N      1 
ATOM   113  C  CA     . ALA A 1 15 ? 6.706   -1.102  3.417   1.00 74.40  ? 405 ALA A CA     1 
ATOM   114  C  C      . ALA A 1 15 ? 6.686   -1.674  4.827   1.00 75.38  ? 405 ALA A C      1 
ATOM   115  O  O      . ALA A 1 15 ? 5.732   -1.451  5.581   1.00 73.43  ? 405 ALA A O      1 
ATOM   116  C  CB     . ALA A 1 15 ? 6.628   0.425   3.456   1.00 76.00  ? 405 ALA A CB     1 
ATOM   117  H  H      . ALA A 1 15 ? 5.082   -1.067  2.296   1.00 86.66  ? 405 ALA A H      1 
ATOM   118  H  HA     . ALA A 1 15 ? 7.547   -1.351  3.002   1.00 89.22  ? 405 ALA A HA     1 
ATOM   119  H  HB1    . ALA A 1 15 ? 7.370   0.765   3.980   1.00 91.15  ? 405 ALA A HB1    1 
ATOM   120  H  HB2    . ALA A 1 15 ? 6.678   0.767   2.549   1.00 91.15  ? 405 ALA A HB2    1 
ATOM   121  H  HB3    . ALA A 1 15 ? 5.788   0.687   3.863   1.00 91.15  ? 405 ALA A HB3    1 
ATOM   122  N  N      . GLY A 1 16 ? 7.731   -2.415  5.187   1.00 91.03  ? 406 GLY A N      1 
ATOM   123  C  CA     . GLY A 1 16 ? 7.789   -3.095  6.465   1.00 90.96  ? 406 GLY A CA     1 
ATOM   124  C  C      . GLY A 1 16 ? 7.920   -4.594  6.290   1.00 89.67  ? 406 GLY A C      1 
ATOM   125  O  O      . GLY A 1 16 ? 8.659   -5.255  7.025   1.00 84.88  ? 406 GLY A O      1 
ATOM   126  H  H      . GLY A 1 16 ? 8.427   -2.538  4.697   1.00 109.19 ? 406 GLY A H      1 
ATOM   127  H  HA2    . GLY A 1 16 ? 8.553   -2.775  6.969   1.00 109.10 ? 406 GLY A HA2    1 
ATOM   128  H  HA3    . GLY A 1 16 ? 6.984   -2.913  6.974   1.00 109.10 ? 406 GLY A HA3    1 
ATOM   129  N  N      . CYS A 1 17 ? 7.212   -5.138  5.305   1.00 94.94  ? 407 CYS A N      1 
ATOM   130  C  CA     . CYS A 1 17 ? 7.313   -6.546  4.956   1.00 94.41  ? 407 CYS A CA     1 
ATOM   131  C  C      . CYS A 1 17 ? 8.442   -6.739  3.943   1.00 93.39  ? 407 CYS A C      1 
ATOM   132  O  O      . CYS A 1 17 ? 9.353   -5.915  3.835   1.00 93.41  ? 407 CYS A O      1 
ATOM   133  C  CB     . CYS A 1 17 ? 5.965   -7.060  4.454   1.00 93.66  ? 407 CYS A CB     1 
ATOM   134  S  SG     . CYS A 1 17 ? 5.979   -8.824  4.079   1.00 91.72  ? 407 CYS A SG     1 
ATOM   135  H  H      . CYS A 1 17 ? 6.656   -4.701  4.816   1.00 113.88 ? 407 CYS A H      1 
ATOM   136  H  HA     . CYS A 1 17 ? 7.542   -7.050  5.752   1.00 113.23 ? 407 CYS A HA     1 
ATOM   137  H  HB2    . CYS A 1 17 ? 5.294   -6.905  5.137   1.00 112.34 ? 407 CYS A HB2    1 
ATOM   138  H  HB3    . CYS A 1 17 ? 5.728   -6.584  3.643   1.00 112.34 ? 407 CYS A HB3    1 
ATOM   139  N  N      . GLY A 1 18 ? 8.410   -7.843  3.202   1.00 92.02  ? 408 GLY A N      1 
ATOM   140  C  CA     . GLY A 1 18 ? 9.549   -8.244  2.408   1.00 86.00  ? 408 GLY A CA     1 
ATOM   141  C  C      . GLY A 1 18 ? 9.734   -9.746  2.437   1.00 80.10  ? 408 GLY A C      1 
ATOM   142  O  O      . GLY A 1 18 ? 10.587  -10.289 1.728   1.00 80.65  ? 408 GLY A O      1 
ATOM   143  H  H      . GLY A 1 18 ? 7.735   -8.372  3.142   1.00 110.37 ? 408 GLY A H      1 
ATOM   144  H  HA2    . GLY A 1 18 ? 9.422   -7.964  1.488   1.00 103.15 ? 408 GLY A HA2    1 
ATOM   145  H  HA3    . GLY A 1 18 ? 10.354  -7.827  2.752   1.00 103.15 ? 408 GLY A HA3    1 
ATOM   146  N  N      . LYS A 1 19 ? 8.961   -10.426 3.285   1.00 76.48  ? 409 LYS A N      1 
ATOM   147  C  CA     . LYS A 1 19 ? 8.924   -11.881 3.264   1.00 69.04  ? 409 LYS A CA     1 
ATOM   148  C  C      . LYS A 1 19 ? 8.778   -12.381 1.832   1.00 70.65  ? 409 LYS A C      1 
ATOM   149  O  O      . LYS A 1 19 ? 7.987   -11.848 1.050   1.00 54.70  ? 409 LYS A O      1 
ATOM   150  C  CB     . LYS A 1 19 ? 7.758   -12.397 4.112   1.00 65.45  ? 409 LYS A CB     1 
ATOM   151  C  CG     . LYS A 1 19 ? 7.701   -11.822 5.511   1.00 66.04  ? 409 LYS A CG     1 
ATOM   152  C  CD     . LYS A 1 19 ? 6.638   -12.517 6.339   1.00 52.84  ? 409 LYS A CD     1 
ATOM   153  C  CE     . LYS A 1 19 ? 6.570   -11.955 7.749   1.00 53.83  ? 409 LYS A CE     1 
ATOM   154  N  NZ     . LYS A 1 19 ? 5.640   -12.734 8.614   1.00 52.60  ? 409 LYS A NZ     1 
ATOM   155  H  H      . LYS A 1 19 ? 8.453   -10.067 3.877   1.00 91.72  ? 409 LYS A H      1 
ATOM   156  H  HA     . LYS A 1 19 ? 9.751   -12.232 3.630   1.00 82.80  ? 409 LYS A HA     1 
ATOM   157  H  HB2    . LYS A 1 19 ? 6.926   -12.171 3.667   1.00 78.49  ? 409 LYS A HB2    1 
ATOM   158  H  HB3    . LYS A 1 19 ? 7.835   -13.361 4.192   1.00 78.49  ? 409 LYS A HB3    1 
ATOM   159  H  HG2    . LYS A 1 19 ? 8.559   -11.948 5.946   1.00 79.19  ? 409 LYS A HG2    1 
ATOM   160  H  HG3    . LYS A 1 19 ? 7.480   -10.879 5.466   1.00 79.19  ? 409 LYS A HG3    1 
ATOM   161  H  HD2    . LYS A 1 19 ? 5.773   -12.390 5.920   1.00 63.35  ? 409 LYS A HD2    1 
ATOM   162  H  HD3    . LYS A 1 19 ? 6.847   -13.462 6.399   1.00 63.35  ? 409 LYS A HD3    1 
ATOM   163  H  HE2    . LYS A 1 19 ? 7.453   -11.988 8.148   1.00 64.54  ? 409 LYS A HE2    1 
ATOM   164  H  HE3    . LYS A 1 19 ? 6.253   -11.039 7.712   1.00 64.54  ? 409 LYS A HE3    1 
ATOM   165  H  HZ1    . LYS A 1 19 ? 4.819   -12.716 8.271   1.00 63.07  ? 409 LYS A HZ1    1 
ATOM   166  H  HZ2    . LYS A 1 19 ? 5.912   -13.580 8.668   1.00 63.07  ? 409 LYS A HZ2    1 
ATOM   167  H  HZ3    . LYS A 1 19 ? 5.620   -12.383 9.432   1.00 63.07  ? 409 LYS A HZ3    1 
ATOM   168  N  N      . THR A 1 20 ? 9.561   -13.401 1.490   1.00 69.13  ? 410 THR A N      1 
ATOM   169  C  CA     . THR A 1 20 ? 9.477   -14.055 0.192   1.00 63.39  ? 410 THR A CA     1 
ATOM   170  C  C      . THR A 1 20 ? 8.947   -15.470 0.376   1.00 53.37  ? 410 THR A C      1 
ATOM   171  O  O      . THR A 1 20 ? 9.260   -16.137 1.367   1.00 52.66  ? 410 THR A O      1 
ATOM   172  C  CB     . THR A 1 20 ? 10.843  -14.091 -0.501  1.00 62.99  ? 410 THR A CB     1 
ATOM   173  O  OG1    . THR A 1 20 ? 11.408  -12.774 -0.514  1.00 59.31  ? 410 THR A OG1    1 
ATOM   174  C  CG2    . THR A 1 20 ? 10.711  -14.596 -1.941  1.00 61.14  ? 410 THR A CG2    1 
ATOM   175  H  H      . THR A 1 20 ? 10.161  -13.738 2.006   1.00 82.90  ? 410 THR A H      1 
ATOM   176  H  HA     . THR A 1 20 ? 8.860   -13.570 -0.377  1.00 76.02  ? 410 THR A HA     1 
ATOM   177  H  HB     . THR A 1 20 ? 11.434  -14.691 -0.019  1.00 75.54  ? 410 THR A HB     1 
ATOM   178  H  HG1    . THR A 1 20 ? 10.901  -12.248 -0.929  1.00 71.12  ? 410 THR A HG1    1 
ATOM   179  H  HG21   . THR A 1 20 ? 11.566  -14.530 -2.394  1.00 73.32  ? 410 THR A HG21   1 
ATOM   180  H  HG22   . THR A 1 20 ? 10.425  -15.523 -1.944  1.00 73.32  ? 410 THR A HG22   1 
ATOM   181  H  HG23   . THR A 1 20 ? 10.059  -14.062 -2.421  1.00 73.32  ? 410 THR A HG23   1 
ATOM   182  N  N      . TYR A 1 21 ? 8.139   -15.921 -0.580  1.00 63.01  ? 411 TYR A N      1 
ATOM   183  C  CA     . TYR A 1 21 ? 7.527   -17.238 -0.523  1.00 58.89  ? 411 TYR A CA     1 
ATOM   184  C  C      . TYR A 1 21 ? 7.833   -18.004 -1.803  1.00 62.39  ? 411 TYR A C      1 
ATOM   185  O  O      . TYR A 1 21 ? 8.178   -17.424 -2.836  1.00 59.18  ? 411 TYR A O      1 
ATOM   186  C  CB     . TYR A 1 21 ? 6.009   -17.141 -0.316  1.00 57.78  ? 411 TYR A CB     1 
ATOM   187  C  CG     . TYR A 1 21 ? 5.607   -16.474 0.984   1.00 59.90  ? 411 TYR A CG     1 
ATOM   188  C  CD1    . TYR A 1 21 ? 5.472   -15.094 1.069   1.00 63.22  ? 411 TYR A CD1    1 
ATOM   189  C  CD2    . TYR A 1 21 ? 5.360   -17.226 2.126   1.00 59.37  ? 411 TYR A CD2    1 
ATOM   190  C  CE1    . TYR A 1 21 ? 5.104   -14.481 2.256   1.00 62.18  ? 411 TYR A CE1    1 
ATOM   191  C  CE2    . TYR A 1 21 ? 4.991   -16.622 3.316   1.00 60.58  ? 411 TYR A CE2    1 
ATOM   192  C  CZ     . TYR A 1 21 ? 4.864   -15.250 3.375   1.00 57.37  ? 411 TYR A CZ     1 
ATOM   193  O  OH     . TYR A 1 21 ? 4.497   -14.649 4.558   1.00 53.78  ? 411 TYR A OH     1 
ATOM   194  H  H      . TYR A 1 21 ? 7.928   -15.472 -1.283  1.00 75.57  ? 411 TYR A H      1 
ATOM   195  H  HA     . TYR A 1 21 ? 7.901   -17.735 0.221   1.00 70.61  ? 411 TYR A HA     1 
ATOM   196  H  HB2    . TYR A 1 21 ? 5.625   -16.628 -1.045  1.00 69.29  ? 411 TYR A HB2    1 
ATOM   197  H  HB3    . TYR A 1 21 ? 5.641   -18.038 -0.314  1.00 69.29  ? 411 TYR A HB3    1 
ATOM   198  H  HD1    . TYR A 1 21 ? 5.633   -14.572 0.316   1.00 75.82  ? 411 TYR A HD1    1 
ATOM   199  H  HD2    . TYR A 1 21 ? 5.444   -18.152 2.090   1.00 71.20  ? 411 TYR A HD2    1 
ATOM   200  H  HE1    . TYR A 1 21 ? 5.018   -13.556 2.297   1.00 74.56  ? 411 TYR A HE1    1 
ATOM   201  H  HE2    . TYR A 1 21 ? 4.829   -17.139 4.072   1.00 72.65  ? 411 TYR A HE2    1 
ATOM   202  H  HH     . TYR A 1 21 ? 4.383   -15.231 5.153   1.00 64.48  ? 411 TYR A HH     1 
ATOM   203  N  N      . THR A 1 22 ? 7.693   -19.328 -1.717  1.00 67.00  ? 412 THR A N      1 
ATOM   204  C  CA     . THR A 1 22 ? 8.020   -20.198 -2.841  1.00 64.09  ? 412 THR A CA     1 
ATOM   205  C  C      . THR A 1 22 ? 6.903   -20.230 -3.878  1.00 61.04  ? 412 THR A C      1 
ATOM   206  O  O      . THR A 1 22 ? 7.176   -20.314 -5.080  1.00 52.65  ? 412 THR A O      1 
ATOM   207  C  CB     . THR A 1 22 ? 8.318   -21.612 -2.336  1.00 65.10  ? 412 THR A CB     1 
ATOM   208  O  OG1    . THR A 1 22 ? 7.193   -22.117 -1.604  1.00 65.96  ? 412 THR A OG1    1 
ATOM   209  C  CG2    . THR A 1 22 ? 9.544   -21.608 -1.433  1.00 55.61  ? 412 THR A CG2    1 
ATOM   210  H  H      . THR A 1 22 ? 7.411   -19.744 -1.019  1.00 80.35  ? 412 THR A H      1 
ATOM   211  H  HA     . THR A 1 22 ? 8.820   -19.862 -3.275  1.00 76.85  ? 412 THR A HA     1 
ATOM   212  H  HB     . THR A 1 22 ? 8.497   -22.193 -3.092  1.00 78.07  ? 412 THR A HB     1 
ATOM   213  H  HG1    . THR A 1 22 ? 7.356   -22.893 -1.326  1.00 79.10  ? 412 THR A HG1    1 
ATOM   214  H  HG21   . THR A 1 22 ? 9.765   -22.515 -1.169  1.00 66.68  ? 412 THR A HG21   1 
ATOM   215  H  HG22   . THR A 1 22 ? 10.300  -21.224 -1.904  1.00 66.68  ? 412 THR A HG22   1 
ATOM   216  H  HG23   . THR A 1 22 ? 9.368   -21.082 -0.637  1.00 66.68  ? 412 THR A HG23   1 
ATOM   217  N  N      . LYS A 1 23 ? 5.647   -20.171 -3.441  1.00 50.50  ? 413 LYS A N      1 
ATOM   218  C  CA     . LYS A 1 23 ? 4.498   -20.168 -4.334  1.00 49.83  ? 413 LYS A CA     1 
ATOM   219  C  C      . LYS A 1 23 ? 3.760   -18.838 -4.245  1.00 50.39  ? 413 LYS A C      1 
ATOM   220  O  O      . LYS A 1 23 ? 3.785   -18.159 -3.215  1.00 49.92  ? 413 LYS A O      1 
ATOM   221  C  CB     . LYS A 1 23 ? 3.528   -21.307 -3.998  1.00 49.28  ? 413 LYS A CB     1 
ATOM   222  C  CG     . LYS A 1 23 ? 4.004   -22.687 -4.418  1.00 49.31  ? 413 LYS A CG     1 
ATOM   223  C  CD     . LYS A 1 23 ? 2.906   -23.728 -4.248  1.00 50.42  ? 413 LYS A CD     1 
ATOM   224  C  CE     . LYS A 1 23 ? 3.314   -25.077 -4.824  1.00 60.05  ? 413 LYS A CE     1 
ATOM   225  N  NZ     . LYS A 1 23 ? 4.481   -25.677 -4.116  1.00 62.80  ? 413 LYS A NZ     1 
ATOM   226  H  H      . LYS A 1 23 ? 5.433   -20.131 -2.609  1.00 60.55  ? 413 LYS A H      1 
ATOM   227  H  HA     . LYS A 1 23 ? 4.798   -20.287 -5.248  1.00 59.75  ? 413 LYS A HA     1 
ATOM   228  H  HB2    . LYS A 1 23 ? 3.390   -21.323 -3.038  1.00 59.08  ? 413 LYS A HB2    1 
ATOM   229  H  HB3    . LYS A 1 23 ? 2.685   -21.138 -4.446  1.00 59.08  ? 413 LYS A HB3    1 
ATOM   230  H  HG2    . LYS A 1 23 ? 4.262   -22.666 -5.353  1.00 59.12  ? 413 LYS A HG2    1 
ATOM   231  H  HG3    . LYS A 1 23 ? 4.758   -22.947 -3.867  1.00 59.12  ? 413 LYS A HG3    1 
ATOM   232  H  HD2    . LYS A 1 23 ? 2.721   -23.845 -3.303  1.00 60.45  ? 413 LYS A HD2    1 
ATOM   233  H  HD3    . LYS A 1 23 ? 2.108   -23.429 -4.712  1.00 60.45  ? 413 LYS A HD3    1 
ATOM   234  H  HE2    . LYS A 1 23 ? 2.568   -25.692 -4.747  1.00 72.01  ? 413 LYS A HE2    1 
ATOM   235  H  HE3    . LYS A 1 23 ? 3.555   -24.963 -5.757  1.00 72.01  ? 413 LYS A HE3    1 
ATOM   236  H  HZ1    . LYS A 1 23 ? 4.687   -26.462 -4.481  1.00 75.31  ? 413 LYS A HZ1    1 
ATOM   237  H  HZ2    . LYS A 1 23 ? 5.185   -25.136 -4.177  1.00 75.31  ? 413 LYS A HZ2    1 
ATOM   238  H  HZ3    . LYS A 1 23 ? 4.285   -25.800 -3.257  1.00 75.31  ? 413 LYS A HZ3    1 
ATOM   239  N  N      . SER A 1 24 ? 3.088   -18.476 -5.340  1.00 53.17  ? 414 SER A N      1 
ATOM   240  C  CA     . SER A 1 24 ? 2.276   -17.264 -5.339  1.00 45.59  ? 414 SER A CA     1 
ATOM   241  C  C      . SER A 1 24 ? 1.127   -17.378 -4.347  1.00 51.26  ? 414 SER A C      1 
ATOM   242  O  O      . SER A 1 24 ? 0.791   -16.407 -3.661  1.00 57.02  ? 414 SER A O      1 
ATOM   243  C  CB     . SER A 1 24 ? 1.737   -16.987 -6.742  1.00 48.15  ? 414 SER A CB     1 
ATOM   244  O  OG     . SER A 1 24 ? 0.729   -17.920 -7.091  1.00 52.63  ? 414 SER A OG     1 
ATOM   245  H  H      . SER A 1 24 ? 3.087   -18.909 -6.083  1.00 63.76  ? 414 SER A H      1 
ATOM   246  H  HA     . SER A 1 24 ? 2.827   -16.512 -5.073  1.00 54.66  ? 414 SER A HA     1 
ATOM   247  H  HB2    . SER A 1 24 ? 1.361   -16.093 -6.765  1.00 57.73  ? 414 SER A HB2    1 
ATOM   248  H  HB3    . SER A 1 24 ? 2.463   -17.058 -7.381  1.00 57.73  ? 414 SER A HB3    1 
ATOM   249  H  HG     . SER A 1 24 ? 0.442   -17.757 -7.863  1.00 63.11  ? 414 SER A HG     1 
ATOM   250  N  N      . SER A 1 25 ? 0.508   -18.558 -4.261  1.00 53.82  ? 415 SER A N      1 
ATOM   251  C  CA     . SER A 1 25 ? -0.600  -18.743 -3.331  1.00 47.92  ? 415 SER A CA     1 
ATOM   252  C  C      . SER A 1 25 ? -0.171  -18.477 -1.897  1.00 48.75  ? 415 SER A C      1 
ATOM   253  O  O      . SER A 1 25 ? -0.977  -18.008 -1.085  1.00 53.49  ? 415 SER A O      1 
ATOM   254  C  CB     . SER A 1 25 ? -1.165  -20.156 -3.461  1.00 51.69  ? 415 SER A CB     1 
ATOM   255  O  OG     . SER A 1 25 ? -0.198  -21.125 -3.098  1.00 53.74  ? 415 SER A OG     1 
ATOM   256  H  H      . SER A 1 25 ? 0.709   -19.255 -4.723  1.00 64.53  ? 415 SER A H      1 
ATOM   257  H  HA     . SER A 1 25 ? -1.306  -18.116 -3.553  1.00 57.45  ? 415 SER A HA     1 
ATOM   258  H  HB2    . SER A 1 25 ? -1.934  -20.243 -2.876  1.00 61.97  ? 415 SER A HB2    1 
ATOM   259  H  HB3    . SER A 1 25 ? -1.431  -20.306 -4.382  1.00 61.97  ? 415 SER A HB3    1 
ATOM   260  H  HG     . SER A 1 25 ? -0.522  -21.896 -3.174  1.00 64.44  ? 415 SER A HG     1 
ATOM   261  N  N      . HIS A 1 26 ? 1.087   -18.771 -1.564  1.00 49.88  ? 416 HIS A N      1 
ATOM   262  C  CA     . HIS A 1 26 ? 1.597   -18.436 -0.239  1.00 42.29  ? 416 HIS A CA     1 
ATOM   263  C  C      . HIS A 1 26 ? 1.550   -16.931 -0.007  1.00 44.05  ? 416 HIS A C      1 
ATOM   264  O  O      . HIS A 1 26 ? 1.094   -16.465 1.043   1.00 42.40  ? 416 HIS A O      1 
ATOM   265  C  CB     . HIS A 1 26 ? 3.025   -18.959 -0.081  1.00 43.84  ? 416 HIS A CB     1 
ATOM   266  C  CG     . HIS A 1 26 ? 3.130   -20.452 -0.080  1.00 48.87  ? 416 HIS A CG     1 
ATOM   267  N  ND1    . HIS A 1 26 ? 2.029   -21.277 -0.163  1.00 49.70  ? 416 HIS A ND1    1 
ATOM   268  C  CD2    . HIS A 1 26 ? 4.208   -21.269 -0.002  1.00 47.81  ? 416 HIS A CD2    1 
ATOM   269  C  CE1    . HIS A 1 26 ? 2.424   -22.538 -0.140  1.00 47.30  ? 416 HIS A CE1    1 
ATOM   270  N  NE2    . HIS A 1 26 ? 3.741   -22.561 -0.042  1.00 47.45  ? 416 HIS A NE2    1 
ATOM   271  H  H      . HIS A 1 26 ? 1.656   -19.158 -2.080  1.00 59.81  ? 416 HIS A H      1 
ATOM   272  H  HA     . HIS A 1 26 ? 1.042   -18.863 0.433   1.00 50.69  ? 416 HIS A HA     1 
ATOM   273  H  HB2    . HIS A 1 26 ? 3.560   -18.626 -0.818  1.00 52.56  ? 416 HIS A HB2    1 
ATOM   274  H  HB3    . HIS A 1 26 ? 3.384   -18.636 0.760   1.00 52.56  ? 416 HIS A HB3    1 
ATOM   275  H  HD2    . HIS A 1 26 ? 5.097   -21.005 0.064   1.00 57.32  ? 416 HIS A HD2    1 
ATOM   276  H  HE1    . HIS A 1 26 ? 1.869   -23.283 -0.183  1.00 56.71  ? 416 HIS A HE1    1 
ATOM   277  H  HE2    . HIS A 1 26 ? 4.227   -23.269 -0.009  1.00 56.89  ? 416 HIS A HE2    1 
ATOM   278  N  N      . LEU A 1 27 ? 2.018   -16.153 -0.984  1.00 48.87  ? 417 LEU A N      1 
ATOM   279  C  CA     . LEU A 1 27 ? 1.999   -14.700 -0.848  1.00 50.56  ? 417 LEU A CA     1 
ATOM   280  C  C      . LEU A 1 27 ? 0.572   -14.175 -0.756  1.00 57.27  ? 417 LEU A C      1 
ATOM   281  O  O      . LEU A 1 27 ? 0.272   -13.315 0.081   1.00 57.12  ? 417 LEU A O      1 
ATOM   282  C  CB     . LEU A 1 27 ? 2.734   -14.059 -2.026  1.00 53.04  ? 417 LEU A CB     1 
ATOM   283  C  CG     . LEU A 1 27 ? 2.744   -12.529 -2.068  1.00 61.75  ? 417 LEU A CG     1 
ATOM   284  C  CD1    . LEU A 1 27 ? 3.383   -11.953 -0.810  1.00 60.11  ? 417 LEU A CD1    1 
ATOM   285  C  CD2    . LEU A 1 27 ? 3.465   -12.032 -3.315  1.00 61.03  ? 417 LEU A CD2    1 
ATOM   286  H  H      . LEU A 1 27 ? 2.347   -16.439 -1.725  1.00 58.60  ? 417 LEU A H      1 
ATOM   287  H  HA     . LEU A 1 27 ? 2.463   -14.454 -0.033  1.00 60.62  ? 417 LEU A HA     1 
ATOM   288  H  HB2    . LEU A 1 27 ? 3.658   -14.353 -2.004  1.00 63.60  ? 417 LEU A HB2    1 
ATOM   289  H  HB3    . LEU A 1 27 ? 2.319   -14.367 -2.847  1.00 63.60  ? 417 LEU A HB3    1 
ATOM   290  H  HG     . LEU A 1 27 ? 1.830   -12.208 -2.110  1.00 74.05  ? 417 LEU A HG     1 
ATOM   291  H  HD11   . LEU A 1 27 ? 3.458   -10.991 -0.908  1.00 72.07  ? 417 LEU A HD11   1 
ATOM   292  H  HD12   . LEU A 1 27 ? 2.825   -12.165 -0.046  1.00 72.07  ? 417 LEU A HD12   1 
ATOM   293  H  HD13   . LEU A 1 27 ? 4.264   -12.343 -0.697  1.00 72.07  ? 417 LEU A HD13   1 
ATOM   294  H  HD21   . LEU A 1 27 ? 3.434   -11.063 -3.332  1.00 73.19  ? 417 LEU A HD21   1 
ATOM   295  H  HD22   . LEU A 1 27 ? 4.387   -12.333 -3.288  1.00 73.19  ? 417 LEU A HD22   1 
ATOM   296  H  HD23   . LEU A 1 27 ? 3.022   -12.391 -4.100  1.00 73.19  ? 417 LEU A HD23   1 
ATOM   297  N  N      . LYS A 1 28 ? -0.323  -14.677 -1.610  1.00 57.63  ? 418 LYS A N      1 
ATOM   298  C  CA     . LYS A 1 28 ? -1.711  -14.229 -1.580  1.00 61.65  ? 418 LYS A CA     1 
ATOM   299  C  C      . LYS A 1 28 ? -2.313  -14.392 -0.192  1.00 54.31  ? 418 LYS A C      1 
ATOM   300  O  O      . LYS A 1 28 ? -3.047  -13.518 0.282   1.00 53.71  ? 418 LYS A O      1 
ATOM   301  C  CB     . LYS A 1 28 ? -2.533  -15.000 -2.612  1.00 70.69  ? 418 LYS A CB     1 
ATOM   302  C  CG     . LYS A 1 28 ? -2.099  -14.759 -4.046  1.00 78.86  ? 418 LYS A CG     1 
ATOM   303  C  CD     . LYS A 1 28 ? -2.871  -15.636 -5.015  1.00 89.35  ? 418 LYS A CD     1 
ATOM   304  C  CE     . LYS A 1 28 ? -2.388  -15.447 -6.443  1.00 89.46  ? 418 LYS A CE     1 
ATOM   305  N  NZ     . LYS A 1 28 ? -3.092  -16.358 -7.389  1.00 87.64  ? 418 LYS A NZ     1 
ATOM   306  H  H      . LYS A 1 28 ? -0.152  -15.271 -2.208  1.00 69.10  ? 418 LYS A H      1 
ATOM   307  H  HA     . LYS A 1 28 ? -1.744  -13.288 -1.812  1.00 73.93  ? 418 LYS A HA     1 
ATOM   308  H  HB2    . LYS A 1 28 ? -2.449  -15.949 -2.432  1.00 84.77  ? 418 LYS A HB2    1 
ATOM   309  H  HB3    . LYS A 1 28 ? -3.462  -14.732 -2.535  1.00 84.77  ? 418 LYS A HB3    1 
ATOM   310  H  HG2    . LYS A 1 28 ? -2.263  -13.832 -4.278  1.00 94.58  ? 418 LYS A HG2    1 
ATOM   311  H  HG3    . LYS A 1 28 ? -1.156  -14.965 -4.135  1.00 94.58  ? 418 LYS A HG3    1 
ATOM   312  H  HD2    . LYS A 1 28 ? -2.747  -16.567 -4.773  1.00 107.17 ? 418 LYS A HD2    1 
ATOM   313  H  HD3    . LYS A 1 28 ? -3.812  -15.402 -4.979  1.00 107.17 ? 418 LYS A HD3    1 
ATOM   314  H  HE2    . LYS A 1 28 ? -2.558  -14.533 -6.719  1.00 107.30 ? 418 LYS A HE2    1 
ATOM   315  H  HE3    . LYS A 1 28 ? -1.438  -15.639 -6.487  1.00 107.30 ? 418 LYS A HE3    1 
ATOM   316  H  HZ1    . LYS A 1 28 ? -2.767  -16.253 -8.211  1.00 105.12 ? 418 LYS A HZ1    1 
ATOM   317  H  HZ2    . LYS A 1 28 ? -2.978  -17.204 -7.138  1.00 105.12 ? 418 LYS A HZ2    1 
ATOM   318  H  HZ3    . LYS A 1 28 ? -3.963  -16.174 -7.397  1.00 105.12 ? 418 LYS A HZ3    1 
ATOM   319  N  N      . ALA A 1 29 ? -2.014  -15.508 0.477   1.00 54.74  ? 419 ALA A N      1 
ATOM   320  C  CA     . ALA A 1 29 ? -2.468  -15.681 1.852   1.00 52.43  ? 419 ALA A CA     1 
ATOM   321  C  C      . ALA A 1 29 ? -1.827  -14.649 2.769   1.00 51.76  ? 419 ALA A C      1 
ATOM   322  O  O      . ALA A 1 29 ? -2.500  -14.060 3.624   1.00 51.39  ? 419 ALA A O      1 
ATOM   323  C  CB     . ALA A 1 29 ? -2.153  -17.096 2.337   1.00 49.39  ? 419 ALA A CB     1 
ATOM   324  H  H      . ALA A 1 29 ? -1.559  -16.166 0.162   1.00 65.64  ? 419 ALA A H      1 
ATOM   325  H  HA     . ALA A 1 29 ? -3.430  -15.558 1.886   1.00 62.86  ? 419 ALA A HA     1 
ATOM   326  H  HB1    . ALA A 1 29 ? -2.462  -17.192 3.252   1.00 59.21  ? 419 ALA A HB1    1 
ATOM   327  H  HB2    . ALA A 1 29 ? -2.608  -17.734 1.765   1.00 59.21  ? 419 ALA A HB2    1 
ATOM   328  H  HB3    . ALA A 1 29 ? -1.194  -17.238 2.294   1.00 59.21  ? 419 ALA A HB3    1 
ATOM   329  N  N      . HIS A 1 30 ? -0.523  -14.412 2.603   1.00 39.57  ? 420 HIS A N      1 
ATOM   330  C  CA     . HIS A 1 30 ? 0.161   -13.436 3.442   1.00 38.16  ? 420 HIS A CA     1 
ATOM   331  C  C      . HIS A 1 30 ? -0.388  -12.035 3.218   1.00 38.67  ? 420 HIS A C      1 
ATOM   332  O  O      . HIS A 1 30 ? -0.575  -11.274 4.173   1.00 38.40  ? 420 HIS A O      1 
ATOM   333  C  CB     . HIS A 1 30 ? 1.662   -13.456 3.167   1.00 36.77  ? 420 HIS A CB     1 
ATOM   334  C  CG     . HIS A 1 30 ? 2.369   -12.231 3.653   1.00 35.68  ? 420 HIS A CG     1 
ATOM   335  N  ND1    . HIS A 1 30 ? 2.490   -11.926 4.992   1.00 35.10  ? 420 HIS A ND1    1 
ATOM   336  C  CD2    . HIS A 1 30 ? 2.971   -11.222 2.982   1.00 35.32  ? 420 HIS A CD2    1 
ATOM   337  C  CE1    . HIS A 1 30 ? 3.147   -10.788 5.124   1.00 34.44  ? 420 HIS A CE1    1 
ATOM   338  N  NE2    . HIS A 1 30 ? 3.450   -10.340 3.919   1.00 35.08  ? 420 HIS A NE2    1 
ATOM   339  H  H      . HIS A 1 30 ? -0.022  -14.798 2.020   1.00 47.43  ? 420 HIS A H      1 
ATOM   340  H  HA     . HIS A 1 30 ? 0.023   -13.668 4.374   1.00 45.74  ? 420 HIS A HA     1 
ATOM   341  H  HB2    . HIS A 1 30 ? 2.053   -14.223 3.614   1.00 44.07  ? 420 HIS A HB2    1 
ATOM   342  H  HB3    . HIS A 1 30 ? 1.805   -13.523 2.210   1.00 44.07  ? 420 HIS A HB3    1 
ATOM   343  H  HD1    . HIS A 1 30 ? 2.189   -12.405 5.640   1.00 42.07  ? 420 HIS A HD1    1 
ATOM   344  H  HD2    . HIS A 1 30 ? 3.051   -11.144 2.059   1.00 42.33  ? 420 HIS A HD2    1 
ATOM   345  H  HE1    . HIS A 1 30 ? 3.360   -10.373 5.928   1.00 41.27  ? 420 HIS A HE1    1 
ATOM   346  N  N      . LEU A 1 31 ? -0.638  -11.669 1.958   1.00 46.93  ? 421 LEU A N      1 
ATOM   347  C  CA     . LEU A 1 31 ? -1.162  -10.340 1.669   1.00 42.50  ? 421 LEU A CA     1 
ATOM   348  C  C      . LEU A 1 31 ? -2.477  -10.094 2.393   1.00 41.58  ? 421 LEU A C      1 
ATOM   349  O  O      . LEU A 1 31 ? -2.777  -8.954  2.760   1.00 41.84  ? 421 LEU A O      1 
ATOM   350  C  CB     . LEU A 1 31 ? -1.339  -10.163 0.161   1.00 42.93  ? 421 LEU A CB     1 
ATOM   351  C  CG     . LEU A 1 31 ? -0.049  -10.173 -0.666  1.00 40.90  ? 421 LEU A CG     1 
ATOM   352  C  CD1    . LEU A 1 31 ? -0.368  -10.167 -2.149  1.00 42.74  ? 421 LEU A CD1    1 
ATOM   353  C  CD2    . LEU A 1 31 ? 0.845   -8.990  -0.305  1.00 39.57  ? 421 LEU A CD2    1 
ATOM   354  H  H      . LEU A 1 31 ? -0.514  -12.165 1.266   1.00 56.27  ? 421 LEU A H      1 
ATOM   355  H  HA     . LEU A 1 31 ? -0.525  -9.677  1.978   1.00 50.94  ? 421 LEU A HA     1 
ATOM   356  H  HB2    . LEU A 1 31 ? -1.900  -10.883 -0.168  1.00 51.47  ? 421 LEU A HB2    1 
ATOM   357  H  HB3    . LEU A 1 31 ? -1.779  -9.313  0.002   1.00 51.47  ? 421 LEU A HB3    1 
ATOM   358  H  HG     . LEU A 1 31 ? 0.443   -10.985 -0.471  1.00 49.03  ? 421 LEU A HG     1 
ATOM   359  H  HD11   . LEU A 1 31 ? 0.462   -10.175 -2.650  1.00 51.23  ? 421 LEU A HD11   1 
ATOM   360  H  HD12   . LEU A 1 31 ? -0.891  -10.955 -2.362  1.00 51.23  ? 421 LEU A HD12   1 
ATOM   361  H  HD13   . LEU A 1 31 ? -0.874  -9.367  -2.359  1.00 51.23  ? 421 LEU A HD13   1 
ATOM   362  H  HD21   . LEU A 1 31 ? 1.587   -8.954  -0.928  1.00 47.43  ? 421 LEU A HD21   1 
ATOM   363  H  HD22   . LEU A 1 31 ? 0.325   -8.173  -0.362  1.00 47.43  ? 421 LEU A HD22   1 
ATOM   364  H  HD23   . LEU A 1 31 ? 1.177   -9.108  0.599   1.00 47.43  ? 421 LEU A HD23   1 
ATOM   365  N  N      . ARG A 1 32 ? -3.263  -11.147 2.623   1.00 42.46  ? 422 ARG A N      1 
ATOM   366  C  CA     . ARG A 1 32 ? -4.504  -11.000 3.370   1.00 43.68  ? 422 ARG A CA     1 
ATOM   367  C  C      . ARG A 1 32 ? -4.272  -10.612 4.824   1.00 44.82  ? 422 ARG A C      1 
ATOM   368  O  O      . ARG A 1 32 ? -5.241  -10.289 5.520   1.00 62.18  ? 422 ARG A O      1 
ATOM   369  C  CB     . ARG A 1 32 ? -5.313  -12.297 3.311   1.00 44.90  ? 422 ARG A CB     1 
ATOM   370  C  CG     . ARG A 1 32 ? -5.877  -12.617 1.934   1.00 46.70  ? 422 ARG A CG     1 
ATOM   371  C  CD     . ARG A 1 32 ? -7.114  -13.486 2.042   1.00 48.61  ? 422 ARG A CD     1 
ATOM   372  N  NE     . ARG A 1 32 ? -7.744  -13.726 0.744   1.00 50.78  ? 422 ARG A NE     1 
ATOM   373  C  CZ     . ARG A 1 32 ? -7.576  -14.821 0.005   1.00 51.48  ? 422 ARG A CZ     1 
ATOM   374  N  NH1    . ARG A 1 32 ? -6.791  -15.813 0.415   1.00 50.33  ? 422 ARG A NH1    1 
ATOM   375  N  NH2    . ARG A 1 32 ? -8.202  -14.925 -1.158  1.00 56.61  ? 422 ARG A NH2    1 
ATOM   376  H  H      . ARG A 1 32 ? -3.099  -11.949 2.358   1.00 50.89  ? 422 ARG A H      1 
ATOM   377  H  HA     . ARG A 1 32 ? -5.035  -10.301 2.958   1.00 52.37  ? 422 ARG A HA     1 
ATOM   378  H  HB2    . ARG A 1 32 ? -4.740  -13.034 3.574   1.00 53.82  ? 422 ARG A HB2    1 
ATOM   379  H  HB3    . ARG A 1 32 ? -6.059  -12.226 3.927   1.00 53.82  ? 422 ARG A HB3    1 
ATOM   380  H  HG2    . ARG A 1 32 ? -6.121  -11.792 1.486   1.00 55.98  ? 422 ARG A HG2    1 
ATOM   381  H  HG3    . ARG A 1 32 ? -5.211  -13.097 1.417   1.00 55.98  ? 422 ARG A HG3    1 
ATOM   382  H  HD2    . ARG A 1 32 ? -6.874  -14.336 2.439   1.00 58.28  ? 422 ARG A HD2    1 
ATOM   383  H  HD3    . ARG A 1 32 ? -7.763  -13.035 2.604   1.00 58.28  ? 422 ARG A HD3    1 
ATOM   384  H  HE     . ARG A 1 32 ? -8.262  -13.113 0.435   1.00 60.89  ? 422 ARG A HE     1 
ATOM   385  H  HH11   . ARG A 1 32 ? -6.378  -15.761 1.166   1.00 60.35  ? 422 ARG A HH11   1 
ATOM   386  H  HH12   . ARG A 1 32 ? -6.695  -16.512 -0.077  1.00 60.35  ? 422 ARG A HH12   1 
ATOM   387  H  HH21   . ARG A 1 32 ? -8.712  -14.288 -1.430  1.00 67.88  ? 422 ARG A HH21   1 
ATOM   388  H  HH22   . ARG A 1 32 ? -8.098  -15.629 -1.641  1.00 67.88  ? 422 ARG A HH22   1 
ATOM   389  N  N      . THR A 1 33 ? -3.027  -10.643 5.303   1.00 40.88  ? 423 THR A N      1 
ATOM   390  C  CA     . THR A 1 33 ? -2.744  -10.191 6.660   1.00 40.22  ? 423 THR A CA     1 
ATOM   391  C  C      . THR A 1 33 ? -2.628  -8.675  6.722   1.00 40.26  ? 423 THR A C      1 
ATOM   392  O  O      . THR A 1 33 ? -3.057  -8.057  7.703   1.00 40.81  ? 423 THR A O      1 
ATOM   393  C  CB     . THR A 1 33 ? -1.460  -10.834 7.186   1.00 38.67  ? 423 THR A CB     1 
ATOM   394  O  OG1    . THR A 1 33 ? -0.342  -10.388 6.409   1.00 37.87  ? 423 THR A OG1    1 
ATOM   395  C  CG2    . THR A 1 33 ? -1.553  -12.354 7.121   1.00 39.51  ? 423 THR A CG2    1 
ATOM   396  H  H      . THR A 1 33 ? -2.339  -10.919 4.868   1.00 49.00  ? 423 THR A H      1 
ATOM   397  H  HA     . THR A 1 33 ? -3.473  -10.460 7.241   1.00 48.21  ? 423 THR A HA     1 
ATOM   398  H  HB     . THR A 1 33 ? -1.329  -10.577 8.112   1.00 46.35  ? 423 THR A HB     1 
ATOM   399  H  HG1    . THR A 1 33 ? -0.494  -10.506 5.592   1.00 45.39  ? 423 THR A HG1    1 
ATOM   400  H  HG21   . THR A 1 33 ? -0.766  -12.751 7.525   1.00 47.35  ? 423 THR A HG21   1 
ATOM   401  H  HG22   . THR A 1 33 ? -2.340  -12.658 7.599   1.00 47.35  ? 423 THR A HG22   1 
ATOM   402  H  HG23   . THR A 1 33 ? -1.613  -12.644 6.197   1.00 47.35  ? 423 THR A HG23   1 
ATOM   403  N  N      . HIS A 1 34 ? -2.041  -8.062  5.691   1.00 41.70  ? 424 HIS A N      1 
ATOM   404  C  CA     . HIS A 1 34 ? -2.014  -6.604  5.613   1.00 43.80  ? 424 HIS A CA     1 
ATOM   405  C  C      . HIS A 1 34 ? -3.426  -6.049  5.475   1.00 49.05  ? 424 HIS A C      1 
ATOM   406  O  O      . HIS A 1 34 ? -3.853  -5.197  6.265   1.00 46.23  ? 424 HIS A O      1 
ATOM   407  C  CB     . HIS A 1 34 ? -1.130  -6.163  4.446   1.00 42.58  ? 424 HIS A CB     1 
ATOM   408  C  CG     . HIS A 1 34 ? 0.298   -6.589  4.583   1.00 45.83  ? 424 HIS A CG     1 
ATOM   409  N  ND1    . HIS A 1 34 ? 1.046   -6.326  5.711   1.00 45.77  ? 424 HIS A ND1    1 
ATOM   410  C  CD2    . HIS A 1 34 ? 1.117   -7.261  3.740   1.00 42.72  ? 424 HIS A CD2    1 
ATOM   411  C  CE1    . HIS A 1 34 ? 2.262   -6.817  5.555   1.00 39.77  ? 424 HIS A CE1    1 
ATOM   412  N  NE2    . HIS A 1 34 ? 2.331   -7.389  4.367   1.00 43.48  ? 424 HIS A NE2    1 
ATOM   413  H  H      . HIS A 1 34 ? -1.657  -8.463  5.034   1.00 49.99  ? 424 HIS A H      1 
ATOM   414  H  HA     . HIS A 1 34 ? -1.631  -6.250  6.431   1.00 52.50  ? 424 HIS A HA     1 
ATOM   415  H  HB2    . HIS A 1 34 ? -1.478  -6.548  3.626   1.00 51.05  ? 424 HIS A HB2    1 
ATOM   416  H  HB3    . HIS A 1 34 ? -1.147  -5.195  4.388   1.00 51.05  ? 424 HIS A HB3    1 
ATOM   417  H  HD1    . HIS A 1 34 ? 0.764   -5.908  6.408   1.00 54.87  ? 424 HIS A HD1    1 
ATOM   418  H  HD2    . HIS A 1 34 ? 0.898   -7.577  2.893   1.00 51.21  ? 424 HIS A HD2    1 
ATOM   419  H  HE1    . HIS A 1 34 ? 2.953   -6.767  6.176   1.00 47.67  ? 424 HIS A HE1    1 
ATOM   420  N  N      . THR A 1 35 ? -4.167  -6.518  4.475   1.00 44.66  ? 425 THR A N      1 
ATOM   421  C  CA     . THR A 1 35 ? -5.599  -6.280  4.435   1.00 42.51  ? 425 THR A CA     1 
ATOM   422  C  C      . THR A 1 35 ? -6.283  -7.104  5.527   1.00 50.63  ? 425 THR A C      1 
ATOM   423  O  O      . THR A 1 35 ? -5.657  -7.910  6.220   1.00 52.58  ? 425 THR A O      1 
ATOM   424  C  CB     . THR A 1 35 ? -6.168  -6.640  3.063   1.00 44.76  ? 425 THR A CB     1 
ATOM   425  O  OG1    . THR A 1 35 ? -6.066  -8.053  2.853   1.00 56.63  ? 425 THR A OG1    1 
ATOM   426  C  CG2    . THR A 1 35 ? -5.409  -5.922  1.962   1.00 41.06  ? 425 THR A CG2    1 
ATOM   427  H  H      . THR A 1 35 ? -3.863  -6.975  3.813   1.00 53.55  ? 425 THR A H      1 
ATOM   428  H  HA     . THR A 1 35 ? -5.775  -5.341  4.603   1.00 50.96  ? 425 THR A HA     1 
ATOM   429  H  HB     . THR A 1 35 ? -7.099  -6.373  3.019   1.00 53.67  ? 425 THR A HB     1 
ATOM   430  H  HG1    . THR A 1 35 ? -6.378  -8.255  2.100   1.00 67.91  ? 425 THR A HG1    1 
ATOM   431  H  HG21   . THR A 1 35 ? -5.855  -6.057  1.112   1.00 49.21  ? 425 THR A HG21   1 
ATOM   432  H  HG22   . THR A 1 35 ? -5.373  -4.971  2.151   1.00 49.21  ? 425 THR A HG22   1 
ATOM   433  H  HG23   . THR A 1 35 ? -4.504  -6.266  1.901   1.00 49.21  ? 425 THR A HG23   1 
ATOM   434  N  N      . GLY A 1 36 ? -7.586  -6.893  5.684   1.00 55.33  ? 426 GLY A N      1 
ATOM   435  C  CA     . GLY A 1 36 ? -8.337  -7.637  6.676   1.00 55.22  ? 426 GLY A CA     1 
ATOM   436  C  C      . GLY A 1 36 ? -9.151  -8.759  6.069   1.00 56.63  ? 426 GLY A C      1 
ATOM   437  O  O      . GLY A 1 36 ? -10.104 -9.245  6.685   1.00 60.16  ? 426 GLY A O      1 
ATOM   438  H  H      . GLY A 1 36 ? -8.051  -6.329  5.231   1.00 66.34  ? 426 GLY A H      1 
ATOM   439  H  HA2    . GLY A 1 36 ? -7.731  -8.018  7.330   1.00 66.21  ? 426 GLY A HA2    1 
ATOM   440  H  HA3    . GLY A 1 36 ? -8.942  -7.036  7.137   1.00 66.21  ? 426 GLY A HA3    1 
ATOM   441  N  N      . GLU A 1 37 ? -8.775  -9.187  4.866   1.00 48.71  ? 427 GLU A N      1 
ATOM   442  C  CA     . GLU A 1 37 ? -9.601  -10.117 4.107   1.00 47.66  ? 427 GLU A CA     1 
ATOM   443  C  C      . GLU A 1 37 ? -9.568  -11.506 4.728   1.00 39.89  ? 427 GLU A C      1 
ATOM   444  O  O      . GLU A 1 37 ? -8.498  -12.092 4.919   1.00 41.50  ? 427 GLU A O      1 
ATOM   445  C  CB     . GLU A 1 37 ? -9.135  -10.183 2.655   1.00 51.19  ? 427 GLU A CB     1 
ATOM   446  C  CG     . GLU A 1 37 ? -9.387  -8.909  1.857   1.00 58.71  ? 427 GLU A CG     1 
ATOM   447  C  CD     . GLU A 1 37 ? -10.839 -8.739  1.429   1.00 60.61  ? 427 GLU A CD     1 
ATOM   448  O  OE1    . GLU A 1 37 ? -11.730 -9.373  2.033   1.00 62.88  ? 427 GLU A OE1    1 
ATOM   449  O  OE2    . GLU A 1 37 ? -11.088 -7.964  0.481   1.00 61.77  ? 427 GLU A OE2    1 
ATOM   450  H  H      . GLU A 1 37 ? -8.048  -8.955  4.469   1.00 58.40  ? 427 GLU A H      1 
ATOM   451  H  HA     . GLU A 1 37 ? -10.519 -9.805  4.116   1.00 57.14  ? 427 GLU A HA     1 
ATOM   452  H  HB2    . GLU A 1 37 ? -8.180  -10.355 2.642   1.00 61.38  ? 427 GLU A HB2    1 
ATOM   453  H  HB3    . GLU A 1 37 ? -9.604  -10.907 2.211   1.00 61.38  ? 427 GLU A HB3    1 
ATOM   454  H  HG2    . GLU A 1 37 ? -9.149  -8.145  2.405   1.00 70.40  ? 427 GLU A HG2    1 
ATOM   455  H  HG3    . GLU A 1 37 ? -8.835  -8.926  1.062   1.00 70.40  ? 427 GLU A HG3    1 
ATOM   456  N  N      . LYS A 1 38 ? -10.752 -12.028 5.035   1.00 45.98  ? 428 LYS A N      1 
ATOM   457  C  CA     . LYS A 1 38 ? -10.923 -13.399 5.515   1.00 43.03  ? 428 LYS A CA     1 
ATOM   458  C  C      . LYS A 1 38 ? -12.175 -13.963 4.855   1.00 39.28  ? 428 LYS A C      1 
ATOM   459  O  O      . LYS A 1 38 ? -13.231 -14.079 5.480   1.00 40.33  ? 428 LYS A O      1 
ATOM   460  C  CB     . LYS A 1 38 ? -11.027 -13.434 7.041   1.00 38.99  ? 428 LYS A CB     1 
ATOM   461  C  CG     . LYS A 1 38 ? -9.864  -12.755 7.741   1.00 29.52  ? 428 LYS A CG     1 
ATOM   462  C  CD     . LYS A 1 38 ? -9.918  -12.958 9.240   1.00 27.62  ? 428 LYS A CD     1 
ATOM   463  C  CE     . LYS A 1 38 ? -8.730  -12.306 9.916   1.00 26.87  ? 428 LYS A CE     1 
ATOM   464  N  NZ     . LYS A 1 38 ? -8.728  -12.541 11.383  1.00 34.53  ? 428 LYS A NZ     1 
ATOM   465  H  H      . LYS A 1 38 ? -11.493 -11.596 4.972   1.00 55.12  ? 428 LYS A H      1 
ATOM   466  H  HA     . LYS A 1 38 ? -10.160 -13.935 5.250   1.00 51.58  ? 428 LYS A HA     1 
ATOM   467  H  HB2    . LYS A 1 38 ? -11.841 -12.980 7.310   1.00 46.74  ? 428 LYS A HB2    1 
ATOM   468  H  HB3    . LYS A 1 38 ? -11.053 -14.358 7.334   1.00 46.74  ? 428 LYS A HB3    1 
ATOM   469  H  HG2    . LYS A 1 38 ? -9.031  -13.130 7.414   1.00 35.37  ? 428 LYS A HG2    1 
ATOM   470  H  HG3    . LYS A 1 38 ? -9.896  -11.802 7.563   1.00 35.37  ? 428 LYS A HG3    1 
ATOM   471  H  HD2    . LYS A 1 38 ? -10.728 -12.556 9.591   1.00 33.09  ? 428 LYS A HD2    1 
ATOM   472  H  HD3    . LYS A 1 38 ? -9.899  -13.908 9.437   1.00 33.09  ? 428 LYS A HD3    1 
ATOM   473  H  HE2    . LYS A 1 38 ? -7.912  -12.676 9.549   1.00 32.20  ? 428 LYS A HE2    1 
ATOM   474  H  HE3    . LYS A 1 38 ? -8.762  -11.349 9.763   1.00 32.20  ? 428 LYS A HE3    1 
ATOM   475  H  HZ1    . LYS A 1 38 ? -8.021  -12.147 11.753  1.00 41.39  ? 428 LYS A HZ1    1 
ATOM   476  H  HZ2    . LYS A 1 38 ? -9.468  -12.205 11.746  1.00 41.39  ? 428 LYS A HZ2    1 
ATOM   477  H  HZ3    . LYS A 1 38 ? -8.694  -13.414 11.551  1.00 41.39  ? 428 LYS A HZ3    1 
ATOM   478  N  N      . PRO A 1 39 ? -12.082 -14.316 3.567   1.00 38.20  ? 429 PRO A N      1 
ATOM   479  C  CA     . PRO A 1 39 ? -13.302 -14.667 2.820   1.00 42.63  ? 429 PRO A CA     1 
ATOM   480  C  C      . PRO A 1 39 ? -13.936 -15.975 3.249   1.00 46.01  ? 429 PRO A C      1 
ATOM   481  O  O      . PRO A 1 39 ? -15.112 -16.200 2.936   1.00 52.85  ? 429 PRO A O      1 
ATOM   482  C  CB     . PRO A 1 39 ? -12.810 -14.741 1.369   1.00 46.45  ? 429 PRO A CB     1 
ATOM   483  C  CG     . PRO A 1 39 ? -11.367 -15.091 1.482   1.00 40.44  ? 429 PRO A CG     1 
ATOM   484  C  CD     . PRO A 1 39 ? -10.873 -14.423 2.735   1.00 38.76  ? 429 PRO A CD     1 
ATOM   485  H  HA     . PRO A 1 39 ? -13.957 -13.956 2.897   1.00 51.11  ? 429 PRO A HA     1 
ATOM   486  H  HB2    . PRO A 1 39 ? -13.296 -15.431 0.892   1.00 55.68  ? 429 PRO A HB2    1 
ATOM   487  H  HB3    . PRO A 1 39 ? -12.923 -13.879 0.940   1.00 55.68  ? 429 PRO A HB3    1 
ATOM   488  H  HG2    . PRO A 1 39 ? -11.271 -16.054 1.550   1.00 48.47  ? 429 PRO A HG2    1 
ATOM   489  H  HG3    . PRO A 1 39 ? -10.890 -14.755 0.707   1.00 48.47  ? 429 PRO A HG3    1 
ATOM   490  H  HD2    . PRO A 1 39 ? -10.209 -14.978 3.173   1.00 46.46  ? 429 PRO A HD2    1 
ATOM   491  H  HD3    . PRO A 1 39 ? -10.523 -13.541 2.533   1.00 46.46  ? 429 PRO A HD3    1 
ATOM   492  N  N      . TYR A 1 40 ? -13.206 -16.843 3.943   1.00 49.74  ? 430 TYR A N      1 
ATOM   493  C  CA     . TYR A 1 40 ? -13.727 -18.144 4.356   1.00 47.00  ? 430 TYR A CA     1 
ATOM   494  C  C      . TYR A 1 40 ? -14.338 -18.001 5.746   1.00 43.40  ? 430 TYR A C      1 
ATOM   495  O  O      . TYR A 1 40 ? -13.625 -17.937 6.750   1.00 38.61  ? 430 TYR A O      1 
ATOM   496  C  CB     . TYR A 1 40 ? -12.618 -19.188 4.322   1.00 47.92  ? 430 TYR A CB     1 
ATOM   497  C  CG     . TYR A 1 40 ? -11.916 -19.259 2.983   1.00 47.11  ? 430 TYR A CG     1 
ATOM   498  C  CD1    . TYR A 1 40 ? -12.513 -19.885 1.897   1.00 45.12  ? 430 TYR A CD1    1 
ATOM   499  C  CD2    . TYR A 1 40 ? -10.661 -18.694 2.802   1.00 43.32  ? 430 TYR A CD2    1 
ATOM   500  C  CE1    . TYR A 1 40 ? -11.880 -19.950 0.668   1.00 41.53  ? 430 TYR A CE1    1 
ATOM   501  C  CE2    . TYR A 1 40 ? -10.019 -18.755 1.576   1.00 42.79  ? 430 TYR A CE2    1 
ATOM   502  C  CZ     . TYR A 1 40 ? -10.633 -19.385 0.513   1.00 44.90  ? 430 TYR A CZ     1 
ATOM   503  O  OH     . TYR A 1 40 ? -10.002 -19.451 -0.709  1.00 49.27  ? 430 TYR A OH     1 
ATOM   504  H  H      . TYR A 1 40 ? -12.395 -16.701 4.191   1.00 59.64  ? 430 TYR A H      1 
ATOM   505  H  HA     . TYR A 1 40 ? -14.425 -18.422 3.743   1.00 56.34  ? 430 TYR A HA     1 
ATOM   506  H  HB2    . TYR A 1 40 ? -11.956 -18.967 4.996   1.00 57.45  ? 430 TYR A HB2    1 
ATOM   507  H  HB3    . TYR A 1 40 ? -13.000 -20.060 4.506   1.00 57.45  ? 430 TYR A HB3    1 
ATOM   508  H  HD1    . TYR A 1 40 ? -13.354 -20.268 1.997   1.00 54.09  ? 430 TYR A HD1    1 
ATOM   509  H  HD2    . TYR A 1 40 ? -10.244 -18.269 3.516   1.00 51.93  ? 430 TYR A HD2    1 
ATOM   510  H  HE1    . TYR A 1 40 ? -12.293 -20.375 -0.049  1.00 49.78  ? 430 TYR A HE1    1 
ATOM   511  H  HE2    . TYR A 1 40 ? -9.177  -18.374 1.470   1.00 51.29  ? 430 TYR A HE2    1 
ATOM   512  H  HH     . TYR A 1 40 ? -9.254  -19.071 -0.667  1.00 59.08  ? 430 TYR A HH     1 
ATOM   513  N  N      . HIS A 1 41 ? -15.666 -17.950 5.801   1.00 42.05  ? 431 HIS A N      1 
ATOM   514  C  CA     . HIS A 1 41 ? -16.387 -17.772 7.051   1.00 42.63  ? 431 HIS A CA     1 
ATOM   515  C  C      . HIS A 1 41 ? -16.813 -19.119 7.620   1.00 43.66  ? 431 HIS A C      1 
ATOM   516  O  O      . HIS A 1 41 ? -17.045 -20.080 6.883   1.00 47.78  ? 431 HIS A O      1 
ATOM   517  C  CB     . HIS A 1 41 ? -17.626 -16.899 6.845   1.00 44.63  ? 431 HIS A CB     1 
ATOM   518  C  CG     . HIS A 1 41 ? -17.351 -15.603 6.149   1.00 48.23  ? 431 HIS A CG     1 
ATOM   519  N  ND1    . HIS A 1 41 ? -16.135 -14.958 6.221   1.00 47.80  ? 431 HIS A ND1    1 
ATOM   520  C  CD2    . HIS A 1 41 ? -18.140 -14.830 5.364   1.00 49.57  ? 431 HIS A CD2    1 
ATOM   521  C  CE1    . HIS A 1 41 ? -16.186 -13.844 5.512   1.00 48.65  ? 431 HIS A CE1    1 
ATOM   522  N  NE2    . HIS A 1 41 ? -17.392 -13.743 4.982   1.00 50.18  ? 431 HIS A NE2    1 
ATOM   523  H  H      . HIS A 1 41 ? -16.178 -18.018 5.114   1.00 50.41  ? 431 HIS A H      1 
ATOM   524  H  HA     . HIS A 1 41 ? -15.810 -17.335 7.697   1.00 51.10  ? 431 HIS A HA     1 
ATOM   525  H  HB2    . HIS A 1 41 ? -18.268 -17.391 6.310   1.00 53.51  ? 431 HIS A HB2    1 
ATOM   526  H  HB3    . HIS A 1 41 ? -18.010 -16.693 7.712   1.00 53.51  ? 431 HIS A HB3    1 
ATOM   527  H  HD2    . HIS A 1 41 ? -19.023 -15.003 5.129   1.00 59.44  ? 431 HIS A HD2    1 
ATOM   528  H  HE1    . HIS A 1 41 ? -15.491 -13.235 5.404   1.00 58.32  ? 431 HIS A HE1    1 
ATOM   529  H  HE2    . HIS A 1 41 ? -17.664 -13.101 4.479   1.00 60.17  ? 431 HIS A HE2    1 
ATOM   530  N  N      . CYS A 1 42 ? -16.921 -19.177 8.945   1.00 38.80  ? 432 CYS A N      1 
ATOM   531  C  CA     . CYS A 1 42 ? -17.472 -20.340 9.627   1.00 41.76  ? 432 CYS A CA     1 
ATOM   532  C  C      . CYS A 1 42 ? -18.962 -20.114 9.852   1.00 40.72  ? 432 CYS A C      1 
ATOM   533  O  O      . CYS A 1 42 ? -19.355 -19.141 10.505  1.00 38.39  ? 432 CYS A O      1 
ATOM   534  C  CB     . CYS A 1 42 ? -16.759 -20.588 10.955  1.00 41.74  ? 432 CYS A CB     1 
ATOM   535  S  SG     . CYS A 1 42 ? -17.371 -22.043 11.849  1.00 41.43  ? 432 CYS A SG     1 
ATOM   536  H  H      . CYS A 1 42 ? -16.678 -18.546 9.476   1.00 46.50  ? 432 CYS A H      1 
ATOM   537  H  HA     . CYS A 1 42 ? -17.362 -21.126 9.069   1.00 50.06  ? 432 CYS A HA     1 
ATOM   538  H  HB2    . CYS A 1 42 ? -15.814 -20.721 10.783  1.00 50.04  ? 432 CYS A HB2    1 
ATOM   539  H  HB3    . CYS A 1 42 ? -16.884 -19.814 11.526  1.00 50.04  ? 432 CYS A HB3    1 
ATOM   540  N  N      . ASP A 1 43 ? -19.785 -21.008 9.309   1.00 52.49  ? 433 ASP A N      1 
ATOM   541  C  CA     . ASP A 1 43 ? -21.234 -20.879 9.374   1.00 53.13  ? 433 ASP A CA     1 
ATOM   542  C  C      . ASP A 1 43 ? -21.825 -21.456 10.652  1.00 51.83  ? 433 ASP A C      1 
ATOM   543  O  O      . ASP A 1 43 ? -23.051 -21.569 10.754  1.00 53.81  ? 433 ASP A O      1 
ATOM   544  C  CB     . ASP A 1 43 ? -21.879 -21.556 8.158   1.00 55.27  ? 433 ASP A CB     1 
ATOM   545  C  CG     . ASP A 1 43 ? -21.494 -23.022 8.025   1.00 55.77  ? 433 ASP A CG     1 
ATOM   546  O  OD1    . ASP A 1 43 ? -21.251 -23.466 6.884   1.00 57.03  ? 433 ASP A OD1    1 
ATOM   547  O  OD2    . ASP A 1 43 ? -21.443 -23.732 9.053   1.00 54.51  ? 433 ASP A OD2    1 
ATOM   548  H  H      . ASP A 1 43 ? -19.519 -21.710 8.891   1.00 62.93  ? 433 ASP A H      1 
ATOM   549  H  HA     . ASP A 1 43 ? -21.463 -19.937 9.343   1.00 63.70  ? 433 ASP A HA     1 
ATOM   550  H  HB2    . ASP A 1 43 ? -22.844 -21.506 8.243   1.00 66.27  ? 433 ASP A HB2    1 
ATOM   551  H  HB3    . ASP A 1 43 ? -21.593 -21.097 7.353   1.00 66.27  ? 433 ASP A HB3    1 
ATOM   552  N  N      . TRP A 1 44 ? -20.993 -21.819 11.623  1.00 43.94  ? 434 TRP A N      1 
ATOM   553  C  CA     . TRP A 1 44 ? -21.496 -22.442 12.836  1.00 45.92  ? 434 TRP A CA     1 
ATOM   554  C  C      . TRP A 1 44 ? -22.285 -21.443 13.671  1.00 50.96  ? 434 TRP A C      1 
ATOM   555  O  O      . TRP A 1 44 ? -21.999 -20.242 13.686  1.00 53.74  ? 434 TRP A O      1 
ATOM   556  C  CB     . TRP A 1 44 ? -20.349 -23.008 13.665  1.00 50.27  ? 434 TRP A CB     1 
ATOM   557  C  CG     . TRP A 1 44 ? -20.809 -23.929 14.746  1.00 52.44  ? 434 TRP A CG     1 
ATOM   558  C  CD1    . TRP A 1 44 ? -21.011 -23.621 16.060  1.00 59.04  ? 434 TRP A CD1    1 
ATOM   559  C  CD2    . TRP A 1 44 ? -21.132 -25.315 14.605  1.00 47.65  ? 434 TRP A CD2    1 
ATOM   560  N  NE1    . TRP A 1 44 ? -21.435 -24.733 16.748  1.00 56.02  ? 434 TRP A NE1    1 
ATOM   561  C  CE2    . TRP A 1 44 ? -21.517 -25.787 15.876  1.00 49.92  ? 434 TRP A CE2    1 
ATOM   562  C  CE3    . TRP A 1 44 ? -21.130 -26.205 13.528  1.00 47.21  ? 434 TRP A CE3    1 
ATOM   563  C  CZ2    . TRP A 1 44 ? -21.896 -27.108 16.098  1.00 52.55  ? 434 TRP A CZ2    1 
ATOM   564  C  CZ3    . TRP A 1 44 ? -21.505 -27.514 13.751  1.00 47.92  ? 434 TRP A CZ3    1 
ATOM   565  C  CH2    . TRP A 1 44 ? -21.883 -27.954 15.025  1.00 52.11  ? 434 TRP A CH2    1 
ATOM   566  H  H      . TRP A 1 44 ? -20.140 -21.716 11.604  1.00 52.67  ? 434 TRP A H      1 
ATOM   567  H  HA     . TRP A 1 44 ? -22.088 -23.173 12.598  1.00 55.05  ? 434 TRP A HA     1 
ATOM   568  H  HB2    . TRP A 1 44 ? -19.754 -23.505 13.082  1.00 60.27  ? 434 TRP A HB2    1 
ATOM   569  H  HB3    . TRP A 1 44 ? -19.869 -22.275 14.081  1.00 60.27  ? 434 TRP A HB3    1 
ATOM   570  H  HD1    . TRP A 1 44 ? -20.878 -22.781 16.436  1.00 70.79  ? 434 TRP A HD1    1 
ATOM   571  H  HE1    . TRP A 1 44 ? -21.619 -24.762 17.587  1.00 67.17  ? 434 TRP A HE1    1 
ATOM   572  H  HE3    . TRP A 1 44 ? -20.877 -25.922 12.679  1.00 56.60  ? 434 TRP A HE3    1 
ATOM   573  H  HZ2    . TRP A 1 44 ? -22.149 -27.403 16.943  1.00 63.01  ? 434 TRP A HZ2    1 
ATOM   574  H  HZ3    . TRP A 1 44 ? -21.506 -28.113 13.044  1.00 57.45  ? 434 TRP A HZ3    1 
ATOM   575  H  HH2    . TRP A 1 44 ? -22.132 -28.842 15.144  1.00 62.49  ? 434 TRP A HH2    1 
ATOM   576  N  N      . ASP A 1 45 ? -23.280 -21.958 14.385  1.00 58.21  ? 435 ASP A N      1 
ATOM   577  C  CA     . ASP A 1 45 ? -24.165 -21.120 15.184  1.00 59.49  ? 435 ASP A CA     1 
ATOM   578  C  C      . ASP A 1 45 ? -23.387 -20.523 16.351  1.00 54.05  ? 435 ASP A C      1 
ATOM   579  O  O      . ASP A 1 45 ? -23.015 -21.234 17.290  1.00 48.69  ? 435 ASP A O      1 
ATOM   580  C  CB     . ASP A 1 45 ? -25.353 -21.943 15.675  1.00 66.97  ? 435 ASP A CB     1 
ATOM   581  C  CG     . ASP A 1 45 ? -26.412 -21.094 16.350  1.00 78.16  ? 435 ASP A CG     1 
ATOM   582  O  OD1    . ASP A 1 45 ? -27.239 -21.660 17.097  1.00 80.49  ? 435 ASP A OD1    1 
ATOM   583  O  OD2    . ASP A 1 45 ? -26.420 -19.864 16.131  1.00 81.32  ? 435 ASP A OD2    1 
ATOM   584  H  H      . ASP A 1 45 ? -23.465 -22.797 14.423  1.00 69.80  ? 435 ASP A H      1 
ATOM   585  H  HA     . ASP A 1 45 ? -24.501 -20.393 14.636  1.00 71.34  ? 435 ASP A HA     1 
ATOM   586  H  HB2    . ASP A 1 45 ? -25.763 -22.389 14.918  1.00 80.31  ? 435 ASP A HB2    1 
ATOM   587  H  HB3    . ASP A 1 45 ? -25.040 -22.599 16.317  1.00 80.31  ? 435 ASP A HB3    1 
ATOM   588  N  N      . GLY A 1 46 ? -23.131 -19.215 16.286  1.00 52.14  ? 436 GLY A N      1 
ATOM   589  C  CA     . GLY A 1 46 ? -22.517 -18.487 17.376  1.00 53.15  ? 436 GLY A CA     1 
ATOM   590  C  C      . GLY A 1 46 ? -21.007 -18.400 17.335  1.00 56.37  ? 436 GLY A C      1 
ATOM   591  O  O      . GLY A 1 46 ? -20.418 -17.784 18.233  1.00 54.58  ? 436 GLY A O      1 
ATOM   592  H  H      . GLY A 1 46 ? -23.311 -18.725 15.603  1.00 62.52  ? 436 GLY A H      1 
ATOM   593  H  HA2    . GLY A 1 46 ? -22.866 -17.582 17.382  1.00 63.72  ? 436 GLY A HA2    1 
ATOM   594  H  HA3    . GLY A 1 46 ? -22.767 -18.908 18.213  1.00 63.72  ? 436 GLY A HA3    1 
ATOM   595  N  N      . CYS A 1 47 ? -20.359 -18.986 16.328  1.00 58.12  ? 437 CYS A N      1 
ATOM   596  C  CA     . CYS A 1 47 ? -18.901 -18.972 16.270  1.00 49.01  ? 437 CYS A CA     1 
ATOM   597  C  C      . CYS A 1 47 ? -18.384 -17.658 15.696  1.00 41.22  ? 437 CYS A C      1 
ATOM   598  O  O      . CYS A 1 47 ? -17.682 -16.901 16.375  1.00 34.79  ? 437 CYS A O      1 
ATOM   599  C  CB     . CYS A 1 47 ? -18.402 -20.151 15.436  1.00 43.90  ? 437 CYS A CB     1 
ATOM   600  S  SG     . CYS A 1 47 ? -16.616 -20.169 15.211  1.00 33.19  ? 437 CYS A SG     1 
ATOM   601  H  H      . CYS A 1 47 ? -20.737 -19.394 15.672  1.00 69.70  ? 437 CYS A H      1 
ATOM   602  H  HA     . CYS A 1 47 ? -18.547 -19.068 17.168  1.00 58.76  ? 437 CYS A HA     1 
ATOM   603  H  HB2    . CYS A 1 47 ? -18.654 -20.977 15.878  1.00 52.63  ? 437 CYS A HB2    1 
ATOM   604  H  HB3    . CYS A 1 47 ? -18.812 -20.109 14.558  1.00 52.63  ? 437 CYS A HB3    1 
ATOM   605  N  N      . GLY A 1 48 ? -18.725 -17.374 14.441  1.00 29.65  ? 438 GLY A N      1 
ATOM   606  C  CA     . GLY A 1 48 ? -18.335 -16.139 13.801  1.00 32.07  ? 438 GLY A CA     1 
ATOM   607  C  C      . GLY A 1 48 ? -16.909 -16.090 13.305  1.00 27.43  ? 438 GLY A C      1 
ATOM   608  O  O      . GLY A 1 48 ? -16.540 -15.117 12.636  1.00 27.06  ? 438 GLY A O      1 
ATOM   609  H  H      . GLY A 1 48 ? -19.190 -17.894 13.938  1.00 35.53  ? 438 GLY A H      1 
ATOM   610  H  HA2    . GLY A 1 48 ? -18.919 -15.981 13.043  1.00 38.43  ? 438 GLY A HA2    1 
ATOM   611  H  HA3    . GLY A 1 48 ? -18.457 -15.409 14.428  1.00 38.43  ? 438 GLY A HA3    1 
ATOM   612  N  N      . TRP A 1 49 ? -16.093 -17.097 13.602  1.00 37.78  ? 439 TRP A N      1 
ATOM   613  C  CA     . TRP A 1 49 ? -14.703 -17.075 13.168  1.00 30.95  ? 439 TRP A CA     1 
ATOM   614  C  C      . TRP A 1 49 ? -14.616 -17.052 11.649  1.00 33.49  ? 439 TRP A C      1 
ATOM   615  O  O      . TRP A 1 49 ? -15.369 -17.736 10.951  1.00 39.51  ? 439 TRP A O      1 
ATOM   616  C  CB     . TRP A 1 49 ? -13.951 -18.286 13.717  1.00 34.75  ? 439 TRP A CB     1 
ATOM   617  C  CG     . TRP A 1 49 ? -13.345 -18.042 15.056  1.00 37.54  ? 439 TRP A CG     1 
ATOM   618  C  CD1    . TRP A 1 49 ? -13.922 -18.257 16.272  1.00 37.40  ? 439 TRP A CD1    1 
ATOM   619  C  CD2    . TRP A 1 49 ? -12.037 -17.525 15.318  1.00 43.03  ? 439 TRP A CD2    1 
ATOM   620  N  NE1    . TRP A 1 49 ? -13.054 -17.907 17.277  1.00 36.86  ? 439 TRP A NE1    1 
ATOM   621  C  CE2    . TRP A 1 49 ? -11.889 -17.453 16.717  1.00 40.29  ? 439 TRP A CE2    1 
ATOM   622  C  CE3    . TRP A 1 49 ? -10.976 -17.115 14.505  1.00 43.79  ? 439 TRP A CE3    1 
ATOM   623  C  CZ2    . TRP A 1 49 ? -10.722 -16.989 17.320  1.00 40.62  ? 439 TRP A CZ2    1 
ATOM   624  C  CZ3    . TRP A 1 49 ? -9.819  -16.656 15.105  1.00 40.68  ? 439 TRP A CZ3    1 
ATOM   625  C  CH2    . TRP A 1 49 ? -9.701  -16.596 16.498  1.00 41.26  ? 439 TRP A CH2    1 
ATOM   626  H  H      . TRP A 1 49 ? -16.317 -17.797 14.049  1.00 45.28  ? 439 TRP A H      1 
ATOM   627  H  HA     . TRP A 1 49 ? -14.276 -16.273 13.508  1.00 37.08  ? 439 TRP A HA     1 
ATOM   628  H  HB2    . TRP A 1 49 ? -14.564 -19.032 13.794  1.00 41.65  ? 439 TRP A HB2    1 
ATOM   629  H  HB3    . TRP A 1 49 ? -13.234 -18.512 13.104  1.00 41.65  ? 439 TRP A HB3    1 
ATOM   630  H  HD1    . TRP A 1 49 ? -14.780 -18.591 16.403  1.00 44.83  ? 439 TRP A HD1    1 
ATOM   631  H  HE1    . TRP A 1 49 ? -13.216 -17.963 18.120  1.00 44.17  ? 439 TRP A HE1    1 
ATOM   632  H  HE3    . TRP A 1 49 ? -11.048 -17.151 13.578  1.00 52.49  ? 439 TRP A HE3    1 
ATOM   633  H  HZ2    . TRP A 1 49 ? -10.639 -16.950 18.245  1.00 48.69  ? 439 TRP A HZ2    1 
ATOM   634  H  HZ3    . TRP A 1 49 ? -9.107  -16.380 14.574  1.00 48.76  ? 439 TRP A HZ3    1 
ATOM   635  H  HH2    . TRP A 1 49 ? -8.910  -16.283 16.874  1.00 49.46  ? 439 TRP A HH2    1 
ATOM   636  N  N      . LYS A 1 50 ? -13.689 -16.251 11.140  1.00 44.92  ? 440 LYS A N      1 
ATOM   637  C  CA     . LYS A 1 50 ? -13.413 -16.170 9.717   1.00 45.66  ? 440 LYS A CA     1 
ATOM   638  C  C      . LYS A 1 50 ? -11.919 -16.355 9.511   1.00 44.08  ? 440 LYS A C      1 
ATOM   639  O  O      . LYS A 1 50 ? -11.118 -16.088 10.410  1.00 42.21  ? 440 LYS A O      1 
ATOM   640  C  CB     . LYS A 1 50 ? -13.877 -14.828 9.133   1.00 49.57  ? 440 LYS A CB     1 
ATOM   641  C  CG     . LYS A 1 50 ? -15.318 -14.481 9.487   1.00 51.01  ? 440 LYS A CG     1 
ATOM   642  C  CD     . LYS A 1 50 ? -15.694 -13.087 9.032   1.00 50.81  ? 440 LYS A CD     1 
ATOM   643  C  CE     . LYS A 1 50 ? -17.089 -12.718 9.503   1.00 55.65  ? 440 LYS A CE     1 
ATOM   644  N  NZ     . LYS A 1 50 ? -17.468 -11.334 9.109   1.00 64.31  ? 440 LYS A NZ     1 
ATOM   645  H  H      . LYS A 1 50 ? -13.194 -15.731 11.614  1.00 53.85  ? 440 LYS A H      1 
ATOM   646  H  HA     . LYS A 1 50 ? -13.877 -16.884 9.253   1.00 54.74  ? 440 LYS A HA     1 
ATOM   647  H  HB2    . LYS A 1 50 ? -13.307 -14.122 9.477   1.00 59.43  ? 440 LYS A HB2    1 
ATOM   648  H  HB3    . LYS A 1 50 ? -13.809 -14.866 8.166   1.00 59.43  ? 440 LYS A HB3    1 
ATOM   649  H  HG2    . LYS A 1 50 ? -15.913 -15.112 9.053   1.00 61.16  ? 440 LYS A HG2    1 
ATOM   650  H  HG3    . LYS A 1 50 ? -15.431 -14.523 10.449  1.00 61.16  ? 440 LYS A HG3    1 
ATOM   651  H  HD2    . LYS A 1 50 ? -15.068 -12.448 9.406   1.00 60.92  ? 440 LYS A HD2    1 
ATOM   652  H  HD3    . LYS A 1 50 ? -15.677 -13.047 8.064   1.00 60.92  ? 440 LYS A HD3    1 
ATOM   653  H  HE2    . LYS A 1 50 ? -17.730 -13.330 9.109   1.00 66.72  ? 440 LYS A HE2    1 
ATOM   654  H  HE3    . LYS A 1 50 ? -17.124 -12.776 10.471  1.00 66.72  ? 440 LYS A HE3    1 
ATOM   655  H  HZ1    . LYS A 1 50 ? -18.289 -11.149 9.399   1.00 77.12  ? 440 LYS A HZ1    1 
ATOM   656  H  HZ2    . LYS A 1 50 ? -16.898 -10.750 9.464   1.00 77.12  ? 440 LYS A HZ2    1 
ATOM   657  H  HZ3    . LYS A 1 50 ? -17.450 -11.255 8.223   1.00 77.12  ? 440 LYS A HZ3    1 
ATOM   658  N  N      . PHE A 1 51 ? -11.547 -16.821 8.323   1.00 37.85  ? 441 PHE A N      1 
ATOM   659  C  CA     . PHE A 1 51 ? -10.163 -17.166 8.053   1.00 36.53  ? 441 PHE A CA     1 
ATOM   660  C  C      . PHE A 1 51 ? -9.764  -16.677 6.670   1.00 37.78  ? 441 PHE A C      1 
ATOM   661  O  O      . PHE A 1 51 ? -10.605 -16.513 5.780   1.00 28.13  ? 441 PHE A O      1 
ATOM   662  C  CB     . PHE A 1 51 ? -9.942  -18.681 8.175   1.00 27.84  ? 441 PHE A CB     1 
ATOM   663  C  CG     . PHE A 1 51 ? -10.277 -19.227 9.532   1.00 29.91  ? 441 PHE A CG     1 
ATOM   664  C  CD1    . PHE A 1 51 ? -9.311  -19.308 10.519  1.00 34.84  ? 441 PHE A CD1    1 
ATOM   665  C  CD2    . PHE A 1 51 ? -11.563 -19.647 9.828   1.00 37.81  ? 441 PHE A CD2    1 
ATOM   666  C  CE1    . PHE A 1 51 ? -9.618  -19.805 11.772  1.00 38.34  ? 441 PHE A CE1    1 
ATOM   667  C  CE2    . PHE A 1 51 ? -11.876 -20.144 11.080  1.00 40.55  ? 441 PHE A CE2    1 
ATOM   668  C  CZ     . PHE A 1 51 ? -10.901 -20.223 12.053  1.00 40.24  ? 441 PHE A CZ     1 
ATOM   669  H  H      . PHE A 1 51 ? -12.079 -16.945 7.659   1.00 45.37  ? 441 PHE A H      1 
ATOM   670  H  HA     . PHE A 1 51 ? -9.590  -16.727 8.701   1.00 43.79  ? 441 PHE A HA     1 
ATOM   671  H  HB2    . PHE A 1 51 ? -10.503 -19.133 7.526   1.00 33.36  ? 441 PHE A HB2    1 
ATOM   672  H  HB3    . PHE A 1 51 ? -9.009  -18.877 7.998   1.00 33.36  ? 441 PHE A HB3    1 
ATOM   673  H  HD1    . PHE A 1 51 ? -8.443  -19.028 10.336  1.00 41.76  ? 441 PHE A HD1    1 
ATOM   674  H  HD2    . PHE A 1 51 ? -12.224 -19.596 9.176   1.00 45.32  ? 441 PHE A HD2    1 
ATOM   675  H  HE1    . PHE A 1 51 ? -8.959  -19.857 12.426  1.00 45.96  ? 441 PHE A HE1    1 
ATOM   676  H  HE2    . PHE A 1 51 ? -12.743 -20.426 11.266  1.00 48.61  ? 441 PHE A HE2    1 
ATOM   677  H  HZ     . PHE A 1 51 ? -11.109 -20.558 12.895  1.00 48.24  ? 441 PHE A HZ     1 
ATOM   678  N  N      . ALA A 1 52 ? -8.464  -16.433 6.507   1.00 39.36  ? 442 ALA A N      1 
ATOM   679  C  CA     . ALA A 1 52 ? -7.910  -16.015 5.229   1.00 38.86  ? 442 ALA A CA     1 
ATOM   680  C  C      . ALA A 1 52 ? -7.524  -17.186 4.340   1.00 37.57  ? 442 ALA A C      1 
ATOM   681  O  O      . ALA A 1 52 ? -7.467  -17.023 3.116   1.00 40.82  ? 442 ALA A O      1 
ATOM   682  C  CB     . ALA A 1 52 ? -6.682  -15.130 5.451   1.00 35.94  ? 442 ALA A CB     1 
ATOM   683  H  H      . ALA A 1 52 ? -7.878  -16.505 7.132   1.00 47.19  ? 442 ALA A H      1 
ATOM   684  H  HA     . ALA A 1 52 ? -8.573  -15.490 4.756   1.00 46.58  ? 442 ALA A HA     1 
ATOM   685  H  HB1    . ALA A 1 52 ? -6.320  -14.870 4.590   1.00 43.07  ? 442 ALA A HB1    1 
ATOM   686  H  HB2    . ALA A 1 52 ? -6.947  -14.342 5.951   1.00 43.07  ? 442 ALA A HB2    1 
ATOM   687  H  HB3    . ALA A 1 52 ? -6.018  -15.631 5.950   1.00 43.07  ? 442 ALA A HB3    1 
ATOM   688  N  N      . ARG A 1 53 ? -7.258  -18.353 4.918   1.00 28.08  ? 443 ARG A N      1 
ATOM   689  C  CA     . ARG A 1 53 ? -6.914  -19.544 4.156   1.00 27.26  ? 443 ARG A CA     1 
ATOM   690  C  C      . ARG A 1 53 ? -8.013  -20.585 4.321   1.00 26.81  ? 443 ARG A C      1 
ATOM   691  O  O      . ARG A 1 53 ? -8.574  -20.745 5.409   1.00 27.45  ? 443 ARG A O      1 
ATOM   692  C  CB     . ARG A 1 53 ? -5.569  -20.126 4.607   1.00 32.87  ? 443 ARG A CB     1 
ATOM   693  C  CG     . ARG A 1 53 ? -4.680  -19.138 5.341   1.00 33.52  ? 443 ARG A CG     1 
ATOM   694  C  CD     . ARG A 1 53 ? -3.218  -19.567 5.348   1.00 38.71  ? 443 ARG A CD     1 
ATOM   695  N  NE     . ARG A 1 53 ? -3.027  -20.986 5.639   1.00 42.48  ? 443 ARG A NE     1 
ATOM   696  C  CZ     . ARG A 1 53 ? -1.855  -21.532 5.951   1.00 36.95  ? 443 ARG A CZ     1 
ATOM   697  N  NH1    . ARG A 1 53 ? -0.765  -20.780 6.031   1.00 33.37  ? 443 ARG A NH1    1 
ATOM   698  N  NH2    . ARG A 1 53 ? -1.770  -22.832 6.192   1.00 36.58  ? 443 ARG A NH2    1 
ATOM   699  H  H      . ARG A 1 53 ? -7.271  -18.481 5.768   1.00 33.65  ? 443 ARG A H      1 
ATOM   700  H  HA     . ARG A 1 53 ? -6.847  -19.320 3.215   1.00 32.66  ? 443 ARG A HA     1 
ATOM   701  H  HB2    . ARG A 1 53 ? -5.737  -20.872 5.204   1.00 39.39  ? 443 ARG A HB2    1 
ATOM   702  H  HB3    . ARG A 1 53 ? -5.085  -20.435 3.825   1.00 39.39  ? 443 ARG A HB3    1 
ATOM   703  H  HG2    . ARG A 1 53 ? -4.733  -18.274 4.903   1.00 40.17  ? 443 ARG A HG2    1 
ATOM   704  H  HG3    . ARG A 1 53 ? -4.978  -19.065 6.261   1.00 40.17  ? 443 ARG A HG3    1 
ATOM   705  H  HD2    . ARG A 1 53 ? -2.834  -19.388 4.475   1.00 46.40  ? 443 ARG A HD2    1 
ATOM   706  H  HD3    . ARG A 1 53 ? -2.747  -19.058 6.026   1.00 46.40  ? 443 ARG A HD3    1 
ATOM   707  H  HE     . ARG A 1 53 ? -3.730  -21.470 5.744   1.00 50.92  ? 443 ARG A HE     1 
ATOM   708  H  HH11   . ARG A 1 53 ? -0.808  -19.936 5.875   1.00 40.00  ? 443 ARG A HH11   1 
ATOM   709  H  HH12   . ARG A 1 53 ? -0.011  -21.140 6.236   1.00 40.00  ? 443 ARG A HH12   1 
ATOM   710  H  HH21   . ARG A 1 53 ? -2.473  -23.325 6.145   1.00 43.84  ? 443 ARG A HH21   1 
ATOM   711  H  HH22   . ARG A 1 53 ? -1.012  -23.182 6.399   1.00 43.84  ? 443 ARG A HH22   1 
ATOM   712  N  N      . SER A 1 54 ? -8.319  -21.291 3.234   1.00 32.35  ? 444 SER A N      1 
ATOM   713  C  CA     . SER A 1 54 ? -9.372  -22.298 3.281   1.00 39.25  ? 444 SER A CA     1 
ATOM   714  C  C      . SER A 1 54 ? -9.023  -23.404 4.268   1.00 38.76  ? 444 SER A C      1 
ATOM   715  O  O      . SER A 1 54 ? -9.854  -23.806 5.091   1.00 32.52  ? 444 SER A O      1 
ATOM   716  C  CB     . SER A 1 54 ? -9.600  -22.878 1.885   1.00 49.38  ? 444 SER A CB     1 
ATOM   717  O  OG     . SER A 1 54 ? -8.447  -23.569 1.433   1.00 55.94  ? 444 SER A OG     1 
ATOM   718  H  H      . SER A 1 54 ? -7.937  -21.207 2.468   1.00 38.77  ? 444 SER A H      1 
ATOM   719  H  HA     . SER A 1 54 ? -10.198 -21.881 3.574   1.00 47.04  ? 444 SER A HA     1 
ATOM   720  H  HB2    . SER A 1 54 ? -10.346 -23.497 1.918   1.00 59.20  ? 444 SER A HB2    1 
ATOM   721  H  HB3    . SER A 1 54 ? -9.796  -22.154 1.270   1.00 59.20  ? 444 SER A HB3    1 
ATOM   722  H  HG     . SER A 1 54 ? -8.583  -23.883 0.666   1.00 67.08  ? 444 SER A HG     1 
ATOM   723  N  N      . ASP A 1 55 ? -7.788  -23.910 4.201   1.00 33.35  ? 445 ASP A N      1 
ATOM   724  C  CA     . ASP A 1 55 ? -7.420  -25.060 5.020   1.00 32.14  ? 445 ASP A CA     1 
ATOM   725  C  C      . ASP A 1 55 ? -7.600  -24.776 6.503   1.00 27.62  ? 445 ASP A C      1 
ATOM   726  O  O      . ASP A 1 55 ? -7.881  -25.699 7.277   1.00 28.92  ? 445 ASP A O      1 
ATOM   727  C  CB     . ASP A 1 55 ? -5.979  -25.487 4.726   1.00 43.95  ? 445 ASP A CB     1 
ATOM   728  C  CG     . ASP A 1 55 ? -4.994  -24.337 4.797   1.00 44.59  ? 445 ASP A CG     1 
ATOM   729  O  OD1    . ASP A 1 55 ? -5.330  -23.224 4.343   1.00 44.06  ? 445 ASP A OD1    1 
ATOM   730  O  OD2    . ASP A 1 55 ? -3.872  -24.555 5.300   1.00 46.87  ? 445 ASP A OD2    1 
ATOM   731  H  H      . ASP A 1 55 ? -7.160  -23.610 3.696   1.00 39.97  ? 445 ASP A H      1 
ATOM   732  H  HA     . ASP A 1 55 ? -8.000  -25.803 4.790   1.00 38.51  ? 445 ASP A HA     1 
ATOM   733  H  HB2    . ASP A 1 55 ? -5.709  -26.153 5.377   1.00 52.69  ? 445 ASP A HB2    1 
ATOM   734  H  HB3    . ASP A 1 55 ? -5.937  -25.862 3.832   1.00 52.69  ? 445 ASP A HB3    1 
ATOM   735  N  N      . ASP A 1 56 ? -7.467  -23.513 6.919   1.00 29.98  ? 446 ASP A N      1 
ATOM   736  C  CA     . ASP A 1 56 ? -7.640  -23.180 8.330   1.00 23.52  ? 446 ASP A CA     1 
ATOM   737  C  C      . ASP A 1 56 ? -9.095  -23.309 8.752   1.00 26.63  ? 446 ASP A C      1 
ATOM   738  O  O      . ASP A 1 56 ? -9.385  -23.725 9.879   1.00 24.73  ? 446 ASP A O      1 
ATOM   739  C  CB     . ASP A 1 56 ? -7.131  -21.769 8.607   1.00 23.62  ? 446 ASP A CB     1 
ATOM   740  C  CG     . ASP A 1 56 ? -5.620  -21.698 8.670   1.00 34.99  ? 446 ASP A CG     1 
ATOM   741  O  OD1    . ASP A 1 56 ? -4.994  -22.690 9.109   1.00 31.35  ? 446 ASP A OD1    1 
ATOM   742  O  OD2    . ASP A 1 56 ? -5.059  -20.652 8.280   1.00 42.10  ? 446 ASP A OD2    1 
ATOM   743  H  H      . ASP A 1 56 ? -7.280  -22.844 6.412   1.00 35.92  ? 446 ASP A H      1 
ATOM   744  H  HA     . ASP A 1 56 ? -7.120  -23.799 8.866   1.00 28.17  ? 446 ASP A HA     1 
ATOM   745  H  HB2    . ASP A 1 56 ? -7.430  -21.179 7.897   1.00 28.29  ? 446 ASP A HB2    1 
ATOM   746  H  HB3    . ASP A 1 56 ? -7.482  -21.468 9.460   1.00 28.29  ? 446 ASP A HB3    1 
ATOM   747  N  N      . LEU A 1 57 ? -10.024 -22.947 7.865   1.00 29.34  ? 447 LEU A N      1 
ATOM   748  C  CA     . LEU A 1 57 ? -11.442 -23.113 8.165   1.00 23.67  ? 447 LEU A CA     1 
ATOM   749  C  C      . LEU A 1 57 ? -11.794 -24.588 8.290   1.00 29.33  ? 447 LEU A C      1 
ATOM   750  O  O      . LEU A 1 57 ? -12.483 -24.998 9.231   1.00 28.95  ? 447 LEU A O      1 
ATOM   751  C  CB     . LEU A 1 57 ? -12.287 -22.451 7.080   1.00 23.98  ? 447 LEU A CB     1 
ATOM   752  C  CG     . LEU A 1 57 ? -13.791 -22.706 7.174   1.00 29.26  ? 447 LEU A CG     1 
ATOM   753  C  CD1    . LEU A 1 57 ? -14.324 -22.286 8.533   1.00 34.19  ? 447 LEU A CD1    1 
ATOM   754  C  CD2    . LEU A 1 57 ? -14.522 -21.976 6.064   1.00 30.86  ? 447 LEU A CD2    1 
ATOM   755  H  H      . LEU A 1 57 ? -9.860  -22.607 7.092   1.00 35.16  ? 447 LEU A H      1 
ATOM   756  H  HA     . LEU A 1 57 ? -11.640 -22.681 9.011   1.00 28.35  ? 447 LEU A HA     1 
ATOM   757  H  HB2    . LEU A 1 57 ? -12.151 -21.492 7.127   1.00 28.72  ? 447 LEU A HB2    1 
ATOM   758  H  HB3    . LEU A 1 57 ? -11.990 -22.778 6.217   1.00 28.72  ? 447 LEU A HB3    1 
ATOM   759  H  HG     . LEU A 1 57 ? -13.962 -23.654 7.065   1.00 35.07  ? 447 LEU A HG     1 
ATOM   760  H  HD11   . LEU A 1 57 ? -15.293 -22.338 8.520   1.00 40.97  ? 447 LEU A HD11   1 
ATOM   761  H  HD12   . LEU A 1 57 ? -13.970 -22.883 9.211   1.00 40.97  ? 447 LEU A HD12   1 
ATOM   762  H  HD13   . LEU A 1 57 ? -14.044 -21.375 8.714   1.00 40.97  ? 447 LEU A HD13   1 
ATOM   763  H  HD21   . LEU A 1 57 ? -15.470 -22.167 6.132   1.00 36.98  ? 447 LEU A HD21   1 
ATOM   764  H  HD22   . LEU A 1 57 ? -14.369 -21.023 6.159   1.00 36.98  ? 447 LEU A HD22   1 
ATOM   765  H  HD23   . LEU A 1 57 ? -14.183 -22.282 5.208   1.00 36.98  ? 447 LEU A HD23   1 
ATOM   766  N  N      . THR A 1 58 ? -11.331 -25.400 7.338   1.00 28.07  ? 448 THR A N      1 
ATOM   767  C  CA     . THR A 1 58 ? -11.511 -26.842 7.430   1.00 30.61  ? 448 THR A CA     1 
ATOM   768  C  C      . THR A 1 58 ? -11.055 -27.353 8.787   1.00 27.88  ? 448 THR A C      1 
ATOM   769  O  O      . THR A 1 58 ? -11.809 -28.022 9.502   1.00 29.70  ? 448 THR A O      1 
ATOM   770  C  CB     . THR A 1 58 ? -10.728 -27.538 6.316   1.00 36.32  ? 448 THR A CB     1 
ATOM   771  O  OG1    . THR A 1 58 ? -11.037 -26.931 5.055   1.00 37.93  ? 448 THR A OG1    1 
ATOM   772  C  CG2    . THR A 1 58 ? -11.074 -29.017 6.265   1.00 35.04  ? 448 THR A CG2    1 
ATOM   773  H  H      . THR A 1 58 ? -10.912 -25.139 6.634   1.00 33.63  ? 448 THR A H      1 
ATOM   774  H  HA     . THR A 1 58 ? -12.451 -27.056 7.323   1.00 36.68  ? 448 THR A HA     1 
ATOM   775  H  HB     . THR A 1 58 ? -9.777  -27.453 6.489   1.00 43.53  ? 448 THR A HB     1 
ATOM   776  H  HG1    . THR A 1 58 ? -10.608 -27.311 4.441   1.00 45.47  ? 448 THR A HG1    1 
ATOM   777  H  HG21   . THR A 1 58 ? -10.653 -29.428 5.494   1.00 42.00  ? 448 THR A HG21   1 
ATOM   778  H  HG22   . THR A 1 58 ? -10.760 -29.461 7.068   1.00 42.00  ? 448 THR A HG22   1 
ATOM   779  H  HG23   . THR A 1 58 ? -12.035 -29.130 6.196   1.00 42.00  ? 448 THR A HG23   1 
ATOM   780  N  N      . ARG A 1 59 ? -9.813  -27.035 9.157   1.00 33.69  ? 449 ARG A N      1 
ATOM   781  C  CA     . ARG A 1 59 ? -9.275  -27.475 10.440  1.00 34.84  ? 449 ARG A CA     1 
ATOM   782  C  C      . ARG A 1 59 ? -10.113 -26.942 11.593  1.00 33.07  ? 449 ARG A C      1 
ATOM   783  O  O      . ARG A 1 59 ? -10.509 -27.694 12.491  1.00 34.28  ? 449 ARG A O      1 
ATOM   784  C  CB     . ARG A 1 59 ? -7.823  -27.018 10.569  1.00 34.64  ? 449 ARG A CB     1 
ATOM   785  C  CG     . ARG A 1 59 ? -7.098  -27.598 11.764  1.00 42.55  ? 449 ARG A CG     1 
ATOM   786  C  CD     . ARG A 1 59 ? -5.659  -27.118 11.821  1.00 38.98  ? 449 ARG A CD     1 
ATOM   787  N  NE     . ARG A 1 59 ? -5.564  -25.705 12.171  1.00 39.10  ? 449 ARG A NE     1 
ATOM   788  C  CZ     . ARG A 1 59 ? -4.417  -25.048 12.312  1.00 40.14  ? 449 ARG A CZ     1 
ATOM   789  N  NH1    . ARG A 1 59 ? -3.263  -25.677 12.130  1.00 40.79  ? 449 ARG A NH1    1 
ATOM   790  N  NH2    . ARG A 1 59 ? -4.426  -23.762 12.636  1.00 35.97  ? 449 ARG A NH2    1 
ATOM   791  H  H      . ARG A 1 59 ? -9.267  -26.568 8.685   1.00 40.38  ? 449 ARG A H      1 
ATOM   792  H  HA     . ARG A 1 59 ? -9.292  -28.444 10.477  1.00 41.76  ? 449 ARG A HA     1 
ATOM   793  H  HB2    . ARG A 1 59 ? -7.340  -27.286 9.772   1.00 41.52  ? 449 ARG A HB2    1 
ATOM   794  H  HB3    . ARG A 1 59 ? -7.807  -26.052 10.654  1.00 41.52  ? 449 ARG A HB3    1 
ATOM   795  H  HG2    . ARG A 1 59 ? -7.544  -27.318 12.578  1.00 51.01  ? 449 ARG A HG2    1 
ATOM   796  H  HG3    . ARG A 1 59 ? -7.094  -28.566 11.698  1.00 51.01  ? 449 ARG A HG3    1 
ATOM   797  H  HD2    . ARG A 1 59 ? -5.179  -27.628 12.491  1.00 46.73  ? 449 ARG A HD2    1 
ATOM   798  H  HD3    . ARG A 1 59 ? -5.249  -27.241 10.951  1.00 46.73  ? 449 ARG A HD3    1 
ATOM   799  H  HE     . ARG A 1 59 ? -6.295  -25.258 12.241  1.00 46.87  ? 449 ARG A HE     1 
ATOM   800  H  HH11   . ARG A 1 59 ? -3.251  -26.511 11.921  1.00 48.90  ? 449 ARG A HH11   1 
ATOM   801  H  HH12   . ARG A 1 59 ? -2.523  -25.249 12.222  1.00 48.90  ? 449 ARG A HH12   1 
ATOM   802  H  HH21   . ARG A 1 59 ? -5.174  -23.353 12.754  1.00 43.12  ? 449 ARG A HH21   1 
ATOM   803  H  HH22   . ARG A 1 59 ? -3.684  -23.336 12.726  1.00 43.12  ? 449 ARG A HH22   1 
ATOM   804  N  N      . HIS A 1 60 ? -10.395 -25.638 11.583  1.00 41.84  ? 450 HIS A N      1 
ATOM   805  C  CA     . HIS A 1 60 ? -11.229 -25.049 12.623  1.00 34.81  ? 450 HIS A CA     1 
ATOM   806  C  C      . HIS A 1 60 ? -12.585 -25.731 12.704  1.00 32.19  ? 450 HIS A C      1 
ATOM   807  O  O      . HIS A 1 60 ? -13.141 -25.875 13.797  1.00 32.55  ? 450 HIS A O      1 
ATOM   808  C  CB     . HIS A 1 60 ? -11.410 -23.553 12.359  1.00 36.29  ? 450 HIS A CB     1 
ATOM   809  C  CG     . HIS A 1 60 ? -12.577 -22.949 13.074  1.00 40.34  ? 450 HIS A CG     1 
ATOM   810  N  ND1    . HIS A 1 60 ? -12.507 -22.512 14.380  1.00 44.87  ? 450 HIS A ND1    1 
ATOM   811  C  CD2    . HIS A 1 60 ? -13.845 -22.707 12.666  1.00 43.91  ? 450 HIS A CD2    1 
ATOM   812  C  CE1    . HIS A 1 60 ? -13.681 -22.029 14.744  1.00 43.25  ? 450 HIS A CE1    1 
ATOM   813  N  NE2    . HIS A 1 60 ? -14.510 -22.135 13.723  1.00 44.70  ? 450 HIS A NE2    1 
ATOM   814  H  H      . HIS A 1 60 ? -10.117 -25.080 10.990  1.00 50.16  ? 450 HIS A H      1 
ATOM   815  H  HA     . HIS A 1 60 ? -10.788 -25.153 13.481  1.00 41.72  ? 450 HIS A HA     1 
ATOM   816  H  HB2    . HIS A 1 60 ? -10.611 -23.086 12.649  1.00 43.49  ? 450 HIS A HB2    1 
ATOM   817  H  HB3    . HIS A 1 60 ? -11.543 -23.418 11.408  1.00 43.49  ? 450 HIS A HB3    1 
ATOM   818  H  HD1    . HIS A 1 60 ? -11.808 -22.549 14.879  1.00 53.79  ? 450 HIS A HD1    1 
ATOM   819  H  HD2    . HIS A 1 60 ? -14.200 -22.894 11.827  1.00 52.65  ? 450 HIS A HD2    1 
ATOM   820  H  HE1    . HIS A 1 60 ? -13.888 -21.674 15.578  1.00 51.84  ? 450 HIS A HE1    1 
ATOM   821  N  N      . TYR A 1 61 ? -13.129 -26.170 11.569  1.00 37.15  ? 451 TYR A N      1 
ATOM   822  C  CA     . TYR A 1 61 ? -14.483 -26.712 11.571  1.00 39.35  ? 451 TYR A CA     1 
ATOM   823  C  C      . TYR A 1 61 ? -14.562 -28.020 12.345  1.00 39.12  ? 451 TYR A C      1 
ATOM   824  O  O      . TYR A 1 61 ? -15.582 -28.293 12.987  1.00 38.76  ? 451 TYR A O      1 
ATOM   825  C  CB     . TYR A 1 61 ? -14.971 -26.908 10.135  1.00 38.61  ? 451 TYR A CB     1 
ATOM   826  C  CG     . TYR A 1 61 ? -16.468 -26.775 9.977   1.00 38.26  ? 451 TYR A CG     1 
ATOM   827  C  CD1    . TYR A 1 61 ? -17.238 -27.847 9.550   1.00 43.24  ? 451 TYR A CD1    1 
ATOM   828  C  CD2    . TYR A 1 61 ? -17.111 -25.577 10.258  1.00 38.22  ? 451 TYR A CD2    1 
ATOM   829  C  CE1    . TYR A 1 61 ? -18.608 -27.729 9.406   1.00 46.52  ? 451 TYR A CE1    1 
ATOM   830  C  CE2    . TYR A 1 61 ? -18.480 -25.449 10.118  1.00 43.17  ? 451 TYR A CE2    1 
ATOM   831  C  CZ     . TYR A 1 61 ? -19.224 -26.529 9.691   1.00 47.88  ? 451 TYR A CZ     1 
ATOM   832  O  OH     . TYR A 1 61 ? -20.588 -26.411 9.547   1.00 51.36  ? 451 TYR A OH     1 
ATOM   833  H  H      . TYR A 1 61 ? -12.743 -26.165 10.801  1.00 44.53  ? 451 TYR A H      1 
ATOM   834  H  HA     . TYR A 1 61 ? -15.072 -26.076 12.005  1.00 47.17  ? 451 TYR A HA     1 
ATOM   835  H  HB2    . TYR A 1 61 ? -14.554 -26.241 9.568   1.00 46.27  ? 451 TYR A HB2    1 
ATOM   836  H  HB3    . TYR A 1 61 ? -14.719 -27.796 9.838   1.00 46.27  ? 451 TYR A HB3    1 
ATOM   837  H  HD1    . TYR A 1 61 ? -16.826 -28.658 9.357   1.00 51.84  ? 451 TYR A HD1    1 
ATOM   838  H  HD2    . TYR A 1 61 ? -16.611 -24.847 10.546  1.00 45.82  ? 451 TYR A HD2    1 
ATOM   839  H  HE1    . TYR A 1 61 ? -19.112 -28.456 9.118   1.00 55.78  ? 451 TYR A HE1    1 
ATOM   840  H  HE2    . TYR A 1 61 ? -18.897 -24.640 10.309  1.00 51.75  ? 451 TYR A HE2    1 
ATOM   841  H  HH     . TYR A 1 61 ? -20.832 -25.634 9.752   1.00 61.59  ? 451 TYR A HH     1 
ATOM   842  N  N      . ARG A 1 62 ? -13.503 -28.833 12.312  1.00 33.37  ? 452 ARG A N      1 
ATOM   843  C  CA     . ARG A 1 62 ? -13.522 -30.086 13.057  1.00 33.63  ? 452 ARG A CA     1 
ATOM   844  C  C      . ARG A 1 62 ? -13.796 -29.847 14.536  1.00 38.25  ? 452 ARG A C      1 
ATOM   845  O  O      . ARG A 1 62 ? -14.375 -30.706 15.210  1.00 36.69  ? 452 ARG A O      1 
ATOM   846  C  CB     . ARG A 1 62 ? -12.199 -30.828 12.873  1.00 36.28  ? 452 ARG A CB     1 
ATOM   847  C  CG     . ARG A 1 62 ? -11.906 -31.218 11.432  1.00 42.13  ? 452 ARG A CG     1 
ATOM   848  C  CD     . ARG A 1 62 ? -10.907 -32.360 11.357  1.00 47.71  ? 452 ARG A CD     1 
ATOM   849  N  NE     . ARG A 1 62 ? -10.566 -32.701 9.976   1.00 54.11  ? 452 ARG A NE     1 
ATOM   850  C  CZ     . ARG A 1 62 ? -9.460  -32.314 9.343   1.00 56.93  ? 452 ARG A CZ     1 
ATOM   851  N  NH1    . ARG A 1 62 ? -8.543  -31.563 9.949   1.00 59.05  ? 452 ARG A NH1    1 
ATOM   852  N  NH2    . ARG A 1 62 ? -9.268  -32.689 8.086   1.00 57.69  ? 452 ARG A NH2    1 
ATOM   853  H  H      . ARG A 1 62 ? -12.778 -28.684 11.875  1.00 39.99  ? 452 ARG A H      1 
ATOM   854  H  HA     . ARG A 1 62 ? -14.231 -30.648 12.708  1.00 40.30  ? 452 ARG A HA     1 
ATOM   855  H  HB2    . ARG A 1 62 ? -11.476 -30.258 13.178  1.00 43.48  ? 452 ARG A HB2    1 
ATOM   856  H  HB3    . ARG A 1 62 ? -12.221 -31.641 13.401  1.00 43.48  ? 452 ARG A HB3    1 
ATOM   857  H  HG2    . ARG A 1 62 ? -12.728 -31.505 11.004  1.00 50.50  ? 452 ARG A HG2    1 
ATOM   858  H  HG3    . ARG A 1 62 ? -11.532 -30.455 10.964  1.00 50.50  ? 452 ARG A HG3    1 
ATOM   859  H  HD2    . ARG A 1 62 ? -10.100 -32.112 11.831  1.00 57.20  ? 452 ARG A HD2    1 
ATOM   860  H  HD3    . ARG A 1 62 ? -11.300 -33.146 11.767  1.00 57.20  ? 452 ARG A HD3    1 
ATOM   861  H  HE     . ARG A 1 62 ? -11.123 -33.189 9.539   1.00 64.88  ? 452 ARG A HE     1 
ATOM   862  H  HH11   . ARG A 1 62 ? -8.653  -31.311 10.763  1.00 70.81  ? 452 ARG A HH11   1 
ATOM   863  H  HH12   . ARG A 1 62 ? -7.836  -31.325 9.521   1.00 70.81  ? 452 ARG A HH12   1 
ATOM   864  H  HH21   . ARG A 1 62 ? -9.855  -33.176 7.688   1.00 69.17  ? 452 ARG A HH21   1 
ATOM   865  H  HH22   . ARG A 1 62 ? -8.556  -32.446 7.669   1.00 69.17  ? 452 ARG A HH22   1 
ATOM   866  N  N      . LYS A 1 63 ? -13.395 -28.684 15.052  1.00 45.42  ? 453 LYS A N      1 
ATOM   867  C  CA     . LYS A 1 63 ? -13.708 -28.326 16.431  1.00 39.89  ? 453 LYS A CA     1 
ATOM   868  C  C      . LYS A 1 63 ? -15.207 -28.371 16.689  1.00 41.39  ? 453 LYS A C      1 
ATOM   869  O  O      . LYS A 1 63 ? -15.635 -28.685 17.804  1.00 44.59  ? 453 LYS A O      1 
ATOM   870  C  CB     . LYS A 1 63 ? -13.146 -26.934 16.731  1.00 46.25  ? 453 LYS A CB     1 
ATOM   871  C  CG     . LYS A 1 63 ? -13.622 -26.288 18.022  1.00 54.48  ? 453 LYS A CG     1 
ATOM   872  C  CD     . LYS A 1 63 ? -13.231 -24.821 18.053  1.00 48.80  ? 453 LYS A CD     1 
ATOM   873  C  CE     . LYS A 1 63 ? -14.034 -24.056 19.087  1.00 54.44  ? 453 LYS A CE     1 
ATOM   874  N  NZ     . LYS A 1 63 ? -13.902 -22.592 18.896  1.00 55.65  ? 453 LYS A NZ     1 
ATOM   875  H  H      . LYS A 1 63 ? -12.943 -28.090 14.625  1.00 54.46  ? 453 LYS A H      1 
ATOM   876  H  HA     . LYS A 1 63 ? -13.280 -28.959 17.028  1.00 47.81  ? 453 LYS A HA     1 
ATOM   877  H  HB2    . LYS A 1 63 ? -12.179 -26.995 16.774  1.00 55.45  ? 453 LYS A HB2    1 
ATOM   878  H  HB3    . LYS A 1 63 ? -13.402 -26.342 16.010  1.00 55.45  ? 453 LYS A HB3    1 
ATOM   879  H  HG2    . LYS A 1 63 ? -14.587 -26.338 18.089  1.00 65.33  ? 453 LYS A HG2    1 
ATOM   880  H  HG3    . LYS A 1 63 ? -13.207 -26.732 18.778  1.00 65.33  ? 453 LYS A HG3    1 
ATOM   881  H  HD2    . LYS A 1 63 ? -12.291 -24.745 18.281  1.00 58.51  ? 453 LYS A HD2    1 
ATOM   882  H  HD3    . LYS A 1 63 ? -13.400 -24.424 17.184  1.00 58.51  ? 453 LYS A HD3    1 
ATOM   883  H  HE2    . LYS A 1 63 ? -14.972 -24.290 19.004  1.00 65.28  ? 453 LYS A HE2    1 
ATOM   884  H  HE3    . LYS A 1 63 ? -13.709 -24.278 19.974  1.00 65.28  ? 453 LYS A HE3    1 
ATOM   885  H  HZ1    . LYS A 1 63 ? -14.379 -22.161 19.511  1.00 66.73  ? 453 LYS A HZ1    1 
ATOM   886  H  HZ2    . LYS A 1 63 ? -13.048 -22.351 18.971  1.00 66.73  ? 453 LYS A HZ2    1 
ATOM   887  H  HZ3    . LYS A 1 63 ? -14.197 -22.363 18.088  1.00 66.73  ? 453 LYS A HZ3    1 
ATOM   888  N  N      . HIS A 1 64 ? -16.017 -28.063 15.677  1.00 43.92  ? 454 HIS A N      1 
ATOM   889  C  CA     . HIS A 1 64 ? -17.467 -28.073 15.829  1.00 47.84  ? 454 HIS A CA     1 
ATOM   890  C  C      . HIS A 1 64 ? -18.084 -29.421 15.487  1.00 48.24  ? 454 HIS A C      1 
ATOM   891  O  O      . HIS A 1 64 ? -19.114 -29.789 16.065  1.00 47.91  ? 454 HIS A O      1 
ATOM   892  C  CB     . HIS A 1 64 ? -18.112 -27.010 14.933  1.00 46.01  ? 454 HIS A CB     1 
ATOM   893  C  CG     . HIS A 1 64 ? -17.664 -25.609 15.217  1.00 46.28  ? 454 HIS A CG     1 
ATOM   894  N  ND1    . HIS A 1 64 ? -17.792 -25.022 16.457  1.00 47.43  ? 454 HIS A ND1    1 
ATOM   895  C  CD2    . HIS A 1 64 ? -17.115 -24.669 14.411  1.00 45.80  ? 454 HIS A CD2    1 
ATOM   896  C  CE1    . HIS A 1 64 ? -17.326 -23.786 16.408  1.00 45.77  ? 454 HIS A CE1    1 
ATOM   897  N  NE2    . HIS A 1 64 ? -16.911 -23.547 15.177  1.00 49.66  ? 454 HIS A NE2    1 
ATOM   898  H  H      . HIS A 1 64 ? -15.749 -27.844 14.890  1.00 52.66  ? 454 HIS A H      1 
ATOM   899  H  HA     . HIS A 1 64 ? -17.691 -27.865 16.750  1.00 57.36  ? 454 HIS A HA     1 
ATOM   900  H  HB2    . HIS A 1 64 ? -17.900 -27.209 14.008  1.00 55.16  ? 454 HIS A HB2    1 
ATOM   901  H  HB3    . HIS A 1 64 ? -19.070 -27.046 15.066  1.00 55.16  ? 454 HIS A HB3    1 
ATOM   902  H  HD1    . HIS A 1 64 ? -18.117 -25.403 17.156  1.00 56.86  ? 454 HIS A HD1    1 
ATOM   903  H  HD2    . HIS A 1 64 ? -16.908 -24.767 13.510  1.00 54.90  ? 454 HIS A HD2    1 
ATOM   904  H  HE1    . HIS A 1 64 ? -17.298 -23.186 17.118  1.00 54.88  ? 454 HIS A HE1    1 
ATOM   905  N  N      . THR A 1 65 ? -17.489 -30.156 14.550  1.00 41.56  ? 455 THR A N      1 
ATOM   906  C  CA     . THR A 1 65 ? -18.059 -31.411 14.081  1.00 41.03  ? 455 THR A CA     1 
ATOM   907  C  C      . THR A 1 65 ? -17.621 -32.611 14.905  1.00 41.85  ? 455 THR A C      1 
ATOM   908  O  O      . THR A 1 65 ? -18.255 -33.668 14.816  1.00 48.96  ? 455 THR A O      1 
ATOM   909  C  CB     . THR A 1 65 ? -17.669 -31.660 12.620  1.00 43.57  ? 455 THR A CB     1 
ATOM   910  O  OG1    . THR A 1 65 ? -16.271 -31.964 12.542  1.00 57.78  ? 455 THR A OG1    1 
ATOM   911  C  CG2    . THR A 1 65 ? -17.949 -30.441 11.781  1.00 40.39  ? 455 THR A CG2    1 
ATOM   912  H  H      . THR A 1 65 ? -16.748 -29.945 14.168  1.00 49.81  ? 455 THR A H      1 
ATOM   913  H  HA     . THR A 1 65 ? -19.026 -31.354 14.127  1.00 49.18  ? 455 THR A HA     1 
ATOM   914  H  HB     . THR A 1 65 ? -18.184 -32.403 12.268  1.00 52.23  ? 455 THR A HB     1 
ATOM   915  H  HG1    . THR A 1 65 ? -16.051 -32.100 11.743  1.00 69.29  ? 455 THR A HG1    1 
ATOM   916  H  HG21   . THR A 1 65 ? -17.922 -30.673 10.839  1.00 48.41  ? 455 THR A HG21   1 
ATOM   917  H  HG22   . THR A 1 65 ? -18.827 -30.088 11.995  1.00 48.41  ? 455 THR A HG22   1 
ATOM   918  H  HG23   . THR A 1 65 ? -17.285 -29.757 11.957  1.00 48.41  ? 455 THR A HG23   1 
ATOM   919  N  N      . GLY A 1 66 ? -16.558 -32.479 15.694  1.00 47.41  ? 456 GLY A N      1 
ATOM   920  C  CA     . GLY A 1 66 ? -15.998 -33.623 16.383  1.00 54.89  ? 456 GLY A CA     1 
ATOM   921  C  C      . GLY A 1 66 ? -15.258 -34.589 15.489  1.00 52.58  ? 456 GLY A C      1 
ATOM   922  O  O      . GLY A 1 66 ? -14.992 -35.720 15.904  1.00 59.04  ? 456 GLY A O      1 
ATOM   923  H  H      . GLY A 1 66 ? -16.147 -31.739 15.844  1.00 56.84  ? 456 GLY A H      1 
ATOM   924  H  HA2    . GLY A 1 66 ? -15.382 -33.311 17.064  1.00 65.82  ? 456 GLY A HA2    1 
ATOM   925  H  HA3    . GLY A 1 66 ? -16.713 -34.108 16.823  1.00 65.82  ? 456 GLY A HA3    1 
ATOM   926  N  N      . HIS A 1 67 ? -14.918 -34.180 14.271  1.00 57.48  ? 457 HIS A N      1 
ATOM   927  C  CA     . HIS A 1 67 ? -14.203 -35.041 13.337  1.00 58.81  ? 457 HIS A CA     1 
ATOM   928  C  C      . HIS A 1 67 ? -12.802 -35.314 13.874  1.00 61.32  ? 457 HIS A C      1 
ATOM   929  O  O      . HIS A 1 67 ? -11.958 -34.414 13.912  1.00 58.33  ? 457 HIS A O      1 
ATOM   930  C  CB     . HIS A 1 67 ? -14.150 -34.374 11.967  1.00 53.35  ? 457 HIS A CB     1 
ATOM   931  C  CG     . HIS A 1 67 ? -13.641 -35.263 10.876  1.00 50.67  ? 457 HIS A CG     1 
ATOM   932  N  ND1    . HIS A 1 67 ? -13.351 -34.794 9.613   1.00 46.89  ? 457 HIS A ND1    1 
ATOM   933  C  CD2    . HIS A 1 67 ? -13.377 -36.591 10.855  1.00 53.20  ? 457 HIS A CD2    1 
ATOM   934  C  CE1    . HIS A 1 67 ? -12.927 -35.794 8.862   1.00 50.13  ? 457 HIS A CE1    1 
ATOM   935  N  NE2    . HIS A 1 67 ? -12.934 -36.896 9.591   1.00 55.11  ? 457 HIS A NE2    1 
ATOM   936  H  H      . HIS A 1 67 ? -15.092 -33.398 13.958  1.00 68.92  ? 457 HIS A H      1 
ATOM   937  H  HA     . HIS A 1 67 ? -14.672 -35.886 13.252  1.00 70.51  ? 457 HIS A HA     1 
ATOM   938  H  HB2    . HIS A 1 67 ? -15.045 -34.090 11.724  1.00 63.97  ? 457 HIS A HB2    1 
ATOM   939  H  HB3    . HIS A 1 67 ? -13.564 -33.603 12.018  1.00 63.97  ? 457 HIS A HB3    1 
ATOM   940  H  HD2    . HIS A 1 67 ? -13.476 -37.185 11.564  1.00 63.79  ? 457 HIS A HD2    1 
ATOM   941  H  HE1    . HIS A 1 67 ? -12.668 -35.733 7.971   1.00 60.11  ? 457 HIS A HE1    1 
ATOM   942  H  HE2    . HIS A 1 67 ? -12.698 -37.677 9.319   1.00 66.08  ? 457 HIS A HE2    1 
ATOM   943  N  N      . ARG A 1 68 ? -12.556 -36.556 14.301  1.00 73.48  ? 458 ARG A N      1 
ATOM   944  C  CA     . ARG A 1 68 ? -11.270 -36.981 14.850  1.00 74.74  ? 458 ARG A CA     1 
ATOM   945  C  C      . ARG A 1 68 ? -10.757 -38.144 14.008  1.00 70.10  ? 458 ARG A C      1 
ATOM   946  O  O      . ARG A 1 68 ? -10.947 -39.315 14.369  1.00 75.25  ? 458 ARG A O      1 
ATOM   947  C  CB     . ARG A 1 68 ? -11.397 -37.378 16.320  1.00 82.86  ? 458 ARG A CB     1 
ATOM   948  C  CG     . ARG A 1 68 ? -11.789 -36.231 17.239  1.00 79.46  ? 458 ARG A CG     1 
ATOM   949  C  CD     . ARG A 1 68 ? -11.922 -36.698 18.678  1.00 84.73  ? 458 ARG A CD     1 
ATOM   950  N  NE     . ARG A 1 68 ? -12.262 -35.604 19.585  1.00 87.44  ? 458 ARG A NE     1 
ATOM   951  C  CZ     . ARG A 1 68 ? -12.450 -35.747 20.893  1.00 95.71  ? 458 ARG A CZ     1 
ATOM   952  N  NH1    . ARG A 1 68 ? -12.334 -36.942 21.461  1.00 103.48 ? 458 ARG A NH1    1 
ATOM   953  N  NH2    . ARG A 1 68 ? -12.757 -34.694 21.638  1.00 94.87  ? 458 ARG A NH2    1 
ATOM   954  H  H      . ARG A 1 68 ? -13.139 -37.188 14.281  1.00 88.13  ? 458 ARG A H      1 
ATOM   955  H  HA     . ARG A 1 68 ? -10.635 -36.251 14.795  1.00 89.63  ? 458 ARG A HA     1 
ATOM   956  H  HB2    . ARG A 1 68 ? -12.075 -38.067 16.400  1.00 99.38  ? 458 ARG A HB2    1 
ATOM   957  H  HB3    . ARG A 1 68 ? -10.543 -37.721 16.624  1.00 99.38  ? 458 ARG A HB3    1 
ATOM   958  H  HG2    . ARG A 1 68 ? -11.105 -35.544 17.204  1.00 95.30  ? 458 ARG A HG2    1 
ATOM   959  H  HG3    . ARG A 1 68 ? -12.644 -35.870 16.955  1.00 95.30  ? 458 ARG A HG3    1 
ATOM   960  H  HD2    . ARG A 1 68 ? -12.626 -37.363 18.732  1.00 101.63 ? 458 ARG A HD2    1 
ATOM   961  H  HD3    . ARG A 1 68 ? -11.080 -37.081 18.968  1.00 101.63 ? 458 ARG A HD3    1 
ATOM   962  H  HE     . ARG A 1 68 ? -12.346 -34.816 19.251  1.00 104.87 ? 458 ARG A HE     1 
ATOM   963  H  HH11   . ARG A 1 68 ? -12.136 -37.630 20.986  1.00 124.12 ? 458 ARG A HH11   1 
ATOM   964  H  HH12   . ARG A 1 68 ? -12.457 -37.027 22.308  1.00 124.12 ? 458 ARG A HH12   1 
ATOM   965  H  HH21   . ARG A 1 68 ? -12.834 -33.918 21.275  1.00 113.80 ? 458 ARG A HH21   1 
ATOM   966  H  HH22   . ARG A 1 68 ? -12.879 -34.787 22.484  1.00 113.80 ? 458 ARG A HH22   1 
ATOM   967  N  N      . PRO A 1 69 ? -10.101 -37.863 12.878  1.00 57.13  ? 459 PRO A N      1 
ATOM   968  C  CA     . PRO A 1 69 ? -9.659  -38.950 11.995  1.00 56.34  ? 459 PRO A CA     1 
ATOM   969  C  C      . PRO A 1 69 ? -8.372  -39.610 12.463  1.00 60.76  ? 459 PRO A C      1 
ATOM   970  O  O      . PRO A 1 69 ? -8.153  -40.801 12.221  1.00 64.31  ? 459 PRO A O      1 
ATOM   971  C  CB     . PRO A 1 69 ? -9.464  -38.251 10.640  1.00 54.34  ? 459 PRO A CB     1 
ATOM   972  C  CG     . PRO A 1 69 ? -9.679  -36.768 10.885  1.00 52.64  ? 459 PRO A CG     1 
ATOM   973  C  CD     . PRO A 1 69 ? -9.698  -36.548 12.360  1.00 56.53  ? 459 PRO A CD     1 
ATOM   974  H  HA     . PRO A 1 69 ? -10.354 -39.621 11.914  1.00 67.56  ? 459 PRO A HA     1 
ATOM   975  H  HB2    . PRO A 1 69 ? -8.563  -38.414 10.319  1.00 65.15  ? 459 PRO A HB2    1 
ATOM   976  H  HB3    . PRO A 1 69 ? -10.116 -38.588 10.006  1.00 65.15  ? 459 PRO A HB3    1 
ATOM   977  H  HG2    . PRO A 1 69 ? -8.951  -36.270 10.482  1.00 63.11  ? 459 PRO A HG2    1 
ATOM   978  H  HG3    . PRO A 1 69 ? -10.525 -36.499 10.495  1.00 63.11  ? 459 PRO A HG3    1 
ATOM   979  H  HD2    . PRO A 1 69 ? -8.813  -36.312 12.680  1.00 67.79  ? 459 PRO A HD2    1 
ATOM   980  H  HD3    . PRO A 1 69 ? -10.354 -35.871 12.588  1.00 67.79  ? 459 PRO A HD3    1 
ATOM   981  N  N      . PHE A 1 70 ? -7.516  -38.845 13.135  1.00 53.05  ? 460 PHE A N      1 
ATOM   982  C  CA     . PHE A 1 70 ? -6.216  -39.342 13.574  1.00 55.74  ? 460 PHE A CA     1 
ATOM   983  C  C      . PHE A 1 70 ? -6.401  -40.150 14.851  1.00 59.27  ? 460 PHE A C      1 
ATOM   984  O  O      . PHE A 1 70 ? -6.707  -39.592 15.909  1.00 61.41  ? 460 PHE A O      1 
ATOM   985  C  CB     . PHE A 1 70 ? -5.257  -38.176 13.780  1.00 55.17  ? 460 PHE A CB     1 
ATOM   986  C  CG     . PHE A 1 70 ? -5.156  -37.272 12.588  1.00 52.12  ? 460 PHE A CG     1 
ATOM   987  C  CD1    . PHE A 1 70 ? -5.937  -36.131 12.498  1.00 49.67  ? 460 PHE A CD1    1 
ATOM   988  C  CD2    . PHE A 1 70 ? -4.298  -37.575 11.546  1.00 52.07  ? 460 PHE A CD2    1 
ATOM   989  C  CE1    . PHE A 1 70 ? -5.852  -35.303 11.396  1.00 47.36  ? 460 PHE A CE1    1 
ATOM   990  C  CE2    . PHE A 1 70 ? -4.208  -36.752 10.442  1.00 49.83  ? 460 PHE A CE2    1 
ATOM   991  C  CZ     . PHE A 1 70 ? -4.986  -35.615 10.365  1.00 47.54  ? 460 PHE A CZ     1 
ATOM   992  H  H      . PHE A 1 70 ? -7.667  -38.027 13.352  1.00 63.61  ? 460 PHE A H      1 
ATOM   993  H  HA     . PHE A 1 70 ? -5.847  -39.926 12.893  1.00 66.84  ? 460 PHE A HA     1 
ATOM   994  H  HB2    . PHE A 1 70 ? -5.564  -37.645 14.531  1.00 66.15  ? 460 PHE A HB2    1 
ATOM   995  H  HB3    . PHE A 1 70 ? -4.371  -38.526 13.964  1.00 66.15  ? 460 PHE A HB3    1 
ATOM   996  H  HD1    . PHE A 1 70 ? -6.521  -35.918 13.190  1.00 59.55  ? 460 PHE A HD1    1 
ATOM   997  H  HD2    . PHE A 1 70 ? -3.771  -38.340 11.593  1.00 62.43  ? 460 PHE A HD2    1 
ATOM   998  H  HE1    . PHE A 1 70 ? -6.377  -34.537 11.347  1.00 56.78  ? 460 PHE A HE1    1 
ATOM   999  H  HE2    . PHE A 1 70 ? -3.624  -36.964 9.750   1.00 59.74  ? 460 PHE A HE2    1 
ATOM   1000 H  HZ     . PHE A 1 70 ? -4.926  -35.059 9.622   1.00 56.99  ? 460 PHE A HZ     1 
ATOM   1001 N  N      . GLN A 1 71 ? -6.209  -41.463 14.755  1.00 76.17  ? 461 GLN A N      1 
ATOM   1002 C  CA     . GLN A 1 71 ? -6.497  -42.387 15.842  1.00 77.82  ? 461 GLN A CA     1 
ATOM   1003 C  C      . GLN A 1 71 ? -5.202  -42.871 16.477  1.00 80.66  ? 461 GLN A C      1 
ATOM   1004 O  O      . GLN A 1 71 ? -4.315  -43.378 15.782  1.00 78.12  ? 461 GLN A O      1 
ATOM   1005 C  CB     . GLN A 1 71 ? -7.310  -43.580 15.332  1.00 81.20  ? 461 GLN A CB     1 
ATOM   1006 C  CG     . GLN A 1 71 ? -7.585  -44.648 16.380  1.00 81.54  ? 461 GLN A CG     1 
ATOM   1007 C  CD     . GLN A 1 71 ? -8.313  -44.103 17.593  1.00 75.47  ? 461 GLN A CD     1 
ATOM   1008 O  OE1    . GLN A 1 71 ? -9.438  -43.611 17.489  1.00 77.91  ? 461 GLN A OE1    1 
ATOM   1009 N  NE2    . GLN A 1 71 ? -7.672  -44.184 18.754  1.00 67.64  ? 461 GLN A NE2    1 
ATOM   1010 H  H      . GLN A 1 71 ? -5.904  -41.850 14.050  1.00 91.35  ? 461 GLN A H      1 
ATOM   1011 H  HA     . GLN A 1 71 ? -7.018  -41.931 16.522  1.00 93.34  ? 461 GLN A HA     1 
ATOM   1012 H  HB2    . GLN A 1 71 ? -8.166  -43.257 15.009  1.00 97.38  ? 461 GLN A HB2    1 
ATOM   1013 H  HB3    . GLN A 1 71 ? -6.823  -43.999 14.605  1.00 97.38  ? 461 GLN A HB3    1 
ATOM   1014 H  HG2    . GLN A 1 71 ? -8.141  -45.338 15.985  1.00 97.80  ? 461 GLN A HG2    1 
ATOM   1015 H  HG3    . GLN A 1 71 ? -6.746  -45.032 16.678  1.00 97.80  ? 461 GLN A HG3    1 
ATOM   1016 H  HE21   . GLN A 1 71 ? -6.896  -44.552 18.792  1.00 81.12  ? 461 GLN A HE21   1 
ATOM   1017 H  HE22   . GLN A 1 71 ? -8.034  -43.868 19.467  1.00 81.12  ? 461 GLN A HE22   1 
ATOM   1018 N  N      . CYS A 1 72 ? -5.096  -42.709 17.794  1.00 87.80  ? 462 CYS A N      1 
ATOM   1019 C  CA     . CYS A 1 72 ? -4.005  -43.317 18.543  1.00 92.76  ? 462 CYS A CA     1 
ATOM   1020 C  C      . CYS A 1 72 ? -4.224  -44.823 18.604  1.00 98.12  ? 462 CYS A C      1 
ATOM   1021 O  O      . CYS A 1 72 ? -5.309  -45.285 18.970  1.00 97.13  ? 462 CYS A O      1 
ATOM   1022 C  CB     . CYS A 1 72 ? -3.934  -42.719 19.949  1.00 91.11  ? 462 CYS A CB     1 
ATOM   1023 S  SG     . CYS A 1 72 ? -2.550  -43.291 20.980  1.00 59.70  ? 462 CYS A SG     1 
ATOM   1024 H  H      . CYS A 1 72 ? -5.643  -42.252 18.275  1.00 105.31 ? 462 CYS A H      1 
ATOM   1025 H  HA     . CYS A 1 72 ? -3.164  -43.145 18.091  1.00 111.25 ? 462 CYS A HA     1 
ATOM   1026 H  HB2    . CYS A 1 72 ? -3.857  -41.755 19.869  1.00 109.28 ? 462 CYS A HB2    1 
ATOM   1027 H  HB3    . CYS A 1 72 ? -4.754  -42.940 20.417  1.00 109.28 ? 462 CYS A HB3    1 
ATOM   1028 N  N      . GLN A 1 73 ? -3.204  -45.593 18.224  1.00 87.92  ? 463 GLN A N      1 
ATOM   1029 C  CA     . GLN A 1 73 ? -3.362  -47.039 18.118  1.00 97.22  ? 463 GLN A CA     1 
ATOM   1030 C  C      . GLN A 1 73 ? -2.942  -47.779 19.381  1.00 103.97 ? 463 GLN A C      1 
ATOM   1031 O  O      . GLN A 1 73 ? -3.481  -48.856 19.662  1.00 113.70 ? 463 GLN A O      1 
ATOM   1032 C  CB     . GLN A 1 73 ? -2.575  -47.567 16.916  1.00 91.74  ? 463 GLN A CB     1 
ATOM   1033 C  CG     . GLN A 1 73 ? -3.131  -47.084 15.582  1.00 81.26  ? 463 GLN A CG     1 
ATOM   1034 C  CD     . GLN A 1 73 ? -2.931  -48.084 14.461  1.00 80.26  ? 463 GLN A CD     1 
ATOM   1035 O  OE1    . GLN A 1 73 ? -2.137  -49.019 14.575  1.00 81.68  ? 463 GLN A OE1    1 
ATOM   1036 N  NE2    . GLN A 1 73 ? -3.662  -47.895 13.368  1.00 76.69  ? 463 GLN A NE2    1 
ATOM   1037 H  H      . GLN A 1 73 ? -2.419  -45.304 18.024  1.00 105.45 ? 463 GLN A H      1 
ATOM   1038 H  HA     . GLN A 1 73 ? -4.298  -47.238 17.962  1.00 116.61 ? 463 GLN A HA     1 
ATOM   1039 H  HB2    . GLN A 1 73 ? -1.656  -47.265 16.984  1.00 110.03 ? 463 GLN A HB2    1 
ATOM   1040 H  HB3    . GLN A 1 73 ? -2.607  -48.536 16.922  1.00 110.03 ? 463 GLN A HB3    1 
ATOM   1041 H  HG2    . GLN A 1 73 ? -4.083  -46.926 15.675  1.00 97.46  ? 463 GLN A HG2    1 
ATOM   1042 H  HG3    . GLN A 1 73 ? -2.682  -46.261 15.333  1.00 97.46  ? 463 GLN A HG3    1 
ATOM   1043 H  HE21   . GLN A 1 73 ? -4.210  -47.234 13.326  1.00 91.97  ? 463 GLN A HE21   1 
ATOM   1044 H  HE22   . GLN A 1 73 ? -3.587  -48.434 12.702  1.00 91.97  ? 463 GLN A HE22   1 
ATOM   1045 N  N      . LYS A 1 74 ? -1.993  -47.240 20.148  1.00 103.82 ? 464 LYS A N      1 
ATOM   1046 C  CA     . LYS A 1 74 ? -1.764  -47.753 21.495  1.00 95.75  ? 464 LYS A CA     1 
ATOM   1047 C  C      . LYS A 1 74 ? -2.985  -47.509 22.366  1.00 84.57  ? 464 LYS A C      1 
ATOM   1048 O  O      . LYS A 1 74 ? -3.518  -48.428 22.999  1.00 88.70  ? 464 LYS A O      1 
ATOM   1049 C  CB     . LYS A 1 74 ? -0.547  -47.079 22.123  1.00 100.74 ? 464 LYS A CB     1 
ATOM   1050 C  CG     . LYS A 1 74 ? 0.763   -47.279 21.405  1.00 108.96 ? 464 LYS A CG     1 
ATOM   1051 C  CD     . LYS A 1 74 ? 1.825   -46.457 22.105  1.00 103.51 ? 464 LYS A CD     1 
ATOM   1052 C  CE     . LYS A 1 74 ? 3.220   -46.745 21.603  1.00 94.26  ? 464 LYS A CE     1 
ATOM   1053 N  NZ     . LYS A 1 74 ? 4.224   -46.010 22.419  1.00 84.29  ? 464 LYS A NZ     1 
ATOM   1054 H  H      . LYS A 1 74 ? -1.479  -46.590 19.917  1.00 124.53 ? 464 LYS A H      1 
ATOM   1055 H  HA     . LYS A 1 74 ? -1.600  -48.708 21.454  1.00 114.85 ? 464 LYS A HA     1 
ATOM   1056 H  HB2    . LYS A 1 74 ? -0.713  -46.124 22.161  1.00 120.83 ? 464 LYS A HB2    1 
ATOM   1057 H  HB3    . LYS A 1 74 ? -0.439  -47.423 23.023  1.00 120.83 ? 464 LYS A HB3    1 
ATOM   1058 H  HG2    . LYS A 1 74 ? 1.018   -48.214 21.439  1.00 130.71 ? 464 LYS A HG2    1 
ATOM   1059 H  HG3    . LYS A 1 74 ? 0.686   -46.975 20.487  1.00 130.71 ? 464 LYS A HG3    1 
ATOM   1060 H  HD2    . LYS A 1 74 ? 1.642   -45.516 21.955  1.00 124.16 ? 464 LYS A HD2    1 
ATOM   1061 H  HD3    . LYS A 1 74 ? 1.801   -46.654 23.054  1.00 124.16 ? 464 LYS A HD3    1 
ATOM   1062 H  HE2    . LYS A 1 74 ? 3.400   -47.695 21.676  1.00 113.05 ? 464 LYS A HE2    1 
ATOM   1063 H  HE3    . LYS A 1 74 ? 3.298   -46.451 20.682  1.00 113.05 ? 464 LYS A HE3    1 
ATOM   1064 H  HZ1    . LYS A 1 74 ? 5.046   -46.238 22.167  1.00 101.10 ? 464 LYS A HZ1    1 
ATOM   1065 H  HZ2    . LYS A 1 74 ? 4.121   -45.133 22.311  1.00 101.10 ? 464 LYS A HZ2    1 
ATOM   1066 H  HZ3    . LYS A 1 74 ? 4.120   -46.210 23.280  1.00 101.10 ? 464 LYS A HZ3    1 
ATOM   1067 N  N      . CYS A 1 75 ? -3.432  -46.265 22.409  1.00 91.02  ? 465 CYS A N      1 
ATOM   1068 C  CA     . CYS A 1 75 ? -4.561  -45.817 23.196  1.00 80.44  ? 465 CYS A CA     1 
ATOM   1069 C  C      . CYS A 1 75 ? -5.805  -45.787 22.308  1.00 71.06  ? 465 CYS A C      1 
ATOM   1070 O  O      . CYS A 1 75 ? -5.794  -46.278 21.175  1.00 73.04  ? 465 CYS A O      1 
ATOM   1071 C  CB     . CYS A 1 75 ? -4.194  -44.462 23.806  1.00 95.15  ? 465 CYS A CB     1 
ATOM   1072 S  SG     . CYS A 1 75 ? -5.395  -43.725 24.897  1.00 87.62  ? 465 CYS A SG     1 
ATOM   1073 H  H      . CYS A 1 75 ? -3.071  -45.626 21.961  1.00 109.18 ? 465 CYS A H      1 
ATOM   1074 H  HA     . CYS A 1 75 ? -4.718  -46.444 23.919  1.00 96.48  ? 465 CYS A HA     1 
ATOM   1075 H  HB2    . CYS A 1 75 ? -3.348  -44.533 24.276  1.00 114.13 ? 465 CYS A HB2    1 
ATOM   1076 H  HB3    . CYS A 1 75 ? -4.118  -43.861 23.058  1.00 114.13 ? 465 CYS A HB3    1 
ATOM   1077 H  HG     . CYS A 1 75 ? -4.970  -42.675 25.294  1.00 105.10 ? 465 CYS A HG     1 
ATOM   1078 N  N      . ASP A 1 76 ? -6.903  -45.229 22.822  1.00 87.69  ? 466 ASP A N      1 
ATOM   1079 C  CA     . ASP A 1 76 ? -8.125  -45.071 22.040  1.00 93.06  ? 466 ASP A CA     1 
ATOM   1080 C  C      . ASP A 1 76 ? -8.566  -43.614 21.967  1.00 90.66  ? 466 ASP A C      1 
ATOM   1081 O  O      . ASP A 1 76 ? -9.749  -43.333 21.751  1.00 90.36  ? 466 ASP A O      1 
ATOM   1082 C  CB     . ASP A 1 76 ? -9.247  -45.943 22.610  1.00 100.36 ? 466 ASP A CB     1 
ATOM   1083 C  CG     . ASP A 1 76 ? -9.057  -47.416 22.293  1.00 106.38 ? 466 ASP A CG     1 
ATOM   1084 O  OD1    . ASP A 1 76 ? -8.507  -47.728 21.214  1.00 105.23 ? 466 ASP A OD1    1 
ATOM   1085 O  OD2    . ASP A 1 76 ? -9.456  -48.263 23.121  1.00 110.40 ? 466 ASP A OD2    1 
ATOM   1086 H  H      . ASP A 1 76 ? -6.963  -44.933 23.627  1.00 105.18 ? 466 ASP A H      1 
ATOM   1087 H  HA     . ASP A 1 76 ? -7.958  -45.366 21.132  1.00 111.61 ? 466 ASP A HA     1 
ATOM   1088 H  HB2    . ASP A 1 76 ? -9.267  -45.843 23.575  1.00 120.38 ? 466 ASP A HB2    1 
ATOM   1089 H  HB3    . ASP A 1 76 ? -10.094 -45.663 22.229  1.00 120.38 ? 466 ASP A HB3    1 
ATOM   1090 N  N      . ARG A 1 77 ? -7.634  -42.683 22.140  1.00 72.27  ? 467 ARG A N      1 
ATOM   1091 C  CA     . ARG A 1 77 ? -7.908  -41.266 21.966  1.00 67.66  ? 467 ARG A CA     1 
ATOM   1092 C  C      . ARG A 1 77 ? -7.618  -40.860 20.528  1.00 60.02  ? 467 ARG A C      1 
ATOM   1093 O  O      . ARG A 1 77 ? -6.628  -41.295 19.934  1.00 59.07  ? 467 ARG A O      1 
ATOM   1094 C  CB     . ARG A 1 77 ? -7.063  -40.432 22.928  1.00 70.51  ? 467 ARG A CB     1 
ATOM   1095 C  CG     . ARG A 1 77 ? -7.688  -40.253 24.296  1.00 77.71  ? 467 ARG A CG     1 
ATOM   1096 C  CD     . ARG A 1 77 ? -8.266  -38.858 24.437  1.00 84.43  ? 467 ARG A CD     1 
ATOM   1097 N  NE     . ARG A 1 77 ? -7.216  -37.843 24.485  1.00 88.70  ? 467 ARG A NE     1 
ATOM   1098 C  CZ     . ARG A 1 77 ? -7.414  -36.542 24.290  1.00 94.40  ? 467 ARG A CZ     1 
ATOM   1099 N  NH1    . ARG A 1 77 ? -8.628  -36.077 24.022  1.00 91.99  ? 467 ARG A NH1    1 
ATOM   1100 N  NH2    . ARG A 1 77 ? -6.391  -35.701 24.356  1.00 95.27  ? 467 ARG A NH2    1 
ATOM   1101 H  H      . ARG A 1 77 ? -6.821  -42.852 22.362  1.00 86.67  ? 467 ARG A H      1 
ATOM   1102 H  HA     . ARG A 1 77 ? -8.844  -41.092 22.151  1.00 81.14  ? 467 ARG A HA     1 
ATOM   1103 H  HB2    . ARG A 1 77 ? -6.205  -40.869 23.049  1.00 84.56  ? 467 ARG A HB2    1 
ATOM   1104 H  HB3    . ARG A 1 77 ? -6.931  -39.551 22.543  1.00 84.56  ? 467 ARG A HB3    1 
ATOM   1105 H  HG2    . ARG A 1 77 ? -8.405  -40.896 24.412  1.00 93.19  ? 467 ARG A HG2    1 
ATOM   1106 H  HG3    . ARG A 1 77 ? -7.010  -40.375 24.979  1.00 93.19  ? 467 ARG A HG3    1 
ATOM   1107 H  HD2    . ARG A 1 77 ? -8.836  -38.671 23.675  1.00 101.26 ? 467 ARG A HD2    1 
ATOM   1108 H  HD3    . ARG A 1 77 ? -8.778  -38.805 25.259  1.00 101.26 ? 467 ARG A HD3    1 
ATOM   1109 H  HE     . ARG A 1 77 ? -6.414  -38.105 24.651  1.00 106.38 ? 467 ARG A HE     1 
ATOM   1110 H  HH11   . ARG A 1 77 ? -9.298  -36.614 23.977  1.00 110.34 ? 467 ARG A HH11   1 
ATOM   1111 H  HH12   . ARG A 1 77 ? -8.746  -35.234 23.896  1.00 110.34 ? 467 ARG A HH12   1 
ATOM   1112 H  HH21   . ARG A 1 77 ? -5.602  -35.996 24.528  1.00 114.28 ? 467 ARG A HH21   1 
ATOM   1113 H  HH22   . ARG A 1 77 ? -6.517  -34.860 24.228  1.00 114.28 ? 467 ARG A HH22   1 
ATOM   1114 N  N      . ALA A 1 78 ? -8.494  -40.030 19.972  1.00 51.47  ? 468 ALA A N      1 
ATOM   1115 C  CA     . ALA A 1 78 ? -8.347  -39.535 18.614  1.00 46.21  ? 468 ALA A CA     1 
ATOM   1116 C  C      . ALA A 1 78 ? -8.326  -38.012 18.620  1.00 45.52  ? 468 ALA A C      1 
ATOM   1117 O  O      . ALA A 1 78 ? -8.781  -37.364 19.566  1.00 48.14  ? 468 ALA A O      1 
ATOM   1118 C  CB     . ALA A 1 78 ? -9.478  -40.044 17.712  1.00 45.50  ? 468 ALA A CB     1 
ATOM   1119 H  H      . ALA A 1 78 ? -9.196  -39.735 20.372  1.00 61.71  ? 468 ALA A H      1 
ATOM   1120 H  HA     . ALA A 1 78 ? -7.505  -39.846 18.247  1.00 55.40  ? 468 ALA A HA     1 
ATOM   1121 H  HB1    . ALA A 1 78 ? -9.342  -39.705 16.814  1.00 54.55  ? 468 ALA A HB1    1 
ATOM   1122 H  HB2    . ALA A 1 78 ? -9.463  -41.014 17.705  1.00 54.55  ? 468 ALA A HB2    1 
ATOM   1123 H  HB3    . ALA A 1 78 ? -10.326 -39.728 18.061  1.00 54.55  ? 468 ALA A HB3    1 
ATOM   1124 N  N      . PHE A 1 79 ? -7.787  -37.446 17.543  1.00 41.19  ? 469 PHE A N      1 
ATOM   1125 C  CA     . PHE A 1 79 ? -7.610  -36.007 17.431  1.00 40.86  ? 469 PHE A CA     1 
ATOM   1126 C  C      . PHE A 1 79 ? -8.011  -35.563 16.034  1.00 42.87  ? 469 PHE A C      1 
ATOM   1127 O  O      . PHE A 1 79 ? -8.012  -36.348 15.082  1.00 39.31  ? 469 PHE A O      1 
ATOM   1128 C  CB     . PHE A 1 79 ? -6.161  -35.589 17.719  1.00 40.14  ? 469 PHE A CB     1 
ATOM   1129 C  CG     . PHE A 1 79 ? -5.640  -36.087 19.034  1.00 47.44  ? 469 PHE A CG     1 
ATOM   1130 C  CD1    . PHE A 1 79 ? -5.111  -37.362 19.146  1.00 43.45  ? 469 PHE A CD1    1 
ATOM   1131 C  CD2    . PHE A 1 79 ? -5.682  -35.283 20.158  1.00 54.35  ? 469 PHE A CD2    1 
ATOM   1132 C  CE1    . PHE A 1 79 ? -4.633  -37.824 20.356  1.00 45.86  ? 469 PHE A CE1    1 
ATOM   1133 C  CE2    . PHE A 1 79 ? -5.205  -35.740 21.370  1.00 56.41  ? 469 PHE A CE2    1 
ATOM   1134 C  CZ     . PHE A 1 79 ? -4.680  -37.012 21.468  1.00 52.53  ? 469 PHE A CZ     1 
ATOM   1135 H  H      . PHE A 1 79 ? -7.513  -37.883 16.855  1.00 49.37  ? 469 PHE A H      1 
ATOM   1136 H  HA     . PHE A 1 79 ? -8.188  -35.560 18.069  1.00 48.98  ? 469 PHE A HA     1 
ATOM   1137 H  HB2    . PHE A 1 79 ? -5.589  -35.942 17.020  1.00 48.11  ? 469 PHE A HB2    1 
ATOM   1138 H  HB3    . PHE A 1 79 ? -6.111  -34.620 17.727  1.00 48.11  ? 469 PHE A HB3    1 
ATOM   1139 H  HD1    . PHE A 1 79 ? -5.078  -37.913 18.398  1.00 52.09  ? 469 PHE A HD1    1 
ATOM   1140 H  HD2    . PHE A 1 79 ? -6.035  -34.425 20.097  1.00 65.17  ? 469 PHE A HD2    1 
ATOM   1141 H  HE1    . PHE A 1 79 ? -4.279  -38.682 20.420  1.00 54.98  ? 469 PHE A HE1    1 
ATOM   1142 H  HE2    . PHE A 1 79 ? -5.237  -35.191 22.120  1.00 67.64  ? 469 PHE A HE2    1 
ATOM   1143 H  HZ     . PHE A 1 79 ? -4.358  -37.321 22.284  1.00 62.98  ? 469 PHE A HZ     1 
ATOM   1144 N  N      . SER A 1 80 ? -8.353  -34.282 15.926  1.00 50.50  ? 470 SER A N      1 
ATOM   1145 C  CA     . SER A 1 80 ? -8.756  -33.699 14.655  1.00 41.00  ? 470 SER A CA     1 
ATOM   1146 C  C      . SER A 1 80 ? -7.575  -33.277 13.792  1.00 38.30  ? 470 SER A C      1 
ATOM   1147 O  O      . SER A 1 80 ? -7.770  -32.989 12.606  1.00 48.93  ? 470 SER A O      1 
ATOM   1148 C  CB     . SER A 1 80 ? -9.660  -32.493 14.913  1.00 41.43  ? 470 SER A CB     1 
ATOM   1149 O  OG     . SER A 1 80 ? -9.064  -31.617 15.853  1.00 44.39  ? 470 SER A OG     1 
ATOM   1150 H  H      . SER A 1 80 ? -8.359  -33.726 16.582  1.00 60.55  ? 470 SER A H      1 
ATOM   1151 H  HA     . SER A 1 80 ? -9.269  -34.355 14.157  1.00 49.15  ? 470 SER A HA     1 
ATOM   1152 H  HB2    . SER A 1 80 ? -9.798  -32.016 14.080  1.00 49.66  ? 470 SER A HB2    1 
ATOM   1153 H  HB3    . SER A 1 80 ? -10.510 -32.803 15.264  1.00 49.66  ? 470 SER A HB3    1 
ATOM   1154 H  HG     . SER A 1 80 ? -9.566  -30.957 15.990  1.00 53.22  ? 470 SER A HG     1 
ATOM   1155 N  N      . ARG A 1 81 ? -6.366  -33.240 14.346  1.00 32.06  ? 471 ARG A N      1 
ATOM   1156 C  CA     . ARG A 1 81 ? -5.190  -32.763 13.635  1.00 35.57  ? 471 ARG A CA     1 
ATOM   1157 C  C      . ARG A 1 81 ? -4.046  -33.755 13.796  1.00 35.23  ? 471 ARG A C      1 
ATOM   1158 O  O      . ARG A 1 81 ? -3.928  -34.435 14.819  1.00 32.47  ? 471 ARG A O      1 
ATOM   1159 C  CB     . ARG A 1 81 ? -4.754  -31.382 14.149  1.00 40.68  ? 471 ARG A CB     1 
ATOM   1160 C  CG     . ARG A 1 81 ? -5.754  -30.276 13.875  1.00 46.06  ? 471 ARG A CG     1 
ATOM   1161 C  CD     . ARG A 1 81 ? -5.568  -29.099 14.818  1.00 55.21  ? 471 ARG A CD     1 
ATOM   1162 N  NE     . ARG A 1 81 ? -4.176  -28.670 14.914  1.00 47.63  ? 471 ARG A NE     1 
ATOM   1163 C  CZ     . ARG A 1 81 ? -3.785  -27.511 15.436  1.00 45.30  ? 471 ARG A CZ     1 
ATOM   1164 N  NH1    . ARG A 1 81 ? -2.495  -27.208 15.480  1.00 45.64  ? 471 ARG A NH1    1 
ATOM   1165 N  NH2    . ARG A 1 81 ? -4.679  -26.649 15.904  1.00 45.65  ? 471 ARG A NH2    1 
ATOM   1166 H  H      . ARG A 1 81 ? -6.200  -33.492 15.151  1.00 38.42  ? 471 ARG A H      1 
ATOM   1167 H  HA     . ARG A 1 81 ? -5.392  -32.685 12.690  1.00 42.63  ? 471 ARG A HA     1 
ATOM   1168 H  HB2    . ARG A 1 81 ? -4.619  -31.431 15.108  1.00 48.76  ? 471 ARG A HB2    1 
ATOM   1169 H  HB3    . ARG A 1 81 ? -3.925  -31.139 13.710  1.00 48.76  ? 471 ARG A HB3    1 
ATOM   1170 H  HG2    . ARG A 1 81 ? -5.636  -29.958 12.966  1.00 55.22  ? 471 ARG A HG2    1 
ATOM   1171 H  HG3    . ARG A 1 81 ? -6.653  -30.621 13.995  1.00 55.22  ? 471 ARG A HG3    1 
ATOM   1172 H  HD2    . ARG A 1 81 ? -6.093  -28.350 14.494  1.00 66.20  ? 471 ARG A HD2    1 
ATOM   1173 H  HD3    . ARG A 1 81 ? -5.866  -29.354 15.705  1.00 66.20  ? 471 ARG A HD3    1 
ATOM   1174 H  HE     . ARG A 1 81 ? -3.585  -29.138 14.502  1.00 57.10  ? 471 ARG A HE     1 
ATOM   1175 H  HH11   . ARG A 1 81 ? -1.912  -27.763 15.176  1.00 54.72  ? 471 ARG A HH11   1 
ATOM   1176 H  HH12   . ARG A 1 81 ? -2.241  -26.458 15.815  1.00 54.72  ? 471 ARG A HH12   1 
ATOM   1177 H  HH21   . ARG A 1 81 ? -5.517  -26.837 15.879  1.00 54.73  ? 471 ARG A HH21   1 
ATOM   1178 H  HH22   . ARG A 1 81 ? -4.418  -25.901 16.238  1.00 54.73  ? 471 ARG A HH22   1 
ATOM   1179 N  N      . SER A 1 82 ? -3.194  -33.822 12.771  1.00 43.71  ? 472 SER A N      1 
ATOM   1180 C  CA     . SER A 1 82 ? -2.060  -34.738 12.813  1.00 49.60  ? 472 SER A CA     1 
ATOM   1181 C  C      . SER A 1 82 ? -1.072  -34.343 13.904  1.00 52.50  ? 472 SER A C      1 
ATOM   1182 O  O      . SER A 1 82 ? -0.567  -35.206 14.632  1.00 65.80  ? 472 SER A O      1 
ATOM   1183 C  CB     . SER A 1 82 ? -1.364  -34.776 11.453  1.00 53.14  ? 472 SER A CB     1 
ATOM   1184 O  OG     . SER A 1 82 ? -0.882  -33.495 11.088  1.00 57.11  ? 472 SER A OG     1 
ATOM   1185 H  H      . SER A 1 82 ? -3.251  -33.354 12.052  1.00 52.40  ? 472 SER A H      1 
ATOM   1186 H  HA     . SER A 1 82 ? -2.383  -35.631 13.010  1.00 59.47  ? 472 SER A HA     1 
ATOM   1187 H  HB2    . SER A 1 82 ? -0.616  -35.392 11.499  1.00 63.72  ? 472 SER A HB2    1 
ATOM   1188 H  HB3    . SER A 1 82 ? -1.998  -35.075 10.783  1.00 63.72  ? 472 SER A HB3    1 
ATOM   1189 H  HG     . SER A 1 82 ? -1.520  -32.951 11.041  1.00 68.48  ? 472 SER A HG     1 
ATOM   1190 N  N      . ASP A 1 83 ? -0.780  -33.046 14.033  1.00 42.39  ? 473 ASP A N      1 
ATOM   1191 C  CA     . ASP A 1 83 ? 0.193   -32.612 15.029  1.00 38.95  ? 473 ASP A CA     1 
ATOM   1192 C  C      . ASP A 1 83 ? -0.315  -32.833 16.448  1.00 39.80  ? 473 ASP A C      1 
ATOM   1193 O  O      . ASP A 1 83 ? 0.486   -33.064 17.360  1.00 40.79  ? 473 ASP A O      1 
ATOM   1194 C  CB     . ASP A 1 83 ? 0.558   -31.142 14.811  1.00 42.75  ? 473 ASP A CB     1 
ATOM   1195 C  CG     . ASP A 1 83 ? -0.652  -30.233 14.776  1.00 39.31  ? 473 ASP A CG     1 
ATOM   1196 O  OD1    . ASP A 1 83 ? -1.769  -30.732 14.545  1.00 41.82  ? 473 ASP A OD1    1 
ATOM   1197 O  OD2    . ASP A 1 83 ? -0.481  -29.013 14.970  1.00 40.74  ? 473 ASP A OD2    1 
ATOM   1198 H  H      . ASP A 1 83 ? -1.125  -32.414 13.563  1.00 50.82  ? 473 ASP A H      1 
ATOM   1199 H  HA     . ASP A 1 83 ? 1.002   -33.136 14.921  1.00 46.69  ? 473 ASP A HA     1 
ATOM   1200 H  HB2    . ASP A 1 83 ? 1.132   -30.849 15.536  1.00 51.25  ? 473 ASP A HB2    1 
ATOM   1201 H  HB3    . ASP A 1 83 ? 1.023   -31.055 13.964  1.00 51.25  ? 473 ASP A HB3    1 
ATOM   1202 N  N      . HIS A 1 84 ? -1.632  -32.780 16.657  1.00 39.85  ? 474 HIS A N      1 
ATOM   1203 C  CA     . HIS A 1 84 ? -2.175  -33.083 17.977  1.00 41.23  ? 474 HIS A CA     1 
ATOM   1204 C  C      . HIS A 1 84 ? -1.854  -34.512 18.385  1.00 41.57  ? 474 HIS A C      1 
ATOM   1205 O  O      . HIS A 1 84 ? -1.470  -34.767 19.532  1.00 42.89  ? 474 HIS A O      1 
ATOM   1206 C  CB     . HIS A 1 84 ? -3.686  -32.859 17.992  1.00 41.72  ? 474 HIS A CB     1 
ATOM   1207 C  CG     . HIS A 1 84 ? -4.083  -31.432 18.192  1.00 42.49  ? 474 HIS A CG     1 
ATOM   1208 N  ND1    . HIS A 1 84 ? -5.400  -31.030 18.258  1.00 43.44  ? 474 HIS A ND1    1 
ATOM   1209 C  CD2    . HIS A 1 84 ? -3.339  -30.311 18.345  1.00 42.94  ? 474 HIS A CD2    1 
ATOM   1210 C  CE1    . HIS A 1 84 ? -5.449  -29.723 18.442  1.00 44.36  ? 474 HIS A CE1    1 
ATOM   1211 N  NE2    . HIS A 1 84 ? -4.212  -29.262 18.498  1.00 44.11  ? 474 HIS A NE2    1 
ATOM   1212 H  H      . HIS A 1 84 ? -2.219  -32.575 16.063  1.00 47.77  ? 474 HIS A H      1 
ATOM   1213 H  HA     . HIS A 1 84 ? -1.771  -32.491 18.630  1.00 49.43  ? 474 HIS A HA     1 
ATOM   1214 H  HB2    . HIS A 1 84 ? -4.054  -33.153 17.144  1.00 50.02  ? 474 HIS A HB2    1 
ATOM   1215 H  HB3    . HIS A 1 84 ? -4.071  -33.378 18.715  1.00 50.02  ? 474 HIS A HB3    1 
ATOM   1216 H  HD2    . HIS A 1 84 ? -2.410  -30.261 18.346  1.00 51.48  ? 474 HIS A HD2    1 
ATOM   1217 H  HE1    . HIS A 1 84 ? -6.223  -29.213 18.518  1.00 53.18  ? 474 HIS A HE1    1 
ATOM   1218 H  HE2    . HIS A 1 84 ? -3.990  -28.439 18.611  1.00 52.88  ? 474 HIS A HE2    1 
ATOM   1219 N  N      . LEU A 1 85 ? -2.007  -35.463 17.463  1.00 45.09  ? 475 LEU A N      1 
ATOM   1220 C  CA     . LEU A 1 85 ? -1.732  -36.856 17.786  1.00 49.05  ? 475 LEU A CA     1 
ATOM   1221 C  C      . LEU A 1 85 ? -0.244  -37.076 18.030  1.00 48.49  ? 475 LEU A C      1 
ATOM   1222 O  O      . LEU A 1 85 ? 0.146   -37.716 19.009  1.00 46.85  ? 475 LEU A O      1 
ATOM   1223 C  CB     . LEU A 1 85 ? -2.234  -37.764 16.666  1.00 50.20  ? 475 LEU A CB     1 
ATOM   1224 C  CG     . LEU A 1 85 ? -1.997  -39.263 16.865  1.00 48.82  ? 475 LEU A CG     1 
ATOM   1225 C  CD1    . LEU A 1 85 ? -2.725  -39.766 18.103  1.00 50.34  ? 475 LEU A CD1    1 
ATOM   1226 C  CD2    . LEU A 1 85 ? -2.431  -40.046 15.635  1.00 46.12  ? 475 LEU A CD2    1 
ATOM   1227 H  H      . LEU A 1 85 ? -2.266  -35.327 16.654  1.00 54.06  ? 475 LEU A H      1 
ATOM   1228 H  HA     . LEU A 1 85 ? -2.207  -37.089 18.599  1.00 58.81  ? 475 LEU A HA     1 
ATOM   1229 H  HB2    . LEU A 1 85 ? -3.190  -37.632 16.571  1.00 60.19  ? 475 LEU A HB2    1 
ATOM   1230 H  HB3    . LEU A 1 85 ? -1.790  -37.507 15.843  1.00 60.19  ? 475 LEU A HB3    1 
ATOM   1231 H  HG     . LEU A 1 85 ? -1.049  -39.420 16.994  1.00 58.53  ? 475 LEU A HG     1 
ATOM   1232 H  HD11   . LEU A 1 85 ? -2.629  -40.730 18.154  1.00 60.36  ? 475 LEU A HD11   1 
ATOM   1233 H  HD12   . LEU A 1 85 ? -2.336  -39.353 18.890  1.00 60.36  ? 475 LEU A HD12   1 
ATOM   1234 H  HD13   . LEU A 1 85 ? -3.663  -39.531 18.034  1.00 60.36  ? 475 LEU A HD13   1 
ATOM   1235 H  HD21   . LEU A 1 85 ? -2.222  -40.984 15.768  1.00 55.29  ? 475 LEU A HD21   1 
ATOM   1236 H  HD22   . LEU A 1 85 ? -3.386  -39.934 15.511  1.00 55.29  ? 475 LEU A HD22   1 
ATOM   1237 H  HD23   . LEU A 1 85 ? -1.954  -39.707 14.861  1.00 55.29  ? 475 LEU A HD23   1 
ATOM   1238 N  N      . ALA A 1 86 ? 0.602   -36.534 17.149  1.00 47.64  ? 476 ALA A N      1 
ATOM   1239 C  CA     . ALA A 1 86 ? 2.042   -36.730 17.283  1.00 47.10  ? 476 ALA A CA     1 
ATOM   1240 C  C      . ALA A 1 86 ? 2.535   -36.321 18.666  1.00 45.26  ? 476 ALA A C      1 
ATOM   1241 O  O      . ALA A 1 86 ? 3.354   -37.019 19.273  1.00 45.39  ? 476 ALA A O      1 
ATOM   1242 C  CB     . ALA A 1 86 ? 2.776   -35.942 16.198  1.00 44.17  ? 476 ALA A CB     1 
ATOM   1243 H  H      . ALA A 1 86 ? 0.368   -36.055 16.474  1.00 57.12  ? 476 ALA A H      1 
ATOM   1244 H  HA     . ALA A 1 86 ? 2.245   -37.670 17.159  1.00 56.47  ? 476 ALA A HA     1 
ATOM   1245 H  HB1    . ALA A 1 86 ? 3.731   -36.081 16.299  1.00 52.95  ? 476 ALA A HB1    1 
ATOM   1246 H  HB2    . ALA A 1 86 ? 2.485   -36.257 15.328  1.00 52.95  ? 476 ALA A HB2    1 
ATOM   1247 H  HB3    . ALA A 1 86 ? 2.566   -35.000 16.296  1.00 52.95  ? 476 ALA A HB3    1 
ATOM   1248 N  N      . LEU A 1 87 ? 2.047   -35.189 19.181  1.00 47.89  ? 477 LEU A N      1 
ATOM   1249 C  CA     . LEU A 1 87 ? 2.391   -34.769 20.534  1.00 50.30  ? 477 LEU A CA     1 
ATOM   1250 C  C      . LEU A 1 87 ? 1.814   -35.701 21.593  1.00 54.79  ? 477 LEU A C      1 
ATOM   1251 O  O      . LEU A 1 87 ? 2.356   -35.772 22.702  1.00 52.36  ? 477 LEU A O      1 
ATOM   1252 C  CB     . LEU A 1 87 ? 1.902   -33.342 20.779  1.00 47.93  ? 477 LEU A CB     1 
ATOM   1253 C  CG     . LEU A 1 87 ? 2.468   -32.280 19.834  1.00 47.23  ? 477 LEU A CG     1 
ATOM   1254 C  CD1    . LEU A 1 87 ? 1.775   -30.948 20.058  1.00 48.25  ? 477 LEU A CD1    1 
ATOM   1255 C  CD2    . LEU A 1 87 ? 3.972   -32.132 20.011  1.00 47.19  ? 477 LEU A CD2    1 
ATOM   1256 H  H      . LEU A 1 87 ? 1.518   -34.652 18.767  1.00 57.41  ? 477 LEU A H      1 
ATOM   1257 H  HA     . LEU A 1 87 ? 3.356   -34.775 20.628  1.00 60.31  ? 477 LEU A HA     1 
ATOM   1258 H  HB2    . LEU A 1 87 ? 0.937   -33.329 20.687  1.00 57.46  ? 477 LEU A HB2    1 
ATOM   1259 H  HB3    . LEU A 1 87 ? 2.144   -33.086 21.683  1.00 57.46  ? 477 LEU A HB3    1 
ATOM   1260 H  HG     . LEU A 1 87 ? 2.302   -32.552 18.918  1.00 56.62  ? 477 LEU A HG     1 
ATOM   1261 H  HD11   . LEU A 1 87 ? 2.149   -30.292 19.449  1.00 57.84  ? 477 LEU A HD11   1 
ATOM   1262 H  HD12   . LEU A 1 87 ? 0.826   -31.054 19.889  1.00 57.84  ? 477 LEU A HD12   1 
ATOM   1263 H  HD13   . LEU A 1 87 ? 1.919   -30.668 20.976  1.00 57.84  ? 477 LEU A HD13   1 
ATOM   1264 H  HD21   . LEU A 1 87 ? 4.282   -31.392 19.466  1.00 56.58  ? 477 LEU A HD21   1 
ATOM   1265 H  HD22   . LEU A 1 87 ? 4.164   -31.958 20.946  1.00 56.58  ? 477 LEU A HD22   1 
ATOM   1266 H  HD23   . LEU A 1 87 ? 4.406   -32.953 19.731  1.00 56.58  ? 477 LEU A HD23   1 
ATOM   1267 N  N      . HIS A 1 88 ? 0.728   -36.413 21.282  1.00 47.57  ? 478 HIS A N      1 
ATOM   1268 C  CA     . HIS A 1 88 ? 0.159   -37.363 22.231  1.00 50.99  ? 478 HIS A CA     1 
ATOM   1269 C  C      . HIS A 1 88 ? 0.991   -38.636 22.323  1.00 52.67  ? 478 HIS A C      1 
ATOM   1270 O  O      . HIS A 1 88 ? 1.106   -39.228 23.402  1.00 56.73  ? 478 HIS A O      1 
ATOM   1271 C  CB     . HIS A 1 88 ? -1.274  -37.712 21.835  1.00 52.26  ? 478 HIS A CB     1 
ATOM   1272 C  CG     . HIS A 1 88 ? -1.837  -38.873 22.592  1.00 60.88  ? 478 HIS A CG     1 
ATOM   1273 N  ND1    . HIS A 1 88 ? -2.265  -38.770 23.897  1.00 68.16  ? 478 HIS A ND1    1 
ATOM   1274 C  CD2    . HIS A 1 88 ? -2.030  -40.164 22.232  1.00 64.40  ? 478 HIS A CD2    1 
ATOM   1275 C  CE1    . HIS A 1 88 ? -2.706  -39.947 24.307  1.00 71.12  ? 478 HIS A CE1    1 
ATOM   1276 N  NE2    . HIS A 1 88 ? -2.573  -40.810 23.316  1.00 70.50  ? 478 HIS A NE2    1 
ATOM   1277 H  H      . HIS A 1 88 ? 0.307   -36.363 20.534  1.00 57.03  ? 478 HIS A H      1 
ATOM   1278 H  HA     . HIS A 1 88 ? 0.136   -36.955 23.111  1.00 61.14  ? 478 HIS A HA     1 
ATOM   1279 H  HB2    . HIS A 1 88 ? -1.841  -36.944 22.005  1.00 62.67  ? 478 HIS A HB2    1 
ATOM   1280 H  HB3    . HIS A 1 88 ? -1.296  -37.935 20.892  1.00 62.67  ? 478 HIS A HB3    1 
ATOM   1281 H  HD1    . HIS A 1 88 ? -2.252  -38.052 24.370  1.00 81.74  ? 478 HIS A HD1    1 
ATOM   1282 H  HD2    . HIS A 1 88 ? -1.835  -40.542 21.405  1.00 77.23  ? 478 HIS A HD2    1 
ATOM   1283 H  HE1    . HIS A 1 88 ? -3.049  -40.136 25.150  1.00 85.30  ? 478 HIS A HE1    1 
ATOM   1284 N  N      . MET A 1 89 ? 1.567   -39.079 21.204  1.00 59.94  ? 479 MET A N      1 
ATOM   1285 C  CA     . MET A 1 89 ? 2.371   -40.295 21.222  1.00 58.14  ? 479 MET A CA     1 
ATOM   1286 C  C      . MET A 1 89 ? 3.555   -40.164 22.168  1.00 60.12  ? 479 MET A C      1 
ATOM   1287 O  O      . MET A 1 89 ? 3.956   -41.147 22.800  1.00 60.87  ? 479 MET A O      1 
ATOM   1288 C  CB     . MET A 1 89 ? 2.851   -40.624 19.809  1.00 60.96  ? 479 MET A CB     1 
ATOM   1289 C  CG     . MET A 1 89 ? 1.733   -40.991 18.843  1.00 66.26  ? 479 MET A CG     1 
ATOM   1290 S  SD     . MET A 1 89 ? 0.819   -42.464 19.349  1.00 71.27  ? 479 MET A SD     1 
ATOM   1291 C  CE     . MET A 1 89 ? -0.196  -42.747 17.900  1.00 68.83  ? 479 MET A CE     1 
ATOM   1292 H  H      . MET A 1 89 ? 1.508   -38.699 20.435  1.00 71.88  ? 479 MET A H      1 
ATOM   1293 H  HA     . MET A 1 89 ? 1.815   -41.029 21.526  1.00 69.72  ? 479 MET A HA     1 
ATOM   1294 H  HB2    . MET A 1 89 ? 3.311   -39.850 19.448  1.00 73.10  ? 479 MET A HB2    1 
ATOM   1295 H  HB3    . MET A 1 89 ? 3.461   -41.377 19.855  1.00 73.10  ? 479 MET A HB3    1 
ATOM   1296 H  HG2    . MET A 1 89 ? 1.106   -40.253 18.791  1.00 79.46  ? 479 MET A HG2    1 
ATOM   1297 H  HG3    . MET A 1 89 ? 2.116   -41.162 17.968  1.00 79.46  ? 479 MET A HG3    1 
ATOM   1298 H  HE1    . MET A 1 89 ? -0.778  -43.505 18.065  1.00 82.54  ? 479 MET A HE1    1 
ATOM   1299 H  HE2    . MET A 1 89 ? -0.727  -41.954 17.727  1.00 82.54  ? 479 MET A HE2    1 
ATOM   1300 H  HE3    . MET A 1 89 ? 0.381   -42.931 17.142  1.00 82.54  ? 479 MET A HE3    1 
ATOM   1301 N  N      . LYS A 1 90 ? 4.121   -38.960 22.289  1.00 58.97  ? 480 LYS A N      1 
ATOM   1302 C  CA     . LYS A 1 90 ? 5.219   -38.751 23.226  1.00 60.09  ? 480 LYS A CA     1 
ATOM   1303 C  C      . LYS A 1 90 ? 4.842   -39.206 24.628  1.00 64.13  ? 480 LYS A C      1 
ATOM   1304 O  O      . LYS A 1 90 ? 5.691   -39.719 25.365  1.00 69.69  ? 480 LYS A O      1 
ATOM   1305 C  CB     . LYS A 1 90 ? 5.629   -37.277 23.235  1.00 60.17  ? 480 LYS A CB     1 
ATOM   1306 C  CG     . LYS A 1 90 ? 6.271   -36.811 21.933  1.00 60.86  ? 480 LYS A CG     1 
ATOM   1307 C  CD     . LYS A 1 90 ? 6.271   -35.287 21.783  1.00 58.10  ? 480 LYS A CD     1 
ATOM   1308 C  CE     . LYS A 1 90 ? 7.219   -34.598 22.757  1.00 55.58  ? 480 LYS A CE     1 
ATOM   1309 N  NZ     . LYS A 1 90 ? 6.619   -34.396 24.104  1.00 52.97  ? 480 LYS A NZ     1 
ATOM   1310 H  H      . LYS A 1 90 ? 3.890   -38.260 21.846  1.00 70.72  ? 480 LYS A H      1 
ATOM   1311 H  HA     . LYS A 1 90 ? 5.981   -39.275 22.939  1.00 72.05  ? 480 LYS A HA     1 
ATOM   1312 H  HB2    . LYS A 1 90 ? 4.841   -36.733 23.391  1.00 72.15  ? 480 LYS A HB2    1 
ATOM   1313 H  HB3    . LYS A 1 90 ? 6.272   -37.140 23.948  1.00 72.15  ? 480 LYS A HB3    1 
ATOM   1314 H  HG2    . LYS A 1 90 ? 7.192   -37.113 21.909  1.00 72.98  ? 480 LYS A HG2    1 
ATOM   1315 H  HG3    . LYS A 1 90 ? 5.779   -37.186 21.186  1.00 72.98  ? 480 LYS A HG3    1 
ATOM   1316 H  HD2    . LYS A 1 90 ? 6.549   -35.058 20.882  1.00 69.66  ? 480 LYS A HD2    1 
ATOM   1317 H  HD3    . LYS A 1 90 ? 5.376   -34.953 21.949  1.00 69.66  ? 480 LYS A HD3    1 
ATOM   1318 H  HE2    . LYS A 1 90 ? 8.015   -35.143 22.862  1.00 66.65  ? 480 LYS A HE2    1 
ATOM   1319 H  HE3    . LYS A 1 90 ? 7.458   -33.727 22.402  1.00 66.65  ? 480 LYS A HE3    1 
ATOM   1320 H  HZ1    . LYS A 1 90 ? 7.153   -33.886 24.601  1.00 63.51  ? 480 LYS A HZ1    1 
ATOM   1321 H  HZ2    . LYS A 1 90 ? 5.828   -33.996 24.027  1.00 63.51  ? 480 LYS A HZ2    1 
ATOM   1322 H  HZ3    . LYS A 1 90 ? 6.507   -35.179 24.510  1.00 63.51  ? 480 LYS A HZ3    1 
ATOM   1323 N  N      . ARG A 1 91 ? 3.576   -39.039 25.011  1.00 64.51  ? 481 ARG A N      1 
ATOM   1324 C  CA     . ARG A 1 91 ? 3.117   -39.534 26.302  1.00 65.48  ? 481 ARG A CA     1 
ATOM   1325 C  C      . ARG A 1 91 ? 3.096   -41.055 26.352  1.00 60.50  ? 481 ARG A C      1 
ATOM   1326 O  O      . ARG A 1 91 ? 3.028   -41.627 27.445  1.00 57.32  ? 481 ARG A O      1 
ATOM   1327 C  CB     . ARG A 1 91 ? 1.723   -38.979 26.608  1.00 66.33  ? 481 ARG A CB     1 
ATOM   1328 C  CG     . ARG A 1 91 ? 1.649   -37.458 26.603  1.00 70.94  ? 481 ARG A CG     1 
ATOM   1329 C  CD     . ARG A 1 91 ? 0.223   -36.962 26.777  1.00 78.87  ? 481 ARG A CD     1 
ATOM   1330 N  NE     . ARG A 1 91 ? -0.337  -37.321 28.079  1.00 86.92  ? 481 ARG A NE     1 
ATOM   1331 C  CZ     . ARG A 1 91 ? -0.185  -36.605 29.191  1.00 88.52  ? 481 ARG A CZ     1 
ATOM   1332 N  NH1    . ARG A 1 91 ? 0.519   -35.480 29.179  1.00 85.46  ? 481 ARG A NH1    1 
ATOM   1333 N  NH2    . ARG A 1 91 ? -0.739  -37.018 30.323  1.00 89.96  ? 481 ARG A NH2    1 
ATOM   1334 H  H      . ARG A 1 91 ? 2.970   -38.646 24.544  1.00 77.36  ? 481 ARG A H      1 
ATOM   1335 H  HA     . ARG A 1 91 ? 3.722   -39.221 26.992  1.00 78.52  ? 481 ARG A HA     1 
ATOM   1336 H  HB2    . ARG A 1 91 ? 1.102   -39.308 25.939  1.00 79.54  ? 481 ARG A HB2    1 
ATOM   1337 H  HB3    . ARG A 1 91 ? 1.451   -39.286 27.487  1.00 79.54  ? 481 ARG A HB3    1 
ATOM   1338 H  HG2    . ARG A 1 91 ? 2.182   -37.110 27.335  1.00 85.08  ? 481 ARG A HG2    1 
ATOM   1339 H  HG3    . ARG A 1 91 ? 1.984   -37.123 25.756  1.00 85.08  ? 481 ARG A HG3    1 
ATOM   1340 H  HD2    . ARG A 1 91 ? 0.207   -35.996 26.690  1.00 94.60  ? 481 ARG A HD2    1 
ATOM   1341 H  HD3    . ARG A 1 91 ? -0.334  -37.364 26.092  1.00 94.60  ? 481 ARG A HD3    1 
ATOM   1342 H  HE     . ARG A 1 91 ? -0.797  -38.046 28.130  1.00 104.25 ? 481 ARG A HE     1 
ATOM   1343 H  HH11   . ARG A 1 91 ? 0.882   -35.202 28.451  1.00 102.50 ? 481 ARG A HH11   1 
ATOM   1344 H  HH12   . ARG A 1 91 ? 0.612   -35.026 29.904  1.00 102.50 ? 481 ARG A HH12   1 
ATOM   1345 H  HH21   . ARG A 1 91 ? -1.195  -37.747 30.338  1.00 107.90 ? 481 ARG A HH21   1 
ATOM   1346 H  HH22   . ARG A 1 91 ? -0.640  -36.558 31.043  1.00 107.90 ? 481 ARG A HH22   1 
ATOM   1347 N  N      . HIS A 1 92 ? 3.160   -41.719 25.198  1.00 58.95  ? 482 HIS A N      1 
ATOM   1348 C  CA     . HIS A 1 92 ? 3.129   -43.172 25.122  1.00 65.52  ? 482 HIS A CA     1 
ATOM   1349 C  C      . HIS A 1 92 ? 4.507   -43.789 24.917  1.00 63.97  ? 482 HIS A C      1 
ATOM   1350 O  O      . HIS A 1 92 ? 4.603   -45.008 24.743  1.00 61.96  ? 482 HIS A O      1 
ATOM   1351 C  CB     . HIS A 1 92 ? 2.202   -43.621 23.986  1.00 71.20  ? 482 HIS A CB     1 
ATOM   1352 C  CG     . HIS A 1 92 ? 0.759   -43.291 24.212  1.00 80.22  ? 482 HIS A CG     1 
ATOM   1353 N  ND1    . HIS A 1 92 ? 0.194   -43.244 25.467  1.00 86.17  ? 482 HIS A ND1    1 
ATOM   1354 C  CD2    . HIS A 1 92 ? -0.234  -42.993 23.340  1.00 80.32  ? 482 HIS A CD2    1 
ATOM   1355 C  CE1    . HIS A 1 92 ? -1.085  -42.929 25.361  1.00 88.04  ? 482 HIS A CE1    1 
ATOM   1356 N  NE2    . HIS A 1 92 ? -1.370  -42.772 24.080  1.00 85.95  ? 482 HIS A NE2    1 
ATOM   1357 H  H      . HIS A 1 92 ? 3.222   -41.339 24.430  1.00 70.68  ? 482 HIS A H      1 
ATOM   1358 H  HA     . HIS A 1 92 ? 2.770   -43.522 25.952  1.00 78.58  ? 482 HIS A HA     1 
ATOM   1359 H  HB2    . HIS A 1 92 ? 2.482   -43.192 23.162  1.00 85.39  ? 482 HIS A HB2    1 
ATOM   1360 H  HB3    . HIS A 1 92 ? 2.274   -44.582 23.900  1.00 85.39  ? 482 HIS A HB3    1 
ATOM   1361 H  HD1    . HIS A 1 92 ? 0.609   -43.394 26.205  1.00 103.35 ? 482 HIS A HD1    1 
ATOM   1362 H  HD2    . HIS A 1 92 ? -0.160  -42.946 22.414  1.00 96.34  ? 482 HIS A HD2    1 
ATOM   1363 H  HE1    . HIS A 1 92 ? -1.683  -42.835 26.067  1.00 105.59 ? 482 HIS A HE1    1 
ATOM   1364 N  N      . PHE A 1 93 ? 5.568   -42.987 24.920  1.00 76.61  ? 483 PHE A N      1 
ATOM   1365 C  CA     . PHE A 1 93 ? 6.921   -43.513 24.776  1.00 75.72  ? 483 PHE A CA     1 
ATOM   1366 C  C      . PHE A 1 93 ? 7.162   -44.636 25.781  1.00 74.62  ? 483 PHE A C      1 
ATOM   1367 O  O      . PHE A 1 93 ? 7.576   -44.392 26.913  1.00 74.31  ? 483 PHE A O      1 
ATOM   1368 C  CB     . PHE A 1 93 ? 7.966   -42.408 24.972  1.00 75.90  ? 483 PHE A CB     1 
ATOM   1369 C  CG     . PHE A 1 93 ? 8.088   -41.447 23.810  1.00 72.04  ? 483 PHE A CG     1 
ATOM   1370 C  CD1    . PHE A 1 93 ? 7.646   -41.785 22.538  1.00 71.99  ? 483 PHE A CD1    1 
ATOM   1371 C  CD2    . PHE A 1 93 ? 8.666   -40.203 23.997  1.00 70.74  ? 483 PHE A CD2    1 
ATOM   1372 C  CE1    . PHE A 1 93 ? 7.770   -40.896 21.484  1.00 69.37  ? 483 PHE A CE1    1 
ATOM   1373 C  CE2    . PHE A 1 93 ? 8.792   -39.312 22.948  1.00 69.88  ? 483 PHE A CE2    1 
ATOM   1374 C  CZ     . PHE A 1 93 ? 8.345   -39.659 21.690  1.00 69.63  ? 483 PHE A CZ     1 
ATOM   1375 H  H      . PHE A 1 93 ? 5.532   -42.132 25.004  1.00 91.88  ? 483 PHE A H      1 
ATOM   1376 H  HA     . PHE A 1 93 ? 7.024   -43.900 23.894  1.00 90.81  ? 483 PHE A HA     1 
ATOM   1377 H  HB2    . PHE A 1 93 ? 7.727   -41.891 25.757  1.00 91.02  ? 483 PHE A HB2    1 
ATOM   1378 H  HB3    . PHE A 1 93 ? 8.833   -42.821 25.104  1.00 91.02  ? 483 PHE A HB3    1 
ATOM   1379 H  HD1    . PHE A 1 93 ? 7.257   -42.615 22.388  1.00 86.34  ? 483 PHE A HD1    1 
ATOM   1380 H  HD2    . PHE A 1 93 ? 8.970   -39.961 24.842  1.00 84.84  ? 483 PHE A HD2    1 
ATOM   1381 H  HE1    . PHE A 1 93 ? 7.467   -41.133 20.637  1.00 83.19  ? 483 PHE A HE1    1 
ATOM   1382 H  HE2    . PHE A 1 93 ? 9.180   -38.479 23.090  1.00 83.80  ? 483 PHE A HE2    1 
ATOM   1383 H  HZ     . PHE A 1 93 ? 8.429   -39.060 20.983  1.00 83.50  ? 483 PHE A HZ     1 
ATOM   1384 O  "O5'"  . DG  B 2 1  ? -8.467  -31.457 23.002  1.00 70.69  ? 1   DG  B "O5'"  1 
ATOM   1385 C  "C5'"  . DG  B 2 1  ? -7.489  -30.461 23.273  1.00 58.39  ? 1   DG  B "C5'"  1 
ATOM   1386 C  "C4'"  . DG  B 2 1  ? -8.087  -29.071 23.170  1.00 49.27  ? 1   DG  B "C4'"  1 
ATOM   1387 O  "O4'"  . DG  B 2 1  ? -7.089  -28.089 23.552  1.00 49.33  ? 1   DG  B "O4'"  1 
ATOM   1388 C  "C3'"  . DG  B 2 1  ? -8.537  -28.665 21.773  1.00 46.87  ? 1   DG  B "C3'"  1 
ATOM   1389 O  "O3'"  . DG  B 2 1  ? -9.645  -27.779 21.838  1.00 35.81  ? 1   DG  B "O3'"  1 
ATOM   1390 C  "C2'"  . DG  B 2 1  ? -7.296  -28.000 21.201  1.00 43.80  ? 1   DG  B "C2'"  1 
ATOM   1391 C  "C1'"  . DG  B 2 1  ? -6.694  -27.324 22.424  1.00 42.96  ? 1   DG  B "C1'"  1 
ATOM   1392 N  N9     . DG  B 2 1  ? -5.240  -27.253 22.405  1.00 44.90  ? 1   DG  B N9     1 
ATOM   1393 C  C8     . DG  B 2 1  ? -4.361  -28.291 22.220  1.00 45.59  ? 1   DG  B C8     1 
ATOM   1394 N  N7     . DG  B 2 1  ? -3.112  -27.925 22.263  1.00 46.21  ? 1   DG  B N7     1 
ATOM   1395 C  C5     . DG  B 2 1  ? -3.168  -26.558 22.497  1.00 42.23  ? 1   DG  B C5     1 
ATOM   1396 C  C6     . DG  B 2 1  ? -2.126  -25.615 22.643  1.00 40.38  ? 1   DG  B C6     1 
ATOM   1397 O  O6     . DG  B 2 1  ? -0.904  -25.805 22.589  1.00 33.98  ? 1   DG  B O6     1 
ATOM   1398 N  N1     . DG  B 2 1  ? -2.621  -24.334 22.865  1.00 51.09  ? 1   DG  B N1     1 
ATOM   1399 C  C2     . DG  B 2 1  ? -3.953  -24.007 22.941  1.00 51.44  ? 1   DG  B C2     1 
ATOM   1400 N  N2     . DG  B 2 1  ? -4.239  -22.717 23.163  1.00 56.14  ? 1   DG  B N2     1 
ATOM   1401 N  N3     . DG  B 2 1  ? -4.937  -24.882 22.807  1.00 48.15  ? 1   DG  B N3     1 
ATOM   1402 C  C4     . DG  B 2 1  ? -4.471  -26.132 22.588  1.00 43.72  ? 1   DG  B C4     1 
ATOM   1403 H  "H5'"  . DG  B 2 1  ? -6.764  -30.544 22.634  1.00 70.02  ? 1   DG  B "H5'"  1 
ATOM   1404 H  "H5''" . DG  B 2 1  ? -7.140  -30.592 24.169  1.00 70.02  ? 1   DG  B "H5''" 1 
ATOM   1405 H  "H4'"  . DG  B 2 1  ? -8.842  -29.006 23.776  1.00 59.07  ? 1   DG  B "H4'"  1 
ATOM   1406 H  "H3'"  . DG  B 2 1  ? -8.765  -29.452 21.254  1.00 56.19  ? 1   DG  B "H3'"  1 
ATOM   1407 H  "H2'"  . DG  B 2 1  ? -6.688  -28.662 20.838  1.00 52.51  ? 1   DG  B "H2'"  1 
ATOM   1408 H  "H2''" . DG  B 2 1  ? -7.536  -27.344 20.528  1.00 52.51  ? 1   DG  B "H2''" 1 
ATOM   1409 H  "H1'"  . DG  B 2 1  ? -7.056  -26.428 22.503  1.00 51.50  ? 1   DG  B "H1'"  1 
ATOM   1410 H  H8     . DG  B 2 1  ? -4.631  -29.169 22.076  1.00 54.66  ? 1   DG  B H8     1 
ATOM   1411 H  H1     . DG  B 2 1  ? -2.050  -23.699 22.964  1.00 61.26  ? 1   DG  B H1     1 
ATOM   1412 H  H21    . DG  B 2 1  ? -5.058  -22.461 23.218  1.00 67.32  ? 1   DG  B H21    1 
ATOM   1413 H  H22    . DG  B 2 1  ? -3.603  -22.145 23.251  1.00 67.32  ? 1   DG  B H22    1 
ATOM   1414 H  "HO5'" . DG  B 2 1  ? -8.257  -32.270 23.027  1.00 84.78  ? 1   DG  B "HO5'" 1 
ATOM   1415 P  P      . DA  B 2 2  ? -10.474 -27.431 20.510  1.00 34.29  ? 2   DA  B P      1 
ATOM   1416 O  OP1    . DA  B 2 2  ? -11.831 -27.022 20.933  1.00 38.70  ? 2   DA  B OP1    1 
ATOM   1417 O  OP2    . DA  B 2 2  ? -10.275 -28.523 19.534  1.00 34.60  ? 2   DA  B OP2    1 
ATOM   1418 O  "O5'"  . DA  B 2 2  ? -9.737  -26.152 19.923  1.00 36.05  ? 2   DA  B "O5'"  1 
ATOM   1419 C  "C5'"  . DA  B 2 2  ? -9.854  -24.916 20.586  1.00 39.77  ? 2   DA  B "C5'"  1 
ATOM   1420 C  "C4'"  . DA  B 2 2  ? -8.928  -23.893 19.968  1.00 34.54  ? 2   DA  B "C4'"  1 
ATOM   1421 O  "O4'"  . DA  B 2 2  ? -7.557  -24.258 20.250  1.00 33.91  ? 2   DA  B "O4'"  1 
ATOM   1422 C  "C3'"  . DA  B 2 2  ? -9.032  -23.773 18.443  1.00 34.51  ? 2   DA  B "C3'"  1 
ATOM   1423 O  "O3'"  . DA  B 2 2  ? -9.456  -22.465 18.082  1.00 42.92  ? 2   DA  B "O3'"  1 
ATOM   1424 C  "C2'"  . DA  B 2 2  ? -7.622  -24.090 17.937  1.00 37.58  ? 2   DA  B "C2'"  1 
ATOM   1425 C  "C1'"  . DA  B 2 2  ? -6.761  -23.868 19.168  1.00 41.68  ? 2   DA  B "C1'"  1 
ATOM   1426 N  N9     . DA  B 2 2  ? -5.524  -24.641 19.190  1.00 34.48  ? 2   DA  B N9     1 
ATOM   1427 C  C8     . DA  B 2 2  ? -5.391  -25.992 19.039  1.00 33.03  ? 2   DA  B C8     1 
ATOM   1428 N  N7     . DA  B 2 2  ? -4.151  -26.411 19.112  1.00 31.17  ? 2   DA  B N7     1 
ATOM   1429 C  C5     . DA  B 2 2  ? -3.423  -25.256 19.333  1.00 30.49  ? 2   DA  B C5     1 
ATOM   1430 C  C6     . DA  B 2 2  ? -2.046  -25.023 19.503  1.00 34.76  ? 2   DA  B C6     1 
ATOM   1431 N  N6     . DA  B 2 2  ? -1.128  -25.994 19.478  1.00 36.61  ? 2   DA  B N6     1 
ATOM   1432 N  N1     . DA  B 2 2  ? -1.648  -23.750 19.705  1.00 34.57  ? 2   DA  B N1     1 
ATOM   1433 C  C2     . DA  B 2 2  ? -2.571  -22.783 19.731  1.00 32.15  ? 2   DA  B C2     1 
ATOM   1434 N  N3     . DA  B 2 2  ? -3.891  -22.881 19.582  1.00 29.47  ? 2   DA  B N3     1 
ATOM   1435 C  C4     . DA  B 2 2  ? -4.254  -24.157 19.385  1.00 30.07  ? 2   DA  B C4     1 
ATOM   1436 H  "H5'"  . DA  B 2 2  ? -9.624  -25.032 21.521  1.00 47.67  ? 2   DA  B "H5'"  1 
ATOM   1437 H  "H5''" . DA  B 2 2  ? -10.769 -24.602 20.518  1.00 47.67  ? 2   DA  B "H5''" 1 
ATOM   1438 H  "H4'"  . DA  B 2 2  ? -9.110  -23.026 20.364  1.00 41.39  ? 2   DA  B "H4'"  1 
ATOM   1439 H  "H3'"  . DA  B 2 2  ? -9.660  -24.430 18.103  1.00 41.35  ? 2   DA  B "H3'"  1 
ATOM   1440 H  "H2'"  . DA  B 2 2  ? -7.564  -25.011 17.639  1.00 45.04  ? 2   DA  B "H2'"  1 
ATOM   1441 H  "H2''" . DA  B 2 2  ? -7.368  -23.481 17.227  1.00 45.04  ? 2   DA  B "H2''" 1 
ATOM   1442 H  "H1'"  . DA  B 2 2  ? -6.552  -22.924 19.248  1.00 49.96  ? 2   DA  B "H1'"  1 
ATOM   1443 H  H8     . DA  B 2 2  ? -6.112  -26.561 18.893  1.00 39.59  ? 2   DA  B H8     1 
ATOM   1444 H  H61    . DA  B 2 2  ? -0.297  -25.803 19.590  1.00 43.88  ? 2   DA  B H61    1 
ATOM   1445 H  H62    . DA  B 2 2  ? -1.368  -26.810 19.350  1.00 43.88  ? 2   DA  B H62    1 
ATOM   1446 H  H2     . DA  B 2 2  ? -2.246  -21.923 19.872  1.00 38.53  ? 2   DA  B H2     1 
ATOM   1447 P  P      . DG  B 2 3  ? -9.774  -22.097 16.552  1.00 45.40  ? 3   DG  B P      1 
ATOM   1448 O  OP1    . DG  B 2 3  ? -11.088 -21.418 16.544  1.00 49.55  ? 3   DG  B OP1    1 
ATOM   1449 O  OP2    . DG  B 2 3  ? -9.548  -23.292 15.709  1.00 53.03  ? 3   DG  B OP2    1 
ATOM   1450 O  "O5'"  . DG  B 2 3  ? -8.646  -21.032 16.187  1.00 50.56  ? 3   DG  B "O5'"  1 
ATOM   1451 C  "C5'"  . DG  B 2 3  ? -8.490  -19.878 16.992  1.00 42.97  ? 3   DG  B "C5'"  1 
ATOM   1452 C  "C4'"  . DG  B 2 3  ? -7.156  -19.211 16.729  1.00 34.12  ? 3   DG  B "C4'"  1 
ATOM   1453 O  "O4'"  . DG  B 2 3  ? -6.082  -20.112 17.116  1.00 37.17  ? 3   DG  B "O4'"  1 
ATOM   1454 C  "C3'"  . DG  B 2 3  ? -6.901  -18.846 15.265  1.00 31.08  ? 3   DG  B "C3'"  1 
ATOM   1455 O  "O3'"  . DG  B 2 3  ? -6.439  -17.508 15.161  1.00 34.13  ? 3   DG  B "O3'"  1 
ATOM   1456 C  "C2'"  . DG  B 2 3  ? -5.856  -19.857 14.812  1.00 33.87  ? 3   DG  B "C2'"  1 
ATOM   1457 C  "C1'"  . DG  B 2 3  ? -5.112  -20.157 16.097  1.00 36.79  ? 3   DG  B "C1'"  1 
ATOM   1458 N  N9     . DG  B 2 3  ? -4.461  -21.466 16.117  1.00 40.69  ? 3   DG  B N9     1 
ATOM   1459 C  C8     . DG  B 2 3  ? -5.054  -22.690 15.917  1.00 37.91  ? 3   DG  B C8     1 
ATOM   1460 N  N7     . DG  B 2 3  ? -4.219  -23.689 15.994  1.00 35.64  ? 3   DG  B N7     1 
ATOM   1461 C  C5     . DG  B 2 3  ? -2.995  -23.089 16.262  1.00 37.47  ? 3   DG  B C5     1 
ATOM   1462 C  C6     . DG  B 2 3  ? -1.718  -23.666 16.451  1.00 32.55  ? 3   DG  B C6     1 
ATOM   1463 O  O6     . DG  B 2 3  ? -1.404  -24.861 16.418  1.00 36.98  ? 3   DG  B O6     1 
ATOM   1464 N  N1     . DG  B 2 3  ? -0.748  -22.703 16.701  1.00 29.09  ? 3   DG  B N1     1 
ATOM   1465 C  C2     . DG  B 2 3  ? -0.979  -21.353 16.759  1.00 33.05  ? 3   DG  B C2     1 
ATOM   1466 N  N2     . DG  B 2 3  ? 0.085   -20.578 17.012  1.00 41.68  ? 3   DG  B N2     1 
ATOM   1467 N  N3     . DG  B 2 3  ? -2.171  -20.796 16.584  1.00 33.49  ? 3   DG  B N3     1 
ATOM   1468 C  C4     . DG  B 2 3  ? -3.128  -21.722 16.340  1.00 36.40  ? 3   DG  B C4     1 
ATOM   1469 H  "H5'"  . DG  B 2 3  ? -8.540  -20.132 17.927  1.00 51.52  ? 3   DG  B "H5'"  1 
ATOM   1470 H  "H5''" . DG  B 2 3  ? -9.203  -19.254 16.793  1.00 51.52  ? 3   DG  B "H5''" 1 
ATOM   1471 H  "H4'"  . DG  B 2 3  ? -7.098  -18.406 17.267  1.00 40.89  ? 3   DG  B "H4'"  1 
ATOM   1472 H  "H3'"  . DG  B 2 3  ? -7.715  -18.958 14.750  1.00 37.24  ? 3   DG  B "H3'"  1 
ATOM   1473 H  "H2'"  . DG  B 2 3  ? -6.280  -20.657 14.465  1.00 40.59  ? 3   DG  B "H2'"  1 
ATOM   1474 H  "H2''" . DG  B 2 3  ? -5.261  -19.467 14.153  1.00 40.59  ? 3   DG  B "H2''" 1 
ATOM   1475 H  "H1'"  . DG  B 2 3  ? -4.450  -19.466 16.254  1.00 44.10  ? 3   DG  B "H1'"  1 
ATOM   1476 H  H8     . DG  B 2 3  ? -5.962  -22.795 15.744  1.00 45.44  ? 3   DG  B H8     1 
ATOM   1477 H  H1     . DG  B 2 3  ? 0.058   -22.974 16.827  1.00 34.85  ? 3   DG  B H1     1 
ATOM   1478 H  H21    . DG  B 2 3  ? 0.022   -19.723 16.939  1.00 49.97  ? 3   DG  B H21    1 
ATOM   1479 H  H22    . DG  B 2 3  ? 0.830   -20.935 17.248  1.00 49.97  ? 3   DG  B H22    1 
ATOM   1480 P  P      . DG  B 2 4  ? -6.134  -16.866 13.723  1.00 32.33  ? 4   DG  B P      1 
ATOM   1481 O  OP1    . DG  B 2 4  ? -6.453  -15.425 13.816  1.00 38.77  ? 4   DG  B OP1    1 
ATOM   1482 O  OP2    . DG  B 2 4  ? -6.783  -17.718 12.701  1.00 35.27  ? 4   DG  B OP2    1 
ATOM   1483 O  "O5'"  . DG  B 2 4  ? -4.553  -17.010 13.577  1.00 27.84  ? 4   DG  B "O5'"  1 
ATOM   1484 C  "C5'"  . DG  B 2 4  ? -3.711  -16.304 14.469  1.00 30.62  ? 4   DG  B "C5'"  1 
ATOM   1485 C  "C4'"  . DG  B 2 4  ? -2.255  -16.431 14.066  1.00 28.61  ? 4   DG  B "C4'"  1 
ATOM   1486 O  "O4'"  . DG  B 2 4  ? -1.805  -17.782 14.334  1.00 27.87  ? 4   DG  B "O4'"  1 
ATOM   1487 C  "C3'"  . DG  B 2 4  ? -1.974  -16.162 12.587  1.00 29.07  ? 4   DG  B "C3'"  1 
ATOM   1488 O  "O3'"  . DG  B 2 4  ? -0.922  -15.215 12.442  1.00 28.07  ? 4   DG  B "O3'"  1 
ATOM   1489 C  "C2'"  . DG  B 2 4  ? -1.610  -17.531 12.020  1.00 32.00  ? 4   DG  B "C2'"  1 
ATOM   1490 C  "C1'"  . DG  B 2 4  ? -1.089  -18.276 13.232  1.00 35.68  ? 4   DG  B "C1'"  1 
ATOM   1491 N  N9     . DG  B 2 4  ? -1.287  -19.717 13.167  1.00 41.69  ? 4   DG  B N9     1 
ATOM   1492 C  C8     . DG  B 2 4  ? -2.473  -20.378 12.966  1.00 37.30  ? 4   DG  B C8     1 
ATOM   1493 N  N7     . DG  B 2 4  ? -2.347  -21.674 12.961  1.00 37.97  ? 4   DG  B N7     1 
ATOM   1494 C  C5     . DG  B 2 4  ? -0.993  -21.885 13.176  1.00 34.94  ? 4   DG  B C5     1 
ATOM   1495 C  C6     . DG  B 2 4  ? -0.267  -23.089 13.272  1.00 38.31  ? 4   DG  B C6     1 
ATOM   1496 O  O6     . DG  B 2 4  ? -0.693  -24.247 13.182  1.00 38.94  ? 4   DG  B O6     1 
ATOM   1497 N  N1     . DG  B 2 4  ? 1.090   -22.857 13.497  1.00 41.21  ? 4   DG  B N1     1 
ATOM   1498 C  C2     . DG  B 2 4  ? 1.665   -21.614 13.614  1.00 36.23  ? 4   DG  B C2     1 
ATOM   1499 N  N2     . DG  B 2 4  ? 2.987   -21.589 13.830  1.00 33.07  ? 4   DG  B N2     1 
ATOM   1500 N  N3     . DG  B 2 4  ? 0.992   -20.477 13.525  1.00 32.79  ? 4   DG  B N3     1 
ATOM   1501 C  C4     . DG  B 2 4  ? -0.327  -20.689 13.306  1.00 37.54  ? 4   DG  B C4     1 
ATOM   1502 H  "H5'"  . DG  B 2 4  ? -3.825  -16.661 15.364  1.00 36.70  ? 4   DG  B "H5'"  1 
ATOM   1503 H  "H5''" . DG  B 2 4  ? -3.961  -15.367 14.467  1.00 36.70  ? 4   DG  B "H5''" 1 
ATOM   1504 H  "H4'"  . DG  B 2 4  ? -1.729  -15.815 14.600  1.00 34.28  ? 4   DG  B "H4'"  1 
ATOM   1505 H  "H3'"  . DG  B 2 4  ? -2.777  -15.831 12.155  1.00 34.83  ? 4   DG  B "H3'"  1 
ATOM   1506 H  "H2'"  . DG  B 2 4  ? -2.395  -17.971 11.659  1.00 38.35  ? 4   DG  B "H2'"  1 
ATOM   1507 H  "H2''" . DG  B 2 4  ? -0.920  -17.451 11.345  1.00 38.35  ? 4   DG  B "H2''" 1 
ATOM   1508 H  "H1'"  . DG  B 2 4  ? -0.145  -18.084 13.348  1.00 42.77  ? 4   DG  B "H1'"  1 
ATOM   1509 H  H8     . DG  B 2 4  ? -3.285  -19.943 12.841  1.00 44.70  ? 4   DG  B H8     1 
ATOM   1510 H  H1     . DG  B 2 4  ? 1.605   -23.542 13.568  1.00 49.40  ? 4   DG  B H1     1 
ATOM   1511 H  H21    . DG  B 2 4  ? 3.395   -20.836 13.910  1.00 39.64  ? 4   DG  B H21    1 
ATOM   1512 H  H22    . DG  B 2 4  ? 3.427   -22.326 13.888  1.00 39.64  ? 4   DG  B H22    1 
ATOM   1513 P  P      . DC  B 2 5  ? -0.498  -14.691 10.985  1.00 37.14  ? 5   DC  B P      1 
ATOM   1514 O  OP1    . DC  B 2 5  ? 0.263   -13.436 11.168  1.00 42.52  ? 5   DC  B OP1    1 
ATOM   1515 O  OP2    . DC  B 2 5  ? -1.699  -14.715 10.121  1.00 30.76  ? 5   DC  B OP2    1 
ATOM   1516 O  "O5'"  . DC  B 2 5  ? 0.519   -15.807 10.474  1.00 42.86  ? 5   DC  B "O5'"  1 
ATOM   1517 C  "C5'"  . DC  B 2 5  ? 1.609   -16.167 11.292  1.00 38.24  ? 5   DC  B "C5'"  1 
ATOM   1518 C  "C4'"  . DC  B 2 5  ? 2.306   -17.406 10.768  1.00 38.23  ? 5   DC  B "C4'"  1 
ATOM   1519 O  "O4'"  . DC  B 2 5  ? 1.471   -18.560 10.986  1.00 31.91  ? 5   DC  B "O4'"  1 
ATOM   1520 C  "C3'"  . DC  B 2 5  ? 2.612   -17.400 9.264   1.00 40.48  ? 5   DC  B "C3'"  1 
ATOM   1521 O  "O3'"  . DC  B 2 5  ? 4.015   -17.260 9.039   1.00 45.24  ? 5   DC  B "O3'"  1 
ATOM   1522 C  "C2'"  . DC  B 2 5  ? 2.076   -18.748 8.761   1.00 37.16  ? 5   DC  B "C2'"  1 
ATOM   1523 C  "C1'"  . DC  B 2 5  ? 1.841   -19.525 10.047  1.00 30.65  ? 5   DC  B "C1'"  1 
ATOM   1524 N  N1     . DC  B 2 5  ? 0.773   -20.550 9.964   1.00 35.33  ? 5   DC  B N1     1 
ATOM   1525 C  C2     . DC  B 2 5  ? 1.112   -21.905 9.994   1.00 37.95  ? 5   DC  B C2     1 
ATOM   1526 O  O2     . DC  B 2 5  ? 2.302   -22.227 10.083  1.00 40.47  ? 5   DC  B O2     1 
ATOM   1527 N  N3     . DC  B 2 5  ? 0.126   -22.831 9.921   1.00 33.70  ? 5   DC  B N3     1 
ATOM   1528 C  C4     . DC  B 2 5  ? -1.144  -22.442 9.825   1.00 37.15  ? 5   DC  B C4     1 
ATOM   1529 N  N4     . DC  B 2 5  ? -2.083  -23.388 9.755   1.00 42.77  ? 5   DC  B N4     1 
ATOM   1530 C  C5     . DC  B 2 5  ? -1.509  -21.065 9.798   1.00 37.38  ? 5   DC  B C5     1 
ATOM   1531 C  C6     . DC  B 2 5  ? -0.528  -20.162 9.871   1.00 40.64  ? 5   DC  B C6     1 
ATOM   1532 H  "H5'"  . DC  B 2 5  ? 1.288   -16.340 12.191  1.00 45.83  ? 5   DC  B "H5'"  1 
ATOM   1533 H  "H5''" . DC  B 2 5  ? 2.243   -15.433 11.317  1.00 45.83  ? 5   DC  B "H5''" 1 
ATOM   1534 H  "H4'"  . DC  B 2 5  ? 3.137   -17.525 11.255  1.00 45.83  ? 5   DC  B "H4'"  1 
ATOM   1535 H  "H3'"  . DC  B 2 5  ? 2.134   -16.674 8.834   1.00 48.53  ? 5   DC  B "H3'"  1 
ATOM   1536 H  "H2'"  . DC  B 2 5  ? 1.245   -18.627 8.276   1.00 44.55  ? 5   DC  B "H2'"  1 
ATOM   1537 H  "H2''" . DC  B 2 5  ? 2.736   -19.192 8.209   1.00 44.55  ? 5   DC  B "H2''" 1 
ATOM   1538 H  "H1'"  . DC  B 2 5  ? 2.670   -19.942 10.326  1.00 36.73  ? 5   DC  B "H1'"  1 
ATOM   1539 H  H41    . DC  B 2 5  ? -2.912  -23.167 9.692   1.00 51.27  ? 5   DC  B H41    1 
ATOM   1540 H  H42    . DC  B 2 5  ? -1.859  -24.218 9.773   1.00 51.27  ? 5   DC  B H42    1 
ATOM   1541 H  H5     . DC  B 2 5  ? -2.399  -20.804 9.730   1.00 44.80  ? 5   DC  B H5     1 
ATOM   1542 H  H6     . DC  B 2 5  ? -0.736  -19.256 9.854   1.00 48.72  ? 5   DC  B H6     1 
ATOM   1543 P  P      . DG  B 2 6  ? 4.563   -16.689 7.642   1.00 46.85  ? 6   DG  B P      1 
ATOM   1544 O  OP1    . DG  B 2 6  ? 5.522   -15.611 7.965   1.00 39.84  ? 6   DG  B OP1    1 
ATOM   1545 O  OP2    . DG  B 2 6  ? 3.399   -16.407 6.771   1.00 53.05  ? 6   DG  B OP2    1 
ATOM   1546 O  "O5'"  . DG  B 2 6  ? 5.357   -17.922 7.007   1.00 46.82  ? 6   DG  B "O5'"  1 
ATOM   1547 C  "C5'"  . DG  B 2 6  ? 6.508   -18.433 7.655   1.00 42.57  ? 6   DG  B "C5'"  1 
ATOM   1548 C  "C4'"  . DG  B 2 6  ? 6.802   -19.852 7.202   1.00 42.39  ? 6   DG  B "C4'"  1 
ATOM   1549 O  "O4'"  . DG  B 2 6  ? 5.708   -20.714 7.594   1.00 43.76  ? 6   DG  B "O4'"  1 
ATOM   1550 C  "C3'"  . DG  B 2 6  ? 6.963   -20.025 5.688   1.00 44.84  ? 6   DG  B "C3'"  1 
ATOM   1551 O  "O3'"  . DG  B 2 6  ? 8.269   -20.490 5.378   1.00 43.55  ? 6   DG  B "O3'"  1 
ATOM   1552 C  "C2'"  . DG  B 2 6  ? 5.879   -21.033 5.292   1.00 44.17  ? 6   DG  B "C2'"  1 
ATOM   1553 C  "C1'"  . DG  B 2 6  ? 5.515   -21.694 6.609   1.00 45.47  ? 6   DG  B "C1'"  1 
ATOM   1554 N  N9     . DG  B 2 6  ? 4.132   -22.157 6.673   1.00 46.89  ? 6   DG  B N9     1 
ATOM   1555 C  C8     . DG  B 2 6  ? 2.999   -21.381 6.652   1.00 48.25  ? 6   DG  B C8     1 
ATOM   1556 N  N7     . DG  B 2 6  ? 1.894   -22.072 6.725   1.00 44.63  ? 6   DG  B N7     1 
ATOM   1557 C  C5     . DG  B 2 6  ? 2.324   -23.389 6.806   1.00 43.00  ? 6   DG  B C5     1 
ATOM   1558 C  C6     . DG  B 2 6  ? 1.578   -24.583 6.908   1.00 41.06  ? 6   DG  B C6     1 
ATOM   1559 O  O6     . DG  B 2 6  ? 0.349   -24.717 6.948   1.00 38.56  ? 6   DG  B O6     1 
ATOM   1560 N  N1     . DG  B 2 6  ? 2.405   -25.702 6.964   1.00 42.59  ? 6   DG  B N1     1 
ATOM   1561 C  C2     . DG  B 2 6  ? 3.778   -25.668 6.926   1.00 38.82  ? 6   DG  B C2     1 
ATOM   1562 N  N2     . DG  B 2 6  ? 4.405   -26.851 6.994   1.00 44.21  ? 6   DG  B N2     1 
ATOM   1563 N  N3     . DG  B 2 6  ? 4.489   -24.555 6.832   1.00 39.35  ? 6   DG  B N3     1 
ATOM   1564 C  C4     . DG  B 2 6  ? 3.699   -23.458 6.775   1.00 44.56  ? 6   DG  B C4     1 
ATOM   1565 H  "H5'"  . DG  B 2 6  ? 6.362   -18.429 8.614   1.00 51.04  ? 6   DG  B "H5'"  1 
ATOM   1566 H  "H5''" . DG  B 2 6  ? 7.268   -17.868 7.446   1.00 51.04  ? 6   DG  B "H5''" 1 
ATOM   1567 H  "H4'"  . DG  B 2 6  ? 7.612   -20.157 7.639   1.00 50.82  ? 6   DG  B "H4'"  1 
ATOM   1568 H  "H3'"  . DG  B 2 6  ? 6.802   -19.178 5.243   1.00 53.76  ? 6   DG  B "H3'"  1 
ATOM   1569 H  "H2'"  . DG  B 2 6  ? 5.110   -20.577 4.915   1.00 52.95  ? 6   DG  B "H2'"  1 
ATOM   1570 H  "H2''" . DG  B 2 6  ? 6.231   -21.687 4.668   1.00 52.95  ? 6   DG  B "H2''" 1 
ATOM   1571 H  "H1'"  . DG  B 2 6  ? 6.114   -22.439 6.773   1.00 54.51  ? 6   DG  B "H1'"  1 
ATOM   1572 H  H8     . DG  B 2 6  ? 3.017   -20.454 6.585   1.00 57.85  ? 6   DG  B H8     1 
ATOM   1573 H  H1     . DG  B 2 6  ? 2.028   -26.472 7.027   1.00 51.06  ? 6   DG  B H1     1 
ATOM   1574 H  H21    . DG  B 2 6  ? 5.264   -26.884 6.974   1.00 53.00  ? 6   DG  B H21    1 
ATOM   1575 H  H22    . DG  B 2 6  ? 3.948   -27.577 7.057   1.00 53.00  ? 6   DG  B H22    1 
ATOM   1576 P  P      . DT  B 2 7  ? 8.741   -20.627 3.849   1.00 48.16  ? 7   DT  B P      1 
ATOM   1577 O  OP1    . DT  B 2 7  ? 10.219  -20.578 3.849   1.00 51.02  ? 7   DT  B OP1    1 
ATOM   1578 O  OP2    . DT  B 2 7  ? 7.962   -19.677 3.024   1.00 44.12  ? 7   DT  B OP2    1 
ATOM   1579 O  "O5'"  . DT  B 2 7  ? 8.290   -22.103 3.448   1.00 37.95  ? 7   DT  B "O5'"  1 
ATOM   1580 C  "C5'"  . DT  B 2 7  ? 8.738   -23.195 4.219   1.00 39.12  ? 7   DT  B "C5'"  1 
ATOM   1581 C  "C4'"  . DT  B 2 7  ? 8.060   -24.477 3.791   1.00 38.07  ? 7   DT  B "C4'"  1 
ATOM   1582 O  "O4'"  . DT  B 2 7  ? 6.674   -24.433 4.156   1.00 39.14  ? 7   DT  B "O4'"  1 
ATOM   1583 C  "C3'"  . DT  B 2 7  ? 8.066   -24.741 2.290   1.00 47.40  ? 7   DT  B "C3'"  1 
ATOM   1584 O  "O3'"  . DT  B 2 7  ? 9.135   -25.618 1.948   1.00 52.06  ? 7   DT  B "O3'"  1 
ATOM   1585 C  "C2'"  . DT  B 2 7  ? 6.682   -25.358 2.005   1.00 45.39  ? 7   DT  B "C2'"  1 
ATOM   1586 C  "C1'"  . DT  B 2 7  ? 5.991   -25.368 3.369   1.00 42.78  ? 7   DT  B "C1'"  1 
ATOM   1587 N  N1     . DT  B 2 7  ? 4.552   -24.995 3.333   1.00 41.12  ? 7   DT  B N1     1 
ATOM   1588 C  C2     . DT  B 2 7  ? 3.605   -25.988 3.356   1.00 43.96  ? 7   DT  B C2     1 
ATOM   1589 O  O2     . DT  B 2 7  ? 3.883   -27.175 3.392   1.00 46.58  ? 7   DT  B O2     1 
ATOM   1590 N  N3     . DT  B 2 7  ? 2.311   -25.544 3.331   1.00 44.88  ? 7   DT  B N3     1 
ATOM   1591 C  C4     . DT  B 2 7  ? 1.877   -24.230 3.291   1.00 48.02  ? 7   DT  B C4     1 
ATOM   1592 O  O4     . DT  B 2 7  ? 0.686   -23.928 3.270   1.00 50.17  ? 7   DT  B O4     1 
ATOM   1593 C  C5     . DT  B 2 7  ? 2.923   -23.237 3.273   1.00 46.06  ? 7   DT  B C5     1 
ATOM   1594 C  C7     . DT  B 2 7  ? 2.572   -21.779 3.231   1.00 40.46  ? 7   DT  B C7     1 
ATOM   1595 C  C6     . DT  B 2 7  ? 4.198   -23.661 3.298   1.00 42.95  ? 7   DT  B C6     1 
ATOM   1596 H  "H5'"  . DT  B 2 7  ? 8.540   -23.027 5.154   1.00 46.90  ? 7   DT  B "H5'"  1 
ATOM   1597 H  "H5''" . DT  B 2 7  ? 9.697   -23.290 4.109   1.00 46.90  ? 7   DT  B "H5''" 1 
ATOM   1598 H  "H4'"  . DT  B 2 7  ? 8.482   -25.224 4.244   1.00 45.63  ? 7   DT  B "H4'"  1 
ATOM   1599 H  "H3'"  . DT  B 2 7  ? 8.159   -23.904 1.809   1.00 56.83  ? 7   DT  B "H3'"  1 
ATOM   1600 H  "H2'"  . DT  B 2 7  ? 6.187   -24.808 1.378   1.00 54.42  ? 7   DT  B "H2'"  1 
ATOM   1601 H  "H2''" . DT  B 2 7  ? 6.776   -26.262 1.666   1.00 54.42  ? 7   DT  B "H2''" 1 
ATOM   1602 H  "H1'"  . DT  B 2 7  ? 6.084   -26.248 3.767   1.00 51.28  ? 7   DT  B "H1'"  1 
ATOM   1603 H  H3     . DT  B 2 7  ? 1.700   -26.148 3.341   1.00 53.81  ? 7   DT  B H3     1 
ATOM   1604 H  H71    . DT  B 2 7  ? 1.619   -21.671 3.377   1.00 48.50  ? 7   DT  B H71    1 
ATOM   1605 H  H72    . DT  B 2 7  ? 3.060   -21.309 3.924   1.00 48.50  ? 7   DT  B H72    1 
ATOM   1606 H  H73    . DT  B 2 7  ? 2.810   -21.415 2.368   1.00 48.50  ? 7   DT  B H73    1 
ATOM   1607 H  H6     . DT  B 2 7  ? 4.876   -23.024 3.288   1.00 51.49  ? 7   DT  B H6     1 
ATOM   1608 P  P      . DG  B 2 8  ? 9.477   -25.920 0.410   1.00 51.98  ? 8   DG  B P      1 
ATOM   1609 O  OP1    . DG  B 2 8  ? 10.872  -26.406 0.363   1.00 55.48  ? 8   DG  B OP1    1 
ATOM   1610 O  OP2    . DG  B 2 8  ? 9.068   -24.749 -0.397  1.00 58.76  ? 8   DG  B OP2    1 
ATOM   1611 O  "O5'"  . DG  B 2 8  ? 8.487   -27.113 0.030   1.00 48.62  ? 8   DG  B "O5'"  1 
ATOM   1612 C  "C5'"  . DG  B 2 8  ? 8.484   -28.297 0.799   1.00 40.77  ? 8   DG  B "C5'"  1 
ATOM   1613 C  "C4'"  . DG  B 2 8  ? 7.444   -29.265 0.282   1.00 47.15  ? 8   DG  B "C4'"  1 
ATOM   1614 O  "O4'"  . DG  B 2 8  ? 6.116   -28.768 0.609   1.00 54.33  ? 8   DG  B "O4'"  1 
ATOM   1615 C  "C3'"  . DG  B 2 8  ? 7.462   -29.470 -1.234  1.00 56.71  ? 8   DG  B "C3'"  1 
ATOM   1616 O  "O3'"  . DG  B 2 8  ? 7.377   -30.852 -1.549  1.00 60.10  ? 8   DG  B "O3'"  1 
ATOM   1617 C  "C2'"  . DG  B 2 8  ? 6.248   -28.686 -1.723  1.00 61.24  ? 8   DG  B "C2'"  1 
ATOM   1618 C  "C1'"  . DG  B 2 8  ? 5.298   -28.796 -0.544  1.00 61.83  ? 8   DG  B "C1'"  1 
ATOM   1619 N  N9     . DG  B 2 8  ? 4.324   -27.713 -0.449  1.00 54.82  ? 8   DG  B N9     1 
ATOM   1620 C  C8     . DG  B 2 8  ? 4.575   -26.367 -0.538  1.00 55.22  ? 8   DG  B C8     1 
ATOM   1621 N  N7     . DG  B 2 8  ? 3.509   -25.630 -0.395  1.00 53.75  ? 8   DG  B N7     1 
ATOM   1622 C  C5     . DG  B 2 8  ? 2.487   -26.545 -0.189  1.00 51.44  ? 8   DG  B C5     1 
ATOM   1623 C  C6     . DG  B 2 8  ? 1.105   -26.332 0.029   1.00 46.40  ? 8   DG  B C6     1 
ATOM   1624 O  O6     . DG  B 2 8  ? 0.492   -25.254 0.084   1.00 42.97  ? 8   DG  B O6     1 
ATOM   1625 N  N1     . DG  B 2 8  ? 0.419   -27.534 0.191   1.00 41.52  ? 8   DG  B N1     1 
ATOM   1626 C  C2     . DG  B 2 8  ? 0.996   -28.781 0.146   1.00 42.61  ? 8   DG  B C2     1 
ATOM   1627 N  N2     . DG  B 2 8  ? 0.170   -29.823 0.326   1.00 45.08  ? 8   DG  B N2     1 
ATOM   1628 N  N3     . DG  B 2 8  ? 2.292   -28.994 -0.057  1.00 44.62  ? 8   DG  B N3     1 
ATOM   1629 C  C4     . DG  B 2 8  ? 2.972   -27.833 -0.216  1.00 50.03  ? 8   DG  B C4     1 
ATOM   1630 H  "H5'"  . DG  B 2 8  ? 8.285   -28.078 1.723   1.00 48.88  ? 8   DG  B "H5'"  1 
ATOM   1631 H  "H5''" . DG  B 2 8  ? 9.359   -28.712 0.750   1.00 48.88  ? 8   DG  B "H5''" 1 
ATOM   1632 H  "H4'"  . DG  B 2 8  ? 7.573   -30.123 0.715   1.00 56.53  ? 8   DG  B "H4'"  1 
ATOM   1633 H  "H3'"  . DG  B 2 8  ? 8.273   -29.093 -1.609  1.00 68.01  ? 8   DG  B "H3'"  1 
ATOM   1634 H  "H2'"  . DG  B 2 8  ? 6.482   -27.761 -1.894  1.00 73.43  ? 8   DG  B "H2'"  1 
ATOM   1635 H  "H2''" . DG  B 2 8  ? 5.866   -29.099 -2.513  1.00 73.43  ? 8   DG  B "H2''" 1 
ATOM   1636 H  "H1'"  . DG  B 2 8  ? 4.831   -29.645 -0.586  1.00 74.14  ? 8   DG  B "H1'"  1 
ATOM   1637 H  H8     . DG  B 2 8  ? 5.422   -26.015 -0.690  1.00 66.21  ? 8   DG  B H8     1 
ATOM   1638 H  H1     . DG  B 2 8  ? -0.429  -27.493 0.326   1.00 49.77  ? 8   DG  B H1     1 
ATOM   1639 H  H21    . DG  B 2 8  ? 0.479   -30.625 0.305   1.00 54.05  ? 8   DG  B H21    1 
ATOM   1640 H  H22    . DG  B 2 8  ? -0.668  -29.689 0.462   1.00 54.05  ? 8   DG  B H22    1 
ATOM   1641 P  P      . DG  B 2 9  ? 7.732   -31.369 -3.026  1.00 67.54  ? 9   DG  B P      1 
ATOM   1642 O  OP1    . DG  B 2 9  ? 8.927   -32.233 -2.907  1.00 72.88  ? 9   DG  B OP1    1 
ATOM   1643 O  OP2    . DG  B 2 9  ? 7.747   -30.198 -3.931  1.00 65.43  ? 9   DG  B OP2    1 
ATOM   1644 O  "O5'"  . DG  B 2 9  ? 6.473   -32.270 -3.426  1.00 66.66  ? 9   DG  B "O5'"  1 
ATOM   1645 C  "C5'"  . DG  B 2 9  ? 6.072   -33.340 -2.583  1.00 62.75  ? 9   DG  B "C5'"  1 
ATOM   1646 C  "C4'"  . DG  B 2 9  ? 4.677   -33.813 -2.941  1.00 54.42  ? 9   DG  B "C4'"  1 
ATOM   1647 O  "O4'"  . DG  B 2 9  ? 3.716   -32.777 -2.599  1.00 53.75  ? 9   DG  B "O4'"  1 
ATOM   1648 C  "C3'"  . DG  B 2 9  ? 4.469   -34.122 -4.422  1.00 51.01  ? 9   DG  B "C3'"  1 
ATOM   1649 O  "O3'"  . DG  B 2 9  ? 3.756   -35.339 -4.586  1.00 48.10  ? 9   DG  B "O3'"  1 
ATOM   1650 C  "C2'"  . DG  B 2 9  ? 3.693   -32.917 -4.944  1.00 51.08  ? 9   DG  B "C2'"  1 
ATOM   1651 C  "C1'"  . DG  B 2 9  ? 2.923   -32.448 -3.721  1.00 49.85  ? 9   DG  B "C1'"  1 
ATOM   1652 N  N9     . DG  B 2 9  ? 2.662   -31.009 -3.702  1.00 48.23  ? 9   DG  B N9     1 
ATOM   1653 C  C8     . DG  B 2 9  ? 3.574   -30.000 -3.904  1.00 47.15  ? 9   DG  B C8     1 
ATOM   1654 N  N7     . DG  B 2 9  ? 3.055   -28.806 -3.824  1.00 41.79  ? 9   DG  B N7     1 
ATOM   1655 C  C5     . DG  B 2 9  ? 1.715   -29.036 -3.544  1.00 44.64  ? 9   DG  B C5     1 
ATOM   1656 C  C6     . DG  B 2 9  ? 0.657   -28.120 -3.348  1.00 44.83  ? 9   DG  B C6     1 
ATOM   1657 O  O6     . DG  B 2 9  ? 0.697   -26.883 -3.382  1.00 44.01  ? 9   DG  B O6     1 
ATOM   1658 N  N1     . DG  B 2 9  ? -0.546  -28.769 -3.088  1.00 44.92  ? 9   DG  B N1     1 
ATOM   1659 C  C2     . DG  B 2 9  ? -0.707  -30.131 -3.028  1.00 45.99  ? 9   DG  B C2     1 
ATOM   1660 N  N2     . DG  B 2 9  ? -1.946  -30.571 -2.766  1.00 48.22  ? 9   DG  B N2     1 
ATOM   1661 N  N3     . DG  B 2 9  ? 0.277   -31.003 -3.211  1.00 50.53  ? 9   DG  B N3     1 
ATOM   1662 C  C4     . DG  B 2 9  ? 1.456   -30.386 -3.465  1.00 49.28  ? 9   DG  B C4     1 
ATOM   1663 H  "H5'"  . DG  B 2 9  ? 6.080   -33.040 -1.661  1.00 75.24  ? 9   DG  B "H5'"  1 
ATOM   1664 H  "H5''" . DG  B 2 9  ? 6.695   -34.077 -2.684  1.00 75.24  ? 9   DG  B "H5''" 1 
ATOM   1665 H  "H4'"  . DG  B 2 9  ? 4.475   -34.609 -2.425  1.00 65.25  ? 9   DG  B "H4'"  1 
ATOM   1666 H  "H3'"  . DG  B 2 9  ? 5.328   -34.179 -4.869  1.00 61.16  ? 9   DG  B "H3'"  1 
ATOM   1667 H  "H2'"  . DG  B 2 9  ? 4.301   -32.227 -5.253  1.00 61.25  ? 9   DG  B "H2'"  1 
ATOM   1668 H  "H2''" . DG  B 2 9  ? 3.084   -33.182 -5.651  1.00 61.25  ? 9   DG  B "H2''" 1 
ATOM   1669 H  "H1'"  . DG  B 2 9  ? 2.081   -32.927 -3.669  1.00 59.76  ? 9   DG  B "H1'"  1 
ATOM   1670 H  H8     . DG  B 2 9  ? 4.473   -30.154 -4.086  1.00 56.53  ? 9   DG  B H8     1 
ATOM   1671 H  H1     . DG  B 2 9  ? -1.241  -28.280 -2.957  1.00 53.86  ? 9   DG  B H1     1 
ATOM   1672 H  H21    . DG  B 2 9  ? -2.101  -31.415 -2.717  1.00 57.81  ? 9   DG  B H21    1 
ATOM   1673 H  H22    . DG  B 2 9  ? -2.586  -30.009 -2.647  1.00 57.81  ? 9   DG  B H22    1 
ATOM   1674 P  P      . DC  B 2 10 ? 3.557   -35.962 -6.052  1.00 51.23  ? 10  DC  B P      1 
ATOM   1675 O  OP1    . DC  B 2 10 ? 3.356   -37.419 -5.904  1.00 49.57  ? 10  DC  B OP1    1 
ATOM   1676 O  OP2    . DC  B 2 10 ? 4.651   -35.451 -6.907  1.00 52.03  ? 10  DC  B OP2    1 
ATOM   1677 O  "O5'"  . DC  B 2 10 ? 2.185   -35.315 -6.556  1.00 46.74  ? 10  DC  B "O5'"  1 
ATOM   1678 C  "C5'"  . DC  B 2 10 ? 0.969   -35.668 -5.918  1.00 43.57  ? 10  DC  B "C5'"  1 
ATOM   1679 C  "C4'"  . DC  B 2 10 ? -0.179  -34.806 -6.406  1.00 48.02  ? 10  DC  B "C4'"  1 
ATOM   1680 O  "O4'"  . DC  B 2 10 ? -0.070  -33.485 -5.846  1.00 41.91  ? 10  DC  B "O4'"  1 
ATOM   1681 C  "C3'"  . DC  B 2 10 ? -0.229  -34.568 -7.906  1.00 54.46  ? 10  DC  B "C3'"  1 
ATOM   1682 O  "O3'"  . DC  B 2 10 ? -0.890  -35.640 -8.575  1.00 53.98  ? 10  DC  B "O3'"  1 
ATOM   1683 C  "C2'"  . DC  B 2 10 ? -0.996  -33.246 -8.019  1.00 56.40  ? 10  DC  B "C2'"  1 
ATOM   1684 C  "C1'"  . DC  B 2 10 ? -0.844  -32.602 -6.632  1.00 57.57  ? 10  DC  B "C1'"  1 
ATOM   1685 N  N1     . DC  B 2 10 ? -0.171  -31.278 -6.665  1.00 50.06  ? 10  DC  B N1     1 
ATOM   1686 C  C2     . DC  B 2 10 ? -0.930  -30.110 -6.546  1.00 43.34  ? 10  DC  B C2     1 
ATOM   1687 O  O2     . DC  B 2 10 ? -2.155  -30.198 -6.406  1.00 42.06  ? 10  DC  B O2     1 
ATOM   1688 N  N3     . DC  B 2 10 ? -0.300  -28.913 -6.583  1.00 42.29  ? 10  DC  B N3     1 
ATOM   1689 C  C4     . DC  B 2 10 ? 1.023   -28.862 -6.737  1.00 50.61  ? 10  DC  B C4     1 
ATOM   1690 N  N4     . DC  B 2 10 ? 1.604   -27.659 -6.768  1.00 57.45  ? 10  DC  B N4     1 
ATOM   1691 C  C5     . DC  B 2 10 ? 1.811   -30.042 -6.861  1.00 54.33  ? 10  DC  B C5     1 
ATOM   1692 C  C6     . DC  B 2 10 ? 1.178   -31.215 -6.821  1.00 54.30  ? 10  DC  B C6     1 
ATOM   1693 H  "H5'"  . DC  B 2 10 ? 1.068   -35.552 -4.960  1.00 52.23  ? 10  DC  B "H5'"  1 
ATOM   1694 H  "H5''" . DC  B 2 10 ? 0.770   -36.598 -6.107  1.00 52.23  ? 10  DC  B "H5''" 1 
ATOM   1695 H  "H4'"  . DC  B 2 10 ? -1.017  -35.203 -6.120  1.00 57.57  ? 10  DC  B "H4'"  1 
ATOM   1696 H  "H3'"  . DC  B 2 10 ? 0.669   -34.461 -8.255  1.00 65.30  ? 10  DC  B "H3'"  1 
ATOM   1697 H  "HO3'" . DC  B 2 10 ? -1.583  -35.490 -9.025  1.00 64.73  ? 10  DC  B "HO3'" 1 
ATOM   1698 H  "H2'"  . DC  B 2 10 ? -0.600  -32.681 -8.700  1.00 67.62  ? 10  DC  B "H2'"  1 
ATOM   1699 H  "H2''" . DC  B 2 10 ? -1.931  -33.412 -8.215  1.00 67.62  ? 10  DC  B "H2''" 1 
ATOM   1700 H  "H1'"  . DC  B 2 10 ? -1.721  -32.505 -6.229  1.00 69.03  ? 10  DC  B "H1'"  1 
ATOM   1701 H  H41    . DC  B 2 10 ? 2.456   -27.595 -6.866  1.00 68.89  ? 10  DC  B H41    1 
ATOM   1702 H  H42    . DC  B 2 10 ? 1.126   -26.948 -6.690  1.00 68.89  ? 10  DC  B H42    1 
ATOM   1703 H  H5     . DC  B 2 10 ? 2.734   -29.996 -6.967  1.00 65.14  ? 10  DC  B H5     1 
ATOM   1704 H  H6     . DC  B 2 10 ? 1.667   -32.002 -6.902  1.00 65.11  ? 10  DC  B H6     1 
ATOM   1705 O  "O5'"  . DG  C 3 1  ? -6.402  -20.065 -8.375  1.00 63.08  ? 1   DG  C "O5'"  1 
ATOM   1706 C  "C5'"  . DG  C 3 1  ? -6.649  -20.032 -6.972  1.00 57.94  ? 1   DG  C "C5'"  1 
ATOM   1707 C  "C4'"  . DG  C 3 1  ? -7.156  -21.374 -6.481  1.00 48.13  ? 1   DG  C "C4'"  1 
ATOM   1708 O  "O4'"  . DG  C 3 1  ? -6.196  -22.406 -6.838  1.00 48.82  ? 1   DG  C "O4'"  1 
ATOM   1709 C  "C3'"  . DG  C 3 1  ? -7.350  -21.478 -4.971  1.00 45.76  ? 1   DG  C "C3'"  1 
ATOM   1710 O  "O3'"  . DG  C 3 1  ? -8.519  -22.224 -4.667  1.00 47.80  ? 1   DG  C "O3'"  1 
ATOM   1711 C  "C2'"  . DG  C 3 1  ? -6.079  -22.166 -4.498  1.00 44.50  ? 1   DG  C "C2'"  1 
ATOM   1712 C  "C1'"  . DG  C 3 1  ? -5.710  -23.051 -5.677  1.00 45.13  ? 1   DG  C "C1'"  1 
ATOM   1713 N  N9     . DG  C 3 1  ? -4.271  -23.259 -5.821  1.00 44.21  ? 1   DG  C N9     1 
ATOM   1714 C  C8     . DG  C 3 1  ? -3.297  -22.291 -5.878  1.00 43.28  ? 1   DG  C C8     1 
ATOM   1715 N  N7     . DG  C 3 1  ? -2.093  -22.773 -6.003  1.00 42.94  ? 1   DG  C N7     1 
ATOM   1716 C  C5     . DG  C 3 1  ? -2.278  -24.149 -6.032  1.00 43.63  ? 1   DG  C C5     1 
ATOM   1717 C  C6     . DG  C 3 1  ? -1.333  -25.191 -6.155  1.00 43.90  ? 1   DG  C C6     1 
ATOM   1718 O  O6     . DG  C 3 1  ? -0.103  -25.101 -6.261  1.00 43.60  ? 1   DG  C O6     1 
ATOM   1719 N  N1     . DG  C 3 1  ? -1.942  -26.444 -6.143  1.00 47.80  ? 1   DG  C N1     1 
ATOM   1720 C  C2     . DG  C 3 1  ? -3.294  -26.659 -6.026  1.00 45.59  ? 1   DG  C C2     1 
ATOM   1721 N  N2     . DG  C 3 1  ? -3.695  -27.936 -6.034  1.00 46.75  ? 1   DG  C N2     1 
ATOM   1722 N  N3     . DG  C 3 1  ? -4.190  -25.690 -5.910  1.00 45.44  ? 1   DG  C N3     1 
ATOM   1723 C  C4     . DG  C 3 1  ? -3.613  -24.465 -5.920  1.00 44.41  ? 1   DG  C C4     1 
ATOM   1724 H  "H5'"  . DG  C 3 1  ? -7.313  -19.351 -6.781  1.00 69.48  ? 1   DG  C "H5'"  1 
ATOM   1725 H  "H5''" . DG  C 3 1  ? -5.826  -19.813 -6.508  1.00 69.48  ? 1   DG  C "H5''" 1 
ATOM   1726 H  "H4'"  . DG  C 3 1  ? -8.000  -21.568 -6.918  1.00 57.70  ? 1   DG  C "H4'"  1 
ATOM   1727 H  "H3'"  . DG  C 3 1  ? -7.411  -20.591 -4.583  1.00 54.86  ? 1   DG  C "H3'"  1 
ATOM   1728 H  "H2'"  . DG  C 3 1  ? -5.382  -21.514 -4.326  1.00 53.34  ? 1   DG  C "H2'"  1 
ATOM   1729 H  "H2''" . DG  C 3 1  ? -6.251  -22.702 -3.709  1.00 53.34  ? 1   DG  C "H2''" 1 
ATOM   1730 H  "H1'"  . DG  C 3 1  ? -6.149  -23.910 -5.581  1.00 54.10  ? 1   DG  C "H1'"  1 
ATOM   1731 H  H8     . DG  C 3 1  ? -3.479  -21.380 -5.827  1.00 51.88  ? 1   DG  C H8     1 
ATOM   1732 H  H1     . DG  C 3 1  ? -1.434  -27.134 -6.212  1.00 57.31  ? 1   DG  C H1     1 
ATOM   1733 H  H21    . DG  C 3 1  ? -4.531  -28.125 -5.966  1.00 56.04  ? 1   DG  C H21    1 
ATOM   1734 H  H22    . DG  C 3 1  ? -3.116  -28.568 -6.107  1.00 56.04  ? 1   DG  C H22    1 
ATOM   1735 H  "HO5'" . DG  C 3 1  ? -6.031  -20.735 -8.720  1.00 75.65  ? 1   DG  C "HO5'" 1 
ATOM   1736 P  P      . DC  C 3 2  ? -8.935  -22.501 -3.141  1.00 62.92  ? 2   DC  C P      1 
ATOM   1737 O  OP1    . DC  C 3 2  ? -10.397 -22.290 -3.028  1.00 65.45  ? 2   DC  C OP1    1 
ATOM   1738 O  OP2    . DC  C 3 2  ? -8.008  -21.751 -2.266  1.00 61.56  ? 2   DC  C OP2    1 
ATOM   1739 O  "O5'"  . DC  C 3 2  ? -8.639  -24.058 -2.952  1.00 59.87  ? 2   DC  C "O5'"  1 
ATOM   1740 C  "C5'"  . DC  C 3 2  ? -9.151  -24.987 -3.896  1.00 62.68  ? 2   DC  C "C5'"  1 
ATOM   1741 C  "C4'"  . DC  C 3 2  ? -8.630  -26.381 -3.620  1.00 61.76  ? 2   DC  C "C4'"  1 
ATOM   1742 O  "O4'"  . DC  C 3 2  ? -7.210  -26.421 -3.900  1.00 55.74  ? 2   DC  C "O4'"  1 
ATOM   1743 C  "C3'"  . DC  C 3 2  ? -8.807  -26.846 -2.174  1.00 61.36  ? 2   DC  C "C3'"  1 
ATOM   1744 O  "O3'"  . DC  C 3 2  ? -9.564  -28.046 -2.127  1.00 62.79  ? 2   DC  C "O3'"  1 
ATOM   1745 C  "C2'"  . DC  C 3 2  ? -7.382  -27.030 -1.645  1.00 58.92  ? 2   DC  C "C2'"  1 
ATOM   1746 C  "C1'"  . DC  C 3 2  ? -6.541  -27.153 -2.904  1.00 54.62  ? 2   DC  C "C1'"  1 
ATOM   1747 N  N1     . DC  C 3 2  ? -5.166  -26.600 -2.768  1.00 48.81  ? 2   DC  C N1     1 
ATOM   1748 C  C2     . DC  C 3 2  ? -4.061  -27.461 -2.765  1.00 44.96  ? 2   DC  C C2     1 
ATOM   1749 O  O2     . DC  C 3 2  ? -4.243  -28.681 -2.867  1.00 46.11  ? 2   DC  C O2     1 
ATOM   1750 N  N3     . DC  C 3 2  ? -2.819  -26.931 -2.648  1.00 43.76  ? 2   DC  C N3     1 
ATOM   1751 C  C4     . DC  C 3 2  ? -2.663  -25.611 -2.541  1.00 42.74  ? 2   DC  C C4     1 
ATOM   1752 N  N4     . DC  C 3 2  ? -1.419  -25.134 -2.428  1.00 43.07  ? 2   DC  C N4     1 
ATOM   1753 C  C5     . DC  C 3 2  ? -3.775  -24.721 -2.545  1.00 44.68  ? 2   DC  C C5     1 
ATOM   1754 C  C6     . DC  C 3 2  ? -4.994  -25.252 -2.661  1.00 45.12  ? 2   DC  C C6     1 
ATOM   1755 H  "H5'"  . DC  C 3 2  ? -8.881  -24.717 -4.788  1.00 75.16  ? 2   DC  C "H5'"  1 
ATOM   1756 H  "H5''" . DC  C 3 2  ? -10.120 -24.993 -3.844  1.00 75.16  ? 2   DC  C "H5''" 1 
ATOM   1757 H  "H4'"  . DC  C 3 2  ? -9.083  -27.006 -4.207  1.00 74.07  ? 2   DC  C "H4'"  1 
ATOM   1758 H  "H3'"  . DC  C 3 2  ? -9.257  -26.155 -1.663  1.00 73.58  ? 2   DC  C "H3'"  1 
ATOM   1759 H  "H2'"  . DC  C 3 2  ? -7.109  -26.257 -1.127  1.00 70.65  ? 2   DC  C "H2'"  1 
ATOM   1760 H  "H2''" . DC  C 3 2  ? -7.319  -27.838 -1.113  1.00 70.65  ? 2   DC  C "H2''" 1 
ATOM   1761 H  "H1'"  . DC  C 3 2  ? -6.491  -28.084 -3.169  1.00 65.50  ? 2   DC  C "H1'"  1 
ATOM   1762 H  H41    . DC  C 3 2  ? -1.288  -24.287 -2.357  1.00 51.63  ? 2   DC  C H41    1 
ATOM   1763 H  H42    . DC  C 3 2  ? -0.750  -25.674 -2.426  1.00 51.63  ? 2   DC  C H42    1 
ATOM   1764 H  H5     . DC  C 3 2  ? -3.656  -23.802 -2.470  1.00 53.57  ? 2   DC  C H5     1 
ATOM   1765 H  H6     . DC  C 3 2  ? -5.738  -24.694 -2.668  1.00 54.09  ? 2   DC  C H6     1 
ATOM   1766 P  P      . DC  C 3 3  ? -10.238 -28.519 -0.749  1.00 63.72  ? 3   DC  C P      1 
ATOM   1767 O  OP1    . DC  C 3 3  ? -11.296 -29.501 -1.072  1.00 74.35  ? 3   DC  C OP1    1 
ATOM   1768 O  OP2    . DC  C 3 3  ? -10.563 -27.308 0.035   1.00 65.11  ? 3   DC  C OP2    1 
ATOM   1769 O  "O5'"  . DC  C 3 3  ? -9.058  -29.284 -0.001  1.00 55.00  ? 3   DC  C "O5'"  1 
ATOM   1770 C  "C5'"  . DC  C 3 3  ? -8.456  -30.400 -0.620  1.00 50.87  ? 3   DC  C "C5'"  1 
ATOM   1771 C  "C4'"  . DC  C 3 3  ? -7.166  -30.773 0.075   1.00 49.61  ? 3   DC  C "C4'"  1 
ATOM   1772 O  "O4'"  . DC  C 3 3  ? -6.166  -29.775 -0.193  1.00 47.70  ? 3   DC  C "O4'"  1 
ATOM   1773 C  "C3'"  . DC  C 3 3  ? -7.257  -30.856 1.598   1.00 49.46  ? 3   DC  C "C3'"  1 
ATOM   1774 O  "O3'"  . DC  C 3 3  ? -7.313  -32.209 2.009   1.00 53.80  ? 3   DC  C "O3'"  1 
ATOM   1775 C  "C2'"  . DC  C 3 3  ? -5.993  -30.141 2.106   1.00 47.34  ? 3   DC  C "C2'"  1 
ATOM   1776 C  "C1'"  . DC  C 3 3  ? -5.212  -29.836 0.834   1.00 46.62  ? 3   DC  C "C1'"  1 
ATOM   1777 N  N1     . DC  C 3 3  ? -4.457  -28.549 0.866   1.00 44.83  ? 3   DC  C N1     1 
ATOM   1778 C  C2     . DC  C 3 3  ? -3.068  -28.557 0.689   1.00 43.92  ? 3   DC  C C2     1 
ATOM   1779 O  O2     . DC  C 3 3  ? -2.486  -29.635 0.520   1.00 44.61  ? 3   DC  C O2     1 
ATOM   1780 N  N3     . DC  C 3 3  ? -2.397  -27.381 0.709   1.00 42.56  ? 3   DC  C N3     1 
ATOM   1781 C  C4     . DC  C 3 3  ? -3.059  -26.240 0.893   1.00 42.05  ? 3   DC  C C4     1 
ATOM   1782 N  N4     . DC  C 3 3  ? -2.354  -25.105 0.909   1.00 40.89  ? 3   DC  C N4     1 
ATOM   1783 C  C5     . DC  C 3 3  ? -4.476  -26.211 1.073   1.00 42.98  ? 3   DC  C C5     1 
ATOM   1784 C  C6     . DC  C 3 3  ? -5.126  -27.376 1.051   1.00 44.37  ? 3   DC  C C6     1 
ATOM   1785 H  "H5'"  . DC  C 3 3  ? -8.268  -30.187 -1.548  1.00 60.99  ? 3   DC  C "H5'"  1 
ATOM   1786 H  "H5''" . DC  C 3 3  ? -9.067  -31.153 -0.583  1.00 60.99  ? 3   DC  C "H5''" 1 
ATOM   1787 H  "H4'"  . DC  C 3 3  ? -6.859  -31.626 -0.269  1.00 59.48  ? 3   DC  C "H4'"  1 
ATOM   1788 H  "H3'"  . DC  C 3 3  ? -8.047  -30.385 1.906   1.00 59.29  ? 3   DC  C "H3'"  1 
ATOM   1789 H  "H2'"  . DC  C 3 3  ? -6.229  -29.321 2.568   1.00 56.75  ? 3   DC  C "H2'"  1 
ATOM   1790 H  "H2''" . DC  C 3 3  ? -5.481  -30.725 2.687   1.00 56.75  ? 3   DC  C "H2''" 1 
ATOM   1791 H  "H1'"  . DC  C 3 3  ? -4.598  -30.565 0.655   1.00 55.89  ? 3   DC  C "H1'"  1 
ATOM   1792 H  H41    . DC  C 3 3  ? -2.753  -24.352 1.026   1.00 49.02  ? 3   DC  C H41    1 
ATOM   1793 H  H42    . DC  C 3 3  ? -1.501  -25.127 0.802   1.00 49.02  ? 3   DC  C H42    1 
ATOM   1794 H  H5     . DC  C 3 3  ? -4.929  -25.409 1.201   1.00 51.52  ? 3   DC  C H5     1 
ATOM   1795 H  H6     . DC  C 3 3  ? -6.049  -27.388 1.163   1.00 53.19  ? 3   DC  C H6     1 
ATOM   1796 P  P      . DA  C 3 4  ? -7.411  -32.576 3.566   1.00 64.13  ? 4   DA  C P      1 
ATOM   1797 O  OP1    . DA  C 3 4  ? -8.139  -33.859 3.677   1.00 69.49  ? 4   DA  C OP1    1 
ATOM   1798 O  OP2    . DA  C 3 4  ? -7.885  -31.378 4.294   1.00 68.23  ? 4   DA  C OP2    1 
ATOM   1799 O  "O5'"  . DA  C 3 4  ? -5.898  -32.832 3.977   1.00 60.80  ? 4   DA  C "O5'"  1 
ATOM   1800 C  "C5'"  . DA  C 3 4  ? -5.101  -33.693 3.195   1.00 58.54  ? 4   DA  C "C5'"  1 
ATOM   1801 C  "C4'"  . DA  C 3 4  ? -3.644  -33.538 3.561   1.00 56.03  ? 4   DA  C "C4'"  1 
ATOM   1802 O  "O4'"  . DA  C 3 4  ? -3.210  -32.205 3.206   1.00 52.89  ? 4   DA  C "O4'"  1 
ATOM   1803 C  "C3'"  . DA  C 3 4  ? -3.350  -33.711 5.053   1.00 60.19  ? 4   DA  C "C3'"  1 
ATOM   1804 O  "O3'"  . DA  C 3 4  ? -2.430  -34.770 5.263   1.00 68.72  ? 4   DA  C "O3'"  1 
ATOM   1805 C  "C2'"  . DA  C 3 4  ? -2.792  -32.360 5.501   1.00 53.81  ? 4   DA  C "C2'"  1 
ATOM   1806 C  "C1'"  . DA  C 3 4  ? -2.362  -31.700 4.205   1.00 50.17  ? 4   DA  C "C1'"  1 
ATOM   1807 N  N9     . DA  C 3 4  ? -2.475  -30.247 4.222   1.00 45.11  ? 4   DA  C N9     1 
ATOM   1808 C  C8     . DA  C 3 4  ? -3.591  -29.509 4.504   1.00 44.94  ? 4   DA  C C8     1 
ATOM   1809 N  N7     . DA  C 3 4  ? -3.396  -28.214 4.445   1.00 46.63  ? 4   DA  C N7     1 
ATOM   1810 C  C5     . DA  C 3 4  ? -2.061  -28.096 4.098   1.00 44.24  ? 4   DA  C C5     1 
ATOM   1811 C  C6     . DA  C 3 4  ? -1.235  -26.978 3.877   1.00 45.91  ? 4   DA  C C6     1 
ATOM   1812 N  N6     . DA  C 3 4  ? -1.663  -25.715 3.979   1.00 45.70  ? 4   DA  C N6     1 
ATOM   1813 N  N1     . DA  C 3 4  ? 0.052   -27.209 3.547   1.00 42.45  ? 4   DA  C N1     1 
ATOM   1814 C  C2     . DA  C 3 4  ? 0.476   -28.474 3.446   1.00 41.53  ? 4   DA  C C2     1 
ATOM   1815 N  N3     . DA  C 3 4  ? -0.205  -29.602 3.630   1.00 42.74  ? 4   DA  C N3     1 
ATOM   1816 C  C4     . DA  C 3 4  ? -1.480  -29.340 3.957   1.00 42.97  ? 4   DA  C C4     1 
ATOM   1817 H  "H5'"  . DA  C 3 4  ? -5.220  -33.477 2.257   1.00 70.19  ? 4   DA  C "H5'"  1 
ATOM   1818 H  "H5''" . DA  C 3 4  ? -5.374  -34.611 3.349   1.00 70.19  ? 4   DA  C "H5''" 1 
ATOM   1819 H  "H4'"  . DA  C 3 4  ? -3.122  -34.184 3.060   1.00 67.18  ? 4   DA  C "H4'"  1 
ATOM   1820 H  "H3'"  . DA  C 3 4  ? -4.175  -33.896 5.528   1.00 72.17  ? 4   DA  C "H3'"  1 
ATOM   1821 H  "H2'"  . DA  C 3 4  ? -3.481  -31.836 5.939   1.00 64.52  ? 4   DA  C "H2'"  1 
ATOM   1822 H  "H2''" . DA  C 3 4  ? -2.030  -32.483 6.089   1.00 64.52  ? 4   DA  C "H2''" 1 
ATOM   1823 H  "H1'"  . DA  C 3 4  ? -1.446  -31.949 4.005   1.00 60.15  ? 4   DA  C "H1'"  1 
ATOM   1824 H  H8     . DA  C 3 4  ? -4.411  -29.890 4.720   1.00 53.88  ? 4   DA  C H8     1 
ATOM   1825 H  H61    . DA  C 3 4  ? -1.120  -25.064 3.835   1.00 54.79  ? 4   DA  C H61    1 
ATOM   1826 H  H62    . DA  C 3 4  ? -2.481  -25.554 4.189   1.00 54.79  ? 4   DA  C H62    1 
ATOM   1827 H  H2     . DA  C 3 4  ? 1.371   -28.579 3.216   1.00 49.78  ? 4   DA  C H2     1 
ATOM   1828 P  P      . DC  C 3 5  ? -2.051  -35.215 6.757   1.00 71.19  ? 5   DC  C P      1 
ATOM   1829 O  OP1    . DC  C 3 5  ? -1.920  -36.688 6.765   1.00 72.28  ? 5   DC  C OP1    1 
ATOM   1830 O  OP2    . DC  C 3 5  ? -3.001  -34.546 7.676   1.00 75.23  ? 5   DC  C OP2    1 
ATOM   1831 O  "O5'"  . DC  C 3 5  ? -0.613  -34.561 6.990   1.00 62.35  ? 5   DC  C "O5'"  1 
ATOM   1832 C  "C5'"  . DC  C 3 5  ? 0.436   -34.819 6.071   1.00 56.57  ? 5   DC  C "C5'"  1 
ATOM   1833 C  "C4'"  . DC  C 3 5  ? 1.651   -33.972 6.391   1.00 52.00  ? 5   DC  C "C4'"  1 
ATOM   1834 O  "O4'"  . DC  C 3 5  ? 1.364   -32.588 6.079   1.00 49.95  ? 5   DC  C "O4'"  1 
ATOM   1835 C  "C3'"  . DC  C 3 5  ? 2.080   -34.003 7.860   1.00 51.54  ? 5   DC  C "C3'"  1 
ATOM   1836 O  "O3'"  . DC  C 3 5  ? 3.408   -34.480 7.978   1.00 53.67  ? 5   DC  C "O3'"  1 
ATOM   1837 C  "C2'"  . DC  C 3 5  ? 1.941   -32.557 8.340   1.00 47.27  ? 5   DC  C "C2'"  1 
ATOM   1838 C  "C1'"  . DC  C 3 5  ? 1.948   -31.757 7.049   1.00 43.99  ? 5   DC  C "C1'"  1 
ATOM   1839 N  N1     . DC  C 3 5  ? 1.167   -30.489 7.120   1.00 42.70  ? 5   DC  C N1     1 
ATOM   1840 C  C2     . DC  C 3 5  ? 1.826   -29.260 7.011   1.00 41.32  ? 5   DC  C C2     1 
ATOM   1841 O  O2     . DC  C 3 5  ? 3.053   -29.243 6.858   1.00 41.21  ? 5   DC  C O2     1 
ATOM   1842 N  N3     . DC  C 3 5  ? 1.098   -28.119 7.077   1.00 40.39  ? 5   DC  C N3     1 
ATOM   1843 C  C4     . DC  C 3 5  ? -0.224  -28.179 7.242   1.00 40.85  ? 5   DC  C C4     1 
ATOM   1844 N  N4     . DC  C 3 5  ? -0.898  -27.026 7.302   1.00 42.39  ? 5   DC  C N4     1 
ATOM   1845 C  C5     . DC  C 3 5  ? -0.912  -29.422 7.355   1.00 42.31  ? 5   DC  C C5     1 
ATOM   1846 C  C6     . DC  C 3 5  ? -0.186  -30.539 7.288   1.00 43.15  ? 5   DC  C C6     1 
ATOM   1847 H  "H5'"  . DC  C 3 5  ? 0.131   -34.614 5.173   1.00 67.83  ? 5   DC  C "H5'"  1 
ATOM   1848 H  "H5''" . DC  C 3 5  ? 0.679   -35.757 6.119   1.00 67.83  ? 5   DC  C "H5''" 1 
ATOM   1849 H  "H4'"  . DC  C 3 5  ? 2.393   -34.269 5.842   1.00 62.35  ? 5   DC  C "H4'"  1 
ATOM   1850 H  "H3'"  . DC  C 3 5  ? 1.480   -34.574 8.364   1.00 61.80  ? 5   DC  C "H3'"  1 
ATOM   1851 H  "H2'"  . DC  C 3 5  ? 1.104   -32.434 8.815   1.00 56.67  ? 5   DC  C "H2'"  1 
ATOM   1852 H  "H2''" . DC  C 3 5  ? 2.693   -32.309 8.899   1.00 56.67  ? 5   DC  C "H2''" 1 
ATOM   1853 H  "H1'"  . DC  C 3 5  ? 2.863   -31.562 6.796   1.00 52.73  ? 5   DC  C "H1'"  1 
ATOM   1854 H  H41    . DC  C 3 5  ? -1.752  -27.032 7.406   1.00 50.82  ? 5   DC  C H41    1 
ATOM   1855 H  H42    . DC  C 3 5  ? -0.478  -26.279 7.236   1.00 50.82  ? 5   DC  C H42    1 
ATOM   1856 H  H5     . DC  C 3 5  ? -1.834  -29.453 7.470   1.00 50.72  ? 5   DC  C H5     1 
ATOM   1857 H  H6     . DC  C 3 5  ? -0.608  -31.365 7.359   1.00 51.73  ? 5   DC  C H6     1 
ATOM   1858 P  P      . DG  C 3 6  ? 3.991   -34.880 9.417   1.00 57.01  ? 6   DG  C P      1 
ATOM   1859 O  OP1    . DG  C 3 6  ? 5.171   -35.746 9.193   1.00 58.58  ? 6   DG  C OP1    1 
ATOM   1860 O  OP2    . DG  C 3 6  ? 2.861   -35.364 10.241  1.00 58.07  ? 6   DG  C OP2    1 
ATOM   1861 O  "O5'"  . DG  C 3 6  ? 4.483   -33.488 10.022  1.00 48.42  ? 6   DG  C "O5'"  1 
ATOM   1862 C  "C5'"  . DG  C 3 6  ? 5.509   -32.766 9.370   1.00 48.42  ? 6   DG  C "C5'"  1 
ATOM   1863 C  "C4'"  . DG  C 3 6  ? 5.688   -31.395 9.991   1.00 47.49  ? 6   DG  C "C4'"  1 
ATOM   1864 O  "O4'"  . DG  C 3 6  ? 4.538   -30.578 9.690   1.00 52.44  ? 6   DG  C "O4'"  1 
ATOM   1865 C  "C3'"  . DG  C 3 6  ? 5.816   -31.395 11.515  1.00 52.40  ? 6   DG  C "C3'"  1 
ATOM   1866 O  "O3'"  . DG  C 3 6  ? 7.142   -31.069 11.897  1.00 54.68  ? 6   DG  C "O3'"  1 
ATOM   1867 C  "C2'"  . DG  C 3 6  ? 4.795   -30.355 12.000  1.00 45.68  ? 6   DG  C "C2'"  1 
ATOM   1868 C  "C1'"  . DG  C 3 6  ? 4.360   -29.650 10.726  1.00 49.42  ? 6   DG  C "C1'"  1 
ATOM   1869 N  N9     . DG  C 3 6  ? 2.965   -29.215 10.728  1.00 46.32  ? 6   DG  C N9     1 
ATOM   1870 C  C8     . DG  C 3 6  ? 1.851   -29.997 10.914  1.00 44.60  ? 6   DG  C C8     1 
ATOM   1871 N  N7     . DG  C 3 6  ? 0.733   -29.327 10.855  1.00 42.63  ? 6   DG  C N7     1 
ATOM   1872 C  C5     . DG  C 3 6  ? 1.133   -28.019 10.610  1.00 41.88  ? 6   DG  C C5     1 
ATOM   1873 C  C6     . DG  C 3 6  ? 0.362   -26.843 10.446  1.00 42.25  ? 6   DG  C C6     1 
ATOM   1874 O  O6     . DG  C 3 6  ? -0.868  -26.720 10.487  1.00 41.14  ? 6   DG  C O6     1 
ATOM   1875 N  N1     . DG  C 3 6  ? 1.164   -25.729 10.215  1.00 42.23  ? 6   DG  C N1     1 
ATOM   1876 C  C2     . DG  C 3 6  ? 2.538   -25.752 10.151  1.00 43.86  ? 6   DG  C C2     1 
ATOM   1877 N  N2     . DG  C 3 6  ? 3.142   -24.581 9.919   1.00 46.61  ? 6   DG  C N2     1 
ATOM   1878 N  N3     . DG  C 3 6  ? 3.269   -26.845 10.303  1.00 44.51  ? 6   DG  C N3     1 
ATOM   1879 C  C4     . DG  C 3 6  ? 2.503   -27.937 10.528  1.00 42.26  ? 6   DG  C C4     1 
ATOM   1880 H  "H5'"  . DG  C 3 6  ? 5.280   -32.664 8.433   1.00 58.05  ? 6   DG  C "H5'"  1 
ATOM   1881 H  "H5''" . DG  C 3 6  ? 6.341   -33.259 9.442   1.00 58.05  ? 6   DG  C "H5''" 1 
ATOM   1882 H  "H4'"  . DG  C 3 6  ? 6.477   -30.979 9.610   1.00 56.93  ? 6   DG  C "H4'"  1 
ATOM   1883 H  "H3'"  . DG  C 3 6  ? 5.581   -32.270 11.862  1.00 62.83  ? 6   DG  C "H3'"  1 
ATOM   1884 H  "H2'"  . DG  C 3 6  ? 4.039   -30.792 12.423  1.00 54.76  ? 6   DG  C "H2'"  1 
ATOM   1885 H  "H2''" . DG  C 3 6  ? 5.212   -29.727 12.610  1.00 54.76  ? 6   DG  C "H2''" 1 
ATOM   1886 H  "H1'"  . DG  C 3 6  ? 4.935   -28.884 10.572  1.00 59.25  ? 6   DG  C "H1'"  1 
ATOM   1887 H  H8     . DG  C 3 6  ? 1.890   -30.913 11.070  1.00 53.47  ? 6   DG  C H8     1 
ATOM   1888 H  H1     . DG  C 3 6  ? 0.772   -24.971 10.105  1.00 50.63  ? 6   DG  C H1     1 
ATOM   1889 H  H21    . DG  C 3 6  ? 3.985   -24.496 10.064  1.00 55.88  ? 6   DG  C H21    1 
ATOM   1890 H  H22    . DG  C 3 6  ? 2.687   -23.914 9.625   1.00 55.88  ? 6   DG  C H22    1 
ATOM   1891 P  P      . DC  C 3 7  ? 7.545   -31.012 13.449  1.00 53.87  ? 7   DC  C P      1 
ATOM   1892 O  OP1    . DC  C 3 7  ? 8.910   -31.568 13.571  1.00 63.60  ? 7   DC  C OP1    1 
ATOM   1893 O  OP2    . DC  C 3 7  ? 6.430   -31.584 14.236  1.00 54.42  ? 7   DC  C OP2    1 
ATOM   1894 O  "O5'"  . DC  C 3 7  ? 7.608   -29.452 13.760  1.00 46.84  ? 7   DC  C "O5'"  1 
ATOM   1895 C  "C5'"  . DC  C 3 7  ? 8.415   -28.613 12.960  1.00 47.88  ? 7   DC  C "C5'"  1 
ATOM   1896 C  "C4'"  . DC  C 3 7  ? 8.065   -27.161 13.193  1.00 45.75  ? 7   DC  C "C4'"  1 
ATOM   1897 O  "O4'"  . DC  C 3 7  ? 6.688   -26.938 12.811  1.00 49.16  ? 7   DC  C "O4'"  1 
ATOM   1898 C  "C3'"  . DC  C 3 7  ? 8.187   -26.707 14.651  1.00 46.44  ? 7   DC  C "C3'"  1 
ATOM   1899 O  "O3'"  . DC  C 3 7  ? 9.178   -25.703 14.781  1.00 49.33  ? 7   DC  C "O3'"  1 
ATOM   1900 C  "C2'"  . DC  C 3 7  ? 6.795   -26.191 15.019  1.00 46.06  ? 7   DC  C "C2'"  1 
ATOM   1901 C  "C1'"  . DC  C 3 7  ? 6.115   -25.995 13.677  1.00 43.52  ? 7   DC  C "C1'"  1 
ATOM   1902 N  N1     . DC  C 3 7  ? 4.650   -26.214 13.719  1.00 41.36  ? 7   DC  C N1     1 
ATOM   1903 C  C2     . DC  C 3 7  ? 3.782   -25.137 13.519  1.00 43.71  ? 7   DC  C C2     1 
ATOM   1904 O  O2     . DC  C 3 7  ? 4.253   -24.013 13.300  1.00 38.49  ? 7   DC  C O2     1 
ATOM   1905 N  N3     . DC  C 3 7  ? 2.446   -25.357 13.568  1.00 46.13  ? 7   DC  C N3     1 
ATOM   1906 C  C4     . DC  C 3 7  ? 1.980   -26.584 13.806  1.00 47.01  ? 7   DC  C C4     1 
ATOM   1907 N  N4     . DC  C 3 7  ? 0.656   -26.751 13.844  1.00 48.77  ? 7   DC  C N4     1 
ATOM   1908 C  C5     . DC  C 3 7  ? 2.850   -27.691 14.015  1.00 48.45  ? 7   DC  C C5     1 
ATOM   1909 C  C6     . DC  C 3 7  ? 4.163   -27.463 13.964  1.00 44.99  ? 7   DC  C C6     1 
ATOM   1910 H  "H5'"  . DC  C 3 7  ? 8.274   -28.830 12.025  1.00 57.41  ? 7   DC  C "H5'"  1 
ATOM   1911 H  "H5''" . DC  C 3 7  ? 9.348   -28.757 13.185  1.00 57.41  ? 7   DC  C "H5''" 1 
ATOM   1912 H  "H4'"  . DC  C 3 7  ? 8.639   -26.606 12.641  1.00 54.85  ? 7   DC  C "H4'"  1 
ATOM   1913 H  "H3'"  . DC  C 3 7  ? 8.413   -27.466 15.212  1.00 55.67  ? 7   DC  C "H3'"  1 
ATOM   1914 H  "H2'"  . DC  C 3 7  ? 6.319   -26.848 15.550  1.00 55.22  ? 7   DC  C "H2'"  1 
ATOM   1915 H  "H2''" . DC  C 3 7  ? 6.858   -25.349 15.493  1.00 55.22  ? 7   DC  C "H2''" 1 
ATOM   1916 H  "H1'"  . DC  C 3 7  ? 6.301   -25.102 13.349  1.00 52.18  ? 7   DC  C "H1'"  1 
ATOM   1917 H  H41    . DC  C 3 7  ? 0.325   -27.530 13.995  1.00 58.47  ? 7   DC  C H41    1 
ATOM   1918 H  H42    . DC  C 3 7  ? 0.134   -26.079 13.717  1.00 58.47  ? 7   DC  C H42    1 
ATOM   1919 H  H5     . DC  C 3 7  ? 2.515   -28.543 14.180  1.00 58.09  ? 7   DC  C H5     1 
ATOM   1920 H  H6     . DC  C 3 7  ? 4.755   -28.167 14.098  1.00 53.94  ? 7   DC  C H6     1 
ATOM   1921 P  P      . DC  C 3 8  ? 9.528   -25.109 16.230  1.00 58.77  ? 8   DC  C P      1 
ATOM   1922 O  OP1    . DC  C 3 8  ? 10.905  -24.569 16.154  1.00 57.94  ? 8   DC  C OP1    1 
ATOM   1923 O  OP2    . DC  C 3 8  ? 9.183   -26.132 17.242  1.00 59.21  ? 8   DC  C OP2    1 
ATOM   1924 O  "O5'"  . DC  C 3 8  ? 8.519   -23.877 16.392  1.00 55.80  ? 8   DC  C "O5'"  1 
ATOM   1925 C  "C5'"  . DC  C 3 8  ? 8.618   -22.766 15.513  1.00 59.85  ? 8   DC  C "C5'"  1 
ATOM   1926 C  "C4'"  . DC  C 3 8  ? 7.604   -21.697 15.870  1.00 46.06  ? 8   DC  C "C4'"  1 
ATOM   1927 O  "O4'"  . DC  C 3 8  ? 6.271   -22.207 15.621  1.00 45.29  ? 8   DC  C "O4'"  1 
ATOM   1928 C  "C3'"  . DC  C 3 8  ? 7.628   -21.247 17.337  1.00 46.29  ? 8   DC  C "C3'"  1 
ATOM   1929 O  "O3'"  . DC  C 3 8  ? 7.792   -19.830 17.429  1.00 52.67  ? 8   DC  C "O3'"  1 
ATOM   1930 C  "C2'"  . DC  C 3 8  ? 6.284   -21.711 17.897  1.00 49.70  ? 8   DC  C "C2'"  1 
ATOM   1931 C  "C1'"  . DC  C 3 8  ? 5.414   -21.801 16.658  1.00 48.68  ? 8   DC  C "C1'"  1 
ATOM   1932 N  N1     . DC  C 3 8  ? 4.303   -22.783 16.766  1.00 45.96  ? 8   DC  C N1     1 
ATOM   1933 C  C2     . DC  C 3 8  ? 2.990   -22.331 16.889  1.00 40.73  ? 8   DC  C C2     1 
ATOM   1934 O  O2     . DC  C 3 8  ? 2.770   -21.116 16.911  1.00 39.94  ? 8   DC  C O2     1 
ATOM   1935 N  N3     . DC  C 3 8  ? 1.991   -23.240 16.981  1.00 44.84  ? 8   DC  C N3     1 
ATOM   1936 C  C4     . DC  C 3 8  ? 2.269   -24.543 16.952  1.00 44.23  ? 8   DC  C C4     1 
ATOM   1937 N  N4     . DC  C 3 8  ? 1.252   -25.402 17.046  1.00 46.21  ? 8   DC  C N4     1 
ATOM   1938 C  C5     . DC  C 3 8  ? 3.603   -25.022 16.828  1.00 46.72  ? 8   DC  C C5     1 
ATOM   1939 C  C6     . DC  C 3 8  ? 4.579   -24.115 16.737  1.00 48.70  ? 8   DC  C C6     1 
ATOM   1940 H  "H5'"  . DC  C 3 8  ? 8.459   -23.064 14.604  1.00 71.77  ? 8   DC  C "H5'"  1 
ATOM   1941 H  "H5''" . DC  C 3 8  ? 9.511   -22.391 15.573  1.00 71.77  ? 8   DC  C "H5''" 1 
ATOM   1942 H  "H4'"  . DC  C 3 8  ? 7.753   -20.924 15.304  1.00 55.22  ? 8   DC  C "H4'"  1 
ATOM   1943 H  "H3'"  . DC  C 3 8  ? 8.351   -21.693 17.805  1.00 55.50  ? 8   DC  C "H3'"  1 
ATOM   1944 H  "H2'"  . DC  C 3 8  ? 6.370   -22.580 18.320  1.00 59.59  ? 8   DC  C "H2'"  1 
ATOM   1945 H  "H2''" . DC  C 3 8  ? 5.928   -21.058 18.519  1.00 59.59  ? 8   DC  C "H2''" 1 
ATOM   1946 H  "H1'"  . DC  C 3 8  ? 5.054   -20.925 16.452  1.00 58.36  ? 8   DC  C "H1'"  1 
ATOM   1947 H  H41    . DC  C 3 8  ? 1.400   -26.249 17.014  1.00 55.40  ? 8   DC  C H41    1 
ATOM   1948 H  H42    . DC  C 3 8  ? 0.449   -25.109 17.138  1.00 55.40  ? 8   DC  C H42    1 
ATOM   1949 H  H5     . DC  C 3 8  ? 3.788   -25.933 16.808  1.00 56.02  ? 8   DC  C H5     1 
ATOM   1950 H  H6     . DC  C 3 8  ? 5.460   -24.398 16.654  1.00 58.39  ? 8   DC  C H6     1 
ATOM   1951 P  P      . DT  C 3 9  ? 8.104   -19.135 18.845  1.00 56.24  ? 9   DT  C P      1 
ATOM   1952 O  OP1    . DT  C 3 9  ? 8.782   -17.851 18.566  1.00 60.36  ? 9   DT  C OP1    1 
ATOM   1953 O  OP2    . DT  C 3 9  ? 8.755   -20.139 19.715  1.00 60.10  ? 9   DT  C OP2    1 
ATOM   1954 O  "O5'"  . DT  C 3 9  ? 6.656   -18.828 19.449  1.00 46.50  ? 9   DT  C "O5'"  1 
ATOM   1955 C  "C5'"  . DT  C 3 9  ? 5.776   -17.955 18.760  1.00 43.31  ? 9   DT  C "C5'"  1 
ATOM   1956 C  "C4'"  . DT  C 3 9  ? 4.407   -17.935 19.413  1.00 42.53  ? 9   DT  C "C4'"  1 
ATOM   1957 O  "O4'"  . DT  C 3 9  ? 3.738   -19.184 19.162  1.00 43.70  ? 9   DT  C "O4'"  1 
ATOM   1958 C  "C3'"  . DT  C 3 9  ? 4.415   -17.776 20.936  1.00 38.09  ? 9   DT  C "C3'"  1 
ATOM   1959 O  "O3'"  . DT  C 3 9  ? 4.053   -16.449 21.305  1.00 37.80  ? 9   DT  C "O3'"  1 
ATOM   1960 C  "C2'"  . DT  C 3 9  ? 3.403   -18.817 21.443  1.00 36.13  ? 9   DT  C "C2'"  1 
ATOM   1961 C  "C1'"  . DT  C 3 9  ? 2.786   -19.382 20.171  1.00 40.12  ? 9   DT  C "C1'"  1 
ATOM   1962 N  N1     . DT  C 3 9  ? 2.461   -20.835 20.237  1.00 41.21  ? 9   DT  C N1     1 
ATOM   1963 C  C2     . DT  C 3 9  ? 1.143   -21.231 20.225  1.00 45.17  ? 9   DT  C C2     1 
ATOM   1964 O  O2     . DT  C 3 9  ? 0.209   -20.450 20.175  1.00 42.21  ? 9   DT  C O2     1 
ATOM   1965 N  N3     . DT  C 3 9  ? 0.954   -22.586 20.278  1.00 49.54  ? 9   DT  C N3     1 
ATOM   1966 C  C4     . DT  C 3 9  ? 1.932   -23.563 20.337  1.00 46.11  ? 9   DT  C C4     1 
ATOM   1967 O  O4     . DT  C 3 9  ? 1.663   -24.759 20.383  1.00 44.86  ? 9   DT  C O4     1 
ATOM   1968 C  C5     . DT  C 3 9  ? 3.290   -23.077 20.345  1.00 37.67  ? 9   DT  C C5     1 
ATOM   1969 C  C7     . DT  C 3 9  ? 4.433   -24.043 20.408  1.00 39.28  ? 9   DT  C C7     1 
ATOM   1970 C  C6     . DT  C 3 9  ? 3.488   -21.753 20.290  1.00 36.87  ? 9   DT  C C6     1 
ATOM   1971 H  "H5'"  . DT  C 3 9  ? 5.686   -18.253 17.841  1.00 51.92  ? 9   DT  C "H5'"  1 
ATOM   1972 H  "H5''" . DT  C 3 9  ? 6.146   -17.058 18.769  1.00 51.92  ? 9   DT  C "H5''" 1 
ATOM   1973 H  "H4'"  . DT  C 3 9  ? 3.885   -17.216 19.025  1.00 50.99  ? 9   DT  C "H4'"  1 
ATOM   1974 H  "H3'"  . DT  C 3 9  ? 5.297   -17.983 21.282  1.00 45.66  ? 9   DT  C "H3'"  1 
ATOM   1975 H  "H2'"  . DT  C 3 9  ? 3.855   -19.516 21.941  1.00 43.30  ? 9   DT  C "H2'"  1 
ATOM   1976 H  "H2''" . DT  C 3 9  ? 2.724   -18.393 21.990  1.00 43.30  ? 9   DT  C "H2''" 1 
ATOM   1977 H  "H1'"  . DT  C 3 9  ? 1.983   -18.882 19.955  1.00 48.09  ? 9   DT  C "H1'"  1 
ATOM   1978 H  H3     . DT  C 3 9  ? 0.139   -22.860 20.275  1.00 59.39  ? 9   DT  C H3     1 
ATOM   1979 H  H71    . DT  C 3 9  ? 4.977   -23.952 19.610  1.00 47.08  ? 9   DT  C H71    1 
ATOM   1980 H  H72    . DT  C 3 9  ? 4.973   -23.854 21.191  1.00 47.08  ? 9   DT  C H72    1 
ATOM   1981 H  H73    . DT  C 3 9  ? 4.089   -24.948 20.463  1.00 47.08  ? 9   DT  C H73    1 
ATOM   1982 H  H6     . DT  C 3 9  ? 4.363   -21.437 20.294  1.00 44.19  ? 9   DT  C H6     1 
ATOM   1983 P  P      . DC  C 3 10 ? 4.116   -15.996 22.845  1.00 46.39  ? 10  DC  C P      1 
ATOM   1984 O  OP1    . DC  C 3 10 ? 4.240   -14.523 22.876  1.00 49.37  ? 10  DC  C OP1    1 
ATOM   1985 O  OP2    . DC  C 3 10 ? 5.136   -16.833 23.512  1.00 42.38  ? 10  DC  C OP2    1 
ATOM   1986 O  "O5'"  . DC  C 3 10 ? 2.678   -16.399 23.420  1.00 36.66  ? 10  DC  C "O5'"  1 
ATOM   1987 C  "C5'"  . DC  C 3 10 ? 1.513   -15.771 22.902  1.00 40.83  ? 10  DC  C "C5'"  1 
ATOM   1988 C  "C4'"  . DC  C 3 10 ? 0.251   -16.534 23.281  1.00 45.76  ? 10  DC  C "C4'"  1 
ATOM   1989 O  "O4'"  . DC  C 3 10 ? 0.285   -17.852 22.698  1.00 48.83  ? 10  DC  C "O4'"  1 
ATOM   1990 C  "C3'"  . DC  C 3 10 ? 0.063   -16.781 24.767  1.00 45.14  ? 10  DC  C "C3'"  1 
ATOM   1991 O  "O3'"  . DC  C 3 10 ? -0.626  -15.694 25.376  1.00 45.65  ? 10  DC  C "O3'"  1 
ATOM   1992 C  "C2'"  . DC  C 3 10 ? -0.746  -18.082 24.819  1.00 49.91  ? 10  DC  C "C2'"  1 
ATOM   1993 C  "C1'"  . DC  C 3 10 ? -0.595  -18.687 23.417  1.00 48.69  ? 10  DC  C "C1'"  1 
ATOM   1994 N  N1     . DC  C 3 10 ? -0.044  -20.071 23.424  1.00 50.82  ? 10  DC  C N1     1 
ATOM   1995 C  C2     . DC  C 3 10 ? -0.891  -21.161 23.180  1.00 58.17  ? 10  DC  C C2     1 
ATOM   1996 O  O2     . DC  C 3 10 ? -2.089  -20.957 22.951  1.00 62.99  ? 10  DC  C O2     1 
ATOM   1997 N  N3     . DC  C 3 10 ? -0.371  -22.412 23.199  1.00 53.68  ? 10  DC  C N3     1 
ATOM   1998 C  C4     . DC  C 3 10 ? 0.926   -22.592 23.452  1.00 51.66  ? 10  DC  C C4     1 
ATOM   1999 N  N4     . DC  C 3 10 ? 1.393   -23.845 23.462  1.00 49.21  ? 10  DC  C N4     1 
ATOM   2000 C  C5     . DC  C 3 10 ? 1.802   -21.496 23.706  1.00 51.17  ? 10  DC  C C5     1 
ATOM   2001 C  C6     . DC  C 3 10 ? 1.278   -20.266 23.686  1.00 51.32  ? 10  DC  C C6     1 
ATOM   2002 H  "H5'"  . DC  C 3 10 ? 1.579   -15.729 21.935  1.00 48.95  ? 10  DC  C "H5'"  1 
ATOM   2003 H  "H5''" . DC  C 3 10 ? 1.456   -14.869 23.255  1.00 48.95  ? 10  DC  C "H5''" 1 
ATOM   2004 H  "H4'"  . DC  C 3 10 ? -0.522  -16.057 22.939  1.00 54.87  ? 10  DC  C "H4'"  1 
ATOM   2005 H  "H3'"  . DC  C 3 10 ? 0.925   -16.909 25.193  1.00 54.12  ? 10  DC  C "H3'"  1 
ATOM   2006 H  "HO3'" . DC  C 3 10 ? -1.361  -15.825 25.761  1.00 54.73  ? 10  DC  C "HO3'" 1 
ATOM   2007 H  "H2'"  . DC  C 3 10 ? -0.379  -18.682 25.487  1.00 59.84  ? 10  DC  C "H2'"  1 
ATOM   2008 H  "H2''" . DC  C 3 10 ? -1.679  -17.893 25.007  1.00 59.84  ? 10  DC  C "H2''" 1 
ATOM   2009 H  "H1'"  . DC  C 3 10 ? -1.459  -18.690 22.977  1.00 58.38  ? 10  DC  C "H1'"  1 
ATOM   2010 H  H41    . DC  C 3 10 ? 2.225   -23.993 23.622  1.00 59.00  ? 10  DC  C H41    1 
ATOM   2011 H  H42    . DC  C 3 10 ? 0.861   -24.503 23.308  1.00 59.00  ? 10  DC  C H42    1 
ATOM   2012 H  H5     . DC  C 3 10 ? 2.705   -21.632 23.882  1.00 61.35  ? 10  DC  C H5     1 
ATOM   2013 H  H6     . DC  C 3 10 ? 1.826   -19.532 23.848  1.00 61.53  ? 10  DC  C H6     1 
HETATM 2014 ZN ZN     . ZN  D 4 .  ? 3.973   -8.390  3.742   1.00 47.93  ? 501 ZN  A ZN     1 
HETATM 2015 ZN ZN     . ZN  E 4 .  ? -16.518 -22.016 13.925  1.00 40.61  ? 502 ZN  A ZN     1 
HETATM 2016 ZN ZN     . ZN  F 4 .  ? -3.218  -42.733 23.210  1.00 70.44  ? 503 ZN  A ZN     1 
HETATM 2017 O  O      . HOH G 5 .  ? -1.628  -18.217 -6.821  1.00 28.82  ? 601 HOH A O      1 
HETATM 2018 O  O      . HOH G 5 .  ? -6.308  -8.781  0.248   1.00 42.13  ? 602 HOH A O      1 
HETATM 2019 O  O      . HOH G 5 .  ? -18.445 -24.109 6.562   1.00 26.34  ? 603 HOH A O      1 
HETATM 2020 O  O      . HOH G 5 .  ? -0.319  -17.907 6.236   1.00 27.09  ? 604 HOH A O      1 
HETATM 2021 O  O      . HOH G 5 .  ? -3.369  -32.114 10.401  1.00 30.22  ? 605 HOH A O      1 
HETATM 2022 O  O      . HOH G 5 .  ? -17.094 -14.948 1.045   1.00 25.96  ? 606 HOH A O      1 
HETATM 2023 O  O      . HOH G 5 .  ? -10.922 -5.976  6.160   1.00 25.76  ? 607 HOH A O      1 
HETATM 2024 O  O      . HOH G 5 .  ? -8.325  -32.471 19.460  1.00 37.94  ? 608 HOH A O      1 
HETATM 2025 O  O      . HOH G 5 .  ? -16.661 -20.342 3.158   1.00 30.98  ? 609 HOH A O      1 
HETATM 2026 O  O      . HOH H 5 .  ? -7.883  -23.629 14.340  1.00 26.01  ? 101 HOH B O      1 
HETATM 2027 O  O      . HOH H 5 .  ? 2.880   -18.380 14.360  1.00 33.42  ? 102 HOH B O      1 
HETATM 2028 O  O      . HOH H 5 .  ? 1.705   -18.180 4.469   1.00 23.83  ? 103 HOH B O      1 
HETATM 2029 O  O      . HOH H 5 .  ? -8.270  -26.517 15.402  1.00 23.72  ? 104 HOH B O      1 
HETATM 2030 O  O      . HOH I 5 .  ? -2.291  -28.624 11.719  1.00 35.89  ? 101 HOH C O      1 
HETATM 2031 O  O      . HOH I 5 .  ? -1.921  -21.653 1.821   1.00 28.05  ? 102 HOH C O      1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . THR A 7  ? 1.4662 1.0900 1.1401 -0.0002 0.2076  0.0817  397 THR A N     
2    C CA    . THR A 7  ? 1.4958 1.1834 1.1762 0.0414  0.2681  0.1085  397 THR A CA    
3    C C     . THR A 7  ? 1.3476 1.1921 1.1739 0.0265  0.2695  0.1112  397 THR A C     
4    O O     . THR A 7  ? 1.3162 1.2422 1.1727 0.0564  0.3142  0.1374  397 THR A O     
5    C CB    . THR A 7  ? 1.5782 1.2561 1.2047 0.0686  0.3186  0.1475  397 THR A CB    
6    O OG1   . THR A 7  ? 1.5716 1.3206 1.2835 0.0326  0.3048  0.1602  397 THR A OG1   
7    C CG2   . THR A 7  ? 1.6935 1.2112 1.1591 0.0856  0.3205  0.1441  397 THR A CG2   
14   N N     . ALA A 8  ? 1.2481 1.1344 1.1612 -0.0183 0.2206  0.0850  398 ALA A N     
15   C CA    . ALA A 8  ? 1.0328 1.0568 1.0730 -0.0390 0.2163  0.0814  398 ALA A CA    
16   C C     . ALA A 8  ? 0.9052 0.9688 0.9711 -0.0282 0.2116  0.0648  398 ALA A C     
17   O O     . ALA A 8  ? 0.9066 0.8872 0.9121 -0.0209 0.1934  0.0464  398 ALA A O     
18   C CB    . ALA A 8  ? 0.8731 0.9122 0.9846 -0.0866 0.1697  0.0571  398 ALA A CB    
24   N N     . THR A 9  ? 1.0279 1.2219 1.1835 -0.0306 0.2264  0.0745  399 THR A N     
25   C CA    . THR A 9  ? 0.9676 1.2181 1.1622 -0.0258 0.2189  0.0604  399 THR A CA    
26   C C     . THR A 9  ? 0.8523 1.1294 1.1147 -0.0677 0.1687  0.0199  399 THR A C     
27   O O     . THR A 9  ? 0.8015 1.1220 1.1247 -0.1004 0.1514  0.0097  399 THR A O     
28   C CB    . THR A 9  ? 0.9762 1.3626 1.2353 -0.0100 0.2547  0.0916  399 THR A CB    
29   O OG1   . THR A 9  ? 0.9444 1.4225 1.2835 -0.0454 0.2484  0.0982  399 THR A OG1   
30   C CG2   . THR A 9  ? 1.0570 1.4182 1.2479 0.0444  0.3107  0.1345  399 THR A CG2   
38   N N     . HIS A 10 ? 0.8264 1.0751 1.0763 -0.0656 0.1473  -0.0014 400 HIS A N     
39   C CA    . HIS A 10 ? 0.7741 1.0319 1.0744 -0.0973 0.1022  -0.0379 400 HIS A CA    
40   C C     . HIS A 10 ? 0.6914 1.0779 1.0892 -0.1170 0.0992  -0.0499 400 HIS A C     
41   O O     . HIS A 10 ? 0.6681 1.1298 1.0950 -0.1079 0.1085  -0.0476 400 HIS A O     
42   C CB    . HIS A 10 ? 0.7892 0.9967 1.0538 -0.0903 0.0841  -0.0492 400 HIS A CB    
43   C CG    . HIS A 10 ? 0.8476 0.9289 1.0014 -0.0704 0.0920  -0.0350 400 HIS A CG    
44   N ND1   . HIS A 10 ? 0.8701 0.9244 0.9638 -0.0362 0.1275  -0.0128 400 HIS A ND1   
45   C CD2   . HIS A 10 ? 0.8877 0.8570 0.9724 -0.0796 0.0688  -0.0399 400 HIS A CD2   
46   C CE1   . HIS A 10 ? 0.9403 0.8618 0.9253 -0.0262 0.1264  -0.0092 400 HIS A CE1   
47   N NE2   . HIS A 10 ? 0.9834 0.8554 0.9609 -0.0546 0.0891  -0.0249 400 HIS A NE2   
55   N N     . THR A 11 ? 0.6714 1.0772 1.1139 -0.1458 0.0846  -0.0631 401 THR A N     
56   C CA    . THR A 11 ? 0.5839 1.0942 1.1062 -0.1718 0.0772  -0.0800 401 THR A CA    
57   C C     . THR A 11 ? 0.4899 0.9700 1.0433 -0.1971 0.0407  -0.1202 401 THR A C     
58   O O     . THR A 11 ? 0.5014 0.8932 1.0292 -0.2015 0.0251  -0.1241 401 THR A O     
59   C CB    . THR A 11 ? 0.6093 1.1759 1.1576 -0.1864 0.0976  -0.0545 401 THR A CB    
60   O OG1   . THR A 11 ? 0.5969 1.1930 1.1167 -0.1541 0.1369  -0.0113 401 THR A OG1   
61   C CG2   . THR A 11 ? 0.5990 1.2731 1.2211 -0.2200 0.0860  -0.0727 401 THR A CG2   
69   N N     . CYS A 12 ? 1.0431 0.8022 0.7392 -0.3866 -0.1108 0.1361  402 CYS A N     
70   C CA    . CYS A 12 ? 1.0072 0.8061 0.7528 -0.3912 -0.1288 0.1450  402 CYS A CA    
71   C C     . CYS A 12 ? 0.9764 0.8033 0.8323 -0.3905 -0.1183 0.1280  402 CYS A C     
72   O O     . CYS A 12 ? 0.9620 0.8094 0.8872 -0.3687 -0.1095 0.0889  402 CYS A O     
73   C CB    . CYS A 12 ? 0.9826 0.8262 0.7354 -0.3580 -0.1530 0.1249  402 CYS A CB    
74   S SG    . CYS A 12 ? 0.9421 0.8314 0.7483 -0.3632 -0.1736 0.1377  402 CYS A SG    
79   N N     . ASP A 13 ? 0.9903 0.8189 0.8676 -0.4132 -0.1183 0.1566  403 ASP A N     
80   C CA    . ASP A 13 ? 1.1348 0.9815 1.1143 -0.4153 -0.1014 0.1483  403 ASP A CA    
81   C C     . ASP A 13 ? 1.1620 1.0674 1.2203 -0.4034 -0.1211 0.1359  403 ASP A C     
82   O O     . ASP A 13 ? 1.1599 1.0731 1.2784 -0.4149 -0.1103 0.1499  403 ASP A O     
83   C CB    . ASP A 13 ? 1.1788 0.9752 1.1221 -0.4460 -0.0789 0.1929  403 ASP A CB    
84   C CG    . ASP A 13 ? 1.2149 0.9956 1.0725 -0.4679 -0.0998 0.2357  403 ASP A CG    
85   O OD1   . ASP A 13 ? 1.1634 0.9570 0.9739 -0.4638 -0.1243 0.2334  403 ASP A OD1   
86   O OD2   . ASP A 13 ? 1.2557 1.0194 1.0976 -0.4707 -0.0888 0.2618  403 ASP A OD2   
91   N N     . TYR A 14 ? 0.9674 0.9112 1.0225 -0.3776 -0.1474 0.1109  404 TYR A N     
92   C CA    . TYR A 14 ? 0.9707 0.9723 1.1029 -0.3592 -0.1658 0.0896  404 TYR A CA    
93   C C     . TYR A 14 ? 0.9559 1.0014 1.1838 -0.3260 -0.1671 0.0281  404 TYR A C     
94   O O     . TYR A 14 ? 0.9463 0.9931 1.1477 -0.3018 -0.1731 -0.0008 404 TYR A O     
95   C CB    . TYR A 14 ? 1.0204 1.0355 1.0878 -0.3470 -0.1921 0.0998  404 TYR A CB    
96   C CG    . TYR A 14 ? 1.0481 1.0434 1.0656 -0.3779 -0.1967 0.1514  404 TYR A CG    
97   C CD1   . TYR A 14 ? 1.0073 1.0380 1.0739 -0.3784 -0.2085 0.1601  404 TYR A CD1   
98   C CD2   . TYR A 14 ? 1.0871 1.0306 1.0123 -0.4058 -0.1904 0.1885  404 TYR A CD2   
99   C CE1   . TYR A 14 ? 0.9832 1.0005 1.0119 -0.4051 -0.2148 0.2050  404 TYR A CE1   
100  C CE2   . TYR A 14 ? 1.0400 0.9715 0.9273 -0.4326 -0.1990 0.2299  404 TYR A CE2   
101  C CZ    . TYR A 14 ? 0.9896 0.9594 0.9308 -0.4318 -0.2116 0.2384  404 TYR A CZ    
102  O OH    . TYR A 14 ? 0.9805 0.9427 0.8914 -0.4571 -0.2220 0.2775  404 TYR A OH    
112  N N     . ALA A 15 ? 0.7737 0.8556 1.1162 -0.3239 -0.1614 0.0064  405 ALA A N     
113  C CA    . ALA A 15 ? 0.7481 0.8796 1.1990 -0.2931 -0.1657 -0.0595 405 ALA A CA    
114  C C     . ALA A 15 ? 0.7574 0.9295 1.1774 -0.2511 -0.2020 -0.0953 405 ALA A C     
115  O O     . ALA A 15 ? 0.7300 0.9260 1.1339 -0.2411 -0.2223 -0.0880 405 ALA A O     
116  C CB    . ALA A 15 ? 0.7143 0.8799 1.2935 -0.2986 -0.1548 -0.0760 405 ALA A CB    
122  N N     . GLY A 16 ? 0.9573 1.1356 1.3660 -0.2234 -0.2085 -0.1325 406 GLY A N     
123  C CA    . GLY A 16 ? 0.9620 1.1710 1.3230 -0.1767 -0.2405 -0.1629 406 GLY A CA    
124  C C     . GLY A 16 ? 1.0021 1.1652 1.2398 -0.1712 -0.2375 -0.1383 406 GLY A C     
125  O O     . GLY A 16 ? 0.9428 1.1233 1.1591 -0.1295 -0.2526 -0.1740 406 GLY A O     
129  N N     . CYS A 17 ? 1.1373 1.2076 1.2623 -0.3933 -0.2974 0.0763  407 CYS A N     
130  C CA    . CYS A 17 ? 1.1094 1.2306 1.2470 -0.3743 -0.2849 0.0853  407 CYS A CA    
131  C C     . CYS A 17 ? 1.0885 1.2448 1.2150 -0.3824 -0.2893 0.1286  407 CYS A C     
132  O O     . CYS A 17 ? 1.0950 1.2490 1.2052 -0.4060 -0.2978 0.1520  407 CYS A O     
133  C CB    . CYS A 17 ? 1.0968 1.2031 1.2589 -0.3481 -0.2855 0.0612  407 CYS A CB    
134  S SG    . CYS A 17 ? 1.0494 1.2105 1.2252 -0.3258 -0.2691 0.0671  407 CYS A SG    
139  N N     . GLY A 18 ? 1.0569 1.2473 1.1922 -0.3641 -0.2828 0.1403  408 GLY A N     
140  C CA    . GLY A 18 ? 0.9696 1.2038 1.0942 -0.3700 -0.2813 0.1827  408 GLY A CA    
141  C C     . GLY A 18 ? 0.8769 1.1607 1.0059 -0.3514 -0.2619 0.1887  408 GLY A C     
142  O O     . GLY A 18 ? 0.8723 1.1979 0.9940 -0.3508 -0.2571 0.2240  408 GLY A O     
146  N N     . LYS A 19 ? 0.8280 1.1088 0.9690 -0.3372 -0.2495 0.1562  409 LYS A N     
147  C CA    . LYS A 19 ? 0.7192 1.0386 0.8655 -0.3188 -0.2318 0.1580  409 LYS A CA    
148  C C     . LYS A 19 ? 0.7360 1.0644 0.8840 -0.3052 -0.2381 0.1744  409 LYS A C     
149  O O     . LYS A 19 ? 0.5437 0.8358 0.6990 -0.2998 -0.2561 0.1626  409 LYS A O     
150  C CB    . LYS A 19 ? 0.6734 0.9748 0.8387 -0.3057 -0.2223 0.1163  409 LYS A CB    
151  C CG    . LYS A 19 ? 0.6867 0.9721 0.8503 -0.3178 -0.2188 0.0961  409 LYS A CG    
152  C CD    . LYS A 19 ? 0.5155 0.7928 0.6994 -0.3052 -0.2057 0.0607  409 LYS A CD    
153  C CE    . LYS A 19 ? 0.5349 0.7961 0.7143 -0.3176 -0.2028 0.0416  409 LYS A CE    
154  N NZ    . LYS A 19 ? 0.5135 0.7730 0.7120 -0.3075 -0.1873 0.0122  409 LYS A NZ    
168  N N     . THR A 20 ? 0.7030 1.0815 0.8421 -0.2985 -0.2239 0.2031  410 THR A N     
169  C CA    . THR A 20 ? 0.6265 1.0195 0.7626 -0.2827 -0.2277 0.2195  410 THR A CA    
170  C C     . THR A 20 ? 0.4905 0.9034 0.6340 -0.2632 -0.2112 0.2036  410 THR A C     
171  O O     . THR A 20 ? 0.4717 0.9127 0.6164 -0.2636 -0.1905 0.2023  410 THR A O     
172  C CB    . THR A 20 ? 0.6120 1.0508 0.7307 -0.2886 -0.2232 0.2706  410 THR A CB    
173  O OG1   . THR A 20 ? 0.5717 0.9954 0.6864 -0.3129 -0.2368 0.2862  410 THR A OG1   
174  C CG2   . THR A 20 ? 0.5908 1.0348 0.6976 -0.2676 -0.2300 0.2874  410 THR A CG2   
182  N N     . TYR A 21 ? 0.6182 1.0127 0.7633 -0.2449 -0.2200 0.1910  411 TYR A N     
183  C CA    . TYR A 21 ? 0.5673 0.9585 0.7116 -0.2212 -0.1984 0.1696  411 TYR A CA    
184  C C     . TYR A 21 ? 0.6222 1.0139 0.7344 -0.1961 -0.1903 0.1894  411 TYR A C     
185  O O     . TYR A 21 ? 0.5901 0.9740 0.6846 -0.1938 -0.2059 0.2112  411 TYR A O     
186  C CB    . TYR A 21 ? 0.5581 0.9065 0.7308 -0.2171 -0.2094 0.1216  411 TYR A CB    
187  C CG    . TYR A 21 ? 0.5779 0.9196 0.7784 -0.2374 -0.2130 0.0991  411 TYR A CG    
188  C CD1   . TYR A 21 ? 0.6313 0.9379 0.8330 -0.2465 -0.2298 0.0931  411 TYR A CD1   
189  C CD2   . TYR A 21 ? 0.5634 0.9167 0.7759 -0.2367 -0.1890 0.0809  411 TYR A CD2   
190  C CE1   . TYR A 21 ? 0.6210 0.9067 0.8347 -0.2546 -0.2245 0.0692  411 TYR A CE1   
191  C CE2   . TYR A 21 ? 0.5805 0.9147 0.8066 -0.2459 -0.1856 0.0582  411 TYR A CE2   
192  C CZ    . TYR A 21 ? 0.5517 0.8513 0.7769 -0.2536 -0.2032 0.0516  411 TYR A CZ    
193  O OH    . TYR A 21 ? 0.5100 0.7892 0.7442 -0.2611 -0.1989 0.0288  411 TYR A OH    
203  N N     . THR A 22 ? 0.6827 1.0791 0.7838 -0.1765 -0.1638 0.1814  412 THR A N     
204  C CA    . THR A 22 ? 0.6598 1.0524 0.7228 -0.1509 -0.1511 0.1989  412 THR A CA    
205  C C     . THR A 22 ? 0.6386 0.9832 0.6973 -0.1376 -0.1711 0.1701  412 THR A C     
206  O O     . THR A 22 ? 0.5479 0.8805 0.5719 -0.1218 -0.1766 0.1877  412 THR A O     
207  C CB    . THR A 22 ? 0.6721 1.0817 0.7197 -0.1347 -0.1132 0.2015  412 THR A CB    
208  O OG1   . THR A 22 ? 0.6824 1.0681 0.7558 -0.1359 -0.1067 0.1582  412 THR A OG1   
209  C CG2   . THR A 22 ? 0.5335 0.9984 0.5810 -0.1437 -0.0947 0.2363  412 THR A CG2   
217  N N     . LYS A 23 ? 0.5023 0.8212 0.5952 -0.1427 -0.1821 0.1268  413 LYS A N     
218  C CA    . LYS A 23 ? 0.5053 0.7857 0.6025 -0.1320 -0.2047 0.0968  413 LYS A CA    
219  C C     . LYS A 23 ? 0.5064 0.7702 0.6381 -0.1454 -0.2378 0.0797  413 LYS A C     
220  O O     . LYS A 23 ? 0.4879 0.7612 0.6477 -0.1639 -0.2384 0.0759  413 LYS A O     
221  C CB    . LYS A 23 ? 0.4980 0.7634 0.6109 -0.1248 -0.1892 0.0590  413 LYS A CB    
222  C CG    . LYS A 23 ? 0.5133 0.7766 0.5836 -0.1064 -0.1598 0.0697  413 LYS A CG    
223  C CD    . LYS A 23 ? 0.5303 0.7692 0.6163 -0.1023 -0.1489 0.0288  413 LYS A CD    
224  C CE    . LYS A 23 ? 0.6742 0.8978 0.7096 -0.0831 -0.1214 0.0371  413 LYS A CE    
225  N NZ    . LYS A 23 ? 0.7080 0.9586 0.7197 -0.0771 -0.0825 0.0697  413 LYS A NZ    
239  N N     . SER A 24 ? 0.9269 0.7359 0.3575 -0.1295 -0.0840 -0.0675 414 SER A N     
240  C CA    . SER A 24 ? 0.7926 0.6519 0.2878 -0.1310 -0.1126 -0.0610 414 SER A CA    
241  C C     . SER A 24 ? 0.8440 0.7158 0.3876 -0.1471 -0.1123 -0.0817 414 SER A C     
242  O O     . SER A 24 ? 0.8861 0.7883 0.4921 -0.1426 -0.1203 -0.0763 414 SER A O     
243  C CB    . SER A 24 ? 0.8215 0.7043 0.3038 -0.1393 -0.1411 -0.0568 414 SER A CB    
244  O OG    . SER A 24 ? 0.8874 0.7630 0.3493 -0.1645 -0.1462 -0.0827 414 SER A OG    
250  N N     . SER A 25 ? 0.8932 0.7406 0.4110 -0.1662 -0.1010 -0.1063 415 SER A N     
251  C CA    . SER A 25 ? 0.8003 0.6566 0.3637 -0.1818 -0.0975 -0.1262 415 SER A CA    
252  C C     . SER A 25 ? 0.8046 0.6539 0.3939 -0.1703 -0.0762 -0.1226 415 SER A C     
253  O O     . SER A 25 ? 0.8392 0.7096 0.4838 -0.1767 -0.0780 -0.1306 415 SER A O     
254  C CB    . SER A 25 ? 0.8705 0.6954 0.3980 -0.2027 -0.0837 -0.1524 415 SER A CB    
255  O OG    . SER A 25 ? 0.9265 0.7070 0.4084 -0.1926 -0.0510 -0.1512 415 SER A OG    
261  N N     . HIS A 26 ? 0.8416 0.6617 0.3921 -0.1539 -0.0558 -0.1107 416 HIS A N     
262  C CA    . HIS A 26 ? 0.7395 0.5566 0.3107 -0.1426 -0.0396 -0.1049 416 HIS A CA    
263  C C     . HIS A 26 ? 0.7284 0.5867 0.3587 -0.1329 -0.0582 -0.0924 416 HIS A C     
264  O O     . HIS A 26 ? 0.6885 0.5603 0.3619 -0.1358 -0.0535 -0.0998 416 HIS A O     
265  C CB    . HIS A 26 ? 0.7870 0.5700 0.3088 -0.1259 -0.0191 -0.0901 416 HIS A CB    
266  C CG    . HIS A 26 ? 0.8822 0.6215 0.3532 -0.1340 0.0057  -0.1015 416 HIS A CG    
267  N ND1   . HIS A 26 ? 0.8931 0.6264 0.3688 -0.1536 0.0100  -0.1237 416 HIS A ND1   
268  C CD2   . HIS A 26 ? 0.8847 0.5979 0.3340 -0.1190 0.0280  -0.0875 416 HIS A CD2   
269  C CE1   . HIS A 26 ? 0.8800 0.5830 0.3341 -0.1506 0.0345  -0.1231 416 HIS A CE1   
270  N NE2   . HIS A 26 ? 0.8912 0.5816 0.3300 -0.1303 0.0454  -0.1012 416 HIS A NE2   
278  N N     . LEU A 27 ? 0.7819 0.6594 0.4156 -0.1215 -0.0773 -0.0735 417 LEU A N     
279  C CA    . LEU A 27 ? 0.7700 0.6865 0.4646 -0.1116 -0.0937 -0.0601 417 LEU A CA    
280  C C     . LEU A 27 ? 0.8232 0.7733 0.5795 -0.1269 -0.1089 -0.0723 417 LEU A C     
281  O O     . LEU A 27 ? 0.7953 0.7666 0.6085 -0.1253 -0.1080 -0.0740 417 LEU A O     
282  C CB    . LEU A 27 ? 0.8006 0.7295 0.4852 -0.0966 -0.1098 -0.0356 417 LEU A CB    
283  C CG    . LEU A 27 ? 0.8753 0.8450 0.6260 -0.0852 -0.1269 -0.0186 417 LEU A CG    
284  C CD1   . LEU A 27 ? 0.8446 0.8140 0.6252 -0.0747 -0.1128 -0.0175 417 LEU A CD1   
285  C CD2   . LEU A 27 ? 0.8688 0.8471 0.6030 -0.0704 -0.1404 0.0072  417 LEU A CD2   
297  N N     . LYS A 28 ? 0.8286 0.7844 0.5765 -0.1426 -0.1227 -0.0812 418 LYS A N     
298  C CA    . LYS A 28 ? 0.8472 0.8366 0.6586 -0.1578 -0.1385 -0.0911 418 LYS A CA    
299  C C     . LYS A 28 ? 0.7453 0.7279 0.5905 -0.1667 -0.1179 -0.1106 418 LYS A C     
300  O O     . LYS A 28 ? 0.7046 0.7166 0.6195 -0.1698 -0.1231 -0.1125 418 LYS A O     
301  C CB    . LYS A 28 ? 0.9691 0.9598 0.7570 -0.1761 -0.1546 -0.1013 418 LYS A CB    
302  C CG    . LYS A 28 ? 1.0798 1.0817 0.8346 -0.1696 -0.1774 -0.0825 418 LYS A CG    
303  C CD    . LYS A 28 ? 1.2246 1.2243 0.9461 -0.1904 -0.1925 -0.0967 418 LYS A CD    
304  C CE    . LYS A 28 ? 1.2382 1.2458 0.9152 -0.1847 -0.2133 -0.0786 418 LYS A CE    
305  N NZ    . LYS A 28 ? 1.2303 1.2335 0.8662 -0.2072 -0.2280 -0.0957 418 LYS A NZ    
319  N N     . ALA A 29 ? 0.7799 0.7229 0.5772 -0.1708 -0.0925 -0.1244 419 ALA A N     
320  C CA    . ALA A 29 ? 0.7459 0.6793 0.5668 -0.1777 -0.0698 -0.1407 419 ALA A CA    
321  C C     . ALA A 29 ? 0.7245 0.6685 0.5736 -0.1630 -0.0629 -0.1316 419 ALA A C     
322  O O     . ALA A 29 ? 0.6971 0.6566 0.5990 -0.1686 -0.0565 -0.1414 419 ALA A O     
323  C CB    . ALA A 29 ? 0.7426 0.6309 0.5030 -0.1826 -0.0433 -0.1525 419 ALA A CB    
329  N N     . HIS A 30 ? 0.5840 0.5195 0.4001 -0.1450 -0.0630 -0.1137 420 HIS A N     
330  C CA    . HIS A 30 ? 0.5541 0.4999 0.3959 -0.1320 -0.0580 -0.1060 420 HIS A CA    
331  C C     . HIS A 30 ? 0.5212 0.5091 0.4392 -0.1304 -0.0757 -0.1007 420 HIS A C     
332  O O     . HIS A 30 ? 0.4989 0.4989 0.4613 -0.1307 -0.0673 -0.1080 420 HIS A O     
333  C CB    . HIS A 30 ? 0.5562 0.4871 0.3536 -0.1131 -0.0572 -0.0860 420 HIS A CB    
334  C CG    . HIS A 30 ? 0.5237 0.4743 0.3578 -0.0993 -0.0608 -0.0751 420 HIS A CG    
335  N ND1   . HIS A 30 ? 0.5120 0.4609 0.3608 -0.1005 -0.0464 -0.0855 420 HIS A ND1   
336  C CD2   . HIS A 30 ? 0.5031 0.4755 0.3634 -0.0850 -0.0764 -0.0557 420 HIS A CD2   
337  C CE1   . HIS A 30 ? 0.4855 0.4543 0.3686 -0.0885 -0.0537 -0.0749 420 HIS A CE1   
338  N NE2   . HIS A 30 ? 0.4854 0.4686 0.3789 -0.0783 -0.0712 -0.0560 420 HIS A NE2   
346  N N     . LEU A 31 ? 0.6131 0.6233 0.5469 -0.1286 -0.0993 -0.0873 421 LEU A N     
347  C CA    . LEU A 31 ? 0.5173 0.5691 0.5282 -0.1258 -0.1163 -0.0779 421 LEU A CA    
348  C C     . LEU A 31 ? 0.4798 0.5472 0.5530 -0.1417 -0.1103 -0.0967 421 LEU A C     
349  O O     . LEU A 31 ? 0.4510 0.5449 0.5938 -0.1388 -0.1114 -0.0945 421 LEU A O     
350  C CB    . LEU A 31 ? 0.5158 0.5887 0.5268 -0.1236 -0.1434 -0.0594 421 LEU A CB    
351  C CG    . LEU A 31 ? 0.5110 0.5725 0.4704 -0.1060 -0.1489 -0.0375 421 LEU A CG    
352  C CD1   . LEU A 31 ? 0.5320 0.6113 0.4805 -0.1074 -0.1743 -0.0224 421 LEU A CD1   
353  C CD2   . LEU A 31 ? 0.4775 0.5524 0.4735 -0.0874 -0.1465 -0.0215 421 LEU A CD2   
365  N N     . ARG A 32 ? 0.5034 0.5534 0.5562 -0.1583 -0.1014 -0.1156 422 ARG A N     
366  C CA    . ARG A 32 ? 0.4957 0.5567 0.6072 -0.1735 -0.0916 -0.1341 422 ARG A CA    
367  C C     . ARG A 32 ? 0.5092 0.5589 0.6347 -0.1716 -0.0651 -0.1467 422 ARG A C     
368  O O     . ARG A 32 ? 0.7075 0.7670 0.8881 -0.1825 -0.0535 -0.1614 422 ARG A O     
369  C CB    . ARG A 32 ? 0.5271 0.5683 0.6105 -0.1916 -0.0855 -0.1517 422 ARG A CB    
370  C CG    . ARG A 32 ? 0.5445 0.6027 0.6271 -0.1996 -0.1134 -0.1451 422 ARG A CG    
371  C CD    . ARG A 32 ? 0.5653 0.6187 0.6628 -0.2215 -0.1091 -0.1659 422 ARG A CD    
372  N NE    . ARG A 32 ? 0.5842 0.6588 0.6864 -0.2319 -0.1393 -0.1613 422 ARG A NE    
373  C CZ    . ARG A 32 ? 0.6219 0.6749 0.6591 -0.2396 -0.1448 -0.1673 422 ARG A CZ    
374  N NH1   . ARG A 32 ? 0.6459 0.6545 0.6120 -0.2368 -0.1205 -0.1761 422 ARG A NH1   
375  N NH2   . ARG A 32 ? 0.6766 0.7532 0.7210 -0.2507 -0.1747 -0.1641 422 ARG A NH2   
389  N N     . THR A 33 ? 0.4821 0.5117 0.5595 -0.1588 -0.0550 -0.1415 423 THR A N     
390  C CA    . THR A 33 ? 0.4729 0.4950 0.5602 -0.1576 -0.0332 -0.1531 423 THR A CA    
391  C C     . THR A 33 ? 0.4402 0.4934 0.5961 -0.1495 -0.0403 -0.1464 423 THR A C     
392  O O     . THR A 33 ? 0.4311 0.4897 0.6296 -0.1555 -0.0241 -0.1617 423 THR A O     
393  C CB    . THR A 33 ? 0.4890 0.4799 0.5005 -0.1482 -0.0216 -0.1493 423 THR A CB    
394  O OG1   . THR A 33 ? 0.4810 0.4794 0.4785 -0.1310 -0.0385 -0.1270 423 THR A OG1   
395  C CG2   . THR A 33 ? 0.5316 0.4900 0.4794 -0.1555 -0.0114 -0.1547 423 THR A CG2   
403  N N     . HIS A 34 ? 0.4482 0.5206 0.6158 -0.1359 -0.0623 -0.1237 424 HIS A N     
404  C CA    . HIS A 34 ? 0.4392 0.5433 0.6815 -0.1280 -0.0693 -0.1148 424 HIS A CA    
405  C C     . HIS A 34 ? 0.4688 0.6010 0.7937 -0.1393 -0.0724 -0.1203 424 HIS A C     
406  O O     . HIS A 34 ? 0.4088 0.5523 0.7955 -0.1431 -0.0582 -0.1322 424 HIS A O     
407  C CB    . HIS A 34 ? 0.4216 0.5393 0.6571 -0.1107 -0.0913 -0.0864 424 HIS A CB    
408  C CG    . HIS A 34 ? 0.4942 0.5866 0.6606 -0.0983 -0.0871 -0.0789 424 HIS A CG    
409  N ND1   . HIS A 34 ? 0.5006 0.5808 0.6575 -0.0950 -0.0712 -0.0888 424 HIS A ND1   
410  C CD2   . HIS A 34 ? 0.4802 0.5574 0.5855 -0.0887 -0.0962 -0.0623 424 HIS A CD2   
411  C CE1   . HIS A 34 ? 0.4510 0.5117 0.5483 -0.0835 -0.0724 -0.0765 424 HIS A CE1   
412  N NE2   . HIS A 34 ? 0.5096 0.5667 0.5756 -0.0790 -0.0857 -0.0604 424 HIS A NE2   
420  N N     . THR A 35 ? 0.5256 0.4683 0.7031 -0.0108 -0.0362 0.0259  425 THR A N     
421  C CA    . THR A 35 ? 0.5072 0.4473 0.6607 -0.0075 -0.0408 0.0253  425 THR A CA    
422  C C     . THR A 35 ? 0.6142 0.5578 0.7516 0.0016  -0.0450 0.0145  425 THR A C     
423  O O     . THR A 35 ? 0.6370 0.5834 0.7774 0.0046  -0.0443 0.0076  425 THR A O     
424  C CB    . THR A 35 ? 0.5426 0.4841 0.6741 -0.0153 -0.0290 0.0354  425 THR A CB    
425  O OG1   . THR A 35 ? 0.6979 0.6428 0.8111 -0.0169 -0.0178 0.0322  425 THR A OG1   
426  C CG2   . THR A 35 ? 0.4929 0.4304 0.6366 -0.0237 -0.0215 0.0477  425 THR A CG2   
434  N N     . GLY A 36 ? 0.6785 0.6231 0.8007 0.0065  -0.0490 0.0149  426 GLY A N     
435  C CA    . GLY A 36 ? 0.6801 0.6298 0.7882 0.0155  -0.0504 0.0079  426 GLY A CA    
436  C C     . GLY A 36 ? 0.7012 0.6598 0.7907 0.0101  -0.0422 0.0131  426 GLY A C     
437  O O     . GLY A 36 ? 0.7467 0.7122 0.8269 0.0161  -0.0429 0.0122  426 GLY A O     
441  N N     . GLU A 37 ? 0.6035 0.5606 0.6867 -0.0011 -0.0341 0.0190  427 GLU A N     
442  C CA    . GLU A 37 ? 0.5967 0.5562 0.6581 -0.0084 -0.0299 0.0242  427 GLU A CA    
443  C C     . GLU A 37 ? 0.5005 0.4624 0.5525 -0.0066 -0.0259 0.0178  427 GLU A C     
444  O O     . GLU A 37 ? 0.5211 0.4791 0.5765 -0.0059 -0.0195 0.0121  427 GLU A O     
445  C CB    . GLU A 37 ? 0.6486 0.5991 0.6974 -0.0195 -0.0221 0.0309  427 GLU A CB    
446  C CG    . GLU A 37 ? 0.7433 0.6909 0.7965 -0.0231 -0.0263 0.0408  427 GLU A CG    
447  C CD    . GLU A 37 ? 0.7699 0.7215 0.8115 -0.0262 -0.0354 0.0492  427 GLU A CD    
448  O OE1   . GLU A 37 ? 0.7966 0.7570 0.8356 -0.0233 -0.0399 0.0475  427 GLU A OE1   
449  O OE2   . GLU A 37 ? 0.7877 0.7345 0.8249 -0.0316 -0.0383 0.0595  427 GLU A OE2   
456  N N     . LYS A 38 ? 0.5781 0.5473 0.6217 -0.0060 -0.0295 0.0206  428 LYS A N     
457  C CA    . LYS A 38 ? 0.5434 0.5142 0.5773 -0.0063 -0.0264 0.0174  428 LYS A CA    
458  C C     . LYS A 38 ? 0.4992 0.4731 0.5203 -0.0156 -0.0303 0.0262  428 LYS A C     
459  O O     . LYS A 38 ? 0.5059 0.4925 0.5338 -0.0121 -0.0346 0.0314  428 LYS A O     
460  C CB    . LYS A 38 ? 0.4866 0.4651 0.5299 0.0068  -0.0284 0.0123  428 LYS A CB    
461  C CG    . LYS A 38 ? 0.3642 0.3375 0.4197 0.0151  -0.0301 0.0039  428 LYS A CG    
462  C CD    . LYS A 38 ? 0.3395 0.3152 0.3945 0.0278  -0.0331 -0.0020 428 LYS A CD    
463  C CE    . LYS A 38 ? 0.3295 0.2967 0.3949 0.0342  -0.0394 -0.0106 428 LYS A CE    
464  N NZ    . LYS A 38 ? 0.4299 0.3949 0.4873 0.0467  -0.0441 -0.0169 428 LYS A NZ    
478  N N     . PRO A 39 ? 0.4961 0.4573 0.4980 -0.0278 -0.0293 0.0289  429 PRO A N     
479  C CA    . PRO A 39 ? 0.5563 0.5179 0.5456 -0.0388 -0.0383 0.0384  429 PRO A CA    
480  C C     . PRO A 39 ? 0.6001 0.5635 0.5846 -0.0429 -0.0410 0.0391  429 PRO A C     
481  O O     . PRO A 39 ? 0.6845 0.6543 0.6692 -0.0512 -0.0515 0.0492  429 PRO A O     
482  C CB    . PRO A 39 ? 0.6208 0.5614 0.5825 -0.0496 -0.0360 0.0386  429 PRO A CB    
483  C CG    . PRO A 39 ? 0.5494 0.4791 0.5080 -0.0445 -0.0215 0.0284  429 PRO A CG    
484  C CD    . PRO A 39 ? 0.5127 0.4577 0.5023 -0.0316 -0.0197 0.0244  429 PRO A CD    
492  N N     . TYR A 40 ? 0.6496 0.6079 0.6324 -0.0381 -0.0329 0.0304  430 TYR A N     
493  C CA    . TYR A 40 ? 0.6167 0.5740 0.5949 -0.0424 -0.0349 0.0318  430 TYR A CA    
494  C C     . TYR A 40 ? 0.5557 0.5356 0.5578 -0.0314 -0.0350 0.0363  430 TYR A C     
495  O O     . TYR A 40 ? 0.4917 0.4744 0.5009 -0.0192 -0.0283 0.0294  430 TYR A O     
496  C CB    . TYR A 40 ? 0.6402 0.5778 0.6028 -0.0421 -0.0255 0.0213  430 TYR A CB    
497  C CG    . TYR A 40 ? 0.6467 0.5604 0.5830 -0.0492 -0.0206 0.0165  430 TYR A CG    
498  C CD1   . TYR A 40 ? 0.6377 0.5316 0.5449 -0.0631 -0.0277 0.0187  430 TYR A CD1   
499  C CD2   . TYR A 40 ? 0.5988 0.5085 0.5386 -0.0420 -0.0091 0.0106  430 TYR A CD2   
500  C CE1   . TYR A 40 ? 0.6115 0.4795 0.4869 -0.0678 -0.0214 0.0141  430 TYR A CE1   
501  C CE2   . TYR A 40 ? 0.6074 0.4958 0.5224 -0.0467 -0.0008 0.0081  430 TYR A CE2   
502  C CZ    . TYR A 40 ? 0.6534 0.5197 0.5329 -0.0587 -0.0059 0.0092  430 TYR A CZ    
503  O OH    . TYR A 40 ? 0.7280 0.5691 0.5751 -0.0617 0.0040  0.0064  430 TYR A OH    
513  N N     . HIS A 41 ? 0.5293 0.5250 0.5434 -0.0353 -0.0426 0.0491  431 HIS A N     
514  C CA    . HIS A 41 ? 0.5220 0.5400 0.5578 -0.0235 -0.0396 0.0561  431 HIS A CA    
515  C C     . HIS A 41 ? 0.5337 0.5542 0.5708 -0.0276 -0.0385 0.0614  431 HIS A C     
516  O O     . HIS A 41 ? 0.5934 0.6019 0.6201 -0.0432 -0.0453 0.0640  431 HIS A O     
517  C CB    . HIS A 41 ? 0.5341 0.5720 0.5897 -0.0230 -0.0458 0.0703  431 HIS A CB    
518  C CG    . HIS A 41 ? 0.5812 0.6151 0.6361 -0.0211 -0.0489 0.0679  431 HIS A CG    
519  N ND1   . HIS A 41 ? 0.5832 0.6038 0.6293 -0.0138 -0.0435 0.0547  431 HIS A ND1   
520  C CD2   . HIS A 41 ? 0.5926 0.6341 0.6569 -0.0260 -0.0578 0.0788  431 HIS A CD2   
521  C CE1   . HIS A 41 ? 0.5932 0.6125 0.6426 -0.0145 -0.0479 0.0575  431 HIS A CE1   
522  N NE2   . HIS A 41 ? 0.6055 0.6368 0.6644 -0.0213 -0.0565 0.0718  431 HIS A NE2   
530  N N     . CYS A 42 ? 0.4644 0.4978 0.5118 -0.0136 -0.0304 0.0632  432 CYS A N     
531  C CA    . CYS A 42 ? 0.4978 0.5378 0.5510 -0.0159 -0.0279 0.0722  432 CYS A CA    
532  C C     . CYS A 42 ? 0.4668 0.5338 0.5464 -0.0160 -0.0292 0.0918  432 CYS A C     
533  O O     . CYS A 42 ? 0.4277 0.5113 0.5196 -0.0005 -0.0223 0.0958  432 CYS A O     
534  C CB    . CYS A 42 ? 0.5003 0.5384 0.5473 -0.0001 -0.0177 0.0654  432 CYS A CB    
535  S SG    . CYS A 42 ? 0.4921 0.5371 0.5451 -0.0023 -0.0131 0.0785  432 CYS A SG    
540  N N     . ASP A 43 ? 0.6117 0.6818 0.7008 -0.0333 -0.0382 0.1046  433 ASP A N     
541  C CA    . ASP A 43 ? 0.5995 0.6979 0.7212 -0.0366 -0.0416 0.1267  433 ASP A CA    
542  C C     . ASP A 43 ? 0.5701 0.6886 0.7107 -0.0272 -0.0291 0.1406  433 ASP A C     
543  O O     . ASP A 43 ? 0.5755 0.7200 0.7488 -0.0311 -0.0302 0.1624  433 ASP A O     
544  C CB    . ASP A 43 ? 0.6276 0.7193 0.7531 -0.0618 -0.0611 0.1358  433 ASP A CB    
545  C CG    . ASP A 43 ? 0.6478 0.7156 0.7557 -0.0759 -0.0659 0.1312  433 ASP A CG    
546  O OD1   . ASP A 43 ? 0.6802 0.7214 0.7653 -0.0929 -0.0801 0.1240  433 ASP A OD1   
547  O OD2   . ASP A 43 ? 0.6281 0.7009 0.7421 -0.0694 -0.0555 0.1350  433 ASP A OD2   
552  N N     . TRP A 44 ? 0.4798 0.5878 0.6020 -0.0148 -0.0173 0.1303  434 TRP A N     
553  C CA    . TRP A 44 ? 0.4956 0.6193 0.6298 -0.0058 -0.0046 0.1441  434 TRP A CA    
554  C C     . TRP A 44 ? 0.5444 0.6953 0.6967 0.0147  0.0097  0.1555  434 TRP A C     
555  O O     . TRP A 44 ? 0.5830 0.7318 0.7270 0.0283  0.0125  0.1450  434 TRP A O     
556  C CB    . TRP A 44 ? 0.5668 0.6702 0.6729 0.0035  0.0028  0.1300  434 TRP A CB    
557  C CG    . TRP A 44 ? 0.5882 0.7021 0.7021 0.0080  0.0134  0.1454  434 TRP A CG    
558  C CD1   . TRP A 44 ? 0.6685 0.7953 0.7794 0.0294  0.0303  0.1518  434 TRP A CD1   
559  C CD2   . TRP A 44 ? 0.5256 0.6356 0.6492 -0.0092 0.0082  0.1574  434 TRP A CD2   
560  N NE1   . TRP A 44 ? 0.6253 0.7588 0.7444 0.0268  0.0373  0.1685  434 TRP A NE1   
561  C CE2   . TRP A 44 ? 0.5478 0.6715 0.6773 0.0026  0.0233  0.1724  434 TRP A CE2   
562  C CE3   . TRP A 44 ? 0.5254 0.6181 0.6502 -0.0331 -0.0081 0.1565  434 TRP A CE3   
563  C CZ2   . TRP A 44 ? 0.5773 0.7005 0.7190 -0.0099 0.0224  0.1882  434 TRP A CZ2   
564  C CZ3   . TRP A 44 ? 0.5323 0.6213 0.6671 -0.0454 -0.0104 0.1701  434 TRP A CZ3   
565  C CH2   . TRP A 44 ? 0.5763 0.6817 0.7221 -0.0343 0.0046  0.1866  434 TRP A CH2   
576  N N     . ASP A 45 ? 0.6199 0.7948 0.7971 0.0177  0.0200  0.1779  435 ASP A N     
577  C CA    . ASP A 45 ? 0.6204 0.8227 0.8172 0.0387  0.0374  0.1923  435 ASP A CA    
578  C C     . ASP A 45 ? 0.5680 0.7561 0.7295 0.0651  0.0529  0.1764  435 ASP A C     
579  O O     . ASP A 45 ? 0.5089 0.6894 0.6518 0.0720  0.0621  0.1761  435 ASP A O     
580  C CB    . ASP A 45 ? 0.6930 0.9248 0.9265 0.0349  0.0466  0.2224  435 ASP A CB    
581  C CG    . ASP A 45 ? 0.8150 1.0790 1.0759 0.0564  0.0667  0.2413  435 ASP A CG    
582  O OD1   . ASP A 45 ? 0.8279 1.1164 1.1139 0.0613  0.0823  0.2657  435 ASP A OD1   
583  O OD2   . ASP A 45 ? 0.8555 1.1200 1.1141 0.0693  0.0679  0.2329  435 ASP A OD2   
588  N N     . GLY A 46 ? 0.5496 0.7314 0.7002 0.0793  0.0539  0.1633  436 GLY A N     
589  C CA    . GLY A 46 ? 0.5787 0.7448 0.6957 0.1048  0.0659  0.1485  436 GLY A CA    
590  C C     . GLY A 46 ? 0.6427 0.7756 0.7235 0.1030  0.0543  0.1218  436 GLY A C     
591  O O     . GLY A 46 ? 0.6356 0.7517 0.6865 0.1223  0.0597  0.1083  436 GLY A O     
595  N N     . CYS A 47 ? 0.6682 0.7899 0.7503 0.0811  0.0384  0.1143  437 CYS A N     
596  C CA    . CYS A 47 ? 0.5713 0.6651 0.6258 0.0795  0.0291  0.0920  437 CYS A CA    
597  C C     . CYS A 47 ? 0.4777 0.5606 0.5278 0.0828  0.0214  0.0773  437 CYS A C     
598  O O     . CYS A 47 ? 0.4084 0.4757 0.4378 0.0978  0.0218  0.0632  437 CYS A O     
599  C CB    . CYS A 47 ? 0.5090 0.5935 0.5655 0.0573  0.0188  0.0905  437 CYS A CB    
600  S SG    . CYS A 47 ? 0.3914 0.4462 0.4237 0.0552  0.0095  0.0665  437 CYS A SG    
605  N N     . GLY A 48 ? 0.3231 0.4119 0.3915 0.0681  0.0129  0.0811  438 GLY A N     
606  C CA    . GLY A 48 ? 0.3570 0.4369 0.4245 0.0696  0.0059  0.0707  438 GLY A CA    
607  C C     . GLY A 48 ? 0.3112 0.3681 0.3630 0.0620  -0.0033 0.0530  438 GLY A C     
608  O O     . GLY A 48 ? 0.3085 0.3578 0.3620 0.0603  -0.0095 0.0463  438 GLY A O     
612  N N     . TRP A 49 ? 0.4499 0.4961 0.4893 0.0578  -0.0037 0.0469  439 TRP A N     
613  C CA    . TRP A 49 ? 0.3729 0.4001 0.4028 0.0522  -0.0104 0.0322  439 TRP A CA    
614  C C     . TRP A 49 ? 0.4040 0.4280 0.4403 0.0348  -0.0161 0.0329  439 TRP A C     
615  O O     . TRP A 49 ? 0.4766 0.5067 0.5179 0.0220  -0.0176 0.0429  439 TRP A O     
616  C CB    . TRP A 49 ? 0.4275 0.4459 0.4470 0.0510  -0.0091 0.0285  439 TRP A CB    
617  C CG    . TRP A 49 ? 0.4699 0.4808 0.4756 0.0677  -0.0086 0.0209  439 TRP A CG    
618  C CD1   . TRP A 49 ? 0.4700 0.4860 0.4651 0.0812  -0.0019 0.0267  439 TRP A CD1   
619  C CD2   . TRP A 49 ? 0.5466 0.5422 0.5462 0.0725  -0.0164 0.0070  439 TRP A CD2   
620  N NE1   . TRP A 49 ? 0.4741 0.4755 0.4507 0.0943  -0.0063 0.0157  439 TRP A NE1   
621  C CE2   . TRP A 49 ? 0.5199 0.5092 0.5016 0.0883  -0.0169 0.0037  439 TRP A CE2   
622  C CE3   . TRP A 49 ? 0.5562 0.5428 0.5646 0.0647  -0.0231 -0.0016 439 TRP A CE3   
623  C CZ2   . TRP A 49 ? 0.5323 0.5057 0.5052 0.0951  -0.0276 -0.0086 439 TRP A CZ2   
624  C CZ3   . TRP A 49 ? 0.5216 0.4963 0.5277 0.0714  -0.0316 -0.0120 439 TRP A CZ3   
625  C CH2   . TRP A 49 ? 0.5371 0.5047 0.5258 0.0857  -0.0357 -0.0157 439 TRP A CH2   
636  N N     . LYS A 50 ? 0.5531 0.5657 0.5880 0.0340  -0.0202 0.0230  440 LYS A N     
637  C CA    . LYS A 50 ? 0.5647 0.5705 0.5997 0.0195  -0.0235 0.0230  440 LYS A CA    
638  C C     . LYS A 50 ? 0.5513 0.5420 0.5816 0.0179  -0.0224 0.0119  440 LYS A C     
639  O O     . LYS A 50 ? 0.5281 0.5151 0.5605 0.0281  -0.0232 0.0044  440 LYS A O     
640  C CB    . LYS A 50 ? 0.6099 0.6199 0.6534 0.0202  -0.0276 0.0266  440 LYS A CB    
641  C CG    . LYS A 50 ? 0.6185 0.6463 0.6732 0.0260  -0.0275 0.0387  440 LYS A CG    
642  C CD    . LYS A 50 ? 0.6119 0.6420 0.6765 0.0298  -0.0314 0.0419  440 LYS A CD    
643  C CE    . LYS A 50 ? 0.6616 0.7110 0.7417 0.0392  -0.0288 0.0547  440 LYS A CE    
644  N NZ    . LYS A 50 ? 0.7673 0.8177 0.8586 0.0450  -0.0324 0.0583  440 LYS A NZ    
658  N N     . PHE A 51 ? 0.4779 0.4589 0.5013 0.0054  -0.0208 0.0118  441 PHE A N     
659  C CA    . PHE A 51 ? 0.4658 0.4344 0.4878 0.0045  -0.0160 0.0039  441 PHE A CA    
660  C C     . PHE A 51 ? 0.4859 0.4458 0.5036 -0.0044 -0.0134 0.0046  441 PHE A C     
661  O O     . PHE A 51 ? 0.3674 0.3263 0.3752 -0.0132 -0.0163 0.0109  441 PHE A O     
662  C CB    . PHE A 51 ? 0.3617 0.3222 0.3739 0.0015  -0.0114 0.0025  441 PHE A CB    
663  C CG    . PHE A 51 ? 0.3845 0.3526 0.3993 0.0101  -0.0129 0.0038  441 PHE A CG    
664  C CD1   . PHE A 51 ? 0.4454 0.4122 0.4662 0.0205  -0.0130 -0.0021 441 PHE A CD1   
665  C CD2   . PHE A 51 ? 0.4823 0.4595 0.4947 0.0078  -0.0146 0.0126  441 PHE A CD2   
666  C CE1   . PHE A 51 ? 0.4892 0.4607 0.5070 0.0291  -0.0143 -0.0001 441 PHE A CE1   
667  C CE2   . PHE A 51 ? 0.5144 0.4986 0.5278 0.0165  -0.0134 0.0159  441 PHE A CE2   
668  C CZ    . PHE A 51 ? 0.5120 0.4920 0.5249 0.0276  -0.0130 0.0090  441 PHE A CZ    
678  N N     . ALA A 52 ? 0.5052 0.4592 0.5313 -0.0020 -0.0081 -0.0003 442 ALA A N     
679  C CA    . ALA A 52 ? 0.5030 0.4484 0.5251 -0.0089 -0.0017 0.0016  442 ALA A CA    
680  C C     . ALA A 52 ? 0.4990 0.4283 0.5002 -0.0148 0.0092  0.0001  442 ALA A C     
681  O O     . ALA A 52 ? 0.5495 0.4675 0.5339 -0.0217 0.0149  0.0029  442 ALA A O     
682  C CB    . ALA A 52 ? 0.4567 0.4053 0.5034 -0.0036 0.0000  -0.0001 442 ALA A CB    
688  N N     . ARG A 53 ? 0.3810 0.3061 0.3799 -0.0114 0.0124  -0.0042 443 ARG A N     
689  C CA    . ARG A 53 ? 0.3846 0.2897 0.3613 -0.0152 0.0230  -0.0071 443 ARG A CA    
690  C C     . ARG A 53 ? 0.3877 0.2856 0.3453 -0.0213 0.0157  -0.0066 443 ARG A C     
691  O O     . ARG A 53 ? 0.3873 0.2985 0.3571 -0.0179 0.0079  -0.0048 443 ARG A O     
692  C CB    . ARG A 53 ? 0.4508 0.3541 0.4440 -0.0059 0.0336  -0.0113 443 ARG A CB    
693  C CG    . ARG A 53 ? 0.4412 0.3623 0.4699 0.0019  0.0309  -0.0103 443 ARG A CG    
694  C CD    . ARG A 53 ? 0.5007 0.4205 0.5497 0.0089  0.0432  -0.0110 443 ARG A CD    
695  N NE    . ARG A 53 ? 0.5550 0.4639 0.5951 0.0130  0.0488  -0.0144 443 ARG A NE    
696  C CZ    . ARG A 53 ? 0.4771 0.3873 0.5393 0.0216  0.0570  -0.0142 443 ARG A CZ    
697  N NH1   . ARG A 53 ? 0.4156 0.3397 0.5128 0.0259  0.0596  -0.0101 443 ARG A NH1   
698  N NH2   . ARG A 53 ? 0.4799 0.3776 0.5323 0.0255  0.0618  -0.0169 443 ARG A NH2   
712  N N     . SER A 54 ? 0.4760 0.3511 0.4022 -0.0305 0.0182  -0.0077 444 SER A N     
713  C CA    . SER A 54 ? 0.5721 0.4376 0.4815 -0.0392 0.0087  -0.0061 444 SER A CA    
714  C C     . SER A 54 ? 0.5636 0.4271 0.4820 -0.0329 0.0118  -0.0092 444 SER A C     
715  O O     . SER A 54 ? 0.4782 0.3521 0.4055 -0.0347 0.0029  -0.0042 444 SER A O     
716  C CB    . SER A 54 ? 0.7247 0.5584 0.5932 -0.0504 0.0091  -0.0087 444 SER A CB    
717  O OG    . SER A 54 ? 0.8212 0.6310 0.6734 -0.0441 0.0259  -0.0171 444 SER A OG    
723  N N     . ASP A 55 ? 0.4994 0.3502 0.4175 -0.0247 0.0255  -0.0157 445 ASP A N     
724  C CA    . ASP A 55 ? 0.4839 0.3288 0.4083 -0.0187 0.0283  -0.0179 445 ASP A CA    
725  C C     . ASP A 55 ? 0.4084 0.2800 0.3612 -0.0115 0.0206  -0.0132 445 ASP A C     
726  O O     . ASP A 55 ? 0.4249 0.2945 0.3793 -0.0103 0.0174  -0.0110 445 ASP A O     
727  C CB    . ASP A 55 ? 0.6373 0.4686 0.5641 -0.0086 0.0452  -0.0238 445 ASP A CB    
728  C CG    . ASP A 55 ? 0.6297 0.4808 0.5836 -0.0004 0.0518  -0.0225 445 ASP A CG    
729  O OD1   . ASP A 55 ? 0.6197 0.4806 0.5737 -0.0052 0.0481  -0.0198 445 ASP A OD1   
730  O OD2   . ASP A 55 ? 0.6489 0.5054 0.6266 0.0104  0.0596  -0.0231 445 ASP A OD2   
735  N N     . ASP A 56 ? 0.4244 0.3180 0.3966 -0.0064 0.0173  -0.0115 446 ASP A N     
736  C CA    . ASP A 56 ? 0.3296 0.2433 0.3208 0.0020  0.0099  -0.0086 446 ASP A CA    
737  C C     . ASP A 56 ? 0.3678 0.2904 0.3536 -0.0032 0.0016  -0.0012 446 ASP A C     
738  O O     . ASP A 56 ? 0.3392 0.2698 0.3306 0.0026  -0.0009 0.0027  446 ASP A O     
739  C CB    . ASP A 56 ? 0.3197 0.2485 0.3291 0.0084  0.0071  -0.0100 446 ASP A CB    
740  C CG    . ASP A 56 ? 0.4584 0.3856 0.4855 0.0156  0.0129  -0.0140 446 ASP A CG    
741  O OD1   . ASP A 56 ? 0.4131 0.3341 0.4440 0.0207  0.0165  -0.0151 446 ASP A OD1   
742  O OD2   . ASP A 56 ? 0.5422 0.4748 0.5825 0.0161  0.0135  -0.0145 446 ASP A OD2   
747  N N     . LEU A 57 ? 0.4054 0.3276 0.3818 -0.0138 -0.0025 0.0026  447 LEU A N     
748  C CA    . LEU A 57 ? 0.3294 0.2627 0.3072 -0.0199 -0.0102 0.0126  447 LEU A CA    
749  C C     . LEU A 57 ? 0.4082 0.3284 0.3776 -0.0267 -0.0112 0.0160  447 LEU A C     
750  O O     . LEU A 57 ? 0.3961 0.3285 0.3753 -0.0247 -0.0133 0.0246  447 LEU A O     
751  C CB    . LEU A 57 ? 0.3348 0.2695 0.3067 -0.0309 -0.0168 0.0172  447 LEU A CB    
752  C CG    . LEU A 57 ? 0.3955 0.3424 0.3740 -0.0397 -0.0261 0.0302  447 LEU A CG    
753  C CD1   . LEU A 57 ? 0.4420 0.4148 0.4422 -0.0276 -0.0241 0.0377  447 LEU A CD1   
754  C CD2   . LEU A 57 ? 0.4166 0.3649 0.3910 -0.0502 -0.0350 0.0354  447 LEU A CD2   
766  N N     . THR A 58 ? 0.4079 0.3009 0.3575 -0.0342 -0.0088 0.0096  448 THR A N     
767  C CA    . THR A 58 ? 0.4498 0.3236 0.3896 -0.0402 -0.0101 0.0110  448 THR A CA    
768  C C     . THR A 58 ? 0.4074 0.2899 0.3622 -0.0282 -0.0055 0.0131  448 THR A C     
769  O O     . THR A 58 ? 0.4263 0.3145 0.3876 -0.0310 -0.0094 0.0228  448 THR A O     
770  C CB    . THR A 58 ? 0.5429 0.3812 0.4559 -0.0441 -0.0042 0.0002  448 THR A CB    
771  O OG1   . THR A 58 ? 0.5729 0.4018 0.4666 -0.0535 -0.0079 -0.0021 448 THR A OG1   
772  C CG2   . THR A 58 ? 0.5402 0.3523 0.4390 -0.0525 -0.0083 0.0011  448 THR A CG2   
780  N N     . ARG A 59 ? 0.4781 0.3622 0.4398 -0.0151 0.0022  0.0057  449 ARG A N     
781  C CA    . ARG A 59 ? 0.4865 0.3772 0.4602 -0.0032 0.0042  0.0077  449 ARG A CA    
782  C C     . ARG A 59 ? 0.4523 0.3679 0.4363 0.0018  -0.0006 0.0170  449 ARG A C     
783  O O     . ARG A 59 ? 0.4662 0.3844 0.4520 0.0040  -0.0012 0.0253  449 ARG A O     
784  C CB    . ARG A 59 ? 0.4803 0.3716 0.4643 0.0088  0.0098  -0.0004 449 ARG A CB    
785  C CG    . ARG A 59 ? 0.5762 0.4696 0.5709 0.0205  0.0096  0.0015  449 ARG A CG    
786  C CD    . ARG A 59 ? 0.5245 0.4207 0.5358 0.0306  0.0125  -0.0046 449 ARG A CD    
787  N NE    . ARG A 59 ? 0.5164 0.4313 0.5381 0.0345  0.0062  -0.0062 449 ARG A NE    
788  C CZ    . ARG A 59 ? 0.5210 0.4421 0.5619 0.0415  0.0047  -0.0097 449 ARG A CZ    
789  N NH1   . ARG A 59 ? 0.5269 0.4409 0.5821 0.0462  0.0107  -0.0106 449 ARG A NH1   
790  N NH2   . ARG A 59 ? 0.4616 0.3955 0.5098 0.0437  -0.0032 -0.0114 449 ARG A NH2   
804  N N     . HIS A 60 ? 0.5558 0.4885 0.5456 0.0047  -0.0028 0.0164  450 HIS A N     
805  C CA    . HIS A 60 ? 0.4576 0.4114 0.4538 0.0119  -0.0048 0.0245  450 HIS A CA    
806  C C     . HIS A 60 ? 0.4215 0.3819 0.4197 0.0030  -0.0058 0.0384  450 HIS A C     
807  O O     . HIS A 60 ? 0.4204 0.3938 0.4226 0.0104  -0.0032 0.0481  450 HIS A O     
808  C CB    . HIS A 60 ? 0.4705 0.4366 0.4715 0.0151  -0.0069 0.0213  450 HIS A CB    
809  C CG    . HIS A 60 ? 0.5137 0.4992 0.5198 0.0207  -0.0069 0.0309  450 HIS A CG    
810  N ND1   . HIS A 60 ? 0.5695 0.5625 0.5728 0.0365  -0.0050 0.0311  450 HIS A ND1   
811  C CD2   . HIS A 60 ? 0.5521 0.5507 0.5658 0.0138  -0.0078 0.0415  450 HIS A CD2   
812  C CE1   . HIS A 60 ? 0.5420 0.5513 0.5498 0.0406  -0.0018 0.0410  450 HIS A CE1   
813  N NE2   . HIS A 60 ? 0.5550 0.5703 0.5731 0.0268  -0.0036 0.0484  450 HIS A NE2   
821  N N     . TYR A 61 ? 0.4886 0.4393 0.4836 -0.0130 -0.0099 0.0405  451 TYR A N     
822  C CA    . TYR A 61 ? 0.5107 0.4702 0.5142 -0.0240 -0.0141 0.0558  451 TYR A CA    
823  C C     . TYR A 61 ? 0.5097 0.4625 0.5143 -0.0246 -0.0120 0.0639  451 TYR A C     
824  O O     . TYR A 61 ? 0.4949 0.4646 0.5132 -0.0262 -0.0113 0.0802  451 TYR A O     
825  C CB    . TYR A 61 ? 0.5083 0.4539 0.5046 -0.0426 -0.0234 0.0554  451 TYR A CB    
826  C CG    . TYR A 61 ? 0.4917 0.4566 0.5055 -0.0535 -0.0314 0.0722  451 TYR A CG    
827  C CD1   . TYR A 61 ? 0.5576 0.5119 0.5735 -0.0712 -0.0414 0.0819  451 TYR A CD1   
828  C CD2   . TYR A 61 ? 0.4762 0.4692 0.5069 -0.0460 -0.0298 0.0793  451 TYR A CD2   
829  C CE1   . TYR A 61 ? 0.5846 0.5596 0.6235 -0.0823 -0.0505 0.1000  451 TYR A CE1   
830  C CE2   . TYR A 61 ? 0.5244 0.5384 0.5774 -0.0548 -0.0363 0.0971  451 TYR A CE2   
831  C CZ    . TYR A 61 ? 0.5843 0.5912 0.6436 -0.0735 -0.0471 0.1083  451 TYR A CZ    
832  O OH    . TYR A 61 ? 0.6109 0.6416 0.6991 -0.0834 -0.0554 0.1286  451 TYR A OH    
842  N N     . ARG A 62 ? 0.4487 0.3779 0.4414 -0.0226 -0.0099 0.0545  452 ARG A N     
843  C CA    . ARG A 62 ? 0.4545 0.3749 0.4482 -0.0226 -0.0084 0.0628  452 ARG A CA    
844  C C     . ARG A 62 ? 0.5026 0.4459 0.5046 -0.0085 -0.0025 0.0738  452 ARG A C     
845  O O     . ARG A 62 ? 0.4800 0.4259 0.4879 -0.0107 -0.0008 0.0884  452 ARG A O     
846  C CB    . ARG A 62 ? 0.5012 0.3942 0.4830 -0.0181 -0.0056 0.0505  452 ARG A CB    
847  C CG    . ARG A 62 ? 0.5900 0.4541 0.5566 -0.0298 -0.0081 0.0395  452 ARG A CG    
848  C CD    . ARG A 62 ? 0.6740 0.5079 0.6310 -0.0261 -0.0037 0.0325  452 ARG A CD    
849  N NE    . ARG A 62 ? 0.7727 0.5746 0.7086 -0.0343 -0.0031 0.0204  452 ARG A NE    
850  C CZ    . ARG A 62 ? 0.8144 0.6062 0.7424 -0.0260 0.0057  0.0074  452 ARG A CZ    
851  N NH1   . ARG A 62 ? 0.8291 0.6412 0.7734 -0.0110 0.0121  0.0049  452 ARG A NH1   
852  N NH2   . ARG A 62 ? 0.8432 0.6027 0.7459 -0.0328 0.0079  -0.0024 452 ARG A NH2   
866  N N     . LYS A 63 ? 0.5894 0.5469 0.5897 0.0060  0.0006  0.0675  453 LYS A N     
867  C CA    . LYS A 63 ? 0.5135 0.4887 0.5133 0.0210  0.0063  0.0764  453 LYS A CA    
868  C C     . LYS A 63 ? 0.5211 0.5173 0.5345 0.0164  0.0106  0.0957  453 LYS A C     
869  O O     . LYS A 63 ? 0.5584 0.5647 0.5713 0.0253  0.0182  0.1090  453 LYS A O     
870  C CB    . LYS A 63 ? 0.5940 0.5761 0.5873 0.0350  0.0061  0.0644  453 LYS A CB    
871  C CG    . LYS A 63 ? 0.6957 0.6928 0.6816 0.0517  0.0120  0.0712  453 LYS A CG    
872  C CD    . LYS A 63 ? 0.6250 0.6245 0.6049 0.0621  0.0091  0.0583  453 LYS A CD    
873  C CE    . LYS A 63 ? 0.6952 0.7077 0.6657 0.0779  0.0169  0.0652  453 LYS A CE    
874  N NZ    . LYS A 63 ? 0.7112 0.7244 0.6789 0.0853  0.0136  0.0535  453 LYS A NZ    
888  N N     . HIS A 64 ? 0.5462 0.5499 0.5728 0.0030  0.0061  0.0990  454 HIS A N     
889  C CA    . HIS A 64 ? 0.5808 0.6083 0.6287 -0.0024 0.0090  0.1198  454 HIS A CA    
890  C C     . HIS A 64 ? 0.5840 0.6043 0.6447 -0.0213 0.0034  0.1339  454 HIS A C     
891  O O     . HIS A 64 ? 0.5666 0.6065 0.6475 -0.0233 0.0086  0.1557  454 HIS A O     
892  C CB    . HIS A 64 ? 0.5489 0.5903 0.6091 -0.0078 0.0042  0.1191  454 HIS A CB    
893  C CG    . HIS A 64 ? 0.5532 0.6010 0.6041 0.0095  0.0088  0.1071  454 HIS A CG    
894  N ND1   . HIS A 64 ? 0.5652 0.6258 0.6111 0.0299  0.0203  0.1107  454 HIS A ND1   
895  C CD2   . HIS A 64 ? 0.5517 0.5923 0.5961 0.0091  0.0030  0.0920  454 HIS A CD2   
896  C CE1   . HIS A 64 ? 0.5479 0.6067 0.5845 0.0408  0.0195  0.0970  454 HIS A CE1   
897  N NE2   . HIS A 64 ? 0.6000 0.6485 0.6383 0.0280  0.0093  0.0865  454 HIS A NE2   
905  N N     . THR A 65 ? 0.5126 0.5040 0.5623 -0.0350 -0.0068 0.1226  455 THR A N     
906  C CA    . THR A 65 ? 0.5080 0.4849 0.5661 -0.0550 -0.0158 0.1333  455 THR A CA    
907  C C     . THR A 65 ? 0.5251 0.4869 0.5782 -0.0519 -0.0113 0.1386  455 THR A C     
908  O O     . THR A 65 ? 0.6138 0.5675 0.6789 -0.0671 -0.0173 0.1526  455 THR A O     
909  C CB    . THR A 65 ? 0.5560 0.5020 0.5975 -0.0706 -0.0290 0.1176  455 THR A CB    
910  O OG1   . THR A 65 ? 0.7533 0.6718 0.7704 -0.0617 -0.0248 0.0985  455 THR A OG1   
911  C CG2   . THR A 65 ? 0.5114 0.4695 0.5536 -0.0725 -0.0337 0.1116  455 THR A CG2   
919  N N     . GLY A 66 ? 0.5707 0.6496 0.5810 -0.2417 0.0472  -0.2001 456 GLY A N     
920  C CA    . GLY A 66 ? 0.6926 0.7381 0.6550 -0.2404 0.0030  -0.1779 456 GLY A CA    
921  C C     . GLY A 66 ? 0.6776 0.6738 0.6463 -0.2066 -0.0289 -0.1702 456 GLY A C     
922  O O     . GLY A 66 ? 0.7853 0.7410 0.7171 -0.2053 -0.0650 -0.1451 456 GLY A O     
926  N N     . HIS A 67 ? 0.7231 0.7225 0.7383 -0.1761 -0.0145 -0.1891 457 HIS A N     
927  C CA    . HIS A 67 ? 0.7519 0.7090 0.7734 -0.1385 -0.0421 -0.1862 457 HIS A CA    
928  C C     . HIS A 67 ? 0.7833 0.7422 0.8043 -0.1202 -0.0696 -0.1874 457 HIS A C     
929  O O     . HIS A 67 ? 0.7168 0.7196 0.7799 -0.1064 -0.0535 -0.2094 457 HIS A O     
930  C CB    . HIS A 67 ? 0.6613 0.6357 0.7301 -0.1050 -0.0133 -0.2050 457 HIS A CB    
931  C CG    . HIS A 67 ? 0.6407 0.5744 0.7102 -0.0634 -0.0385 -0.2046 457 HIS A CG    
932  N ND1   . HIS A 67 ? 0.5750 0.5262 0.6803 -0.0206 -0.0162 -0.2180 457 HIS A ND1   
933  C CD2   . HIS A 67 ? 0.7012 0.5790 0.7413 -0.0550 -0.0822 -0.1926 457 HIS A CD2   
934  C CE1   . HIS A 67 ? 0.6339 0.5442 0.7266 0.0130  -0.0471 -0.2180 457 HIS A CE1   
935  N NE2   . HIS A 67 ? 0.7248 0.5877 0.7816 -0.0085 -0.0879 -0.2044 457 HIS A NE2   
943  N N     . ARG A 68 ? 0.9662 0.8786 0.9471 -0.1197 -0.1104 -0.1631 458 ARG A N     
944  C CA    . ARG A 68 ? 0.9845 0.8961 0.9591 -0.1005 -0.1418 -0.1591 458 ARG A CA    
945  C C     . ARG A 68 ? 0.9456 0.7974 0.9204 -0.0675 -0.1727 -0.1484 458 ARG A C     
946  O O     . ARG A 68 ? 1.0392 0.8405 0.9793 -0.0738 -0.2028 -0.1201 458 ARG A O     
947  C CB    . ARG A 68 ? 1.1026 1.0207 1.0249 -0.1268 -0.1610 -0.1349 458 ARG A CB    
948  C CG    . ARG A 68 ? 1.0390 1.0224 0.9578 -0.1549 -0.1338 -0.1517 458 ARG A CG    
949  C CD    . ARG A 68 ? 1.1229 1.1171 0.9794 -0.1733 -0.1534 -0.1250 458 ARG A CD    
950  N NE    . ARG A 68 ? 1.1371 1.1986 0.9865 -0.1963 -0.1295 -0.1472 458 ARG A NE    
951  C CZ    . ARG A 68 ? 1.2515 1.3415 1.0437 -0.2101 -0.1391 -0.1306 458 ARG A CZ    
952  N NH1   . ARG A 68 ? 1.3790 1.4349 1.1178 -0.2031 -0.1696 -0.0848 458 ARG A NH1   
953  N NH2   . ARG A 68 ? 1.2205 1.3747 1.0097 -0.2279 -0.1166 -0.1589 458 ARG A NH2   
967  N N     . PRO A 69 ? 0.7660 0.6220 0.7829 -0.0297 -0.1639 -0.1692 459 PRO A N     
968  C CA    . PRO A 69 ? 0.7745 0.5755 0.7908 0.0054  -0.1918 -0.1645 459 PRO A CA    
969  C C     . PRO A 69 ? 0.8362 0.6230 0.8493 0.0272  -0.2263 -0.1540 459 PRO A C     
970  O O     . PRO A 69 ? 0.9052 0.6351 0.9031 0.0438  -0.2583 -0.1395 459 PRO A O     
971  C CB    . PRO A 69 ? 0.7272 0.5509 0.7864 0.0418  -0.1625 -0.1893 459 PRO A CB    
972  C CG    . PRO A 69 ? 0.6730 0.5625 0.7646 0.0250  -0.1179 -0.2032 459 PRO A CG    
973  C CD    . PRO A 69 ? 0.7217 0.6334 0.7929 -0.0142 -0.1257 -0.1963 459 PRO A CD    
981  N N     . PHE A 70 ? 0.7142 0.5541 0.7473 0.0282  -0.2209 -0.1637 460 PHE A N     
982  C CA    . PHE A 70 ? 0.7470 0.5864 0.7845 0.0521  -0.2533 -0.1574 460 PHE A CA    
983  C C     . PHE A 70 ? 0.8163 0.6378 0.7978 0.0292  -0.2849 -0.1256 460 PHE A C     
984  O O     . PHE A 70 ? 0.8360 0.7011 0.7963 0.0008  -0.2783 -0.1248 460 PHE A O     
985  C CB    . PHE A 70 ? 0.6982 0.6077 0.7904 0.0620  -0.2361 -0.1851 460 PHE A CB    
986  C CG    . PHE A 70 ? 0.6316 0.5637 0.7851 0.0840  -0.1952 -0.2083 460 PHE A CG    
987  C CD1   . PHE A 70 ? 0.5799 0.5505 0.7566 0.0617  -0.1524 -0.2237 460 PHE A CD1   
988  C CD2   . PHE A 70 ? 0.6251 0.5407 0.8127 0.1303  -0.1968 -0.2112 460 PHE A CD2   
989  C CE1   . PHE A 70 ? 0.5240 0.5169 0.7587 0.0864  -0.1107 -0.2376 460 PHE A CE1   
990  C CE2   . PHE A 70 ? 0.5705 0.5108 0.8120 0.1563  -0.1548 -0.2255 460 PHE A CE2   
991  C CZ    . PHE A 70 ? 0.5206 0.4994 0.7862 0.1349  -0.1111 -0.2367 460 PHE A CZ    
1001 N N     . GLN A 71 ? 1.1371 0.8349 0.9220 -0.2148 0.0062  0.1840  461 GLN A N     
1002 C CA    . GLN A 71 ? 1.1092 0.8700 0.9778 -0.1844 0.0034  0.2128  461 GLN A CA    
1003 C C     . GLN A 71 ? 1.1171 0.9331 1.0144 -0.1521 0.0478  0.1914  461 GLN A C     
1004 O O     . GLN A 71 ? 1.1179 0.8832 0.9671 -0.1571 0.0715  0.1605  461 GLN A O     
1005 C CB    . GLN A 71 ? 1.1798 0.8681 1.0373 -0.1985 -0.0265 0.2333  461 GLN A CB    
1006 C CG    . GLN A 71 ? 1.1409 0.8813 1.0759 -0.1694 -0.0276 0.2619  461 GLN A CG    
1007 C CD    . GLN A 71 ? 1.0060 0.8395 1.0219 -0.1512 -0.0408 0.2938  461 GLN A CD    
1008 O OE1   . GLN A 71 ? 1.0363 0.8622 1.0618 -0.1689 -0.0755 0.3157  461 GLN A OE1   
1009 N NE2   . GLN A 71 ? 0.8576 0.7798 0.9327 -0.1158 -0.0132 0.2958  461 GLN A NE2   
1018 N N     . CYS A 72 ? 1.1470 1.0664 1.1228 -0.1192 0.0585  0.2071  462 CYS A N     
1019 C CA    . CYS A 72 ? 1.1775 1.1547 1.1920 -0.0841 0.0937  0.1936  462 CYS A CA    
1020 C C     . CYS A 72 ? 1.2516 1.1944 1.2822 -0.0735 0.0850  0.2109  462 CYS A C     
1021 O O     . CYS A 72 ? 1.2283 1.1695 1.2927 -0.0745 0.0550  0.2479  462 CYS A O     
1022 C CB    . CYS A 72 ? 1.0924 1.1860 1.1833 -0.0536 0.1033  0.2087  462 CYS A CB    
1023 S SG    . CYS A 72 ? 0.6499 0.8266 0.7917 -0.0074 0.1445  0.1915  462 CYS A SG    
1028 N N     . GLN A 73 ? 1.1406 1.0532 1.1466 -0.0643 0.1118  0.1831  463 GLN A N     
1029 C CA    . GLN A 73 ? 1.2729 1.1382 1.2827 -0.0573 0.1050  0.1959  463 GLN A CA    
1030 C C     . GLN A 73 ? 1.3096 1.2499 1.3910 -0.0131 0.1193  0.2104  463 GLN A C     
1031 O O     . GLN A 73 ? 1.4324 1.3519 1.5360 -0.0048 0.1043  0.2371  463 GLN A O     
1032 C CB    . GLN A 73 ? 1.2561 1.0342 1.1953 -0.0740 0.1239  0.1586  463 GLN A CB    
1033 C CG    . GLN A 73 ? 1.1816 0.8653 1.0406 -0.1207 0.1042  0.1490  463 GLN A CG    
1034 C CD    . GLN A 73 ? 1.2249 0.8033 1.0214 -0.1408 0.1069  0.1317  463 GLN A CD    
1035 O OE1   . GLN A 73 ? 1.2401 0.8159 1.0473 -0.1199 0.1314  0.1174  463 GLN A OE1   
1036 N NE2   . GLN A 73 ? 1.2314 0.7208 0.9615 -0.1816 0.0807  0.1330  463 GLN A NE2   
1045 N N     . LYS A 74 ? 1.2679 1.2930 1.3839 0.0149  0.1476  0.1932  464 LYS A N     
1046 C CA    . LYS A 74 ? 1.1149 1.2206 1.3026 0.0567  0.1548  0.2132  464 LYS A CA    
1047 C C     . LYS A 74 ? 0.9429 1.0913 1.1791 0.0575  0.1265  0.2580  464 LYS A C     
1048 O O     . LYS A 74 ? 0.9822 1.1341 1.2540 0.0724  0.1134  0.2894  464 LYS A O     
1049 C CB    . LYS A 74 ? 1.1407 1.3320 1.3548 0.0837  0.1882  0.1848  464 LYS A CB    
1050 C CG    . LYS A 74 ? 1.2659 1.4305 1.4437 0.0868  0.2208  0.1370  464 LYS A CG    
1051 C CD    . LYS A 74 ? 1.1543 1.4136 1.3649 0.1109  0.2505  0.1110  464 LYS A CD    
1052 C CE    . LYS A 74 ? 1.0468 1.2966 1.2379 0.1212  0.2859  0.0627  464 LYS A CE    
1053 N NZ    . LYS A 74 ? 0.8727 1.2243 1.1057 0.1479  0.3129  0.0395  464 LYS A NZ    
1067 N N     . CYS A 75 ? 1.0137 1.1936 1.2512 0.0412  0.1181  0.2605  465 CYS A N     
1068 C CA    . CYS A 75 ? 0.8488 1.0745 1.1331 0.0395  0.0939  0.2982  465 CYS A CA    
1069 C C     . CYS A 75 ? 0.7664 0.9155 1.0180 0.0014  0.0583  0.3149  465 CYS A C     
1070 O O     . CYS A 75 ? 0.8404 0.9004 1.0344 -0.0211 0.0520  0.3009  465 CYS A O     
1071 C CB    . CYS A 75 ? 0.9993 1.3092 1.3069 0.0474  0.1090  0.2876  465 CYS A CB    
1072 S SG    . CYS A 75 ? 0.8589 1.2407 1.2297 0.0489  0.0870  0.3280  465 CYS A SG    
1078 N N     . ASP A 76 ? 0.9386 1.1775 1.2159 0.0949  -0.0624 0.4024  466 ASP A N     
1079 C CA    . ASP A 76 ? 0.9871 1.2271 1.3215 0.0870  -0.0485 0.4057  466 ASP A CA    
1080 C C     . ASP A 76 ? 0.9650 1.2027 1.2769 0.0954  -0.0316 0.4048  466 ASP A C     
1081 O O     . ASP A 76 ? 0.9435 1.1912 1.2985 0.0974  -0.0070 0.4222  466 ASP A O     
1082 C CB    . ASP A 76 ? 1.0619 1.3110 1.4402 0.0894  -0.0255 0.4410  466 ASP A CB    
1083 C CG    . ASP A 76 ? 1.1300 1.3720 1.5399 0.0767  -0.0413 0.4430  466 ASP A CG    
1084 O OD1   . ASP A 76 ? 1.1184 1.3440 1.5359 0.0623  -0.0644 0.4190  466 ASP A OD1   
1085 O OD2   . ASP A 76 ? 1.1765 1.4215 1.5968 0.0836  -0.0275 0.4700  466 ASP A OD2   
1090 N N     . ARG A 77 ? 0.7589 0.9849 1.0021 0.0994  -0.0429 0.3891  467 ARG A N     
1091 C CA    . ARG A 77 ? 0.7201 0.9280 0.9228 0.1076  -0.0253 0.3868  467 ARG A CA    
1092 C C     . ARG A 77 ? 0.6070 0.8254 0.8482 0.0924  -0.0507 0.3512  467 ARG A C     
1093 O O     . ARG A 77 ? 0.5905 0.8158 0.8380 0.0766  -0.0840 0.3212  467 ARG A O     
1094 C CB    . ARG A 77 ? 0.8098 0.9823 0.8870 0.1053  -0.0214 0.3777  467 ARG A CB    
1095 C CG    . ARG A 77 ? 0.9403 1.0692 0.9429 0.1215  0.0249  0.4064  467 ARG A CG    
1096 C CD    . ARG A 77 ? 1.0728 1.1399 0.9953 0.1312  0.0740  0.3961  467 ARG A CD    
1097 N NE    . ARG A 77 ? 1.1802 1.2039 0.9860 0.1048  0.0571  0.3530  467 ARG A NE    
1098 C CZ    . ARG A 77 ? 1.2986 1.2616 1.0266 0.1052  0.0895  0.3303  467 ARG A CZ    
1099 N NH1   . ARG A 77 ? 1.2626 1.2080 1.0246 0.1374  0.1438  0.3506  467 ARG A NH1   
1100 N NH2   . ARG A 77 ? 1.3607 1.2821 0.9773 0.0724  0.0682  0.2920  467 ARG A NH2   
1114 N N     . ALA A 78 ? 0.4926 0.7074 0.7557 0.0988  -0.0283 0.3544  468 ALA A N     
1115 C CA    . ALA A 78 ? 0.4149 0.6338 0.7071 0.0841  -0.0480 0.3207  468 ALA A CA    
1116 C C     . ALA A 78 ? 0.4370 0.6281 0.6644 0.0960  -0.0244 0.3085  468 ALA A C     
1117 O O     . ALA A 78 ? 0.5040 0.6601 0.6650 0.1132  0.0213  0.3232  468 ALA A O     
1118 C CB    . ALA A 78 ? 0.3743 0.6090 0.7455 0.0673  -0.0432 0.3265  468 ALA A CB    
1124 N N     . PHE A 79 ? 0.3818 0.5719 0.6113 0.0825  -0.0478 0.2707  469 PHE A N     
1125 C CA    . PHE A 79 ? 0.4169 0.5670 0.5685 0.0840  -0.0250 0.2409  469 PHE A CA    
1126 C C     . PHE A 79 ? 0.4166 0.5820 0.6302 0.0819  -0.0334 0.2285  469 PHE A C     
1127 O O     . PHE A 79 ? 0.3348 0.5314 0.6275 0.0685  -0.0691 0.2276  469 PHE A O     
1128 C CB    . PHE A 79 ? 0.4463 0.5735 0.5053 0.0617  -0.0501 0.2007  469 PHE A CB    
1129 C CG    . PHE A 79 ? 0.5615 0.6815 0.5595 0.0563  -0.0532 0.2156  469 PHE A CG    
1130 C CD1   . PHE A 79 ? 0.4771 0.6427 0.5312 0.0524  -0.0880 0.2314  469 PHE A CD1   
1131 C CD2   . PHE A 79 ? 0.7107 0.7688 0.5855 0.0552  -0.0188 0.2159  469 PHE A CD2   
1132 C CE1   . PHE A 79 ? 0.5255 0.6905 0.5266 0.0482  -0.0922 0.2498  469 PHE A CE1   
1133 C CE2   . PHE A 79 ? 0.7615 0.8098 0.5720 0.0456  -0.0256 0.2314  469 PHE A CE2   
1134 C CZ    . PHE A 79 ? 0.6686 0.7782 0.5490 0.0425  -0.0643 0.2497  469 PHE A CZ    
1144 N N     . SER A 80 ? 0.5418 0.6724 0.7047 0.0939  0.0033  0.2182  470 SER A N     
1145 C CA    . SER A 80 ? 0.4006 0.5439 0.6132 0.0946  -0.0001 0.2089  470 SER A CA    
1146 C C     . SER A 80 ? 0.3826 0.5109 0.5618 0.0717  -0.0365 0.1536  470 SER A C     
1147 O O     . SER A 80 ? 0.4979 0.6379 0.7233 0.0677  -0.0499 0.1422  470 SER A O     
1148 C CB    . SER A 80 ? 0.4303 0.5403 0.6035 0.1247  0.0637  0.2282  470 SER A CB    
1149 O OG    . SER A 80 ? 0.5407 0.5732 0.5729 0.1272  0.0965  0.2024  470 SER A OG    
1155 N N     . ARG A 81 ? 0.3357 0.4432 0.4392 0.0549  -0.0540 0.1243  471 ARG A N     
1156 C CA    . ARG A 81 ? 0.3940 0.4929 0.4647 0.0332  -0.0844 0.0785  471 ARG A CA    
1157 C C     . ARG A 81 ? 0.3735 0.5051 0.4601 0.0166  -0.1277 0.0745  471 ARG A C     
1158 O O     . ARG A 81 ? 0.3388 0.4819 0.4132 0.0177  -0.1287 0.0984  471 ARG A O     
1159 C CB    . ARG A 81 ? 0.5212 0.5589 0.4655 0.0246  -0.0577 0.0507  471 ARG A CB    
1160 C CG    . ARG A 81 ? 0.6127 0.6067 0.5308 0.0471  -0.0069 0.0533  471 ARG A CG    
1161 C CD    . ARG A 81 ? 0.8090 0.7144 0.5743 0.0431  0.0362  0.0385  471 ARG A CD    
1162 N NE    . ARG A 81 ? 0.7499 0.6319 0.4280 0.0017  0.0023  -0.0023 471 ARG A NE    
1163 C CZ    . ARG A 81 ? 0.7991 0.5930 0.3290 -0.0181 0.0273  -0.0268 471 ARG A CZ    
1164 N NH1   . ARG A 81 ? 0.8159 0.6151 0.3032 -0.0609 -0.0125 -0.0549 471 ARG A NH1   
1165 N NH2   . ARG A 81 ? 0.8613 0.5687 0.3046 0.0071  0.0950  -0.0169 471 ARG A NH2   
1179 N N     . SER A 82 ? 0.6130 0.5536 0.4942 -0.0117 0.0474  0.0936  472 SER A N     
1180 C CA    . SER A 82 ? 0.7098 0.6123 0.5623 -0.0016 0.0448  0.0870  472 SER A CA    
1181 C C     . SER A 82 ? 0.7191 0.6614 0.6143 0.0199  0.0465  0.0580  472 SER A C     
1182 O O     . SER A 82 ? 0.8969 0.8364 0.7668 0.0271  0.0360  0.0554  472 SER A O     
1183 C CB    . SER A 82 ? 0.7782 0.6236 0.6174 0.0039  0.0581  0.0893  472 SER A CB    
1184 O OG    . SER A 82 ? 0.7995 0.6675 0.7029 0.0133  0.0771  0.0750  472 SER A OG    
1190 N N     . ASP A 83 ? 0.5590 0.5337 0.5179 0.0299  0.0554  0.0363  473 ASP A N     
1191 C CA    . ASP A 83 ? 0.4909 0.4968 0.4922 0.0486  0.0496  0.0071  473 ASP A CA    
1192 C C     . ASP A 83 ? 0.4942 0.5418 0.4764 0.0561  0.0343  -0.0010 473 ASP A C     
1193 O O     . ASP A 83 ? 0.5005 0.5620 0.4872 0.0710  0.0232  -0.0189 473 ASP A O     
1194 C CB    . ASP A 83 ? 0.5100 0.5312 0.5833 0.0542  0.0553  -0.0125 473 ASP A CB    
1195 C CG    . ASP A 83 ? 0.4568 0.4969 0.5400 0.0498  0.0561  -0.0118 473 ASP A CG    
1196 O OD1   . ASP A 83 ? 0.5028 0.5429 0.5433 0.0382  0.0579  0.0113  473 ASP A OD1   
1197 O OD2   . ASP A 83 ? 0.4528 0.5064 0.5889 0.0582  0.0525  -0.0332 473 ASP A OD2   
1202 N N     . HIS A 84 ? 0.4937 0.5660 0.4545 0.0480  0.0339  0.0147  474 HIS A N     
1203 C CA    . HIS A 84 ? 0.5039 0.6228 0.4401 0.0578  0.0243  0.0149  474 HIS A CA    
1204 C C     . HIS A 84 ? 0.5304 0.6320 0.4169 0.0520  0.0139  0.0324  474 HIS A C     
1205 O O     . HIS A 84 ? 0.5424 0.6698 0.4174 0.0685  0.0040  0.0202  474 HIS A O     
1206 C CB    . HIS A 84 ? 0.5007 0.6571 0.4276 0.0495  0.0298  0.0388  474 HIS A CB    
1207 C CG    . HIS A 84 ? 0.4856 0.6755 0.4534 0.0688  0.0356  0.0154  474 HIS A CG    
1208 N ND1   . HIS A 84 ? 0.4829 0.7164 0.4513 0.0703  0.0428  0.0331  474 HIS A ND1   
1209 C CD2   . HIS A 84 ? 0.4793 0.6629 0.4894 0.0883  0.0323  -0.0233 474 HIS A CD2   
1210 C CE1   . HIS A 84 ? 0.4782 0.7261 0.4812 0.0942  0.0448  0.0031  474 HIS A CE1   
1211 N NE2   . HIS A 84 ? 0.4780 0.6919 0.5061 0.1034  0.0361  -0.0316 474 HIS A NE2   
1219 N N     . LEU A 85 ? 0.6034 0.6553 0.4546 0.0305  0.0128  0.0605  475 LEU A N     
1220 C CA    . LEU A 85 ? 0.6806 0.7031 0.4799 0.0248  -0.0013 0.0783  475 LEU A CA    
1221 C C     . LEU A 85 ? 0.6776 0.6796 0.4853 0.0464  -0.0042 0.0526  475 LEU A C     
1222 O O     . LEU A 85 ? 0.6603 0.6731 0.4464 0.0567  -0.0168 0.0508  475 LEU A O     
1223 C CB    . LEU A 85 ? 0.7310 0.6911 0.4855 -0.0011 -0.0080 0.1104  475 LEU A CB    
1224 C CG    . LEU A 85 ? 0.7500 0.6610 0.4439 -0.0086 -0.0284 0.1306  475 LEU A CG    
1225 C CD1   . LEU A 85 ? 0.7583 0.7180 0.4365 -0.0175 -0.0405 0.1542  475 LEU A CD1   
1226 C CD2   . LEU A 85 ? 0.7579 0.5912 0.4032 -0.0311 -0.0409 0.1555  475 LEU A CD2   
1238 N N     . ALA A 86 ? 0.6633 0.6409 0.5059 0.0542  0.0077  0.0361  476 ALA A N     
1239 C CA    . ALA A 86 ? 0.6537 0.6205 0.5152 0.0748  0.0067  0.0173  476 ALA A CA    
1240 C C     . ALA A 86 ? 0.6039 0.6211 0.4945 0.0923  -0.0063 -0.0080 476 ALA A C     
1241 O O     . ALA A 86 ? 0.6111 0.6247 0.4886 0.1062  -0.0183 -0.0132 476 ALA A O     
1242 C CB    . ALA A 86 ? 0.6040 0.5585 0.5157 0.0800  0.0253  0.0082  476 ALA A CB    
1248 N N     . LEU A 87 ? 0.6113 0.6716 0.5366 0.0951  -0.0067 -0.0254 477 LEU A N     
1249 C CA    . LEU A 87 ? 0.6234 0.7251 0.5626 0.1151  -0.0237 -0.0524 477 LEU A CA    
1250 C C     . LEU A 87 ? 0.6948 0.8149 0.5720 0.1190  -0.0343 -0.0372 477 LEU A C     
1251 O O     . LEU A 87 ? 0.6586 0.8010 0.5297 0.1387  -0.0509 -0.0554 477 LEU A O     
1252 C CB    . LEU A 87 ? 0.5701 0.7024 0.5486 0.1218  -0.0237 -0.0757 477 LEU A CB    
1253 C CG    . LEU A 87 ? 0.5437 0.6601 0.5906 0.1164  -0.0166 -0.0887 477 LEU A CG    
1254 C CD1   . LEU A 87 ? 0.5411 0.6772 0.6149 0.1229  -0.0195 -0.1085 477 LEU A CD1   
1255 C CD2   . LEU A 87 ? 0.5271 0.6413 0.6246 0.1257  -0.0298 -0.1082 477 LEU A CD2   
1267 N N     . HIS A 88 ? 0.6208 0.7330 0.4536 0.0993  -0.0275 -0.0014 478 HIS A N     
1268 C CA    . HIS A 88 ? 0.6757 0.8075 0.4542 0.0981  -0.0370 0.0231  478 HIS A CA    
1269 C C     . HIS A 88 ? 0.7231 0.8119 0.4663 0.0984  -0.0508 0.0339  478 HIS A C     
1270 O O     . HIS A 88 ? 0.7791 0.8866 0.4899 0.1092  -0.0640 0.0393  478 HIS A O     
1271 C CB    . HIS A 88 ? 0.6975 0.8375 0.4509 0.0719  -0.0292 0.0643  478 HIS A CB    
1272 C CG    . HIS A 88 ? 0.8196 0.9721 0.5215 0.0617  -0.0398 0.1024  478 HIS A CG    
1273 N ND1   . HIS A 88 ? 0.8953 1.1129 0.5817 0.0791  -0.0398 0.1070  478 HIS A ND1   
1274 C CD2   . HIS A 88 ? 0.8940 0.9990 0.5542 0.0366  -0.0526 0.1398  478 HIS A CD2   
1275 C CE1   . HIS A 88 ? 0.9474 1.1642 0.5907 0.0622  -0.0494 0.1502  478 HIS A CE1   
1276 N NE2   . HIS A 88 ? 0.9685 1.1135 0.5965 0.0345  -0.0600 0.1702  478 HIS A NE2   
1284 N N     . MET A 89 ? 0.8345 0.8646 0.5784 0.0905  -0.0478 0.0379  479 MET A N     
1285 C CA    . MET A 89 ? 0.8400 0.8227 0.5464 0.0968  -0.0611 0.0467  479 MET A CA    
1286 C C     . MET A 89 ? 0.8487 0.8573 0.5781 0.1254  -0.0722 0.0185  479 MET A C     
1287 O O     . MET A 89 ? 0.8762 0.8696 0.5670 0.1343  -0.0884 0.0279  479 MET A O     
1288 C CB    . MET A 89 ? 0.8987 0.8166 0.6011 0.0938  -0.0525 0.0503  479 MET A CB    
1289 C CG    . MET A 89 ? 0.9923 0.8682 0.6571 0.0654  -0.0507 0.0797  479 MET A CG    
1290 S SD    . MET A 89 ? 1.0921 0.9347 0.6812 0.0413  -0.0775 0.1229  479 MET A SD    
1291 C CE    . MET A 89 ? 1.0928 0.8723 0.6500 0.0093  -0.0810 0.1500  479 MET A CE    
1301 N N     . LYS A 90 ? 0.8012 0.8459 0.5936 0.1389  -0.0678 -0.0147 480 LYS A N     
1302 C CA    . LYS A 90 ? 0.7973 0.8687 0.6170 0.1636  -0.0852 -0.0422 480 LYS A CA    
1303 C C     . LYS A 90 ? 0.8555 0.9549 0.6261 0.1737  -0.1031 -0.0383 480 LYS A C     
1304 O O     . LYS A 90 ? 0.9288 1.0297 0.6894 0.1918  -0.1220 -0.0460 480 LYS A O     
1305 C CB    . LYS A 90 ? 0.7626 0.8671 0.6563 0.1704  -0.0851 -0.0761 480 LYS A CB    
1306 C CG    . LYS A 90 ? 0.7585 0.8432 0.7108 0.1636  -0.0679 -0.0771 480 LYS A CG    
1307 C CD    . LYS A 90 ? 0.6921 0.8021 0.7132 0.1603  -0.0666 -0.1010 480 LYS A CD    
1308 C CE    . LYS A 90 ? 0.6333 0.7739 0.7046 0.1766  -0.0952 -0.1339 480 LYS A CE    
1309 N NZ    . LYS A 90 ? 0.6068 0.7705 0.6354 0.1905  -0.1166 -0.1532 480 LYS A NZ    
1323 N N     . ARG A 91 ? 0.8618 0.9879 0.6014 0.1642  -0.0964 -0.0232 481 ARG A N     
1324 C CA    . ARG A 91 ? 0.8807 1.0394 0.5679 0.1749  -0.1079 -0.0105 481 ARG A CA    
1325 C C     . ARG A 91 ? 0.8484 0.9699 0.4803 0.1634  -0.1167 0.0282  481 ARG A C     
1326 O O     . ARG A 91 ? 0.8157 0.9576 0.4048 0.1744  -0.1296 0.0408  481 ARG A O     
1327 C CB    . ARG A 91 ? 0.8805 1.0862 0.5535 0.1698  -0.0933 0.0030  481 ARG A CB    
1328 C CG    . ARG A 91 ? 0.9138 1.1486 0.6331 0.1851  -0.0876 -0.0362 481 ARG A CG    
1329 C CD    . ARG A 91 ? 1.0036 1.2846 0.7086 0.1841  -0.0697 -0.0194 481 ARG A CD    
1330 N NE    . ARG A 91 ? 1.1066 1.4385 0.7574 0.2042  -0.0718 -0.0039 481 ARG A NE    
1331 C CZ    . ARG A 91 ? 1.1203 1.4884 0.7547 0.2430  -0.0811 -0.0375 481 ARG A CZ    
1332 N NH1   . ARG A 91 ? 1.0737 1.4274 0.7459 0.2622  -0.0947 -0.0899 481 ARG A NH1   
1333 N NH2   . ARG A 91 ? 1.1413 1.5580 0.7186 0.2634  -0.0788 -0.0171 481 ARG A NH2   
1347 N N     . HIS A 92 ? 0.8501 0.9125 0.4771 0.1437  -0.1121 0.0471  482 HIS A N     
1348 C CA    . HIS A 92 ? 0.9699 0.9792 0.5404 0.1323  -0.1258 0.0825  482 HIS A CA    
1349 C C     . HIS A 92 ? 0.9657 0.9285 0.5363 0.1534  -0.1381 0.0673  482 HIS A C     
1350 O O     . HIS A 92 ? 0.9763 0.8807 0.4973 0.1488  -0.1519 0.0924  482 HIS A O     
1351 C CB    . HIS A 92 ? 1.0642 1.0264 0.6145 0.0989  -0.1194 0.1149  482 HIS A CB    
1352 C CG    . HIS A 92 ? 1.1635 1.1734 0.7110 0.0753  -0.1106 0.1427  482 HIS A CG    
1353 N ND1   . HIS A 92 ? 1.2220 1.2976 0.7545 0.0813  -0.1114 0.1577  482 HIS A ND1   
1354 C CD2   . HIS A 92 ? 1.1624 1.1687 0.7208 0.0486  -0.0999 0.1607  482 HIS A CD2   
1355 C CE1   . HIS A 92 ? 1.2299 1.3463 0.7688 0.0604  -0.0990 0.1854  482 HIS A CE1   
1356 N NE2   . HIS A 92 ? 1.2113 1.2860 0.7682 0.0387  -0.0938 0.1875  482 HIS A NE2   
1364 N N     . PHE A 93 ? 1.0991 1.0856 0.7262 0.1766  -0.1354 0.0292  483 PHE A N     
1365 C CA    . PHE A 93 ? 1.0934 1.0517 0.7319 0.2005  -0.1452 0.0174  483 PHE A CA    
1366 C C     . PHE A 93 ? 1.1026 1.0469 0.6857 0.2125  -0.1700 0.0337  483 PHE A C     
1367 O O     . PHE A 93 ? 1.0816 1.0699 0.6721 0.2305  -0.1854 0.0184  483 PHE A O     
1368 C CB    . PHE A 93 ? 1.0533 1.0597 0.7707 0.2207  -0.1454 -0.0210 483 PHE A CB    
1369 C CG    . PHE A 93 ? 0.9828 0.9921 0.7621 0.2124  -0.1220 -0.0333 483 PHE A CG    
1370 C CD1   . PHE A 93 ? 1.0053 0.9662 0.7639 0.1982  -0.1020 -0.0138 483 PHE A CD1   
1371 C CD2   . PHE A 93 ? 0.9250 0.9816 0.7812 0.2190  -0.1237 -0.0632 483 PHE A CD2   
1372 C CE1   . PHE A 93 ? 0.9528 0.9182 0.7647 0.1925  -0.0796 -0.0221 483 PHE A CE1   
1373 C CE2   . PHE A 93 ? 0.8931 0.9530 0.8089 0.2098  -0.1030 -0.0694 483 PHE A CE2   
1374 C CZ    . PHE A 93 ? 0.9118 0.9289 0.8047 0.1975  -0.0786 -0.0479 483 PHE A CZ    
1384 O "O5'" . DG  B 1  ? 0.9788 0.8927 0.8144 -0.0581 0.0885  0.0165  1   DG  B "O5'" 
1385 C "C5'" . DG  B 1  ? 0.8139 0.7528 0.6520 -0.0457 0.0834  0.0171  1   DG  B "C5'" 
1386 C "C4'" . DG  B 1  ? 0.6731 0.6469 0.5519 -0.0534 0.0817  0.0112  1   DG  B "C4'" 
1387 O "O4'" . DG  B 1  ? 0.6664 0.6625 0.5456 -0.0418 0.0767  0.0123  1   DG  B "O4'" 
1388 C "C3'" . DG  B 1  ? 0.6285 0.6165 0.5358 -0.0584 0.0705  0.0061  1   DG  B "C3'" 
1389 O "O3'" . DG  B 1  ? 0.4696 0.4778 0.4132 -0.0709 0.0722  -0.0009 1   DG  B "O3'" 
1390 C "C2'" . DG  B 1  ? 0.5846 0.5909 0.4888 -0.0446 0.0587  0.0081  1   DG  B "C2'" 
1391 C "C1'" . DG  B 1  ? 0.5717 0.5903 0.4703 -0.0384 0.0634  0.0102  1   DG  B "C1'" 
1392 N N9    . DG  B 1  ? 0.6009 0.6252 0.4800 -0.0225 0.0571  0.0143  1   DG  B N9    
1393 C C8    . DG  B 1  ? 0.6264 0.6318 0.4742 -0.0106 0.0554  0.0181  1   DG  B C8    
1394 N N7    . DG  B 1  ? 0.6321 0.6521 0.4715 0.0027  0.0494  0.0198  1   DG  B N7    
1395 C C5    . DG  B 1  ? 0.5635 0.6120 0.4293 -0.0016 0.0470  0.0179  1   DG  B C5    
1396 C C6    . DG  B 1  ? 0.5295 0.6034 0.4012 0.0065  0.0404  0.0186  1   DG  B C6    
1397 O O6    . DG  B 1  ? 0.4518 0.5311 0.3081 0.0196  0.0361  0.0205  1   DG  B O6    
1398 N N1    . DG  B 1  ? 0.6490 0.7438 0.5486 -0.0020 0.0383  0.0161  1   DG  B N1    
1399 C C2    . DG  B 1  ? 0.6469 0.7404 0.5671 -0.0153 0.0421  0.0122  1   DG  B C2    
1400 N N2    . DG  B 1  ? 0.6910 0.8060 0.6361 -0.0203 0.0376  0.0091  1   DG  B N2    
1401 N N3    . DG  B 1  ? 0.6130 0.6862 0.5304 -0.0232 0.0490  0.0109  1   DG  B N3    
1402 C C4    . DG  B 1  ? 0.5738 0.6243 0.4632 -0.0163 0.0511  0.0144  1   DG  B C4    
1415 P P     . DA  B 2  ? 0.4366 0.4547 0.4115 -0.0790 0.0614  -0.0081 2   DA  B P     
1416 O OP1   . DA  B 2  ? 0.4785 0.5075 0.4844 -0.0934 0.0681  -0.0161 2   DA  B OP1   
1417 O OP2   . DA  B 2  ? 0.4542 0.4490 0.4114 -0.0762 0.0560  -0.0056 2   DA  B OP2   
1418 O "O5'" . DA  B 2  ? 0.4460 0.4902 0.4334 -0.0709 0.0480  -0.0086 2   DA  B "O5'" 
1419 C "C5'" . DA  B 2  ? 0.4788 0.5467 0.4856 -0.0720 0.0478  -0.0119 2   DA  B "C5'" 
1420 C "C4'" . DA  B 2  ? 0.4051 0.4915 0.4157 -0.0640 0.0345  -0.0100 2   DA  B "C4'" 
1421 O "O4'" . DA  B 2  ? 0.4083 0.4905 0.3896 -0.0515 0.0357  -0.0021 2   DA  B "O4'" 
1422 C "C3'" . DA  B 2  ? 0.4016 0.4883 0.4212 -0.0653 0.0212  -0.0120 2   DA  B "C3'" 
1423 O "O3'" . DA  B 2  ? 0.4927 0.5986 0.5393 -0.0697 0.0107  -0.0175 2   DA  B "O3'" 
1424 C "C2'" . DA  B 2  ? 0.4500 0.5344 0.4433 -0.0533 0.0170  -0.0042 2   DA  B "C2'" 
1425 C "C1'" . DA  B 2  ? 0.5039 0.5956 0.4841 -0.0459 0.0238  0.0002  2   DA  B "C1'" 
1426 N N9    . DA  B 2  ? 0.4255 0.5090 0.3755 -0.0335 0.0255  0.0065  2   DA  B N9    
1427 C C8    . DA  B 2  ? 0.4233 0.4828 0.3490 -0.0289 0.0299  0.0087  2   DA  B C8    
1428 N N7    . DA  B 2  ? 0.4081 0.4665 0.3097 -0.0157 0.0291  0.0130  2   DA  B N7    
1429 C C5    . DA  B 2  ? 0.3870 0.4718 0.2995 -0.0124 0.0247  0.0140  2   DA  B C5    
1430 C C6    . DA  B 2  ? 0.4403 0.5395 0.3409 -0.0004 0.0218  0.0171  2   DA  B C6    
1431 N N6    . DA  B 2  ? 0.4759 0.5651 0.3500 0.0125  0.0227  0.0191  2   DA  B N6    
1432 N N1    . DA  B 2  ? 0.4236 0.5482 0.3416 -0.0020 0.0170  0.0173  2   DA  B N1    
1433 C C2    . DA  B 2  ? 0.3818 0.5147 0.3250 -0.0136 0.0144  0.0144  2   DA  B C2    
1434 N N3    . DA  B 2  ? 0.3469 0.4691 0.3037 -0.0242 0.0164  0.0103  2   DA  B N3    
1435 C C4    . DA  B 2  ? 0.3676 0.4664 0.3085 -0.0235 0.0221  0.0104  2   DA  B C4    
1447 P P     . DG  B 3  ? 0.5201 0.6261 0.5787 -0.0726 -0.0047 -0.0210 3   DG  B P     
1448 O OP1   . DG  B 3  ? 0.5594 0.6731 0.6501 -0.0819 -0.0094 -0.0316 3   DG  B OP1   
1449 O OP2   . DG  B 3  ? 0.6299 0.7162 0.6688 -0.0695 -0.0045 -0.0178 3   DG  B OP2   
1450 O "O5'" . DG  B 3  ? 0.5820 0.7036 0.6354 -0.0666 -0.0147 -0.0157 3   DG  B "O5'" 
1451 C "C5'" . DG  B 3  ? 0.4760 0.6153 0.5415 -0.0668 -0.0167 -0.0166 3   DG  B "C5'" 
1452 C "C4'" . DG  B 3  ? 0.3640 0.5149 0.4175 -0.0608 -0.0232 -0.0091 3   DG  B "C4'" 
1453 O "O4'" . DG  B 3  ? 0.4125 0.5595 0.4404 -0.0518 -0.0138 -0.0020 3   DG  B "O4'" 
1454 C "C3'" . DG  B 3  ? 0.3264 0.4765 0.3779 -0.0624 -0.0360 -0.0073 3   DG  B "C3'" 
1455 O "O3'" . DG  B 3  ? 0.3578 0.5224 0.4168 -0.0643 -0.0465 -0.0055 3   DG  B "O3'" 
1456 C "C2'" . DG  B 3  ? 0.3725 0.5168 0.3975 -0.0544 -0.0305 -0.0002 3   DG  B "C2'" 
1457 C "C1'" . DG  B 3  ? 0.4112 0.5612 0.4255 -0.0474 -0.0197 0.0034  3   DG  B "C1'" 
1458 N N9    . DG  B 3  ? 0.4727 0.6113 0.4621 -0.0386 -0.0113 0.0073  3   DG  B N9    
1459 C C8    . DG  B 3  ? 0.4478 0.5650 0.4277 -0.0383 -0.0060 0.0053  3   DG  B C8    
1460 N N7    . DG  B 3  ? 0.4300 0.5389 0.3851 -0.0283 -0.0007 0.0092  3   DG  B N7    
1461 C C5    . DG  B 3  ? 0.4485 0.5769 0.3983 -0.0214 -0.0021 0.0134  3   DG  B C5    
1462 C C6    . DG  B 3  ? 0.3924 0.5243 0.3202 -0.0086 0.0009  0.0171  3   DG  B C6    
1463 O O6    . DG  B 3  ? 0.4611 0.5772 0.3669 0.0002  0.0049  0.0176  3   DG  B O6    
1464 N N1    . DG  B 3  ? 0.3383 0.4950 0.2718 -0.0061 -0.0022 0.0197  3   DG  B N1    
1465 C C2    . DG  B 3  ? 0.3758 0.5487 0.3312 -0.0151 -0.0082 0.0195  3   DG  B C2    
1466 N N2    . DG  B 3  ? 0.4770 0.6718 0.4349 -0.0121 -0.0112 0.0224  3   DG  B N2    
1467 N N3    . DG  B 3  ? 0.3769 0.5446 0.3509 -0.0260 -0.0121 0.0159  3   DG  B N3    
1468 C C4    . DG  B 3  ? 0.4219 0.5684 0.3928 -0.0284 -0.0084 0.0127  3   DG  B C4    
1480 P P     . DG  B 4  ? 0.3363 0.5003 0.3917 -0.0677 -0.0604 -0.0027 4   DG  B P     
1481 O OP1   . DG  B 4  ? 0.4098 0.5813 0.4821 -0.0735 -0.0731 -0.0057 4   DG  B OP1   
1482 O OP2   . DG  B 4  ? 0.3807 0.5277 0.4316 -0.0685 -0.0619 -0.0057 4   DG  B OP2   
1483 O "O5'" . DG  B 4  ? 0.2829 0.4577 0.3173 -0.0617 -0.0563 0.0073  4   DG  B "O5'" 
1484 C "C5'" . DG  B 4  ? 0.3119 0.5036 0.3481 -0.0599 -0.0551 0.0110  4   DG  B "C5'" 
1485 C "C4'" . DG  B 4  ? 0.2880 0.4920 0.3072 -0.0553 -0.0527 0.0191  4   DG  B "C4'" 
1486 O "O4'" . DG  B 4  ? 0.2856 0.4852 0.2881 -0.0453 -0.0408 0.0201  4   DG  B "O4'" 
1487 C "C3'" . DG  B 4  ? 0.2969 0.4997 0.3079 -0.0600 -0.0604 0.0228  4   DG  B "C3'" 
1488 O "O3'" . DG  B 4  ? 0.2788 0.4993 0.2886 -0.0636 -0.0649 0.0291  4   DG  B "O3'" 
1489 C "C2'" . DG  B 4  ? 0.3428 0.5387 0.3345 -0.0516 -0.0519 0.0240  4   DG  B "C2'" 
1490 C "C1'" . DG  B 4  ? 0.3894 0.5904 0.3759 -0.0421 -0.0406 0.0240  4   DG  B "C1'" 
1491 N N9    . DG  B 4  ? 0.4756 0.6608 0.4475 -0.0340 -0.0327 0.0219  4   DG  B N9    
1492 C C8    . DG  B 4  ? 0.4264 0.5901 0.4006 -0.0365 -0.0324 0.0169  4   DG  B C8    
1493 N N7    . DG  B 4  ? 0.4449 0.5956 0.4022 -0.0283 -0.0254 0.0166  4   DG  B N7    
1494 C C5    . DG  B 4  ? 0.4066 0.5716 0.3493 -0.0186 -0.0212 0.0208  4   DG  B C5    
1495 C C6    . DG  B 4  ? 0.4586 0.6178 0.3792 -0.0059 -0.0149 0.0214  4   DG  B C6    
1496 O O6    . DG  B 4  ? 0.4783 0.6155 0.3858 -0.0013 -0.0118 0.0191  4   DG  B O6    
1497 N N1    . DG  B 4  ? 0.4901 0.6716 0.4042 0.0019  -0.0132 0.0244  4   DG  B N1    
1498 C C2    . DG  B 4  ? 0.4142 0.6202 0.3422 -0.0036 -0.0168 0.0273  4   DG  B C2    
1499 N N2    . DG  B 4  ? 0.3692 0.5965 0.2909 0.0047  -0.0144 0.0292  4   DG  B N2    
1500 N N3    . DG  B 4  ? 0.3634 0.5722 0.3102 -0.0163 -0.0231 0.0277  4   DG  B N3    
1501 C C4    . DG  B 4  ? 0.4285 0.6163 0.3814 -0.0224 -0.0252 0.0240  4   DG  B C4    
1513 P P     . DC  B 5  ? 0.3966 0.6181 0.3963 -0.0707 -0.0725 0.0345  5   DC  B P     
1514 O OP1   . DC  B 5  ? 0.4575 0.6951 0.4629 -0.0783 -0.0788 0.0399  5   DC  B OP1   
1515 O OP2   . DC  B 5  ? 0.3228 0.5222 0.3237 -0.0751 -0.0809 0.0299  5   DC  B OP2   
1516 O "O5'" . DC  B 5  ? 0.4729 0.7026 0.4529 -0.0617 -0.0616 0.0381  5   DC  B "O5'" 
1517 C "C5'" . DC  B 5  ? 0.4089 0.6578 0.3863 -0.0536 -0.0525 0.0400  5   DC  B "C5'" 
1518 C "C4'" . DC  B 5  ? 0.4141 0.6660 0.3726 -0.0426 -0.0434 0.0404  5   DC  B "C4'" 
1519 O "O4'" . DC  B 5  ? 0.3431 0.5733 0.2960 -0.0351 -0.0394 0.0351  5   DC  B "O4'" 
1520 C "C3'" . DC  B 5  ? 0.4469 0.6996 0.3917 -0.0460 -0.0456 0.0438  5   DC  B "C3'" 
1521 O "O3'" . DC  B 5  ? 0.4999 0.7801 0.4388 -0.0441 -0.0404 0.0482  5   DC  B "O3'" 
1522 C "C2'" . DC  B 5  ? 0.4163 0.6490 0.3468 -0.0364 -0.0421 0.0394  5   DC  B "C2'" 
1523 C "C1'" . DC  B 5  ? 0.3347 0.5611 0.2689 -0.0276 -0.0358 0.0352  5   DC  B "C1'" 
1524 N N1    . DC  B 5  ? 0.4047 0.6038 0.3338 -0.0238 -0.0351 0.0300  5   DC  B N1    
1525 C C2    . DC  B 5  ? 0.4465 0.6376 0.3579 -0.0109 -0.0284 0.0280  5   DC  B C2    
1526 O O2    . DC  B 5  ? 0.4762 0.6845 0.3770 -0.0014 -0.0234 0.0296  5   DC  B O2    
1527 N N3    . DC  B 5  ? 0.4031 0.5676 0.3099 -0.0090 -0.0284 0.0237  5   DC  B N3    
1528 C C4    . DC  B 5  ? 0.4468 0.5965 0.3684 -0.0193 -0.0340 0.0208  5   DC  B C4    
1529 N N4    . DC  B 5  ? 0.5270 0.6523 0.4457 -0.0182 -0.0336 0.0163  5   DC  B N4    
1530 C C5    . DC  B 5  ? 0.4403 0.5992 0.3807 -0.0310 -0.0412 0.0217  5   DC  B C5    
1531 C C6    . DC  B 5  ? 0.4734 0.6553 0.4156 -0.0329 -0.0418 0.0267  5   DC  B C6    
1543 P P     . DG  B 6  ? 0.5207 0.8104 0.4491 -0.0529 -0.0426 0.0541  6   DG  B P     
1544 O OP1   . DG  B 6  ? 0.4196 0.7356 0.3583 -0.0619 -0.0431 0.0595  6   DG  B OP1   
1545 O OP2   . DG  B 6  ? 0.6097 0.8721 0.5338 -0.0607 -0.0521 0.0536  6   DG  B OP2   
1546 O "O5'" . DG  B 6  ? 0.5235 0.8227 0.4327 -0.0393 -0.0329 0.0523  6   DG  B "O5'" 
1547 C "C5'" . DG  B 6  ? 0.4611 0.7857 0.3708 -0.0282 -0.0243 0.0507  6   DG  B "C5'" 
1548 C "C4'" . DG  B 6  ? 0.4662 0.7876 0.3569 -0.0116 -0.0179 0.0458  6   DG  B "C4'" 
1549 O "O4'" . DG  B 6  ? 0.4955 0.7849 0.3822 -0.0048 -0.0201 0.0410  6   DG  B "O4'" 
1550 C "C3'" . DG  B 6  ? 0.5031 0.8246 0.3760 -0.0127 -0.0171 0.0474  6   DG  B "C3'" 
1551 O "O3'" . DG  B 6  ? 0.4795 0.8311 0.3442 -0.0028 -0.0085 0.0460  6   DG  B "O3'" 
1552 C "C2'" . DG  B 6  ? 0.5106 0.7972 0.3704 -0.0050 -0.0206 0.0427  6   DG  B "C2'" 
1553 C "C1'" . DG  B 6  ? 0.5285 0.8035 0.3956 0.0036  -0.0194 0.0381  6   DG  B "C1'" 
1554 N N9    . DG  B 6  ? 0.5582 0.7982 0.4251 0.0024  -0.0246 0.0350  6   DG  B N9    
1555 C C8    . DG  B 6  ? 0.5768 0.8000 0.4567 -0.0109 -0.0323 0.0359  6   DG  B C8    
1556 N N7    . DG  B 6  ? 0.5405 0.7357 0.4197 -0.0090 -0.0351 0.0314  6   DG  B N7    
1557 C C5    . DG  B 6  ? 0.5270 0.7174 0.3896 0.0060  -0.0294 0.0281  6   DG  B C5    
1558 C C6    . DG  B 6  ? 0.5146 0.6771 0.3683 0.0132  -0.0297 0.0232  6   DG  B C6    
1559 O O6    . DG  B 6  ? 0.4884 0.6271 0.3498 0.0069  -0.0341 0.0204  6   DG  B O6    
1560 N N1    . DG  B 6  ? 0.5399 0.7041 0.3744 0.0293  -0.0246 0.0209  6   DG  B N1    
1561 C C2    . DG  B 6  ? 0.4851 0.6777 0.3122 0.0381  -0.0196 0.0220  6   DG  B C2    
1562 N N2    . DG  B 6  ? 0.5608 0.7502 0.3689 0.0552  -0.0167 0.0179  6   DG  B N2    
1563 N N3    . DG  B 6  ? 0.4784 0.7003 0.3164 0.0306  -0.0182 0.0264  6   DG  B N3    
1564 C C4    . DG  B 6  ? 0.5403 0.7579 0.3948 0.0142  -0.0234 0.0298  6   DG  B C4    
1576 P P     . DT  B 7  ? 0.5412 0.9021 0.3864 -0.0029 -0.0048 0.0476  7   DT  B P     
1577 O OP1   . DT  B 7  ? 0.5623 0.9660 0.4104 0.0013  0.0045  0.0471  7   DT  B OP1   
1578 O OP2   . DT  B 7  ? 0.4969 0.8399 0.3394 -0.0202 -0.0120 0.0540  7   DT  B OP2   
1579 O "O5'" . DT  B 7  ? 0.4266 0.7635 0.2516 0.0151  -0.0050 0.0403  7   DT  B "O5'" 
1580 C "C5'" . DT  B 7  ? 0.4413 0.7818 0.2634 0.0335  -0.0014 0.0333  7   DT  B "C5'" 
1581 C "C4'" . DT  B 7  ? 0.4451 0.7539 0.2473 0.0471  -0.0045 0.0275  7   DT  B "C4'" 
1582 O "O4'" . DT  B 7  ? 0.4686 0.7415 0.2768 0.0394  -0.0119 0.0283  7   DT  B "O4'" 
1583 C "C3'" . DT  B 7  ? 0.5716 0.8763 0.3531 0.0494  -0.0048 0.0271  7   DT  B "C3'" 
1584 O "O3'" . DT  B 7  ? 0.6286 0.9543 0.3953 0.0674  0.0014  0.0211  7   DT  B "O3'" 
1585 C "C2'" . DT  B 7  ? 0.5641 0.8240 0.3365 0.0504  -0.0136 0.0248  7   DT  B "C2'" 
1586 C "C1'" . DT  B 7  ? 0.5305 0.7746 0.3203 0.0471  -0.0161 0.0244  7   DT  B "C1'" 
1587 N N1    . DT  B 7  ? 0.5169 0.7299 0.3155 0.0344  -0.0243 0.0258  7   DT  B N1    
1588 C C2    . DT  B 7  ? 0.5666 0.7461 0.3578 0.0405  -0.0290 0.0209  7   DT  B C2    
1589 O O2    . DT  B 7  ? 0.6079 0.7788 0.3833 0.0558  -0.0274 0.0160  7   DT  B O2    
1590 N N3    . DT  B 7  ? 0.5819 0.7380 0.3854 0.0279  -0.0364 0.0212  7   DT  B N3    
1591 C C4    . DT  B 7  ? 0.6144 0.7754 0.4347 0.0117  -0.0406 0.0255  7   DT  B C4    
1592 O O4    . DT  B 7  ? 0.6450 0.7847 0.4764 0.0026  -0.0483 0.0238  7   DT  B O4    
1593 C C5    . DT  B 7  ? 0.5776 0.7707 0.4020 0.0060  -0.0363 0.0313  7   DT  B C5    
1594 C C7    . DT  B 7  ? 0.5000 0.6975 0.3398 -0.0114 -0.0420 0.0364  7   DT  B C7    
1595 C C6    . DT  B 7  ? 0.5330 0.7513 0.3475 0.0168  -0.0279 0.0314  7   DT  B C6    
1608 P P     . DG  B 8  ? 0.6333 0.9648 0.3767 0.0729  0.0037  0.0196  8   DG  B P     
1609 O OP1   . DG  B 8  ? 0.6666 1.0363 0.4052 0.0881  0.0125  0.0137  8   DG  B OP1   
1610 O OP2   . DG  B 8  ? 0.7195 1.0488 0.4642 0.0527  0.0020  0.0281  8   DG  B OP2   
1611 O "O5'" . DG  B 8  ? 0.6119 0.8998 0.3357 0.0853  -0.0047 0.0139  8   DG  B "O5'" 
1612 C "C5'" . DG  B 8  ? 0.5191 0.7926 0.2375 0.1025  -0.0067 0.0066  8   DG  B "C5'" 
1613 C "C4'" . DG  B 8  ? 0.6204 0.8503 0.3209 0.1096  -0.0156 0.0026  8   DG  B "C4'" 
1614 O "O4'" . DG  B 8  ? 0.7164 0.9170 0.4309 0.0931  -0.0222 0.0071  8   DG  B "O4'" 
1615 C "C3'" . DG  B 8  ? 0.7503 0.9763 0.4284 0.1143  -0.0175 0.0009  8   DG  B "C3'" 
1616 O "O3'" . DG  B 8  ? 0.8082 1.0115 0.4637 0.1344  -0.0227 -0.0076 8   DG  B "O3'" 
1617 C "C2'" . DG  B 8  ? 0.8141 1.0146 0.4981 0.0957  -0.0247 0.0067  8   DG  B "C2'" 
1618 C "C1'" . DG  B 8  ? 0.8236 0.9997 0.5259 0.0894  -0.0295 0.0070  8   DG  B "C1'" 
1619 N N9    . DG  B 8  ? 0.7325 0.8973 0.4533 0.0690  -0.0343 0.0128  8   DG  B N9    
1620 C C8    . DG  B 8  ? 0.7261 0.9124 0.4596 0.0532  -0.0318 0.0198  8   DG  B C8    
1621 N N7    . DG  B 8  ? 0.7087 0.8765 0.4569 0.0383  -0.0391 0.0226  8   DG  B N7    
1622 C C5    . DG  B 8  ? 0.6909 0.8254 0.4383 0.0436  -0.0457 0.0169  8   DG  B C5    
1623 C C6    . DG  B 8  ? 0.6314 0.7380 0.3935 0.0333  -0.0546 0.0154  8   DG  B C6    
1624 O O6    . DG  B 8  ? 0.5831 0.6881 0.3614 0.0184  -0.0596 0.0184  8   DG  B O6    
1625 N N1    . DG  B 8  ? 0.5806 0.6594 0.3374 0.0419  -0.0583 0.0092  8   DG  B N1    
1626 C C2    . DG  B 8  ? 0.6024 0.6772 0.3394 0.0591  -0.0553 0.0051  8   DG  B C2    
1627 N N2    . DG  B 8  ? 0.6454 0.6887 0.3789 0.0638  -0.0606 -0.0002 8   DG  B N2    
1628 N N3    . DG  B 8  ? 0.6243 0.7244 0.3466 0.0707  -0.0481 0.0056  8   DG  B N3    
1629 C C4    . DG  B 8  ? 0.6802 0.8109 0.4099 0.0618  -0.0430 0.0114  8   DG  B C4    
1641 P P     . DG  B 9  ? 0.9115 1.1159 0.5387 0.1475  -0.0237 -0.0125 9   DG  B P     
1642 O OP1   . DG  B 9  ? 0.9739 1.1988 0.5962 0.1674  -0.0184 -0.0206 9   DG  B OP1   
1643 O OP2   . DG  B 9  ? 0.8793 1.0988 0.5078 0.1314  -0.0201 -0.0053 9   DG  B OP2   
1644 O "O5'" . DG  B 9  ? 0.9226 1.0749 0.5351 0.1523  -0.0370 -0.0164 9   DG  B "O5'" 
1645 C "C5'" . DG  B 9  ? 0.8830 1.0075 0.4936 0.1622  -0.0429 -0.0214 9   DG  B "C5'" 
1646 C "C4'" . DG  B 9  ? 0.7951 0.8721 0.4005 0.1578  -0.0551 -0.0227 9   DG  B "C4'" 
1647 O "O4'" . DG  B 9  ? 0.7807 0.8505 0.4110 0.1347  -0.0563 -0.0156 9   DG  B "O4'" 
1648 C "C3'" . DG  B 9  ? 0.7648 0.8273 0.3462 0.1654  -0.0621 -0.0265 9   DG  B "C3'" 
1649 O "O3'" . DG  B 9  ? 0.7469 0.7679 0.3129 0.1764  -0.0738 -0.0332 9   DG  B "O3'" 
1650 C "C2'" . DG  B 9  ? 0.7624 0.8217 0.3568 0.1444  -0.0642 -0.0196 9   DG  B "C2'" 
1651 C "C1'" . DG  B 9  ? 0.7396 0.7906 0.3637 0.1278  -0.0643 -0.0151 9   DG  B "C1'" 
1652 N N9    . DG  B 9  ? 0.7075 0.7734 0.3517 0.1074  -0.0618 -0.0074 9   DG  B N9    
1653 C C8    . DG  B 9  ? 0.6807 0.7831 0.3277 0.1011  -0.0528 -0.0017 9   DG  B C8    
1654 N N7    . DG  B 9  ? 0.6064 0.7105 0.2710 0.0820  -0.0544 0.0047  9   DG  B N7    
1655 C C5    . DG  B 9  ? 0.6504 0.7196 0.3261 0.0761  -0.0647 0.0021  9   DG  B C5    
1656 C C6    . DG  B 9  ? 0.6502 0.7063 0.3468 0.0584  -0.0715 0.0048  9   DG  B C6    
1657 O O6    . DG  B 9  ? 0.6315 0.7015 0.3390 0.0444  -0.0708 0.0108  9   DG  B O6    
1658 N N1    . DG  B 9  ? 0.6596 0.6828 0.3645 0.0579  -0.0804 -0.0007 9   DG  B N1    
1659 C C2    . DG  B 9  ? 0.6840 0.6866 0.3767 0.0714  -0.0828 -0.0070 9   DG  B C2    
1660 N N2    . DG  B 9  ? 0.7182 0.6907 0.4231 0.0664  -0.0912 -0.0114 9   DG  B N2    
1661 N N3    . DG  B 9  ? 0.7460 0.7571 0.4167 0.0886  -0.0778 -0.0093 9   DG  B N3    
1662 C C4    . DG  B 9  ? 0.7209 0.7668 0.3849 0.0905  -0.0687 -0.0050 9   DG  B C4    
1674 P P     . DC  B 10 ? 0.8033 0.8031 0.3399 0.1896  -0.0836 -0.0395 10  DC  B P     
1675 O OP1   . DC  B 10 ? 0.7994 0.7662 0.3180 0.2070  -0.0934 -0.0477 10  DC  B OP1   
1676 O OP2   . DC  B 10 ? 0.8055 0.8426 0.3288 0.1961  -0.0747 -0.0391 10  DC  B OP2   
1677 O "O5'" . DC  B 10 ? 0.7519 0.7243 0.2999 0.1710  -0.0929 -0.0359 10  DC  B "O5'" 
1678 C "C5'" . DC  B 10 ? 0.7179 0.6558 0.2817 0.1615  -0.1014 -0.0367 10  DC  B "C5'" 
1679 C "C4'" . DC  B 10 ? 0.7744 0.6969 0.3532 0.1435  -0.1089 -0.0339 10  DC  B "C4'" 
1680 O "O4'" . DC  B 10 ? 0.6798 0.6298 0.2829 0.1259  -0.1001 -0.0259 10  DC  B "O4'" 
1681 C "C3'" . DC  B 10 ? 0.8657 0.7813 0.4224 0.1484  -0.1161 -0.0359 10  DC  B "C3'" 
1682 O "O3'" . DC  B 10 ? 0.8784 0.7555 0.4172 0.1599  -0.1304 -0.0440 10  DC  B "O3'" 
1683 C "C2'" . DC  B 10 ? 0.8829 0.7993 0.4606 0.1271  -0.1186 -0.0302 10  DC  B "C2'" 
1684 C "C1'" . DC  B 10 ? 0.8797 0.8197 0.4878 0.1135  -0.1077 -0.0241 10  DC  B "C1'" 
1685 N N1    . DC  B 10 ? 0.7710 0.7450 0.3859 0.1026  -0.0984 -0.0161 10  DC  B N1    
1686 C C2    . DC  B 10 ? 0.6796 0.6514 0.3158 0.0836  -0.1023 -0.0117 10  DC  B C2    
1687 O O2    . DC  B 10 ? 0.6676 0.6119 0.3187 0.0766  -0.1130 -0.0155 10  DC  B O2    
1688 N N3    . DC  B 10 ? 0.6556 0.6554 0.2960 0.0732  -0.0949 -0.0040 10  DC  B N3    
1689 C C4    . DC  B 10 ? 0.7550 0.7865 0.3814 0.0802  -0.0828 -0.0007 10  DC  B C4    
1690 N N4    . DC  B 10 ? 0.8310 0.8891 0.4627 0.0678  -0.0758 0.0072  10  DC  B N4    
1691 C C5    . DC  B 10 ? 0.8065 0.8442 0.4134 0.1003  -0.0780 -0.0061 10  DC  B C5    
1692 C C6    . DC  B 10 ? 0.8185 0.8255 0.4191 0.1113  -0.0866 -0.0136 10  DC  B C6    
1705 O "O5'" . DG  C 1  ? 0.7325 1.0482 0.6161 0.0319  -0.0514 -0.0066 1   DG  C "O5'" 
1706 C "C5'" . DG  C 1  ? 0.6401 0.9984 0.5631 0.0286  -0.0451 -0.0059 1   DG  C "C5'" 
1707 C "C4'" . DG  C 1  ? 0.5076 0.8802 0.4407 0.0103  -0.0529 -0.0043 1   DG  C "C4'" 
1708 O "O4'" . DG  C 1  ? 0.5404 0.8722 0.4423 0.0049  -0.0487 -0.0055 1   DG  C "O4'" 
1709 C "C3'" . DG  C 1  ? 0.4526 0.8649 0.4213 0.0036  -0.0447 -0.0035 1   DG  C "C3'" 
1710 O "O3'" . DG  C 1  ? 0.4628 0.9053 0.4480 -0.0137 -0.0580 -0.0013 1   DG  C "O3'" 
1711 C "C2'" . DG  C 1  ? 0.4501 0.8358 0.4047 0.0009  -0.0315 -0.0048 1   DG  C "C2'" 
1712 C "C1'" . DG  C 1  ? 0.4864 0.8273 0.4011 -0.0021 -0.0394 -0.0057 1   DG  C "C1'" 
1713 N N9    . DG  C 1  ? 0.4926 0.8015 0.3858 0.0067  -0.0255 -0.0093 1   DG  C N9    
1714 C C8    . DG  C 1  ? 0.4811 0.7874 0.3759 0.0203  -0.0096 -0.0116 1   DG  C C8    
1715 N N7    . DG  C 1  ? 0.4899 0.7740 0.3675 0.0254  0.0007  -0.0154 1   DG  C N7    
1716 C C5    . DG  C 1  ? 0.5112 0.7758 0.3708 0.0173  -0.0098 -0.0158 1   DG  C C5    
1717 C C6    . DG  C 1  ? 0.5332 0.7678 0.3670 0.0219  -0.0069 -0.0203 1   DG  C C6    
1718 O O6    . DG  C 1  ? 0.5337 0.7612 0.3617 0.0346  0.0071  -0.0254 1   DG  C O6    
1719 N N1    . DG  C 1  ? 0.5970 0.8097 0.4095 0.0101  -0.0230 -0.0190 1   DG  C N1    
1720 C C2    . DG  C 1  ? 0.5626 0.7875 0.3821 -0.0076 -0.0389 -0.0136 1   DG  C C2    
1721 N N2    . DG  C 1  ? 0.5958 0.7930 0.3873 -0.0214 -0.0536 -0.0124 1   DG  C N2    
1722 N N3    . DG  C 1  ? 0.5381 0.8002 0.3882 -0.0113 -0.0407 -0.0099 1   DG  C N3    
1723 C C4    . DG  C 1  ? 0.5143 0.7917 0.3814 0.0034  -0.0261 -0.0115 1   DG  C C4    
1736 P P     . DC  C 2  ? 0.6292 1.1140 0.6476 -0.0260 -0.0509 -0.0001 2   DC  C P     
1737 O OP1   . DC  C 2  ? 0.6335 1.1712 0.6824 -0.0324 -0.0623 0.0007  2   DC  C OP1   
1738 O OP2   . DC  C 2  ? 0.6089 1.0932 0.6368 -0.0127 -0.0322 -0.0017 2   DC  C OP2   
1739 O "O5'" . DC  C 2  ? 0.6082 1.0642 0.6022 -0.0481 -0.0551 0.0016  2   DC  C "O5'" 
1740 C "C5'" . DC  C 2  ? 0.6595 1.0940 0.6279 -0.0627 -0.0731 0.0033  2   DC  C "C5'" 
1741 C "C4'" . DC  C 2  ? 0.6724 1.0664 0.6079 -0.0793 -0.0754 0.0042  2   DC  C "C4'" 
1742 O "O4'" . DC  C 2  ? 0.6201 0.9687 0.5289 -0.0615 -0.0648 0.0006  2   DC  C "O4'" 
1743 C "C3'" . DC  C 2  ? 0.6547 1.0706 0.6062 -0.0959 -0.0690 0.0057  2   DC  C "C3'" 
1744 O "O3'" . DC  C 2  ? 0.6815 1.0898 0.6143 -0.1255 -0.0839 0.0093  2   DC  C "O3'" 
1745 C "C2'" . DC  C 2  ? 0.6417 1.0210 0.5758 -0.0828 -0.0556 0.0027  2   DC  C "C2'" 
1746 C "C1'" . DC  C 2  ? 0.6142 0.9469 0.5143 -0.0669 -0.0581 -0.0002 2   DC  C "C1'" 
1747 N N1    . DC  C 2  ? 0.5453 0.8641 0.4453 -0.0440 -0.0414 -0.0046 2   DC  C N1    
1748 C C2    . DC  C 2  ? 0.5213 0.7973 0.3897 -0.0376 -0.0392 -0.0083 2   DC  C C2    
1749 O O2    . DC  C 2  ? 0.5582 0.8005 0.3932 -0.0503 -0.0519 -0.0078 2   DC  C O2    
1750 N N3    . DC  C 2  ? 0.5054 0.7783 0.3790 -0.0177 -0.0241 -0.0128 2   DC  C N3    
1751 C C4    . DC  C 2  ? 0.4721 0.7761 0.3758 -0.0075 -0.0120 -0.0126 2   DC  C C4    
1752 N N4    . DC  C 2  ? 0.4758 0.7774 0.3832 0.0081  0.0023  -0.0167 2   DC  C N4    
1753 C C5    . DC  C 2  ? 0.4765 0.8153 0.4059 -0.0124 -0.0149 -0.0088 2   DC  C C5    
1754 C C6    . DC  C 2  ? 0.4791 0.8272 0.4082 -0.0290 -0.0294 -0.0053 2   DC  C C6    
1766 P P     . DC  C 3  ? 0.6764 1.1180 0.6268 -0.1519 -0.0808 0.0121  3   DC  C P     
1767 O OP1   . DC  C 3  ? 0.8156 1.2593 0.7502 -0.1850 -0.0994 0.0164  3   DC  C OP1   
1768 O OP2   . DC  C 3  ? 0.6572 1.1588 0.6578 -0.1394 -0.0661 0.0108  3   DC  C OP2   
1769 O "O5'" . DC  C 3  ? 0.5949 0.9837 0.5113 -0.1509 -0.0738 0.0108  3   DC  C "O5'" 
1770 C "C5'" . DC  C 3  ? 0.5829 0.9048 0.4452 -0.1542 -0.0854 0.0102  3   DC  C "C5'" 
1771 C "C4'" . DC  C 3  ? 0.5882 0.8688 0.4279 -0.1405 -0.0765 0.0066  3   DC  C "C4'" 
1772 O "O4'" . DC  C 3  ? 0.5557 0.8424 0.4144 -0.1080 -0.0623 0.0019  3   DC  C "O4'" 
1773 C "C3'" . DC  C 3  ? 0.5756 0.8743 0.4292 -0.1536 -0.0681 0.0080  3   DC  C "C3'" 
1774 O "O3'" . DC  C 3  ? 0.6624 0.9134 0.4684 -0.1771 -0.0802 0.0099  3   DC  C "O3'" 
1775 C "C2'" . DC  C 3  ? 0.5446 0.8411 0.4129 -0.1240 -0.0520 0.0032  3   DC  C "C2'" 
1776 C "C1'" . DC  C 3  ? 0.5461 0.8211 0.4042 -0.0985 -0.0520 -0.0008 3   DC  C "C1'" 
1777 N N1    . DC  C 3  ? 0.5033 0.8050 0.3949 -0.0725 -0.0354 -0.0040 3   DC  C N1    
1778 C C2    . DC  C 3  ? 0.5055 0.7797 0.3836 -0.0499 -0.0285 -0.0095 3   DC  C C2    
1779 O O2    . DC  C 3  ? 0.5426 0.7708 0.3817 -0.0478 -0.0364 -0.0124 3   DC  C O2    
1780 N N3    . DC  C 3  ? 0.4706 0.7694 0.3770 -0.0311 -0.0138 -0.0117 3   DC  C N3    
1781 C C4    . DC  C 3  ? 0.4385 0.7794 0.3796 -0.0320 -0.0073 -0.0088 3   DC  C C4    
1782 N N4    . DC  C 3  ? 0.4122 0.7686 0.3729 -0.0152 0.0057  -0.0106 3   DC  C N4    
1783 C C5    . DC  C 3  ? 0.4358 0.8055 0.3916 -0.0500 -0.0143 -0.0042 3   DC  C C5    
1784 C C6    . DC  C 3  ? 0.4666 0.8194 0.3997 -0.0709 -0.0276 -0.0019 3   DC  C C6    
1796 P P     . DA  C 4  ? 0.7935 1.0463 0.5967 -0.1961 -0.0747 0.0118  4   DA  C P     
1797 O OP1   . DA  C 4  ? 0.8880 1.1066 0.6456 -0.2335 -0.0912 0.0163  4   DA  C OP1   
1798 O OP2   . DA  C 4  ? 0.8024 1.1256 0.6642 -0.1929 -0.0579 0.0125  4   DA  C OP2   
1799 O "O5'" . DA  C 4  ? 0.7770 0.9790 0.5539 -0.1699 -0.0711 0.0062  4   DA  C "O5'" 
1800 C "C5'" . DA  C 4  ? 0.7864 0.9243 0.5134 -0.1566 -0.0831 0.0023  4   DA  C "C5'" 
1801 C "C4'" . DA  C 4  ? 0.7629 0.8790 0.4869 -0.1241 -0.0754 -0.0046 4   DA  C "C4'" 
1802 O "O4'" . DA  C 4  ? 0.6901 0.8545 0.4648 -0.0994 -0.0591 -0.0071 4   DA  C "O4'" 
1803 C "C3'" . DA  C 4  ? 0.8189 0.9281 0.5400 -0.1302 -0.0716 -0.0045 4   DA  C "C3'" 
1804 O "O3'" . DA  C 4  ? 0.9673 1.0090 0.6347 -0.1193 -0.0835 -0.0094 4   DA  C "O3'" 
1805 C "C2'" . DA  C 4  ? 0.7023 0.8630 0.4791 -0.1082 -0.0525 -0.0068 4   DA  C "C2'" 
1806 C "C1'" . DA  C 4  ? 0.6449 0.8212 0.4402 -0.0843 -0.0476 -0.0101 4   DA  C "C1'" 
1807 N N9    . DA  C 4  ? 0.5432 0.7779 0.3927 -0.0747 -0.0315 -0.0091 4   DA  C N9    
1808 C C8    . DA  C 4  ? 0.5136 0.7967 0.3974 -0.0897 -0.0258 -0.0041 4   DA  C C8    
1809 N N7    . DA  C 4  ? 0.5092 0.8308 0.4316 -0.0734 -0.0127 -0.0049 4   DA  C N7    
1810 C C5    . DA  C 4  ? 0.4887 0.7888 0.4035 -0.0497 -0.0087 -0.0102 4   DA  C C5    
1811 C C6    . DA  C 4  ? 0.4951 0.8148 0.4346 -0.0285 0.0038  -0.0130 4   DA  C C6    
1812 N N6    . DA  C 4  ? 0.4685 0.8271 0.4410 -0.0260 0.0135  -0.0106 4   DA  C N6    
1813 N N1    . DA  C 4  ? 0.4631 0.7603 0.3895 -0.0102 0.0057  -0.0186 4   DA  C N1    
1814 C C2    . DA  C 4  ? 0.4776 0.7330 0.3673 -0.0087 -0.0052 -0.0221 4   DA  C C2    
1815 N N3    . DA  C 4  ? 0.5139 0.7387 0.3715 -0.0261 -0.0190 -0.0198 4   DA  C N3    
1816 C C4    . DA  C 4  ? 0.5031 0.7536 0.3761 -0.0485 -0.0197 -0.0133 4   DA  C C4    
1828 P P     . DC  C 5  ? 1.0146 1.0291 0.6612 -0.1255 -0.0855 -0.0099 5   DC  C P     
1829 O OP1   . DC  C 5  ? 1.0807 1.0140 0.6514 -0.1344 -0.1067 -0.0112 5   DC  C OP1   
1830 O OP2   . DC  C 5  ? 1.0362 1.1019 0.7203 -0.1508 -0.0738 -0.0035 5   DC  C OP2   
1831 O "O5'" . DC  C 5  ? 0.8901 0.9160 0.5629 -0.0860 -0.0757 -0.0177 5   DC  C "O5'" 
1832 C "C5'" . DC  C 5  ? 0.8300 0.8318 0.4877 -0.0542 -0.0796 -0.0257 5   DC  C "C5'" 
1833 C "C4'" . DC  C 5  ? 0.7485 0.7820 0.4455 -0.0234 -0.0669 -0.0319 5   DC  C "C4'" 
1834 O "O4'" . DC  C 5  ? 0.6808 0.7800 0.4369 -0.0233 -0.0488 -0.0287 5   DC  C "O4'" 
1835 C "C3'" . DC  C 5  ? 0.7454 0.7711 0.4419 -0.0240 -0.0678 -0.0326 5   DC  C "C3'" 
1836 O "O3'" . DC  C 5  ? 0.7885 0.7848 0.4658 0.0067  -0.0752 -0.0421 5   DC  C "O3'" 
1837 C "C2'" . DC  C 5  ? 0.6484 0.7402 0.4073 -0.0262 -0.0486 -0.0289 5   DC  C "C2'" 
1838 C "C1'" . DC  C 5  ? 0.5834 0.7134 0.3745 -0.0147 -0.0379 -0.0296 5   DC  C "C1'" 
1839 N N1    . DC  C 5  ? 0.5325 0.7186 0.3712 -0.0263 -0.0231 -0.0235 5   DC  C N1    
1840 C C2    . DC  C 5  ? 0.4878 0.7142 0.3679 -0.0093 -0.0088 -0.0254 5   DC  C C2    
1841 O O2    . DC  C 5  ? 0.4875 0.7093 0.3691 0.0130  -0.0073 -0.0319 5   DC  C O2    
1842 N N3    . DC  C 5  ? 0.4499 0.7193 0.3655 -0.0176 0.0027  -0.0203 5   DC  C N3    
1843 C C4    . DC  C 5  ? 0.4515 0.7324 0.3684 -0.0398 0.0010  -0.0145 5   DC  C C4    
1844 N N4    . DC  C 5  ? 0.4448 0.7692 0.3966 -0.0428 0.0117  -0.0109 5   DC  C N4    
1845 C C5    . DC  C 5  ? 0.4930 0.7412 0.3734 -0.0602 -0.0122 -0.0123 5   DC  C C5    
1846 C C6    . DC  C 5  ? 0.5343 0.7318 0.3736 -0.0536 -0.0243 -0.0165 5   DC  C C6    
1858 P P     . DG  C 6  ? 0.8474 0.8139 0.5049 0.0102  -0.0843 -0.0446 6   DG  C P     
1859 O OP1   . DG  C 6  ? 0.8936 0.8167 0.5153 0.0430  -0.0986 -0.0555 6   DG  C OP1   
1860 O OP2   . DG  C 6  ? 0.8802 0.8191 0.5072 -0.0265 -0.0906 -0.0363 6   DG  C OP2   
1861 O "O5'" . DG  C 6  ? 0.6959 0.7261 0.4176 0.0185  -0.0664 -0.0441 6   DG  C "O5'" 
1862 C "C5'" . DG  C 6  ? 0.6698 0.7397 0.4301 0.0464  -0.0563 -0.0505 6   DG  C "C5'" 
1863 C "C4'" . DG  C 6  ? 0.6215 0.7466 0.4361 0.0442  -0.0402 -0.0473 6   DG  C "C4'" 
1864 O "O4'" . DG  C 6  ? 0.6646 0.8233 0.5046 0.0223  -0.0275 -0.0388 6   DG  C "O4'" 
1865 C "C3'" . DG  C 6  ? 0.6902 0.8017 0.4991 0.0368  -0.0452 -0.0457 6   DG  C "C3'" 
1866 O "O3'" . DG  C 6  ? 0.7075 0.8340 0.5362 0.0611  -0.0460 -0.0527 6   DG  C "O3'" 
1867 C "C2'" . DG  C 6  ? 0.5827 0.7305 0.4222 0.0124  -0.0304 -0.0364 6   DG  C "C2'" 
1868 C "C1'" . DG  C 6  ? 0.6076 0.7941 0.4761 0.0127  -0.0182 -0.0343 6   DG  C "C1'" 
1869 N N9    . DG  C 6  ? 0.5580 0.7646 0.4371 -0.0119 -0.0105 -0.0262 6   DG  C N9    
1870 C C8    . DG  C 6  ? 0.5534 0.7375 0.4039 -0.0362 -0.0175 -0.0215 6   DG  C C8    
1871 N N7    . DG  C 6  ? 0.5083 0.7286 0.3828 -0.0531 -0.0076 -0.0155 6   DG  C N7    
1872 C C5    . DG  C 6  ? 0.4710 0.7329 0.3874 -0.0376 0.0056  -0.0162 6   DG  C C5    
1873 C C6    . DG  C 6  ? 0.4489 0.7561 0.4003 -0.0418 0.0184  -0.0122 6   DG  C C6    
1874 O O6    . DG  C 6  ? 0.4255 0.7534 0.3841 -0.0588 0.0213  -0.0077 6   DG  C O6    
1875 N N1    . DG  C 6  ? 0.4322 0.7619 0.4106 -0.0234 0.0276  -0.0142 6   DG  C N1    
1876 C C2    . DG  C 6  ? 0.4569 0.7753 0.4343 -0.0055 0.0261  -0.0195 6   DG  C C2    
1877 N N2    . DG  C 6  ? 0.4742 0.8189 0.4780 0.0059  0.0362  -0.0202 6   DG  C N2    
1878 N N3    . DG  C 6  ? 0.4854 0.7696 0.4364 0.0009  0.0147  -0.0242 6   DG  C N3    
1879 C C4    . DG  C 6  ? 0.4777 0.7314 0.3966 -0.0148 0.0044  -0.0222 6   DG  C C4    
1891 P P     . DC  C 7  ? 0.7039 0.8156 0.5274 0.0590  -0.0532 -0.0525 7   DC  C P     
1892 O OP1   . DC  C 7  ? 0.8349 0.9325 0.6493 0.0892  -0.0669 -0.0633 7   DC  C OP1   
1893 O OP2   . DC  C 7  ? 0.7369 0.8083 0.5224 0.0313  -0.0591 -0.0455 7   DC  C OP2   
1894 O "O5'" . DC  C 7  ? 0.5779 0.7468 0.4552 0.0534  -0.0349 -0.0479 7   DC  C "O5'" 
1895 C "C5'" . DC  C 7  ? 0.5619 0.7777 0.4797 0.0695  -0.0241 -0.0517 7   DC  C "C5'" 
1896 C "C4'" . DC  C 7  ? 0.5088 0.7657 0.4639 0.0564  -0.0074 -0.0448 7   DC  C "C4'" 
1897 O "O4'" . DC  C 7  ? 0.5517 0.8118 0.5045 0.0371  0.0009  -0.0373 7   DC  C "O4'" 
1898 C "C3'" . DC  C 7  ? 0.5186 0.7700 0.4757 0.0486  -0.0095 -0.0417 7   DC  C "C3'" 
1899 O "O3'" . DC  C 7  ? 0.5325 0.8188 0.5230 0.0575  -0.0037 -0.0436 7   DC  C "O3'" 
1900 C "C2'" . DC  C 7  ? 0.5135 0.7671 0.4694 0.0251  0.0008  -0.0325 7   DC  C "C2'" 
1901 C "C1'" . DC  C 7  ? 0.4705 0.7454 0.4378 0.0228  0.0099  -0.0308 7   DC  C "C1'" 
1902 N N1    . DC  C 7  ? 0.4495 0.7180 0.4041 0.0023  0.0128  -0.0246 7   DC  C N1    
1903 C C2    . DC  C 7  ? 0.4600 0.7619 0.4388 -0.0062 0.0266  -0.0192 7   DC  C C2    
1904 O O2    . DC  C 7  ? 0.3765 0.7049 0.3812 0.0025  0.0354  -0.0192 7   DC  C O2    
1905 N N3    . DC  C 7  ? 0.4922 0.7966 0.4639 -0.0240 0.0290  -0.0146 7   DC  C N3    
1906 C C4    . DC  C 7  ? 0.5246 0.7975 0.4640 -0.0372 0.0189  -0.0142 7   DC  C C4    
1907 N N4    . DC  C 7  ? 0.5447 0.8277 0.4806 -0.0578 0.0222  -0.0095 7   DC  C N4    
1908 C C5    . DC  C 7  ? 0.5681 0.7975 0.4753 -0.0300 0.0040  -0.0189 7   DC  C C5    
1909 C C6    . DC  C 7  ? 0.5207 0.7507 0.4380 -0.0081 0.0013  -0.0245 7   DC  C C6    
1921 P P     . DC  C 8  ? 0.6526 0.9343 0.6463 0.0517  -0.0069 -0.0410 8   DC  C P     
1922 O OP1   . DC  C 8  ? 0.6221 0.9351 0.6442 0.0657  -0.0083 -0.0464 8   DC  C OP1   
1923 O OP2   . DC  C 8  ? 0.6877 0.9202 0.6419 0.0464  -0.0211 -0.0409 8   DC  C OP2   
1924 O "O5'" . DC  C 8  ? 0.6046 0.9039 0.6118 0.0335  0.0097  -0.0320 8   DC  C "O5'" 
1925 C "C5'" . DC  C 8  ? 0.6338 0.9705 0.6697 0.0344  0.0232  -0.0303 8   DC  C "C5'" 
1926 C "C4'" . DC  C 8  ? 0.4559 0.7990 0.4953 0.0207  0.0352  -0.0226 8   DC  C "C4'" 
1927 O "O4'" . DC  C 8  ? 0.4536 0.7877 0.4796 0.0116  0.0380  -0.0195 8   DC  C "O4'" 
1928 C "C3'" . DC  C 8  ? 0.4672 0.7941 0.4974 0.0135  0.0331  -0.0194 8   DC  C "C3'" 
1929 O "O3'" . DC  C 8  ? 0.5373 0.8816 0.5821 0.0111  0.0423  -0.0159 8   DC  C "O3'" 
1930 C "C2'" . DC  C 8  ? 0.5240 0.8314 0.5330 0.0010  0.0356  -0.0154 8   DC  C "C2'" 
1931 C "C1'" . DC  C 8  ? 0.5019 0.8281 0.5194 -0.0003 0.0428  -0.0145 8   DC  C "C1'" 
1932 N N1    . DC  C 8  ? 0.4793 0.7903 0.4768 -0.0122 0.0407  -0.0129 8   DC  C N1    
1933 C C2    . DC  C 8  ? 0.4067 0.7332 0.4078 -0.0234 0.0513  -0.0083 8   DC  C C2    
1934 O O2    . DC  C 8  ? 0.3840 0.7317 0.4017 -0.0198 0.0615  -0.0061 8   DC  C O2    
1935 N N3    . DC  C 8  ? 0.4671 0.7851 0.4517 -0.0380 0.0496  -0.0068 8   DC  C N3    
1936 C C4    . DC  C 8  ? 0.4785 0.7649 0.4373 -0.0420 0.0368  -0.0091 8   DC  C C4    
1937 N N4    . DC  C 8  ? 0.5138 0.7896 0.4523 -0.0606 0.0349  -0.0068 8   DC  C N4    
1938 C C5    . DC  C 8  ? 0.5199 0.7845 0.4709 -0.0269 0.0248  -0.0143 8   DC  C C5    
1939 C C6    . DC  C 8  ? 0.5312 0.8136 0.5054 -0.0121 0.0277  -0.0163 8   DC  C C6    
1951 P P     . DT  C 9  ? 0.5913 0.9191 0.6266 0.0055  0.0398  -0.0130 9   DT  C P     
1952 O OP1   . DT  C 9  ? 0.6323 0.9786 0.6827 0.0054  0.0449  -0.0114 9   DT  C OP1   
1953 O OP2   . DT  C 9  ? 0.6531 0.9566 0.6739 0.0081  0.0246  -0.0167 9   DT  C OP2   
1954 O "O5'" . DT  C 9  ? 0.4772 0.7930 0.4966 -0.0037 0.0494  -0.0077 9   DT  C "O5'" 
1955 C "C5'" . DT  C 9  ? 0.4273 0.7624 0.4557 -0.0038 0.0622  -0.0047 9   DT  C "C5'" 
1956 C "C4'" . DT  C 9  ? 0.4236 0.7533 0.4392 -0.0104 0.0701  -0.0016 9   DT  C "C4'" 
1957 O "O4'" . DT  C 9  ? 0.4403 0.7692 0.4509 -0.0163 0.0675  -0.0029 9   DT  C "O4'" 
1958 C "C3'" . DT  C 9  ? 0.3833 0.6866 0.3774 -0.0162 0.0692  0.0002  9   DT  C "C3'" 
1959 O "O3'" . DT  C 9  ? 0.3804 0.6849 0.3709 -0.0134 0.0786  0.0031  9   DT  C "O3'" 
1960 C "C2'" . DT  C 9  ? 0.3665 0.6610 0.3452 -0.0268 0.0709  0.0005  9   DT  C "C2'" 
1961 C "C1'" . DT  C 9  ? 0.4038 0.7227 0.3979 -0.0266 0.0726  -0.0007 9   DT  C "C1'" 
1962 N N1    . DT  C 9  ? 0.4280 0.7316 0.4060 -0.0374 0.0654  -0.0018 9   DT  C N1    
1963 C C2    . DT  C 9  ? 0.4752 0.7915 0.4497 -0.0500 0.0727  0.0000  9   DT  C C2    
1964 O O2    . DT  C 9  ? 0.4239 0.7683 0.4116 -0.0498 0.0851  0.0017  9   DT  C O2    
1965 N N3    . DT  C 9  ? 0.5448 0.8396 0.4977 -0.0629 0.0641  -0.0006 9   DT  C N3    
1966 C C4    . DT  C 9  ? 0.5202 0.7791 0.4526 -0.0604 0.0482  -0.0034 9   DT  C C4    
1967 O O4    . DT  C 9  ? 0.5218 0.7551 0.4277 -0.0723 0.0397  -0.0038 9   DT  C O4    
1968 C C5    . DT  C 9  ? 0.4120 0.6651 0.3541 -0.0431 0.0413  -0.0063 9   DT  C C5    
1969 C C7    . DT  C 9  ? 0.4489 0.6700 0.3735 -0.0348 0.0234  -0.0110 9   DT  C C7    
1970 C C6    . DT  C 9  ? 0.3861 0.6634 0.3514 -0.0346 0.0506  -0.0050 9   DT  C C6    
1983 P P     . DC  C 10 ? 0.5079 0.7821 0.4725 -0.0176 0.0791  0.0052  10  DC  C P     
1984 O OP1   . DC  C 10 ? 0.5479 0.8194 0.5085 -0.0113 0.0841  0.0074  10  DC  C OP1   
1985 O OP2   . DC  C 10 ? 0.4689 0.7184 0.4229 -0.0222 0.0647  0.0036  10  DC  C OP2   
1986 O "O5'" . DC  C 10 ? 0.3875 0.6648 0.3406 -0.0238 0.0903  0.0058  10  DC  C "O5'" 
1987 C "C5'" . DC  C 10 ? 0.4269 0.7331 0.3914 -0.0179 0.1034  0.0060  10  DC  C "C5'" 
1988 C "C4'" . DC  C 10 ? 0.4858 0.8062 0.4469 -0.0278 0.1123  0.0056  10  DC  C "C4'" 
1989 O "O4'" . DC  C 10 ? 0.5212 0.8458 0.4884 -0.0379 0.1044  0.0047  10  DC  C "O4'" 
1990 C "C3'" . DC  C 10 ? 0.4968 0.7898 0.4287 -0.0380 0.1161  0.0064  10  DC  C "C3'" 
1991 O "O3'" . DC  C 10 ? 0.5041 0.8026 0.4280 -0.0297 0.1297  0.0065  10  DC  C "O3'" 
1992 C "C2'" . DC  C 10 ? 0.5550 0.8576 0.4836 -0.0555 0.1182  0.0060  10  DC  C "C2'" 
1993 C "C1'" . DC  C 10 ? 0.5251 0.8478 0.4772 -0.0541 0.1098  0.0051  10  DC  C "C1'" 
1994 N N1    . DC  C 10 ? 0.5665 0.8616 0.5027 -0.0661 0.0959  0.0046  10  DC  C N1    
1995 C C2    . DC  C 10 ? 0.6589 0.9618 0.5895 -0.0829 0.0964  0.0049  10  DC  C C2    
1996 O O2    . DC  C 10 ? 0.7026 1.0430 0.6477 -0.0884 0.1088  0.0054  10  DC  C O2    
1997 N N3    . DC  C 10 ? 0.6212 0.8896 0.5287 -0.0925 0.0819  0.0042  10  DC  C N3    
1998 C C4    . DC  C 10 ? 0.6114 0.8449 0.5065 -0.0831 0.0677  0.0025  10  DC  C C4    
1999 N N4    . DC  C 10 ? 0.6011 0.7986 0.4701 -0.0891 0.0522  0.0008  10  DC  C N4    
2000 C C5    . DC  C 10 ? 0.6013 0.8347 0.5082 -0.0671 0.0675  0.0021  10  DC  C C5    
2001 C C6    . DC  C 10 ? 0.5878 0.8494 0.5126 -0.0607 0.0818  0.0036  10  DC  C C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  391 ?   ?   ?   A . n 
A 1 2  PRO 2  392 ?   ?   ?   A . n 
A 1 3  LEU 3  393 ?   ?   ?   A . n 
A 1 4  GLY 4  394 ?   ?   ?   A . n 
A 1 5  SER 5  395 ?   ?   ?   A . n 
A 1 6  ARG 6  396 ?   ?   ?   A . n 
A 1 7  THR 7  397 397 THR THR A . n 
A 1 8  ALA 8  398 398 ALA ALA A . n 
A 1 9  THR 9  399 399 THR THR A . n 
A 1 10 HIS 10 400 400 HIS HIS A . n 
A 1 11 THR 11 401 401 THR THR A . n 
A 1 12 CYS 12 402 402 CYS CYS A . n 
A 1 13 ASP 13 403 403 ASP ASP A . n 
A 1 14 TYR 14 404 404 TYR TYR A . n 
A 1 15 ALA 15 405 405 ALA ALA A . n 
A 1 16 GLY 16 406 406 GLY GLY A . n 
A 1 17 CYS 17 407 407 CYS CYS A . n 
A 1 18 GLY 18 408 408 GLY GLY A . n 
A 1 19 LYS 19 409 409 LYS LYS A . n 
A 1 20 THR 20 410 410 THR THR A . n 
A 1 21 TYR 21 411 411 TYR TYR A . n 
A 1 22 THR 22 412 412 THR THR A . n 
A 1 23 LYS 23 413 413 LYS LYS A . n 
A 1 24 SER 24 414 414 SER SER A . n 
A 1 25 SER 25 415 415 SER SER A . n 
A 1 26 HIS 26 416 416 HIS HIS A . n 
A 1 27 LEU 27 417 417 LEU LEU A . n 
A 1 28 LYS 28 418 418 LYS LYS A . n 
A 1 29 ALA 29 419 419 ALA ALA A . n 
A 1 30 HIS 30 420 420 HIS HIS A . n 
A 1 31 LEU 31 421 421 LEU LEU A . n 
A 1 32 ARG 32 422 422 ARG ARG A . n 
A 1 33 THR 33 423 423 THR THR A . n 
A 1 34 HIS 34 424 424 HIS HIS A . n 
A 1 35 THR 35 425 425 THR THR A . n 
A 1 36 GLY 36 426 426 GLY GLY A . n 
A 1 37 GLU 37 427 427 GLU GLU A . n 
A 1 38 LYS 38 428 428 LYS LYS A . n 
A 1 39 PRO 39 429 429 PRO PRO A . n 
A 1 40 TYR 40 430 430 TYR TYR A . n 
A 1 41 HIS 41 431 431 HIS HIS A . n 
A 1 42 CYS 42 432 432 CYS CYS A . n 
A 1 43 ASP 43 433 433 ASP ASP A . n 
A 1 44 TRP 44 434 434 TRP TRP A . n 
A 1 45 ASP 45 435 435 ASP ASP A . n 
A 1 46 GLY 46 436 436 GLY GLY A . n 
A 1 47 CYS 47 437 437 CYS CYS A . n 
A 1 48 GLY 48 438 438 GLY GLY A . n 
A 1 49 TRP 49 439 439 TRP TRP A . n 
A 1 50 LYS 50 440 440 LYS LYS A . n 
A 1 51 PHE 51 441 441 PHE PHE A . n 
A 1 52 ALA 52 442 442 ALA ALA A . n 
A 1 53 ARG 53 443 443 ARG ARG A . n 
A 1 54 SER 54 444 444 SER SER A . n 
A 1 55 ASP 55 445 445 ASP ASP A . n 
A 1 56 ASP 56 446 446 ASP ASP A . n 
A 1 57 LEU 57 447 447 LEU LEU A . n 
A 1 58 THR 58 448 448 THR THR A . n 
A 1 59 ARG 59 449 449 ARG ARG A . n 
A 1 60 HIS 60 450 450 HIS HIS A . n 
A 1 61 TYR 61 451 451 TYR TYR A . n 
A 1 62 ARG 62 452 452 ARG ARG A . n 
A 1 63 LYS 63 453 453 LYS LYS A . n 
A 1 64 HIS 64 454 454 HIS HIS A . n 
A 1 65 THR 65 455 455 THR THR A . n 
A 1 66 GLY 66 456 456 GLY GLY A . n 
A 1 67 HIS 67 457 457 HIS HIS A . n 
A 1 68 ARG 68 458 458 ARG ARG A . n 
A 1 69 PRO 69 459 459 PRO PRO A . n 
A 1 70 PHE 70 460 460 PHE PHE A . n 
A 1 71 GLN 71 461 461 GLN GLN A . n 
A 1 72 CYS 72 462 462 CYS CYS A . n 
A 1 73 GLN 73 463 463 GLN GLN A . n 
A 1 74 LYS 74 464 464 LYS LYS A . n 
A 1 75 CYS 75 465 465 CYS CYS A . n 
A 1 76 ASP 76 466 466 ASP ASP A . n 
A 1 77 ARG 77 467 467 ARG ARG A . n 
A 1 78 ALA 78 468 468 ALA ALA A . n 
A 1 79 PHE 79 469 469 PHE PHE A . n 
A 1 80 SER 80 470 470 SER SER A . n 
A 1 81 ARG 81 471 471 ARG ARG A . n 
A 1 82 SER 82 472 472 SER SER A . n 
A 1 83 ASP 83 473 473 ASP ASP A . n 
A 1 84 HIS 84 474 474 HIS HIS A . n 
A 1 85 LEU 85 475 475 LEU LEU A . n 
A 1 86 ALA 86 476 476 ALA ALA A . n 
A 1 87 LEU 87 477 477 LEU LEU A . n 
A 1 88 HIS 88 478 478 HIS HIS A . n 
A 1 89 MET 89 479 479 MET MET A . n 
A 1 90 LYS 90 480 480 LYS LYS A . n 
A 1 91 ARG 91 481 481 ARG ARG A . n 
A 1 92 HIS 92 482 482 HIS HIS A . n 
A 1 93 PHE 93 483 483 PHE PHE A . n 
B 2 1  DG  1  1   1   DG  DG  B . n 
B 2 2  DA  2  2   2   DA  DA  B . n 
B 2 3  DG  3  3   3   DG  DG  B . n 
B 2 4  DG  4  4   4   DG  DG  B . n 
B 2 5  DC  5  5   5   DC  DC  B . n 
B 2 6  DG  6  6   6   DG  DG  B . n 
B 2 7  DT  7  7   7   DT  DT  B . n 
B 2 8  DG  8  8   8   DG  DG  B . n 
B 2 9  DG  9  9   9   DG  DG  B . n 
B 2 10 DC  10 10  10  DC  DC  B . n 
C 3 1  DG  1  1   1   DG  DG  C . n 
C 3 2  DC  2  2   2   DC  DC  C . n 
C 3 3  DC  3  3   3   DC  DC  C . n 
C 3 4  DA  4  4   4   DA  DA  C . n 
C 3 5  DC  5  5   5   DC  DC  C . n 
C 3 6  DG  6  6   6   DG  DG  C . n 
C 3 7  DC  7  7   7   DC  DC  C . n 
C 3 8  DC  8  8   8   DC  DC  C . n 
C 3 9  DT  9  9   9   DT  DT  C . n 
C 3 10 DC  10 10  10  DC  DC  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1 501 1  ZN  ZN  A . 
E 4 ZN  1 502 2  ZN  ZN  A . 
F 4 ZN  1 503 3  ZN  ZN  A . 
G 5 HOH 1 601 10 HOH HOH A . 
G 5 HOH 2 602 11 HOH HOH A . 
G 5 HOH 3 603 2  HOH HOH A . 
G 5 HOH 4 604 19 HOH HOH A . 
G 5 HOH 5 605 17 HOH HOH A . 
G 5 HOH 6 606 15 HOH HOH A . 
G 5 HOH 7 607 12 HOH HOH A . 
G 5 HOH 8 608 4  HOH HOH A . 
G 5 HOH 9 609 14 HOH HOH A . 
H 5 HOH 1 101 9  HOH HOH B . 
H 5 HOH 2 102 5  HOH HOH B . 
H 5 HOH 3 103 20 HOH HOH B . 
H 5 HOH 4 104 16 HOH HOH B . 
I 5 HOH 1 101 18 HOH HOH C . 
I 5 HOH 2 102 13 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3190 ? 
1 MORE         -22  ? 
1 'SSA (A^2)'  8440 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 12 ? A CYS 402 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG  ? A CYS 17 ? A CYS 407 ? 1_555 108.8 ? 
2  SG  ? A CYS 12 ? A CYS 402 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 30 ? A HIS 420 ? 1_555 110.7 ? 
3  SG  ? A CYS 17 ? A CYS 407 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 30 ? A HIS 420 ? 1_555 91.9  ? 
4  SG  ? A CYS 12 ? A CYS 402 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 34 ? A HIS 424 ? 1_555 92.9  ? 
5  SG  ? A CYS 17 ? A CYS 407 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 34 ? A HIS 424 ? 1_555 146.8 ? 
6  NE2 ? A HIS 30 ? A HIS 420 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 34 ? A HIS 424 ? 1_555 103.9 ? 
7  SG  ? A CYS 42 ? A CYS 432 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 SG  ? A CYS 47 ? A CYS 437 ? 1_555 121.4 ? 
8  SG  ? A CYS 42 ? A CYS 432 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 60 ? A HIS 450 ? 1_555 106.5 ? 
9  SG  ? A CYS 47 ? A CYS 437 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 60 ? A HIS 450 ? 1_555 98.5  ? 
10 SG  ? A CYS 42 ? A CYS 432 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64 ? A HIS 454 ? 1_555 119.4 ? 
11 SG  ? A CYS 47 ? A CYS 437 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64 ? A HIS 454 ? 1_555 105.0 ? 
12 NE2 ? A HIS 60 ? A HIS 450 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64 ? A HIS 454 ? 1_555 102.2 ? 
13 SG  ? A CYS 72 ? A CYS 462 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 SG  ? A CYS 75 ? A CYS 465 ? 1_555 131.7 ? 
14 SG  ? A CYS 72 ? A CYS 462 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 88 ? A HIS 478 ? 1_555 100.4 ? 
15 SG  ? A CYS 75 ? A CYS 465 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 88 ? A HIS 478 ? 1_555 121.8 ? 
16 SG  ? A CYS 72 ? A CYS 462 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 92 ? A HIS 482 ? 1_555 98.0  ? 
17 SG  ? A CYS 75 ? A CYS 465 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 92 ? A HIS 482 ? 1_555 114.9 ? 
18 NE2 ? A HIS 88 ? A HIS 478 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 92 ? A HIS 482 ? 1_555 73.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-09-14 
2 'Structure model' 1 1 2016-09-21 
3 'Structure model' 1 2 2016-12-14 
4 'Structure model' 1 3 2017-09-20 
5 'Structure model' 1 4 2018-01-03 
6 'Structure model' 1 5 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 5 'Structure model' 'Structure summary'          
5 6 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_audit_support 
2 5 'Structure model' struct             
3 6 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_audit_support.funding_organization' 
2 5 'Structure model' '_struct.title'                            
3 6 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 8.6697   -13.6071 -7.1851 0.7477 0.9080 0.9275 -0.0615 0.1674  0.0251  4.6249 4.7898 7.9028 
0.1319  -0.3154 -3.7121 -0.1366 -0.4039 0.5489  -1.7964 -0.6184 -0.3592 0.7268  1.4597  0.4112  
'X-RAY DIFFRACTION' 2  ? refined 4.5023   -4.6089  1.3813  0.8630 0.8259 0.9094 -0.3627 -0.1620 0.0997  3.8782 5.3409 1.6368 
-2.9845 -2.4355 1.2971  -0.4171 -0.4412 1.4414  -0.5627 1.0000  -0.9542 0.6980  0.0648  -0.1759 
'X-RAY DIFFRACTION' 3  ? refined 7.1643   -15.0068 0.7117  0.4595 0.8225 0.6389 -0.2670 -0.2343 0.1493  1.7941 3.1872 4.0281 
-0.9037 -1.1256 -0.9385 -0.1378 0.0567  0.5940  -0.3080 -0.7808 0.4110  -0.4666 0.8808  -1.0965 
'X-RAY DIFFRACTION' 4  ? refined -0.7297  -13.5334 0.9822  0.5734 0.5460 0.4178 -0.1405 -0.0980 -0.0950 3.3078 3.3435 0.6297 
0.4503  -1.3789 -0.6586 -0.1737 0.5298  0.5056  -0.3068 -0.2239 0.8941  0.7330  -0.3849 0.4431  
'X-RAY DIFFRACTION' 5  ? refined -13.3254 -20.9049 9.7870  0.2934 0.2787 0.3038 -0.0039 -0.0169 0.0285  1.8557 3.8436 1.9085 
-0.4370 0.4052  -1.4749 -0.2012 -0.0772 -0.0500 -0.1441 0.3578  0.1459  0.1991  -0.2926 -0.2507 
'X-RAY DIFFRACTION' 6  ? refined -10.6538 -36.6905 13.9630 0.6329 0.5498 0.6474 -0.0706 -0.1343 -0.1767 8.0179 3.8926 1.7154 
-3.4709 -1.3648 0.1734  0.9258  -1.0703 -0.4445 0.6757  -0.2672 -0.4977 1.2557  0.2493  -0.5902 
'X-RAY DIFFRACTION' 7  ? refined -3.7851  -45.4704 19.4060 0.7885 0.7789 0.8650 -0.0430 0.0997  0.2164  0.6454 2.6587 1.7952 
0.7357  -0.4048 1.1467  -0.4412 -0.4138 -0.8977 -1.6035 0.9783  0.2165  0.7362  0.4604  -0.6341 
'X-RAY DIFFRACTION' 8  ? refined -7.0717  -37.1161 18.8289 0.4375 0.5934 0.5572 0.0815  -0.0355 0.2631  1.1081 7.0026 8.2601 
1.3002  -2.7269 -6.0927 0.2670  -0.9930 -0.7370 1.5516  0.5651  1.0362  -0.8977 -0.0344 -0.5495 
'X-RAY DIFFRACTION' 9  ? refined 1.3784   -37.5512 20.9894 0.6109 0.6785 0.4142 0.0952  -0.0341 0.0123  4.2402 5.0423 5.5683 
-2.3552 2.7354  -2.7072 -0.0987 -1.1369 0.4099  0.2219  0.5560  -0.5137 0.7219  -0.3648 -0.5992 
'X-RAY DIFFRACTION' 10 ? refined 0.1957   -24.7023 8.0440  0.3894 0.5283 0.2602 0.0058  -0.0304 0.0201  0.6619 1.5831 1.7258 
-0.3003 0.8527  0.7367  -0.0436 0.1343  -0.0023 -0.1958 -0.0408 0.2310  0.3677  0.4799  0.0360  
'X-RAY DIFFRACTION' 11 ? refined 0.0937   -26.1764 8.8455  0.3885 0.7225 0.3599 -0.0323 0.0227  -0.0123 0.1246 2.3960 4.6307 
0.2380  0.9622  0.4230  0.2790  0.0494  -0.0587 0.0037  -0.0380 0.0822  0.7602  -0.3471 -0.1764 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 397 through 401 )
;
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 402 through 406 )
;
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 407 through 413 )
;
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 414 through 424 )
;
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 425 through 455 )
;
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 456 through 460 )
;
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 461 through 465 )
;
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 466 through 471 )
;
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 472 through 483 )
;
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 1 through 10 )
;
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 1 through 10 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_2400: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .                 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HB3 A CYS 465 ? ? ZN A ZN  503 ? ? 1.45 
2 1 OP2 B DG  3   ? ? O  B HOH 101 ? ? 2.18 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    CYS 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     407 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -87.89 
_pdbx_validate_torsion.psi             -159.11 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 391 ? A GLY 1 
2 1 Y 1 A PRO 392 ? A PRO 2 
3 1 Y 1 A LEU 393 ? A LEU 3 
4 1 Y 1 A GLY 394 ? A GLY 4 
5 1 Y 1 A SER 395 ? A SER 5 
6 1 Y 1 A ARG 396 ? A ARG 6 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KEA 'double helix'        
5KEA 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 10 1_555 -0.652 -0.119 0.005  -1.580  -13.493 3.393  1  B_DG1:DC10_C B 1  ? C 10 ? 19 1 
1 B DA 2  1_555 C DT 9  1_555 0.391  -0.032 0.559  8.115   -6.835  2.158  2  B_DA2:DT9_C  B 2  ? C 9  ? 20 1 
1 B DG 3  1_555 C DC 8  1_555 0.310  -0.184 0.460  14.662  -6.839  -1.862 3  B_DG3:DC8_C  B 3  ? C 8  ? 19 1 
1 B DG 4  1_555 C DC 7  1_555 -0.580 -0.277 -0.123 -1.372  -15.188 1.220  4  B_DG4:DC7_C  B 4  ? C 7  ? 19 1 
1 B DC 5  1_555 C DG 6  1_555 0.271  0.225  0.261  -7.994  -8.908  12.467 5  B_DC5:DG6_C  B 5  ? C 6  ? ?  1 
1 B DG 6  1_555 C DC 5  1_555 -0.103 -0.303 -0.028 0.753   -6.189  -2.889 6  B_DG6:DC5_C  B 6  ? C 5  ? 19 1 
1 B DT 7  1_555 C DA 4  1_555 -0.518 -0.110 0.178  -10.791 -10.455 1.643  7  B_DT7:DA4_C  B 7  ? C 4  ? 20 1 
1 B DG 8  1_555 C DC 3  1_555 -0.209 -0.143 0.218  3.048   -6.964  1.634  8  B_DG8:DC3_C  B 8  ? C 3  ? 19 1 
1 B DG 9  1_555 C DC 2  1_555 -0.182 -0.115 0.491  10.868  -11.756 -3.856 9  B_DG9:DC2_C  B 9  ? C 2  ? 19 1 
1 B DC 10 1_555 C DG 1  1_555 0.124  0.004  0.203  0.323   -1.404  2.519  10 B_DC10:DG1_C B 10 ? C 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1 1_555 C DC 10 1_555 B DA 2  1_555 C DT 9 1_555 0.013  -0.257 2.917 -4.323 2.104  35.038 -0.699 -0.589 2.875 3.475  7.139  
35.356 1 BB_DG1DA2:DT9DC10_CC B 1 ? C 10 ? B 2  ? C 9 ? 
1 B DA 2 1_555 C DT 9  1_555 B DG 3  1_555 C DC 8 1_555 -0.481 -0.605 3.098 -1.025 0.075  33.311 -1.067 0.678  3.110 0.130  1.788  
33.327 2 BB_DA2DG3:DC8DT9_CC  B 2 ? C 9  ? B 3  ? C 8 ? 
1 B DG 3 1_555 C DC 8  1_555 B DG 4  1_555 C DC 7 1_555 0.057  -0.992 3.639 5.013  5.445  33.480 -2.618 0.763  3.413 9.311  -8.572 
34.266 3 BB_DG3DG4:DC7DC8_CC  B 3 ? C 8  ? B 4  ? C 7 ? 
1 B DG 4 1_555 C DC 7  1_555 B DC 5  1_555 C DG 6 1_555 1.199  -0.540 3.421 -1.857 3.251  33.827 -1.456 -2.353 3.288 5.566  3.179  
34.028 4 BB_DG4DC5:DG6DC7_CC  B 4 ? C 7  ? B 5  ? C 6 ? 
1 B DC 5 1_555 C DG 6  1_555 B DG 6  1_555 C DC 5 1_555 -1.521 -0.385 3.052 -2.019 5.123  30.924 -1.614 2.454  3.041 9.513  3.748  
31.398 5 BB_DC5DG6:DC5DG6_CC  B 5 ? C 6  ? B 6  ? C 5 ? 
1 B DG 6 1_555 C DC 5  1_555 B DT 7  1_555 C DA 4 1_555 0.567  -1.034 3.684 0.231  3.152  31.262 -2.566 -0.998 3.569 5.831  -0.427 
31.418 6 BB_DG6DT7:DA4DC5_CC  B 6 ? C 5  ? B 7  ? C 4 ? 
1 B DT 7 1_555 C DA 4  1_555 B DG 8  1_555 C DC 3 1_555 -0.225 -0.029 3.082 0.232  2.651  32.836 -0.477 0.434  3.068 4.680  -0.409 
32.940 7 BB_DT7DG8:DC3DA4_CC  B 7 ? C 4  ? B 8  ? C 3 ? 
1 B DG 8 1_555 C DC 3  1_555 B DG 9  1_555 C DC 2 1_555 -1.108 0.050  3.203 -4.136 0.962  34.512 -0.063 1.223  3.310 1.614  6.939  
34.765 8 BB_DG8DG9:DC2DC3_CC  B 8 ? C 3  ? B 9  ? C 2 ? 
1 B DG 9 1_555 C DC 2  1_555 B DC 10 1_555 C DG 1 1_555 0.759  -0.734 3.571 1.500  -1.208 35.685 -1.005 -0.999 3.621 -1.969 -2.445 
35.736 9 BB_DG9DC10:DG1DC2_CC B 9 ? C 2  ? B 10 ? C 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM049245 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#