data_5KFE
# 
_entry.id   5KFE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KFE         
WWPDB D_1000222115 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5KFA unspecified 
PDB . 5KFB unspecified 
PDB . 5KFC unspecified 
PDB . 5KG0 unspecified 
PDB . 5KG1 unspecified 
PDB . 5KG2 unspecified 
PDB . 5KG3 unspecified 
PDB . 5KG4 unspecified 
PDB . 5KG5 unspecified 
PDB . 5KG6 unspecified 
PDB . 5KG7 unspecified 
PDB . 5KFD unspecified 
PDB . 5KFS unspecified 
PDB . 5KFT unspecified 
PDB . 5KFU unspecified 
PDB . 5KFV unspecified 
PDB . 5KFW unspecified 
PDB . 5KFX unspecified 
PDB . 5KFG unspecified 
PDB . 5KFY unspecified 
PDB . 5KFZ unspecified 
PDB . 5KFH unspecified 
PDB . 5KFK unspecified 
PDB . 5KFL unspecified 
PDB . 5KFI unspecified 
PDB . 5KFJ unspecified 
PDB . 5KFM unspecified 
PDB . 5KFN unspecified 
PDB . 5KFO unspecified 
PDB . 5KFP unspecified 
PDB . 5KFQ unspecified 
PDB . 5KFR unspecified 
PDB . 5KFF unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KFE 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gao, Y.'  1 ? 
primary 'Yang, W.' 2 ? 
# 
_cell.length_a           98.620 
_cell.length_b           98.620 
_cell.length_c           81.930 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           5KFE 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.entry_id                         5KFE 
_symmetry.Int_Tables_number                169 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                 54.938    2   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ? ? 
8 water       nat water                                                18.015    441 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' ? 9606 ? 
3 1 sample 1 8  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5KFE       5KFE   ? 2 ? 1 
3 PDB 5KFE       5KFE   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KFE A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5KFE T 1 ? 12  ? 5KFE   1 ? 12  ? 1 12  
3 3 5KFE P 1 ? 8   ? 5KFE   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KFE GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5KFE PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5KFE HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ?                               'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KFE 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.10 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.52 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.d_resolution_high            1.550 
_reflns.pdbx_number_measured_all     491628 
_reflns.number_obs                   65580 
_reflns.pdbx_Rmerge_I_obs            0.059 
_reflns.pdbx_netI_over_sigmaI        23.650 
_reflns.pdbx_chi_squared             0.971 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.pdbx_Rrim_I_all              0.063 
_reflns.pdbx_CC_half                 1.000 
_reflns.B_iso_Wilson_estimate        23.227 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5KFE 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  1.550 1.590 35855 ? 4857 0 0.651 3.150  ? ? ? ? ? 4858 ? ? ? ? ? 100.000 0.700 ? 0.829 
1 2  1.590 1.630 34983 ? 4697 0 0.545 3.780  ? ? ? ? ? 4698 ? ? ? ? ? 100.000 0.586 ? 0.878 
1 3  1.630 1.680 34071 ? 4588 0 0.436 4.710  ? ? ? ? ? 4588 ? ? ? ? ? 100.000 0.469 ? 0.915 
1 4  1.680 1.730 33323 ? 4475 0 0.363 5.670  ? ? ? ? ? 4476 ? ? ? ? ? 100.000 0.390 ? 0.944 
1 5  1.730 1.790 32264 ? 4297 0 0.293 7.120  ? ? ? ? ? 4298 ? ? ? ? ? 100.000 0.315 ? 0.966 
1 6  1.790 1.850 31215 ? 4163 0 0.239 8.640  ? ? ? ? ? 4165 ? ? ? ? ? 100.000 0.256 ? 0.975 
1 7  1.850 1.920 30409 ? 4040 0 0.186 10.910 ? ? ? ? ? 4041 ? ? ? ? ? 100.000 0.200 ? 0.985 
1 8  1.920 2.000 29265 ? 3881 0 0.142 14.260 ? ? ? ? ? 3881 ? ? ? ? ? 100.000 0.152 ? 0.991 
1 9  2.000 2.090 28047 ? 3718 0 0.110 18.070 ? ? ? ? ? 3718 ? ? ? ? ? 100.000 0.118 ? 0.994 
1 10 2.090 2.190 26947 ? 3570 0 0.086 22.750 ? ? ? ? ? 3570 ? ? ? ? ? 100.000 0.093 ? 0.997 
1 11 2.190 2.310 25645 ? 3391 0 0.070 27.300 ? ? ? ? ? 3392 ? ? ? ? ? 100.000 0.076 ? 0.998 
1 12 2.310 2.450 24187 ? 3193 0 0.060 31.970 ? ? ? ? ? 3196 ? ? ? ? ? 99.900  0.064 ? 0.998 
1 13 2.450 2.620 22802 ? 3025 0 0.054 34.930 ? ? ? ? ? 3026 ? ? ? ? ? 100.000 0.058 ? 0.998 
1 14 2.620 2.830 21260 ? 2818 0 0.043 42.770 ? ? ? ? ? 2818 ? ? ? ? ? 100.000 0.046 ? 0.999 
1 15 2.830 3.100 19526 ? 2589 0 0.036 50.080 ? ? ? ? ? 2589 ? ? ? ? ? 100.000 0.039 ? 0.999 
1 16 3.100 3.470 17507 ? 2336 0 0.027 63.080 ? ? ? ? ? 2336 ? ? ? ? ? 100.000 0.029 ? 0.999 
1 17 3.470 4.000 15527 ? 2084 0 0.022 73.050 ? ? ? ? ? 2084 ? ? ? ? ? 100.000 0.024 ? 1.000 
1 18 4.000 4.900 13248 ? 1762 0 0.019 79.300 ? ? ? ? ? 1762 ? ? ? ? ? 100.000 0.020 ? 1.000 
1 19 4.900 6.930 10183 ? 1355 0 0.020 77.290 ? ? ? ? ? 1355 ? ? ? ? ? 100.000 0.021 ? 1.000 
1 20 6.930 ?     5364  ? 741  0 0.019 83.770 ? ? ? ? ? 775  ? ? ? ? ? 95.600  0.021 ? 0.999 
# 
_refine.entry_id                                 5KFE 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            1.5500 
_refine.ls_d_res_low                             19.9180 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.9800 
_refine.ls_number_reflns_obs                     65574 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1752 
_refine.ls_R_factor_R_work                       0.1729 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2031 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 7.7700 
_refine.ls_number_reflns_R_free                  5098 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               21.8470 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1600 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4ECQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                84.480 
_refine.B_iso_min                                5.930 
_refine.pdbx_overall_phase_error                 19.6600 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.5500 
_refine_hist.d_res_low                        19.9180 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             441 
_refine_hist.number_atoms_total               4239 
_refine_hist.pdbx_number_residues_total       450 
_refine_hist.pdbx_B_iso_mean_ligand           14.99 
_refine_hist.pdbx_B_iso_mean_solvent          27.66 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
# 
_struct.entry_id                     5KFE 
_struct.title                        'Human DNA polymerase eta-DNA ternary complex: reaction with 1 mM Mn2+ for 600s' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KFE 
_struct_keywords.text            
'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, REPLICATION, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   'REPLICATION, TRANSFERASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? LEU A 135 ? LEU A 121 LEU A 132 1 ? 12 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 AB2 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 AB3 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 AB4 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 AB5 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 AB6 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 AB7 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 AB8 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 AB9 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 AC1 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 AC2 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 AC3 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc2  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 F MN  . MN  B ? A ASP 13  A MN  503 1_555 ? ? ? ? ? ? ?            2.229 ? 
metalc3  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 D MN  . MN  ? ? A ASP 13  A MN  501 1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc4  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.175 ? 
metalc5  metalc ? ? A MET 17  O     ? ? ? 1_555 F MN  . MN  B ? A MET 14  A MN  503 1_555 ? ? ? ? ? ? ?            2.177 ? 
metalc6  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 D MN  . MN  ? ? A ASP 115 A MN  501 1_555 ? ? ? ? ? ? ?            2.139 ? 
metalc7  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.142 ? 
metalc8  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 F MN  . MN  B ? A ASP 115 A MN  503 1_555 ? ? ? ? ? ? ?            2.136 ? 
metalc9  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MN  . MN  ? ? A GLU 116 A MN  501 1_555 ? ? ? ? ? ? ?            2.141 ? 
metalc10 metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc11 metalc ? ? D MN  .   MN    ? ? ? 1_555 J HOH . O   ? ? A MN  501 A HOH 797 1_555 ? ? ? ? ? ? ?            2.154 ? 
metalc12 metalc ? ? D MN  .   MN    ? ? ? 1_555 I DTP . O2A ? ? A MN  501 A DTP 506 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc13 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1B ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.209 ? 
metalc14 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O2A ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc15 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O3G ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc16 metalc ? ? F MN  .   MN    B ? ? 1_555 I DTP . O1B ? ? A MN  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc17 metalc ? ? F MN  .   MN    B ? ? 1_555 I DTP . O2A ? ? A MN  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.379 ? 
metalc18 metalc ? ? F MN  .   MN    B ? ? 1_555 I DTP . O3G ? ? A MN  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.269 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 1.43  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -2.89 
3 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 0.14  
4 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -8.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? THR A 430 ? GLU A 414 THR A 427 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? THR A 430 ? GLU A 414 THR A 427 
AA5 3 GLN A 368 ? VAL A 375 ? GLN A 365 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
AA6 1 ARG A 364 ? VAL A 365 ? ARG A 361 VAL A 362 
AA6 2 SER A 433 ? ALA A 434 ? SER A 430 ALA A 431 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
AA6 1 2 N VAL A 365 ? N VAL A 362 O SER A 433 ? O SER A 430 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  501 ? 8  'binding site for residue MN A 501'  
AC2 Software A CA  502 ? 5  'binding site for residue CA A 502'  
AC3 Software A MN  503 ? 5  'binding site for residue MN A 503'  
AC4 Software A GOL 504 ? 10 'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 10 'binding site for residue GOL A 505' 
AC6 Software A DTP 506 ? 27 'binding site for residue DTP A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4  AC1 8  CA  E .   ? CA  A 502 . ? 1_555 ? 
5  AC1 8  MN  F .   ? MN  A 503 . ? 1_555 ? 
6  AC1 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
7  AC1 8  HOH J .   ? HOH A 797 . ? 1_555 ? 
8  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
9  AC2 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 5  MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
12 AC2 5  MN  D .   ? MN  A 501 . ? 1_555 ? 
13 AC2 5  DTP I .   ? DTP A 506 . ? 1_555 ? 
14 AC3 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
15 AC3 5  MET A 17  ? MET A 14  . ? 1_555 ? 
16 AC3 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
17 AC3 5  MN  D .   ? MN  A 501 . ? 1_555 ? 
18 AC3 5  DTP I .   ? DTP A 506 . ? 1_555 ? 
19 AC4 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
20 AC4 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
21 AC4 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
22 AC4 10 SER A 251 ? SER A 248 . ? 1_555 ? 
23 AC4 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
24 AC4 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
25 AC4 10 HOH J .   ? HOH A 644 . ? 1_555 ? 
26 AC4 10 HOH J .   ? HOH A 710 . ? 1_555 ? 
27 AC4 10 HOH J .   ? HOH A 726 . ? 1_555 ? 
28 AC4 10 HOH J .   ? HOH A 801 . ? 1_555 ? 
29 AC5 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
30 AC5 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
31 AC5 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
32 AC5 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
33 AC5 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
34 AC5 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
35 AC5 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
36 AC5 10 HOH J .   ? HOH A 608 . ? 1_555 ? 
37 AC5 10 HOH J .   ? HOH A 616 . ? 5_664 ? 
38 AC5 10 HOH J .   ? HOH A 632 . ? 1_555 ? 
39 AC6 27 ASP A 16  ? ASP A 13  . ? 1_555 ? 
40 AC6 27 MET A 17  ? MET A 14  . ? 1_555 ? 
41 AC6 27 ASP A 18  ? ASP A 15  . ? 1_555 ? 
42 AC6 27 CYS A 19  ? CYS A 16  . ? 1_555 ? 
43 AC6 27 PHE A 20  ? PHE A 17  . ? 1_555 ? 
44 AC6 27 PHE A 21  ? PHE A 18  . ? 1_555 ? 
45 AC6 27 ILE A 51  ? ILE A 48  . ? 1_555 ? 
46 AC6 27 ALA A 52  ? ALA A 49  . ? 1_555 ? 
47 AC6 27 TYR A 55  ? TYR A 52  . ? 1_555 ? 
48 AC6 27 ARG A 58  ? ARG A 55  . ? 1_555 ? 
49 AC6 27 ARG A 64  ? ARG A 61  . ? 1_555 ? 
50 AC6 27 ASP A 118 ? ASP A 115 . ? 1_555 ? 
51 AC6 27 LYS A 234 ? LYS A 231 . ? 1_555 ? 
52 AC6 27 MN  D .   ? MN  A 501 . ? 1_555 ? 
53 AC6 27 CA  E .   ? CA  A 502 . ? 1_555 ? 
54 AC6 27 MN  F .   ? MN  A 503 . ? 1_555 ? 
55 AC6 27 HOH J .   ? HOH A 641 . ? 1_555 ? 
56 AC6 27 HOH J .   ? HOH A 664 . ? 1_555 ? 
57 AC6 27 HOH J .   ? HOH A 685 . ? 1_555 ? 
58 AC6 27 HOH J .   ? HOH A 766 . ? 1_555 ? 
59 AC6 27 HOH J .   ? HOH A 797 . ? 1_555 ? 
60 AC6 27 HOH J .   ? HOH A 820 . ? 1_555 ? 
61 AC6 27 DT  C 8   ? DT  P 8   . ? 1_555 ? 
62 AC6 27 HOH L .   ? HOH P 103 . ? 1_555 ? 
63 AC6 27 DT  B 3   ? DT  T 3   . ? 1_555 ? 
64 AC6 27 DT  B 4   ? DT  T 4   . ? 1_555 ? 
65 AC6 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KFE 
_atom_sites.fract_transf_matrix[1][1]   0.010140 
_atom_sites.fract_transf_matrix[1][2]   0.005854 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011709 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012206 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.900 -34.209 -3.497  1.00 43.38 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.281 -33.778 -3.632  1.00 40.43 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.538 -32.856 -4.813  1.00 42.31 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.191 -31.675 -4.767  1.00 46.07 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.153 -33.393 -5.881  1.00 40.74 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.580 -32.656 -7.082  1.00 41.77 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.428 -32.143 -7.952  1.00 44.04 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.615 -31.199 -8.724  1.00 47.47 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.409 -33.694 -7.848  1.00 40.23 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.870 -35.010 -7.399  1.00 41.42 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.524 -34.817 -5.952  1.00 39.08 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.256 -32.756 -7.831  1.00 32.87 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.093 -32.322 -8.600  1.00 39.65 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.155 -31.460 -7.757  1.00 41.45 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.071 -31.085 -8.210  1.00 40.04 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.338 -33.533 -9.156  1.00 32.19 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.229 -34.549 -9.806  1.00 26.62 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.927 -34.292 -10.968 1.00 28.58 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.539 -35.817 -9.452  1.00 25.46 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.629 -35.362 -11.301 1.00 28.79 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.412 -36.301 -10.400 1.00 25.91 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.575 -31.143 -6.533  1.00 43.00 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.737 -30.367 -5.623  1.00 46.49 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.922 -28.869 -5.831  1.00 44.41 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.958 -28.294 -5.480  1.00 45.04 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 64.027 -30.731 -4.159  1.00 47.27 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 63.187 -31.890 -3.588  1.00 55.16 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.383 -31.732 -3.624  1.00 67.96 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.163 -29.962 -3.467  1.00 54.01 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.896 -28.252 -6.407  1.00 47.53 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.889 -26.819 -6.652  1.00 43.29 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 62.970 -26.064 -5.336  1.00 39.39 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.378 -26.471 -4.335  1.00 36.93 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.652 -26.415 -7.427  1.00 43.01 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.721 -24.969 -5.341  1.00 31.48 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.017 -24.246 -4.111  1.00 26.17 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.539 -22.801 -4.164  1.00 21.51 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.768 -22.036 -3.229  1.00 25.12 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.515 -24.257 -3.820  1.00 28.69 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.214 -23.681 -4.932  1.00 26.53 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 65.997 -25.684 -3.594  1.00 29.87 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.888 -22.437 -5.266  1.00 21.26 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.352 -21.096 -5.435  1.00 21.84 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.418 -20.014 -5.334  1.00 21.41 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.219 -18.993 -4.662  1.00 20.86 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.553 -20.249 -5.989  1.00 17.89 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.687 -19.333 -5.927  1.00 15.05 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.021 -18.758 -7.297  1.00 15.84 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.116 -18.234 -7.500  1.00 15.74 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.915 -20.046 -5.346  1.00 14.94 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.861 -20.222 -3.832  1.00 17.78 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.073 -20.963 -3.288  1.00 16.30 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.895 -20.410 -2.539  1.00 19.86 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.194 -22.224 -3.664  1.00 16.97 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.043 -18.827 -8.198  1.00 18.50 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.188 -18.462 -9.603  1.00 21.20 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.182 -16.952 -9.860  1.00 15.71 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.756 -16.484 -10.838 1.00 21.10 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.066 -19.123 -10.433 1.00 22.37 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.670 -18.983 -9.788  1.00 29.52 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.505 -19.274 -8.579  1.00 28.13 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.715 -18.579 -10.500 1.00 35.46 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.532 -16.199 -8.983  1.00 13.71 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.318 -14.769 -9.205  1.00 15.26 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.942 -13.924 -8.111  1.00 12.43 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.177 -14.403 -7.004  1.00 12.84 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.820 -14.433 -9.258  1.00 11.51 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.034 -15.088 -10.375 1.00 13.96 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.559 -14.713 -10.256 1.00 13.37 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.920 -15.340 -9.104  1.00 14.49 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.851 -14.857 -8.469  1.00 11.92 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.342 -15.515 -7.433  1.00 11.84 ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.291 -13.709 -8.855  1.00 12.20 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.183 -12.655 -8.416  1.00 10.13 ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.487 -11.678 -7.379  1.00 7.16  ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.349 -10.660 -7.388  1.00 10.67 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.101 -10.029 -8.407  1.00 13.96 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.843 -10.970 -7.588  1.00 11.58 ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.102 -9.987  -6.451  1.00 12.04 ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 67.973 -12.004 -7.643  1.00 11.94 ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.656 -10.520 -6.257  1.00 8.86  ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.476 -9.659  -6.165  1.00 9.87  ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.670 -8.716  -5.002  1.00 9.14  ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.099 -9.131  -3.923  1.00 9.88  ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.172 -10.461 -5.959  1.00 7.24  ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 59.983 -9.525  -5.725  1.00 11.28 ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.899 -11.357 -7.173  1.00 9.61  ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.373 -7.438  -5.208  1.00 10.52 ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.385 -6.514  -4.088  1.00 9.25  ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.022 -5.901  -3.891  1.00 9.41  ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.223 -5.847  -4.816  1.00 11.04 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.429 -5.425  -4.295  1.00 10.56 ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.776 -5.436  -2.672  1.00 8.57  ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.606 -4.636  -2.363  1.00 8.11  ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.106 -3.352  -1.729  1.00 10.97 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.827 -3.390  -0.725  1.00 11.72 ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.657 -5.388  -1.437  1.00 12.14 ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.319 -4.768  -0.999  1.00 11.19 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.468 -3.835  0.211   1.00 12.31 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.611 -4.056  -2.169  1.00 11.02 ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.748 -2.221  -2.328  1.00 8.90  ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.163 -0.910  -1.836  1.00 8.89  ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.929 -0.220  -1.286  1.00 11.22 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.935 -0.081  -2.002  1.00 11.18 ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.788 -0.044  -2.944  1.00 10.11 ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.187 1.315   -2.373  1.00 10.51 ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.992 -0.752  -3.554  1.00 12.74 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 58.973 0.166   -0.012  1.00 9.87  ? 13  ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.840 0.782   0.655   1.00 10.57 ? 13  ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 58.202 2.101   1.335   1.00 9.70  ? 13  ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 59.081 2.129   2.080   1.00 10.02 ? 13  ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.320 -0.136  1.728   1.00 10.12 ? 13  ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 56.095 0.350   2.370   1.00 12.24 ? 13  ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 56.197 0.960   3.343   1.00 12.05 ? 13  ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 55.075 0.014   1.888   1.00 12.45 ? 13  ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.469 3.145   1.045   1.00 8.69  ? 14  MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 57.846 4.451   1.590   1.00 8.51  ? 14  MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.683 4.520   3.114   1.00 9.11  ? 14  MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.760 3.927   3.653   1.00 10.61 ? 14  MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 57.014 5.557   0.929   1.00 12.60 ? 14  MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 57.072 5.546   -0.583  1.00 11.36 ? 14  MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.741 5.559   -1.269  1.00 13.03 ? 14  MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.324 7.131   -0.725  1.00 15.77 ? 14  MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.565 5.202   3.822   1.00 8.29  ? 15  ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.411 5.350   5.258   1.00 9.03  ? 15  ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.332 6.400   5.539   1.00 10.09 ? 15  ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.331 7.420   4.943   1.00 8.83  ? 15  ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.719 5.779   5.883   1.00 10.31 ? 15  ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.830 4.726   5.741   1.00 11.19 ? 15  ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.541 3.573   5.550   1.00 13.25 ? 15  ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.934 5.113   5.857   1.00 16.01 ? 15  ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.443 6.075   6.469   1.00 9.10  ? 16  CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.334 6.953   6.906   1.00 8.02  ? 16  CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.936 7.931   5.787   1.00 8.66  ? 16  CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 55.067 9.147   5.927   1.00 9.80  ? 16  CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.668 7.705   8.209   1.00 10.18 ? 16  CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 57.219 8.613   8.319   1.00 12.37 ? 16  CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.471 7.378   4.670   1.00 9.56  ? 17  PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.454 8.100   3.400   1.00 8.02  ? 17  PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.726 9.449   3.416   1.00 9.10  ? 17  PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.329 10.465  3.060   1.00 7.45  ? 17  PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.848 7.223   2.293   1.00 8.67  ? 17  PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.918 7.846   0.924   1.00 7.96  ? 17  PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 55.075 8.473   0.488   1.00 9.69  ? 17  PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.823 7.796   0.071   1.00 9.84  ? 17  PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 55.141 9.045   -0.798  1.00 11.02 ? 17  PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.887 8.359   -1.214  1.00 11.45 ? 17  PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 54.041 8.982   -1.638  1.00 11.05 ? 17  PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.457 9.479   3.819   1.00 9.04  ? 18  PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.724 10.746  3.747   1.00 6.86  ? 18  PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.380 11.795  4.653   1.00 8.37  ? 18  PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.347 12.992  4.353   1.00 10.32 ? 18  PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.244 10.590  4.133   1.00 8.20  ? 18  PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.401 9.846   3.134   1.00 8.63  ? 18  PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 49.952 9.108   2.085   1.00 8.45  ? 18  PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 48.022 9.882   3.257   1.00 9.22  ? 18  PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 49.115 8.423   1.180   1.00 11.44 ? 18  PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 47.188 9.208   2.360   1.00 10.98 ? 18  PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.737 8.472   1.327   1.00 10.98 ? 18  PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.938 11.359  5.786   1.00 7.31  ? 19  VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.661 12.277  6.659   1.00 8.39  ? 19  VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.882 12.862  5.943   1.00 8.43  ? 19  VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 55.111 14.078  5.995   1.00 8.49  ? 19  VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 54.087 11.580  7.965   1.00 7.64  ? 19  VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 55.155 12.387  8.713   1.00 11.19 ? 19  VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.866 11.321  8.865   1.00 10.44 ? 19  VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.668 12.032  5.261   1.00 8.21  ? 20  GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.819 12.579  4.537   1.00 6.90  ? 20  GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.406 13.574  3.460   1.00 8.79  ? 20  GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 57.118 14.559  3.212   1.00 9.59  ? 20  GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.639 11.477  3.891   1.00 9.45  ? 20  GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.485 10.691  4.863   1.00 11.30 ? 20  GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.571 9.976   4.095   1.00 13.22 ? 20  GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.623 10.544  3.840   1.00 13.79 ? 20  GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.302 8.738   3.684   1.00 16.56 ? 20  GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.298 13.295  2.781   1.00 6.96  ? 21  VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.796 14.224  1.765   1.00 7.48  ? 21  VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.496 15.576  2.414   1.00 8.75  ? 21  VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.866 16.629  1.876   1.00 9.93  ? 21  VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.539 13.686  1.063   1.00 7.16  ? 21  VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.954 14.738  0.112   1.00 9.05  ? 21  VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.879 12.398  0.290   1.00 8.14  ? 21  VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.868 15.551  3.585   1.00 8.25  ? 22  GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.534 16.806  4.261   1.00 7.69  ? 22  GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.788 17.474  4.855   1.00 10.21 ? 22  GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.876 18.706  4.914   1.00 9.64  ? 22  GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.470 16.557  5.345   1.00 7.80  ? 22  GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 51.146 16.071  4.803   1.00 8.74  ? 22  GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.421 17.112  3.954   1.00 12.21 ? 22  GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.675 18.326  4.136   1.00 13.74 ? 22  GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.575 16.715  3.121   1.00 13.60 ? 22  GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.753 16.665  5.299   1.00 8.71  ? 23  GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 56.995 17.207  5.857   1.00 7.87  ? 23  GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.873 17.861  4.792   1.00 9.75  ? 23  GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.570 18.838  5.065   1.00 9.70  ? 23  GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.778 16.108  6.572   1.00 8.38  ? 23  GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 57.131 15.685  7.886   1.00 10.47 ? 23  GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.895 14.547  8.523   1.00 10.82 ? 23  GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.343 13.637  7.831   1.00 11.28 ? 23  GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 58.054 14.596  9.842   1.00 13.65 ? 23  GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.853 17.313  3.580   1.00 8.95  ? 24  ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.584 17.944  2.489   1.00 8.87  ? 24  ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 57.999 19.332  2.230   1.00 9.27  ? 24  ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.727 20.306  2.103   1.00 10.02 ? 24  ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.524 17.095  1.221   1.00 8.47  ? 24  ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 59.278 17.731  0.057   1.00 9.61  ? 24  ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.324 16.814  -1.148  1.00 10.41 ? 24  ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 58.027 16.719  -1.810  1.00 9.51  ? 24  ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.836 16.126  -2.981  1.00 8.21  ? 24  ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.852 15.546  -3.618  1.00 9.51  ? 24  ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.623 16.104  -3.513  1.00 11.65 ? 24  ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.670 19.405  2.220   1.00 7.75  ? 25  GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 55.958 20.650  1.920   1.00 9.19  ? 25  GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 56.133 21.707  3.002   1.00 10.72 ? 25  GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 56.253 22.898  2.702   1.00 11.35 ? 25  GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.468 20.375  1.724   1.00 9.76  ? 25  GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.700 21.586  1.192   1.00 11.41 ? 25  GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 52.226 21.270  0.999   1.00 13.96 ? 25  GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.883 20.189  0.539   1.00 13.94 ? 25  GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.359 22.219  1.332   1.00 21.94 ? 25  GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 56.091 21.267  4.255   1.00 8.81  ? 26  ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 56.167 22.150  5.410   1.00 10.21 ? 26  ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.329 21.750  6.309   1.00 10.72 ? 26  ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 57.202 20.848  7.132   1.00 9.57  ? 26  ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.850 22.120  6.192   1.00 10.12 ? 26  ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.855 23.070  7.392   1.00 11.60 ? 26  ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.840 23.747  7.651   1.00 13.68 ? 26  ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.735 23.132  8.109   1.00 17.01 ? 26  ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.471 22.427  6.155   1.00 10.82 ? 27  PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.672 22.077  6.918   1.00 11.94 ? 27  PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.481 22.145  8.439   1.00 12.33 ? 27  PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 60.237 21.492  9.155   1.00 12.55 ? 27  PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.693 23.122  6.454   1.00 15.91 ? 27  PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 60.237 23.466  5.062   1.00 14.58 ? 27  PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.743 23.451  5.132   1.00 12.50 ? 27  PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.493 22.901  8.917   1.00 11.46 ? 28  HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.209 22.950  10.360  1.00 15.74 ? 28  HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.840 21.589  10.933  1.00 16.11 ? 28  HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 57.944 21.371  12.144  1.00 18.22 ? 28  HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 57.072 23.928  10.661  1.00 17.40 ? 28  HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.474 25.365  10.597  1.00 20.11 ? 28  HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 56.681 26.331  10.014  1.00 26.25 ? 28  HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.569 26.006  11.064  1.00 21.98 ? 28  HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.279 27.505  10.114  1.00 23.71 ? 28  HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.429 27.335  10.744  1.00 24.31 ? 28  HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.378 20.682  10.075  1.00 12.10 ? 29  LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 56.950 19.359  10.529  1.00 11.84 ? 29  LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 58.080 18.336  10.543  1.00 12.85 ? 29  LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 57.917 17.230  11.063  1.00 11.61 ? 29  LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.820 18.824  9.644   1.00 9.35  ? 29  LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.596 19.720  9.481   1.00 11.98 ? 29  LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.571 19.045  8.573   1.00 13.74 ? 29  LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 53.990 20.040  10.845  1.00 17.82 ? 29  LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 59.223 18.679  9.952   1.00 10.09 ? 30  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.317 17.725  9.822   1.00 10.49 ? 30  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 60.923 17.367  11.173  1.00 10.90 ? 30  ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 61.052 18.224  12.036  1.00 13.80 ? 30  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.403 18.289  8.902   1.00 11.51 ? 30  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.896 18.575  7.497   1.00 10.95 ? 30  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 61.949 19.163  6.591   1.00 15.13 ? 30  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.383 19.448  5.272   1.00 13.31 ? 30  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 62.084 19.935  4.257   1.00 15.94 ? 30  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.376 20.193  4.419   1.00 15.95 ? 30  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.494 20.164  3.090   1.00 13.77 ? 30  ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.255 16.089  11.345  1.00 14.45 ? 31  ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 61.900 15.617  12.573  1.00 15.82 ? 31  ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 61.094 15.935  13.828  1.00 19.46 ? 31  ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.635 16.334  14.872  1.00 19.56 ? 31  ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.308 16.207  12.676  1.00 19.28 ? 31  ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 64.143 15.903  11.443  1.00 22.64 ? 31  ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.330 14.739  11.085  1.00 29.80 ? 31  ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.627 16.947  10.777  1.00 27.11 ? 31  ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.785 15.745  13.712  1.00 13.79 ? 32  LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.853 16.018  14.790  1.00 13.54 ? 32  LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.876 14.876  14.917  1.00 13.65 ? 32  LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.641 14.159  13.944  1.00 12.28 ? 32  LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 58.079 17.317  14.529  1.00 15.20 ? 32  LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 58.946 18.572  14.530  1.00 18.17 ? 32  LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 59.032 19.172  15.917  1.00 27.90 ? 32  LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 60.151 20.212  15.997  1.00 34.82 ? 32  LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 60.210 21.086  14.791  1.00 37.85 ? 32  LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 57.299 14.699  16.114  1.00 12.29 ? 33  PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 56.134 13.825  16.226  1.00 11.45 ? 33  PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 54.992 14.463  15.435  1.00 10.48 ? 33  PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 54.543 15.562  15.765  1.00 11.45 ? 33  PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 55.837 13.805  17.728  1.00 11.36 ? 33  PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 56.402 15.093  18.248  1.00 16.73 ? 33  PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 57.588 15.422  17.372  1.00 13.76 ? 33  PRO A CD    1 
ATOM   289  N  N     . CYS A 1 37  ? 54.542 13.792  14.387  1.00 10.72 ? 34  CYS A N     1 
ATOM   290  C  CA    A CYS A 1 37  ? 53.615 14.368  13.414  0.44 10.46 ? 34  CYS A CA    1 
ATOM   291  C  CA    B CYS A 1 37  ? 53.462 14.357  13.611  0.56 10.34 ? 34  CYS A CA    1 
ATOM   292  C  C     . CYS A 1 37  ? 52.678 13.276  12.899  1.00 10.82 ? 34  CYS A C     1 
ATOM   293  O  O     . CYS A 1 37  ? 53.104 12.125  12.797  1.00 12.22 ? 34  CYS A O     1 
ATOM   294  C  CB    A CYS A 1 37  ? 54.414 15.010  12.261  0.44 11.54 ? 34  CYS A CB    1 
ATOM   295  C  CB    B CYS A 1 37  ? 53.987 15.393  12.619  0.56 12.90 ? 34  CYS A CB    1 
ATOM   296  S  SG    A CYS A 1 37  ? 53.502 15.741  10.867  0.44 11.00 ? 34  CYS A SG    1 
ATOM   297  S  SG    B CYS A 1 37  ? 55.099 14.726  11.400  0.56 12.95 ? 34  CYS A SG    1 
ATOM   298  N  N     . ALA A 1 38  ? 51.455 13.632  12.519  1.00 8.32  ? 35  ALA A N     1 
ATOM   299  C  CA    . ALA A 1 38  ? 50.543 12.685  11.912  1.00 8.80  ? 35  ALA A CA    1 
ATOM   300  C  C     . ALA A 1 38  ? 49.711 13.383  10.865  1.00 9.48  ? 35  ALA A C     1 
ATOM   301  O  O     . ALA A 1 38  ? 49.577 14.604  10.897  1.00 10.51 ? 35  ALA A O     1 
ATOM   302  C  CB    . ALA A 1 38  ? 49.649 12.041  12.959  1.00 10.96 ? 35  ALA A CB    1 
ATOM   303  N  N     . VAL A 1 39  ? 49.153 12.605  9.943   1.00 8.67  ? 36  VAL A N     1 
ATOM   304  C  CA    . VAL A 1 39  ? 48.232 13.139  8.952   1.00 8.70  ? 36  VAL A CA    1 
ATOM   305  C  C     . VAL A 1 39  ? 46.828 12.683  9.308   1.00 11.84 ? 36  VAL A C     1 
ATOM   306  O  O     . VAL A 1 39  ? 46.613 11.512  9.645   1.00 10.93 ? 36  VAL A O     1 
ATOM   307  C  CB    . VAL A 1 39  ? 48.620 12.685  7.527   1.00 8.16  ? 36  VAL A CB    1 
ATOM   308  C  CG1   . VAL A 1 39  ? 47.532 13.045  6.523   1.00 9.63  ? 36  VAL A CG1   1 
ATOM   309  C  CG2   . VAL A 1 39  ? 49.963 13.293  7.138   1.00 9.58  ? 36  VAL A CG2   1 
ATOM   310  N  N     . VAL A 1 40  ? 45.885 13.619  9.239   1.00 11.90 ? 37  VAL A N     1 
ATOM   311  C  CA    . VAL A 1 40  ? 44.531 13.421  9.728   1.00 10.90 ? 37  VAL A CA    1 
ATOM   312  C  C     . VAL A 1 40  ? 43.535 13.730  8.626   1.00 12.41 ? 37  VAL A C     1 
ATOM   313  O  O     . VAL A 1 40  ? 43.789 14.595  7.774   1.00 13.55 ? 37  VAL A O     1 
ATOM   314  C  CB    . VAL A 1 40  ? 44.249 14.329  10.979  1.00 12.72 ? 37  VAL A CB    1 
ATOM   315  C  CG1   A VAL A 1 40  ? 44.925 13.752  12.212  0.47 11.04 ? 37  VAL A CG1   1 
ATOM   316  C  CG1   B VAL A 1 40  ? 44.000 15.776  10.571  0.53 14.09 ? 37  VAL A CG1   1 
ATOM   317  C  CG2   A VAL A 1 40  ? 44.692 15.766  10.718  0.47 14.78 ? 37  VAL A CG2   1 
ATOM   318  C  CG2   B VAL A 1 40  ? 43.113 13.817  11.782  0.53 13.65 ? 37  VAL A CG2   1 
ATOM   319  N  N     . GLN A 1 41  ? 42.402 13.035  8.625   1.00 11.79 ? 38  GLN A N     1 
ATOM   320  C  CA    . GLN A 1 41  ? 41.336 13.444  7.713   1.00 11.48 ? 38  GLN A CA    1 
ATOM   321  C  C     . GLN A 1 41  ? 40.110 13.820  8.523   1.00 10.78 ? 38  GLN A C     1 
ATOM   322  O  O     . GLN A 1 41  ? 39.757 13.154  9.495   1.00 13.81 ? 38  GLN A O     1 
ATOM   323  C  CB    . GLN A 1 41  ? 41.018 12.367  6.670   1.00 18.80 ? 38  GLN A CB    1 
ATOM   324  C  CG    . GLN A 1 41  ? 40.776 10.990  7.196   1.00 20.49 ? 38  GLN A CG    1 
ATOM   325  C  CD    . GLN A 1 41  ? 40.762 9.956   6.079   1.00 20.21 ? 38  GLN A CD    1 
ATOM   326  O  OE1   . GLN A 1 41  ? 41.128 10.247  4.936   1.00 21.22 ? 38  GLN A OE1   1 
ATOM   327  N  NE2   . GLN A 1 41  ? 40.322 8.755   6.403   1.00 23.07 ? 38  GLN A NE2   1 
ATOM   328  N  N     . TYR A 1 42  ? 39.505 14.926  8.093   1.00 12.01 ? 39  TYR A N     1 
ATOM   329  C  CA    . TYR A 1 42  ? 38.398 15.590  8.757   1.00 14.70 ? 39  TYR A CA    1 
ATOM   330  C  C     . TYR A 1 42  ? 38.905 16.111  10.098  1.00 19.31 ? 39  TYR A C     1 
ATOM   331  O  O     . TYR A 1 42  ? 40.106 16.052  10.375  1.00 18.15 ? 39  TYR A O     1 
ATOM   332  C  CB    . TYR A 1 42  ? 37.202 14.653  8.858   1.00 14.83 ? 39  TYR A CB    1 
ATOM   333  C  CG    . TYR A 1 42  ? 36.805 14.114  7.485   1.00 13.31 ? 39  TYR A CG    1 
ATOM   334  C  CD1   . TYR A 1 42  ? 36.391 14.974  6.482   1.00 15.71 ? 39  TYR A CD1   1 
ATOM   335  C  CD2   . TYR A 1 42  ? 36.882 12.748  7.184   1.00 12.00 ? 39  TYR A CD2   1 
ATOM   336  C  CE1   . TYR A 1 42  ? 36.037 14.503  5.225   1.00 18.03 ? 39  TYR A CE1   1 
ATOM   337  C  CE2   . TYR A 1 42  ? 36.526 12.268  5.923   1.00 13.88 ? 39  TYR A CE2   1 
ATOM   338  C  CZ    . TYR A 1 42  ? 36.101 13.152  4.956   1.00 13.88 ? 39  TYR A CZ    1 
ATOM   339  O  OH    . TYR A 1 42  ? 35.741 12.702  3.702   1.00 14.05 ? 39  TYR A OH    1 
ATOM   340  N  N     . LYS A 1 43  ? 38.023 16.675  10.903  1.00 18.16 ? 40  LYS A N     1 
ATOM   341  C  CA    . LYS A 1 43  ? 38.467 17.328  12.143  1.00 19.84 ? 40  LYS A CA    1 
ATOM   342  C  C     . LYS A 1 43  ? 37.367 17.485  13.178  1.00 26.17 ? 40  LYS A C     1 
ATOM   343  O  O     . LYS A 1 43  ? 37.624 17.400  14.379  1.00 22.13 ? 40  LYS A O     1 
ATOM   344  C  CB    . LYS A 1 43  ? 39.083 18.698  11.837  1.00 24.11 ? 40  LYS A CB    1 
ATOM   345  C  CG    . LYS A 1 43  ? 40.255 19.050  12.766  1.00 37.50 ? 40  LYS A CG    1 
ATOM   346  C  CD    . LYS A 1 43  ? 41.597 19.065  12.055  1.00 31.97 ? 40  LYS A CD    1 
ATOM   347  C  CE    . LYS A 1 43  ? 42.732 19.391  13.011  1.00 35.33 ? 40  LYS A CE    1 
ATOM   348  N  NZ    . LYS A 1 43  ? 44.006 19.641  12.270  1.00 33.76 ? 40  LYS A NZ    1 
ATOM   349  N  N     . SER A 1 44  ? 36.143 17.704  12.717  1.00 21.16 ? 41  SER A N     1 
ATOM   350  C  CA    . SER A 1 44  ? 35.037 17.955  13.626  1.00 23.35 ? 41  SER A CA    1 
ATOM   351  C  C     . SER A 1 44  ? 34.791 16.814  14.606  1.00 23.00 ? 41  SER A C     1 
ATOM   352  O  O     . SER A 1 44  ? 34.577 17.051  15.793  1.00 27.92 ? 41  SER A O     1 
ATOM   353  C  CB    . SER A 1 44  ? 33.769 18.240  12.827  1.00 30.28 ? 41  SER A CB    1 
ATOM   354  O  OG    . SER A 1 44  ? 33.679 19.628  12.558  1.00 39.56 ? 41  SER A OG    1 
ATOM   355  N  N     . TRP A 1 45  ? 34.833 15.577  14.115  1.00 24.99 ? 42  TRP A N     1 
ATOM   356  C  CA    . TRP A 1 45  ? 34.628 14.416  14.976  1.00 21.00 ? 42  TRP A CA    1 
ATOM   357  C  C     . TRP A 1 45  ? 35.948 13.977  15.601  1.00 20.63 ? 42  TRP A C     1 
ATOM   358  O  O     . TRP A 1 45  ? 36.820 13.429  14.919  1.00 20.90 ? 42  TRP A O     1 
ATOM   359  C  CB    . TRP A 1 45  ? 33.997 13.261  14.190  1.00 20.82 ? 42  TRP A CB    1 
ATOM   360  C  CG    . TRP A 1 45  ? 33.570 12.096  15.032  1.00 27.62 ? 42  TRP A CG    1 
ATOM   361  C  CD1   . TRP A 1 45  ? 34.287 10.962  15.286  1.00 28.43 ? 42  TRP A CD1   1 
ATOM   362  C  CD2   . TRP A 1 45  ? 32.322 11.941  15.712  1.00 26.14 ? 42  TRP A CD2   1 
ATOM   363  N  NE1   . TRP A 1 45  ? 33.569 10.116  16.093  1.00 30.50 ? 42  TRP A NE1   1 
ATOM   364  C  CE2   . TRP A 1 45  ? 32.355 10.689  16.365  1.00 30.66 ? 42  TRP A CE2   1 
ATOM   365  C  CE3   . TRP A 1 45  ? 31.178 12.736  15.833  1.00 30.94 ? 42  TRP A CE3   1 
ATOM   366  C  CZ2   . TRP A 1 45  ? 31.291 10.219  17.133  1.00 32.75 ? 42  TRP A CZ2   1 
ATOM   367  C  CZ3   . TRP A 1 45  ? 30.120 12.265  16.595  1.00 32.83 ? 42  TRP A CZ3   1 
ATOM   368  C  CH2   . TRP A 1 45  ? 30.183 11.018  17.233  1.00 35.10 ? 42  TRP A CH2   1 
ATOM   369  N  N     . LYS A 1 46  ? 36.087 14.258  16.895  1.00 21.86 ? 43  LYS A N     1 
ATOM   370  C  CA    . LYS A 1 46  ? 37.210 13.803  17.719  1.00 18.96 ? 43  LYS A CA    1 
ATOM   371  C  C     . LYS A 1 46  ? 38.578 14.210  17.178  1.00 16.54 ? 43  LYS A C     1 
ATOM   372  O  O     . LYS A 1 46  ? 39.571 13.525  17.413  1.00 16.64 ? 43  LYS A O     1 
ATOM   373  C  CB    . LYS A 1 46  ? 37.146 12.284  17.899  1.00 23.92 ? 43  LYS A CB    1 
ATOM   374  C  CG    . LYS A 1 46  ? 35.911 11.807  18.663  1.00 25.32 ? 43  LYS A CG    1 
ATOM   375  C  CD    . LYS A 1 46  ? 35.847 10.289  18.743  1.00 27.42 ? 43  LYS A CD    1 
ATOM   376  C  CE    . LYS A 1 46  ? 34.753 9.829   19.700  1.00 36.44 ? 43  LYS A CE    1 
ATOM   377  N  NZ    . LYS A 1 46  ? 35.012 10.276  21.100  1.00 49.26 ? 43  LYS A NZ    1 
ATOM   378  N  N     . GLY A 1 47  ? 38.622 15.330  16.463  1.00 17.63 ? 44  GLY A N     1 
ATOM   379  C  CA    . GLY A 1 47  ? 39.869 15.898  15.996  1.00 15.95 ? 44  GLY A CA    1 
ATOM   380  C  C     . GLY A 1 47  ? 40.310 15.401  14.636  1.00 13.47 ? 44  GLY A C     1 
ATOM   381  O  O     . GLY A 1 47  ? 41.315 15.861  14.113  1.00 16.09 ? 44  GLY A O     1 
ATOM   382  N  N     . GLY A 1 48  ? 39.547 14.464  14.078  1.00 16.82 ? 45  GLY A N     1 
ATOM   383  C  CA    . GLY A 1 48  ? 39.866 13.855  12.805  1.00 16.08 ? 45  GLY A CA    1 
ATOM   384  C  C     . GLY A 1 48  ? 40.491 12.487  13.003  1.00 17.01 ? 45  GLY A C     1 
ATOM   385  O  O     . GLY A 1 48  ? 40.977 12.161  14.086  1.00 16.47 ? 45  GLY A O     1 
ATOM   386  N  N     . GLY A 1 49  ? 40.527 11.690  11.945  1.00 12.25 ? 46  GLY A N     1 
ATOM   387  C  CA    . GLY A 1 49  ? 41.070 10.348  12.057  1.00 12.27 ? 46  GLY A CA    1 
ATOM   388  C  C     . GLY A 1 49  ? 42.477 10.284  11.500  1.00 12.73 ? 46  GLY A C     1 
ATOM   389  O  O     . GLY A 1 49  ? 42.720 10.764  10.391  1.00 12.84 ? 46  GLY A O     1 
ATOM   390  N  N     . ILE A 1 50  ? 43.394 9.685   12.258  1.00 11.61 ? 47  ILE A N     1 
ATOM   391  C  CA    . ILE A 1 50  ? 44.791 9.596   11.837  1.00 9.39  ? 47  ILE A CA    1 
ATOM   392  C  C     . ILE A 1 50  ? 44.985 8.500   10.796  1.00 10.70 ? 47  ILE A C     1 
ATOM   393  O  O     . ILE A 1 50  ? 44.538 7.377   10.991  1.00 12.79 ? 47  ILE A O     1 
ATOM   394  C  CB    . ILE A 1 50  ? 45.701 9.332   13.050  1.00 11.11 ? 47  ILE A CB    1 
ATOM   395  C  CG1   . ILE A 1 50  ? 45.695 10.553  13.959  1.00 16.31 ? 47  ILE A CG1   1 
ATOM   396  C  CG2   . ILE A 1 50  ? 47.121 8.963   12.624  1.00 12.63 ? 47  ILE A CG2   1 
ATOM   397  C  CD1   . ILE A 1 50  ? 46.470 10.355  15.208  1.00 19.23 ? 47  ILE A CD1   1 
ATOM   398  N  N     . ILE A 1 51  ? 45.651 8.829   9.691   1.00 10.08 ? 48  ILE A N     1 
ATOM   399  C  CA    . ILE A 1 51  ? 45.924 7.825   8.669   1.00 11.04 ? 48  ILE A CA    1 
ATOM   400  C  C     . ILE A 1 51  ? 47.422 7.602   8.423   1.00 11.46 ? 48  ILE A C     1 
ATOM   401  O  O     . ILE A 1 51  ? 47.786 6.663   7.732   1.00 11.49 ? 48  ILE A O     1 
ATOM   402  C  CB    . ILE A 1 51  ? 45.236 8.159   7.325   1.00 14.33 ? 48  ILE A CB    1 
ATOM   403  C  CG1   . ILE A 1 51  ? 45.688 9.519   6.776   1.00 10.82 ? 48  ILE A CG1   1 
ATOM   404  C  CG2   . ILE A 1 51  ? 43.711 8.099   7.487   1.00 15.88 ? 48  ILE A CG2   1 
ATOM   405  C  CD1   . ILE A 1 51  ? 45.149 9.801   5.366   1.00 13.54 ? 48  ILE A CD1   1 
ATOM   406  N  N     . ALA A 1 52  ? 48.287 8.431   9.000   1.00 10.81 ? 49  ALA A N     1 
ATOM   407  C  CA    . ALA A 1 52  ? 49.741 8.219   8.878   1.00 7.17  ? 49  ALA A CA    1 
ATOM   408  C  C     . ALA A 1 52  ? 50.448 8.869   10.058  1.00 7.20  ? 49  ALA A C     1 
ATOM   409  O  O     . ALA A 1 52  ? 49.997 9.910   10.546  1.00 9.75  ? 49  ALA A O     1 
ATOM   410  C  CB    . ALA A 1 52  ? 50.283 8.777   7.544   1.00 8.88  ? 49  ALA A CB    1 
ATOM   411  N  N     . VAL A 1 53  ? 51.545 8.259   10.522  1.00 7.35  ? 50  VAL A N     1 
ATOM   412  C  CA    . VAL A 1 53  ? 52.194 8.651   11.770  1.00 7.91  ? 50  VAL A CA    1 
ATOM   413  C  C     . VAL A 1 53  ? 53.707 8.626   11.632  1.00 7.10  ? 50  VAL A C     1 
ATOM   414  O  O     . VAL A 1 53  ? 54.260 7.595   11.219  1.00 9.02  ? 50  VAL A O     1 
ATOM   415  C  CB    . VAL A 1 53  ? 51.803 7.689   12.930  1.00 7.60  ? 50  VAL A CB    1 
ATOM   416  C  CG1   . VAL A 1 53  ? 52.322 8.198   14.261  1.00 11.42 ? 50  VAL A CG1   1 
ATOM   417  C  CG2   . VAL A 1 53  ? 50.299 7.493   13.004  1.00 12.71 ? 50  VAL A CG2   1 
ATOM   418  N  N     . SER A 1 54  ? 54.378 9.716   12.008  1.00 8.78  ? 51  SER A N     1 
ATOM   419  C  CA    . SER A 1 54  ? 55.840 9.766   11.948  1.00 8.49  ? 51  SER A CA    1 
ATOM   420  C  C     . SER A 1 54  ? 56.432 8.843   13.009  1.00 11.12 ? 51  SER A C     1 
ATOM   421  O  O     . SER A 1 54  ? 55.773 8.515   13.998  1.00 9.96  ? 51  SER A O     1 
ATOM   422  C  CB    . SER A 1 54  ? 56.344 11.200  12.139  1.00 9.88  ? 51  SER A CB    1 
ATOM   423  O  OG    . SER A 1 54  ? 56.400 11.526  13.526  1.00 10.13 ? 51  SER A OG    1 
ATOM   424  N  N     . TYR A 1 55  ? 57.668 8.412   12.792  1.00 11.48 ? 52  TYR A N     1 
ATOM   425  C  CA    . TYR A 1 55  ? 58.278 7.470   13.727  1.00 10.43 ? 52  TYR A CA    1 
ATOM   426  C  C     . TYR A 1 55  ? 58.502 8.112   15.098  1.00 10.51 ? 52  TYR A C     1 
ATOM   427  O  O     . TYR A 1 55  ? 58.399 7.431   16.116  1.00 11.98 ? 52  TYR A O     1 
ATOM   428  C  CB    . TYR A 1 55  ? 59.573 6.898   13.136  1.00 10.30 ? 52  TYR A CB    1 
ATOM   429  C  CG    . TYR A 1 55  ? 59.242 5.811   12.145  1.00 10.45 ? 52  TYR A CG    1 
ATOM   430  C  CD1   . TYR A 1 55  ? 58.864 6.122   10.841  1.00 11.29 ? 52  TYR A CD1   1 
ATOM   431  C  CD2   . TYR A 1 55  ? 59.231 4.479   12.527  1.00 12.47 ? 52  TYR A CD2   1 
ATOM   432  C  CE1   . TYR A 1 55  ? 58.509 5.137   9.945   1.00 13.05 ? 52  TYR A CE1   1 
ATOM   433  C  CE2   . TYR A 1 55  ? 58.881 3.480   11.642  1.00 13.19 ? 52  TYR A CE2   1 
ATOM   434  C  CZ    . TYR A 1 55  ? 58.523 3.807   10.350  1.00 14.26 ? 52  TYR A CZ    1 
ATOM   435  O  OH    . TYR A 1 55  ? 58.176 2.799   9.479   1.00 13.60 ? 52  TYR A OH    1 
ATOM   436  N  N     . GLU A 1 56  ? 58.756 9.416   15.130  1.00 11.67 ? 53  GLU A N     1 
ATOM   437  C  CA    . GLU A 1 56  ? 58.823 10.125  16.409  1.00 12.75 ? 53  GLU A CA    1 
ATOM   438  C  C     . GLU A 1 56  ? 57.507 10.014  17.174  1.00 13.02 ? 53  GLU A C     1 
ATOM   439  O  O     . GLU A 1 56  ? 57.505 9.864   18.401  1.00 14.59 ? 53  GLU A O     1 
ATOM   440  C  CB    . GLU A 1 56  ? 59.172 11.605  16.201  1.00 13.69 ? 53  GLU A CB    1 
ATOM   441  C  CG    . GLU A 1 56  ? 60.570 11.887  15.653  1.00 15.72 ? 53  GLU A CG    1 
ATOM   442  C  CD    . GLU A 1 56  ? 60.693 11.732  14.135  1.00 23.23 ? 53  GLU A CD    1 
ATOM   443  O  OE1   . GLU A 1 56  ? 59.716 11.318  13.465  1.00 18.39 ? 53  GLU A OE1   1 
ATOM   444  O  OE2   . GLU A 1 56  ? 61.786 12.031  13.607  1.00 26.21 ? 53  GLU A OE2   1 
ATOM   445  N  N     . ALA A 1 57  ? 56.382 10.137  16.469  1.00 9.21  ? 54  ALA A N     1 
ATOM   446  C  CA    . ALA A 1 57  ? 55.081 10.048  17.115  1.00 8.84  ? 54  ALA A CA    1 
ATOM   447  C  C     . ALA A 1 57  ? 54.742 8.615   17.524  1.00 10.13 ? 54  ALA A C     1 
ATOM   448  O  O     . ALA A 1 57  ? 54.076 8.398   18.535  1.00 11.02 ? 54  ALA A O     1 
ATOM   449  C  CB    . ALA A 1 57  ? 53.989 10.610  16.191  1.00 10.18 ? 54  ALA A CB    1 
ATOM   450  N  N     . ARG A 1 58  ? 55.185 7.636   16.736  1.00 11.48 ? 55  ARG A N     1 
ATOM   451  C  CA    . ARG A 1 58  ? 54.936 6.235   17.095  1.00 11.57 ? 55  ARG A CA    1 
ATOM   452  C  C     . ARG A 1 58  ? 55.558 5.876   18.447  1.00 11.37 ? 55  ARG A C     1 
ATOM   453  O  O     . ARG A 1 58  ? 55.027 5.018   19.164  1.00 13.06 ? 55  ARG A O     1 
ATOM   454  C  CB    . ARG A 1 58  ? 55.475 5.295   16.023  1.00 10.04 ? 55  ARG A CB    1 
ATOM   455  C  CG    . ARG A 1 58  ? 54.829 5.505   14.691  1.00 12.92 ? 55  ARG A CG    1 
ATOM   456  C  CD    . ARG A 1 58  ? 55.327 4.514   13.669  1.00 10.95 ? 55  ARG A CD    1 
ATOM   457  N  NE    . ARG A 1 58  ? 54.929 4.967   12.335  1.00 10.01 ? 55  ARG A NE    1 
ATOM   458  C  CZ    . ARG A 1 58  ? 55.007 4.241   11.228  1.00 13.64 ? 55  ARG A CZ    1 
ATOM   459  N  NH1   . ARG A 1 58  ? 55.452 2.990   11.279  1.00 13.55 ? 55  ARG A NH1   1 
ATOM   460  N  NH2   . ARG A 1 58  ? 54.612 4.776   10.065  1.00 12.44 ? 55  ARG A NH2   1 
ATOM   461  N  N     . ALA A 1 59  ? 56.661 6.542   18.789  1.00 12.49 ? 56  ALA A N     1 
ATOM   462  C  CA    . ALA A 1 59  ? 57.335 6.313   20.070  1.00 12.20 ? 56  ALA A CA    1 
ATOM   463  C  C     . ALA A 1 59  ? 56.424 6.638   21.259  1.00 15.99 ? 56  ALA A C     1 
ATOM   464  O  O     . ALA A 1 59  ? 56.607 6.101   22.360  1.00 19.16 ? 56  ALA A O     1 
ATOM   465  C  CB    . ALA A 1 59  ? 58.625 7.132   20.147  1.00 14.23 ? 56  ALA A CB    1 
ATOM   466  N  N     . PHE A 1 60  ? 55.446 7.514   21.043  1.00 12.65 ? 57  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 60  ? 54.485 7.880   22.088  1.00 13.66 ? 57  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 60  ? 53.276 6.960   22.107  1.00 14.25 ? 57  PHE A C     1 
ATOM   469  O  O     . PHE A 1 60  ? 52.414 7.068   22.985  1.00 16.04 ? 57  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 60  ? 53.995 9.321   21.908  1.00 13.79 ? 57  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 60  ? 55.030 10.365  22.209  1.00 12.25 ? 57  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 60  ? 55.056 11.003  23.446  1.00 16.64 ? 57  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 60  ? 55.975 10.715  21.264  1.00 13.64 ? 57  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 60  ? 56.003 11.973  23.724  1.00 23.51 ? 57  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 60  ? 56.927 11.673  21.533  1.00 17.70 ? 57  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 60  ? 56.938 12.311  22.766  1.00 20.68 ? 57  PHE A CZ    1 
ATOM   477  N  N     . GLY A 1 61  ? 53.196 6.072   21.122  1.00 12.77 ? 58  GLY A N     1 
ATOM   478  C  CA    . GLY A 1 61  ? 52.073 5.157   20.998  1.00 14.27 ? 58  GLY A CA    1 
ATOM   479  C  C     . GLY A 1 61  ? 50.982 5.597   20.033  1.00 11.84 ? 58  GLY A C     1 
ATOM   480  O  O     . GLY A 1 61  ? 49.917 4.981   19.956  1.00 13.51 ? 58  GLY A O     1 
ATOM   481  N  N     . VAL A 1 62  ? 51.232 6.670   19.279  1.00 13.15 ? 59  VAL A N     1 
ATOM   482  C  CA    . VAL A 1 62  ? 50.272 7.108   18.268  1.00 12.59 ? 59  VAL A CA    1 
ATOM   483  C  C     . VAL A 1 62  ? 50.220 6.105   17.111  1.00 12.32 ? 59  VAL A C     1 
ATOM   484  O  O     . VAL A 1 62  ? 51.258 5.653   16.617  1.00 11.52 ? 59  VAL A O     1 
ATOM   485  C  CB    . VAL A 1 62  ? 50.613 8.518   17.737  1.00 11.59 ? 59  VAL A CB    1 
ATOM   486  C  CG1   . VAL A 1 62  ? 49.561 8.985   16.725  1.00 13.85 ? 59  VAL A CG1   1 
ATOM   487  C  CG2   . VAL A 1 62  ? 50.683 9.500   18.894  1.00 14.32 ? 59  VAL A CG2   1 
ATOM   488  N  N     . THR A 1 63  ? 49.006 5.761   16.691  1.00 13.63 ? 60  THR A N     1 
ATOM   489  C  CA    . THR A 1 63  ? 48.814 4.794   15.618  1.00 13.55 ? 60  THR A CA    1 
ATOM   490  C  C     . THR A 1 63  ? 47.788 5.258   14.606  1.00 14.68 ? 60  THR A C     1 
ATOM   491  O  O     . THR A 1 63  ? 46.986 6.149   14.873  1.00 14.70 ? 60  THR A O     1 
ATOM   492  C  CB    . THR A 1 63  ? 48.357 3.421   16.151  1.00 14.41 ? 60  THR A CB    1 
ATOM   493  O  OG1   . THR A 1 63  ? 47.092 3.558   16.812  1.00 18.83 ? 60  THR A OG1   1 
ATOM   494  C  CG2   . THR A 1 63  ? 49.372 2.848   17.124  1.00 14.51 ? 60  THR A CG2   1 
ATOM   495  N  N     . ARG A 1 64  ? 47.824 4.644   13.427  1.00 14.95 ? 61  ARG A N     1 
ATOM   496  C  CA    . ARG A 1 64  ? 46.750 4.772   12.460  1.00 17.97 ? 61  ARG A CA    1 
ATOM   497  C  C     . ARG A 1 64  ? 45.420 4.353   13.102  1.00 19.67 ? 61  ARG A C     1 
ATOM   498  O  O     . ARG A 1 64  ? 45.409 3.508   14.000  1.00 18.85 ? 61  ARG A O     1 
ATOM   499  C  CB    . ARG A 1 64  ? 47.086 3.924   11.222  1.00 17.43 ? 61  ARG A CB    1 
ATOM   500  C  CG    . ARG A 1 64  ? 45.965 3.671   10.243  1.00 30.19 ? 61  ARG A CG    1 
ATOM   501  C  CD    . ARG A 1 64  ? 46.521 2.944   9.021   1.00 25.94 ? 61  ARG A CD    1 
ATOM   502  N  NE    . ARG A 1 64  ? 47.544 3.779   8.409   1.00 24.77 ? 61  ARG A NE    1 
ATOM   503  C  CZ    . ARG A 1 64  ? 48.765 3.381   8.054   1.00 27.31 ? 61  ARG A CZ    1 
ATOM   504  N  NH1   . ARG A 1 64  ? 49.161 2.118   8.207   1.00 27.56 ? 61  ARG A NH1   1 
ATOM   505  N  NH2   . ARG A 1 64  ? 49.595 4.265   7.516   1.00 16.82 ? 61  ARG A NH2   1 
ATOM   506  N  N     . SER A 1 65  ? 44.328 4.977   12.652  1.00 19.32 ? 62  SER A N     1 
ATOM   507  C  CA    . SER A 1 65  ? 42.942 4.720   13.075  1.00 23.52 ? 62  SER A CA    1 
ATOM   508  C  C     . SER A 1 65  ? 42.573 5.400   14.392  1.00 17.49 ? 62  SER A C     1 
ATOM   509  O  O     . SER A 1 65  ? 41.413 5.409   14.796  1.00 30.00 ? 62  SER A O     1 
ATOM   510  C  CB    . SER A 1 65  ? 42.660 3.225   13.193  1.00 27.67 ? 62  SER A CB    1 
ATOM   511  O  OG    . SER A 1 65  ? 42.911 2.779   14.514  1.00 34.12 ? 62  SER A OG    1 
ATOM   512  N  N     . MET A 1 66  ? 43.564 5.962   15.059  1.00 20.95 ? 63  MET A N     1 
ATOM   513  C  CA    . MET A 1 66  ? 43.335 6.700   16.283  1.00 16.37 ? 63  MET A CA    1 
ATOM   514  C  C     . MET A 1 66  ? 42.677 8.036   15.950  1.00 15.32 ? 63  MET A C     1 
ATOM   515  O  O     . MET A 1 66  ? 42.994 8.633   14.924  1.00 15.18 ? 63  MET A O     1 
ATOM   516  C  CB    . MET A 1 66  ? 44.670 6.899   16.983  1.00 19.40 ? 63  MET A CB    1 
ATOM   517  C  CG    . MET A 1 66  ? 44.649 7.262   18.413  1.00 23.35 ? 63  MET A CG    1 
ATOM   518  S  SD    . MET A 1 66  ? 46.357 7.054   18.972  1.00 19.80 ? 63  MET A SD    1 
ATOM   519  C  CE    . MET A 1 66  ? 46.363 5.359   19.505  1.00 19.81 ? 63  MET A CE    1 
ATOM   520  N  N     . TRP A 1 67  ? 41.770 8.509   16.803  1.00 14.52 ? 64  TRP A N     1 
ATOM   521  C  CA    . TRP A 1 67  ? 41.293 9.888   16.690  1.00 14.16 ? 64  TRP A CA    1 
ATOM   522  C  C     . TRP A 1 67  ? 42.374 10.855  17.150  1.00 14.01 ? 64  TRP A C     1 
ATOM   523  O  O     . TRP A 1 67  ? 43.068 10.585  18.125  1.00 12.86 ? 64  TRP A O     1 
ATOM   524  C  CB    . TRP A 1 67  ? 40.022 10.104  17.511  1.00 13.75 ? 64  TRP A CB    1 
ATOM   525  C  CG    . TRP A 1 67  ? 38.923 9.223   17.078  1.00 16.31 ? 64  TRP A CG    1 
ATOM   526  C  CD1   . TRP A 1 67  ? 38.354 8.208   17.788  1.00 21.74 ? 64  TRP A CD1   1 
ATOM   527  C  CD2   . TRP A 1 67  ? 38.261 9.252   15.810  1.00 21.11 ? 64  TRP A CD2   1 
ATOM   528  N  NE1   . TRP A 1 67  ? 37.365 7.610   17.040  1.00 24.28 ? 64  TRP A NE1   1 
ATOM   529  C  CE2   . TRP A 1 67  ? 37.296 8.230   15.819  1.00 24.37 ? 64  TRP A CE2   1 
ATOM   530  C  CE3   . TRP A 1 67  ? 38.394 10.046  14.666  1.00 19.33 ? 64  TRP A CE3   1 
ATOM   531  C  CZ2   . TRP A 1 67  ? 36.458 7.983   14.732  1.00 24.73 ? 64  TRP A CZ2   1 
ATOM   532  C  CZ3   . TRP A 1 67  ? 37.563 9.799   13.584  1.00 19.06 ? 64  TRP A CZ3   1 
ATOM   533  C  CH2   . TRP A 1 67  ? 36.609 8.776   13.627  1.00 21.99 ? 64  TRP A CH2   1 
ATOM   534  N  N     . ALA A 1 68  ? 42.519 11.986  16.469  1.00 12.93 ? 65  ALA A N     1 
ATOM   535  C  CA    . ALA A 1 68  ? 43.557 12.942  16.841  1.00 14.68 ? 65  ALA A CA    1 
ATOM   536  C  C     . ALA A 1 68  ? 43.423 13.407  18.294  1.00 13.26 ? 65  ALA A C     1 
ATOM   537  O  O     . ALA A 1 68  ? 44.435 13.597  18.979  1.00 13.56 ? 65  ALA A O     1 
ATOM   538  C  CB    . ALA A 1 68  ? 43.536 14.140  15.899  1.00 16.58 ? 65  ALA A CB    1 
ATOM   539  N  N     . ASP A 1 69  ? 42.188 13.581  18.769  1.00 13.72 ? 66  ASP A N     1 
ATOM   540  C  CA    . ASP A 1 69  ? 41.987 14.006  20.157  1.00 12.57 ? 66  ASP A CA    1 
ATOM   541  C  C     . ASP A 1 69  ? 42.595 12.974  21.102  1.00 12.92 ? 66  ASP A C     1 
ATOM   542  O  O     . ASP A 1 69  ? 43.150 13.326  22.154  1.00 14.19 ? 66  ASP A O     1 
ATOM   543  C  CB    . ASP A 1 69  ? 40.509 14.189  20.495  1.00 15.50 ? 66  ASP A CB    1 
ATOM   544  C  CG    . ASP A 1 69  ? 39.896 15.447  19.881  1.00 13.81 ? 66  ASP A CG    1 
ATOM   545  O  OD1   . ASP A 1 69  ? 40.623 16.292  19.318  1.00 19.26 ? 66  ASP A OD1   1 
ATOM   546  O  OD2   . ASP A 1 69  ? 38.661 15.577  19.983  1.00 20.55 ? 66  ASP A OD2   1 
ATOM   547  N  N     . ASP A 1 70  ? 42.500 11.703  20.726  1.00 12.45 ? 67  ASP A N     1 
ATOM   548  C  CA    . ASP A 1 70  ? 43.036 10.638  21.568  1.00 12.59 ? 67  ASP A CA    1 
ATOM   549  C  C     . ASP A 1 70  ? 44.558 10.548  21.434  1.00 12.92 ? 67  ASP A C     1 
ATOM   550  O  O     . ASP A 1 70  ? 45.270 10.314  22.415  1.00 11.45 ? 67  ASP A O     1 
ATOM   551  C  CB    . ASP A 1 70  ? 42.373 9.304   21.211  1.00 15.02 ? 67  ASP A CB    1 
ATOM   552  C  CG    . ASP A 1 70  ? 40.888 9.291   21.546  1.00 19.04 ? 67  ASP A CG    1 
ATOM   553  O  OD1   . ASP A 1 70  ? 40.469 10.057  22.447  1.00 18.51 ? 67  ASP A OD1   1 
ATOM   554  O  OD2   . ASP A 1 70  ? 40.138 8.530   20.895  1.00 19.91 ? 67  ASP A OD2   1 
ATOM   555  N  N     . ALA A 1 71  ? 45.068 10.747  20.218  1.00 11.69 ? 68  ALA A N     1 
ATOM   556  C  CA    . ALA A 1 71  ? 46.511 10.781  20.002  1.00 12.58 ? 68  ALA A CA    1 
ATOM   557  C  C     . ALA A 1 71  ? 47.178 11.884  20.817  1.00 12.60 ? 68  ALA A C     1 
ATOM   558  O  O     . ALA A 1 71  ? 48.266 11.691  21.339  1.00 13.28 ? 68  ALA A O     1 
ATOM   559  C  CB    . ALA A 1 71  ? 46.828 10.965  18.516  1.00 14.57 ? 68  ALA A CB    1 
ATOM   560  N  N     . LYS A 1 72  ? 46.500 13.023  20.932  1.00 12.14 ? 69  LYS A N     1 
ATOM   561  C  CA    . LYS A 1 72  ? 46.999 14.162  21.702  1.00 11.74 ? 69  LYS A CA    1 
ATOM   562  C  C     . LYS A 1 72  ? 47.116 13.835  23.186  1.00 14.81 ? 69  LYS A C     1 
ATOM   563  O  O     . LYS A 1 72  ? 47.909 14.447  23.903  1.00 14.22 ? 69  LYS A O     1 
ATOM   564  C  CB    . LYS A 1 72  ? 46.078 15.377  21.507  1.00 13.16 ? 69  LYS A CB    1 
ATOM   565  C  CG    . LYS A 1 72  ? 46.392 16.210  20.249  1.00 17.29 ? 69  LYS A CG    1 
ATOM   566  C  CD    . LYS A 1 72  ? 47.709 16.973  20.418  1.00 16.70 ? 69  LYS A CD    1 
ATOM   567  C  CE    . LYS A 1 72  ? 47.853 18.110  19.415  1.00 22.76 ? 69  LYS A CE    1 
ATOM   568  N  NZ    . LYS A 1 72  ? 49.130 18.858  19.639  1.00 17.29 ? 69  LYS A NZ    1 
ATOM   569  N  N     . LYS A 1 73  ? 46.325 12.870  23.643  1.00 11.75 ? 70  LYS A N     1 
ATOM   570  C  CA    . LYS A 1 73  ? 46.419 12.431  25.033  1.00 12.43 ? 70  LYS A CA    1 
ATOM   571  C  C     . LYS A 1 73  ? 47.750 11.713  25.248  1.00 18.87 ? 70  LYS A C     1 
ATOM   572  O  O     . LYS A 1 73  ? 48.366 11.859  26.295  1.00 20.61 ? 70  LYS A O     1 
ATOM   573  C  CB    . LYS A 1 73  ? 45.231 11.528  25.389  1.00 11.03 ? 70  LYS A CB    1 
ATOM   574  C  CG    . LYS A 1 73  ? 43.904 12.237  25.229  1.00 12.65 ? 70  LYS A CG    1 
ATOM   575  C  CD    . LYS A 1 73  ? 42.719 11.293  25.430  1.00 13.96 ? 70  LYS A CD    1 
ATOM   576  C  CE    . LYS A 1 73  ? 41.403 12.000  25.097  1.00 15.57 ? 70  LYS A CE    1 
ATOM   577  N  NZ    . LYS A 1 73  ? 40.273 11.031  24.997  1.00 18.38 ? 70  LYS A NZ    1 
ATOM   578  N  N     . LEU A 1 74  ? 48.211 10.969  24.241  1.00 12.47 ? 71  LEU A N     1 
ATOM   579  C  CA    . LEU A 1 74  ? 49.489 10.256  24.345  1.00 13.11 ? 71  LEU A CA    1 
ATOM   580  C  C     . LEU A 1 74  ? 50.683 11.156  24.056  1.00 14.34 ? 71  LEU A C     1 
ATOM   581  O  O     . LEU A 1 74  ? 51.785 10.933  24.559  1.00 15.30 ? 71  LEU A O     1 
ATOM   582  C  CB    . LEU A 1 74  ? 49.526 9.071   23.377  1.00 12.51 ? 71  LEU A CB    1 
ATOM   583  C  CG    . LEU A 1 74  ? 48.486 7.980   23.599  1.00 14.18 ? 71  LEU A CG    1 
ATOM   584  C  CD1   . LEU A 1 74  ? 48.689 6.908   22.527  1.00 16.86 ? 71  LEU A CD1   1 
ATOM   585  C  CD2   . LEU A 1 74  ? 48.624 7.388   24.992  1.00 14.15 ? 71  LEU A CD2   1 
ATOM   586  N  N     . CYS A 1 75  ? 50.443 12.158  23.221  1.00 13.02 ? 72  CYS A N     1 
ATOM   587  C  CA    . CYS A 1 75  ? 51.501 12.990  22.669  1.00 15.12 ? 72  CYS A CA    1 
ATOM   588  C  C     . CYS A 1 75  ? 50.981 14.412  22.521  1.00 16.68 ? 72  CYS A C     1 
ATOM   589  O  O     . CYS A 1 75  ? 50.506 14.799  21.452  1.00 14.70 ? 72  CYS A O     1 
ATOM   590  C  CB    . CYS A 1 75  ? 51.948 12.423  21.326  1.00 12.98 ? 72  CYS A CB    1 
ATOM   591  S  SG    . CYS A 1 75  ? 53.299 13.315  20.511  1.00 16.69 ? 72  CYS A SG    1 
ATOM   592  N  N     . PRO A 1 76  ? 51.025 15.192  23.609  1.00 14.41 ? 73  PRO A N     1 
ATOM   593  C  CA    . PRO A 1 76  ? 50.409 16.521  23.607  1.00 14.36 ? 73  PRO A CA    1 
ATOM   594  C  C     . PRO A 1 76  ? 51.002 17.471  22.568  1.00 13.98 ? 73  PRO A C     1 
ATOM   595  O  O     . PRO A 1 76  ? 50.304 18.384  22.130  1.00 17.75 ? 73  PRO A O     1 
ATOM   596  C  CB    . PRO A 1 76  ? 50.676 17.034  25.030  1.00 18.07 ? 73  PRO A CB    1 
ATOM   597  C  CG    . PRO A 1 76  ? 50.808 15.798  25.851  1.00 22.35 ? 73  PRO A CG    1 
ATOM   598  C  CD    . PRO A 1 76  ? 51.434 14.763  24.958  1.00 18.78 ? 73  PRO A CD    1 
ATOM   599  N  N     . ASP A 1 77  ? 52.261 17.258  22.203  1.00 17.54 ? 74  ASP A N     1 
ATOM   600  C  CA    . ASP A 1 77  ? 52.932 18.139  21.251  1.00 18.09 ? 74  ASP A CA    1 
ATOM   601  C  C     . ASP A 1 77  ? 52.850 17.616  19.822  1.00 16.20 ? 74  ASP A C     1 
ATOM   602  O  O     . ASP A 1 77  ? 53.532 18.133  18.935  1.00 15.30 ? 74  ASP A O     1 
ATOM   603  C  CB    . ASP A 1 77  ? 54.395 18.328  21.637  1.00 22.69 ? 74  ASP A CB    1 
ATOM   604  C  CG    . ASP A 1 77  ? 54.559 19.061  22.949  1.00 28.09 ? 74  ASP A CG    1 
ATOM   605  O  OD1   . ASP A 1 77  ? 55.462 18.681  23.726  1.00 35.47 ? 74  ASP A OD1   1 
ATOM   606  O  OD2   . ASP A 1 77  ? 53.784 20.007  23.204  1.00 30.26 ? 74  ASP A OD2   1 
ATOM   607  N  N     . LEU A 1 78  ? 52.022 16.598  19.604  1.00 12.26 ? 75  LEU A N     1 
ATOM   608  C  CA    . LEU A 1 78  ? 51.851 16.024  18.262  1.00 10.57 ? 75  LEU A CA    1 
ATOM   609  C  C     . LEU A 1 78  ? 51.456 17.088  17.248  1.00 11.80 ? 75  LEU A C     1 
ATOM   610  O  O     . LEU A 1 78  ? 50.501 17.828  17.476  1.00 12.62 ? 75  LEU A O     1 
ATOM   611  C  CB    . LEU A 1 78  ? 50.777 14.939  18.285  1.00 11.61 ? 75  LEU A CB    1 
ATOM   612  C  CG    . LEU A 1 78  ? 50.420 14.225  16.976  1.00 9.58  ? 75  LEU A CG    1 
ATOM   613  C  CD1   . LEU A 1 78  ? 51.581 13.345  16.534  1.00 10.91 ? 75  LEU A CD1   1 
ATOM   614  C  CD2   . LEU A 1 78  ? 49.149 13.421  17.171  1.00 13.35 ? 75  LEU A CD2   1 
ATOM   615  N  N     . LEU A 1 79  ? 52.169 17.150  16.129  1.00 10.66 ? 76  LEU A N     1 
ATOM   616  C  CA    . LEU A 1 79  ? 51.791 18.087  15.085  1.00 10.15 ? 76  LEU A CA    1 
ATOM   617  C  C     . LEU A 1 79  ? 50.911 17.365  14.077  1.00 13.95 ? 76  LEU A C     1 
ATOM   618  O  O     . LEU A 1 79  ? 51.053 16.166  13.879  1.00 12.36 ? 76  LEU A O     1 
ATOM   619  C  CB    . LEU A 1 79  ? 53.023 18.683  14.413  1.00 9.30  ? 76  LEU A CB    1 
ATOM   620  C  CG    . LEU A 1 79  ? 53.980 19.423  15.352  1.00 10.45 ? 76  LEU A CG    1 
ATOM   621  C  CD1   . LEU A 1 79  ? 55.173 19.980  14.595  1.00 13.32 ? 76  LEU A CD1   1 
ATOM   622  C  CD2   . LEU A 1 79  ? 53.268 20.520  16.146  1.00 10.49 ? 76  LEU A CD2   1 
ATOM   623  N  N     . LEU A 1 80  ? 50.005 18.098  13.442  1.00 11.51 ? 77  LEU A N     1 
ATOM   624  C  CA    . LEU A 1 80  ? 49.070 17.489  12.503  1.00 11.74 ? 77  LEU A CA    1 
ATOM   625  C  C     . LEU A 1 80  ? 49.048 18.225  11.179  1.00 15.34 ? 77  LEU A C     1 
ATOM   626  O  O     . LEU A 1 80  ? 49.130 19.454  11.122  1.00 19.07 ? 77  LEU A O     1 
ATOM   627  C  CB    . LEU A 1 80  ? 47.660 17.455  13.087  1.00 13.66 ? 77  LEU A CB    1 
ATOM   628  C  CG    . LEU A 1 80  ? 47.459 16.696  14.393  1.00 14.45 ? 77  LEU A CG    1 
ATOM   629  C  CD1   . LEU A 1 80  ? 46.033 16.898  14.890  1.00 16.45 ? 77  LEU A CD1   1 
ATOM   630  C  CD2   . LEU A 1 80  ? 47.777 15.219  14.178  1.00 15.35 ? 77  LEU A CD2   1 
ATOM   631  N  N     . ALA A 1 81  ? 48.946 17.452  10.114  1.00 10.27 ? 78  ALA A N     1 
ATOM   632  C  CA    . ALA A 1 81  ? 48.650 17.983  8.790   1.00 9.53  ? 78  ALA A CA    1 
ATOM   633  C  C     . ALA A 1 81  ? 47.346 17.362  8.329   1.00 12.13 ? 78  ALA A C     1 
ATOM   634  O  O     . ALA A 1 81  ? 47.127 16.172  8.530   1.00 12.56 ? 78  ALA A O     1 
ATOM   635  C  CB    . ALA A 1 81  ? 49.768 17.675  7.817   1.00 11.49 ? 78  ALA A CB    1 
ATOM   636  N  N     . GLN A 1 82  ? 46.475 18.172  7.733   1.00 12.23 ? 79  GLN A N     1 
ATOM   637  C  CA    . GLN A 1 82  ? 45.161 17.700  7.288   1.00 10.75 ? 79  GLN A CA    1 
ATOM   638  C  C     . GLN A 1 82  ? 45.131 17.350  5.816   1.00 9.60  ? 79  GLN A C     1 
ATOM   639  O  O     . GLN A 1 82  ? 45.666 18.094  4.993   1.00 14.55 ? 79  GLN A O     1 
ATOM   640  C  CB    . GLN A 1 82  ? 44.086 18.765  7.529   1.00 15.52 ? 79  GLN A CB    1 
ATOM   641  C  CG    . GLN A 1 82  ? 43.840 19.131  8.952   1.00 23.92 ? 79  GLN A CG    1 
ATOM   642  C  CD    . GLN A 1 82  ? 42.769 20.185  9.045   1.00 31.23 ? 79  GLN A CD    1 
ATOM   643  O  OE1   . GLN A 1 82  ? 43.028 21.305  9.471   1.00 30.64 ? 79  GLN A OE1   1 
ATOM   644  N  NE2   . GLN A 1 82  ? 41.557 19.837  8.618   1.00 29.31 ? 79  GLN A NE2   1 
ATOM   645  N  N     . VAL A 1 83  ? 44.477 16.240  5.493   1.00 10.99 ? 80  VAL A N     1 
ATOM   646  C  CA    . VAL A 1 83  ? 44.166 15.911  4.109   1.00 11.06 ? 80  VAL A CA    1 
ATOM   647  C  C     . VAL A 1 83  ? 43.276 16.999  3.501   1.00 13.63 ? 80  VAL A C     1 
ATOM   648  O  O     . VAL A 1 83  ? 42.349 17.494  4.136   1.00 13.19 ? 80  VAL A O     1 
ATOM   649  C  CB    . VAL A 1 83  ? 43.458 14.546  4.012   1.00 11.41 ? 80  VAL A CB    1 
ATOM   650  C  CG1   . VAL A 1 83  ? 42.995 14.253  2.594   1.00 12.26 ? 80  VAL A CG1   1 
ATOM   651  C  CG2   . VAL A 1 83  ? 44.376 13.432  4.540   1.00 12.00 ? 80  VAL A CG2   1 
ATOM   652  N  N     . ARG A 1 84  ? 43.570 17.352  2.260   1.00 10.98 ? 81  ARG A N     1 
ATOM   653  C  CA    . ARG A 1 84  ? 42.783 18.347  1.544   1.00 10.58 ? 81  ARG A CA    1 
ATOM   654  C  C     . ARG A 1 84  ? 41.322 17.920  1.470   1.00 12.32 ? 81  ARG A C     1 
ATOM   655  O  O     . ARG A 1 84  ? 41.022 16.731  1.315   1.00 12.45 ? 81  ARG A O     1 
ATOM   656  C  CB    . ARG A 1 84  ? 43.359 18.539  0.143   1.00 16.77 ? 81  ARG A CB    1 
ATOM   657  C  CG    . ARG A 1 84  ? 42.497 19.398  -0.785  1.00 19.04 ? 81  ARG A CG    1 
ATOM   658  C  CD    . ARG A 1 84  ? 43.206 19.620  -2.109  1.00 28.44 ? 81  ARG A CD    1 
ATOM   659  N  NE    . ARG A 1 84  ? 42.294 20.082  -3.151  1.00 39.53 ? 81  ARG A NE    1 
ATOM   660  C  CZ    . ARG A 1 84  ? 42.539 19.987  -4.455  1.00 47.92 ? 81  ARG A CZ    1 
ATOM   661  N  NH1   . ARG A 1 84  ? 43.670 19.441  -4.884  1.00 42.94 ? 81  ARG A NH1   1 
ATOM   662  N  NH2   . ARG A 1 84  ? 41.650 20.435  -5.333  1.00 39.78 ? 81  ARG A NH2   1 
ATOM   663  N  N     . GLU A 1 85  ? 40.421 18.889  1.601   1.00 12.48 ? 82  GLU A N     1 
ATOM   664  C  CA    . GLU A 1 85  ? 39.018 18.638  1.349   1.00 13.85 ? 82  GLU A CA    1 
ATOM   665  C  C     . GLU A 1 85  ? 38.581 19.411  0.119   1.00 16.77 ? 82  GLU A C     1 
ATOM   666  O  O     . GLU A 1 85  ? 38.893 20.595  -0.026  1.00 18.16 ? 82  GLU A O     1 
ATOM   667  C  CB    . GLU A 1 85  ? 38.186 18.998  2.577   1.00 16.33 ? 82  GLU A CB    1 
ATOM   668  C  CG    . GLU A 1 85  ? 38.291 17.909  3.633   1.00 22.77 ? 82  GLU A CG    1 
ATOM   669  C  CD    . GLU A 1 85  ? 37.566 18.235  4.928   1.00 28.66 ? 82  GLU A CD    1 
ATOM   670  O  OE1   . GLU A 1 85  ? 36.352 18.558  4.892   1.00 29.61 ? 82  GLU A OE1   1 
ATOM   671  O  OE2   . GLU A 1 85  ? 38.227 18.155  5.987   1.00 30.10 ? 82  GLU A OE2   1 
ATOM   672  N  N     . SER A 1 86  ? 37.915 18.705  -0.793  1.00 13.95 ? 83  SER A N     1 
ATOM   673  C  CA    . SER A 1 86  ? 37.326 19.297  -1.984  1.00 14.62 ? 83  SER A CA    1 
ATOM   674  C  C     . SER A 1 86  ? 35.970 18.664  -2.209  1.00 17.53 ? 83  SER A C     1 
ATOM   675  O  O     . SER A 1 86  ? 35.815 17.453  -2.054  1.00 15.07 ? 83  SER A O     1 
ATOM   676  C  CB    . SER A 1 86  ? 38.210 19.083  -3.211  1.00 16.61 ? 83  SER A CB    1 
ATOM   677  O  OG    . SER A 1 86  ? 39.513 19.579  -2.987  1.00 27.18 ? 83  SER A OG    1 
ATOM   678  N  N     . ARG A 1 87  ? 34.996 19.492  -2.578  1.00 17.66 ? 84  ARG A N     1 
ATOM   679  C  CA    . ARG A 1 87  ? 33.636 19.033  -2.849  1.00 18.68 ? 84  ARG A CA    1 
ATOM   680  C  C     . ARG A 1 87  ? 33.055 18.270  -1.679  1.00 15.54 ? 84  ARG A C     1 
ATOM   681  O  O     . ARG A 1 87  ? 32.289 17.327  -1.862  1.00 19.43 ? 84  ARG A O     1 
ATOM   682  C  CB    . ARG A 1 87  ? 33.607 18.166  -4.110  1.00 20.62 ? 84  ARG A CB    1 
ATOM   683  C  CG    . ARG A 1 87  ? 34.230 18.821  -5.318  1.00 27.27 ? 84  ARG A CG    1 
ATOM   684  C  CD    . ARG A 1 87  ? 34.152 17.900  -6.523  1.00 26.13 ? 84  ARG A CD    1 
ATOM   685  N  NE    . ARG A 1 87  ? 34.967 18.385  -7.630  1.00 30.77 ? 84  ARG A NE    1 
ATOM   686  C  CZ    . ARG A 1 87  ? 36.290 18.259  -7.704  1.00 33.38 ? 84  ARG A CZ    1 
ATOM   687  N  NH1   . ARG A 1 87  ? 36.977 17.666  -6.725  1.00 30.49 ? 84  ARG A NH1   1 
ATOM   688  N  NH2   . ARG A 1 87  ? 36.934 18.739  -8.760  1.00 32.78 ? 84  ARG A NH2   1 
ATOM   689  N  N     . GLY A 1 88  ? 33.434 18.670  -0.472  1.00 16.44 ? 85  GLY A N     1 
ATOM   690  C  CA    . GLY A 1 88  ? 32.866 18.109  0.738   1.00 18.24 ? 85  GLY A CA    1 
ATOM   691  C  C     . GLY A 1 88  ? 33.502 16.815  1.214   1.00 16.82 ? 85  GLY A C     1 
ATOM   692  O  O     . GLY A 1 88  ? 33.027 16.205  2.175   1.00 15.06 ? 85  GLY A O     1 
ATOM   693  N  N     . LYS A 1 89  ? 34.573 16.388  0.550   1.00 14.77 ? 86  LYS A N     1 
ATOM   694  C  CA    . LYS A 1 89  ? 35.202 15.114  0.893   1.00 12.97 ? 86  LYS A CA    1 
ATOM   695  C  C     . LYS A 1 89  ? 36.730 15.181  0.923   1.00 12.59 ? 86  LYS A C     1 
ATOM   696  O  O     . LYS A 1 89  ? 37.350 16.068  0.345   1.00 12.21 ? 86  LYS A O     1 
ATOM   697  C  CB    . LYS A 1 89  ? 34.771 14.017  -0.088  1.00 15.20 ? 86  LYS A CB    1 
ATOM   698  C  CG    . LYS A 1 89  ? 35.246 14.230  -1.509  1.00 15.72 ? 86  LYS A CG    1 
ATOM   699  C  CD    . LYS A 1 89  ? 34.730 13.150  -2.462  1.00 16.71 ? 86  LYS A CD    1 
ATOM   700  C  CE    . LYS A 1 89  ? 35.309 11.781  -2.130  1.00 14.96 ? 86  LYS A CE    1 
ATOM   701  N  NZ    . LYS A 1 89  ? 36.802 11.751  -2.289  1.00 12.84 ? 86  LYS A NZ    1 
ATOM   702  N  N     . ALA A 1 90  ? 37.330 14.214  1.599   1.00 13.99 ? 87  ALA A N     1 
ATOM   703  C  CA    . ALA A 1 90  ? 38.780 14.092  1.592   1.00 14.46 ? 87  ALA A CA    1 
ATOM   704  C  C     . ALA A 1 90  ? 39.242 13.857  0.164   1.00 13.30 ? 87  ALA A C     1 
ATOM   705  O  O     . ALA A 1 90  ? 38.595 13.128  -0.594  1.00 15.58 ? 87  ALA A O     1 
ATOM   706  C  CB    . ALA A 1 90  ? 39.225 12.963  2.506   1.00 15.21 ? 87  ALA A CB    1 
ATOM   707  N  N     . ASN A 1 91  ? 40.337 14.507  -0.209  1.00 11.40 ? 88  ASN A N     1 
ATOM   708  C  CA    . ASN A 1 91  ? 40.872 14.393  -1.558  1.00 13.99 ? 88  ASN A CA    1 
ATOM   709  C  C     . ASN A 1 91  ? 42.339 13.998  -1.478  1.00 12.34 ? 88  ASN A C     1 
ATOM   710  O  O     . ASN A 1 91  ? 43.152 14.738  -0.907  1.00 12.44 ? 88  ASN A O     1 
ATOM   711  C  CB    . ASN A 1 91  ? 40.707 15.709  -2.322  1.00 14.28 ? 88  ASN A CB    1 
ATOM   712  C  CG    . ASN A 1 91  ? 41.060 15.569  -3.786  1.00 17.63 ? 88  ASN A CG    1 
ATOM   713  O  OD1   . ASN A 1 91  ? 42.204 15.311  -4.124  1.00 15.06 ? 88  ASN A OD1   1 
ATOM   714  N  ND2   . ASN A 1 91  ? 40.069 15.722  -4.666  1.00 21.82 ? 88  ASN A ND2   1 
ATOM   715  N  N     . LEU A 1 92  ? 42.680 12.838  -2.033  1.00 10.68 ? 89  LEU A N     1 
ATOM   716  C  CA    . LEU A 1 92  ? 44.032 12.297  -1.849  1.00 11.07 ? 89  LEU A CA    1 
ATOM   717  C  C     . LEU A 1 92  ? 44.995 12.610  -2.994  1.00 11.67 ? 89  LEU A C     1 
ATOM   718  O  O     . LEU A 1 92  ? 46.046 11.980  -3.113  1.00 12.33 ? 89  LEU A O     1 
ATOM   719  C  CB    . LEU A 1 92  ? 43.952 10.781  -1.639  1.00 10.79 ? 89  LEU A CB    1 
ATOM   720  C  CG    . LEU A 1 92  ? 42.979 10.346  -0.543  1.00 11.17 ? 89  LEU A CG    1 
ATOM   721  C  CD1   . LEU A 1 92  ? 42.866 8.835   -0.509  1.00 13.47 ? 89  LEU A CD1   1 
ATOM   722  C  CD2   . LEU A 1 92  ? 43.460 10.900  0.800   1.00 15.37 ? 89  LEU A CD2   1 
ATOM   723  N  N     . THR A 1 93  ? 44.667 13.604  -3.812  1.00 10.45 ? 90  THR A N     1 
ATOM   724  C  CA    . THR A 1 93  ? 45.469 13.875  -5.005  1.00 12.43 ? 90  THR A CA    1 
ATOM   725  C  C     . THR A 1 93  ? 46.949 14.145  -4.730  1.00 11.57 ? 90  THR A C     1 
ATOM   726  O  O     . THR A 1 93  ? 47.808 13.659  -5.481  1.00 12.17 ? 90  THR A O     1 
ATOM   727  C  CB    . THR A 1 93  ? 44.864 15.050  -5.801  1.00 14.34 ? 90  THR A CB    1 
ATOM   728  O  OG1   . THR A 1 93  ? 43.562 14.656  -6.255  1.00 17.83 ? 90  THR A OG1   1 
ATOM   729  C  CG2   . THR A 1 93  ? 45.724 15.392  -7.015  1.00 16.07 ? 90  THR A CG2   1 
ATOM   730  N  N     . LYS A 1 94  ? 47.257 14.901  -3.679  1.00 10.77 ? 91  LYS A N     1 
ATOM   731  C  CA    . LYS A 1 94  ? 48.648 15.229  -3.376  1.00 10.13 ? 91  LYS A CA    1 
ATOM   732  C  C     . LYS A 1 94  ? 49.483 13.965  -3.188  1.00 10.88 ? 91  LYS A C     1 
ATOM   733  O  O     . LYS A 1 94  ? 50.646 13.898  -3.615  1.00 11.56 ? 91  LYS A O     1 
ATOM   734  C  CB    . LYS A 1 94  ? 48.732 16.115  -2.121  1.00 10.07 ? 91  LYS A CB    1 
ATOM   735  C  CG    . LYS A 1 94  ? 50.143 16.638  -1.830  1.00 11.94 ? 91  LYS A CG    1 
ATOM   736  C  CD    . LYS A 1 94  ? 50.266 17.185  -0.399  1.00 13.80 ? 91  LYS A CD    1 
ATOM   737  C  CE    . LYS A 1 94  ? 49.286 18.303  -0.118  1.00 16.91 ? 91  LYS A CE    1 
ATOM   738  N  NZ    . LYS A 1 94  ? 49.516 18.842  1.251   1.00 11.16 ? 91  LYS A NZ    1 
ATOM   739  N  N     . TYR A 1 95  ? 48.881 12.948  -2.591  1.00 10.14 ? 92  TYR A N     1 
ATOM   740  C  CA    . TYR A 1 95  ? 49.621 11.738  -2.250  1.00 8.43  ? 92  TYR A CA    1 
ATOM   741  C  C     . TYR A 1 95  ? 49.710 10.825  -3.462  1.00 10.68 ? 92  TYR A C     1 
ATOM   742  O  O     . TYR A 1 95  ? 50.726 10.154  -3.659  1.00 11.43 ? 92  TYR A O     1 
ATOM   743  C  CB    . TYR A 1 95  ? 48.979 11.013  -1.051  1.00 9.73  ? 92  TYR A CB    1 
ATOM   744  C  CG    . TYR A 1 95  ? 48.664 11.997  0.047   1.00 8.44  ? 92  TYR A CG    1 
ATOM   745  C  CD1   . TYR A 1 95  ? 47.357 12.385  0.296   1.00 10.36 ? 92  TYR A CD1   1 
ATOM   746  C  CD2   . TYR A 1 95  ? 49.685 12.621  0.764   1.00 9.98  ? 92  TYR A CD2   1 
ATOM   747  C  CE1   . TYR A 1 95  ? 47.062 13.335  1.264   1.00 10.23 ? 92  TYR A CE1   1 
ATOM   748  C  CE2   . TYR A 1 95  ? 49.406 13.563  1.731   1.00 10.40 ? 92  TYR A CE2   1 
ATOM   749  C  CZ    . TYR A 1 95  ? 48.081 13.916  1.972   1.00 8.98  ? 92  TYR A CZ    1 
ATOM   750  O  OH    . TYR A 1 95  ? 47.751 14.868  2.911   1.00 11.52 ? 92  TYR A OH    1 
ATOM   751  N  N     . ARG A 1 96  ? 48.664 10.812  -4.286  1.00 11.28 ? 93  ARG A N     1 
ATOM   752  C  CA    . ARG A 1 96  ? 48.735 10.048  -5.538  1.00 11.29 ? 93  ARG A CA    1 
ATOM   753  C  C     . ARG A 1 96  ? 49.810 10.623  -6.458  1.00 14.65 ? 93  ARG A C     1 
ATOM   754  O  O     . ARG A 1 96  ? 50.551 9.872   -7.115  1.00 12.52 ? 93  ARG A O     1 
ATOM   755  C  CB    . ARG A 1 96  ? 47.381 10.033  -6.262  1.00 11.16 ? 93  ARG A CB    1 
ATOM   756  C  CG    . ARG A 1 96  ? 46.346 9.152   -5.604  1.00 12.73 ? 93  ARG A CG    1 
ATOM   757  C  CD    . ARG A 1 96  ? 45.091 8.958   -6.462  1.00 12.30 ? 93  ARG A CD    1 
ATOM   758  N  NE    . ARG A 1 96  ? 44.072 8.255   -5.692  1.00 16.37 ? 93  ARG A NE    1 
ATOM   759  C  CZ    . ARG A 1 96  ? 43.041 8.850   -5.099  1.00 15.96 ? 93  ARG A CZ    1 
ATOM   760  N  NH1   . ARG A 1 96  ? 42.185 8.124   -4.380  1.00 14.23 ? 93  ARG A NH1   1 
ATOM   761  N  NH2   . ARG A 1 96  ? 42.876 10.163  -5.220  1.00 15.19 ? 93  ARG A NH2   1 
ATOM   762  N  N     . GLU A 1 97  ? 49.915 11.949  -6.503  1.00 12.16 ? 94  GLU A N     1 
ATOM   763  C  CA    . GLU A 1 97  ? 50.923 12.581  -7.350  1.00 11.29 ? 94  GLU A CA    1 
ATOM   764  C  C     . GLU A 1 97  ? 52.335 12.335  -6.799  1.00 11.74 ? 94  GLU A C     1 
ATOM   765  O  O     . GLU A 1 97  ? 53.265 12.092  -7.571  1.00 11.31 ? 94  GLU A O     1 
ATOM   766  C  CB    . GLU A 1 97  ? 50.623 14.071  -7.518  1.00 14.50 ? 94  GLU A CB    1 
ATOM   767  C  CG    . GLU A 1 97  ? 49.456 14.282  -8.468  1.00 16.83 ? 94  GLU A CG    1 
ATOM   768  C  CD    . GLU A 1 97  ? 48.979 15.718  -8.570  1.00 26.49 ? 94  GLU A CD    1 
ATOM   769  O  OE1   . GLU A 1 97  ? 49.493 16.596  -7.841  1.00 31.73 ? 94  GLU A OE1   1 
ATOM   770  O  OE2   . GLU A 1 97  ? 48.075 15.966  -9.402  1.00 24.55 ? 94  GLU A OE2   1 
ATOM   771  N  N     . ALA A 1 98  ? 52.489 12.337  -5.474  1.00 10.26 ? 95  ALA A N     1 
ATOM   772  C  CA    . ALA A 1 98  ? 53.785 12.018  -4.877  1.00 10.85 ? 95  ALA A CA    1 
ATOM   773  C  C     . ALA A 1 98  ? 54.164 10.567  -5.151  1.00 10.79 ? 95  ALA A C     1 
ATOM   774  O  O     . ALA A 1 98  ? 55.332 10.257  -5.384  1.00 10.72 ? 95  ALA A O     1 
ATOM   775  C  CB    . ALA A 1 98  ? 53.766 12.295  -3.371  1.00 8.98  ? 95  ALA A CB    1 
ATOM   776  N  N     . SER A 1 99  ? 53.167 9.687   -5.149  1.00 10.50 ? 96  SER A N     1 
ATOM   777  C  CA    . SER A 1 99  ? 53.380 8.291   -5.498  1.00 10.56 ? 96  SER A CA    1 
ATOM   778  C  C     . SER A 1 99  ? 53.945 8.168   -6.908  1.00 11.68 ? 96  SER A C     1 
ATOM   779  O  O     . SER A 1 99  ? 54.880 7.400   -7.148  1.00 10.35 ? 96  SER A O     1 
ATOM   780  C  CB    . SER A 1 99  ? 52.065 7.514   -5.402  1.00 12.01 ? 96  SER A CB    1 
ATOM   781  O  OG    . SER A 1 99  ? 52.256 6.155   -5.740  1.00 14.14 ? 96  SER A OG    1 
ATOM   782  N  N     . VAL A 1 100 ? 53.360 8.904   -7.842  1.00 10.62 ? 97  VAL A N     1 
ATOM   783  C  CA    . VAL A 1 100 ? 53.854 8.848   -9.222  1.00 11.31 ? 97  VAL A CA    1 
ATOM   784  C  C     . VAL A 1 100 ? 55.329 9.280   -9.299  1.00 11.21 ? 97  VAL A C     1 
ATOM   785  O  O     . VAL A 1 100 ? 56.127 8.680   -10.045 1.00 11.07 ? 97  VAL A O     1 
ATOM   786  C  CB    . VAL A 1 100 ? 52.977 9.711   -10.147 1.00 11.56 ? 97  VAL A CB    1 
ATOM   787  C  CG1   . VAL A 1 100 ? 53.633 9.899   -11.522 1.00 14.35 ? 97  VAL A CG1   1 
ATOM   788  C  CG2   . VAL A 1 100 ? 51.602 9.068   -10.290 1.00 13.36 ? 97  VAL A CG2   1 
ATOM   789  N  N     . GLU A 1 101 ? 55.723 10.279  -8.506  1.00 9.43  ? 98  GLU A N     1 
ATOM   790  C  CA    . GLU A 1 101 ? 57.132 10.698  -8.476  1.00 11.25 ? 98  GLU A CA    1 
ATOM   791  C  C     . GLU A 1 101 ? 58.047 9.522   -8.183  1.00 11.01 ? 98  GLU A C     1 
ATOM   792  O  O     . GLU A 1 101 ? 59.082 9.334   -8.823  1.00 12.93 ? 98  GLU A O     1 
ATOM   793  C  CB    . GLU A 1 101 ? 57.395 11.762  -7.410  1.00 10.51 ? 98  GLU A CB    1 
ATOM   794  C  CG    . GLU A 1 101 ? 56.828 13.139  -7.668  1.00 15.41 ? 98  GLU A CG    1 
ATOM   795  C  CD    . GLU A 1 101 ? 57.231 14.135  -6.584  1.00 13.76 ? 98  GLU A CD    1 
ATOM   796  O  OE1   . GLU A 1 101 ? 58.437 14.494  -6.489  1.00 13.69 ? 98  GLU A OE1   1 
ATOM   797  O  OE2   . GLU A 1 101 ? 56.331 14.562  -5.823  1.00 16.46 ? 98  GLU A OE2   1 
ATOM   798  N  N     . VAL A 1 102 ? 57.642 8.717   -7.209  1.00 9.91  ? 99  VAL A N     1 
ATOM   799  C  CA    . VAL A 1 102 ? 58.485 7.627   -6.753  1.00 9.58  ? 99  VAL A CA    1 
ATOM   800  C  C     . VAL A 1 102 ? 58.450 6.475   -7.741  1.00 10.24 ? 99  VAL A C     1 
ATOM   801  O  O     . VAL A 1 102 ? 59.494 5.901   -8.068  1.00 12.66 ? 99  VAL A O     1 
ATOM   802  C  CB    . VAL A 1 102 ? 58.059 7.120   -5.357  1.00 9.81  ? 99  VAL A CB    1 
ATOM   803  C  CG1   . VAL A 1 102 ? 58.874 5.889   -4.965  1.00 15.48 ? 99  VAL A CG1   1 
ATOM   804  C  CG2   . VAL A 1 102 ? 58.208 8.224   -4.318  1.00 11.99 ? 99  VAL A CG2   1 
ATOM   805  N  N     . MET A 1 103 ? 57.254 6.129   -8.207  1.00 9.47  ? 100 MET A N     1 
ATOM   806  C  CA    . MET A 1 103 ? 57.100 5.020   -9.143  1.00 10.34 ? 100 MET A CA    1 
ATOM   807  C  C     . MET A 1 103 ? 57.871 5.267   -10.434 1.00 12.35 ? 100 MET A C     1 
ATOM   808  O  O     . MET A 1 103 ? 58.445 4.335   -10.999 1.00 13.75 ? 100 MET A O     1 
ATOM   809  C  CB    . MET A 1 103 ? 55.627 4.779   -9.463  1.00 15.87 ? 100 MET A CB    1 
ATOM   810  C  CG    . MET A 1 103 ? 54.730 4.569   -8.255  1.00 16.74 ? 100 MET A CG    1 
ATOM   811  S  SD    . MET A 1 103 ? 55.043 2.976   -7.485  1.00 20.55 ? 100 MET A SD    1 
ATOM   812  C  CE    . MET A 1 103 ? 54.164 3.125   -5.902  1.00 14.42 ? 100 MET A CE    1 
ATOM   813  N  N     . GLU A 1 104 ? 57.900 6.514   -10.908 1.00 10.96 ? 101 GLU A N     1 
ATOM   814  C  CA    . GLU A 1 104 ? 58.616 6.782   -12.157 1.00 12.81 ? 101 GLU A CA    1 
ATOM   815  C  C     . GLU A 1 104 ? 60.138 6.636   -11.981 1.00 12.91 ? 101 GLU A C     1 
ATOM   816  O  O     . GLU A 1 104 ? 60.832 6.174   -12.900 1.00 15.07 ? 101 GLU A O     1 
ATOM   817  C  CB    . GLU A 1 104 ? 58.228 8.167   -12.709 1.00 13.24 ? 101 GLU A CB    1 
ATOM   818  C  CG    . GLU A 1 104 ? 56.779 8.179   -13.229 1.00 16.53 ? 101 GLU A CG    1 
ATOM   819  C  CD    . GLU A 1 104 ? 56.395 9.475   -13.923 1.00 25.57 ? 101 GLU A CD    1 
ATOM   820  O  OE1   . GLU A 1 104 ? 57.172 10.452  -13.837 1.00 28.00 ? 101 GLU A OE1   1 
ATOM   821  O  OE2   . GLU A 1 104 ? 55.312 9.513   -14.548 1.00 27.53 ? 101 GLU A OE2   1 
ATOM   822  N  N     . ILE A 1 105 ? 60.658 6.974   -10.806 1.00 11.12 ? 102 ILE A N     1 
ATOM   823  C  CA    . ILE A 1 105 ? 62.081 6.756   -10.530 1.00 11.95 ? 102 ILE A CA    1 
ATOM   824  C  C     . ILE A 1 105 ? 62.400 5.263   -10.467 1.00 11.10 ? 102 ILE A C     1 
ATOM   825  O  O     . ILE A 1 105 ? 63.348 4.788   -11.109 1.00 13.06 ? 102 ILE A O     1 
ATOM   826  C  CB    . ILE A 1 105 ? 62.504 7.436   -9.224  1.00 11.36 ? 102 ILE A CB    1 
ATOM   827  C  CG1   . ILE A 1 105 ? 62.387 8.957   -9.359  1.00 10.26 ? 102 ILE A CG1   1 
ATOM   828  C  CG2   . ILE A 1 105 ? 63.932 7.060   -8.863  1.00 12.32 ? 102 ILE A CG2   1 
ATOM   829  C  CD1   . ILE A 1 105 ? 62.366 9.667   -8.020  1.00 13.00 ? 102 ILE A CD1   1 
ATOM   830  N  N     . MET A 1 106 ? 61.591 4.510   -9.728  1.00 12.38 ? 103 MET A N     1 
ATOM   831  C  CA    . MET A 1 106 ? 61.804 3.063   -9.649  1.00 10.93 ? 103 MET A CA    1 
ATOM   832  C  C     . MET A 1 106 ? 61.787 2.409   -11.022 1.00 13.23 ? 103 MET A C     1 
ATOM   833  O  O     . MET A 1 106 ? 62.593 1.506   -11.296 1.00 13.48 ? 103 MET A O     1 
ATOM   834  C  CB    . MET A 1 106 ? 60.749 2.416   -8.752  1.00 12.31 ? 103 MET A CB    1 
ATOM   835  C  CG    A MET A 1 106 ? 60.766 2.858   -7.298  0.56 10.25 ? 103 MET A CG    1 
ATOM   836  C  CG    B MET A 1 106 ? 61.047 2.660   -7.276  0.44 10.30 ? 103 MET A CG    1 
ATOM   837  S  SD    A MET A 1 106 ? 59.474 1.987   -6.373  0.56 14.92 ? 103 MET A SD    1 
ATOM   838  S  SD    B MET A 1 106 ? 59.970 1.726   -6.182  0.44 14.26 ? 103 MET A SD    1 
ATOM   839  C  CE    A MET A 1 106 ? 59.926 0.280   -6.656  0.56 13.77 ? 103 MET A CE    1 
ATOM   840  C  CE    B MET A 1 106 ? 58.406 2.507   -6.558  0.44 16.50 ? 103 MET A CE    1 
ATOM   841  N  N     . SER A 1 107 ? 60.881 2.876   -11.883 1.00 11.47 ? 104 SER A N     1 
ATOM   842  C  CA    A SER A 1 107 ? 60.712 2.298   -13.213 0.23 13.39 ? 104 SER A CA    1 
ATOM   843  C  CA    B SER A 1 107 ? 60.711 2.287   -13.210 0.77 13.27 ? 104 SER A CA    1 
ATOM   844  C  C     . SER A 1 107 ? 61.964 2.444   -14.079 1.00 14.74 ? 104 SER A C     1 
ATOM   845  O  O     . SER A 1 107 ? 62.111 1.735   -15.079 1.00 17.04 ? 104 SER A O     1 
ATOM   846  C  CB    A SER A 1 107 ? 59.516 2.934   -13.929 0.23 16.96 ? 104 SER A CB    1 
ATOM   847  C  CB    B SER A 1 107 ? 59.499 2.903   -13.918 0.77 16.99 ? 104 SER A CB    1 
ATOM   848  O  OG    A SER A 1 107 ? 59.731 4.313   -14.174 0.23 16.65 ? 104 SER A OG    1 
ATOM   849  O  OG    B SER A 1 107 ? 58.290 2.469   -13.314 0.77 18.17 ? 104 SER A OG    1 
ATOM   850  N  N     . ARG A 1 108 ? 62.861 3.363   -13.710 1.00 14.14 ? 105 ARG A N     1 
ATOM   851  C  CA    . ARG A 1 108 ? 64.127 3.530   -14.451 1.00 14.78 ? 105 ARG A CA    1 
ATOM   852  C  C     . ARG A 1 108 ? 65.037 2.322   -14.264 1.00 19.31 ? 105 ARG A C     1 
ATOM   853  O  O     . ARG A 1 108 ? 65.884 2.037   -15.115 1.00 20.18 ? 105 ARG A O     1 
ATOM   854  C  CB    . ARG A 1 108 ? 64.899 4.785   -14.018 1.00 17.13 ? 105 ARG A CB    1 
ATOM   855  C  CG    . ARG A 1 108 ? 64.202 6.111   -14.252 1.00 16.11 ? 105 ARG A CG    1 
ATOM   856  C  CD    . ARG A 1 108 ? 65.193 7.256   -14.435 1.00 19.16 ? 105 ARG A CD    1 
ATOM   857  N  NE    . ARG A 1 108 ? 66.216 7.339   -13.396 1.00 22.66 ? 105 ARG A NE    1 
ATOM   858  C  CZ    . ARG A 1 108 ? 66.180 8.193   -12.376 1.00 18.05 ? 105 ARG A CZ    1 
ATOM   859  N  NH1   . ARG A 1 108 ? 67.157 8.191   -11.485 1.00 19.90 ? 105 ARG A NH1   1 
ATOM   860  N  NH2   . ARG A 1 108 ? 65.170 9.043   -12.253 1.00 17.11 ? 105 ARG A NH2   1 
ATOM   861  N  N     . PHE A 1 109 ? 64.881 1.630   -13.138 1.00 16.45 ? 106 PHE A N     1 
ATOM   862  C  CA    . PHE A 1 109 ? 65.778 0.529   -12.801 1.00 18.01 ? 106 PHE A CA    1 
ATOM   863  C  C     . PHE A 1 109 ? 65.263 -0.814  -13.291 1.00 22.25 ? 106 PHE A C     1 
ATOM   864  O  O     . PHE A 1 109 ? 66.044 -1.694  -13.679 1.00 24.77 ? 106 PHE A O     1 
ATOM   865  C  CB    . PHE A 1 109 ? 65.992 0.473   -11.293 1.00 15.71 ? 106 PHE A CB    1 
ATOM   866  C  CG    . PHE A 1 109 ? 66.737 1.648   -10.742 1.00 18.85 ? 106 PHE A CG    1 
ATOM   867  C  CD1   . PHE A 1 109 ? 66.088 2.851   -10.507 1.00 14.86 ? 106 PHE A CD1   1 
ATOM   868  C  CD2   . PHE A 1 109 ? 68.092 1.550   -10.439 1.00 16.26 ? 106 PHE A CD2   1 
ATOM   869  C  CE1   . PHE A 1 109 ? 66.767 3.936   -9.985  1.00 15.99 ? 106 PHE A CE1   1 
ATOM   870  C  CE2   . PHE A 1 109 ? 68.776 2.623   -9.913  1.00 18.38 ? 106 PHE A CE2   1 
ATOM   871  C  CZ    . PHE A 1 109 ? 68.122 3.829   -9.692  1.00 17.41 ? 106 PHE A CZ    1 
ATOM   872  N  N     . ALA A 1 110 ? 63.947 -0.976  -13.262 1.00 19.66 ? 107 ALA A N     1 
ATOM   873  C  CA    . ALA A 1 110 ? 63.340 -2.251  -13.597 1.00 21.20 ? 107 ALA A CA    1 
ATOM   874  C  C     . ALA A 1 110 ? 61.843 -2.123  -13.769 1.00 20.53 ? 107 ALA A C     1 
ATOM   875  O  O     . ALA A 1 110 ? 61.249 -1.104  -13.426 1.00 21.27 ? 107 ALA A O     1 
ATOM   876  C  CB    . ALA A 1 110 ? 63.652 -3.288  -12.525 1.00 21.69 ? 107 ALA A CB    1 
ATOM   877  N  N     . VAL A 1 111 ? 61.252 -3.176  -14.313 1.00 26.06 ? 108 VAL A N     1 
ATOM   878  C  CA    . VAL A 1 111 ? 59.811 -3.343  -14.356 1.00 30.78 ? 108 VAL A CA    1 
ATOM   879  C  C     . VAL A 1 111 ? 59.251 -3.378  -12.935 1.00 22.00 ? 108 VAL A C     1 
ATOM   880  O  O     . VAL A 1 111 ? 59.749 -4.132  -12.090 1.00 21.18 ? 108 VAL A O     1 
ATOM   881  C  CB    . VAL A 1 111 ? 59.436 -4.640  -15.097 1.00 32.93 ? 108 VAL A CB    1 
ATOM   882  C  CG1   . VAL A 1 111 ? 58.046 -5.135  -14.680 1.00 27.78 ? 108 VAL A CG1   1 
ATOM   883  C  CG2   . VAL A 1 111 ? 59.538 -4.432  -16.605 1.00 36.34 ? 108 VAL A CG2   1 
ATOM   884  N  N     . ILE A 1 112 ? 58.244 -2.548  -12.660 1.00 21.33 ? 109 ILE A N     1 
ATOM   885  C  CA    . ILE A 1 112 ? 57.630 -2.569  -11.331 1.00 17.70 ? 109 ILE A CA    1 
ATOM   886  C  C     . ILE A 1 112 ? 56.146 -2.918  -11.352 1.00 12.45 ? 109 ILE A C     1 
ATOM   887  O  O     . ILE A 1 112 ? 55.451 -2.738  -12.359 1.00 14.39 ? 109 ILE A O     1 
ATOM   888  C  CB    . ILE A 1 112 ? 57.794 -1.213  -10.583 1.00 17.89 ? 109 ILE A CB    1 
ATOM   889  C  CG1   . ILE A 1 112 ? 56.871 -0.141  -11.157 1.00 19.92 ? 109 ILE A CG1   1 
ATOM   890  C  CG2   . ILE A 1 112 ? 59.264 -0.782  -10.558 1.00 20.03 ? 109 ILE A CG2   1 
ATOM   891  C  CD1   . ILE A 1 112 ? 56.862 1.155   -10.346 1.00 18.97 ? 109 ILE A CD1   1 
ATOM   892  N  N     . GLU A 1 113 ? 55.688 -3.478  -10.237 1.00 11.97 ? 110 GLU A N     1 
ATOM   893  C  CA    . GLU A 1 113 ? 54.271 -3.700  -9.974  1.00 9.66  ? 110 GLU A CA    1 
ATOM   894  C  C     . GLU A 1 113 ? 53.810 -2.784  -8.855  1.00 10.97 ? 110 GLU A C     1 
ATOM   895  O  O     . GLU A 1 113 ? 54.226 -2.947  -7.714  1.00 12.12 ? 110 GLU A O     1 
ATOM   896  C  CB    . GLU A 1 113 ? 53.984 -5.164  -9.577  1.00 11.10 ? 110 GLU A CB    1 
ATOM   897  C  CG    . GLU A 1 113 ? 52.520 -5.406  -9.218  1.00 12.80 ? 110 GLU A CG    1 
ATOM   898  C  CD    . GLU A 1 113 ? 52.221 -6.843  -8.800  1.00 19.99 ? 110 GLU A CD    1 
ATOM   899  O  OE1   . GLU A 1 113 ? 51.115 -7.088  -8.254  1.00 23.27 ? 110 GLU A OE1   1 
ATOM   900  O  OE2   . GLU A 1 113 ? 53.076 -7.726  -9.031  1.00 15.02 ? 110 GLU A OE2   1 
ATOM   901  N  N     . ARG A 1 114 ? 52.958 -1.816  -9.177  1.00 12.89 ? 111 ARG A N     1 
ATOM   902  C  CA    . ARG A 1 114 ? 52.384 -0.938  -8.152  1.00 12.40 ? 111 ARG A CA    1 
ATOM   903  C  C     . ARG A 1 114 ? 51.482 -1.752  -7.234  1.00 14.03 ? 111 ARG A C     1 
ATOM   904  O  O     . ARG A 1 114 ? 50.451 -2.277  -7.673  1.00 19.95 ? 111 ARG A O     1 
ATOM   905  C  CB    . ARG A 1 114 ? 51.591 0.207   -8.803  1.00 11.18 ? 111 ARG A CB    1 
ATOM   906  C  CG    . ARG A 1 114 ? 50.974 1.205   -7.804  1.00 13.08 ? 111 ARG A CG    1 
ATOM   907  C  CD    . ARG A 1 114 ? 49.859 2.007   -8.472  1.00 15.40 ? 111 ARG A CD    1 
ATOM   908  N  NE    . ARG A 1 114 ? 49.480 3.208   -7.729  1.00 17.91 ? 111 ARG A NE    1 
ATOM   909  C  CZ    . ARG A 1 114 ? 48.543 3.260   -6.784  1.00 19.01 ? 111 ARG A CZ    1 
ATOM   910  N  NH1   . ARG A 1 114 ? 47.869 2.170   -6.425  1.00 21.31 ? 111 ARG A NH1   1 
ATOM   911  N  NH2   . ARG A 1 114 ? 48.290 4.419   -6.186  1.00 17.39 ? 111 ARG A NH2   1 
ATOM   912  N  N     . ALA A 1 115 ? 51.854 -1.866  -5.962  1.00 10.20 ? 112 ALA A N     1 
ATOM   913  C  CA    . ALA A 1 115 ? 51.106 -2.702  -5.030  1.00 9.40  ? 112 ALA A CA    1 
ATOM   914  C  C     . ALA A 1 115 ? 50.219 -1.903  -4.076  1.00 11.51 ? 112 ALA A C     1 
ATOM   915  O  O     . ALA A 1 115 ? 49.285 -2.453  -3.475  1.00 14.73 ? 112 ALA A O     1 
ATOM   916  C  CB    . ALA A 1 115 ? 52.060 -3.577  -4.229  1.00 12.01 ? 112 ALA A CB    1 
ATOM   917  N  N     . SER A 1 116 ? 50.543 -0.626  -3.919  1.00 10.52 ? 113 SER A N     1 
ATOM   918  C  CA    . SER A 1 116 ? 49.741 0.303   -3.131  1.00 11.80 ? 113 SER A CA    1 
ATOM   919  C  C     . SER A 1 116 ? 50.150 1.717   -3.512  1.00 9.77  ? 113 SER A C     1 
ATOM   920  O  O     . SER A 1 116 ? 51.026 1.914   -4.344  1.00 10.87 ? 113 SER A O     1 
ATOM   921  C  CB    . SER A 1 116 ? 49.936 0.103   -1.627  1.00 11.35 ? 113 SER A CB    1 
ATOM   922  O  OG    . SER A 1 116 ? 51.127 0.740   -1.181  1.00 13.14 ? 113 SER A OG    1 
ATOM   923  N  N     . ILE A 1 117 ? 49.553 2.711   -2.863  1.00 10.14 ? 114 ILE A N     1 
ATOM   924  C  CA    . ILE A 1 117 ? 49.938 4.079   -3.139  1.00 9.11  ? 114 ILE A CA    1 
ATOM   925  C  C     . ILE A 1 117 ? 51.414 4.337   -2.760  1.00 9.76  ? 114 ILE A C     1 
ATOM   926  O  O     . ILE A 1 117 ? 52.031 5.270   -3.264  1.00 11.24 ? 114 ILE A O     1 
ATOM   927  C  CB    . ILE A 1 117 ? 48.994 5.065   -2.393  1.00 9.20  ? 114 ILE A CB    1 
ATOM   928  C  CG1   . ILE A 1 117 ? 49.087 6.463   -3.000  1.00 10.98 ? 114 ILE A CG1   1 
ATOM   929  C  CG2   . ILE A 1 117 ? 49.293 5.067   -0.894  1.00 10.80 ? 114 ILE A CG2   1 
ATOM   930  C  CD1   . ILE A 1 117 ? 47.948 7.390   -2.544  1.00 11.21 ? 114 ILE A CD1   1 
ATOM   931  N  N     . ASP A 1 118 ? 51.989 3.516   -1.877  1.00 8.81  ? 115 ASP A N     1 
ATOM   932  C  CA    . ASP A 1 118 ? 53.349 3.825   -1.436  1.00 9.71  ? 115 ASP A CA    1 
ATOM   933  C  C     . ASP A 1 118 ? 54.341 2.669   -1.573  1.00 10.84 ? 115 ASP A C     1 
ATOM   934  O  O     . ASP A 1 118 ? 55.411 2.704   -0.959  1.00 10.64 ? 115 ASP A O     1 
ATOM   935  C  CB    . ASP A 1 118 ? 53.347 4.319   0.019   1.00 9.50  ? 115 ASP A CB    1 
ATOM   936  C  CG    . ASP A 1 118 ? 53.501 3.192   1.045   1.00 9.66  ? 115 ASP A CG    1 
ATOM   937  O  OD1   . ASP A 1 118 ? 52.905 2.091   0.905   1.00 10.59 ? 115 ASP A OD1   1 
ATOM   938  O  OD2   . ASP A 1 118 ? 54.309 3.414   1.986   1.00 10.86 ? 115 ASP A OD2   1 
ATOM   939  N  N     . GLU A 1 119 ? 54.007 1.652   -2.368  1.00 9.37  ? 116 GLU A N     1 
ATOM   940  C  CA    . GLU A 1 119 ? 54.951 0.553   -2.537  1.00 10.34 ? 116 GLU A CA    1 
ATOM   941  C  C     . GLU A 1 119 ? 54.826 -0.159  -3.859  1.00 9.92  ? 116 GLU A C     1 
ATOM   942  O  O     . GLU A 1 119 ? 53.760 -0.172  -4.487  1.00 10.63 ? 116 GLU A O     1 
ATOM   943  C  CB    . GLU A 1 119 ? 54.803 -0.468  -1.410  1.00 10.87 ? 116 GLU A CB    1 
ATOM   944  C  CG    . GLU A 1 119 ? 53.585 -1.369  -1.520  1.00 11.57 ? 116 GLU A CG    1 
ATOM   945  C  CD    . GLU A 1 119 ? 53.120 -1.810  -0.150  1.00 14.87 ? 116 GLU A CD    1 
ATOM   946  O  OE1   . GLU A 1 119 ? 53.419 -2.951  0.256   1.00 15.12 ? 116 GLU A OE1   1 
ATOM   947  O  OE2   . GLU A 1 119 ? 52.484 -0.989  0.542   1.00 12.30 ? 116 GLU A OE2   1 
ATOM   948  N  N     . ALA A 1 120 ? 55.950 -0.716  -4.296  1.00 10.17 ? 117 ALA A N     1 
ATOM   949  C  CA    . ALA A 1 120 ? 55.995 -1.453  -5.537  1.00 9.23  ? 117 ALA A CA    1 
ATOM   950  C  C     . ALA A 1 120 ? 56.974 -2.605  -5.437  1.00 11.41 ? 117 ALA A C     1 
ATOM   951  O  O     . ALA A 1 120 ? 58.015 -2.503  -4.770  1.00 10.75 ? 117 ALA A O     1 
ATOM   952  C  CB    . ALA A 1 120 ? 56.379 -0.541  -6.698  1.00 11.31 ? 117 ALA A CB    1 
ATOM   953  N  N     . TYR A 1 121 ? 56.630 -3.697  -6.108  1.00 9.95  ? 118 TYR A N     1 
ATOM   954  C  CA    . TYR A 1 121 ? 57.574 -4.796  -6.299  1.00 9.82  ? 118 TYR A CA    1 
ATOM   955  C  C     . TYR A 1 121 ? 58.427 -4.553  -7.512  1.00 11.70 ? 118 TYR A C     1 
ATOM   956  O  O     . TYR A 1 121 ? 57.977 -3.967  -8.502  1.00 13.33 ? 118 TYR A O     1 
ATOM   957  C  CB    . TYR A 1 121 ? 56.844 -6.131  -6.439  1.00 8.86  ? 118 TYR A CB    1 
ATOM   958  C  CG    . TYR A 1 121 ? 56.114 -6.515  -5.185  1.00 10.15 ? 118 TYR A CG    1 
ATOM   959  C  CD1   . TYR A 1 121 ? 54.776 -6.175  -5.004  1.00 10.39 ? 118 TYR A CD1   1 
ATOM   960  C  CD2   . TYR A 1 121 ? 56.764 -7.197  -4.173  1.00 11.34 ? 118 TYR A CD2   1 
ATOM   961  C  CE1   . TYR A 1 121 ? 54.102 -6.514  -3.839  1.00 13.62 ? 118 TYR A CE1   1 
ATOM   962  C  CE2   . TYR A 1 121 ? 56.099 -7.555  -3.009  1.00 12.72 ? 118 TYR A CE2   1 
ATOM   963  C  CZ    . TYR A 1 121 ? 54.776 -7.201  -2.844  1.00 13.81 ? 118 TYR A CZ    1 
ATOM   964  O  OH    . TYR A 1 121 ? 54.107 -7.552  -1.691  1.00 15.09 ? 118 TYR A OH    1 
ATOM   965  N  N     . VAL A 1 122 ? 59.651 -5.059  -7.441  1.00 10.62 ? 119 VAL A N     1 
ATOM   966  C  CA    . VAL A 1 122 ? 60.664 -4.889  -8.462  1.00 14.73 ? 119 VAL A CA    1 
ATOM   967  C  C     . VAL A 1 122 ? 61.169 -6.266  -8.845  1.00 17.12 ? 119 VAL A C     1 
ATOM   968  O  O     . VAL A 1 122 ? 61.568 -7.021  -7.975  1.00 12.17 ? 119 VAL A O     1 
ATOM   969  C  CB    . VAL A 1 122 ? 61.853 -4.041  -7.921  1.00 15.13 ? 119 VAL A CB    1 
ATOM   970  C  CG1   . VAL A 1 122 ? 62.634 -3.444  -9.051  1.00 23.54 ? 119 VAL A CG1   1 
ATOM   971  C  CG2   . VAL A 1 122 ? 61.342 -2.954  -6.985  1.00 19.26 ? 119 VAL A CG2   1 
ATOM   972  N  N     . ASP A 1 123 ? 61.164 -6.607  -10.128 1.00 16.28 ? 120 ASP A N     1 
ATOM   973  C  CA    . ASP A 1 123 ? 61.798 -7.842  -10.568 1.00 14.15 ? 120 ASP A CA    1 
ATOM   974  C  C     . ASP A 1 123 ? 63.204 -7.538  -11.043 1.00 16.74 ? 120 ASP A C     1 
ATOM   975  O  O     . ASP A 1 123 ? 63.387 -6.999  -12.131 1.00 17.33 ? 120 ASP A O     1 
ATOM   976  C  CB    . ASP A 1 123 ? 60.989 -8.503  -11.678 1.00 23.77 ? 120 ASP A CB    1 
ATOM   977  C  CG    . ASP A 1 123 ? 61.426 -9.919  -11.946 1.00 25.02 ? 120 ASP A CG    1 
ATOM   978  O  OD1   . ASP A 1 123 ? 62.647 -10.194 -11.969 1.00 17.56 ? 120 ASP A OD1   1 
ATOM   979  O  OD2   . ASP A 1 123 ? 60.537 -10.778 -12.128 1.00 38.89 ? 120 ASP A OD2   1 
ATOM   980  N  N     . LEU A 1 124 ? 64.193 -7.875  -10.219 1.00 13.30 ? 121 LEU A N     1 
ATOM   981  C  CA    . LEU A 1 124 ? 65.580 -7.475  -10.461 1.00 13.81 ? 121 LEU A CA    1 
ATOM   982  C  C     . LEU A 1 124 ? 66.448 -8.554  -11.097 1.00 12.40 ? 121 LEU A C     1 
ATOM   983  O  O     . LEU A 1 124 ? 67.660 -8.366  -11.233 1.00 13.16 ? 121 LEU A O     1 
ATOM   984  C  CB    . LEU A 1 124 ? 66.230 -7.044  -9.142  1.00 15.05 ? 121 LEU A CB    1 
ATOM   985  C  CG    . LEU A 1 124 ? 65.692 -5.774  -8.489  1.00 14.71 ? 121 LEU A CG    1 
ATOM   986  C  CD1   . LEU A 1 124 ? 66.186 -5.671  -7.063  1.00 18.45 ? 121 LEU A CD1   1 
ATOM   987  C  CD2   . LEU A 1 124 ? 66.112 -4.552  -9.301  1.00 20.06 ? 121 LEU A CD2   1 
ATOM   988  N  N     . THR A 1 125 ? 65.838 -9.677  -11.456 1.00 12.92 ? 122 THR A N     1 
ATOM   989  C  CA    . THR A 1 125 ? 66.600 -10.814 -11.960 1.00 12.87 ? 122 THR A CA    1 
ATOM   990  C  C     . THR A 1 125 ? 67.524 -10.430 -13.124 1.00 12.71 ? 122 THR A C     1 
ATOM   991  O  O     . THR A 1 125 ? 68.723 -10.717 -13.082 1.00 15.99 ? 122 THR A O     1 
ATOM   992  C  CB    . THR A 1 125 ? 65.669 -11.931 -12.383 1.00 15.99 ? 122 THR A CB    1 
ATOM   993  O  OG1   . THR A 1 125 ? 64.784 -12.238 -11.295 1.00 13.83 ? 122 THR A OG1   1 
ATOM   994  C  CG2   . THR A 1 125 ? 66.466 -13.168 -12.762 1.00 17.65 ? 122 THR A CG2   1 
ATOM   995  N  N     . SER A 1 126 ? 66.972 -9.762  -14.134 1.00 16.39 ? 123 SER A N     1 
ATOM   996  C  CA    . SER A 1 126 ? 67.766 -9.376  -15.303 1.00 16.34 ? 123 SER A CA    1 
ATOM   997  C  C     . SER A 1 126 ? 68.818 -8.311  -14.972 1.00 16.88 ? 123 SER A C     1 
ATOM   998  O  O     . SER A 1 126 ? 69.961 -8.411  -15.416 1.00 19.60 ? 123 SER A O     1 
ATOM   999  C  CB    . SER A 1 126 ? 66.851 -8.882  -16.422 1.00 20.37 ? 123 SER A CB    1 
ATOM   1000 O  OG    A SER A 1 126 ? 66.044 -9.925  -16.927 0.43 22.03 ? 123 SER A OG    1 
ATOM   1001 O  OG    B SER A 1 126 ? 66.026 -7.825  -15.982 0.57 20.70 ? 123 SER A OG    1 
ATOM   1002 N  N     . ALA A 1 127 ? 68.440 -7.308  -14.182 1.00 16.16 ? 124 ALA A N     1 
ATOM   1003 C  CA    . ALA A 1 127 ? 69.389 -6.267  -13.788 1.00 17.54 ? 124 ALA A CA    1 
ATOM   1004 C  C     . ALA A 1 127 ? 70.555 -6.858  -13.001 1.00 16.97 ? 124 ALA A C     1 
ATOM   1005 O  O     . ALA A 1 127 ? 71.689 -6.396  -13.115 1.00 17.68 ? 124 ALA A O     1 
ATOM   1006 C  CB    . ALA A 1 127 ? 68.693 -5.172  -12.964 1.00 15.40 ? 124 ALA A CB    1 
ATOM   1007 N  N     . VAL A 1 128 ? 70.269 -7.882  -12.196 1.00 14.64 ? 125 VAL A N     1 
ATOM   1008 C  CA    . VAL A 1 128 ? 71.310 -8.526  -11.417 1.00 15.20 ? 125 VAL A CA    1 
ATOM   1009 C  C     . VAL A 1 128 ? 72.291 -9.269  -12.324 1.00 18.19 ? 125 VAL A C     1 
ATOM   1010 O  O     . VAL A 1 128 ? 73.508 -9.196  -12.120 1.00 18.50 ? 125 VAL A O     1 
ATOM   1011 C  CB    . VAL A 1 128 ? 70.698 -9.496  -10.381 1.00 14.55 ? 125 VAL A CB    1 
ATOM   1012 C  CG1   . VAL A 1 128 ? 71.723 -10.556 -9.963  1.00 18.95 ? 125 VAL A CG1   1 
ATOM   1013 C  CG2   . VAL A 1 128 ? 70.196 -8.712  -9.187  1.00 15.59 ? 125 VAL A CG2   1 
ATOM   1014 N  N     . GLN A 1 129 ? 71.824 -9.913  -13.263 1.00 16.78 ? 126 GLN A N     1 
ATOM   1015 C  CA    . GLN A 1 129 ? 72.663 -10.593 -14.247 1.00 26.38 ? 126 GLN A CA    1 
ATOM   1016 C  C     . GLN A 1 129 ? 73.568 -9.597  -14.963 1.00 25.67 ? 126 GLN A C     1 
ATOM   1017 O  O     . GLN A 1 129 ? 74.754 -9.854  -15.159 1.00 27.16 ? 126 GLN A O     1 
ATOM   1018 C  CB    . GLN A 1 129 ? 71.808 -11.354 -15.260 1.00 21.43 ? 126 GLN A CB    1 
ATOM   1019 C  CG    . GLN A 1 129 ? 71.037 -12.514 -14.652 1.00 31.69 ? 126 GLN A CG    1 
ATOM   1020 C  CD    . GLN A 1 129 ? 71.948 -13.557 -14.019 1.00 39.54 ? 126 GLN A CD    1 
ATOM   1021 O  OE1   . GLN A 1 129 ? 73.006 -13.883 -14.559 1.00 49.52 ? 126 GLN A OE1   1 
ATOM   1022 N  NE2   . GLN A 1 129 ? 71.550 -14.064 -12.857 1.00 37.98 ? 126 GLN A NE2   1 
ATOM   1023 N  N     . GLU A 1 130 ? 73.038 -8.544  -15.364 1.00 23.35 ? 127 GLU A N     1 
ATOM   1024 C  CA    . GLU A 1 130 ? 73.872 -7.559  -16.041 1.00 28.83 ? 127 GLU A CA    1 
ATOM   1025 C  C     . GLU A 1 130 ? 74.950 -6.982  -15.130 1.00 32.42 ? 127 GLU A C     1 
ATOM   1026 O  O     . GLU A 1 130 ? 76.107 -6.850  -15.535 1.00 28.22 ? 127 GLU A O     1 
ATOM   1027 C  CB    . GLU A 1 130 ? 73.011 -6.438  -16.620 1.00 27.48 ? 127 GLU A CB    1 
ATOM   1028 C  CG    . GLU A 1 130 ? 71.900 -6.952  -17.507 1.00 32.42 ? 127 GLU A CG    1 
ATOM   1029 C  CD    . GLU A 1 130 ? 71.481 -5.949  -18.560 1.00 59.79 ? 127 GLU A CD    1 
ATOM   1030 O  OE1   . GLU A 1 130 ? 71.996 -4.808  -18.537 1.00 55.68 ? 127 GLU A OE1   1 
ATOM   1031 O  OE2   . GLU A 1 130 ? 70.640 -6.307  -19.415 1.00 63.30 ? 127 GLU A OE2   1 
ATOM   1032 N  N     . ARG A 1 131 ? 74.584 -6.646  -13.898 1.00 22.17 ? 128 ARG A N     1 
ATOM   1033 C  CA    . ARG A 1 131 ? 75.560 -6.079  -12.978 1.00 26.81 ? 128 ARG A CA    1 
ATOM   1034 C  C     . ARG A 1 131 ? 76.649 -7.103  -12.673 1.00 29.37 ? 128 ARG A C     1 
ATOM   1035 O  O     . ARG A 1 131 ? 77.822 -6.748  -12.565 1.00 27.64 ? 128 ARG A O     1 
ATOM   1036 C  CB    . ARG A 1 131 ? 74.895 -5.601  -11.685 1.00 20.39 ? 128 ARG A CB    1 
ATOM   1037 C  CG    . ARG A 1 131 ? 75.873 -4.988  -10.692 1.00 26.12 ? 128 ARG A CG    1 
ATOM   1038 C  CD    . ARG A 1 131 ? 76.424 -3.671  -11.217 1.00 22.49 ? 128 ARG A CD    1 
ATOM   1039 N  NE    . ARG A 1 131 ? 75.325 -2.739  -11.403 1.00 33.90 ? 128 ARG A NE    1 
ATOM   1040 C  CZ    . ARG A 1 131 ? 74.910 -1.903  -10.459 1.00 25.85 ? 128 ARG A CZ    1 
ATOM   1041 N  NH1   . ARG A 1 131 ? 75.531 -1.878  -9.290  1.00 24.46 ? 128 ARG A NH1   1 
ATOM   1042 N  NH2   . ARG A 1 131 ? 73.894 -1.085  -10.691 1.00 38.98 ? 128 ARG A NH2   1 
ATOM   1043 N  N     . LEU A 1 132 ? 76.258 -8.370  -12.561 1.00 22.42 ? 129 LEU A N     1 
ATOM   1044 C  CA    . LEU A 1 132 ? 77.206 -9.460  -12.293 1.00 23.47 ? 129 LEU A CA    1 
ATOM   1045 C  C     . LEU A 1 132 ? 78.284 -9.581  -13.367 1.00 35.05 ? 129 LEU A C     1 
ATOM   1046 O  O     . LEU A 1 132 ? 79.423 -9.947  -13.074 1.00 36.30 ? 129 LEU A O     1 
ATOM   1047 C  CB    . LEU A 1 132 ? 76.469 -10.797 -12.151 1.00 28.07 ? 129 LEU A CB    1 
ATOM   1048 C  CG    . LEU A 1 132 ? 76.000 -11.127 -10.727 1.00 21.48 ? 129 LEU A CG    1 
ATOM   1049 C  CD1   . LEU A 1 132 ? 75.059 -12.324 -10.679 1.00 22.65 ? 129 LEU A CD1   1 
ATOM   1050 C  CD2   . LEU A 1 132 ? 77.208 -11.358 -9.827  1.00 24.38 ? 129 LEU A CD2   1 
ATOM   1051 N  N     . GLN A 1 133 ? 77.930 -9.274  -14.611 1.00 34.34 ? 130 GLN A N     1 
ATOM   1052 C  CA    . GLN A 1 133 ? 78.894 -9.396  -15.696 1.00 36.64 ? 130 GLN A CA    1 
ATOM   1053 C  C     . GLN A 1 133 ? 79.791 -8.157  -15.759 1.00 42.54 ? 130 GLN A C     1 
ATOM   1054 O  O     . GLN A 1 133 ? 80.984 -8.272  -16.044 1.00 50.10 ? 130 GLN A O     1 
ATOM   1055 C  CB    . GLN A 1 133 ? 78.191 -9.619  -17.035 1.00 41.80 ? 130 GLN A CB    1 
ATOM   1056 C  CG    . GLN A 1 133 ? 79.151 -9.711  -18.218 1.00 55.10 ? 130 GLN A CG    1 
ATOM   1057 C  CD    . GLN A 1 133 ? 78.833 -8.729  -19.329 1.00 63.69 ? 130 GLN A CD    1 
ATOM   1058 O  OE1   . GLN A 1 133 ? 78.282 -7.654  -19.088 1.00 68.36 ? 130 GLN A OE1   1 
ATOM   1059 N  NE2   . GLN A 1 133 ? 79.198 -9.088  -20.557 1.00 61.65 ? 130 GLN A NE2   1 
ATOM   1060 N  N     . LYS A 1 134 ? 79.241 -6.977  -15.475 1.00 39.65 ? 131 LYS A N     1 
ATOM   1061 C  CA    . LYS A 1 134 ? 80.097 -5.800  -15.343 1.00 45.78 ? 131 LYS A CA    1 
ATOM   1062 C  C     . LYS A 1 134 ? 81.036 -6.004  -14.157 1.00 50.27 ? 131 LYS A C     1 
ATOM   1063 O  O     . LYS A 1 134 ? 82.142 -5.449  -14.130 1.00 54.33 ? 131 LYS A O     1 
ATOM   1064 C  CB    . LYS A 1 134 ? 79.297 -4.505  -15.147 1.00 43.70 ? 131 LYS A CB    1 
ATOM   1065 C  CG    . LYS A 1 134 ? 78.238 -4.205  -16.196 1.00 47.26 ? 131 LYS A CG    1 
ATOM   1066 C  CD    . LYS A 1 134 ? 77.742 -2.758  -16.076 1.00 49.70 ? 131 LYS A CD    1 
ATOM   1067 C  CE    . LYS A 1 134 ? 77.439 -2.353  -14.640 1.00 45.02 ? 131 LYS A CE    1 
ATOM   1068 N  NZ    . LYS A 1 134 ? 75.986 -2.075  -14.455 1.00 50.44 ? 131 LYS A NZ    1 
ATOM   1069 N  N     . LEU A 1 135 ? 80.597 -6.803  -13.183 1.00 44.24 ? 132 LEU A N     1 
ATOM   1070 C  CA    . LEU A 1 135 ? 81.382 -7.025  -11.971 1.00 48.59 ? 132 LEU A CA    1 
ATOM   1071 C  C     . LEU A 1 135 ? 82.572 -7.950  -12.190 1.00 54.75 ? 132 LEU A C     1 
ATOM   1072 O  O     . LEU A 1 135 ? 83.465 -7.977  -11.381 1.00 57.55 ? 132 LEU A O     1 
ATOM   1073 C  CB    . LEU A 1 135 ? 80.515 -7.581  -10.836 1.00 47.44 ? 132 LEU A CB    1 
ATOM   1074 C  CG    . LEU A 1 135 ? 79.649 -6.607  -10.040 1.00 47.99 ? 132 LEU A CG    1 
ATOM   1075 C  CD1   . LEU A 1 135 ? 78.984 -7.345  -8.881  1.00 43.44 ? 132 LEU A CD1   1 
ATOM   1076 C  CD2   . LEU A 1 135 ? 80.477 -5.423  -9.563  1.00 48.04 ? 132 LEU A CD2   1 
ATOM   1077 N  N     . GLN A 1 136 ? 82.579 -8.716  -13.273 1.00 53.39 ? 133 GLN A N     1 
ATOM   1078 C  CA    . GLN A 1 136 ? 83.766 -9.473  -13.676 1.00 60.14 ? 133 GLN A CA    1 
ATOM   1079 C  C     . GLN A 1 136 ? 84.332 -10.346 -12.554 1.00 56.86 ? 133 GLN A C     1 
ATOM   1080 O  O     . GLN A 1 136 ? 85.547 -10.531 -12.457 1.00 56.91 ? 133 GLN A O     1 
ATOM   1081 C  CB    . GLN A 1 136 ? 84.846 -8.499  -14.153 1.00 57.82 ? 133 GLN A CB    1 
ATOM   1082 C  CG    . GLN A 1 136 ? 84.451 -7.581  -15.284 1.00 59.28 ? 133 GLN A CG    1 
ATOM   1083 C  CD    . GLN A 1 136 ? 85.444 -6.444  -15.441 1.00 73.65 ? 133 GLN A CD    1 
ATOM   1084 O  OE1   . GLN A 1 136 ? 86.610 -6.565  -15.057 1.00 74.04 ? 133 GLN A OE1   1 
ATOM   1085 N  NE2   . GLN A 1 136 ? 84.972 -5.311  -15.955 1.00 69.97 ? 133 GLN A NE2   1 
ATOM   1086 N  N     . GLY A 1 137 ? 83.457 -10.793 -11.659 1.00 53.65 ? 134 GLY A N     1 
ATOM   1087 C  CA    . GLY A 1 137 ? 83.872 -11.601 -10.528 1.00 48.21 ? 134 GLY A CA    1 
ATOM   1088 C  C     . GLY A 1 137 ? 84.611 -10.922 -9.373  1.00 51.76 ? 134 GLY A C     1 
ATOM   1089 O  O     . GLY A 1 137 ? 85.276 -11.618 -8.603  1.00 49.98 ? 134 GLY A O     1 
ATOM   1090 N  N     . GLN A 1 138 ? 84.512 -9.598  -9.225  1.00 48.53 ? 135 GLN A N     1 
ATOM   1091 C  CA    . GLN A 1 138 ? 85.131 -8.928  -8.075  1.00 49.68 ? 135 GLN A CA    1 
ATOM   1092 C  C     . GLN A 1 138 ? 84.241 -9.058  -6.843  1.00 46.04 ? 135 GLN A C     1 
ATOM   1093 O  O     . GLN A 1 138 ? 83.025 -9.220  -6.969  1.00 43.86 ? 135 GLN A O     1 
ATOM   1094 C  CB    . GLN A 1 138 ? 85.388 -7.446  -8.338  1.00 49.06 ? 135 GLN A CB    1 
ATOM   1095 C  CG    . GLN A 1 138 ? 84.198 -6.706  -8.865  1.00 55.35 ? 135 GLN A CG    1 
ATOM   1096 C  CD    . GLN A 1 138 ? 84.553 -5.709  -9.949  1.00 66.83 ? 135 GLN A CD    1 
ATOM   1097 O  OE1   . GLN A 1 138 ? 85.513 -5.894  -10.701 1.00 64.54 ? 135 GLN A OE1   1 
ATOM   1098 N  NE2   . GLN A 1 138 ? 83.741 -4.661  -10.065 1.00 70.44 ? 135 GLN A NE2   1 
ATOM   1099 N  N     . PRO A 1 139 ? 84.841 -8.982  -5.643  1.00 46.32 ? 136 PRO A N     1 
ATOM   1100 C  CA    . PRO A 1 139 ? 84.040 -9.070  -4.420  1.00 38.89 ? 136 PRO A CA    1 
ATOM   1101 C  C     . PRO A 1 139 ? 83.157 -7.844  -4.245  1.00 37.58 ? 136 PRO A C     1 
ATOM   1102 O  O     . PRO A 1 139 ? 83.427 -6.788  -4.816  1.00 36.73 ? 136 PRO A O     1 
ATOM   1103 C  CB    . PRO A 1 139 ? 85.095 -9.152  -3.312  1.00 42.95 ? 136 PRO A CB    1 
ATOM   1104 C  CG    . PRO A 1 139 ? 86.296 -8.499  -3.892  1.00 45.93 ? 136 PRO A CG    1 
ATOM   1105 C  CD    . PRO A 1 139 ? 86.278 -8.851  -5.348  1.00 48.13 ? 136 PRO A CD    1 
ATOM   1106 N  N     . ILE A 1 140 ? 82.092 -7.999  -3.473  1.00 33.48 ? 137 ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 140 ? 81.209 -6.891  -3.171  1.00 26.56 ? 137 ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 140 ? 81.615 -6.286  -1.837  1.00 23.90 ? 137 ILE A C     1 
ATOM   1109 O  O     . ILE A 1 140 ? 81.634 -6.967  -0.814  1.00 26.30 ? 137 ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 140 ? 79.746 -7.346  -3.142  1.00 29.95 ? 137 ILE A CB    1 
ATOM   1111 C  CG1   . ILE A 1 140 ? 79.370 -7.921  -4.512  1.00 33.07 ? 137 ILE A CG1   1 
ATOM   1112 C  CG2   . ILE A 1 140 ? 78.840 -6.190  -2.764  1.00 23.41 ? 137 ILE A CG2   1 
ATOM   1113 C  CD1   . ILE A 1 140 ? 77.999 -8.529  -4.578  1.00 31.05 ? 137 ILE A CD1   1 
ATOM   1114 N  N     . SER A 1 141 ? 81.961 -5.005  -1.859  1.00 22.62 ? 138 SER A N     1 
ATOM   1115 C  CA    . SER A 1 141 ? 82.405 -4.310  -0.655  1.00 22.67 ? 138 SER A CA    1 
ATOM   1116 C  C     . SER A 1 141 ? 81.215 -3.960  0.237   1.00 20.44 ? 138 SER A C     1 
ATOM   1117 O  O     . SER A 1 141 ? 80.130 -3.659  -0.267  1.00 19.77 ? 138 SER A O     1 
ATOM   1118 C  CB    . SER A 1 141 ? 83.181 -3.043  -1.034  1.00 22.86 ? 138 SER A CB    1 
ATOM   1119 O  OG    . SER A 1 141 ? 83.144 -2.075  0.002   1.00 30.62 ? 138 SER A OG    1 
ATOM   1120 N  N     . ALA A 1 142 ? 81.419 -3.995  1.550   1.00 18.12 ? 139 ALA A N     1 
ATOM   1121 C  CA    . ALA A 1 142 ? 80.389 -3.572  2.492   1.00 19.13 ? 139 ALA A CA    1 
ATOM   1122 C  C     . ALA A 1 142 ? 79.964 -2.131  2.216   1.00 21.93 ? 139 ALA A C     1 
ATOM   1123 O  O     . ALA A 1 142 ? 78.837 -1.736  2.523   1.00 18.57 ? 139 ALA A O     1 
ATOM   1124 C  CB    . ALA A 1 142 ? 80.875 -3.717  3.927   1.00 21.31 ? 139 ALA A CB    1 
ATOM   1125 N  N     . ASP A 1 143 ? 80.862 -1.350  1.622   1.00 20.01 ? 140 ASP A N     1 
ATOM   1126 C  CA    . ASP A 1 143 ? 80.573 0.057   1.361   1.00 23.55 ? 140 ASP A CA    1 
ATOM   1127 C  C     . ASP A 1 143 ? 79.434 0.225   0.368   1.00 22.94 ? 140 ASP A C     1 
ATOM   1128 O  O     . ASP A 1 143 ? 78.802 1.283   0.319   1.00 22.48 ? 140 ASP A O     1 
ATOM   1129 C  CB    . ASP A 1 143 ? 81.816 0.778   0.843   1.00 21.32 ? 140 ASP A CB    1 
ATOM   1130 C  CG    . ASP A 1 143 ? 82.921 0.839   1.878   1.00 38.07 ? 140 ASP A CG    1 
ATOM   1131 O  OD1   . ASP A 1 143 ? 82.618 0.692   3.082   1.00 35.59 ? 140 ASP A OD1   1 
ATOM   1132 O  OD2   . ASP A 1 143 ? 84.091 1.043   1.487   1.00 46.71 ? 140 ASP A OD2   1 
ATOM   1133 N  N     . LEU A 1 144 ? 79.174 -0.818  -0.416  1.00 16.66 ? 141 LEU A N     1 
ATOM   1134 C  CA    . LEU A 1 144 ? 78.088 -0.788  -1.390  1.00 17.14 ? 141 LEU A CA    1 
ATOM   1135 C  C     . LEU A 1 144 ? 76.738 -1.109  -0.757  1.00 15.92 ? 141 LEU A C     1 
ATOM   1136 O  O     . LEU A 1 144 ? 75.709 -0.962  -1.406  1.00 16.48 ? 141 LEU A O     1 
ATOM   1137 C  CB    . LEU A 1 144 ? 78.349 -1.768  -2.524  1.00 16.89 ? 141 LEU A CB    1 
ATOM   1138 C  CG    . LEU A 1 144 ? 79.579 -1.487  -3.384  1.00 18.32 ? 141 LEU A CG    1 
ATOM   1139 C  CD1   . LEU A 1 144 ? 79.697 -2.555  -4.457  1.00 23.59 ? 141 LEU A CD1   1 
ATOM   1140 C  CD2   . LEU A 1 144 ? 79.494 -0.095  -3.992  1.00 22.74 ? 141 LEU A CD2   1 
ATOM   1141 N  N     . LEU A 1 145 ? 76.751 -1.540  0.503   1.00 12.73 ? 142 LEU A N     1 
ATOM   1142 C  CA    . LEU A 1 145 ? 75.529 -1.927  1.209   1.00 15.14 ? 142 LEU A CA    1 
ATOM   1143 C  C     . LEU A 1 145 ? 75.380 -1.199  2.551   1.00 13.35 ? 142 LEU A C     1 
ATOM   1144 O  O     . LEU A 1 145 ? 75.225 -1.819  3.600   1.00 14.39 ? 142 LEU A O     1 
ATOM   1145 C  CB    . LEU A 1 145 ? 75.522 -3.451  1.417   1.00 13.20 ? 142 LEU A CB    1 
ATOM   1146 C  CG    . LEU A 1 145 ? 75.467 -4.293  0.143   1.00 13.87 ? 142 LEU A CG    1 
ATOM   1147 C  CD1   . LEU A 1 145 ? 75.884 -5.740  0.428   1.00 14.47 ? 142 LEU A CD1   1 
ATOM   1148 C  CD2   . LEU A 1 145 ? 74.079 -4.274  -0.472  1.00 16.02 ? 142 LEU A CD2   1 
ATOM   1149 N  N     . PRO A 1 146 ? 75.394 0.140   2.520   1.00 15.73 ? 143 PRO A N     1 
ATOM   1150 C  CA    . PRO A 1 146 ? 75.477 0.924   3.759   1.00 14.41 ? 143 PRO A CA    1 
ATOM   1151 C  C     . PRO A 1 146 ? 74.215 0.941   4.610   1.00 13.46 ? 143 PRO A C     1 
ATOM   1152 O  O     . PRO A 1 146 ? 74.280 1.402   5.748   1.00 16.12 ? 143 PRO A O     1 
ATOM   1153 C  CB    . PRO A 1 146 ? 75.781 2.338   3.246   1.00 17.90 ? 143 PRO A CB    1 
ATOM   1154 C  CG    . PRO A 1 146 ? 75.142 2.371   1.893   1.00 16.69 ? 143 PRO A CG    1 
ATOM   1155 C  CD    . PRO A 1 146 ? 75.399 1.000   1.323   1.00 14.44 ? 143 PRO A CD    1 
ATOM   1156 N  N     . SER A 1 147 ? 73.085 0.457   4.091   1.00 14.85 ? 144 SER A N     1 
ATOM   1157 C  CA    . SER A 1 147 ? 71.873 0.455   4.903   1.00 13.00 ? 144 SER A CA    1 
ATOM   1158 C  C     . SER A 1 147 ? 71.185 -0.916  4.879   1.00 11.88 ? 144 SER A C     1 
ATOM   1159 O  O     . SER A 1 147 ? 70.005 -1.034  5.211   1.00 11.58 ? 144 SER A O     1 
ATOM   1160 C  CB    . SER A 1 147 ? 70.897 1.542   4.436   1.00 15.14 ? 144 SER A CB    1 
ATOM   1161 O  OG    . SER A 1 147 ? 70.406 1.264   3.137   1.00 14.56 ? 144 SER A OG    1 
ATOM   1162 N  N     . THR A 1 148 ? 71.957 -1.940  4.529   1.00 11.79 ? 145 THR A N     1 
ATOM   1163 C  CA    . THR A 1 148 ? 71.444 -3.309  4.381   1.00 11.40 ? 145 THR A CA    1 
ATOM   1164 C  C     . THR A 1 148 ? 71.645 -4.175  5.624   1.00 11.28 ? 145 THR A C     1 
ATOM   1165 O  O     . THR A 1 148 ? 72.742 -4.217  6.201   1.00 13.27 ? 145 THR A O     1 
ATOM   1166 C  CB    . THR A 1 148 ? 72.122 -4.013  3.183   1.00 10.78 ? 145 THR A CB    1 
ATOM   1167 O  OG1   . THR A 1 148 ? 71.762 -3.348  1.967   1.00 11.73 ? 145 THR A OG1   1 
ATOM   1168 C  CG2   . THR A 1 148 ? 71.677 -5.474  3.097   1.00 11.22 ? 145 THR A CG2   1 
ATOM   1169 N  N     . TYR A 1 149 ? 70.569 -4.846  6.023   1.00 10.49 ? 146 TYR A N     1 
ATOM   1170 C  CA    . TYR A 1 149 ? 70.590 -5.900  7.044   1.00 12.10 ? 146 TYR A CA    1 
ATOM   1171 C  C     . TYR A 1 149 ? 70.508 -7.253  6.382   1.00 13.51 ? 146 TYR A C     1 
ATOM   1172 O  O     . TYR A 1 149 ? 69.757 -7.432  5.418   1.00 12.21 ? 146 TYR A O     1 
ATOM   1173 C  CB    . TYR A 1 149 ? 69.413 -5.766  8.003   1.00 12.08 ? 146 TYR A CB    1 
ATOM   1174 C  CG    . TYR A 1 149 ? 69.588 -4.714  9.058   1.00 11.70 ? 146 TYR A CG    1 
ATOM   1175 C  CD1   . TYR A 1 149 ? 69.995 -5.064  10.332  1.00 13.24 ? 146 TYR A CD1   1 
ATOM   1176 C  CD2   . TYR A 1 149 ? 69.341 -3.370  8.781   1.00 15.41 ? 146 TYR A CD2   1 
ATOM   1177 C  CE1   . TYR A 1 149 ? 70.164 -4.115  11.304  1.00 14.57 ? 146 TYR A CE1   1 
ATOM   1178 C  CE2   . TYR A 1 149 ? 69.508 -2.402  9.760   1.00 16.29 ? 146 TYR A CE2   1 
ATOM   1179 C  CZ    . TYR A 1 149 ? 69.921 -2.791  11.018  1.00 16.30 ? 146 TYR A CZ    1 
ATOM   1180 O  OH    . TYR A 1 149 ? 70.096 -1.859  12.020  1.00 24.62 ? 146 TYR A OH    1 
ATOM   1181 N  N     . ILE A 1 150 ? 71.261 -8.212  6.910   1.00 9.48  ? 147 ILE A N     1 
ATOM   1182 C  CA    . ILE A 1 150 ? 71.157 -9.596  6.467   1.00 10.15 ? 147 ILE A CA    1 
ATOM   1183 C  C     . ILE A 1 150 ? 70.410 -10.378 7.537   1.00 10.36 ? 147 ILE A C     1 
ATOM   1184 O  O     . ILE A 1 150 ? 70.943 -10.626 8.621   1.00 11.97 ? 147 ILE A O     1 
ATOM   1185 C  CB    . ILE A 1 150 ? 72.541 -10.241 6.240   1.00 8.71  ? 147 ILE A CB    1 
ATOM   1186 C  CG1   . ILE A 1 150 ? 73.419 -9.365  5.345   1.00 11.85 ? 147 ILE A CG1   1 
ATOM   1187 C  CG2   . ILE A 1 150 ? 72.386 -11.662 5.664   1.00 13.07 ? 147 ILE A CG2   1 
ATOM   1188 C  CD1   . ILE A 1 150 ? 72.861 -9.166  3.932   1.00 11.37 ? 147 ILE A CD1   1 
ATOM   1189 N  N     . GLU A 1 151 ? 69.168 -10.750 7.255   1.00 9.40  ? 148 GLU A N     1 
ATOM   1190 C  CA    . GLU A 1 151 ? 68.342 -11.397 8.265   1.00 9.87  ? 148 GLU A CA    1 
ATOM   1191 C  C     . GLU A 1 151 ? 68.960 -12.724 8.719   1.00 11.85 ? 148 GLU A C     1 
ATOM   1192 O  O     . GLU A 1 151 ? 69.364 -13.541 7.884   1.00 11.61 ? 148 GLU A O     1 
ATOM   1193 C  CB    . GLU A 1 151 ? 66.920 -11.630 7.732   1.00 10.78 ? 148 GLU A CB    1 
ATOM   1194 C  CG    . GLU A 1 151 ? 66.016 -12.440 8.688   1.00 13.81 ? 148 GLU A CG    1 
ATOM   1195 C  CD    . GLU A 1 151 ? 65.770 -11.757 10.022  1.00 16.43 ? 148 GLU A CD    1 
ATOM   1196 O  OE1   . GLU A 1 151 ? 65.478 -12.460 11.010  1.00 17.63 ? 148 GLU A OE1   1 
ATOM   1197 O  OE2   . GLU A 1 151 ? 65.849 -10.516 10.085  1.00 17.65 ? 148 GLU A OE2   1 
ATOM   1198 N  N     . GLY A 1 152 ? 69.034 -12.902 10.041  1.00 11.79 ? 149 GLY A N     1 
ATOM   1199 C  CA    . GLY A 1 152 ? 69.616 -14.096 10.646  1.00 12.71 ? 149 GLY A CA    1 
ATOM   1200 C  C     . GLY A 1 152 ? 71.061 -13.937 11.089  1.00 15.90 ? 149 GLY A C     1 
ATOM   1201 O  O     . GLY A 1 152 ? 71.594 -14.795 11.798  1.00 17.30 ? 149 GLY A O     1 
ATOM   1202 N  N     . LEU A 1 153 ? 71.703 -12.856 10.659  1.00 13.98 ? 150 LEU A N     1 
ATOM   1203 C  CA    . LEU A 1 153 ? 73.092 -12.605 11.014  1.00 15.10 ? 150 LEU A CA    1 
ATOM   1204 C  C     . LEU A 1 153 ? 73.197 -11.295 11.790  1.00 16.78 ? 150 LEU A C     1 
ATOM   1205 O  O     . LEU A 1 153 ? 72.356 -10.414 11.633  1.00 16.11 ? 150 LEU A O     1 
ATOM   1206 C  CB    . LEU A 1 153 ? 73.963 -12.572 9.760   1.00 13.51 ? 150 LEU A CB    1 
ATOM   1207 C  CG    . LEU A 1 153 ? 74.017 -13.861 8.945   1.00 15.23 ? 150 LEU A CG    1 
ATOM   1208 C  CD1   . LEU A 1 153 ? 74.868 -13.678 7.713   1.00 15.07 ? 150 LEU A CD1   1 
ATOM   1209 C  CD2   . LEU A 1 153 ? 74.542 -15.031 9.798   1.00 17.74 ? 150 LEU A CD2   1 
ATOM   1210 N  N     . PRO A 1 154 ? 74.222 -11.162 12.649  1.00 14.27 ? 151 PRO A N     1 
ATOM   1211 C  CA    . PRO A 1 154 ? 75.290 -12.139 12.912  1.00 15.89 ? 151 PRO A CA    1 
ATOM   1212 C  C     . PRO A 1 154 ? 74.838 -13.325 13.746  1.00 14.96 ? 151 PRO A C     1 
ATOM   1213 O  O     . PRO A 1 154 ? 73.844 -13.237 14.460  1.00 19.17 ? 151 PRO A O     1 
ATOM   1214 C  CB    . PRO A 1 154 ? 76.322 -11.322 13.687  1.00 14.76 ? 151 PRO A CB    1 
ATOM   1215 C  CG    . PRO A 1 154 ? 75.503 -10.280 14.407  1.00 18.12 ? 151 PRO A CG    1 
ATOM   1216 C  CD    . PRO A 1 154 ? 74.374 -9.936  13.454  1.00 18.20 ? 151 PRO A CD    1 
ATOM   1217 N  N     . GLN A 1 155 ? 75.586 -14.418 13.660  1.00 19.12 ? 152 GLN A N     1 
ATOM   1218 C  CA    . GLN A 1 155 ? 75.315 -15.592 14.469  1.00 23.56 ? 152 GLN A CA    1 
ATOM   1219 C  C     . GLN A 1 155 ? 76.624 -16.067 15.094  1.00 33.06 ? 152 GLN A C     1 
ATOM   1220 O  O     . GLN A 1 155 ? 77.701 -15.720 14.608  1.00 35.43 ? 152 GLN A O     1 
ATOM   1221 C  CB    . GLN A 1 155 ? 74.698 -16.708 13.632  1.00 27.60 ? 152 GLN A CB    1 
ATOM   1222 C  CG    . GLN A 1 155 ? 75.741 -17.709 13.159  1.00 39.55 ? 152 GLN A CG    1 
ATOM   1223 C  CD    . GLN A 1 155 ? 75.147 -18.919 12.487  1.00 37.29 ? 152 GLN A CD    1 
ATOM   1224 O  OE1   . GLN A 1 155 ? 73.966 -19.231 12.664  1.00 39.75 ? 152 GLN A OE1   1 
ATOM   1225 N  NE2   . GLN A 1 155 ? 75.968 -19.621 11.718  1.00 28.23 ? 152 GLN A NE2   1 
ATOM   1226 N  N     . GLY A 1 156 ? 76.525 -16.854 16.161  1.00 39.77 ? 153 GLY A N     1 
ATOM   1227 C  CA    . GLY A 1 156 ? 77.694 -17.395 16.833  1.00 49.51 ? 153 GLY A CA    1 
ATOM   1228 C  C     . GLY A 1 156 ? 78.557 -16.341 17.509  1.00 54.76 ? 153 GLY A C     1 
ATOM   1229 O  O     . GLY A 1 156 ? 78.051 -15.318 17.955  1.00 64.89 ? 153 GLY A O     1 
ATOM   1230 N  N     . PRO A 1 157 ? 79.881 -16.591 17.592  1.00 62.49 ? 154 PRO A N     1 
ATOM   1231 C  CA    . PRO A 1 157 ? 80.870 -15.654 18.157  1.00 65.13 ? 154 PRO A CA    1 
ATOM   1232 C  C     . PRO A 1 157 ? 80.826 -14.264 17.516  1.00 63.80 ? 154 PRO A C     1 
ATOM   1233 O  O     . PRO A 1 157 ? 81.725 -13.472 17.775  1.00 62.04 ? 154 PRO A O     1 
ATOM   1234 C  CB    . PRO A 1 157 ? 82.197 -16.337 17.856  1.00 51.26 ? 154 PRO A CB    1 
ATOM   1235 C  CG    . PRO A 1 157 ? 81.858 -17.786 17.827  1.00 47.93 ? 154 PRO A CG    1 
ATOM   1236 C  CD    . PRO A 1 157 ? 80.498 -17.881 17.226  1.00 50.79 ? 154 PRO A CD    1 
ATOM   1237 N  N     . THR A 1 163 ? 78.918 -5.108  19.453  1.00 65.12 ? 160 THR A N     1 
ATOM   1238 C  CA    . THR A 1 163 ? 77.903 -6.080  19.850  1.00 61.60 ? 160 THR A CA    1 
ATOM   1239 C  C     . THR A 1 163 ? 76.780 -5.328  20.569  1.00 54.05 ? 160 THR A C     1 
ATOM   1240 O  O     . THR A 1 163 ? 75.649 -5.801  20.678  1.00 59.66 ? 160 THR A O     1 
ATOM   1241 C  CB    . THR A 1 163 ? 78.499 -7.184  20.761  1.00 61.06 ? 160 THR A CB    1 
ATOM   1242 O  OG1   . THR A 1 163 ? 79.549 -7.863  20.064  1.00 64.09 ? 160 THR A OG1   1 
ATOM   1243 C  CG2   . THR A 1 163 ? 77.441 -8.213  21.157  1.00 61.07 ? 160 THR A CG2   1 
ATOM   1244 N  N     . VAL A 1 164 ? 77.107 -4.124  21.022  1.00 45.81 ? 161 VAL A N     1 
ATOM   1245 C  CA    . VAL A 1 164 ? 76.208 -3.310  21.833  1.00 51.23 ? 161 VAL A CA    1 
ATOM   1246 C  C     . VAL A 1 164 ? 75.286 -2.378  21.029  1.00 46.84 ? 161 VAL A C     1 
ATOM   1247 O  O     . VAL A 1 164 ? 74.105 -2.240  21.360  1.00 47.03 ? 161 VAL A O     1 
ATOM   1248 C  CB    . VAL A 1 164 ? 77.036 -2.473  22.839  1.00 54.59 ? 161 VAL A CB    1 
ATOM   1249 C  CG1   . VAL A 1 164 ? 76.144 -1.740  23.814  1.00 44.03 ? 161 VAL A CG1   1 
ATOM   1250 C  CG2   . VAL A 1 164 ? 77.988 -3.385  23.600  1.00 54.76 ? 161 VAL A CG2   1 
ATOM   1251 N  N     . GLN A 1 165 ? 75.816 -1.744  19.983  1.00 43.75 ? 162 GLN A N     1 
ATOM   1252 C  CA    . GLN A 1 165 ? 75.048 -0.781  19.184  1.00 42.90 ? 162 GLN A CA    1 
ATOM   1253 C  C     . GLN A 1 165 ? 74.294 -1.454  18.037  1.00 35.01 ? 162 GLN A C     1 
ATOM   1254 O  O     . GLN A 1 165 ? 74.677 -2.531  17.575  1.00 31.14 ? 162 GLN A O     1 
ATOM   1255 C  CB    . GLN A 1 165 ? 75.970 0.292   18.610  1.00 45.19 ? 162 GLN A CB    1 
ATOM   1256 C  CG    . GLN A 1 165 ? 77.329 0.370   19.282  1.00 58.72 ? 162 GLN A CG    1 
ATOM   1257 C  CD    . GLN A 1 165 ? 78.329 1.157   18.463  1.00 63.89 ? 162 GLN A CD    1 
ATOM   1258 O  OE1   . GLN A 1 165 ? 78.119 2.335   18.175  1.00 69.53 ? 162 GLN A OE1   1 
ATOM   1259 N  NE2   . GLN A 1 165 ? 79.421 0.506   18.073  1.00 65.38 ? 162 GLN A NE2   1 
ATOM   1260 N  N     . LYS A 1 166 ? 73.234 -0.810  17.558  1.00 30.04 ? 163 LYS A N     1 
ATOM   1261 C  CA    . LYS A 1 166 ? 72.453 -1.395  16.475  1.00 31.39 ? 163 LYS A CA    1 
ATOM   1262 C  C     . LYS A 1 166 ? 73.208 -1.395  15.144  1.00 22.46 ? 163 LYS A C     1 
ATOM   1263 O  O     . LYS A 1 166 ? 73.203 -2.392  14.416  1.00 21.00 ? 163 LYS A O     1 
ATOM   1264 C  CB    . LYS A 1 166 ? 71.120 -0.668  16.314  1.00 34.46 ? 163 LYS A CB    1 
ATOM   1265 C  CG    . LYS A 1 166 ? 70.219 -1.377  15.345  1.00 36.20 ? 163 LYS A CG    1 
ATOM   1266 C  CD    . LYS A 1 166 ? 68.796 -0.905  15.441  1.00 45.27 ? 163 LYS A CD    1 
ATOM   1267 C  CE    . LYS A 1 166 ? 67.950 -1.713  14.495  1.00 33.58 ? 163 LYS A CE    1 
ATOM   1268 N  NZ    . LYS A 1 166 ? 68.180 -3.189  14.631  1.00 35.57 ? 163 LYS A NZ    1 
ATOM   1269 N  N     . GLU A 1 167 ? 73.848 -0.280  14.817  1.00 25.78 ? 164 GLU A N     1 
ATOM   1270 C  CA    . GLU A 1 167 ? 74.634 -0.210  13.591  1.00 26.78 ? 164 GLU A CA    1 
ATOM   1271 C  C     . GLU A 1 167 ? 75.799 -1.197  13.657  1.00 23.89 ? 164 GLU A C     1 
ATOM   1272 O  O     . GLU A 1 167 ? 76.206 -1.757  12.643  1.00 22.04 ? 164 GLU A O     1 
ATOM   1273 C  CB    . GLU A 1 167 ? 75.132 1.223   13.352  1.00 26.13 ? 164 GLU A CB    1 
ATOM   1274 C  CG    . GLU A 1 167 ? 76.143 1.405   12.208  1.00 20.58 ? 164 GLU A CG    1 
ATOM   1275 C  CD    . GLU A 1 167 ? 75.582 1.125   10.818  1.00 26.71 ? 164 GLU A CD    1 
ATOM   1276 O  OE1   . GLU A 1 167 ? 76.393 1.093   9.863   1.00 27.77 ? 164 GLU A OE1   1 
ATOM   1277 O  OE2   . GLU A 1 167 ? 74.349 0.949   10.670  1.00 27.12 ? 164 GLU A OE2   1 
ATOM   1278 N  N     . GLY A 1 168 ? 76.325 -1.413  14.859  1.00 30.15 ? 165 GLY A N     1 
ATOM   1279 C  CA    . GLY A 1 168 ? 77.406 -2.359  15.054  1.00 27.43 ? 165 GLY A CA    1 
ATOM   1280 C  C     . GLY A 1 168 ? 76.969 -3.772  14.731  1.00 21.15 ? 165 GLY A C     1 
ATOM   1281 O  O     . GLY A 1 168 ? 77.704 -4.530  14.093  1.00 25.56 ? 165 GLY A O     1 
ATOM   1282 N  N     . MET A 1 169 ? 75.768 -4.126  15.183  1.00 22.44 ? 166 MET A N     1 
ATOM   1283 C  CA    . MET A 1 169 ? 75.175 -5.423  14.868  1.00 20.14 ? 166 MET A CA    1 
ATOM   1284 C  C     . MET A 1 169 ? 74.937 -5.555  13.364  1.00 19.03 ? 166 MET A C     1 
ATOM   1285 O  O     . MET A 1 169 ? 75.226 -6.603  12.774  1.00 20.51 ? 166 MET A O     1 
ATOM   1286 C  CB    . MET A 1 169 ? 73.857 -5.621  15.628  1.00 27.43 ? 166 MET A CB    1 
ATOM   1287 C  CG    . MET A 1 169 ? 74.009 -5.822  17.133  1.00 39.27 ? 166 MET A CG    1 
ATOM   1288 S  SD    . MET A 1 169 ? 74.583 -7.480  17.572  1.00 48.13 ? 166 MET A SD    1 
ATOM   1289 C  CE    . MET A 1 169 ? 73.251 -8.483  16.908  1.00 33.51 ? 166 MET A CE    1 
ATOM   1290 N  N     . ARG A 1 170 ? 74.424 -4.496  12.737  1.00 18.96 ? 167 ARG A N     1 
ATOM   1291 C  CA    . ARG A 1 170 ? 74.166 -4.537  11.299  1.00 17.83 ? 167 ARG A CA    1 
ATOM   1292 C  C     . ARG A 1 170 ? 75.439 -4.873  10.532  1.00 15.40 ? 167 ARG A C     1 
ATOM   1293 O  O     . ARG A 1 170 ? 75.436 -5.753  9.666   1.00 16.42 ? 167 ARG A O     1 
ATOM   1294 C  CB    . ARG A 1 170 ? 73.596 -3.205  10.786  1.00 17.00 ? 167 ARG A CB    1 
ATOM   1295 C  CG    . ARG A 1 170 ? 73.254 -3.245  9.291   1.00 15.22 ? 167 ARG A CG    1 
ATOM   1296 C  CD    . ARG A 1 170 ? 73.053 -1.848  8.708   1.00 15.60 ? 167 ARG A CD    1 
ATOM   1297 N  NE    . ARG A 1 170 ? 74.327 -1.151  8.499   1.00 16.69 ? 167 ARG A NE    1 
ATOM   1298 C  CZ    . ARG A 1 170 ? 75.118 -1.322  7.445   1.00 16.40 ? 167 ARG A CZ    1 
ATOM   1299 N  NH1   . ARG A 1 170 ? 74.795 -2.172  6.487   1.00 13.83 ? 167 ARG A NH1   1 
ATOM   1300 N  NH2   . ARG A 1 170 ? 76.248 -0.639  7.343   1.00 19.98 ? 167 ARG A NH2   1 
ATOM   1301 N  N     . LYS A 1 171 ? 76.520 -4.156  10.837  1.00 16.02 ? 168 LYS A N     1 
ATOM   1302 C  CA    . LYS A 1 171 ? 77.777 -4.360  10.139  1.00 19.45 ? 168 LYS A CA    1 
ATOM   1303 C  C     . LYS A 1 171 ? 78.356 -5.731  10.418  1.00 15.32 ? 168 LYS A C     1 
ATOM   1304 O  O     . LYS A 1 171 ? 78.929 -6.348  9.519   1.00 16.83 ? 168 LYS A O     1 
ATOM   1305 C  CB    . LYS A 1 171 ? 78.798 -3.285  10.515  1.00 21.67 ? 168 LYS A CB    1 
ATOM   1306 C  CG    . LYS A 1 171 ? 78.645 -1.997  9.732   1.00 29.98 ? 168 LYS A CG    1 
ATOM   1307 C  CD    . LYS A 1 171 ? 79.893 -1.129  9.860   1.00 34.98 ? 168 LYS A CD    1 
ATOM   1308 C  CE    . LYS A 1 171 ? 79.808 0.074   8.936   1.00 40.11 ? 168 LYS A CE    1 
ATOM   1309 N  NZ    . LYS A 1 171 ? 81.089 0.826   8.877   1.00 42.65 ? 168 LYS A NZ    1 
ATOM   1310 N  N     . GLN A 1 172 ? 78.205 -6.208  11.653  1.00 19.19 ? 169 GLN A N     1 
ATOM   1311 C  CA    . GLN A 1 172 ? 78.712 -7.528  12.011  1.00 19.67 ? 169 GLN A CA    1 
ATOM   1312 C  C     . GLN A 1 172 ? 78.060 -8.583  11.129  1.00 16.39 ? 169 GLN A C     1 
ATOM   1313 O  O     . GLN A 1 172 ? 78.734 -9.458  10.571  1.00 17.80 ? 169 GLN A O     1 
ATOM   1314 C  CB    . GLN A 1 172 ? 78.453 -7.862  13.483  1.00 22.56 ? 169 GLN A CB    1 
ATOM   1315 C  CG    . GLN A 1 172 ? 79.517 -7.355  14.442  1.00 38.13 ? 169 GLN A CG    1 
ATOM   1316 C  CD    . GLN A 1 172 ? 79.103 -7.482  15.900  1.00 51.45 ? 169 GLN A CD    1 
ATOM   1317 O  OE1   . GLN A 1 172 ? 78.005 -7.077  16.292  1.00 45.12 ? 169 GLN A OE1   1 
ATOM   1318 N  NE2   . GLN A 1 172 ? 79.990 -8.049  16.715  1.00 61.96 ? 169 GLN A NE2   1 
ATOM   1319 N  N     . GLY A 1 173 ? 76.741 -8.499  10.999  1.00 17.21 ? 170 GLY A N     1 
ATOM   1320 C  CA    . GLY A 1 173 ? 76.017 -9.454  10.185  1.00 15.88 ? 170 GLY A CA    1 
ATOM   1321 C  C     . GLY A 1 173 ? 76.367 -9.349  8.717   1.00 14.53 ? 170 GLY A C     1 
ATOM   1322 O  O     . GLY A 1 173 ? 76.500 -10.354 8.015   1.00 13.70 ? 170 GLY A O     1 
ATOM   1323 N  N     . LEU A 1 174 ? 76.520 -8.116  8.239   1.00 13.52 ? 171 LEU A N     1 
ATOM   1324 C  CA    . LEU A 1 174 ? 76.863 -7.894  6.845   1.00 11.25 ? 171 LEU A CA    1 
ATOM   1325 C  C     . LEU A 1 174 ? 78.235 -8.469  6.546   1.00 16.07 ? 171 LEU A C     1 
ATOM   1326 O  O     . LEU A 1 174 ? 78.447 -9.068  5.494   1.00 16.60 ? 171 LEU A O     1 
ATOM   1327 C  CB    . LEU A 1 174 ? 76.818 -6.399  6.494   1.00 14.00 ? 171 LEU A CB    1 
ATOM   1328 C  CG    . LEU A 1 174 ? 77.194 -6.062  5.052   1.00 14.26 ? 171 LEU A CG    1 
ATOM   1329 C  CD1   . LEU A 1 174 ? 76.258 -6.785  4.077   1.00 14.28 ? 171 LEU A CD1   1 
ATOM   1330 C  CD2   . LEU A 1 174 ? 77.182 -4.547  4.821   1.00 19.18 ? 171 LEU A CD2   1 
ATOM   1331 N  N     . PHE A 1 175 ? 79.159 -8.320  7.488   1.00 14.98 ? 172 PHE A N     1 
ATOM   1332 C  CA    . PHE A 1 175 ? 80.501 -8.822  7.248   1.00 17.93 ? 172 PHE A CA    1 
ATOM   1333 C  C     . PHE A 1 175 ? 80.519 -10.350 7.239   1.00 15.33 ? 172 PHE A C     1 
ATOM   1334 O  O     . PHE A 1 175 ? 81.198 -10.946 6.412   1.00 19.38 ? 172 PHE A O     1 
ATOM   1335 C  CB    . PHE A 1 175 ? 81.479 -8.263  8.272   1.00 20.06 ? 172 PHE A CB    1 
ATOM   1336 C  CG    . PHE A 1 175 ? 82.001 -6.900  7.908   1.00 30.48 ? 172 PHE A CG    1 
ATOM   1337 C  CD1   . PHE A 1 175 ? 81.685 -5.784  8.664   1.00 32.82 ? 172 PHE A CD1   1 
ATOM   1338 C  CD2   . PHE A 1 175 ? 82.787 -6.733  6.779   1.00 37.58 ? 172 PHE A CD2   1 
ATOM   1339 C  CE1   . PHE A 1 175 ? 82.158 -4.530  8.312   1.00 39.08 ? 172 PHE A CE1   1 
ATOM   1340 C  CE2   . PHE A 1 175 ? 83.264 -5.485  6.422   1.00 44.39 ? 172 PHE A CE2   1 
ATOM   1341 C  CZ    . PHE A 1 175 ? 82.948 -4.382  7.189   1.00 40.75 ? 172 PHE A CZ    1 
ATOM   1342 N  N     . GLN A 1 176 ? 79.764 -10.986 8.134   1.00 17.35 ? 173 GLN A N     1 
ATOM   1343 C  CA    . GLN A 1 176 ? 79.685 -12.450 8.119   1.00 16.56 ? 173 GLN A CA    1 
ATOM   1344 C  C     . GLN A 1 176 ? 79.157 -12.944 6.777   1.00 20.39 ? 173 GLN A C     1 
ATOM   1345 O  O     . GLN A 1 176 ? 79.691 -13.890 6.189   1.00 21.13 ? 173 GLN A O     1 
ATOM   1346 C  CB    . GLN A 1 176 ? 78.802 -12.978 9.262   1.00 18.86 ? 173 GLN A CB    1 
ATOM   1347 C  CG    . GLN A 1 176 ? 79.413 -12.773 10.650  1.00 18.07 ? 173 GLN A CG    1 
ATOM   1348 C  CD    . GLN A 1 176 ? 78.627 -13.462 11.745  1.00 22.10 ? 173 GLN A CD    1 
ATOM   1349 O  OE1   . GLN A 1 176 ? 77.539 -13.979 11.511  1.00 22.00 ? 173 GLN A OE1   1 
ATOM   1350 N  NE2   . GLN A 1 176 ? 79.189 -13.490 12.949  1.00 29.45 ? 173 GLN A NE2   1 
ATOM   1351 N  N     . TRP A 1 177 ? 78.108 -12.282 6.291   1.00 15.99 ? 174 TRP A N     1 
ATOM   1352 C  CA    . TRP A 1 177 ? 77.508 -12.611 5.004   1.00 14.55 ? 174 TRP A CA    1 
ATOM   1353 C  C     . TRP A 1 177 ? 78.497 -12.465 3.848   1.00 16.17 ? 174 TRP A C     1 
ATOM   1354 O  O     . TRP A 1 177 ? 78.673 -13.377 3.042   1.00 16.31 ? 174 TRP A O     1 
ATOM   1355 C  CB    . TRP A 1 177 ? 76.281 -11.713 4.767   1.00 13.08 ? 174 TRP A CB    1 
ATOM   1356 C  CG    . TRP A 1 177 ? 75.614 -11.876 3.425   1.00 13.46 ? 174 TRP A CG    1 
ATOM   1357 C  CD1   . TRP A 1 177 ? 75.716 -11.031 2.348   1.00 12.76 ? 174 TRP A CD1   1 
ATOM   1358 C  CD2   . TRP A 1 177 ? 74.721 -12.928 3.024   1.00 13.24 ? 174 TRP A CD2   1 
ATOM   1359 N  NE1   . TRP A 1 177 ? 74.953 -11.497 1.313   1.00 12.78 ? 174 TRP A NE1   1 
ATOM   1360 C  CE2   . TRP A 1 177 ? 74.329 -12.654 1.698   1.00 13.18 ? 174 TRP A CE2   1 
ATOM   1361 C  CE3   . TRP A 1 177 ? 74.214 -14.066 3.659   1.00 14.24 ? 174 TRP A CE3   1 
ATOM   1362 C  CZ2   . TRP A 1 177 ? 73.464 -13.489 0.988   1.00 10.83 ? 174 TRP A CZ2   1 
ATOM   1363 C  CZ3   . TRP A 1 177 ? 73.354 -14.896 2.956   1.00 14.74 ? 174 TRP A CZ3   1 
ATOM   1364 C  CH2   . TRP A 1 177 ? 72.983 -14.601 1.637   1.00 14.48 ? 174 TRP A CH2   1 
ATOM   1365 N  N     . LEU A 1 178 ? 79.133 -11.304 3.759   1.00 16.27 ? 175 LEU A N     1 
ATOM   1366 C  CA    . LEU A 1 178 ? 80.034 -11.036 2.647   1.00 14.19 ? 175 LEU A CA    1 
ATOM   1367 C  C     . LEU A 1 178 ? 81.267 -11.926 2.699   1.00 24.12 ? 175 LEU A C     1 
ATOM   1368 O  O     . LEU A 1 178 ? 81.777 -12.336 1.658   1.00 24.93 ? 175 LEU A O     1 
ATOM   1369 C  CB    . LEU A 1 178 ? 80.452 -9.569  2.640   1.00 17.43 ? 175 LEU A CB    1 
ATOM   1370 C  CG    . LEU A 1 178 ? 79.328 -8.577  2.343   1.00 16.68 ? 175 LEU A CG    1 
ATOM   1371 C  CD1   . LEU A 1 178 ? 79.861 -7.157  2.439   1.00 19.98 ? 175 LEU A CD1   1 
ATOM   1372 C  CD2   . LEU A 1 178 ? 78.735 -8.842  0.956   1.00 15.19 ? 175 LEU A CD2   1 
ATOM   1373 N  N     . ASP A 1 179 ? 81.736 -12.226 3.906   1.00 20.26 ? 176 ASP A N     1 
ATOM   1374 C  CA    . ASP A 1 179 ? 82.918 -13.075 4.065   1.00 27.14 ? 176 ASP A CA    1 
ATOM   1375 C  C     . ASP A 1 179 ? 82.667 -14.476 3.543   1.00 29.02 ? 176 ASP A C     1 
ATOM   1376 O  O     . ASP A 1 179 ? 83.590 -15.148 3.082   1.00 30.40 ? 176 ASP A O     1 
ATOM   1377 C  CB    . ASP A 1 179 ? 83.354 -13.150 5.532   1.00 26.45 ? 176 ASP A CB    1 
ATOM   1378 C  CG    . ASP A 1 179 ? 83.983 -11.863 6.019   1.00 35.91 ? 176 ASP A CG    1 
ATOM   1379 O  OD1   . ASP A 1 179 ? 84.361 -11.027 5.171   1.00 44.09 ? 176 ASP A OD1   1 
ATOM   1380 O  OD2   . ASP A 1 179 ? 84.095 -11.677 7.252   1.00 44.75 ? 176 ASP A OD2   1 
ATOM   1381 N  N     . SER A 1 180 ? 81.413 -14.908 3.607   1.00 22.76 ? 177 SER A N     1 
ATOM   1382 C  CA    A SER A 1 180 ? 81.043 -16.259 3.204   0.58 24.26 ? 177 SER A CA    1 
ATOM   1383 C  CA    B SER A 1 180 ? 81.053 -16.262 3.201   0.42 24.29 ? 177 SER A CA    1 
ATOM   1384 C  C     . SER A 1 180 ? 80.665 -16.381 1.726   1.00 29.88 ? 177 SER A C     1 
ATOM   1385 O  O     . SER A 1 180 ? 80.570 -17.488 1.193   1.00 37.39 ? 177 SER A O     1 
ATOM   1386 C  CB    A SER A 1 180 ? 79.883 -16.752 4.076   0.58 25.23 ? 177 SER A CB    1 
ATOM   1387 C  CB    B SER A 1 180 ? 79.902 -16.776 4.073   0.42 25.25 ? 177 SER A CB    1 
ATOM   1388 O  OG    A SER A 1 180 ? 80.231 -16.706 5.449   0.58 25.12 ? 177 SER A OG    1 
ATOM   1389 O  OG    B SER A 1 180 ? 79.518 -18.082 3.685   0.42 29.30 ? 177 SER A OG    1 
ATOM   1390 N  N     . LEU A 1 181 ? 80.439 -15.250 1.062   1.00 20.28 ? 178 LEU A N     1 
ATOM   1391 C  CA    . LEU A 1 181 ? 79.968 -15.271 -0.331  1.00 18.56 ? 178 LEU A CA    1 
ATOM   1392 C  C     . LEU A 1 181 ? 80.906 -15.917 -1.349  1.00 35.38 ? 178 LEU A C     1 
ATOM   1393 O  O     . LEU A 1 181 ? 82.102 -15.652 -1.349  1.00 36.25 ? 178 LEU A O     1 
ATOM   1394 C  CB    . LEU A 1 181 ? 79.679 -13.848 -0.807  1.00 26.15 ? 178 LEU A CB    1 
ATOM   1395 C  CG    . LEU A 1 181 ? 78.240 -13.347 -0.731  1.00 27.19 ? 178 LEU A CG    1 
ATOM   1396 C  CD1   . LEU A 1 181 ? 78.159 -11.991 -1.433  1.00 18.03 ? 178 LEU A CD1   1 
ATOM   1397 C  CD2   . LEU A 1 181 ? 77.261 -14.346 -1.343  1.00 22.85 ? 178 LEU A CD2   1 
ATOM   1398 N  N     . GLN A 1 182 ? 80.351 -16.740 -2.237  1.00 33.77 ? 179 GLN A N     1 
ATOM   1399 C  CA    . GLN A 1 182 ? 81.128 -17.267 -3.362  1.00 45.92 ? 179 GLN A CA    1 
ATOM   1400 C  C     . GLN A 1 182 ? 80.868 -16.424 -4.630  1.00 49.21 ? 179 GLN A C     1 
ATOM   1401 O  O     . GLN A 1 182 ? 79.821 -16.510 -5.270  1.00 54.95 ? 179 GLN A O     1 
ATOM   1402 C  CB    . GLN A 1 182 ? 80.847 -18.780 -3.549  1.00 52.82 ? 179 GLN A CB    1 
ATOM   1403 C  CG    . GLN A 1 182 ? 79.700 -19.226 -4.466  1.00 57.53 ? 179 GLN A CG    1 
ATOM   1404 C  CD    . GLN A 1 182 ? 79.348 -20.697 -4.276  1.00 61.78 ? 179 GLN A CD    1 
ATOM   1405 O  OE1   . GLN A 1 182 ? 78.278 -21.037 -3.768  1.00 67.00 ? 179 GLN A OE1   1 
ATOM   1406 N  NE2   . GLN A 1 182 ? 80.260 -21.576 -4.676  1.00 72.51 ? 179 GLN A NE2   1 
ATOM   1407 N  N     . ILE A 1 183 ? 81.837 -15.576 -4.966  1.00 42.35 ? 180 ILE A N     1 
ATOM   1408 C  CA    . ILE A 1 183 ? 81.621 -14.542 -5.978  1.00 49.60 ? 180 ILE A CA    1 
ATOM   1409 C  C     . ILE A 1 183 ? 81.977 -14.953 -7.409  1.00 51.39 ? 180 ILE A C     1 
ATOM   1410 O  O     . ILE A 1 183 ? 81.711 -14.211 -8.356  1.00 50.93 ? 180 ILE A O     1 
ATOM   1411 C  CB    . ILE A 1 183 ? 82.401 -13.253 -5.619  1.00 45.71 ? 180 ILE A CB    1 
ATOM   1412 C  CG1   . ILE A 1 183 ? 83.815 -13.588 -5.124  1.00 49.76 ? 180 ILE A CG1   1 
ATOM   1413 C  CG2   . ILE A 1 183 ? 81.652 -12.471 -4.556  1.00 45.51 ? 180 ILE A CG2   1 
ATOM   1414 C  CD1   . ILE A 1 183 ? 84.830 -13.859 -6.222  1.00 57.12 ? 180 ILE A CD1   1 
ATOM   1415 N  N     . ASP A 1 184 ? 82.571 -16.131 -7.569  1.00 53.38 ? 181 ASP A N     1 
ATOM   1416 C  CA    . ASP A 1 184 ? 82.950 -16.605 -8.896  1.00 51.85 ? 181 ASP A CA    1 
ATOM   1417 C  C     . ASP A 1 184 ? 81.904 -17.554 -9.488  1.00 57.54 ? 181 ASP A C     1 
ATOM   1418 O  O     . ASP A 1 184 ? 82.070 -18.053 -10.602 1.00 56.76 ? 181 ASP A O     1 
ATOM   1419 C  CB    . ASP A 1 184 ? 84.325 -17.280 -8.850  1.00 56.05 ? 181 ASP A CB    1 
ATOM   1420 C  CG    . ASP A 1 184 ? 84.335 -18.541 -8.003  1.00 63.26 ? 181 ASP A CG    1 
ATOM   1421 O  OD1   . ASP A 1 184 ? 83.493 -18.651 -7.085  1.00 62.56 ? 181 ASP A OD1   1 
ATOM   1422 O  OD2   . ASP A 1 184 ? 85.192 -19.416 -8.253  1.00 66.86 ? 181 ASP A OD2   1 
ATOM   1423 N  N     . ASN A 1 185 ? 80.827 -17.800 -8.744  1.00 50.84 ? 182 ASN A N     1 
ATOM   1424 C  CA    . ASN A 1 185 ? 79.677 -18.510 -9.297  1.00 53.07 ? 182 ASN A CA    1 
ATOM   1425 C  C     . ASN A 1 185 ? 78.600 -17.486 -9.638  1.00 48.25 ? 182 ASN A C     1 
ATOM   1426 O  O     . ASN A 1 185 ? 77.990 -16.896 -8.746  1.00 45.84 ? 182 ASN A O     1 
ATOM   1427 C  CB    . ASN A 1 185 ? 79.137 -19.559 -8.318  1.00 49.45 ? 182 ASN A CB    1 
ATOM   1428 C  CG    . ASN A 1 185 ? 77.997 -20.390 -8.905  1.00 48.29 ? 182 ASN A CG    1 
ATOM   1429 O  OD1   . ASN A 1 185 ? 77.566 -20.178 -10.042 1.00 43.02 ? 182 ASN A OD1   1 
ATOM   1430 N  ND2   . ASN A 1 185 ? 77.498 -21.339 -8.118  1.00 51.61 ? 182 ASN A ND2   1 
ATOM   1431 N  N     . LEU A 1 186 ? 78.375 -17.272 -10.930 1.00 44.55 ? 183 LEU A N     1 
ATOM   1432 C  CA    . LEU A 1 186 ? 77.458 -16.230 -11.383 1.00 44.23 ? 183 LEU A CA    1 
ATOM   1433 C  C     . LEU A 1 186 ? 75.992 -16.639 -11.211 1.00 39.99 ? 183 LEU A C     1 
ATOM   1434 O  O     . LEU A 1 186 ? 75.084 -15.825 -11.401 1.00 39.93 ? 183 LEU A O     1 
ATOM   1435 C  CB    . LEU A 1 186 ? 77.740 -15.874 -12.848 1.00 44.01 ? 183 LEU A CB    1 
ATOM   1436 C  CG    . LEU A 1 186 ? 79.118 -15.318 -13.239 1.00 54.26 ? 183 LEU A CG    1 
ATOM   1437 C  CD1   . LEU A 1 186 ? 78.964 -14.262 -14.320 1.00 49.03 ? 183 LEU A CD1   1 
ATOM   1438 C  CD2   . LEU A 1 186 ? 79.873 -14.733 -12.047 1.00 55.91 ? 183 LEU A CD2   1 
ATOM   1439 N  N     . THR A 1 187 ? 75.760 -17.898 -10.853 1.00 35.35 ? 184 THR A N     1 
ATOM   1440 C  CA    . THR A 1 187 ? 74.397 -18.375 -10.645 1.00 35.33 ? 184 THR A CA    1 
ATOM   1441 C  C     . THR A 1 187 ? 74.076 -18.709 -9.181  1.00 31.42 ? 184 THR A C     1 
ATOM   1442 O  O     . THR A 1 187 ? 73.008 -19.248 -8.908  1.00 32.43 ? 184 THR A O     1 
ATOM   1443 C  CB    . THR A 1 187 ? 74.097 -19.628 -11.508 1.00 42.33 ? 184 THR A CB    1 
ATOM   1444 O  OG1   . THR A 1 187 ? 74.901 -20.730 -11.068 1.00 45.45 ? 184 THR A OG1   1 
ATOM   1445 C  CG2   . THR A 1 187 ? 74.379 -19.347 -12.980 1.00 40.66 ? 184 THR A CG2   1 
ATOM   1446 N  N     . SER A 1 188 ? 74.986 -18.407 -8.251  1.00 30.74 ? 185 SER A N     1 
ATOM   1447 C  CA    . SER A 1 188 ? 74.693 -18.561 -6.814  1.00 19.08 ? 185 SER A CA    1 
ATOM   1448 C  C     . SER A 1 188 ? 73.541 -17.658 -6.398  1.00 17.83 ? 185 SER A C     1 
ATOM   1449 O  O     . SER A 1 188 ? 73.633 -16.438 -6.522  1.00 14.12 ? 185 SER A O     1 
ATOM   1450 C  CB    . SER A 1 188 ? 75.908 -18.237 -5.941  1.00 28.74 ? 185 SER A CB    1 
ATOM   1451 O  OG    . SER A 1 188 ? 75.535 -18.151 -4.562  1.00 26.85 ? 185 SER A OG    1 
ATOM   1452 N  N     . PRO A 1 189 ? 72.446 -18.250 -5.913  1.00 14.76 ? 186 PRO A N     1 
ATOM   1453 C  CA    . PRO A 1 189 ? 71.323 -17.405 -5.482  1.00 12.18 ? 186 PRO A CA    1 
ATOM   1454 C  C     . PRO A 1 189 ? 71.695 -16.373 -4.422  1.00 11.86 ? 186 PRO A C     1 
ATOM   1455 O  O     . PRO A 1 189 ? 71.182 -15.245 -4.489  1.00 11.28 ? 186 PRO A O     1 
ATOM   1456 C  CB    . PRO A 1 189 ? 70.329 -18.415 -4.912  1.00 14.42 ? 186 PRO A CB    1 
ATOM   1457 C  CG    . PRO A 1 189 ? 70.627 -19.689 -5.678  1.00 16.38 ? 186 PRO A CG    1 
ATOM   1458 C  CD    . PRO A 1 189 ? 72.120 -19.685 -5.859  1.00 15.11 ? 186 PRO A CD    1 
ATOM   1459 N  N     . ASP A 1 190 ? 72.554 -16.729 -3.468  1.00 11.45 ? 187 ASP A N     1 
ATOM   1460 C  CA    . ASP A 1 190 ? 72.943 -15.771 -2.428  1.00 9.15  ? 187 ASP A CA    1 
ATOM   1461 C  C     . ASP A 1 190 ? 73.672 -14.579 -3.029  1.00 12.43 ? 187 ASP A C     1 
ATOM   1462 O  O     . ASP A 1 190 ? 73.477 -13.439 -2.598  1.00 12.46 ? 187 ASP A O     1 
ATOM   1463 C  CB    . ASP A 1 190 ? 73.828 -16.435 -1.361  1.00 12.01 ? 187 ASP A CB    1 
ATOM   1464 C  CG    . ASP A 1 190 ? 73.062 -17.411 -0.484  1.00 17.32 ? 187 ASP A CG    1 
ATOM   1465 O  OD1   . ASP A 1 190 ? 71.823 -17.352 -0.439  1.00 11.08 ? 187 ASP A OD1   1 
ATOM   1466 O  OD2   . ASP A 1 190 ? 73.708 -18.243 0.174   1.00 18.79 ? 187 ASP A OD2   1 
ATOM   1467 N  N     . LEU A 1 191 ? 74.528 -14.843 -4.010  1.00 11.00 ? 188 LEU A N     1 
ATOM   1468 C  CA    . LEU A 1 191 ? 75.252 -13.771 -4.680  1.00 12.74 ? 188 LEU A CA    1 
ATOM   1469 C  C     . LEU A 1 191 ? 74.271 -12.902 -5.443  1.00 12.86 ? 188 LEU A C     1 
ATOM   1470 O  O     . LEU A 1 191 ? 74.365 -11.676 -5.400  1.00 11.78 ? 188 LEU A O     1 
ATOM   1471 C  CB    . LEU A 1 191 ? 76.318 -14.335 -5.632  1.00 16.92 ? 188 LEU A CB    1 
ATOM   1472 C  CG    . LEU A 1 191 ? 77.095 -13.294 -6.449  1.00 17.89 ? 188 LEU A CG    1 
ATOM   1473 C  CD1   . LEU A 1 191 ? 77.799 -12.291 -5.570  1.00 16.50 ? 188 LEU A CD1   1 
ATOM   1474 C  CD2   . LEU A 1 191 ? 78.105 -13.989 -7.361  1.00 18.95 ? 188 LEU A CD2   1 
ATOM   1475 N  N     . GLN A 1 192 ? 73.308 -13.541 -6.102  1.00 11.71 ? 189 GLN A N     1 
ATOM   1476 C  CA    . GLN A 1 192 ? 72.306 -12.808 -6.873  1.00 13.39 ? 189 GLN A CA    1 
ATOM   1477 C  C     . GLN A 1 192 ? 71.510 -11.870 -5.957  1.00 13.32 ? 189 GLN A C     1 
ATOM   1478 O  O     . GLN A 1 192 ? 71.306 -10.700 -6.286  1.00 11.04 ? 189 GLN A O     1 
ATOM   1479 C  CB    . GLN A 1 192 ? 71.387 -13.779 -7.614  1.00 12.70 ? 189 GLN A CB    1 
ATOM   1480 C  CG    . GLN A 1 192 ? 72.088 -14.436 -8.808  1.00 14.11 ? 189 GLN A CG    1 
ATOM   1481 C  CD    . GLN A 1 192 ? 71.339 -15.619 -9.365  1.00 24.62 ? 189 GLN A CD    1 
ATOM   1482 O  OE1   . GLN A 1 192 ? 70.337 -16.063 -8.804  1.00 30.35 ? 189 GLN A OE1   1 
ATOM   1483 N  NE2   . GLN A 1 192 ? 71.820 -16.139 -10.490 1.00 35.68 ? 189 GLN A NE2   1 
ATOM   1484 N  N     . LEU A 1 193 ? 71.090 -12.362 -4.796  1.00 10.26 ? 190 LEU A N     1 
ATOM   1485 C  CA    . LEU A 1 193 ? 70.386 -11.505 -3.836  1.00 9.54  ? 190 LEU A CA    1 
ATOM   1486 C  C     . LEU A 1 193 ? 71.232 -10.320 -3.392  1.00 10.84 ? 190 LEU A C     1 
ATOM   1487 O  O     . LEU A 1 193 ? 70.722 -9.222  -3.175  1.00 11.44 ? 190 LEU A O     1 
ATOM   1488 C  CB    . LEU A 1 193 ? 69.972 -12.298 -2.601  1.00 10.75 ? 190 LEU A CB    1 
ATOM   1489 C  CG    . LEU A 1 193 ? 68.898 -13.363 -2.763  1.00 9.83  ? 190 LEU A CG    1 
ATOM   1490 C  CD1   . LEU A 1 193 ? 68.554 -13.946 -1.395  1.00 12.74 ? 190 LEU A CD1   1 
ATOM   1491 C  CD2   . LEU A 1 193 ? 67.662 -12.779 -3.421  1.00 11.54 ? 190 LEU A CD2   1 
ATOM   1492 N  N     . THR A 1 194 ? 72.524 -10.568 -3.179  1.00 10.75 ? 191 THR A N     1 
ATOM   1493 C  CA    . THR A 1 194 ? 73.435 -9.540  -2.722  1.00 9.78  ? 191 THR A CA    1 
ATOM   1494 C  C     . THR A 1 194 ? 73.566 -8.432  -3.755  1.00 10.73 ? 191 THR A C     1 
ATOM   1495 O  O     . THR A 1 194 ? 73.536 -7.252  -3.407  1.00 12.28 ? 191 THR A O     1 
ATOM   1496 C  CB    . THR A 1 194 ? 74.821 -10.127 -2.428  1.00 10.75 ? 191 THR A CB    1 
ATOM   1497 O  OG1   . THR A 1 194 ? 74.689 -11.166 -1.455  1.00 12.81 ? 191 THR A OG1   1 
ATOM   1498 C  CG2   . THR A 1 194 ? 75.744 -9.043  -1.876  1.00 12.14 ? 191 THR A CG2   1 
ATOM   1499 N  N     . VAL A 1 195 ? 73.700 -8.824  -5.019  1.00 11.85 ? 192 VAL A N     1 
ATOM   1500 C  CA    . VAL A 1 195 ? 73.795 -7.842  -6.092  1.00 13.66 ? 192 VAL A CA    1 
ATOM   1501 C  C     . VAL A 1 195 ? 72.453 -7.109  -6.179  1.00 11.21 ? 192 VAL A C     1 
ATOM   1502 O  O     . VAL A 1 195 ? 72.417 -5.885  -6.374  1.00 10.75 ? 192 VAL A O     1 
ATOM   1503 C  CB    . VAL A 1 195 ? 74.178 -8.500  -7.427  1.00 12.18 ? 192 VAL A CB    1 
ATOM   1504 C  CG1   . VAL A 1 195 ? 74.065 -7.489  -8.584  1.00 14.82 ? 192 VAL A CG1   1 
ATOM   1505 C  CG2   . VAL A 1 195 ? 75.594 -9.067  -7.339  1.00 13.73 ? 192 VAL A CG2   1 
ATOM   1506 N  N     . GLY A 1 196 ? 71.357 -7.838  -5.983  1.00 9.62  ? 193 GLY A N     1 
ATOM   1507 C  CA    . GLY A 1 196 ? 70.036 -7.211  -5.929  1.00 10.23 ? 193 GLY A CA    1 
ATOM   1508 C  C     . GLY A 1 196 ? 69.991 -6.118  -4.870  1.00 11.55 ? 193 GLY A C     1 
ATOM   1509 O  O     . GLY A 1 196 ? 69.483 -5.011  -5.109  1.00 12.41 ? 193 GLY A O     1 
ATOM   1510 N  N     . ALA A 1 197 ? 70.540 -6.409  -3.697  1.00 9.99  ? 194 ALA A N     1 
ATOM   1511 C  CA    . ALA A 1 197 ? 70.572 -5.443  -2.616  1.00 8.77  ? 194 ALA A CA    1 
ATOM   1512 C  C     . ALA A 1 197 ? 71.409 -4.202  -2.963  1.00 10.83 ? 194 ALA A C     1 
ATOM   1513 O  O     . ALA A 1 197 ? 71.047 -3.081  -2.597  1.00 10.53 ? 194 ALA A O     1 
ATOM   1514 C  CB    . ALA A 1 197 ? 71.085 -6.096  -1.352  1.00 11.42 ? 194 ALA A CB    1 
ATOM   1515 N  N     . VAL A 1 198 ? 72.506 -4.405  -3.686  1.00 10.81 ? 195 VAL A N     1 
ATOM   1516 C  CA    . VAL A 1 198 ? 73.327 -3.281  -4.159  1.00 10.51 ? 195 VAL A CA    1 
ATOM   1517 C  C     . VAL A 1 198 ? 72.510 -2.346  -5.059  1.00 14.18 ? 195 VAL A C     1 
ATOM   1518 O  O     . VAL A 1 198 ? 72.529 -1.111  -4.888  1.00 13.10 ? 195 VAL A O     1 
ATOM   1519 C  CB    . VAL A 1 198 ? 74.580 -3.779  -4.912  1.00 12.78 ? 195 VAL A CB    1 
ATOM   1520 C  CG1   . VAL A 1 198 ? 75.332 -2.603  -5.544  1.00 15.67 ? 195 VAL A CG1   1 
ATOM   1521 C  CG2   . VAL A 1 198 ? 75.496 -4.541  -3.961  1.00 14.48 ? 195 VAL A CG2   1 
ATOM   1522 N  N     . ILE A 1 199 ? 71.765 -2.943  -5.980  1.00 10.94 ? 196 ILE A N     1 
ATOM   1523 C  CA    . ILE A 1 199 ? 70.904 -2.182  -6.879  1.00 10.93 ? 196 ILE A CA    1 
ATOM   1524 C  C     . ILE A 1 199 ? 69.806 -1.455  -6.084  1.00 11.49 ? 196 ILE A C     1 
ATOM   1525 O  O     . ILE A 1 199 ? 69.524 -0.290  -6.352  1.00 12.44 ? 196 ILE A O     1 
ATOM   1526 C  CB    . ILE A 1 199 ? 70.293 -3.078  -7.955  1.00 10.64 ? 196 ILE A CB    1 
ATOM   1527 C  CG1   . ILE A 1 199 ? 71.398 -3.586  -8.902  1.00 10.65 ? 196 ILE A CG1   1 
ATOM   1528 C  CG2   . ILE A 1 199 ? 69.211 -2.333  -8.744  1.00 11.97 ? 196 ILE A CG2   1 
ATOM   1529 C  CD1   . ILE A 1 199 ? 70.958 -4.701  -9.822  1.00 14.17 ? 196 ILE A CD1   1 
ATOM   1530 N  N     . VAL A 1 200 ? 69.207 -2.118  -5.097  1.00 9.81  ? 197 VAL A N     1 
ATOM   1531 C  CA    . VAL A 1 200 ? 68.166 -1.461  -4.317  1.00 8.70  ? 197 VAL A CA    1 
ATOM   1532 C  C     . VAL A 1 200 ? 68.726 -0.311  -3.473  1.00 11.40 ? 197 VAL A C     1 
ATOM   1533 O  O     . VAL A 1 200 ? 68.042 0.696   -3.283  1.00 10.76 ? 197 VAL A O     1 
ATOM   1534 C  CB    . VAL A 1 200 ? 67.418 -2.495  -3.444  1.00 8.68  ? 197 VAL A CB    1 
ATOM   1535 C  CG1   . VAL A 1 200 ? 66.421 -1.800  -2.526  1.00 12.92 ? 197 VAL A CG1   1 
ATOM   1536 C  CG2   . VAL A 1 200 ? 66.716 -3.467  -4.348  1.00 11.76 ? 197 VAL A CG2   1 
ATOM   1537 N  N     . GLU A 1 201 ? 69.967 -0.417  -2.991  1.00 10.17 ? 198 GLU A N     1 
ATOM   1538 C  CA    . GLU A 1 201 ? 70.597 0.744   -2.345  1.00 11.14 ? 198 GLU A CA    1 
ATOM   1539 C  C     . GLU A 1 201 ? 70.627 1.927   -3.315  1.00 11.52 ? 198 GLU A C     1 
ATOM   1540 O  O     . GLU A 1 201 ? 70.340 3.075   -2.932  1.00 12.56 ? 198 GLU A O     1 
ATOM   1541 C  CB    . GLU A 1 201 ? 72.034 0.437   -1.876  1.00 12.87 ? 198 GLU A CB    1 
ATOM   1542 C  CG    . GLU A 1 201 ? 72.175 -0.591  -0.742  1.00 13.14 ? 198 GLU A CG    1 
ATOM   1543 C  CD    . GLU A 1 201 ? 72.086 -0.005  0.657   1.00 14.65 ? 198 GLU A CD    1 
ATOM   1544 O  OE1   . GLU A 1 201 ? 71.728 1.191   0.811   1.00 15.71 ? 198 GLU A OE1   1 
ATOM   1545 O  OE2   . GLU A 1 201 ? 72.372 -0.751  1.626   1.00 13.66 ? 198 GLU A OE2   1 
ATOM   1546 N  N     . GLU A 1 202 ? 70.982 1.637   -4.565  1.00 12.12 ? 199 GLU A N     1 
ATOM   1547 C  CA    . GLU A 1 202 ? 71.082 2.663   -5.593  1.00 11.30 ? 199 GLU A CA    1 
ATOM   1548 C  C     . GLU A 1 202 ? 69.704 3.261   -5.875  1.00 13.35 ? 199 GLU A C     1 
ATOM   1549 O  O     . GLU A 1 202 ? 69.553 4.488   -5.961  1.00 12.72 ? 199 GLU A O     1 
ATOM   1550 C  CB    . GLU A 1 202 ? 71.705 2.081   -6.874  1.00 14.24 ? 199 GLU A CB    1 
ATOM   1551 C  CG    . GLU A 1 202 ? 73.200 1.775   -6.733  1.00 14.09 ? 199 GLU A CG    1 
ATOM   1552 C  CD    . GLU A 1 202 ? 73.732 0.810   -7.788  1.00 19.55 ? 199 GLU A CD    1 
ATOM   1553 O  OE1   . GLU A 1 202 ? 74.952 0.537   -7.769  1.00 25.40 ? 199 GLU A OE1   1 
ATOM   1554 O  OE2   . GLU A 1 202 ? 72.954 0.335   -8.636  1.00 24.30 ? 199 GLU A OE2   1 
ATOM   1555 N  N     . MET A 1 203 ? 68.704 2.388   -5.987  1.00 11.65 ? 200 MET A N     1 
ATOM   1556 C  CA    . MET A 1 203 ? 67.322 2.824   -6.197  1.00 10.29 ? 200 MET A CA    1 
ATOM   1557 C  C     . MET A 1 203 ? 66.842 3.711   -5.072  1.00 11.41 ? 200 MET A C     1 
ATOM   1558 O  O     . MET A 1 203 ? 66.236 4.764   -5.317  1.00 12.13 ? 200 MET A O     1 
ATOM   1559 C  CB    . MET A 1 203 ? 66.377 1.629   -6.316  1.00 11.06 ? 200 MET A CB    1 
ATOM   1560 C  CG    A MET A 1 203 ? 66.662 0.686   -7.457  0.60 11.45 ? 200 MET A CG    1 
ATOM   1561 C  CG    B MET A 1 203 ? 64.978 2.014   -6.669  0.40 11.18 ? 200 MET A CG    1 
ATOM   1562 S  SD    A MET A 1 203 ? 65.444 -0.636  -7.530  0.60 14.44 ? 200 MET A SD    1 
ATOM   1563 S  SD    B MET A 1 203 ? 63.877 0.589   -6.659  0.40 17.84 ? 200 MET A SD    1 
ATOM   1564 C  CE    A MET A 1 203 ? 63.965 0.339   -7.776  0.60 8.72  ? 200 MET A CE    1 
ATOM   1565 C  CE    B MET A 1 203 ? 64.324 -0.240  -8.176  0.40 14.35 ? 200 MET A CE    1 
ATOM   1566 N  N     . ARG A 1 204 ? 67.084 3.284   -3.832  1.00 8.22  ? 201 ARG A N     1 
ATOM   1567 C  CA    . ARG A 1 204 ? 66.615 4.041   -2.675  1.00 9.75  ? 201 ARG A CA    1 
ATOM   1568 C  C     . ARG A 1 204 ? 67.339 5.386   -2.556  1.00 13.22 ? 201 ARG A C     1 
ATOM   1569 O  O     . ARG A 1 204 ? 66.734 6.378   -2.175  1.00 10.98 ? 201 ARG A O     1 
ATOM   1570 C  CB    . ARG A 1 204 ? 66.772 3.211   -1.398  1.00 10.85 ? 201 ARG A CB    1 
ATOM   1571 C  CG    . ARG A 1 204 ? 65.799 2.027   -1.396  1.00 10.20 ? 201 ARG A CG    1 
ATOM   1572 C  CD    . ARG A 1 204 ? 65.889 1.193   -0.140  1.00 13.52 ? 201 ARG A CD    1 
ATOM   1573 N  NE    . ARG A 1 204 ? 65.910 2.024   1.047   1.00 11.47 ? 201 ARG A NE    1 
ATOM   1574 C  CZ    . ARG A 1 204 ? 66.962 2.158   1.846   1.00 12.40 ? 201 ARG A CZ    1 
ATOM   1575 N  NH1   . ARG A 1 204 ? 66.907 2.979   2.882   1.00 11.73 ? 201 ARG A NH1   1 
ATOM   1576 N  NH2   . ARG A 1 204 ? 68.071 1.479   1.604   1.00 14.41 ? 201 ARG A NH2   1 
ATOM   1577 N  N     . ALA A 1 205 ? 68.618 5.418   -2.923  1.00 12.42 ? 202 ALA A N     1 
ATOM   1578 C  CA    . ALA A 1 205 ? 69.369 6.677   -2.916  1.00 11.37 ? 202 ALA A CA    1 
ATOM   1579 C  C     . ALA A 1 205 ? 68.792 7.640   -3.956  1.00 11.73 ? 202 ALA A C     1 
ATOM   1580 O  O     . ALA A 1 205 ? 68.631 8.844   -3.681  1.00 12.51 ? 202 ALA A O     1 
ATOM   1581 C  CB    . ALA A 1 205 ? 70.857 6.409   -3.188  1.00 12.94 ? 202 ALA A CB    1 
ATOM   1582 N  N     . ALA A 1 206 ? 68.456 7.104   -5.128  1.00 10.97 ? 203 ALA A N     1 
ATOM   1583 C  CA    . ALA A 1 206 ? 67.855 7.907   -6.195  1.00 11.98 ? 203 ALA A CA    1 
ATOM   1584 C  C     . ALA A 1 206 ? 66.514 8.474   -5.750  1.00 11.63 ? 203 ALA A C     1 
ATOM   1585 O  O     . ALA A 1 206 ? 66.216 9.652   -5.975  1.00 12.82 ? 203 ALA A O     1 
ATOM   1586 C  CB    . ALA A 1 206 ? 67.692 7.084   -7.471  1.00 12.88 ? 203 ALA A CB    1 
ATOM   1587 N  N     . ILE A 1 207 ? 65.693 7.648   -5.109  1.00 9.16  ? 204 ILE A N     1 
ATOM   1588 C  CA    . ILE A 1 207 ? 64.398 8.138   -4.642  1.00 9.88  ? 204 ILE A CA    1 
ATOM   1589 C  C     . ILE A 1 207 ? 64.600 9.290   -3.662  1.00 12.09 ? 204 ILE A C     1 
ATOM   1590 O  O     . ILE A 1 207 ? 63.950 10.332  -3.778  1.00 9.82  ? 204 ILE A O     1 
ATOM   1591 C  CB    . ILE A 1 207 ? 63.578 7.006   -3.990  1.00 8.78  ? 204 ILE A CB    1 
ATOM   1592 C  CG1   . ILE A 1 207 ? 63.156 5.995   -5.051  1.00 10.53 ? 204 ILE A CG1   1 
ATOM   1593 C  CG2   . ILE A 1 207 ? 62.348 7.558   -3.256  1.00 8.46  ? 204 ILE A CG2   1 
ATOM   1594 C  CD1   . ILE A 1 207 ? 62.509 4.715   -4.467  1.00 10.40 ? 204 ILE A CD1   1 
ATOM   1595 N  N     . GLU A 1 208 ? 65.509 9.124   -2.705  1.00 10.49 ? 205 GLU A N     1 
ATOM   1596 C  CA    . GLU A 1 208 ? 65.688 10.161  -1.692  1.00 9.85  ? 205 GLU A CA    1 
ATOM   1597 C  C     . GLU A 1 208 ? 66.290 11.415  -2.317  1.00 12.10 ? 205 GLU A C     1 
ATOM   1598 O  O     . GLU A 1 208 ? 65.830 12.526  -2.047  1.00 11.53 ? 205 GLU A O     1 
ATOM   1599 C  CB    . GLU A 1 208 ? 66.567 9.673   -0.542  1.00 12.74 ? 205 GLU A CB    1 
ATOM   1600 C  CG    . GLU A 1 208 ? 66.703 10.727  0.557   1.00 14.15 ? 205 GLU A CG    1 
ATOM   1601 C  CD    . GLU A 1 208 ? 67.431 10.244  1.801   1.00 14.02 ? 205 GLU A CD    1 
ATOM   1602 O  OE1   . GLU A 1 208 ? 67.426 11.001  2.791   1.00 18.78 ? 205 GLU A OE1   1 
ATOM   1603 O  OE2   . GLU A 1 208 ? 68.010 9.133   1.786   1.00 18.37 ? 205 GLU A OE2   1 
ATOM   1604 N  N     . ARG A 1 209 ? 67.286 11.238  -3.181  1.00 11.41 ? 206 ARG A N     1 
ATOM   1605 C  CA    . ARG A 1 209 ? 67.904 12.400  -3.833  1.00 12.15 ? 206 ARG A CA    1 
ATOM   1606 C  C     . ARG A 1 209 ? 66.871 13.220  -4.611  1.00 12.07 ? 206 ARG A C     1 
ATOM   1607 O  O     . ARG A 1 209 ? 66.853 14.454  -4.515  1.00 13.42 ? 206 ARG A O     1 
ATOM   1608 C  CB    . ARG A 1 209 ? 69.040 11.983  -4.779  1.00 13.71 ? 206 ARG A CB    1 
ATOM   1609 C  CG    . ARG A 1 209 ? 69.806 13.216  -5.340  1.00 14.51 ? 206 ARG A CG    1 
ATOM   1610 C  CD    . ARG A 1 209 ? 70.844 12.874  -6.408  1.00 17.37 ? 206 ARG A CD    1 
ATOM   1611 N  NE    . ARG A 1 209 ? 70.258 12.624  -7.732  1.00 22.11 ? 206 ARG A NE    1 
ATOM   1612 C  CZ    . ARG A 1 209 ? 69.903 13.571  -8.603  1.00 18.66 ? 206 ARG A CZ    1 
ATOM   1613 N  NH1   . ARG A 1 209 ? 69.395 13.232  -9.781  1.00 18.18 ? 206 ARG A NH1   1 
ATOM   1614 N  NH2   . ARG A 1 209 ? 70.062 14.854  -8.305  1.00 17.10 ? 206 ARG A NH2   1 
ATOM   1615 N  N     . GLU A 1 210 ? 66.016 12.536  -5.366  1.00 10.45 ? 207 GLU A N     1 
ATOM   1616 C  CA    . GLU A 1 210 ? 65.160 13.186  -6.359  1.00 10.05 ? 207 GLU A CA    1 
ATOM   1617 C  C     . GLU A 1 210 ? 63.784 13.583  -5.838  1.00 11.53 ? 207 GLU A C     1 
ATOM   1618 O  O     . GLU A 1 210 ? 63.073 14.360  -6.491  1.00 10.29 ? 207 GLU A O     1 
ATOM   1619 C  CB    . GLU A 1 210 ? 65.017 12.287  -7.589  1.00 11.02 ? 207 GLU A CB    1 
ATOM   1620 C  CG    . GLU A 1 210 ? 66.342 11.969  -8.251  1.00 9.70  ? 207 GLU A CG    1 
ATOM   1621 C  CD    . GLU A 1 210 ? 66.225 11.091  -9.483  1.00 18.48 ? 207 GLU A CD    1 
ATOM   1622 O  OE1   . GLU A 1 210 ? 65.184 11.128  -10.178 1.00 18.49 ? 207 GLU A OE1   1 
ATOM   1623 O  OE2   . GLU A 1 210 ? 67.202 10.360  -9.759  1.00 25.04 ? 207 GLU A OE2   1 
ATOM   1624 N  N     . THR A 1 211 ? 63.410 13.091  -4.657  1.00 10.25 ? 208 THR A N     1 
ATOM   1625 C  CA    . THR A 1 211 ? 62.104 13.431  -4.095  1.00 10.17 ? 208 THR A CA    1 
ATOM   1626 C  C     . THR A 1 211 ? 62.175 13.962  -2.678  1.00 10.60 ? 208 THR A C     1 
ATOM   1627 O  O     . THR A 1 211 ? 61.240 14.619  -2.229  1.00 12.33 ? 208 THR A O     1 
ATOM   1628 C  CB    . THR A 1 211 ? 61.127 12.209  -4.077  1.00 10.05 ? 208 THR A CB    1 
ATOM   1629 O  OG1   . THR A 1 211 ? 61.563 11.233  -3.114  1.00 9.46  ? 208 THR A OG1   1 
ATOM   1630 C  CG2   . THR A 1 211 ? 61.006 11.565  -5.444  1.00 9.71  ? 208 THR A CG2   1 
ATOM   1631 N  N     . GLY A 1 212 ? 63.241 13.637  -1.945  1.00 9.04  ? 209 GLY A N     1 
ATOM   1632 C  CA    . GLY A 1 212 ? 63.319 13.948  -0.520  1.00 11.15 ? 209 GLY A CA    1 
ATOM   1633 C  C     . GLY A 1 212 ? 62.756 12.856  0.387   1.00 12.56 ? 209 GLY A C     1 
ATOM   1634 O  O     . GLY A 1 212 ? 62.898 12.926  1.610   1.00 17.31 ? 209 GLY A O     1 
ATOM   1635 N  N     . PHE A 1 213 ? 62.137 11.841  -0.210  1.00 11.19 ? 210 PHE A N     1 
ATOM   1636 C  CA    . PHE A 1 213 ? 61.443 10.807  0.565   1.00 10.16 ? 210 PHE A CA    1 
ATOM   1637 C  C     . PHE A 1 213 ? 62.359 9.628   0.855   1.00 12.01 ? 210 PHE A C     1 
ATOM   1638 O  O     . PHE A 1 213 ? 63.060 9.152   -0.034  1.00 12.89 ? 210 PHE A O     1 
ATOM   1639 C  CB    . PHE A 1 213 ? 60.211 10.285  -0.177  1.00 8.79  ? 210 PHE A CB    1 
ATOM   1640 C  CG    . PHE A 1 213 ? 59.208 11.344  -0.564  1.00 8.58  ? 210 PHE A CG    1 
ATOM   1641 C  CD1   . PHE A 1 213 ? 58.536 11.246  -1.775  1.00 11.30 ? 210 PHE A CD1   1 
ATOM   1642 C  CD2   . PHE A 1 213 ? 58.914 12.409  0.278   1.00 9.97  ? 210 PHE A CD2   1 
ATOM   1643 C  CE1   . PHE A 1 213 ? 57.595 12.206  -2.157  1.00 10.26 ? 210 PHE A CE1   1 
ATOM   1644 C  CE2   . PHE A 1 213 ? 57.978 13.373  -0.100  1.00 10.73 ? 210 PHE A CE2   1 
ATOM   1645 C  CZ    . PHE A 1 213 ? 57.311 13.256  -1.316  1.00 8.56  ? 210 PHE A CZ    1 
ATOM   1646 N  N     . GLN A 1 214 ? 62.328 9.159   2.097   1.00 9.69  ? 211 GLN A N     1 
ATOM   1647 C  CA    . GLN A 1 214 ? 63.026 7.937   2.496   1.00 9.91  ? 211 GLN A CA    1 
ATOM   1648 C  C     . GLN A 1 214 ? 62.110 6.727   2.417   1.00 10.07 ? 211 GLN A C     1 
ATOM   1649 O  O     . GLN A 1 214 ? 60.883 6.844   2.533   1.00 10.76 ? 211 GLN A O     1 
ATOM   1650 C  CB    . GLN A 1 214 ? 63.584 8.071   3.914   1.00 13.02 ? 211 GLN A CB    1 
ATOM   1651 C  CG    . GLN A 1 214 ? 64.716 9.093   3.978   1.00 13.67 ? 211 GLN A CG    1 
ATOM   1652 C  CD    . GLN A 1 214 ? 65.352 9.214   5.341   1.00 15.39 ? 211 GLN A CD    1 
ATOM   1653 O  OE1   . GLN A 1 214 ? 64.796 8.783   6.354   1.00 15.16 ? 211 GLN A OE1   1 
ATOM   1654 N  NE2   . GLN A 1 214 ? 66.544 9.805   5.369   1.00 16.92 ? 211 GLN A NE2   1 
ATOM   1655 N  N     . CYS A 1 215 ? 62.709 5.553   2.259   1.00 9.54  ? 212 CYS A N     1 
ATOM   1656 C  CA    . CYS A 1 215 ? 61.922 4.327   2.153   1.00 9.39  ? 212 CYS A CA    1 
ATOM   1657 C  C     . CYS A 1 215 ? 62.696 3.156   2.703   1.00 9.43  ? 212 CYS A C     1 
ATOM   1658 O  O     . CYS A 1 215 ? 63.900 3.245   2.963   1.00 12.05 ? 212 CYS A O     1 
ATOM   1659 C  CB    . CYS A 1 215 ? 61.528 4.036   0.703   1.00 10.08 ? 212 CYS A CB    1 
ATOM   1660 S  SG    . CYS A 1 215 ? 62.954 3.831   -0.373  1.00 15.82 ? 212 CYS A SG    1 
ATOM   1661 N  N     . SER A 1 216 ? 61.989 2.049   2.871   1.00 9.55  ? 213 SER A N     1 
ATOM   1662 C  CA    . SER A 1 216 ? 62.631 0.805   3.261   1.00 9.87  ? 213 SER A CA    1 
ATOM   1663 C  C     . SER A 1 216 ? 62.444 -0.191  2.143   1.00 10.72 ? 213 SER A C     1 
ATOM   1664 O  O     . SER A 1 216 ? 61.667 0.061   1.232   1.00 10.46 ? 213 SER A O     1 
ATOM   1665 C  CB    . SER A 1 216 ? 62.033 0.290   4.559   1.00 11.07 ? 213 SER A CB    1 
ATOM   1666 O  OG    . SER A 1 216 ? 62.284 1.234   5.595   1.00 14.65 ? 213 SER A OG    1 
ATOM   1667 N  N     . ALA A 1 217 ? 63.160 -1.313  2.179   1.00 9.26  ? 214 ALA A N     1 
ATOM   1668 C  CA    . ALA A 1 217 ? 62.992 -2.317  1.139   1.00 8.04  ? 214 ALA A CA    1 
ATOM   1669 C  C     . ALA A 1 217 ? 63.334 -3.698  1.642   1.00 9.01  ? 214 ALA A C     1 
ATOM   1670 O  O     . ALA A 1 217 ? 64.133 -3.837  2.567   1.00 9.19  ? 214 ALA A O     1 
ATOM   1671 C  CB    . ALA A 1 217 ? 63.851 -1.994  -0.079  1.00 9.38  ? 214 ALA A CB    1 
ATOM   1672 N  N     . GLY A 1 218 ? 62.723 -4.701  1.011   1.00 9.47  ? 215 GLY A N     1 
ATOM   1673 C  CA    . GLY A 1 218 ? 63.053 -6.103  1.239   1.00 7.87  ? 215 GLY A CA    1 
ATOM   1674 C  C     . GLY A 1 218 ? 63.595 -6.681  -0.055  1.00 8.90  ? 215 GLY A C     1 
ATOM   1675 O  O     . GLY A 1 218 ? 63.106 -6.362  -1.138  1.00 8.96  ? 215 GLY A O     1 
ATOM   1676 N  N     . ILE A 1 219 ? 64.611 -7.528  0.044   1.00 7.92  ? 216 ILE A N     1 
ATOM   1677 C  CA    . ILE A 1 219 ? 65.163 -8.212  -1.115  1.00 7.43  ? 216 ILE A CA    1 
ATOM   1678 C  C     . ILE A 1 219 ? 65.166 -9.700  -0.817  1.00 8.76  ? 216 ILE A C     1 
ATOM   1679 O  O     . ILE A 1 219 ? 65.771 -10.138 0.174   1.00 9.66  ? 216 ILE A O     1 
ATOM   1680 C  CB    . ILE A 1 219 ? 66.605 -7.762  -1.438  1.00 9.85  ? 216 ILE A CB    1 
ATOM   1681 C  CG1   . ILE A 1 219 ? 66.681 -6.238  -1.633  1.00 10.71 ? 216 ILE A CG1   1 
ATOM   1682 C  CG2   . ILE A 1 219 ? 67.114 -8.476  -2.677  1.00 11.33 ? 216 ILE A CG2   1 
ATOM   1683 C  CD1   . ILE A 1 219 ? 67.098 -5.471  -0.393  1.00 12.74 ? 216 ILE A CD1   1 
ATOM   1684 N  N     . SER A 1 220 ? 64.476 -10.468 -1.654  1.00 8.96  ? 217 SER A N     1 
ATOM   1685 C  CA    . SER A 1 220 ? 64.453 -11.915 -1.521  1.00 6.82  ? 217 SER A CA    1 
ATOM   1686 C  C     . SER A 1 220 ? 64.174 -12.563 -2.870  1.00 8.72  ? 217 SER A C     1 
ATOM   1687 O  O     . SER A 1 220 ? 64.422 -11.964 -3.917  1.00 9.83  ? 217 SER A O     1 
ATOM   1688 C  CB    . SER A 1 220 ? 63.404 -12.336 -0.481  1.00 12.04 ? 217 SER A CB    1 
ATOM   1689 O  OG    . SER A 1 220 ? 63.579 -13.694 -0.112  1.00 11.88 ? 217 SER A OG    1 
ATOM   1690 N  N     . HIS A 1 221 ? 63.694 -13.801 -2.850  1.00 9.90  ? 218 HIS A N     1 
ATOM   1691 C  CA    . HIS A 1 221 ? 63.467 -14.541 -4.088  1.00 9.42  ? 218 HIS A CA    1 
ATOM   1692 C  C     . HIS A 1 221 ? 62.022 -14.506 -4.582  1.00 10.43 ? 218 HIS A C     1 
ATOM   1693 O  O     . HIS A 1 221 ? 61.722 -15.070 -5.636  1.00 10.04 ? 218 HIS A O     1 
ATOM   1694 C  CB    . HIS A 1 221 ? 63.905 -15.998 -3.911  1.00 10.41 ? 218 HIS A CB    1 
ATOM   1695 C  CG    . HIS A 1 221 ? 65.385 -16.169 -3.808  1.00 11.75 ? 218 HIS A CG    1 
ATOM   1696 N  ND1   . HIS A 1 221 ? 66.240 -15.846 -4.843  1.00 10.20 ? 218 HIS A ND1   1 
ATOM   1697 C  CD2   . HIS A 1 221 ? 66.166 -16.654 -2.811  1.00 11.30 ? 218 HIS A CD2   1 
ATOM   1698 C  CE1   . HIS A 1 221 ? 67.482 -16.118 -4.484  1.00 12.97 ? 218 HIS A CE1   1 
ATOM   1699 N  NE2   . HIS A 1 221 ? 67.465 -16.607 -3.253  1.00 11.35 ? 218 HIS A NE2   1 
ATOM   1700 N  N     . ASN A 1 222 ? 61.129 -13.883 -3.825  1.00 8.33  ? 219 ASN A N     1 
ATOM   1701 C  CA    . ASN A 1 222 ? 59.742 -13.776 -4.244  1.00 8.65  ? 219 ASN A CA    1 
ATOM   1702 C  C     . ASN A 1 222 ? 59.059 -12.621 -3.522  1.00 8.59  ? 219 ASN A C     1 
ATOM   1703 O  O     . ASN A 1 222 ? 59.632 -12.000 -2.613  1.00 9.86  ? 219 ASN A O     1 
ATOM   1704 C  CB    . ASN A 1 222 ? 58.990 -15.091 -3.979  1.00 8.42  ? 219 ASN A CB    1 
ATOM   1705 C  CG    . ASN A 1 222 ? 59.119 -15.547 -2.545  1.00 8.89  ? 219 ASN A CG    1 
ATOM   1706 O  OD1   . ASN A 1 222 ? 58.638 -14.880 -1.644  1.00 10.26 ? 219 ASN A OD1   1 
ATOM   1707 N  ND2   . ASN A 1 222 ? 59.736 -16.714 -2.332  1.00 9.81  ? 219 ASN A ND2   1 
ATOM   1708 N  N     . LYS A 1 223 ? 57.827 -12.334 -3.926  1.00 8.93  ? 220 LYS A N     1 
ATOM   1709 C  CA    . LYS A 1 223 ? 57.122 -11.174 -3.396  1.00 9.21  ? 220 LYS A CA    1 
ATOM   1710 C  C     . LYS A 1 223 ? 56.792 -11.283 -1.909  1.00 9.92  ? 220 LYS A C     1 
ATOM   1711 O  O     . LYS A 1 223 ? 56.931 -10.299 -1.164  1.00 9.07  ? 220 LYS A O     1 
ATOM   1712 C  CB    . LYS A 1 223 ? 55.839 -10.935 -4.196  1.00 10.86 ? 220 LYS A CB    1 
ATOM   1713 C  CG    . LYS A 1 223 ? 56.099 -10.407 -5.606  1.00 12.12 ? 220 LYS A CG    1 
ATOM   1714 C  CD    . LYS A 1 223 ? 54.887 -9.648  -6.154  1.00 26.25 ? 220 LYS A CD    1 
ATOM   1715 C  CE    . LYS A 1 223 ? 53.823 -10.571 -6.632  1.00 27.25 ? 220 LYS A CE    1 
ATOM   1716 N  NZ    . LYS A 1 223 ? 52.671 -9.849  -7.286  1.00 17.11 ? 220 LYS A NZ    1 
ATOM   1717 N  N     . VAL A 1 224 ? 56.330 -12.454 -1.466  1.00 10.05 ? 221 VAL A N     1 
ATOM   1718 C  CA    . VAL A 1 224 ? 55.945 -12.597 -0.060  1.00 9.11  ? 221 VAL A CA    1 
ATOM   1719 C  C     . VAL A 1 224 ? 57.140 -12.395 0.881   1.00 8.03  ? 221 VAL A C     1 
ATOM   1720 O  O     . VAL A 1 224 ? 57.043 -11.649 1.876   1.00 9.92  ? 221 VAL A O     1 
ATOM   1721 C  CB    . VAL A 1 224 ? 55.304 -13.970 0.222   1.00 11.78 ? 221 VAL A CB    1 
ATOM   1722 C  CG1   . VAL A 1 224 ? 55.319 -14.284 1.716   1.00 15.04 ? 221 VAL A CG1   1 
ATOM   1723 C  CG2   . VAL A 1 224 ? 53.882 -13.990 -0.312  1.00 13.10 ? 221 VAL A CG2   1 
ATOM   1724 N  N     . LEU A 1 225 ? 58.272 -13.011 0.551   1.00 9.69  ? 222 LEU A N     1 
ATOM   1725 C  CA    . LEU A 1 225 ? 59.474 -12.844 1.369   1.00 9.12  ? 222 LEU A CA    1 
ATOM   1726 C  C     . LEU A 1 225 ? 60.022 -11.417 1.274   1.00 7.91  ? 222 LEU A C     1 
ATOM   1727 O  O     . LEU A 1 225 ? 60.491 -10.865 2.268   1.00 9.00  ? 222 LEU A O     1 
ATOM   1728 C  CB    . LEU A 1 225 ? 60.554 -13.856 0.966   1.00 9.29  ? 222 LEU A CB    1 
ATOM   1729 C  CG    . LEU A 1 225 ? 60.266 -15.298 1.393   1.00 9.33  ? 222 LEU A CG    1 
ATOM   1730 C  CD1   . LEU A 1 225 ? 61.437 -16.204 0.983   1.00 10.77 ? 222 LEU A CD1   1 
ATOM   1731 C  CD2   . LEU A 1 225 ? 59.976 -15.390 2.894   1.00 11.49 ? 222 LEU A CD2   1 
ATOM   1732 N  N     . ALA A 1 226 ? 59.952 -10.814 0.087   1.00 7.79  ? 223 ALA A N     1 
ATOM   1733 C  CA    . ALA A 1 226 ? 60.411 -9.437  -0.049  1.00 8.32  ? 223 ALA A CA    1 
ATOM   1734 C  C     . ALA A 1 226 ? 59.581 -8.482  0.797   1.00 9.10  ? 223 ALA A C     1 
ATOM   1735 O  O     . ALA A 1 226 ? 60.138 -7.583  1.446   1.00 9.05  ? 223 ALA A O     1 
ATOM   1736 C  CB    . ALA A 1 226 ? 60.388 -9.004  -1.502  1.00 10.93 ? 223 ALA A CB    1 
ATOM   1737 N  N     . LYS A 1 227 ? 58.260 -8.662  0.797   1.00 9.90  ? 224 LYS A N     1 
ATOM   1738 C  CA    . LYS A 1 227 ? 57.390 -7.834  1.627   1.00 9.17  ? 224 LYS A CA    1 
ATOM   1739 C  C     . LYS A 1 227 ? 57.690 -8.029  3.115   1.00 10.99 ? 224 LYS A C     1 
ATOM   1740 O  O     . LYS A 1 227 ? 57.772 -7.055  3.873   1.00 11.51 ? 224 LYS A O     1 
ATOM   1741 C  CB    . LYS A 1 227 ? 55.913 -8.148  1.343   1.00 10.03 ? 224 LYS A CB    1 
ATOM   1742 C  CG    A LYS A 1 227 ? 54.939 -7.377  2.240   0.65 11.41 ? 224 LYS A CG    1 
ATOM   1743 C  CG    B LYS A 1 227 ? 54.933 -7.358  2.202   0.35 11.44 ? 224 LYS A CG    1 
ATOM   1744 C  CD    A LYS A 1 227 ? 55.049 -5.864  2.087   0.65 14.42 ? 224 LYS A CD    1 
ATOM   1745 C  CD    B LYS A 1 227 ? 53.497 -7.625  1.766   0.35 13.14 ? 224 LYS A CD    1 
ATOM   1746 C  CE    A LYS A 1 227 ? 54.020 -5.157  2.976   0.65 15.51 ? 224 LYS A CE    1 
ATOM   1747 C  CE    B LYS A 1 227 ? 52.490 -6.917  2.659   0.35 18.65 ? 224 LYS A CE    1 
ATOM   1748 N  NZ    A LYS A 1 227 ? 53.960 -3.668  2.818   0.65 10.10 ? 224 LYS A NZ    1 
ATOM   1749 N  NZ    B LYS A 1 227 ? 52.754 -5.473  2.802   0.35 19.44 ? 224 LYS A NZ    1 
ATOM   1750 N  N     . LEU A 1 228 ? 57.860 -9.284  3.528   1.00 9.92  ? 225 LEU A N     1 
ATOM   1751 C  CA    . LEU A 1 228 ? 58.148 -9.587  4.922   1.00 9.99  ? 225 LEU A CA    1 
ATOM   1752 C  C     . LEU A 1 228 ? 59.478 -8.955  5.332   1.00 10.68 ? 225 LEU A C     1 
ATOM   1753 O  O     . LEU A 1 228 ? 59.589 -8.294  6.376   1.00 11.09 ? 225 LEU A O     1 
ATOM   1754 C  CB    . LEU A 1 228 ? 58.180 -11.097 5.131   1.00 12.28 ? 225 LEU A CB    1 
ATOM   1755 C  CG    . LEU A 1 228 ? 58.354 -11.538 6.582   1.00 14.61 ? 225 LEU A CG    1 
ATOM   1756 C  CD1   . LEU A 1 228 ? 57.142 -11.107 7.422   1.00 17.00 ? 225 LEU A CD1   1 
ATOM   1757 C  CD2   . LEU A 1 228 ? 58.539 -13.036 6.626   1.00 11.39 ? 225 LEU A CD2   1 
ATOM   1758 N  N     . ALA A 1 229 ? 60.484 -9.158  4.487   1.00 9.22  ? 226 ALA A N     1 
ATOM   1759 C  CA    . ALA A 1 229 ? 61.810 -8.585  4.712   1.00 9.08  ? 226 ALA A CA    1 
ATOM   1760 C  C     . ALA A 1 229 ? 61.769 -7.069  4.909   1.00 9.01  ? 226 ALA A C     1 
ATOM   1761 O  O     . ALA A 1 229 ? 62.449 -6.520  5.779   1.00 12.02 ? 226 ALA A O     1 
ATOM   1762 C  CB    . ALA A 1 229 ? 62.725 -8.925  3.551   1.00 9.14  ? 226 ALA A CB    1 
ATOM   1763 N  N     . CYS A 1 230 ? 60.989 -6.390  4.069   1.00 9.28  ? 227 CYS A N     1 
ATOM   1764 C  CA    . CYS A 1 230 ? 60.948 -4.935  4.076   1.00 10.03 ? 227 CYS A CA    1 
ATOM   1765 C  C     . CYS A 1 230 ? 60.604 -4.387  5.459   1.00 9.91  ? 227 CYS A C     1 
ATOM   1766 O  O     . CYS A 1 230 ? 61.235 -3.428  5.940   1.00 13.59 ? 227 CYS A O     1 
ATOM   1767 C  CB    . CYS A 1 230 ? 59.931 -4.455  3.038   1.00 8.44  ? 227 CYS A CB    1 
ATOM   1768 S  SG    . CYS A 1 230 ? 59.824 -2.644  2.905   1.00 11.81 ? 227 CYS A SG    1 
ATOM   1769 N  N     . GLY A 1 231 ? 59.650 -5.034  6.119   1.00 9.86  ? 228 GLY A N     1 
ATOM   1770 C  CA    . GLY A 1 231 ? 59.226 -4.586  7.439   1.00 14.17 ? 228 GLY A CA    1 
ATOM   1771 C  C     . GLY A 1 231 ? 60.158 -4.903  8.599   1.00 13.49 ? 228 GLY A C     1 
ATOM   1772 O  O     . GLY A 1 231 ? 59.989 -4.363  9.689   1.00 18.79 ? 228 GLY A O     1 
ATOM   1773 N  N     . LEU A 1 232 ? 61.154 -5.752  8.383   1.00 11.84 ? 229 LEU A N     1 
ATOM   1774 C  CA    . LEU A 1 232 ? 61.992 -6.211  9.501   1.00 11.04 ? 229 LEU A CA    1 
ATOM   1775 C  C     . LEU A 1 232 ? 62.892 -5.116  10.065  1.00 12.80 ? 229 LEU A C     1 
ATOM   1776 O  O     . LEU A 1 232 ? 63.223 -5.124  11.262  1.00 13.98 ? 229 LEU A O     1 
ATOM   1777 C  CB    . LEU A 1 232 ? 62.845 -7.398  9.057   1.00 12.38 ? 229 LEU A CB    1 
ATOM   1778 C  CG    . LEU A 1 232 ? 62.025 -8.652  8.748   1.00 14.11 ? 229 LEU A CG    1 
ATOM   1779 C  CD1   . LEU A 1 232 ? 62.931 -9.794  8.291   1.00 12.33 ? 229 LEU A CD1   1 
ATOM   1780 C  CD2   . LEU A 1 232 ? 61.193 -9.058  9.961   1.00 15.44 ? 229 LEU A CD2   1 
ATOM   1781 N  N     A ASN A 1 233 ? 63.225 -4.179  9.240   0.50 12.07 ? 230 ASN A N     1 
ATOM   1782 N  N     B ASN A 1 233 ? 63.212 -4.169  9.234   0.50 12.07 ? 230 ASN A N     1 
ATOM   1783 C  CA    A ASN A 1 233 ? 64.086 -3.110  9.683   0.50 12.58 ? 230 ASN A CA    1 
ATOM   1784 C  CA    B ASN A 1 233 ? 64.123 -3.122  9.663   0.50 12.56 ? 230 ASN A CA    1 
ATOM   1785 C  C     A ASN A 1 233 ? 63.603 -1.832  9.042   0.50 13.44 ? 230 ASN A C     1 
ATOM   1786 C  C     B ASN A 1 233 ? 63.801 -1.681  9.288   0.50 13.66 ? 230 ASN A C     1 
ATOM   1787 O  O     A ASN A 1 233 ? 63.968 -1.544  8.018   0.50 14.32 ? 230 ASN A O     1 
ATOM   1788 O  O     B ASN A 1 233 ? 64.673 -0.874  9.215   0.50 13.60 ? 230 ASN A O     1 
ATOM   1789 C  CB    A ASN A 1 233 ? 65.542 -3.373  9.305   0.50 14.66 ? 230 ASN A CB    1 
ATOM   1790 C  CB    B ASN A 1 233 ? 65.571 -3.415  9.281   0.50 14.65 ? 230 ASN A CB    1 
ATOM   1791 C  CG    A ASN A 1 233 ? 66.155 -4.543  10.040  0.50 14.20 ? 230 ASN A CG    1 
ATOM   1792 C  CG    B ASN A 1 233 ? 66.165 -4.564  10.033  0.50 14.20 ? 230 ASN A CG    1 
ATOM   1793 O  OD1   A ASN A 1 233 ? 66.545 -4.413  11.167  0.50 15.66 ? 230 ASN A OD1   1 
ATOM   1794 O  OD1   B ASN A 1 233 ? 66.544 -4.422  11.164  0.50 15.65 ? 230 ASN A OD1   1 
ATOM   1795 N  ND2   A ASN A 1 233 ? 66.306 -5.640  9.341   0.50 13.18 ? 230 ASN A ND2   1 
ATOM   1796 N  ND2   B ASN A 1 233 ? 66.316 -5.663  9.346   0.50 13.18 ? 230 ASN A ND2   1 
ATOM   1797 N  N     A LYS A 1 234 ? 62.664 -1.174  9.630   0.50 18.31 ? 231 LYS A N     1 
ATOM   1798 N  N     B LYS A 1 234 ? 62.573 -1.306  9.303   0.50 17.89 ? 231 LYS A N     1 
ATOM   1799 C  CA    A LYS A 1 234 ? 62.127 0.091   9.132   0.50 15.51 ? 231 LYS A CA    1 
ATOM   1800 C  CA    B LYS A 1 234 ? 62.153 0.075   9.035   0.50 15.49 ? 231 LYS A CA    1 
ATOM   1801 C  C     A LYS A 1 234 ? 62.437 1.044   10.253  0.50 19.37 ? 231 LYS A C     1 
ATOM   1802 C  C     B LYS A 1 234 ? 62.417 1.027   10.215  0.50 19.34 ? 231 LYS A C     1 
ATOM   1803 O  O     A LYS A 1 234 ? 62.425 0.618   11.343  0.50 22.65 ? 231 LYS A O     1 
ATOM   1804 O  O     B LYS A 1 234 ? 62.395 0.576   11.302  0.50 22.67 ? 231 LYS A O     1 
ATOM   1805 C  CB    A LYS A 1 234 ? 60.601 0.013   8.915   0.50 17.56 ? 231 LYS A CB    1 
ATOM   1806 C  CB    B LYS A 1 234 ? 60.690 0.076   8.595   0.50 18.00 ? 231 LYS A CB    1 
ATOM   1807 C  CG    A LYS A 1 234 ? 60.160 -0.190  7.485   0.50 15.68 ? 231 LYS A CG    1 
ATOM   1808 C  CG    B LYS A 1 234 ? 59.818 -0.675  9.504   0.50 18.32 ? 231 LYS A CG    1 
ATOM   1809 C  CD    A LYS A 1 234 ? 58.659 0.103   7.131   0.50 15.47 ? 231 LYS A CD    1 
ATOM   1810 C  CD    B LYS A 1 234 ? 58.385 -0.705  9.001   0.50 16.22 ? 231 LYS A CD    1 
ATOM   1811 C  CE    A LYS A 1 234 ? 58.379 0.196   5.597   0.50 12.99 ? 231 LYS A CE    1 
ATOM   1812 C  CE    B LYS A 1 234 ? 57.407 -0.362  10.134  0.50 17.12 ? 231 LYS A CE    1 
ATOM   1813 N  NZ    A LYS A 1 234 ? 58.358 1.628   5.170   0.50 5.93  ? 231 LYS A NZ    1 
ATOM   1814 N  NZ    B LYS A 1 234 ? 56.026 -0.476  9.605   0.50 17.47 ? 231 LYS A NZ    1 
ATOM   1815 N  N     . PRO A 1 235 ? 62.594 2.328   10.006  1.00 13.98 ? 232 PRO A N     1 
ATOM   1816 C  CA    . PRO A 1 235 ? 62.561 2.994   8.703   1.00 11.38 ? 232 PRO A CA    1 
ATOM   1817 C  C     . PRO A 1 235 ? 63.940 3.156   8.093   1.00 12.02 ? 232 PRO A C     1 
ATOM   1818 O  O     . PRO A 1 235 ? 64.957 2.945   8.763   1.00 13.28 ? 232 PRO A O     1 
ATOM   1819 C  CB    . PRO A 1 235 ? 61.982 4.363   9.045   1.00 15.43 ? 232 PRO A CB    1 
ATOM   1820 C  CG    . PRO A 1 235 ? 62.581 4.652   10.404  1.00 15.62 ? 232 PRO A CG    1 
ATOM   1821 C  CD    . PRO A 1 235 ? 62.674 3.301   11.107  1.00 16.24 ? 232 PRO A CD    1 
ATOM   1822 N  N     . ASN A 1 236 ? 63.957 3.550   6.825   1.00 11.26 ? 233 ASN A N     1 
ATOM   1823 C  CA    . ASN A 1 236 ? 65.180 3.952   6.139   1.00 11.56 ? 233 ASN A CA    1 
ATOM   1824 C  C     . ASN A 1 236 ? 66.275 2.887   6.113   1.00 9.06  ? 233 ASN A C     1 
ATOM   1825 O  O     . ASN A 1 236 ? 67.457 3.212   6.176   1.00 11.48 ? 233 ASN A O     1 
ATOM   1826 C  CB    . ASN A 1 236 ? 65.730 5.229   6.778   1.00 12.35 ? 233 ASN A CB    1 
ATOM   1827 C  CG    . ASN A 1 236 ? 66.696 5.960   5.878   1.00 13.33 ? 233 ASN A CG    1 
ATOM   1828 O  OD1   . ASN A 1 236 ? 66.595 5.891   4.657   1.00 16.48 ? 233 ASN A OD1   1 
ATOM   1829 N  ND2   . ASN A 1 236 ? 67.642 6.666   6.480   1.00 17.10 ? 233 ASN A ND2   1 
ATOM   1830 N  N     . ARG A 1 237 ? 65.874 1.622   6.004   1.00 9.65  ? 234 ARG A N     1 
ATOM   1831 C  CA    . ARG A 1 237 ? 66.831 0.514   5.927   1.00 10.73 ? 234 ARG A CA    1 
ATOM   1832 C  C     . ARG A 1 237 ? 66.287 -0.530  4.983   1.00 11.47 ? 234 ARG A C     1 
ATOM   1833 O  O     . ARG A 1 237 ? 65.100 -0.522  4.664   1.00 11.42 ? 234 ARG A O     1 
ATOM   1834 C  CB    . ARG A 1 237 ? 67.083 -0.117  7.308   1.00 12.05 ? 234 ARG A CB    1 
ATOM   1835 C  CG    . ARG A 1 237 ? 67.722 0.796   8.344   1.00 13.12 ? 234 ARG A CG    1 
ATOM   1836 C  CD    . ARG A 1 237 ? 69.162 1.088   7.996   1.00 17.37 ? 234 ARG A CD    1 
ATOM   1837 N  NE    . ARG A 1 237 ? 69.844 1.872   9.032   1.00 17.14 ? 234 ARG A NE    1 
ATOM   1838 C  CZ    . ARG A 1 237 ? 69.922 3.202   9.036   1.00 23.71 ? 234 ARG A CZ    1 
ATOM   1839 N  NH1   . ARG A 1 237 ? 69.351 3.913   8.070   1.00 21.52 ? 234 ARG A NH1   1 
ATOM   1840 N  NH2   . ARG A 1 237 ? 70.573 3.826   10.010  1.00 26.44 ? 234 ARG A NH2   1 
ATOM   1841 N  N     . GLN A 1 238 ? 67.136 -1.445  4.537   1.00 8.91  ? 235 GLN A N     1 
ATOM   1842 C  CA    . GLN A 1 238 ? 66.655 -2.537  3.700   1.00 8.80  ? 235 GLN A CA    1 
ATOM   1843 C  C     . GLN A 1 238 ? 67.173 -3.862  4.230   1.00 9.86  ? 235 GLN A C     1 
ATOM   1844 O  O     . GLN A 1 238 ? 68.224 -3.927  4.865   1.00 10.41 ? 235 GLN A O     1 
ATOM   1845 C  CB    . GLN A 1 238 ? 67.076 -2.337  2.244   1.00 12.19 ? 235 GLN A CB    1 
ATOM   1846 C  CG    . GLN A 1 238 ? 68.591 -2.164  2.053   1.00 11.04 ? 235 GLN A CG    1 
ATOM   1847 C  CD    . GLN A 1 238 ? 68.949 -1.897  0.599   1.00 11.27 ? 235 GLN A CD    1 
ATOM   1848 O  OE1   . GLN A 1 238 ? 68.532 -0.887  0.010   1.00 13.69 ? 235 GLN A OE1   1 
ATOM   1849 N  NE2   . GLN A 1 238 ? 69.698 -2.813  -0.003  1.00 9.35  ? 235 GLN A NE2   1 
ATOM   1850 N  N     . THR A 1 239 ? 66.431 -4.923  3.950   1.00 8.93  ? 236 THR A N     1 
ATOM   1851 C  CA    . THR A 1 239 ? 66.735 -6.231  4.532   1.00 10.10 ? 236 THR A CA    1 
ATOM   1852 C  C     . THR A 1 239 ? 66.758 -7.312  3.462   1.00 10.00 ? 236 THR A C     1 
ATOM   1853 O  O     . THR A 1 239 ? 65.837 -7.415  2.640   1.00 9.76  ? 236 THR A O     1 
ATOM   1854 C  CB    . THR A 1 239 ? 65.705 -6.593  5.614   1.00 9.08  ? 236 THR A CB    1 
ATOM   1855 O  OG1   . THR A 1 239 ? 65.631 -5.528  6.567   1.00 10.75 ? 236 THR A OG1   1 
ATOM   1856 C  CG2   . THR A 1 239 ? 66.112 -7.873  6.365   1.00 10.73 ? 236 THR A CG2   1 
ATOM   1857 N  N     . LEU A 1 240 ? 67.815 -8.117  3.482   1.00 8.66  ? 237 LEU A N     1 
ATOM   1858 C  CA    . LEU A 1 240 ? 67.962 -9.249  2.581   1.00 7.42  ? 237 LEU A CA    1 
ATOM   1859 C  C     . LEU A 1 240 ? 67.559 -10.519 3.338   1.00 8.86  ? 237 LEU A C     1 
ATOM   1860 O  O     . LEU A 1 240 ? 68.138 -10.835 4.391   1.00 10.57 ? 237 LEU A O     1 
ATOM   1861 C  CB    . LEU A 1 240 ? 69.408 -9.325  2.059   1.00 10.89 ? 237 LEU A CB    1 
ATOM   1862 C  CG    . LEU A 1 240 ? 69.831 -10.350 1.005   1.00 10.33 ? 237 LEU A CG    1 
ATOM   1863 C  CD1   . LEU A 1 240 ? 71.183 -9.943  0.378   1.00 11.38 ? 237 LEU A CD1   1 
ATOM   1864 C  CD2   . LEU A 1 240 ? 69.929 -11.778 1.555   1.00 11.98 ? 237 LEU A CD2   1 
ATOM   1865 N  N     . VAL A 1 241 ? 66.557 -11.224 2.807   1.00 7.59  ? 238 VAL A N     1 
ATOM   1866 C  CA    . VAL A 1 241 ? 66.128 -12.510 3.370   1.00 8.26  ? 238 VAL A CA    1 
ATOM   1867 C  C     . VAL A 1 241 ? 66.502 -13.582 2.364   1.00 8.10  ? 238 VAL A C     1 
ATOM   1868 O  O     . VAL A 1 241 ? 65.945 -13.662 1.267   1.00 9.54  ? 238 VAL A O     1 
ATOM   1869 C  CB    . VAL A 1 241 ? 64.622 -12.512 3.679   1.00 8.15  ? 238 VAL A CB    1 
ATOM   1870 C  CG1   . VAL A 1 241 ? 64.077 -13.944 3.885   1.00 8.81  ? 238 VAL A CG1   1 
ATOM   1871 C  CG2   . VAL A 1 241 ? 64.339 -11.652 4.908   1.00 9.31  ? 238 VAL A CG2   1 
ATOM   1872 N  N     . SER A 1 242 ? 67.505 -14.368 2.729   1.00 9.01  ? 239 SER A N     1 
ATOM   1873 C  CA    . SER A 1 242 ? 68.003 -15.409 1.854   1.00 9.44  ? 239 SER A CA    1 
ATOM   1874 C  C     . SER A 1 242 ? 67.145 -16.667 1.983   1.00 8.16  ? 239 SER A C     1 
ATOM   1875 O  O     . SER A 1 242 ? 66.377 -16.816 2.930   1.00 10.25 ? 239 SER A O     1 
ATOM   1876 C  CB    . SER A 1 242 ? 69.458 -15.738 2.193   1.00 12.22 ? 239 SER A CB    1 
ATOM   1877 O  OG    . SER A 1 242 ? 69.516 -16.223 3.527   1.00 13.20 ? 239 SER A OG    1 
ATOM   1878 N  N     . HIS A 1 243 ? 67.286 -17.580 1.028   1.00 9.11  ? 240 HIS A N     1 
ATOM   1879 C  CA    . HIS A 1 243 ? 66.540 -18.828 1.114   1.00 8.88  ? 240 HIS A CA    1 
ATOM   1880 C  C     . HIS A 1 243 ? 66.922 -19.575 2.392   1.00 9.11  ? 240 HIS A C     1 
ATOM   1881 O  O     . HIS A 1 243 ? 66.047 -20.129 3.079   1.00 10.00 ? 240 HIS A O     1 
ATOM   1882 C  CB    . HIS A 1 243 ? 66.782 -19.709 -0.117  1.00 11.22 ? 240 HIS A CB    1 
ATOM   1883 C  CG    . HIS A 1 243 ? 66.000 -20.987 -0.101  1.00 12.11 ? 240 HIS A CG    1 
ATOM   1884 N  ND1   . HIS A 1 243 ? 64.641 -21.031 -0.327  1.00 15.70 ? 240 HIS A ND1   1 
ATOM   1885 C  CD2   . HIS A 1 243 ? 66.385 -22.265 0.136   1.00 18.28 ? 240 HIS A CD2   1 
ATOM   1886 C  CE1   . HIS A 1 243 ? 64.226 -22.284 -0.244  1.00 17.77 ? 240 HIS A CE1   1 
ATOM   1887 N  NE2   . HIS A 1 243 ? 65.263 -23.051 0.034   1.00 15.27 ? 240 HIS A NE2   1 
ATOM   1888 N  N     . GLY A 1 244 ? 68.212 -19.560 2.714   1.00 10.62 ? 241 GLY A N     1 
ATOM   1889 C  CA    . GLY A 1 244 ? 68.702 -20.268 3.890   1.00 11.08 ? 241 GLY A CA    1 
ATOM   1890 C  C     . GLY A 1 244 ? 68.217 -19.703 5.211   1.00 10.48 ? 241 GLY A C     1 
ATOM   1891 O  O     . GLY A 1 244 ? 68.183 -20.417 6.214   1.00 12.52 ? 241 GLY A O     1 
ATOM   1892 N  N     . SER A 1 245 ? 67.823 -18.432 5.228   1.00 10.31 ? 242 SER A N     1 
ATOM   1893 C  CA    . SER A 1 245 ? 67.337 -17.802 6.459   1.00 9.95  ? 242 SER A CA    1 
ATOM   1894 C  C     . SER A 1 245 ? 65.908 -18.216 6.809   1.00 9.47  ? 242 SER A C     1 
ATOM   1895 O  O     . SER A 1 245 ? 65.429 -17.944 7.914   1.00 10.31 ? 242 SER A O     1 
ATOM   1896 C  CB    . SER A 1 245 ? 67.395 -16.268 6.352   1.00 10.39 ? 242 SER A CB    1 
ATOM   1897 O  OG    . SER A 1 245 ? 66.354 -15.752 5.511   1.00 11.03 ? 242 SER A OG    1 
ATOM   1898 N  N     . VAL A 1 246 ? 65.226 -18.857 5.868   1.00 8.96  ? 243 VAL A N     1 
ATOM   1899 C  CA    . VAL A 1 246 ? 63.793 -19.086 6.046   1.00 8.43  ? 243 VAL A CA    1 
ATOM   1900 C  C     . VAL A 1 246 ? 63.435 -20.039 7.212   1.00 10.03 ? 243 VAL A C     1 
ATOM   1901 O  O     . VAL A 1 246 ? 62.559 -19.701 8.015   1.00 10.08 ? 243 VAL A O     1 
ATOM   1902 C  CB    . VAL A 1 246 ? 63.162 -19.571 4.737   1.00 8.73  ? 243 VAL A CB    1 
ATOM   1903 C  CG1   . VAL A 1 246 ? 61.718 -20.024 4.966   1.00 11.45 ? 243 VAL A CG1   1 
ATOM   1904 C  CG2   . VAL A 1 246 ? 63.221 -18.445 3.703   1.00 10.69 ? 243 VAL A CG2   1 
ATOM   1905 N  N     . PRO A 1 247 ? 64.112 -21.200 7.351   1.00 9.34  ? 244 PRO A N     1 
ATOM   1906 C  CA    . PRO A 1 247 ? 63.684 -22.056 8.477   1.00 8.60  ? 244 PRO A CA    1 
ATOM   1907 C  C     . PRO A 1 247 ? 63.726 -21.370 9.857   1.00 8.80  ? 244 PRO A C     1 
ATOM   1908 O  O     . PRO A 1 247 ? 62.761 -21.467 10.617  1.00 10.71 ? 244 PRO A O     1 
ATOM   1909 C  CB    . PRO A 1 247 ? 64.677 -23.231 8.411   1.00 11.33 ? 244 PRO A CB    1 
ATOM   1910 C  CG    . PRO A 1 247 ? 64.991 -23.342 6.910   1.00 11.84 ? 244 PRO A CG    1 
ATOM   1911 C  CD    . PRO A 1 247 ? 65.115 -21.874 6.492   1.00 8.95  ? 244 PRO A CD    1 
ATOM   1912 N  N     . GLN A 1 248 ? 64.802 -20.665 10.176  1.00 9.90  ? 245 GLN A N     1 
ATOM   1913 C  CA    . GLN A 1 248 ? 64.848 -19.978 11.463  1.00 10.61 ? 245 GLN A CA    1 
ATOM   1914 C  C     . GLN A 1 248 ? 63.837 -18.829 11.528  1.00 11.38 ? 245 GLN A C     1 
ATOM   1915 O  O     . GLN A 1 248 ? 63.128 -18.666 12.536  1.00 11.17 ? 245 GLN A O     1 
ATOM   1916 C  CB    . GLN A 1 248 ? 66.262 -19.467 11.750  1.00 13.97 ? 245 GLN A CB    1 
ATOM   1917 C  CG    . GLN A 1 248 ? 67.276 -20.581 11.961  1.00 20.08 ? 245 GLN A CG    1 
ATOM   1918 C  CD    . GLN A 1 248 ? 68.314 -20.237 13.017  1.00 26.29 ? 245 GLN A CD    1 
ATOM   1919 O  OE1   . GLN A 1 248 ? 67.977 -20.090 14.194  1.00 33.25 ? 245 GLN A OE1   1 
ATOM   1920 N  NE2   . GLN A 1 248 ? 69.583 -20.110 12.605  1.00 21.74 ? 245 GLN A NE2   1 
ATOM   1921 N  N     . LEU A 1 249 ? 63.759 -18.049 10.453  1.00 9.95  ? 246 LEU A N     1 
ATOM   1922 C  CA    . LEU A 1 249 ? 62.834 -16.919 10.408  1.00 9.34  ? 246 LEU A CA    1 
ATOM   1923 C  C     . LEU A 1 249 ? 61.395 -17.380 10.599  1.00 7.61  ? 246 LEU A C     1 
ATOM   1924 O  O     . LEU A 1 249 ? 60.625 -16.786 11.372  1.00 11.25 ? 246 LEU A O     1 
ATOM   1925 C  CB    . LEU A 1 249 ? 62.979 -16.181 9.076   1.00 8.44  ? 246 LEU A CB    1 
ATOM   1926 C  CG    . LEU A 1 249 ? 62.047 -14.983 8.887   1.00 11.44 ? 246 LEU A CG    1 
ATOM   1927 C  CD1   . LEU A 1 249 ? 62.325 -13.907 9.953   1.00 13.51 ? 246 LEU A CD1   1 
ATOM   1928 C  CD2   . LEU A 1 249 ? 62.198 -14.429 7.487   1.00 12.47 ? 246 LEU A CD2   1 
ATOM   1929 N  N     . PHE A 1 250 ? 61.035 -18.462 9.918   1.00 8.02  ? 247 PHE A N     1 
ATOM   1930 C  CA    . PHE A 1 250 ? 59.657 -18.920 9.985   1.00 9.68  ? 247 PHE A CA    1 
ATOM   1931 C  C     . PHE A 1 250 ? 59.340 -19.707 11.251  1.00 8.25  ? 247 PHE A C     1 
ATOM   1932 O  O     . PHE A 1 250 ? 58.170 -19.923 11.568  1.00 9.35  ? 247 PHE A O     1 
ATOM   1933 C  CB    . PHE A 1 250 ? 59.322 -19.768 8.757   1.00 9.47  ? 247 PHE A CB    1 
ATOM   1934 C  CG    . PHE A 1 250 ? 58.901 -18.974 7.552   1.00 8.84  ? 247 PHE A CG    1 
ATOM   1935 C  CD1   . PHE A 1 250 ? 58.359 -19.630 6.463   1.00 12.04 ? 247 PHE A CD1   1 
ATOM   1936 C  CD2   . PHE A 1 250 ? 59.058 -17.588 7.496   1.00 10.45 ? 247 PHE A CD2   1 
ATOM   1937 C  CE1   . PHE A 1 250 ? 57.953 -18.936 5.348   1.00 12.01 ? 247 PHE A CE1   1 
ATOM   1938 C  CE2   . PHE A 1 250 ? 58.654 -16.881 6.373   1.00 12.17 ? 247 PHE A CE2   1 
ATOM   1939 C  CZ    . PHE A 1 250 ? 58.105 -17.564 5.300   1.00 12.33 ? 247 PHE A CZ    1 
ATOM   1940 N  N     . SER A 1 251 ? 60.372 -20.137 11.979  1.00 7.95  ? 248 SER A N     1 
ATOM   1941 C  CA    . SER A 1 251 ? 60.148 -20.999 13.139  1.00 10.31 ? 248 SER A CA    1 
ATOM   1942 C  C     . SER A 1 251 ? 59.421 -20.278 14.270  1.00 10.38 ? 248 SER A C     1 
ATOM   1943 O  O     . SER A 1 251 ? 58.791 -20.919 15.091  1.00 9.70  ? 248 SER A O     1 
ATOM   1944 C  CB    . SER A 1 251 ? 61.475 -21.567 13.662  1.00 9.47  ? 248 SER A CB    1 
ATOM   1945 O  OG    . SER A 1 251 ? 62.239 -20.583 14.337  1.00 10.83 ? 248 SER A OG    1 
ATOM   1946 N  N     . GLN A 1 252 ? 59.493 -18.950 14.301  1.00 9.12  ? 249 GLN A N     1 
ATOM   1947 C  CA    . GLN A 1 252 ? 58.773 -18.174 15.310  1.00 10.66 ? 249 GLN A CA    1 
ATOM   1948 C  C     . GLN A 1 252 ? 57.896 -17.087 14.688  1.00 11.86 ? 249 GLN A C     1 
ATOM   1949 O  O     . GLN A 1 252 ? 57.525 -16.126 15.370  1.00 14.41 ? 249 GLN A O     1 
ATOM   1950 C  CB    . GLN A 1 252 ? 59.753 -17.530 16.281  1.00 16.89 ? 249 GLN A CB    1 
ATOM   1951 C  CG    . GLN A 1 252 ? 60.601 -18.509 17.056  1.00 16.83 ? 249 GLN A CG    1 
ATOM   1952 C  CD    . GLN A 1 252 ? 61.409 -17.791 18.112  1.00 19.11 ? 249 GLN A CD    1 
ATOM   1953 O  OE1   . GLN A 1 252 ? 60.968 -17.648 19.257  1.00 23.77 ? 249 GLN A OE1   1 
ATOM   1954 N  NE2   . GLN A 1 252 ? 62.573 -17.286 17.720  1.00 19.70 ? 249 GLN A NE2   1 
ATOM   1955 N  N     . MET A 1 253 ? 57.582 -17.236 13.403  1.00 9.34  ? 250 MET A N     1 
ATOM   1956 C  CA    . MET A 1 253 ? 56.861 -16.201 12.656  1.00 9.48  ? 250 MET A CA    1 
ATOM   1957 C  C     . MET A 1 253 ? 55.365 -16.498 12.717  1.00 9.02  ? 250 MET A C     1 
ATOM   1958 O  O     . MET A 1 253 ? 54.921 -17.471 12.128  1.00 11.10 ? 250 MET A O     1 
ATOM   1959 C  CB    . MET A 1 253 ? 57.331 -16.156 11.195  1.00 10.23 ? 250 MET A CB    1 
ATOM   1960 C  CG    . MET A 1 253 ? 56.672 -15.059 10.350  1.00 15.49 ? 250 MET A CG    1 
ATOM   1961 S  SD    . MET A 1 253 ? 57.006 -13.389 10.935  1.00 15.43 ? 250 MET A SD    1 
ATOM   1962 C  CE    . MET A 1 253 ? 58.794 -13.268 10.778  1.00 15.02 ? 250 MET A CE    1 
ATOM   1963 N  N     . PRO A 1 254 ? 54.583 -15.664 13.428  1.00 11.57 ? 251 PRO A N     1 
ATOM   1964 C  CA    . PRO A 1 254 ? 53.132 -15.892 13.436  1.00 11.19 ? 251 PRO A CA    1 
ATOM   1965 C  C     . PRO A 1 254 ? 52.561 -15.931 12.025  1.00 12.84 ? 251 PRO A C     1 
ATOM   1966 O  O     . PRO A 1 254 ? 52.945 -15.123 11.189  1.00 11.92 ? 251 PRO A O     1 
ATOM   1967 C  CB    . PRO A 1 254 ? 52.578 -14.681 14.208  1.00 12.96 ? 251 PRO A CB    1 
ATOM   1968 C  CG    . PRO A 1 254 ? 53.738 -14.195 15.039  1.00 12.02 ? 251 PRO A CG    1 
ATOM   1969 C  CD    . PRO A 1 254 ? 54.947 -14.427 14.140  1.00 12.26 ? 251 PRO A CD    1 
ATOM   1970 N  N     . ILE A 1 255 ? 51.666 -16.875 11.776  1.00 12.46 ? 252 ILE A N     1 
ATOM   1971 C  CA    . ILE A 1 255 ? 51.091 -17.081 10.456  1.00 9.47  ? 252 ILE A CA    1 
ATOM   1972 C  C     . ILE A 1 255 ? 50.474 -15.786 9.890   1.00 10.95 ? 252 ILE A C     1 
ATOM   1973 O  O     . ILE A 1 255 ? 50.590 -15.505 8.704   1.00 10.41 ? 252 ILE A O     1 
ATOM   1974 C  CB    . ILE A 1 255 ? 50.058 -18.232 10.513  1.00 12.34 ? 252 ILE A CB    1 
ATOM   1975 C  CG1   . ILE A 1 255 ? 50.819 -19.568 10.577  1.00 17.13 ? 252 ILE A CG1   1 
ATOM   1976 C  CG2   . ILE A 1 255 ? 49.129 -18.194 9.307   1.00 13.76 ? 252 ILE A CG2   1 
ATOM   1977 C  CD1   . ILE A 1 255 ? 50.030 -20.721 11.120  1.00 17.47 ? 252 ILE A CD1   1 
ATOM   1978 N  N     . ARG A 1 256 ? 49.877 -14.972 10.758  1.00 11.06 ? 253 ARG A N     1 
ATOM   1979 C  CA    . ARG A 1 256 ? 49.165 -13.789 10.290  1.00 8.82  ? 253 ARG A CA    1 
ATOM   1980 C  C     . ARG A 1 256 ? 50.098 -12.738 9.696   1.00 13.50 ? 253 ARG A C     1 
ATOM   1981 O  O     . ARG A 1 256 ? 49.635 -11.781 9.071   1.00 14.09 ? 253 ARG A O     1 
ATOM   1982 C  CB    . ARG A 1 256 ? 48.357 -13.170 11.430  1.00 12.33 ? 253 ARG A CB    1 
ATOM   1983 C  CG    . ARG A 1 256 ? 49.236 -12.585 12.522  1.00 13.28 ? 253 ARG A CG    1 
ATOM   1984 C  CD    . ARG A 1 256 ? 48.426 -11.964 13.658  1.00 18.00 ? 253 ARG A CD    1 
ATOM   1985 N  NE    . ARG A 1 256 ? 49.315 -11.482 14.715  1.00 17.31 ? 253 ARG A NE    1 
ATOM   1986 C  CZ    . ARG A 1 256 ? 49.766 -12.227 15.724  1.00 17.68 ? 253 ARG A CZ    1 
ATOM   1987 N  NH1   . ARG A 1 256 ? 49.396 -13.502 15.843  1.00 16.48 ? 253 ARG A NH1   1 
ATOM   1988 N  NH2   . ARG A 1 256 ? 50.583 -11.687 16.625  1.00 17.11 ? 253 ARG A NH2   1 
ATOM   1989 N  N     . LYS A 1 257 ? 51.408 -12.889 9.895   1.00 11.72 ? 254 LYS A N     1 
ATOM   1990 C  CA    . LYS A 1 257 ? 52.334 -11.879 9.389   1.00 11.38 ? 254 LYS A CA    1 
ATOM   1991 C  C     . LYS A 1 257 ? 52.612 -12.033 7.900   1.00 12.26 ? 254 LYS A C     1 
ATOM   1992 O  O     . LYS A 1 257 ? 53.155 -11.119 7.276   1.00 14.50 ? 254 LYS A O     1 
ATOM   1993 C  CB    . LYS A 1 257 ? 53.661 -11.917 10.150  1.00 10.31 ? 254 LYS A CB    1 
ATOM   1994 C  CG    . LYS A 1 257 ? 53.527 -11.722 11.643  1.00 18.20 ? 254 LYS A CG    1 
ATOM   1995 C  CD    . LYS A 1 257 ? 52.884 -10.393 11.983  1.00 17.36 ? 254 LYS A CD    1 
ATOM   1996 C  CE    . LYS A 1 257 ? 52.888 -10.154 13.490  1.00 25.58 ? 254 LYS A CE    1 
ATOM   1997 N  NZ    . LYS A 1 257 ? 52.409 -8.777  13.830  1.00 26.55 ? 254 LYS A NZ    1 
ATOM   1998 N  N     . ILE A 1 258 ? 52.261 -13.184 7.331   1.00 10.49 ? 255 ILE A N     1 
ATOM   1999 C  CA    . ILE A 1 258 ? 52.554 -13.438 5.923   1.00 13.05 ? 255 ILE A CA    1 
ATOM   2000 C  C     . ILE A 1 258 ? 51.422 -12.889 5.061   1.00 13.07 ? 255 ILE A C     1 
ATOM   2001 O  O     . ILE A 1 258 ? 50.244 -13.087 5.375   1.00 13.07 ? 255 ILE A O     1 
ATOM   2002 C  CB    . ILE A 1 258 ? 52.751 -14.947 5.653   1.00 13.83 ? 255 ILE A CB    1 
ATOM   2003 C  CG1   . ILE A 1 258 ? 54.184 -15.374 5.996   1.00 16.93 ? 255 ILE A CG1   1 
ATOM   2004 C  CG2   . ILE A 1 258 ? 52.520 -15.274 4.201   1.00 14.41 ? 255 ILE A CG2   1 
ATOM   2005 C  CD1   . ILE A 1 258 ? 54.546 -15.256 7.436   1.00 21.99 ? 255 ILE A CD1   1 
ATOM   2006 N  N     . ARG A 1 259 ? 51.770 -12.187 3.985   1.00 13.58 ? 256 ARG A N     1 
ATOM   2007 C  CA    . ARG A 1 259 ? 50.756 -11.524 3.175   1.00 12.88 ? 256 ARG A CA    1 
ATOM   2008 C  C     . ARG A 1 259 ? 49.714 -12.511 2.639   1.00 16.40 ? 256 ARG A C     1 
ATOM   2009 O  O     . ARG A 1 259 ? 50.073 -13.552 2.081   1.00 15.06 ? 256 ARG A O     1 
ATOM   2010 C  CB    . ARG A 1 259 ? 51.420 -10.761 2.032   1.00 15.23 ? 256 ARG A CB    1 
ATOM   2011 C  CG    . ARG A 1 259 ? 50.502 -9.752  1.383   1.00 20.27 ? 256 ARG A CG    1 
ATOM   2012 C  CD    . ARG A 1 259 ? 50.222 -10.166 -0.034  1.00 32.13 ? 256 ARG A CD    1 
ATOM   2013 N  NE    . ARG A 1 259 ? 51.311 -9.769  -0.914  1.00 38.08 ? 256 ARG A NE    1 
ATOM   2014 C  CZ    . ARG A 1 259 ? 51.469 -10.212 -2.157  1.00 39.76 ? 256 ARG A CZ    1 
ATOM   2015 N  NH1   . ARG A 1 259 ? 50.610 -11.086 -2.669  1.00 45.20 ? 256 ARG A NH1   1 
ATOM   2016 N  NH2   . ARG A 1 259 ? 52.489 -9.778  -2.885  1.00 24.00 ? 256 ARG A NH2   1 
ATOM   2017 N  N     . SER A 1 260 ? 48.441 -12.158 2.860   1.00 12.56 ? 257 SER A N     1 
ATOM   2018 C  CA    . SER A 1 260 ? 47.221 -12.919 2.510   1.00 13.88 ? 257 SER A CA    1 
ATOM   2019 C  C     . SER A 1 260 ? 46.750 -13.820 3.655   1.00 15.58 ? 257 SER A C     1 
ATOM   2020 O  O     . SER A 1 260 ? 45.645 -14.345 3.593   1.00 13.46 ? 257 SER A O     1 
ATOM   2021 C  CB    . SER A 1 260 ? 47.383 -13.766 1.237   1.00 13.60 ? 257 SER A CB    1 
ATOM   2022 O  OG    . SER A 1 260 ? 48.007 -15.017 1.515   1.00 14.48 ? 257 SER A OG    1 
ATOM   2023 N  N     . LEU A 1 261 ? 47.572 -13.999 4.692   1.00 11.01 ? 258 LEU A N     1 
ATOM   2024 C  CA    . LEU A 1 261 ? 47.163 -14.804 5.841   1.00 11.00 ? 258 LEU A CA    1 
ATOM   2025 C  C     . LEU A 1 261 ? 46.756 -13.988 7.081   1.00 11.13 ? 258 LEU A C     1 
ATOM   2026 O  O     . LEU A 1 261 ? 46.605 -14.542 8.169   1.00 11.53 ? 258 LEU A O     1 
ATOM   2027 C  CB    . LEU A 1 261 ? 48.292 -15.780 6.211   1.00 10.44 ? 258 LEU A CB    1 
ATOM   2028 C  CG    . LEU A 1 261 ? 48.654 -16.745 5.075   1.00 10.69 ? 258 LEU A CG    1 
ATOM   2029 C  CD1   . LEU A 1 261 ? 49.742 -17.719 5.521   1.00 10.59 ? 258 LEU A CD1   1 
ATOM   2030 C  CD2   . LEU A 1 261 ? 47.432 -17.515 4.587   1.00 13.95 ? 258 LEU A CD2   1 
ATOM   2031 N  N     . GLY A 1 262 ? 46.547 -12.680 6.923   1.00 12.57 ? 259 GLY A N     1 
ATOM   2032 C  CA    . GLY A 1 262 ? 46.223 -11.832 8.057   1.00 13.53 ? 259 GLY A CA    1 
ATOM   2033 C  C     . GLY A 1 262 ? 44.748 -11.804 8.425   1.00 14.35 ? 259 GLY A C     1 
ATOM   2034 O  O     . GLY A 1 262 ? 44.361 -11.131 9.381   1.00 15.84 ? 259 GLY A O     1 
ATOM   2035 N  N     . GLY A 1 263 ? 43.933 -12.527 7.664   1.00 13.05 ? 260 GLY A N     1 
ATOM   2036 C  CA    . GLY A 1 263 ? 42.492 -12.540 7.865   1.00 12.43 ? 260 GLY A CA    1 
ATOM   2037 C  C     . GLY A 1 263 ? 41.910 -13.904 8.199   1.00 14.13 ? 260 GLY A C     1 
ATOM   2038 O  O     . GLY A 1 263 ? 42.508 -14.696 8.943   1.00 13.53 ? 260 GLY A O     1 
ATOM   2039 N  N     . LYS A 1 264 ? 40.740 -14.194 7.636   1.00 15.31 ? 261 LYS A N     1 
ATOM   2040 C  CA    . LYS A 1 264 ? 40.005 -15.402 8.003   1.00 15.59 ? 261 LYS A CA    1 
ATOM   2041 C  C     . LYS A 1 264 ? 40.755 -16.694 7.639   1.00 13.71 ? 261 LYS A C     1 
ATOM   2042 O  O     . LYS A 1 264 ? 40.750 -17.656 8.420   1.00 16.82 ? 261 LYS A O     1 
ATOM   2043 C  CB    . LYS A 1 264 ? 38.616 -15.386 7.344   1.00 16.96 ? 261 LYS A CB    1 
ATOM   2044 C  CG    . LYS A 1 264 ? 37.700 -14.309 7.925   1.00 21.26 ? 261 LYS A CG    1 
ATOM   2045 C  CD    . LYS A 1 264 ? 36.344 -14.275 7.214   1.00 23.22 ? 261 LYS A CD    1 
ATOM   2046 C  CE    . LYS A 1 264 ? 35.452 -13.172 7.773   1.00 35.53 ? 261 LYS A CE    1 
ATOM   2047 N  NZ    . LYS A 1 264 ? 34.101 -13.158 7.128   1.00 36.61 ? 261 LYS A NZ    1 
ATOM   2048 N  N     . LEU A 1 265 ? 41.392 -16.726 6.468   1.00 13.53 ? 262 LEU A N     1 
ATOM   2049 C  CA    . LEU A 1 265 ? 42.133 -17.913 6.065   1.00 13.25 ? 262 LEU A CA    1 
ATOM   2050 C  C     . LEU A 1 265 ? 43.231 -18.210 7.071   1.00 13.59 ? 262 LEU A C     1 
ATOM   2051 O  O     . LEU A 1 265 ? 43.363 -19.337 7.540   1.00 12.66 ? 262 LEU A O     1 
ATOM   2052 C  CB    . LEU A 1 265 ? 42.743 -17.754 4.673   1.00 13.42 ? 262 LEU A CB    1 
ATOM   2053 C  CG    . LEU A 1 265 ? 43.640 -18.912 4.220   1.00 15.13 ? 262 LEU A CG    1 
ATOM   2054 C  CD1   . LEU A 1 265 ? 42.839 -20.221 4.168   1.00 18.54 ? 262 LEU A CD1   1 
ATOM   2055 C  CD2   . LEU A 1 265 ? 44.265 -18.627 2.872   1.00 14.62 ? 262 LEU A CD2   1 
ATOM   2056 N  N     . GLY A 1 266 ? 44.007 -17.191 7.422   1.00 11.91 ? 263 GLY A N     1 
ATOM   2057 C  CA    . GLY A 1 266 ? 45.066 -17.395 8.396   1.00 11.90 ? 263 GLY A CA    1 
ATOM   2058 C  C     . GLY A 1 266 ? 44.542 -17.886 9.731   1.00 12.96 ? 263 GLY A C     1 
ATOM   2059 O  O     . GLY A 1 266 ? 45.140 -18.768 10.366  1.00 13.00 ? 263 GLY A O     1 
ATOM   2060 N  N     . ALA A 1 267 ? 43.419 -17.317 10.173  1.00 12.10 ? 264 ALA A N     1 
ATOM   2061 C  CA    . ALA A 1 267 ? 42.823 -17.763 11.420  1.00 14.87 ? 264 ALA A CA    1 
ATOM   2062 C  C     . ALA A 1 267 ? 42.411 -19.225 11.318  1.00 13.38 ? 264 ALA A C     1 
ATOM   2063 O  O     . ALA A 1 267 ? 42.534 -19.979 12.284  1.00 15.81 ? 264 ALA A O     1 
ATOM   2064 C  CB    . ALA A 1 267 ? 41.628 -16.880 11.788  1.00 15.16 ? 264 ALA A CB    1 
ATOM   2065 N  N     . SER A 1 268 ? 41.935 -19.635 10.146  1.00 12.91 ? 265 SER A N     1 
ATOM   2066 C  CA    . SER A 1 268 ? 41.484 -21.010 9.964   1.00 15.24 ? 265 SER A CA    1 
ATOM   2067 C  C     . SER A 1 268 ? 42.672 -21.979 9.934   1.00 13.00 ? 265 SER A C     1 
ATOM   2068 O  O     . SER A 1 268 ? 42.568 -23.096 10.444  1.00 14.13 ? 265 SER A O     1 
ATOM   2069 C  CB    . SER A 1 268 ? 40.651 -21.141 8.686   1.00 16.56 ? 265 SER A CB    1 
ATOM   2070 O  OG    A SER A 1 268 ? 39.675 -20.118 8.601   0.17 15.92 ? 265 SER A OG    1 
ATOM   2071 O  OG    B SER A 1 268 ? 41.451 -21.230 7.527   0.43 14.76 ? 265 SER A OG    1 
ATOM   2072 O  OG    C SER A 1 268 ? 40.197 -22.472 8.526   0.40 16.12 ? 265 SER A OG    1 
ATOM   2073 N  N     . VAL A 1 269 ? 43.794 -21.560 9.351   1.00 12.49 ? 266 VAL A N     1 
ATOM   2074 C  CA    . VAL A 1 269 ? 45.006 -22.382 9.369   1.00 12.68 ? 266 VAL A CA    1 
ATOM   2075 C  C     . VAL A 1 269 ? 45.404 -22.666 10.822  1.00 14.55 ? 266 VAL A C     1 
ATOM   2076 O  O     . VAL A 1 269 ? 45.666 -23.818 11.207  1.00 13.24 ? 266 VAL A O     1 
ATOM   2077 C  CB    . VAL A 1 269 ? 46.168 -21.697 8.617   1.00 13.01 ? 266 VAL A CB    1 
ATOM   2078 C  CG1   . VAL A 1 269 ? 47.456 -22.486 8.793   1.00 16.02 ? 266 VAL A CG1   1 
ATOM   2079 C  CG2   . VAL A 1 269 ? 45.827 -21.557 7.123   1.00 14.03 ? 266 VAL A CG2   1 
ATOM   2080 N  N     . ILE A 1 270 ? 45.408 -21.610 11.632  1.00 12.39 ? 267 ILE A N     1 
ATOM   2081 C  CA    . ILE A 1 270 ? 45.759 -21.706 13.044  1.00 13.45 ? 267 ILE A CA    1 
ATOM   2082 C  C     . ILE A 1 270 ? 44.806 -22.633 13.801  1.00 12.30 ? 267 ILE A C     1 
ATOM   2083 O  O     . ILE A 1 270 ? 45.257 -23.538 14.513  1.00 16.37 ? 267 ILE A O     1 
ATOM   2084 C  CB    . ILE A 1 270 ? 45.773 -20.307 13.688  1.00 14.00 ? 267 ILE A CB    1 
ATOM   2085 C  CG1   . ILE A 1 270 ? 46.967 -19.500 13.156  1.00 14.94 ? 267 ILE A CG1   1 
ATOM   2086 C  CG2   . ILE A 1 270 ? 45.823 -20.398 15.205  1.00 19.44 ? 267 ILE A CG2   1 
ATOM   2087 C  CD1   . ILE A 1 270 ? 46.881 -18.006 13.461  1.00 17.18 ? 267 ILE A CD1   1 
ATOM   2088 N  N     . GLU A 1 271 ? 43.498 -22.431 13.620  1.00 13.57 ? 268 GLU A N     1 
ATOM   2089 C  CA    . GLU A 1 271 ? 42.488 -23.189 14.363  1.00 16.81 ? 268 GLU A CA    1 
ATOM   2090 C  C     . GLU A 1 271 ? 42.423 -24.647 13.941  1.00 14.89 ? 268 GLU A C     1 
ATOM   2091 O  O     . GLU A 1 271 ? 42.409 -25.546 14.784  1.00 17.75 ? 268 GLU A O     1 
ATOM   2092 C  CB    . GLU A 1 271 ? 41.107 -22.553 14.203  1.00 23.97 ? 268 GLU A CB    1 
ATOM   2093 C  CG    . GLU A 1 271 ? 39.978 -23.343 14.880  1.00 34.18 ? 268 GLU A CG    1 
ATOM   2094 C  CD    . GLU A 1 271 ? 38.741 -22.495 15.125  1.00 43.26 ? 268 GLU A CD    1 
ATOM   2095 O  OE1   . GLU A 1 271 ? 38.820 -21.258 14.948  1.00 53.33 ? 268 GLU A OE1   1 
ATOM   2096 O  OE2   . GLU A 1 271 ? 37.691 -23.061 15.498  1.00 46.21 ? 268 GLU A OE2   1 
ATOM   2097 N  N     . ILE A 1 272 ? 42.387 -24.880 12.636  1.00 15.95 ? 269 ILE A N     1 
ATOM   2098 C  CA    . ILE A 1 272 ? 42.179 -26.227 12.128  1.00 14.41 ? 269 ILE A CA    1 
ATOM   2099 C  C     . ILE A 1 272 ? 43.404 -27.100 12.367  1.00 14.62 ? 269 ILE A C     1 
ATOM   2100 O  O     . ILE A 1 272 ? 43.284 -28.279 12.710  1.00 19.18 ? 269 ILE A O     1 
ATOM   2101 C  CB    . ILE A 1 272 ? 41.834 -26.223 10.616  1.00 15.73 ? 269 ILE A CB    1 
ATOM   2102 C  CG1   . ILE A 1 272 ? 40.442 -25.626 10.379  1.00 18.46 ? 269 ILE A CG1   1 
ATOM   2103 C  CG2   . ILE A 1 272 ? 41.890 -27.630 10.050  1.00 15.34 ? 269 ILE A CG2   1 
ATOM   2104 C  CD1   . ILE A 1 272 ? 40.046 -25.545 8.910   1.00 19.22 ? 269 ILE A CD1   1 
ATOM   2105 N  N     . LEU A 1 273 ? 44.591 -26.527 12.195  1.00 15.00 ? 270 LEU A N     1 
ATOM   2106 C  CA    . LEU A 1 273 ? 45.804 -27.324 12.321  1.00 15.80 ? 270 LEU A CA    1 
ATOM   2107 C  C     . LEU A 1 273 ? 46.397 -27.283 13.727  1.00 13.99 ? 270 LEU A C     1 
ATOM   2108 O  O     . LEU A 1 273 ? 47.268 -28.102 14.062  1.00 15.11 ? 270 LEU A O     1 
ATOM   2109 C  CB    . LEU A 1 273 ? 46.842 -26.858 11.311  1.00 14.63 ? 270 LEU A CB    1 
ATOM   2110 C  CG    . LEU A 1 273 ? 46.448 -26.934 9.835   1.00 14.12 ? 270 LEU A CG    1 
ATOM   2111 C  CD1   . LEU A 1 273 ? 47.638 -26.497 8.990   1.00 14.57 ? 270 LEU A CD1   1 
ATOM   2112 C  CD2   . LEU A 1 273 ? 45.996 -28.349 9.466   1.00 18.31 ? 270 LEU A CD2   1 
ATOM   2113 N  N     . GLY A 1 274 ? 45.938 -26.334 14.544  1.00 13.97 ? 271 GLY A N     1 
ATOM   2114 C  CA    . GLY A 1 274 ? 46.445 -26.195 15.904  1.00 13.35 ? 271 GLY A CA    1 
ATOM   2115 C  C     . GLY A 1 274 ? 47.912 -25.803 15.950  1.00 17.82 ? 271 GLY A C     1 
ATOM   2116 O  O     . GLY A 1 274 ? 48.682 -26.319 16.767  1.00 19.60 ? 271 GLY A O     1 
ATOM   2117 N  N     . ILE A 1 275 ? 48.293 -24.876 15.075  1.00 13.35 ? 272 ILE A N     1 
ATOM   2118 C  CA    . ILE A 1 275 ? 49.662 -24.360 15.025  1.00 13.32 ? 272 ILE A CA    1 
ATOM   2119 C  C     . ILE A 1 275 ? 49.669 -22.842 15.181  1.00 11.87 ? 272 ILE A C     1 
ATOM   2120 O  O     . ILE A 1 275 ? 48.610 -22.210 15.136  1.00 14.07 ? 272 ILE A O     1 
ATOM   2121 C  CB    . ILE A 1 275 ? 50.368 -24.746 13.702  1.00 11.96 ? 272 ILE A CB    1 
ATOM   2122 C  CG1   . ILE A 1 275 ? 49.628 -24.147 12.502  1.00 12.13 ? 272 ILE A CG1   1 
ATOM   2123 C  CG2   . ILE A 1 275 ? 50.475 -26.266 13.590  1.00 12.01 ? 272 ILE A CG2   1 
ATOM   2124 C  CD1   . ILE A 1 275 ? 50.318 -24.444 11.151  1.00 12.08 ? 272 ILE A CD1   1 
ATOM   2125 N  N     . GLU A 1 276 ? 50.851 -22.258 15.363  1.00 11.49 ? 273 GLU A N     1 
ATOM   2126 C  CA    . GLU A 1 276 ? 50.982 -20.806 15.499  1.00 11.58 ? 273 GLU A CA    1 
ATOM   2127 C  C     . GLU A 1 276 ? 51.927 -20.163 14.474  1.00 10.96 ? 273 GLU A C     1 
ATOM   2128 O  O     . GLU A 1 276 ? 51.732 -19.015 14.087  1.00 12.37 ? 273 GLU A O     1 
ATOM   2129 C  CB    . GLU A 1 276 ? 51.471 -20.447 16.905  1.00 12.64 ? 273 GLU A CB    1 
ATOM   2130 C  CG    . GLU A 1 276 ? 50.519 -20.844 18.034  1.00 19.84 ? 273 GLU A CG    1 
ATOM   2131 C  CD    . GLU A 1 276 ? 51.147 -20.678 19.416  1.00 28.80 ? 273 GLU A CD    1 
ATOM   2132 O  OE1   . GLU A 1 276 ? 50.922 -21.551 20.281  1.00 38.98 ? 273 GLU A OE1   1 
ATOM   2133 O  OE2   . GLU A 1 276 ? 51.860 -19.673 19.637  1.00 34.07 ? 273 GLU A OE2   1 
ATOM   2134 N  N     . TYR A 1 277 ? 52.959 -20.891 14.061  1.00 11.12 ? 274 TYR A N     1 
ATOM   2135 C  CA    . TYR A 1 277 ? 54.051 -20.305 13.283  1.00 10.58 ? 274 TYR A CA    1 
ATOM   2136 C  C     . TYR A 1 277 ? 54.117 -20.861 11.872  1.00 11.07 ? 274 TYR A C     1 
ATOM   2137 O  O     . TYR A 1 277 ? 53.793 -22.024 11.628  1.00 10.28 ? 274 TYR A O     1 
ATOM   2138 C  CB    . TYR A 1 277 ? 55.392 -20.543 13.987  1.00 10.63 ? 274 TYR A CB    1 
ATOM   2139 C  CG    . TYR A 1 277 ? 55.392 -20.025 15.404  1.00 11.09 ? 274 TYR A CG    1 
ATOM   2140 C  CD1   . TYR A 1 277 ? 55.602 -20.883 16.473  1.00 12.50 ? 274 TYR A CD1   1 
ATOM   2141 C  CD2   . TYR A 1 277 ? 55.135 -18.687 15.669  1.00 11.04 ? 274 TYR A CD2   1 
ATOM   2142 C  CE1   . TYR A 1 277 ? 55.581 -20.421 17.774  1.00 11.51 ? 274 TYR A CE1   1 
ATOM   2143 C  CE2   . TYR A 1 277 ? 55.106 -18.210 16.977  1.00 12.41 ? 274 TYR A CE2   1 
ATOM   2144 C  CZ    . TYR A 1 277 ? 55.328 -19.091 18.024  1.00 16.00 ? 274 TYR A CZ    1 
ATOM   2145 O  OH    . TYR A 1 277 ? 55.304 -18.642 19.326  1.00 17.52 ? 274 TYR A OH    1 
ATOM   2146 N  N     . MET A 1 278 ? 54.582 -20.029 10.953  1.00 8.08  ? 275 MET A N     1 
ATOM   2147 C  CA    . MET A 1 278 ? 54.642 -20.403 9.548   1.00 8.99  ? 275 MET A CA    1 
ATOM   2148 C  C     . MET A 1 278 ? 55.422 -21.702 9.349   1.00 10.46 ? 275 MET A C     1 
ATOM   2149 O  O     . MET A 1 278 ? 55.028 -22.551 8.550   1.00 10.64 ? 275 MET A O     1 
ATOM   2150 C  CB    . MET A 1 278 ? 55.281 -19.269 8.740   1.00 14.23 ? 275 MET A CB    1 
ATOM   2151 C  CG    . MET A 1 278 ? 54.930 -19.274 7.277   1.00 16.01 ? 275 MET A CG    1 
ATOM   2152 S  SD    . MET A 1 278 ? 53.158 -19.016 6.986   1.00 15.98 ? 275 MET A SD    1 
ATOM   2153 C  CE    . MET A 1 278 ? 53.089 -19.521 5.267   1.00 22.46 ? 275 MET A CE    1 
ATOM   2154 N  N     . GLY A 1 279 ? 56.519 -21.859 10.093  1.00 9.78  ? 276 GLY A N     1 
ATOM   2155 C  CA    . GLY A 1 279 ? 57.387 -23.021 9.930   1.00 10.42 ? 276 GLY A CA    1 
ATOM   2156 C  C     . GLY A 1 279 ? 56.681 -24.334 10.233  1.00 10.96 ? 276 GLY A C     1 
ATOM   2157 O  O     . GLY A 1 279 ? 56.995 -25.377 9.640   1.00 12.74 ? 276 GLY A O     1 
ATOM   2158 N  N     . GLU A 1 280 ? 55.717 -24.294 11.156  1.00 9.82  ? 277 GLU A N     1 
ATOM   2159 C  CA    . GLU A 1 280 ? 54.997 -25.495 11.542  1.00 10.34 ? 277 GLU A CA    1 
ATOM   2160 C  C     . GLU A 1 280 ? 54.196 -26.100 10.391  1.00 11.06 ? 277 GLU A C     1 
ATOM   2161 O  O     . GLU A 1 280 ? 53.822 -27.275 10.449  1.00 10.40 ? 277 GLU A O     1 
ATOM   2162 C  CB    . GLU A 1 280 ? 54.056 -25.204 12.718  1.00 10.11 ? 277 GLU A CB    1 
ATOM   2163 C  CG    . GLU A 1 280 ? 54.761 -24.859 14.020  1.00 9.97  ? 277 GLU A CG    1 
ATOM   2164 C  CD    . GLU A 1 280 ? 53.766 -24.612 15.120  1.00 13.54 ? 277 GLU A CD    1 
ATOM   2165 O  OE1   . GLU A 1 280 ? 53.396 -23.444 15.296  1.00 13.51 ? 277 GLU A OE1   1 
ATOM   2166 O  OE2   . GLU A 1 280 ? 53.335 -25.584 15.779  1.00 16.64 ? 277 GLU A OE2   1 
ATOM   2167 N  N     . LEU A 1 281 ? 53.935 -25.321 9.348   1.00 9.14  ? 278 LEU A N     1 
ATOM   2168 C  CA    . LEU A 1 281 ? 53.212 -25.856 8.197   1.00 8.44  ? 278 LEU A CA    1 
ATOM   2169 C  C     . LEU A 1 281 ? 53.975 -26.938 7.440   1.00 10.03 ? 278 LEU A C     1 
ATOM   2170 O  O     . LEU A 1 281 ? 53.364 -27.697 6.681   1.00 10.49 ? 278 LEU A O     1 
ATOM   2171 C  CB    . LEU A 1 281 ? 52.847 -24.731 7.228   1.00 9.79  ? 278 LEU A CB    1 
ATOM   2172 C  CG    . LEU A 1 281 ? 51.649 -23.890 7.668   1.00 11.38 ? 278 LEU A CG    1 
ATOM   2173 C  CD1   . LEU A 1 281 ? 51.647 -22.540 6.946   1.00 13.37 ? 278 LEU A CD1   1 
ATOM   2174 C  CD2   . LEU A 1 281 ? 50.351 -24.644 7.393   1.00 12.83 ? 278 LEU A CD2   1 
ATOM   2175 N  N     . THR A 1 282 ? 55.301 -27.003 7.603   1.00 10.61 ? 279 THR A N     1 
ATOM   2176 C  CA    . THR A 1 282 ? 56.084 -27.968 6.823   1.00 11.06 ? 279 THR A CA    1 
ATOM   2177 C  C     . THR A 1 282 ? 55.704 -29.413 7.160   1.00 11.72 ? 279 THR A C     1 
ATOM   2178 O  O     . THR A 1 282 ? 55.968 -30.307 6.383   1.00 12.93 ? 279 THR A O     1 
ATOM   2179 C  CB    . THR A 1 282 ? 57.616 -27.818 7.019   1.00 11.84 ? 279 THR A CB    1 
ATOM   2180 O  OG1   . THR A 1 282 ? 57.976 -28.059 8.395   1.00 12.71 ? 279 THR A OG1   1 
ATOM   2181 C  CG2   . THR A 1 282 ? 58.088 -26.424 6.589   1.00 10.31 ? 279 THR A CG2   1 
ATOM   2182 N  N     . GLN A 1 283 ? 55.082 -29.635 8.314   1.00 12.06 ? 280 GLN A N     1 
ATOM   2183 C  CA    . GLN A 1 283 ? 54.767 -31.001 8.732   1.00 13.07 ? 280 GLN A CA    1 
ATOM   2184 C  C     . GLN A 1 283 ? 53.472 -31.566 8.152   1.00 16.83 ? 280 GLN A C     1 
ATOM   2185 O  O     . GLN A 1 283 ? 53.017 -32.632 8.561   1.00 23.17 ? 280 GLN A O     1 
ATOM   2186 C  CB    . GLN A 1 283 ? 54.718 -31.046 10.252  1.00 15.40 ? 280 GLN A CB    1 
ATOM   2187 C  CG    A GLN A 1 283 ? 53.479 -30.428 10.816  0.45 13.98 ? 280 GLN A CG    1 
ATOM   2188 C  CG    B GLN A 1 283 ? 56.082 -30.760 10.819  0.55 10.30 ? 280 GLN A CG    1 
ATOM   2189 C  CD    A GLN A 1 283 ? 53.569 -30.190 12.304  0.45 20.05 ? 280 GLN A CD    1 
ATOM   2190 C  CD    B GLN A 1 283 ? 57.125 -31.623 10.143  0.55 14.51 ? 280 GLN A CD    1 
ATOM   2191 O  OE1   A GLN A 1 283 ? 53.961 -31.078 13.072  0.45 22.45 ? 280 GLN A OE1   1 
ATOM   2192 O  OE1   B GLN A 1 283 ? 57.152 -32.835 10.346  0.55 13.22 ? 280 GLN A OE1   1 
ATOM   2193 N  NE2   A GLN A 1 283 ? 53.196 -28.989 12.724  0.45 10.61 ? 280 GLN A NE2   1 
ATOM   2194 N  NE2   B GLN A 1 283 ? 57.959 -31.015 9.297   0.55 13.40 ? 280 GLN A NE2   1 
ATOM   2195 N  N     . PHE A 1 284 ? 52.878 -30.856 7.207   1.00 11.43 ? 281 PHE A N     1 
ATOM   2196 C  CA    . PHE A 1 284 ? 51.665 -31.328 6.554   1.00 11.49 ? 281 PHE A CA    1 
ATOM   2197 C  C     . PHE A 1 284 ? 51.950 -31.648 5.091   1.00 14.92 ? 281 PHE A C     1 
ATOM   2198 O  O     . PHE A 1 284 ? 52.789 -31.004 4.455   1.00 15.63 ? 281 PHE A O     1 
ATOM   2199 C  CB    . PHE A 1 284 ? 50.554 -30.285 6.697   1.00 12.30 ? 281 PHE A CB    1 
ATOM   2200 C  CG    . PHE A 1 284 ? 50.194 -30.016 8.132   1.00 13.43 ? 281 PHE A CG    1 
ATOM   2201 C  CD1   . PHE A 1 284 ? 49.304 -30.841 8.797   1.00 18.37 ? 281 PHE A CD1   1 
ATOM   2202 C  CD2   . PHE A 1 284 ? 50.800 -28.993 8.837   1.00 12.95 ? 281 PHE A CD2   1 
ATOM   2203 C  CE1   . PHE A 1 284 ? 48.989 -30.617 10.131  1.00 18.32 ? 281 PHE A CE1   1 
ATOM   2204 C  CE2   . PHE A 1 284 ? 50.492 -28.771 10.163  1.00 12.44 ? 281 PHE A CE2   1 
ATOM   2205 C  CZ    . PHE A 1 284 ? 49.592 -29.580 10.817  1.00 16.14 ? 281 PHE A CZ    1 
ATOM   2206 N  N     . THR A 1 285 ? 51.284 -32.663 4.553   1.00 12.04 ? 282 THR A N     1 
ATOM   2207 C  CA    . THR A 1 285 ? 51.449 -32.942 3.133   1.00 13.03 ? 282 THR A CA    1 
ATOM   2208 C  C     . THR A 1 285 ? 50.700 -31.901 2.330   1.00 11.33 ? 282 THR A C     1 
ATOM   2209 O  O     . THR A 1 285 ? 49.795 -31.248 2.842   1.00 11.85 ? 282 THR A O     1 
ATOM   2210 C  CB    . THR A 1 285 ? 50.924 -34.319 2.727   1.00 10.66 ? 282 THR A CB    1 
ATOM   2211 O  OG1   . THR A 1 285 ? 49.499 -34.340 2.867   1.00 14.01 ? 282 THR A OG1   1 
ATOM   2212 C  CG2   . THR A 1 285 ? 51.562 -35.409 3.575   1.00 16.54 ? 282 THR A CG2   1 
ATOM   2213 N  N     . GLU A 1 286 ? 51.061 -31.779 1.063   1.00 12.63 ? 283 GLU A N     1 
ATOM   2214 C  CA    . GLU A 1 286 ? 50.357 -30.875 0.170   1.00 12.54 ? 283 GLU A CA    1 
ATOM   2215 C  C     . GLU A 1 286 ? 48.878 -31.252 0.107   1.00 11.51 ? 283 GLU A C     1 
ATOM   2216 O  O     . GLU A 1 286 ? 48.007 -30.373 0.166   1.00 11.76 ? 283 GLU A O     1 
ATOM   2217 C  CB    . GLU A 1 286 ? 50.985 -30.891 -1.226  1.00 13.60 ? 283 GLU A CB    1 
ATOM   2218 C  CG    . GLU A 1 286 ? 50.399 -29.819 -2.129  1.00 13.56 ? 283 GLU A CG    1 
ATOM   2219 C  CD    . GLU A 1 286 ? 51.155 -29.664 -3.432  1.00 21.44 ? 283 GLU A CD    1 
ATOM   2220 O  OE1   . GLU A 1 286 ? 52.103 -30.434 -3.671  1.00 22.81 ? 283 GLU A OE1   1 
ATOM   2221 O  OE2   . GLU A 1 286 ? 50.799 -28.759 -4.217  1.00 20.39 ? 283 GLU A OE2   1 
ATOM   2222 N  N     . SER A 1 287 ? 48.598 -32.559 0.031   1.00 12.31 ? 284 SER A N     1 
ATOM   2223 C  CA    . SER A 1 287 ? 47.210 -33.027 -0.013  1.00 12.58 ? 284 SER A CA    1 
ATOM   2224 C  C     . SER A 1 287 ? 46.451 -32.690 1.273   1.00 11.60 ? 284 SER A C     1 
ATOM   2225 O  O     . SER A 1 287 ? 45.263 -32.341 1.231   1.00 13.09 ? 284 SER A O     1 
ATOM   2226 C  CB    . SER A 1 287 ? 47.156 -34.544 -0.274  1.00 15.52 ? 284 SER A CB    1 
ATOM   2227 O  OG    A SER A 1 287 ? 47.770 -34.866 -1.503  0.77 19.84 ? 284 SER A OG    1 
ATOM   2228 O  OG    B SER A 1 287 ? 47.929 -35.262 0.673   0.23 14.08 ? 284 SER A OG    1 
ATOM   2229 N  N     . GLN A 1 288 ? 47.135 -32.767 2.418   1.00 10.66 ? 285 GLN A N     1 
ATOM   2230 C  CA    . GLN A 1 288 ? 46.494 -32.401 3.671   1.00 10.47 ? 285 GLN A CA    1 
ATOM   2231 C  C     . GLN A 1 288 ? 46.099 -30.929 3.647   1.00 11.34 ? 285 GLN A C     1 
ATOM   2232 O  O     . GLN A 1 288 ? 44.979 -30.558 3.991   1.00 13.04 ? 285 GLN A O     1 
ATOM   2233 C  CB    . GLN A 1 288 ? 47.417 -32.678 4.852   1.00 10.24 ? 285 GLN A CB    1 
ATOM   2234 C  CG    . GLN A 1 288 ? 47.418 -34.109 5.323   1.00 16.38 ? 285 GLN A CG    1 
ATOM   2235 C  CD    . GLN A 1 288 ? 48.352 -34.306 6.497   1.00 22.19 ? 285 GLN A CD    1 
ATOM   2236 O  OE1   . GLN A 1 288 ? 49.524 -33.933 6.438   1.00 16.49 ? 285 GLN A OE1   1 
ATOM   2237 N  NE2   . GLN A 1 288 ? 47.836 -34.884 7.578   1.00 24.41 ? 285 GLN A NE2   1 
ATOM   2238 N  N     . LEU A 1 289 ? 47.023 -30.080 3.220   1.00 12.05 ? 286 LEU A N     1 
ATOM   2239 C  CA    . LEU A 1 289 ? 46.720 -28.653 3.188   1.00 11.68 ? 286 LEU A CA    1 
ATOM   2240 C  C     . LEU A 1 289 ? 45.617 -28.336 2.175   1.00 13.38 ? 286 LEU A C     1 
ATOM   2241 O  O     . LEU A 1 289 ? 44.745 -27.508 2.439   1.00 13.86 ? 286 LEU A O     1 
ATOM   2242 C  CB    . LEU A 1 289 ? 47.977 -27.854 2.872   1.00 10.17 ? 286 LEU A CB    1 
ATOM   2243 C  CG    . LEU A 1 289 ? 49.045 -27.965 3.969   1.00 9.96  ? 286 LEU A CG    1 
ATOM   2244 C  CD1   . LEU A 1 289 ? 50.327 -27.251 3.539   1.00 12.26 ? 286 LEU A CD1   1 
ATOM   2245 C  CD2   . LEU A 1 289 ? 48.528 -27.438 5.314   1.00 12.63 ? 286 LEU A CD2   1 
ATOM   2246 N  N     . GLN A 1 290 ? 45.647 -29.006 1.028   1.00 12.32 ? 287 GLN A N     1 
ATOM   2247 C  CA    . GLN A 1 290 ? 44.599 -28.796 0.042   1.00 14.01 ? 287 GLN A CA    1 
ATOM   2248 C  C     . GLN A 1 290 ? 43.240 -29.255 0.569   1.00 13.74 ? 287 GLN A C     1 
ATOM   2249 O  O     . GLN A 1 290 ? 42.205 -28.664 0.247   1.00 14.54 ? 287 GLN A O     1 
ATOM   2250 C  CB    . GLN A 1 290 ? 44.936 -29.524 -1.254  1.00 12.71 ? 287 GLN A CB    1 
ATOM   2251 C  CG    . GLN A 1 290 ? 46.116 -28.945 -2.019  1.00 14.02 ? 287 GLN A CG    1 
ATOM   2252 C  CD    . GLN A 1 290 ? 46.464 -29.799 -3.208  1.00 17.62 ? 287 GLN A CD    1 
ATOM   2253 O  OE1   . GLN A 1 290 ? 46.441 -31.026 -3.127  1.00 17.31 ? 287 GLN A OE1   1 
ATOM   2254 N  NE2   . GLN A 1 290 ? 46.788 -29.158 -4.324  1.00 20.62 ? 287 GLN A NE2   1 
ATOM   2255 N  N     A SER A 1 291 ? 43.244 -30.300 1.391   0.54 12.32 ? 288 SER A N     1 
ATOM   2256 N  N     B SER A 1 291 ? 43.241 -30.298 1.385   0.46 12.33 ? 288 SER A N     1 
ATOM   2257 C  CA    A SER A 1 291 ? 41.998 -30.836 1.934   0.54 12.68 ? 288 SER A CA    1 
ATOM   2258 C  CA    B SER A 1 291 ? 41.990 -30.819 1.914   0.46 12.71 ? 288 SER A CA    1 
ATOM   2259 C  C     A SER A 1 291 ? 41.291 -29.825 2.840   0.54 15.56 ? 288 SER A C     1 
ATOM   2260 C  C     B SER A 1 291 ? 41.287 -29.810 2.826   0.46 15.56 ? 288 SER A C     1 
ATOM   2261 O  O     A SER A 1 291 ? 40.060 -29.758 2.871   0.54 22.22 ? 288 SER A O     1 
ATOM   2262 O  O     B SER A 1 291 ? 40.058 -29.729 2.849   0.46 22.17 ? 288 SER A O     1 
ATOM   2263 C  CB    A SER A 1 291 ? 42.247 -32.147 2.697   0.54 14.09 ? 288 SER A CB    1 
ATOM   2264 C  CB    B SER A 1 291 ? 42.231 -32.129 2.660   0.46 14.08 ? 288 SER A CB    1 
ATOM   2265 O  OG    A SER A 1 291 ? 42.710 -31.928 4.024   0.54 12.78 ? 288 SER A OG    1 
ATOM   2266 O  OG    B SER A 1 291 ? 41.010 -32.812 2.867   0.46 16.24 ? 288 SER A OG    1 
ATOM   2267 N  N     . HIS A 1 292 ? 42.062 -29.033 3.575   1.00 14.48 ? 289 HIS A N     1 
ATOM   2268 C  CA    . HIS A 1 292 ? 41.476 -28.041 4.463   1.00 15.08 ? 289 HIS A CA    1 
ATOM   2269 C  C     . HIS A 1 292 ? 41.207 -26.691 3.800   1.00 17.02 ? 289 HIS A C     1 
ATOM   2270 O  O     . HIS A 1 292 ? 40.210 -26.043 4.096   1.00 20.87 ? 289 HIS A O     1 
ATOM   2271 C  CB    . HIS A 1 292 ? 42.375 -27.813 5.670   1.00 17.21 ? 289 HIS A CB    1 
ATOM   2272 C  CG    . HIS A 1 292 ? 42.543 -29.019 6.539   1.00 15.42 ? 289 HIS A CG    1 
ATOM   2273 N  ND1   . HIS A 1 292 ? 41.510 -29.556 7.273   1.00 25.94 ? 289 HIS A ND1   1 
ATOM   2274 C  CD2   . HIS A 1 292 ? 43.633 -29.771 6.811   1.00 19.37 ? 289 HIS A CD2   1 
ATOM   2275 C  CE1   . HIS A 1 292 ? 41.954 -30.596 7.955   1.00 20.63 ? 289 HIS A CE1   1 
ATOM   2276 N  NE2   . HIS A 1 292 ? 43.239 -30.751 7.690   1.00 26.05 ? 289 HIS A NE2   1 
ATOM   2277 N  N     . PHE A 1 293 ? 42.100 -26.256 2.917   1.00 15.20 ? 290 PHE A N     1 
ATOM   2278 C  CA    . PHE A 1 293 ? 42.087 -24.862 2.484   1.00 15.23 ? 290 PHE A CA    1 
ATOM   2279 C  C     . PHE A 1 293 ? 41.841 -24.693 0.985   1.00 15.57 ? 290 PHE A C     1 
ATOM   2280 O  O     . PHE A 1 293 ? 41.834 -23.569 0.468   1.00 18.80 ? 290 PHE A O     1 
ATOM   2281 C  CB    . PHE A 1 293 ? 43.411 -24.212 2.914   1.00 12.82 ? 290 PHE A CB    1 
ATOM   2282 C  CG    . PHE A 1 293 ? 43.739 -24.468 4.360   1.00 12.72 ? 290 PHE A CG    1 
ATOM   2283 C  CD1   . PHE A 1 293 ? 42.923 -23.961 5.366   1.00 14.58 ? 290 PHE A CD1   1 
ATOM   2284 C  CD2   . PHE A 1 293 ? 44.837 -25.239 4.720   1.00 12.58 ? 290 PHE A CD2   1 
ATOM   2285 C  CE1   . PHE A 1 293 ? 43.197 -24.216 6.696   1.00 15.62 ? 290 PHE A CE1   1 
ATOM   2286 C  CE2   . PHE A 1 293 ? 45.120 -25.494 6.060   1.00 14.25 ? 290 PHE A CE2   1 
ATOM   2287 C  CZ    . PHE A 1 293 ? 44.294 -24.983 7.043   1.00 16.16 ? 290 PHE A CZ    1 
ATOM   2288 N  N     . GLY A 1 294 ? 41.618 -25.808 0.295   1.00 16.08 ? 291 GLY A N     1 
ATOM   2289 C  CA    . GLY A 1 294 ? 41.387 -25.783 -1.135  1.00 17.61 ? 291 GLY A CA    1 
ATOM   2290 C  C     . GLY A 1 294 ? 42.643 -26.074 -1.924  1.00 17.29 ? 291 GLY A C     1 
ATOM   2291 O  O     . GLY A 1 294 ? 43.758 -25.944 -1.416  1.00 15.89 ? 291 GLY A O     1 
ATOM   2292 N  N     . GLU A 1 295 ? 42.459 -26.466 -3.179  1.00 15.07 ? 292 GLU A N     1 
ATOM   2293 C  CA    . GLU A 1 295 ? 43.553 -26.819 -4.058  1.00 16.74 ? 292 GLU A CA    1 
ATOM   2294 C  C     . GLU A 1 295 ? 44.598 -25.710 -4.173  1.00 15.66 ? 292 GLU A C     1 
ATOM   2295 O  O     . GLU A 1 295 ? 45.786 -25.953 -3.972  1.00 15.21 ? 292 GLU A O     1 
ATOM   2296 C  CB    . GLU A 1 295 ? 43.000 -27.172 -5.440  1.00 20.13 ? 292 GLU A CB    1 
ATOM   2297 C  CG    . GLU A 1 295 ? 44.029 -27.711 -6.388  1.00 20.78 ? 292 GLU A CG    1 
ATOM   2298 C  CD    . GLU A 1 295 ? 43.408 -28.365 -7.605  1.00 41.44 ? 292 GLU A CD    1 
ATOM   2299 O  OE1   . GLU A 1 295 ? 44.153 -29.006 -8.377  1.00 50.26 ? 292 GLU A OE1   1 
ATOM   2300 O  OE2   . GLU A 1 295 ? 42.174 -28.255 -7.782  1.00 28.20 ? 292 GLU A OE2   1 
ATOM   2301 N  N     . LYS A 1 296 ? 44.148 -24.497 -4.479  1.00 15.84 ? 293 LYS A N     1 
ATOM   2302 C  CA    . LYS A 1 296 ? 45.049 -23.374 -4.713  1.00 15.12 ? 293 LYS A CA    1 
ATOM   2303 C  C     . LYS A 1 296 ? 45.760 -22.947 -3.430  1.00 14.75 ? 293 LYS A C     1 
ATOM   2304 O  O     . LYS A 1 296 ? 46.995 -22.855 -3.397  1.00 14.22 ? 293 LYS A O     1 
ATOM   2305 C  CB    . LYS A 1 296 ? 44.271 -22.192 -5.310  1.00 17.67 ? 293 LYS A CB    1 
ATOM   2306 C  CG    . LYS A 1 296 ? 45.111 -20.982 -5.644  1.00 28.69 ? 293 LYS A CG    1 
ATOM   2307 C  CD    . LYS A 1 296 ? 44.339 -20.027 -6.547  1.00 33.89 ? 293 LYS A CD    1 
ATOM   2308 C  CE    . LYS A 1 296 ? 44.643 -18.575 -6.201  1.00 36.33 ? 293 LYS A CE    1 
ATOM   2309 N  NZ    . LYS A 1 296 ? 43.957 -18.187 -4.932  1.00 39.96 ? 293 LYS A NZ    1 
ATOM   2310 N  N     . ASN A 1 297 ? 44.994 -22.693 -2.378  1.00 15.12 ? 294 ASN A N     1 
ATOM   2311 C  CA    . ASN A 1 297 ? 45.607 -22.282 -1.112  1.00 13.16 ? 294 ASN A CA    1 
ATOM   2312 C  C     . ASN A 1 297 ? 46.530 -23.351 -0.550  1.00 13.36 ? 294 ASN A C     1 
ATOM   2313 O  O     . ASN A 1 297 ? 47.574 -23.030 0.021   1.00 12.13 ? 294 ASN A O     1 
ATOM   2314 C  CB    . ASN A 1 297 ? 44.551 -21.970 -0.058  1.00 17.29 ? 294 ASN A CB    1 
ATOM   2315 C  CG    . ASN A 1 297 ? 43.801 -20.706 -0.336  1.00 20.75 ? 294 ASN A CG    1 
ATOM   2316 O  OD1   . ASN A 1 297 ? 44.302 -19.798 -1.002  1.00 20.25 ? 294 ASN A OD1   1 
ATOM   2317 N  ND2   . ASN A 1 297 ? 42.585 -20.623 0.191   1.00 20.11 ? 294 ASN A ND2   1 
ATOM   2318 N  N     . GLY A 1 298 ? 46.116 -24.614 -0.669  1.00 14.26 ? 295 GLY A N     1 
ATOM   2319 C  CA    . GLY A 1 298 ? 46.891 -25.734 -0.146  1.00 12.63 ? 295 GLY A CA    1 
ATOM   2320 C  C     . GLY A 1 298 ? 48.267 -25.828 -0.792  1.00 11.99 ? 295 GLY A C     1 
ATOM   2321 O  O     . GLY A 1 298 ? 49.283 -25.987 -0.112  1.00 12.20 ? 295 GLY A O     1 
ATOM   2322 N  N     . SER A 1 299 ? 48.304 -25.725 -2.115  1.00 10.30 ? 296 SER A N     1 
ATOM   2323 C  CA    . SER A 1 299 ? 49.555 -25.756 -2.854  1.00 11.19 ? 296 SER A CA    1 
ATOM   2324 C  C     . SER A 1 299 ? 50.404 -24.540 -2.506  1.00 13.42 ? 296 SER A C     1 
ATOM   2325 O  O     . SER A 1 299 ? 51.616 -24.665 -2.305  1.00 12.04 ? 296 SER A O     1 
ATOM   2326 C  CB    . SER A 1 299 ? 49.274 -25.808 -4.357  1.00 14.56 ? 296 SER A CB    1 
ATOM   2327 O  OG    . SER A 1 299 ? 48.838 -27.107 -4.711  1.00 16.81 ? 296 SER A OG    1 
ATOM   2328 N  N     . TRP A 1 300 ? 49.757 -23.379 -2.408  1.00 12.25 ? 297 TRP A N     1 
ATOM   2329 C  CA    . TRP A 1 300 ? 50.461 -22.145 -2.072  1.00 10.44 ? 297 TRP A CA    1 
ATOM   2330 C  C     . TRP A 1 300 ? 51.087 -22.250 -0.682  1.00 11.79 ? 297 TRP A C     1 
ATOM   2331 O  O     . TRP A 1 300 ? 52.266 -21.942 -0.523  1.00 10.96 ? 297 TRP A O     1 
ATOM   2332 C  CB    . TRP A 1 300 ? 49.514 -20.940 -2.170  1.00 12.04 ? 297 TRP A CB    1 
ATOM   2333 C  CG    . TRP A 1 300 ? 50.187 -19.628 -1.899  1.00 12.14 ? 297 TRP A CG    1 
ATOM   2334 C  CD1   . TRP A 1 300 ? 50.850 -18.846 -2.805  1.00 17.32 ? 297 TRP A CD1   1 
ATOM   2335 C  CD2   . TRP A 1 300 ? 50.248 -18.929 -0.644  1.00 10.15 ? 297 TRP A CD2   1 
ATOM   2336 N  NE1   . TRP A 1 300 ? 51.331 -17.710 -2.185  1.00 18.86 ? 297 TRP A NE1   1 
ATOM   2337 C  CE2   . TRP A 1 300 ? 50.974 -17.739 -0.861  1.00 15.63 ? 297 TRP A CE2   1 
ATOM   2338 C  CE3   . TRP A 1 300 ? 49.760 -19.194 0.639   1.00 15.61 ? 297 TRP A CE3   1 
ATOM   2339 C  CZ2   . TRP A 1 300 ? 51.224 -16.812 0.161   1.00 15.62 ? 297 TRP A CZ2   1 
ATOM   2340 C  CZ3   . TRP A 1 300 ? 50.011 -18.279 1.649   1.00 20.17 ? 297 TRP A CZ3   1 
ATOM   2341 C  CH2   . TRP A 1 300 ? 50.738 -17.107 1.404   1.00 14.93 ? 297 TRP A CH2   1 
ATOM   2342 N  N     . LEU A 1 301 ? 50.321 -22.733 0.299   1.00 10.60 ? 298 LEU A N     1 
ATOM   2343 C  CA    . LEU A 1 301 ? 50.835 -22.887 1.664   1.00 11.86 ? 298 LEU A CA    1 
ATOM   2344 C  C     . LEU A 1 301 ? 51.990 -23.889 1.742   1.00 11.96 ? 298 LEU A C     1 
ATOM   2345 O  O     . LEU A 1 301 ? 52.980 -23.670 2.459   1.00 9.82  ? 298 LEU A O     1 
ATOM   2346 C  CB    . LEU A 1 301 ? 49.724 -23.329 2.617   1.00 9.27  ? 298 LEU A CB    1 
ATOM   2347 C  CG    . LEU A 1 301 ? 48.662 -22.274 2.965   1.00 10.36 ? 298 LEU A CG    1 
ATOM   2348 C  CD1   . LEU A 1 301 ? 47.431 -22.913 3.599   1.00 13.99 ? 298 LEU A CD1   1 
ATOM   2349 C  CD2   . LEU A 1 301 ? 49.254 -21.213 3.894   1.00 13.37 ? 298 LEU A CD2   1 
ATOM   2350 N  N     . TYR A 1 302 ? 51.866 -24.987 1.014   1.00 10.05 ? 299 TYR A N     1 
ATOM   2351 C  CA    . TYR A 1 302 ? 52.893 -26.022 1.030   1.00 10.57 ? 299 TYR A CA    1 
ATOM   2352 C  C     . TYR A 1 302 ? 54.247 -25.457 0.579   1.00 12.07 ? 299 TYR A C     1 
ATOM   2353 O  O     . TYR A 1 302 ? 55.287 -25.678 1.213   1.00 10.74 ? 299 TYR A O     1 
ATOM   2354 C  CB    . TYR A 1 302 ? 52.475 -27.200 0.135   1.00 11.08 ? 299 TYR A CB    1 
ATOM   2355 C  CG    . TYR A 1 302 ? 53.477 -28.322 0.165   1.00 12.67 ? 299 TYR A CG    1 
ATOM   2356 C  CD1   . TYR A 1 302 ? 53.428 -29.285 1.160   1.00 13.96 ? 299 TYR A CD1   1 
ATOM   2357 C  CD2   . TYR A 1 302 ? 54.491 -28.394 -0.772  1.00 12.79 ? 299 TYR A CD2   1 
ATOM   2358 C  CE1   . TYR A 1 302 ? 54.356 -30.311 1.212   1.00 13.69 ? 299 TYR A CE1   1 
ATOM   2359 C  CE2   . TYR A 1 302 ? 55.435 -29.406 -0.723  1.00 15.25 ? 299 TYR A CE2   1 
ATOM   2360 C  CZ    . TYR A 1 302 ? 55.358 -30.367 0.270   1.00 18.29 ? 299 TYR A CZ    1 
ATOM   2361 O  OH    . TYR A 1 302 ? 56.302 -31.380 0.326   1.00 21.65 ? 299 TYR A OH    1 
ATOM   2362 N  N     . ALA A 1 303 ? 54.220 -24.702 -0.509  1.00 11.57 ? 300 ALA A N     1 
ATOM   2363 C  CA    . ALA A 1 303 ? 55.422 -24.066 -1.023  1.00 10.86 ? 300 ALA A CA    1 
ATOM   2364 C  C     . ALA A 1 303 ? 55.857 -22.877 -0.163  1.00 8.39  ? 300 ALA A C     1 
ATOM   2365 O  O     . ALA A 1 303 ? 57.057 -22.692 0.104   1.00 10.09 ? 300 ALA A O     1 
ATOM   2366 C  CB    . ALA A 1 303 ? 55.195 -23.613 -2.483  1.00 13.80 ? 300 ALA A CB    1 
ATOM   2367 N  N     . MET A 1 304 ? 54.894 -22.073 0.272   1.00 9.85  ? 301 MET A N     1 
ATOM   2368 C  CA    . MET A 1 304 ? 55.245 -20.833 0.955   1.00 8.50  ? 301 MET A CA    1 
ATOM   2369 C  C     . MET A 1 304 ? 55.939 -21.084 2.282   1.00 7.81  ? 301 MET A C     1 
ATOM   2370 O  O     . MET A 1 304 ? 56.878 -20.353 2.624   1.00 10.21 ? 301 MET A O     1 
ATOM   2371 C  CB    . MET A 1 304 ? 54.018 -19.961 1.189   1.00 9.78  ? 301 MET A CB    1 
ATOM   2372 C  CG    . MET A 1 304 ? 54.371 -18.533 1.624   1.00 12.33 ? 301 MET A CG    1 
ATOM   2373 S  SD    . MET A 1 304 ? 55.147 -17.599 0.296   1.00 13.59 ? 301 MET A SD    1 
ATOM   2374 C  CE    . MET A 1 304 ? 56.842 -17.468 0.877   1.00 13.64 ? 301 MET A CE    1 
ATOM   2375 N  N     . CYS A 1 305 ? 55.515 -22.116 3.017   1.00 8.87  ? 302 CYS A N     1 
ATOM   2376 C  CA    . CYS A 1 305 ? 56.154 -22.379 4.320   1.00 9.64  ? 302 CYS A CA    1 
ATOM   2377 C  C     . CYS A 1 305 ? 57.603 -22.876 4.163   1.00 8.63  ? 302 CYS A C     1 
ATOM   2378 O  O     . CYS A 1 305 ? 58.363 -22.890 5.141   1.00 11.04 ? 302 CYS A O     1 
ATOM   2379 C  CB    . CYS A 1 305 ? 55.345 -23.378 5.164   1.00 8.34  ? 302 CYS A CB    1 
ATOM   2380 S  SG    . CYS A 1 305 ? 55.362 -25.065 4.547   1.00 9.93  ? 302 CYS A SG    1 
ATOM   2381 N  N     . ARG A 1 306 ? 57.991 -23.227 2.943   1.00 8.85  ? 303 ARG A N     1 
ATOM   2382 C  CA    . ARG A 1 306 ? 59.375 -23.573 2.605   1.00 10.13 ? 303 ARG A CA    1 
ATOM   2383 C  C     . ARG A 1 306 ? 60.132 -22.401 1.943   1.00 10.18 ? 303 ARG A C     1 
ATOM   2384 O  O     . ARG A 1 306 ? 61.277 -22.559 1.488   1.00 12.27 ? 303 ARG A O     1 
ATOM   2385 C  CB    . ARG A 1 306 ? 59.390 -24.809 1.693   1.00 10.37 ? 303 ARG A CB    1 
ATOM   2386 C  CG    . ARG A 1 306 ? 58.846 -26.054 2.386   1.00 10.23 ? 303 ARG A CG    1 
ATOM   2387 C  CD    . ARG A 1 306 ? 58.507 -27.201 1.433   1.00 10.08 ? 303 ARG A CD    1 
ATOM   2388 N  NE    . ARG A 1 306 ? 58.340 -28.426 2.224   1.00 14.21 ? 303 ARG A NE    1 
ATOM   2389 C  CZ    . ARG A 1 306 ? 57.231 -28.733 2.889   1.00 12.35 ? 303 ARG A CZ    1 
ATOM   2390 N  NH1   . ARG A 1 306 ? 57.166 -29.842 3.613   1.00 13.03 ? 303 ARG A NH1   1 
ATOM   2391 N  NH2   . ARG A 1 306 ? 56.178 -27.930 2.837   1.00 9.99  ? 303 ARG A NH2   1 
ATOM   2392 N  N     . GLY A 1 307 ? 59.498 -21.231 1.901   1.00 10.16 ? 304 GLY A N     1 
ATOM   2393 C  CA    . GLY A 1 307 ? 60.115 -20.041 1.343   1.00 10.45 ? 304 GLY A CA    1 
ATOM   2394 C  C     . GLY A 1 307 ? 59.911 -19.878 -0.153  1.00 9.48  ? 304 GLY A C     1 
ATOM   2395 O  O     . GLY A 1 307 ? 60.571 -19.065 -0.782  1.00 11.01 ? 304 GLY A O     1 
ATOM   2396 N  N     . ILE A 1 308 ? 59.001 -20.662 -0.725  1.00 9.72  ? 305 ILE A N     1 
ATOM   2397 C  CA    . ILE A 1 308 ? 58.842 -20.724 -2.180  1.00 11.28 ? 305 ILE A CA    1 
ATOM   2398 C  C     . ILE A 1 308 ? 57.500 -20.169 -2.624  1.00 10.61 ? 305 ILE A C     1 
ATOM   2399 O  O     . ILE A 1 308 ? 56.459 -20.550 -2.107  1.00 11.35 ? 305 ILE A O     1 
ATOM   2400 C  CB    . ILE A 1 308 ? 58.986 -22.173 -2.676  1.00 12.19 ? 305 ILE A CB    1 
ATOM   2401 C  CG1   . ILE A 1 308 ? 60.383 -22.688 -2.320  1.00 15.38 ? 305 ILE A CG1   1 
ATOM   2402 C  CG2   . ILE A 1 308 ? 58.720 -22.262 -4.172  1.00 13.15 ? 305 ILE A CG2   1 
ATOM   2403 C  CD1   . ILE A 1 308 ? 60.589 -24.165 -2.584  1.00 19.34 ? 305 ILE A CD1   1 
ATOM   2404 N  N     . GLU A 1 309 ? 57.524 -19.275 -3.603  1.00 10.23 ? 306 GLU A N     1 
ATOM   2405 C  CA    . GLU A 1 309 ? 56.295 -18.681 -4.116  1.00 15.61 ? 306 GLU A CA    1 
ATOM   2406 C  C     . GLU A 1 309 ? 56.557 -18.255 -5.544  1.00 14.85 ? 306 GLU A C     1 
ATOM   2407 O  O     . GLU A 1 309 ? 57.656 -17.810 -5.853  1.00 16.77 ? 306 GLU A O     1 
ATOM   2408 C  CB    . GLU A 1 309 ? 55.860 -17.477 -3.277  1.00 21.25 ? 306 GLU A CB    1 
ATOM   2409 C  CG    . GLU A 1 309 ? 54.425 -17.117 -3.531  1.00 27.68 ? 306 GLU A CG    1 
ATOM   2410 C  CD    . GLU A 1 309 ? 54.112 -15.648 -3.396  1.00 21.73 ? 306 GLU A CD    1 
ATOM   2411 O  OE1   . GLU A 1 309 ? 55.023 -14.780 -3.501  1.00 17.06 ? 306 GLU A OE1   1 
ATOM   2412 O  OE2   . GLU A 1 309 ? 52.918 -15.362 -3.193  1.00 26.84 ? 306 GLU A OE2   1 
ATOM   2413 N  N     . HIS A 1 310 ? 55.570 -18.383 -6.426  1.00 17.01 ? 307 HIS A N     1 
ATOM   2414 C  CA    . HIS A 1 310 ? 55.863 -18.101 -7.828  1.00 17.10 ? 307 HIS A CA    1 
ATOM   2415 C  C     . HIS A 1 310 ? 55.101 -16.921 -8.413  1.00 14.70 ? 307 HIS A C     1 
ATOM   2416 O  O     . HIS A 1 310 ? 55.277 -16.612 -9.588  1.00 19.76 ? 307 HIS A O     1 
ATOM   2417 C  CB    . HIS A 1 310 ? 55.603 -19.349 -8.669  1.00 23.67 ? 307 HIS A CB    1 
ATOM   2418 C  CG    . HIS A 1 310 ? 56.488 -20.504 -8.315  1.00 32.46 ? 307 HIS A CG    1 
ATOM   2419 N  ND1   . HIS A 1 310 ? 57.857 -20.383 -8.184  1.00 35.03 ? 307 HIS A ND1   1 
ATOM   2420 C  CD2   . HIS A 1 310 ? 56.197 -21.798 -8.042  1.00 33.86 ? 307 HIS A CD2   1 
ATOM   2421 C  CE1   . HIS A 1 310 ? 58.370 -21.557 -7.857  1.00 31.25 ? 307 HIS A CE1   1 
ATOM   2422 N  NE2   . HIS A 1 310 ? 57.385 -22.431 -7.763  1.00 32.54 ? 307 HIS A NE2   1 
ATOM   2423 N  N     . ASP A 1 311 ? 54.313 -16.226 -7.624  1.00 14.10 ? 308 ASP A N     1 
ATOM   2424 C  CA    . ASP A 1 311 ? 53.538 -15.091 -8.123  1.00 14.19 ? 308 ASP A CA    1 
ATOM   2425 C  C     . ASP A 1 311 ? 54.468 -14.084 -8.758  1.00 16.97 ? 308 ASP A C     1 
ATOM   2426 O  O     . ASP A 1 311 ? 55.354 -13.649 -8.197  1.00 13.17 ? 308 ASP A O     1 
ATOM   2427 C  CB    . ASP A 1 311 ? 52.809 -14.459 -6.951  1.00 13.82 ? 308 ASP A CB    1 
ATOM   2428 C  CG    . ASP A 1 311 ? 51.892 -13.366 -7.354  1.00 21.32 ? 308 ASP A CG    1 
ATOM   2429 O  OD1   . ASP A 1 311 ? 51.801 -12.384 -6.708  1.00 26.62 ? 308 ASP A OD1   1 
ATOM   2430 O  OD2   . ASP A 1 311 ? 51.234 -13.514 -8.330  1.00 27.52 ? 308 ASP A OD2   1 
ATOM   2431 N  N     . PRO A 1 312 ? 54.189 -13.745 -10.020 1.00 13.32 ? 309 PRO A N     1 
ATOM   2432 C  CA    . PRO A 1 312 ? 55.042 -12.841 -10.750 1.00 12.73 ? 309 PRO A CA    1 
ATOM   2433 C  C     . PRO A 1 312 ? 54.859 -11.405 -10.337 1.00 10.58 ? 309 PRO A C     1 
ATOM   2434 O  O     . PRO A 1 312 ? 53.823 -11.026 -9.924  1.00 13.81 ? 309 PRO A O     1 
ATOM   2435 C  CB    . PRO A 1 312 ? 54.632 -13.061 -12.218 1.00 12.74 ? 309 PRO A CB    1 
ATOM   2436 C  CG    . PRO A 1 312 ? 53.263 -13.542 -12.138 1.00 14.61 ? 309 PRO A CG    1 
ATOM   2437 C  CD    . PRO A 1 312 ? 53.211 -14.390 -10.900 1.00 13.92 ? 309 PRO A CD    1 
ATOM   2438 N  N     . VAL A 1 313 ? 55.920 -10.651 -10.529 1.00 11.66 ? 310 VAL A N     1 
ATOM   2439 C  CA    . VAL A 1 313 ? 55.837 -9.219  -10.482 1.00 12.63 ? 310 VAL A CA    1 
ATOM   2440 C  C     . VAL A 1 313 ? 55.192 -8.795  -11.785 1.00 15.03 ? 310 VAL A C     1 
ATOM   2441 O  O     . VAL A 1 313 ? 55.732 -8.967  -12.804 1.00 14.79 ? 310 VAL A O     1 
ATOM   2442 C  CB    . VAL A 1 313 ? 57.229 -8.601  -10.450 1.00 12.39 ? 310 VAL A CB    1 
ATOM   2443 C  CG1   . VAL A 1 313 ? 57.164 -7.085  -10.435 1.00 14.24 ? 310 VAL A CG1   1 
ATOM   2444 C  CG2   . VAL A 1 313 ? 57.967 -9.056  -9.219  1.00 11.77 ? 310 VAL A CG2   1 
ATOM   2445 N  N     . LYS A 1 314 ? 53.995 -8.271  -11.691 1.00 13.95 ? 311 LYS A N     1 
ATOM   2446 C  CA    . LYS A 1 314 ? 53.248 -7.938  -12.856 1.00 13.26 ? 311 LYS A CA    1 
ATOM   2447 C  C     . LYS A 1 314 ? 53.685 -6.602  -13.391 1.00 13.44 ? 311 LYS A C     1 
ATOM   2448 O  O     . LYS A 1 314 ? 53.899 -5.693  -12.669 1.00 14.67 ? 311 LYS A O     1 
ATOM   2449 C  CB    . LYS A 1 314 ? 51.766 -7.898  -12.525 1.00 16.56 ? 311 LYS A CB    1 
ATOM   2450 C  CG    . LYS A 1 314 ? 51.164 -9.218  -12.071 1.00 18.98 ? 311 LYS A CG    1 
ATOM   2451 C  CD    . LYS A 1 314 ? 49.691 -9.068  -11.703 1.00 29.72 ? 311 LYS A CD    1 
ATOM   2452 C  CE    . LYS A 1 314 ? 49.030 -10.399 -11.318 1.00 31.58 ? 311 LYS A CE    1 
ATOM   2453 N  NZ    . LYS A 1 314 ? 47.540 -10.294 -11.352 1.00 30.69 ? 311 LYS A NZ    1 
ATOM   2454 N  N     . PRO A 1 315 ? 53.816 -6.495  -14.687 1.00 13.06 ? 312 PRO A N     1 
ATOM   2455 C  CA    . PRO A 1 315 ? 54.222 -5.227  -15.260 1.00 11.46 ? 312 PRO A CA    1 
ATOM   2456 C  C     . PRO A 1 315 ? 53.024 -4.279  -15.301 1.00 16.20 ? 312 PRO A C     1 
ATOM   2457 O  O     . PRO A 1 315 ? 52.305 -4.184  -16.236 1.00 18.33 ? 312 PRO A O     1 
ATOM   2458 C  CB    . PRO A 1 315 ? 54.593 -5.599  -16.692 1.00 17.05 ? 312 PRO A CB    1 
ATOM   2459 C  CG    . PRO A 1 315 ? 53.697 -6.696  -17.050 1.00 17.33 ? 312 PRO A CG    1 
ATOM   2460 C  CD    . PRO A 1 315 ? 53.672 -7.527  -15.847 1.00 14.53 ? 312 PRO A CD    1 
ATOM   2461 N  N     . ARG A 1 316 ? 52.851 -3.591  -14.190 1.00 14.26 ? 313 ARG A N     1 
ATOM   2462 C  CA    . ARG A 1 316 ? 51.787 -2.620  -14.054 1.00 14.85 ? 313 ARG A CA    1 
ATOM   2463 C  C     . ARG A 1 316 ? 52.149 -1.503  -13.058 1.00 16.74 ? 313 ARG A C     1 
ATOM   2464 O  O     . ARG A 1 316 ? 52.234 -1.723  -11.918 1.00 15.92 ? 313 ARG A O     1 
ATOM   2465 C  CB    . ARG A 1 316 ? 50.533 -3.333  -13.590 1.00 16.88 ? 313 ARG A CB    1 
ATOM   2466 C  CG    . ARG A 1 316 ? 49.317 -2.447  -13.637 1.00 19.53 ? 313 ARG A CG    1 
ATOM   2467 C  CD    . ARG A 1 316 ? 48.062 -3.021  -13.055 1.00 20.62 ? 313 ARG A CD    1 
ATOM   2468 N  NE    . ARG A 1 316 ? 48.313 -3.627  -11.788 1.00 22.39 ? 313 ARG A NE    1 
ATOM   2469 C  CZ    . ARG A 1 316 ? 48.422 -2.978  -10.653 1.00 25.52 ? 313 ARG A CZ    1 
ATOM   2470 N  NH1   . ARG A 1 316 ? 48.294 -1.657  -10.602 1.00 26.59 ? 313 ARG A NH1   1 
ATOM   2471 N  NH2   . ARG A 1 316 ? 48.711 -3.659  -9.565  1.00 30.30 ? 313 ARG A NH2   1 
ATOM   2472 N  N     . GLN A 1 317 ? 52.343 -0.310  -13.586 1.00 14.42 ? 314 GLN A N     1 
ATOM   2473 C  CA    . GLN A 1 317 ? 52.705 0.862   -12.817 1.00 18.24 ? 314 GLN A CA    1 
ATOM   2474 C  C     . GLN A 1 317 ? 51.507 1.737   -12.440 1.00 18.00 ? 314 GLN A C     1 
ATOM   2475 O  O     . GLN A 1 317 ? 51.556 2.511   -11.531 1.00 20.46 ? 314 GLN A O     1 
ATOM   2476 C  CB    . GLN A 1 317 ? 53.601 1.689   -13.712 1.00 25.88 ? 314 GLN A CB    1 
ATOM   2477 C  CG    . GLN A 1 317 ? 54.441 2.545   -12.913 1.00 29.22 ? 314 GLN A CG    1 
ATOM   2478 C  CD    . GLN A 1 317 ? 55.366 3.342   -13.740 1.00 28.92 ? 314 GLN A CD    1 
ATOM   2479 O  OE1   . GLN A 1 317 ? 55.818 2.928   -14.804 1.00 34.41 ? 314 GLN A OE1   1 
ATOM   2480 N  NE2   . GLN A 1 317 ? 55.674 4.454   -13.256 1.00 26.64 ? 314 GLN A NE2   1 
ATOM   2481 N  N     . LEU A 1 318 ? 50.459 1.626   -13.209 1.00 15.15 ? 315 LEU A N     1 
ATOM   2482 C  CA    . LEU A 1 318 ? 49.263 2.443   -13.026 1.00 15.61 ? 315 LEU A CA    1 
ATOM   2483 C  C     . LEU A 1 318 ? 48.129 1.645   -12.390 1.00 15.19 ? 315 LEU A C     1 
ATOM   2484 O  O     . LEU A 1 318 ? 47.953 0.458   -12.688 1.00 15.51 ? 315 LEU A O     1 
ATOM   2485 C  CB    . LEU A 1 318 ? 48.785 2.991   -14.375 1.00 16.94 ? 315 LEU A CB    1 
ATOM   2486 C  CG    . LEU A 1 318 ? 49.779 3.724   -15.272 1.00 18.96 ? 315 LEU A CG    1 
ATOM   2487 C  CD1   . LEU A 1 318 ? 49.191 3.935   -16.670 1.00 16.28 ? 315 LEU A CD1   1 
ATOM   2488 C  CD2   . LEU A 1 318 ? 50.175 5.051   -14.638 1.00 19.41 ? 315 LEU A CD2   1 
ATOM   2489 N  N     . PRO A 1 319 ? 47.330 2.296   -11.533 1.00 13.67 ? 316 PRO A N     1 
ATOM   2490 C  CA    . PRO A 1 319 ? 46.144 1.621   -10.988 1.00 14.93 ? 316 PRO A CA    1 
ATOM   2491 C  C     . PRO A 1 319 ? 45.175 1.181   -12.091 1.00 15.43 ? 316 PRO A C     1 
ATOM   2492 O  O     . PRO A 1 319 ? 45.107 1.836   -13.123 1.00 17.36 ? 316 PRO A O     1 
ATOM   2493 C  CB    . PRO A 1 319 ? 45.509 2.675   -10.073 1.00 18.60 ? 316 PRO A CB    1 
ATOM   2494 C  CG    . PRO A 1 319 ? 46.224 3.948   -10.332 1.00 19.75 ? 316 PRO A CG    1 
ATOM   2495 C  CD    . PRO A 1 319 ? 47.514 3.664   -11.015 1.00 14.75 ? 316 PRO A CD    1 
ATOM   2496 N  N     . LYS A 1 320 ? 44.478 0.065   -11.874 1.00 16.92 ? 317 LYS A N     1 
ATOM   2497 C  CA    . LYS A 1 320 ? 43.534 -0.522  -12.835 1.00 15.99 ? 317 LYS A CA    1 
ATOM   2498 C  C     . LYS A 1 320 ? 42.149 0.096   -12.760 1.00 16.93 ? 317 LYS A C     1 
ATOM   2499 O  O     . LYS A 1 320 ? 41.284 -0.185  -13.596 1.00 17.78 ? 317 LYS A O     1 
ATOM   2500 C  CB    . LYS A 1 320 ? 43.359 -2.026  -12.578 1.00 25.40 ? 317 LYS A CB    1 
ATOM   2501 C  CG    . LYS A 1 320 ? 44.507 -2.928  -12.918 1.00 29.68 ? 317 LYS A CG    1 
ATOM   2502 C  CD    . LYS A 1 320 ? 44.048 -4.380  -12.779 1.00 28.53 ? 317 LYS A CD    1 
ATOM   2503 C  CE    . LYS A 1 320 ? 45.147 -5.347  -13.166 1.00 41.06 ? 317 LYS A CE    1 
ATOM   2504 N  NZ    . LYS A 1 320 ? 44.652 -6.750  -13.177 1.00 38.68 ? 317 LYS A NZ    1 
ATOM   2505 N  N     . THR A 1 321 ? 41.914 0.860   -11.699 1.00 17.43 ? 318 THR A N     1 
ATOM   2506 C  CA    . THR A 1 321 ? 40.612 1.459   -11.459 1.00 17.86 ? 318 THR A CA    1 
ATOM   2507 C  C     . THR A 1 321 ? 40.855 2.831   -10.867 1.00 18.56 ? 318 THR A C     1 
ATOM   2508 O  O     . THR A 1 321 ? 41.931 3.102   -10.310 1.00 18.53 ? 318 THR A O     1 
ATOM   2509 C  CB    . THR A 1 321 ? 39.729 0.617   -10.495 1.00 19.00 ? 318 THR A CB    1 
ATOM   2510 O  OG1   . THR A 1 321 ? 40.402 0.455   -9.239  1.00 18.01 ? 318 THR A OG1   1 
ATOM   2511 C  CG2   . THR A 1 321 ? 39.395 -0.768  -11.070 1.00 17.25 ? 318 THR A CG2   1 
ATOM   2512 N  N     . ILE A 1 322 ? 39.866 3.704   -11.018 1.00 13.88 ? 319 ILE A N     1 
ATOM   2513 C  CA    . ILE A 1 322 ? 39.905 5.032   -10.427 1.00 14.35 ? 319 ILE A CA    1 
ATOM   2514 C  C     . ILE A 1 322 ? 38.584 5.244   -9.701  1.00 13.59 ? 319 ILE A C     1 
ATOM   2515 O  O     . ILE A 1 322 ? 37.534 5.217   -10.331 1.00 15.07 ? 319 ILE A O     1 
ATOM   2516 C  CB    . ILE A 1 322 ? 40.133 6.112   -11.496 1.00 12.13 ? 319 ILE A CB    1 
ATOM   2517 C  CG1   . ILE A 1 322 ? 41.511 5.932   -12.150 1.00 16.05 ? 319 ILE A CG1   1 
ATOM   2518 C  CG2   . ILE A 1 322 ? 39.976 7.509   -10.900 1.00 15.72 ? 319 ILE A CG2   1 
ATOM   2519 C  CD1   . ILE A 1 322 ? 41.906 7.073   -13.074 1.00 19.37 ? 319 ILE A CD1   1 
ATOM   2520 N  N     . GLY A 1 323 ? 38.632 5.402   -8.381  1.00 13.51 ? 320 GLY A N     1 
ATOM   2521 C  CA    . GLY A 1 323 ? 37.419 5.424   -7.576  1.00 13.60 ? 320 GLY A CA    1 
ATOM   2522 C  C     . GLY A 1 323 ? 37.326 6.577   -6.593  1.00 12.54 ? 320 GLY A C     1 
ATOM   2523 O  O     . GLY A 1 323 ? 38.335 7.173   -6.225  1.00 15.57 ? 320 GLY A O     1 
ATOM   2524 N  N     . CYS A 1 324 ? 36.095 6.851   -6.156  1.00 13.65 ? 321 CYS A N     1 
ATOM   2525 C  CA    . CYS A 1 324 ? 35.746 7.975   -5.274  1.00 15.58 ? 321 CYS A CA    1 
ATOM   2526 C  C     . CYS A 1 324 ? 34.735 7.438   -4.281  1.00 14.83 ? 321 CYS A C     1 
ATOM   2527 O  O     . CYS A 1 324 ? 33.700 6.924   -4.708  1.00 16.46 ? 321 CYS A O     1 
ATOM   2528 C  CB    . CYS A 1 324 ? 35.140 9.164   -6.064  1.00 14.29 ? 321 CYS A CB    1 
ATOM   2529 S  SG    A CYS A 1 324 ? 36.256 9.958   -7.212  0.65 21.66 ? 321 CYS A SG    1 
ATOM   2530 S  SG    B CYS A 1 324 ? 35.489 10.793  -5.421  0.35 21.32 ? 321 CYS A SG    1 
ATOM   2531 N  N     . SER A 1 325 ? 34.993 7.551   -2.980  1.00 14.15 ? 322 SER A N     1 
ATOM   2532 C  CA    A SER A 1 325 ? 34.043 7.026   -2.007  0.54 15.17 ? 322 SER A CA    1 
ATOM   2533 C  CA    B SER A 1 325 ? 34.112 6.974   -1.969  0.46 15.21 ? 322 SER A CA    1 
ATOM   2534 C  C     . SER A 1 325 ? 33.939 7.901   -0.771  1.00 15.89 ? 322 SER A C     1 
ATOM   2535 O  O     . SER A 1 325 ? 34.888 8.601   -0.384  1.00 15.65 ? 322 SER A O     1 
ATOM   2536 C  CB    A SER A 1 325 ? 34.415 5.594   -1.601  0.54 16.97 ? 322 SER A CB    1 
ATOM   2537 C  CB    B SER A 1 325 ? 34.670 5.622   -1.509  0.46 16.80 ? 322 SER A CB    1 
ATOM   2538 O  OG    A SER A 1 325 ? 35.590 5.554   -0.815  0.54 16.60 ? 322 SER A OG    1 
ATOM   2539 O  OG    B SER A 1 325 ? 34.101 5.205   -0.283  0.46 19.03 ? 322 SER A OG    1 
ATOM   2540 N  N     . LYS A 1 326 ? 32.750 7.885   -0.174  1.00 14.02 ? 323 LYS A N     1 
ATOM   2541 C  CA    . LYS A 1 326 ? 32.540 8.623   1.065   1.00 15.77 ? 323 LYS A CA    1 
ATOM   2542 C  C     . LYS A 1 326 ? 31.573 7.903   1.976   1.00 16.89 ? 323 LYS A C     1 
ATOM   2543 O  O     . LYS A 1 326 ? 30.501 7.479   1.540   1.00 14.91 ? 323 LYS A O     1 
ATOM   2544 C  CB    . LYS A 1 326 ? 32.022 10.036  0.789   1.00 13.75 ? 323 LYS A CB    1 
ATOM   2545 C  CG    . LYS A 1 326 ? 31.827 10.839  2.082   1.00 15.81 ? 323 LYS A CG    1 
ATOM   2546 C  CD    . LYS A 1 326 ? 31.772 12.319  1.800   1.00 19.00 ? 323 LYS A CD    1 
ATOM   2547 C  CE    . LYS A 1 326 ? 31.520 13.119  3.068   1.00 25.07 ? 323 LYS A CE    1 
ATOM   2548 N  NZ    . LYS A 1 326 ? 32.445 12.708  4.147   1.00 26.72 ? 323 LYS A NZ    1 
ATOM   2549 N  N     . ASN A 1 327 ? 31.971 7.755   3.236   1.00 13.69 ? 324 ASN A N     1 
ATOM   2550 C  CA    . ASN A 1 327 ? 31.078 7.285   4.289   1.00 14.13 ? 324 ASN A CA    1 
ATOM   2551 C  C     . ASN A 1 327 ? 30.215 8.412   4.857   1.00 17.66 ? 324 ASN A C     1 
ATOM   2552 O  O     . ASN A 1 327 ? 30.607 9.579   4.867   1.00 15.61 ? 324 ASN A O     1 
ATOM   2553 C  CB    . ASN A 1 327 ? 31.858 6.654   5.446   1.00 20.12 ? 324 ASN A CB    1 
ATOM   2554 C  CG    . ASN A 1 327 ? 32.526 5.345   5.075   1.00 23.93 ? 324 ASN A CG    1 
ATOM   2555 O  OD1   . ASN A 1 327 ? 32.346 4.820   3.978   1.00 23.05 ? 324 ASN A OD1   1 
ATOM   2556 N  ND2   . ASN A 1 327 ? 33.295 4.798   6.013   1.00 24.44 ? 324 ASN A ND2   1 
ATOM   2557 N  N     . PHE A 1 328 ? 29.041 8.033   5.349   1.00 19.31 ? 325 PHE A N     1 
ATOM   2558 C  CA    . PHE A 1 328 ? 28.128 8.966   5.979   1.00 22.52 ? 325 PHE A CA    1 
ATOM   2559 C  C     . PHE A 1 328 ? 27.648 8.310   7.264   1.00 25.03 ? 325 PHE A C     1 
ATOM   2560 O  O     . PHE A 1 328 ? 26.553 7.731   7.314   1.00 21.42 ? 325 PHE A O     1 
ATOM   2561 C  CB    . PHE A 1 328 ? 26.973 9.302   5.041   1.00 23.28 ? 325 PHE A CB    1 
ATOM   2562 C  CG    . PHE A 1 328 ? 27.414 9.882   3.725   1.00 18.43 ? 325 PHE A CG    1 
ATOM   2563 C  CD1   . PHE A 1 328 ? 27.604 9.061   2.619   1.00 19.86 ? 325 PHE A CD1   1 
ATOM   2564 C  CD2   . PHE A 1 328 ? 27.639 11.240  3.588   1.00 18.13 ? 325 PHE A CD2   1 
ATOM   2565 C  CE1   . PHE A 1 328 ? 28.013 9.597   1.405   1.00 14.04 ? 325 PHE A CE1   1 
ATOM   2566 C  CE2   . PHE A 1 328 ? 28.036 11.784  2.379   1.00 19.80 ? 325 PHE A CE2   1 
ATOM   2567 C  CZ    . PHE A 1 328 ? 28.229 10.954  1.280   1.00 19.26 ? 325 PHE A CZ    1 
ATOM   2568 N  N     . PRO A 1 329 ? 28.493 8.374   8.305   1.00 26.58 ? 326 PRO A N     1 
ATOM   2569 C  CA    . PRO A 1 329 ? 28.311 7.617   9.545   1.00 29.98 ? 326 PRO A CA    1 
ATOM   2570 C  C     . PRO A 1 329 ? 27.235 8.197   10.451  1.00 30.14 ? 326 PRO A C     1 
ATOM   2571 O  O     . PRO A 1 329 ? 26.909 9.381   10.335  1.00 26.02 ? 326 PRO A O     1 
ATOM   2572 C  CB    . PRO A 1 329 ? 29.684 7.712   10.211  1.00 28.79 ? 326 PRO A CB    1 
ATOM   2573 C  CG    . PRO A 1 329 ? 30.226 9.015   9.733   1.00 28.20 ? 326 PRO A CG    1 
ATOM   2574 C  CD    . PRO A 1 329 ? 29.737 9.164   8.318   1.00 26.79 ? 326 PRO A CD    1 
ATOM   2575 N  N     . GLY A 1 330 ? 26.704 7.354   11.335  1.00 33.28 ? 327 GLY A N     1 
ATOM   2576 C  CA    . GLY A 1 330 ? 25.745 7.769   12.346  1.00 34.83 ? 327 GLY A CA    1 
ATOM   2577 C  C     . GLY A 1 330 ? 24.606 8.622   11.825  1.00 34.21 ? 327 GLY A C     1 
ATOM   2578 O  O     . GLY A 1 330 ? 23.869 8.221   10.920  1.00 35.56 ? 327 GLY A O     1 
ATOM   2579 N  N     . LYS A 1 331 ? 24.478 9.818   12.390  1.00 30.84 ? 328 LYS A N     1 
ATOM   2580 C  CA    . LYS A 1 331 ? 23.373 10.703  12.057  1.00 31.20 ? 328 LYS A CA    1 
ATOM   2581 C  C     . LYS A 1 331 ? 23.577 11.459  10.749  1.00 35.83 ? 328 LYS A C     1 
ATOM   2582 O  O     . LYS A 1 331 ? 22.684 12.182  10.308  1.00 35.22 ? 328 LYS A O     1 
ATOM   2583 C  CB    . LYS A 1 331 ? 23.133 11.697  13.199  1.00 39.21 ? 328 LYS A CB    1 
ATOM   2584 C  CG    . LYS A 1 331 ? 22.312 11.121  14.343  1.00 47.28 ? 328 LYS A CG    1 
ATOM   2585 C  CD    . LYS A 1 331 ? 21.672 12.215  15.187  1.00 47.78 ? 328 LYS A CD    1 
ATOM   2586 C  CE    . LYS A 1 331 ? 20.180 11.967  15.372  1.00 48.88 ? 328 LYS A CE    1 
ATOM   2587 N  NZ    . LYS A 1 331 ? 19.775 11.992  16.806  1.00 63.90 ? 328 LYS A NZ    1 
ATOM   2588 N  N     . THR A 1 332 ? 24.737 11.305  10.117  1.00 31.19 ? 329 THR A N     1 
ATOM   2589 C  CA    . THR A 1 332 ? 24.963 12.003  8.853   1.00 32.57 ? 329 THR A CA    1 
ATOM   2590 C  C     . THR A 1 332 ? 24.470 11.181  7.659   1.00 27.25 ? 329 THR A C     1 
ATOM   2591 O  O     . THR A 1 332 ? 24.533 11.646  6.526   1.00 27.20 ? 329 THR A O     1 
ATOM   2592 C  CB    . THR A 1 332 ? 26.449 12.349  8.627   1.00 27.08 ? 329 THR A CB    1 
ATOM   2593 O  OG1   . THR A 1 332 ? 27.207 11.147  8.439   1.00 28.36 ? 329 THR A OG1   1 
ATOM   2594 C  CG2   . THR A 1 332 ? 27.010 13.133  9.812   1.00 27.10 ? 329 THR A CG2   1 
ATOM   2595 N  N     . ALA A 1 333 ? 23.978 9.973   7.925   1.00 24.78 ? 330 ALA A N     1 
ATOM   2596 C  CA    . ALA A 1 333 ? 23.465 9.093   6.871   1.00 26.85 ? 330 ALA A CA    1 
ATOM   2597 C  C     . ALA A 1 333 ? 22.417 9.784   6.003   1.00 32.41 ? 330 ALA A C     1 
ATOM   2598 O  O     . ALA A 1 333 ? 21.528 10.472  6.507   1.00 35.37 ? 330 ALA A O     1 
ATOM   2599 C  CB    . ALA A 1 333 ? 22.895 7.826   7.478   1.00 29.22 ? 330 ALA A CB    1 
ATOM   2600 N  N     . LEU A 1 334 ? 22.527 9.592   4.692   1.00 28.10 ? 331 LEU A N     1 
ATOM   2601 C  CA    . LEU A 1 334 ? 21.682 10.291  3.733   1.00 27.96 ? 331 LEU A CA    1 
ATOM   2602 C  C     . LEU A 1 334 ? 20.255 9.736   3.741   1.00 29.01 ? 331 LEU A C     1 
ATOM   2603 O  O     . LEU A 1 334 ? 20.046 8.549   3.515   1.00 33.11 ? 331 LEU A O     1 
ATOM   2604 C  CB    . LEU A 1 334 ? 22.285 10.187  2.332   1.00 26.63 ? 331 LEU A CB    1 
ATOM   2605 C  CG    . LEU A 1 334 ? 23.785 10.470  2.238   1.00 22.22 ? 331 LEU A CG    1 
ATOM   2606 C  CD1   . LEU A 1 334 ? 24.247 10.360  0.798   1.00 21.07 ? 331 LEU A CD1   1 
ATOM   2607 C  CD2   . LEU A 1 334 ? 24.103 11.852  2.807   1.00 22.34 ? 331 LEU A CD2   1 
ATOM   2608 N  N     . ALA A 1 335 ? 19.280 10.605  3.987   1.00 30.23 ? 332 ALA A N     1 
ATOM   2609 C  CA    . ALA A 1 335 ? 17.899 10.168  4.195   1.00 33.10 ? 332 ALA A CA    1 
ATOM   2610 C  C     . ALA A 1 335 ? 16.904 10.864  3.267   1.00 38.89 ? 332 ALA A C     1 
ATOM   2611 O  O     . ALA A 1 335 ? 15.696 10.628  3.353   1.00 33.16 ? 332 ALA A O     1 
ATOM   2612 C  CB    . ALA A 1 335 ? 17.501 10.392  5.643   1.00 37.76 ? 332 ALA A CB    1 
ATOM   2613 N  N     . THR A 1 336 ? 17.408 11.725  2.390   1.00 31.25 ? 333 THR A N     1 
ATOM   2614 C  CA    . THR A 1 336 ? 16.575 12.350  1.373   1.00 35.16 ? 333 THR A CA    1 
ATOM   2615 C  C     . THR A 1 336 ? 17.137 12.065  -0.017  1.00 39.28 ? 333 THR A C     1 
ATOM   2616 O  O     . THR A 1 336 ? 18.343 11.869  -0.179  1.00 32.53 ? 333 THR A O     1 
ATOM   2617 C  CB    . THR A 1 336 ? 16.460 13.874  1.565   1.00 36.55 ? 333 THR A CB    1 
ATOM   2618 O  OG1   . THR A 1 336 ? 17.651 14.519  1.099   1.00 37.05 ? 333 THR A OG1   1 
ATOM   2619 C  CG2   . THR A 1 336 ? 16.233 14.218  3.031   1.00 35.32 ? 333 THR A CG2   1 
ATOM   2620 N  N     . ARG A 1 337 ? 16.258 12.038  -1.012  1.00 37.04 ? 334 ARG A N     1 
ATOM   2621 C  CA    . ARG A 1 337 ? 16.676 11.852  -2.397  1.00 36.30 ? 334 ARG A CA    1 
ATOM   2622 C  C     . ARG A 1 337 ? 17.614 12.966  -2.850  1.00 36.84 ? 334 ARG A C     1 
ATOM   2623 O  O     . ARG A 1 337 ? 18.584 12.715  -3.567  1.00 34.49 ? 334 ARG A O     1 
ATOM   2624 C  CB    . ARG A 1 337 ? 15.454 11.782  -3.320  1.00 42.74 ? 334 ARG A CB    1 
ATOM   2625 C  CG    . ARG A 1 337 ? 15.802 11.721  -4.800  1.00 47.50 ? 334 ARG A CG    1 
ATOM   2626 C  CD    . ARG A 1 337 ? 14.576 11.459  -5.671  1.00 52.35 ? 334 ARG A CD    1 
ATOM   2627 N  NE    . ARG A 1 337 ? 13.470 12.370  -5.384  1.00 61.61 ? 334 ARG A NE    1 
ATOM   2628 C  CZ    . ARG A 1 337 ? 13.415 13.637  -5.786  1.00 68.58 ? 334 ARG A CZ    1 
ATOM   2629 N  NH1   . ARG A 1 337 ? 14.409 14.160  -6.492  1.00 61.65 ? 334 ARG A NH1   1 
ATOM   2630 N  NH2   . ARG A 1 337 ? 12.364 14.387  -5.478  1.00 66.87 ? 334 ARG A NH2   1 
ATOM   2631 N  N     . GLU A 1 338 ? 17.327 14.193  -2.422  1.00 36.89 ? 335 GLU A N     1 
ATOM   2632 C  CA    . GLU A 1 338 ? 18.151 15.351  -2.773  1.00 38.14 ? 335 GLU A CA    1 
ATOM   2633 C  C     . GLU A 1 338 ? 19.565 15.227  -2.215  1.00 31.17 ? 335 GLU A C     1 
ATOM   2634 O  O     . GLU A 1 338 ? 20.533 15.652  -2.843  1.00 28.38 ? 335 GLU A O     1 
ATOM   2635 C  CB    . GLU A 1 338 ? 17.509 16.643  -2.264  1.00 37.95 ? 335 GLU A CB    1 
ATOM   2636 C  CG    . GLU A 1 338 ? 16.251 17.063  -3.010  1.00 48.61 ? 335 GLU A CG    1 
ATOM   2637 C  CD    . GLU A 1 338 ? 16.549 17.681  -4.366  1.00 58.78 ? 335 GLU A CD    1 
ATOM   2638 O  OE1   . GLU A 1 338 ? 17.740 17.854  -4.697  1.00 54.98 ? 335 GLU A OE1   1 
ATOM   2639 O  OE2   . GLU A 1 338 ? 15.587 17.997  -5.100  1.00 62.43 ? 335 GLU A OE2   1 
ATOM   2640 N  N     . GLN A 1 339 ? 19.668 14.651  -1.024  1.00 31.92 ? 336 GLN A N     1 
ATOM   2641 C  CA    . GLN A 1 339 ? 20.962 14.425  -0.398  1.00 31.67 ? 336 GLN A CA    1 
ATOM   2642 C  C     . GLN A 1 339 ? 21.781 13.435  -1.212  1.00 30.31 ? 336 GLN A C     1 
ATOM   2643 O  O     . GLN A 1 339 ? 22.939 13.701  -1.563  1.00 25.92 ? 336 GLN A O     1 
ATOM   2644 C  CB    . GLN A 1 339 ? 20.785 13.895  1.021   1.00 34.66 ? 336 GLN A CB    1 
ATOM   2645 C  CG    . GLN A 1 339 ? 21.044 14.891  2.118   1.00 32.06 ? 336 GLN A CG    1 
ATOM   2646 C  CD    . GLN A 1 339 ? 21.023 14.228  3.474   1.00 33.48 ? 336 GLN A CD    1 
ATOM   2647 O  OE1   . GLN A 1 339 ? 20.159 13.396  3.759   1.00 31.98 ? 336 GLN A OE1   1 
ATOM   2648 N  NE2   . GLN A 1 339 ? 21.991 14.570  4.314   1.00 28.53 ? 336 GLN A NE2   1 
ATOM   2649 N  N     . VAL A 1 340 ? 21.163 12.290  -1.491  1.00 30.28 ? 337 VAL A N     1 
ATOM   2650 C  CA    . VAL A 1 340 ? 21.793 11.221  -2.252  1.00 25.91 ? 337 VAL A CA    1 
ATOM   2651 C  C     . VAL A 1 340 ? 22.284 11.739  -3.596  1.00 29.91 ? 337 VAL A C     1 
ATOM   2652 O  O     . VAL A 1 340 ? 23.396 11.416  -4.020  1.00 23.61 ? 337 VAL A O     1 
ATOM   2653 C  CB    . VAL A 1 340 ? 20.821 10.038  -2.466  1.00 31.21 ? 337 VAL A CB    1 
ATOM   2654 C  CG1   . VAL A 1 340 ? 21.434 8.989   -3.376  1.00 23.58 ? 337 VAL A CG1   1 
ATOM   2655 C  CG2   . VAL A 1 340 ? 20.451 9.421   -1.135  1.00 27.26 ? 337 VAL A CG2   1 
ATOM   2656 N  N     . GLN A 1 341 ? 21.471 12.563  -4.247  1.00 26.36 ? 338 GLN A N     1 
ATOM   2657 C  CA    . GLN A 1 341 ? 21.817 13.090  -5.561  1.00 26.24 ? 338 GLN A CA    1 
ATOM   2658 C  C     . GLN A 1 341 ? 22.953 14.092  -5.501  1.00 27.57 ? 338 GLN A C     1 
ATOM   2659 O  O     . GLN A 1 341 ? 23.819 14.102  -6.371  1.00 26.10 ? 338 GLN A O     1 
ATOM   2660 C  CB    . GLN A 1 341 ? 20.604 13.738  -6.224  1.00 31.84 ? 338 GLN A CB    1 
ATOM   2661 C  CG    . GLN A 1 341 ? 19.553 12.745  -6.674  1.00 33.89 ? 338 GLN A CG    1 
ATOM   2662 C  CD    . GLN A 1 341 ? 18.318 13.427  -7.235  1.00 39.20 ? 338 GLN A CD    1 
ATOM   2663 O  OE1   . GLN A 1 341 ? 18.174 14.647  -7.154  1.00 45.76 ? 338 GLN A OE1   1 
ATOM   2664 N  NE2   . GLN A 1 341 ? 17.421 12.638  -7.815  1.00 42.87 ? 338 GLN A NE2   1 
ATOM   2665 N  N     . TRP A 1 342 ? 22.949 14.941  -4.479  1.00 22.42 ? 339 TRP A N     1 
ATOM   2666 C  CA    . TRP A 1 342 ? 23.981 15.959  -4.359  1.00 21.91 ? 339 TRP A CA    1 
ATOM   2667 C  C     . TRP A 1 342 ? 25.349 15.307  -4.136  1.00 17.20 ? 339 TRP A C     1 
ATOM   2668 O  O     . TRP A 1 342 ? 26.337 15.704  -4.747  1.00 18.65 ? 339 TRP A O     1 
ATOM   2669 C  CB    . TRP A 1 342 ? 23.655 16.937  -3.222  1.00 22.50 ? 339 TRP A CB    1 
ATOM   2670 C  CG    . TRP A 1 342 ? 24.583 18.115  -3.181  1.00 25.42 ? 339 TRP A CG    1 
ATOM   2671 C  CD1   . TRP A 1 342 ? 24.519 19.239  -3.949  1.00 25.61 ? 339 TRP A CD1   1 
ATOM   2672 C  CD2   . TRP A 1 342 ? 25.722 18.277  -2.331  1.00 21.52 ? 339 TRP A CD2   1 
ATOM   2673 N  NE1   . TRP A 1 342 ? 25.543 20.090  -3.631  1.00 29.09 ? 339 TRP A NE1   1 
ATOM   2674 C  CE2   . TRP A 1 342 ? 26.297 19.524  -2.637  1.00 24.25 ? 339 TRP A CE2   1 
ATOM   2675 C  CE3   . TRP A 1 342 ? 26.310 17.488  -1.336  1.00 24.05 ? 339 TRP A CE3   1 
ATOM   2676 C  CZ2   . TRP A 1 342 ? 27.436 20.002  -1.992  1.00 26.22 ? 339 TRP A CZ2   1 
ATOM   2677 C  CZ3   . TRP A 1 342 ? 27.437 17.967  -0.687  1.00 22.52 ? 339 TRP A CZ3   1 
ATOM   2678 C  CH2   . TRP A 1 342 ? 27.990 19.213  -1.020  1.00 25.43 ? 339 TRP A CH2   1 
ATOM   2679 N  N     . TRP A 1 343 ? 25.397 14.304  -3.272  1.00 20.16 ? 340 TRP A N     1 
ATOM   2680 C  CA    . TRP A 1 343 ? 26.665 13.643  -2.980  1.00 17.08 ? 340 TRP A CA    1 
ATOM   2681 C  C     . TRP A 1 343 ? 27.131 12.778  -4.146  1.00 19.07 ? 340 TRP A C     1 
ATOM   2682 O  O     . TRP A 1 343 ? 28.331 12.654  -4.378  1.00 17.98 ? 340 TRP A O     1 
ATOM   2683 C  CB    . TRP A 1 343 ? 26.560 12.816  -1.703  1.00 20.33 ? 340 TRP A CB    1 
ATOM   2684 C  CG    . TRP A 1 343 ? 26.686 13.660  -0.462  1.00 20.35 ? 340 TRP A CG    1 
ATOM   2685 C  CD1   . TRP A 1 343 ? 25.708 13.947  0.445   1.00 21.78 ? 340 TRP A CD1   1 
ATOM   2686 C  CD2   . TRP A 1 343 ? 27.866 14.336  -0.010  1.00 17.31 ? 340 TRP A CD2   1 
ATOM   2687 N  NE1   . TRP A 1 343 ? 26.211 14.757  1.442   1.00 19.70 ? 340 TRP A NE1   1 
ATOM   2688 C  CE2   . TRP A 1 343 ? 27.534 15.009  1.181   1.00 20.16 ? 340 TRP A CE2   1 
ATOM   2689 C  CE3   . TRP A 1 343 ? 29.178 14.429  -0.498  1.00 19.11 ? 340 TRP A CE3   1 
ATOM   2690 C  CZ2   . TRP A 1 343 ? 28.466 15.764  1.897   1.00 19.09 ? 340 TRP A CZ2   1 
ATOM   2691 C  CZ3   . TRP A 1 343 ? 30.096 15.186  0.208   1.00 16.44 ? 340 TRP A CZ3   1 
ATOM   2692 C  CH2   . TRP A 1 343 ? 29.737 15.838  1.396   1.00 23.61 ? 340 TRP A CH2   1 
ATOM   2693 N  N     . LEU A 1 344 ? 26.198 12.209  -4.905  1.00 17.01 ? 341 LEU A N     1 
ATOM   2694 C  CA    . LEU A 1 344 ? 26.603 11.459  -6.095  1.00 17.80 ? 341 LEU A CA    1 
ATOM   2695 C  C     . LEU A 1 344 ? 27.276 12.410  -7.071  1.00 18.35 ? 341 LEU A C     1 
ATOM   2696 O  O     . LEU A 1 344 ? 28.270 12.064  -7.720  1.00 17.23 ? 341 LEU A O     1 
ATOM   2697 C  CB    . LEU A 1 344 ? 25.410 10.761  -6.758  1.00 16.49 ? 341 LEU A CB    1 
ATOM   2698 C  CG    . LEU A 1 344 ? 24.881 9.504   -6.065  1.00 18.69 ? 341 LEU A CG    1 
ATOM   2699 C  CD1   . LEU A 1 344 ? 23.620 9.018   -6.777  1.00 25.00 ? 341 LEU A CD1   1 
ATOM   2700 C  CD2   . LEU A 1 344 ? 25.921 8.390   -6.005  1.00 18.68 ? 341 LEU A CD2   1 
ATOM   2701 N  N     . LEU A 1 345 ? 26.749 13.624  -7.162  1.00 16.58 ? 342 LEU A N     1 
ATOM   2702 C  CA    . LEU A 1 345 ? 27.342 14.631  -8.017  1.00 14.32 ? 342 LEU A CA    1 
ATOM   2703 C  C     . LEU A 1 345 ? 28.739 15.034  -7.525  1.00 17.49 ? 342 LEU A C     1 
ATOM   2704 O  O     . LEU A 1 345 ? 29.654 15.201  -8.328  1.00 16.73 ? 342 LEU A O     1 
ATOM   2705 C  CB    . LEU A 1 345 ? 26.431 15.863  -8.109  1.00 20.98 ? 342 LEU A CB    1 
ATOM   2706 C  CG    . LEU A 1 345 ? 26.948 17.007  -8.980  1.00 22.12 ? 342 LEU A CG    1 
ATOM   2707 C  CD1   . LEU A 1 345 ? 27.212 16.513  -10.410 1.00 23.60 ? 342 LEU A CD1   1 
ATOM   2708 C  CD2   . LEU A 1 345 ? 25.951 18.151  -8.990  1.00 24.91 ? 342 LEU A CD2   1 
ATOM   2709 N  N     . GLN A 1 346 ? 28.905 15.188  -6.213  1.00 17.14 ? 343 GLN A N     1 
ATOM   2710 C  CA    . GLN A 1 346 ? 30.211 15.577  -5.682  1.00 16.09 ? 343 GLN A CA    1 
ATOM   2711 C  C     . GLN A 1 346 ? 31.251 14.519  -6.031  1.00 14.50 ? 343 GLN A C     1 
ATOM   2712 O  O     . GLN A 1 346 ? 32.338 14.845  -6.507  1.00 15.14 ? 343 GLN A O     1 
ATOM   2713 C  CB    . GLN A 1 346 ? 30.182 15.776  -4.162  1.00 16.03 ? 343 GLN A CB    1 
ATOM   2714 C  CG    . GLN A 1 346 ? 29.170 16.831  -3.668  1.00 14.99 ? 343 GLN A CG    1 
ATOM   2715 C  CD    . GLN A 1 346 ? 29.118 18.066  -4.543  1.00 17.93 ? 343 GLN A CD    1 
ATOM   2716 O  OE1   . GLN A 1 346 ? 30.077 18.843  -4.628  1.00 22.11 ? 343 GLN A OE1   1 
ATOM   2717 N  NE2   . GLN A 1 346 ? 27.984 18.254  -5.213  1.00 20.77 ? 343 GLN A NE2   1 
ATOM   2718 N  N     . LEU A 1 347 ? 30.905 13.266  -5.765  1.00 15.54 ? 344 LEU A N     1 
ATOM   2719 C  CA    . LEU A 1 347 ? 31.767 12.134  -6.099  1.00 15.41 ? 344 LEU A CA    1 
ATOM   2720 C  C     . LEU A 1 347 ? 32.064 12.096  -7.600  1.00 17.10 ? 344 LEU A C     1 
ATOM   2721 O  O     . LEU A 1 347 ? 33.210 11.902  -8.007  1.00 15.04 ? 344 LEU A O     1 
ATOM   2722 C  CB    . LEU A 1 347 ? 31.125 10.817  -5.660  1.00 14.20 ? 344 LEU A CB    1 
ATOM   2723 C  CG    . LEU A 1 347 ? 31.120 10.483  -4.166  1.00 20.44 ? 344 LEU A CG    1 
ATOM   2724 C  CD1   . LEU A 1 347 ? 30.461 9.141   -3.905  1.00 23.71 ? 344 LEU A CD1   1 
ATOM   2725 C  CD2   . LEU A 1 347 ? 32.509 10.465  -3.647  1.00 22.07 ? 344 LEU A CD2   1 
ATOM   2726 N  N     . ALA A 1 348 ? 31.030 12.285  -8.420  1.00 16.74 ? 345 ALA A N     1 
ATOM   2727 C  CA    . ALA A 1 348 ? 31.190 12.220  -9.874  1.00 13.02 ? 345 ALA A CA    1 
ATOM   2728 C  C     . ALA A 1 348 ? 32.067 13.339  -10.408 1.00 13.49 ? 345 ALA A C     1 
ATOM   2729 O  O     . ALA A 1 348 ? 32.746 13.176  -11.423 1.00 14.66 ? 345 ALA A O     1 
ATOM   2730 C  CB    . ALA A 1 348 ? 29.817 12.269  -10.567 1.00 14.20 ? 345 ALA A CB    1 
ATOM   2731 N  N     . GLN A 1 349 ? 32.024 14.492  -9.745  1.00 14.38 ? 346 GLN A N     1 
ATOM   2732 C  CA    . GLN A 1 349 ? 32.831 15.614  -10.167 1.00 14.33 ? 346 GLN A CA    1 
ATOM   2733 C  C     . GLN A 1 349 ? 34.309 15.371  -9.868  1.00 14.46 ? 346 GLN A C     1 
ATOM   2734 O  O     . GLN A 1 349 ? 35.168 15.712  -10.673 1.00 14.69 ? 346 GLN A O     1 
ATOM   2735 C  CB    . GLN A 1 349 ? 32.351 16.904  -9.502  1.00 15.77 ? 346 GLN A CB    1 
ATOM   2736 C  CG    . GLN A 1 349 ? 31.090 17.458  -10.151 1.00 19.65 ? 346 GLN A CG    1 
ATOM   2737 C  CD    . GLN A 1 349 ? 30.569 18.712  -9.464  1.00 32.02 ? 346 GLN A CD    1 
ATOM   2738 O  OE1   . GLN A 1 349 ? 31.068 19.112  -8.413  1.00 32.59 ? 346 GLN A OE1   1 
ATOM   2739 N  NE2   . GLN A 1 349 ? 29.565 19.343  -10.068 1.00 35.25 ? 346 GLN A NE2   1 
ATOM   2740 N  N     . GLU A 1 350 ? 34.605 14.780  -8.717  1.00 14.55 ? 347 GLU A N     1 
ATOM   2741 C  CA    . GLU A 1 350 ? 35.984 14.403  -8.444  1.00 15.96 ? 347 GLU A CA    1 
ATOM   2742 C  C     . GLU A 1 350 ? 36.424 13.320  -9.428  1.00 13.49 ? 347 GLU A C     1 
ATOM   2743 O  O     . GLU A 1 350 ? 37.538 13.372  -9.950  1.00 14.89 ? 347 GLU A O     1 
ATOM   2744 C  CB    . GLU A 1 350 ? 36.178 13.915  -7.006  1.00 13.03 ? 347 GLU A CB    1 
ATOM   2745 C  CG    . GLU A 1 350 ? 37.641 13.512  -6.778  1.00 14.96 ? 347 GLU A CG    1 
ATOM   2746 C  CD    . GLU A 1 350 ? 37.942 12.949  -5.403  1.00 21.40 ? 347 GLU A CD    1 
ATOM   2747 O  OE1   . GLU A 1 350 ? 37.295 13.346  -4.413  1.00 20.21 ? 347 GLU A OE1   1 
ATOM   2748 O  OE2   . GLU A 1 350 ? 38.837 12.091  -5.322  1.00 17.55 ? 347 GLU A OE2   1 
ATOM   2749 N  N     . LEU A 1 351 ? 35.552 12.344  -9.670  1.00 12.11 ? 348 LEU A N     1 
ATOM   2750 C  CA    . LEU A 1 351 ? 35.866 11.254  -10.592 1.00 14.59 ? 348 LEU A CA    1 
ATOM   2751 C  C     . LEU A 1 351 ? 36.154 11.785  -11.998 1.00 13.40 ? 348 LEU A C     1 
ATOM   2752 O  O     . LEU A 1 351 ? 37.130 11.382  -12.630 1.00 14.71 ? 348 LEU A O     1 
ATOM   2753 C  CB    . LEU A 1 351 ? 34.728 10.240  -10.623 1.00 16.39 ? 348 LEU A CB    1 
ATOM   2754 C  CG    . LEU A 1 351 ? 35.010 8.942   -11.384 1.00 18.06 ? 348 LEU A CG    1 
ATOM   2755 C  CD1   . LEU A 1 351 ? 36.271 8.276   -10.831 1.00 22.29 ? 348 LEU A CD1   1 
ATOM   2756 C  CD2   . LEU A 1 351 ? 33.817 7.998   -11.306 1.00 19.38 ? 348 LEU A CD2   1 
ATOM   2757 N  N     . GLU A 1 352 ? 35.318 12.696  -12.491 1.00 14.46 ? 349 GLU A N     1 
ATOM   2758 C  CA    . GLU A 1 352 ? 35.548 13.267  -13.816 1.00 15.25 ? 349 GLU A CA    1 
ATOM   2759 C  C     . GLU A 1 352 ? 36.900 13.958  -13.910 1.00 15.60 ? 349 GLU A C     1 
ATOM   2760 O  O     . GLU A 1 352 ? 37.624 13.809  -14.901 1.00 15.86 ? 349 GLU A O     1 
ATOM   2761 C  CB    . GLU A 1 352 ? 34.443 14.266  -14.180 1.00 17.33 ? 349 GLU A CB    1 
ATOM   2762 C  CG    . GLU A 1 352 ? 34.747 15.028  -15.461 1.00 21.82 ? 349 GLU A CG    1 
ATOM   2763 C  CD    . GLU A 1 352 ? 33.737 16.127  -15.765 1.00 34.42 ? 349 GLU A CD    1 
ATOM   2764 O  OE1   . GLU A 1 352 ? 34.130 17.131  -16.397 1.00 39.55 ? 349 GLU A OE1   1 
ATOM   2765 O  OE2   . GLU A 1 352 ? 32.553 15.988  -15.386 1.00 30.95 ? 349 GLU A OE2   1 
ATOM   2766 N  N     . GLU A 1 353 ? 37.250 14.708  -12.868 1.00 15.38 ? 350 GLU A N     1 
ATOM   2767 C  CA    . GLU A 1 353 ? 38.516 15.422  -12.833 1.00 13.72 ? 350 GLU A CA    1 
ATOM   2768 C  C     . GLU A 1 353 ? 39.686 14.446  -12.941 1.00 16.05 ? 350 GLU A C     1 
ATOM   2769 O  O     . GLU A 1 353 ? 40.624 14.644  -13.719 1.00 16.84 ? 350 GLU A O     1 
ATOM   2770 C  CB    . GLU A 1 353 ? 38.615 16.236  -11.545 1.00 20.58 ? 350 GLU A CB    1 
ATOM   2771 C  CG    . GLU A 1 353 ? 39.806 17.167  -11.472 1.00 28.39 ? 350 GLU A CG    1 
ATOM   2772 C  CD    . GLU A 1 353 ? 39.679 18.149  -10.319 1.00 37.25 ? 350 GLU A CD    1 
ATOM   2773 O  OE1   . GLU A 1 353 ? 39.746 17.704  -9.154  1.00 48.06 ? 350 GLU A OE1   1 
ATOM   2774 O  OE2   . GLU A 1 353 ? 39.475 19.354  -10.580 1.00 45.95 ? 350 GLU A OE2   1 
ATOM   2775 N  N     . ARG A 1 354 ? 39.606 13.374  -12.165 1.00 14.33 ? 351 ARG A N     1 
ATOM   2776 C  CA    . ARG A 1 354 ? 40.689 12.406  -12.144 1.00 13.73 ? 351 ARG A CA    1 
ATOM   2777 C  C     . ARG A 1 354 ? 40.729 11.606  -13.437 1.00 15.16 ? 351 ARG A C     1 
ATOM   2778 O  O     . ARG A 1 354 ? 41.810 11.310  -13.938 1.00 13.55 ? 351 ARG A O     1 
ATOM   2779 C  CB    . ARG A 1 354 ? 40.559 11.494  -10.931 1.00 13.72 ? 351 ARG A CB    1 
ATOM   2780 C  CG    . ARG A 1 354 ? 41.010 12.192  -9.653  1.00 14.76 ? 351 ARG A CG    1 
ATOM   2781 C  CD    . ARG A 1 354 ? 40.548 11.466  -8.408  1.00 16.96 ? 351 ARG A CD    1 
ATOM   2782 N  NE    . ARG A 1 354 ? 41.065 10.108  -8.339  1.00 16.00 ? 351 ARG A NE    1 
ATOM   2783 C  CZ    . ARG A 1 354 ? 40.608 9.191   -7.494  1.00 16.22 ? 351 ARG A CZ    1 
ATOM   2784 N  NH1   . ARG A 1 354 ? 39.636 9.495   -6.626  1.00 15.95 ? 351 ARG A NH1   1 
ATOM   2785 N  NH2   . ARG A 1 354 ? 41.132 7.977   -7.509  1.00 15.95 ? 351 ARG A NH2   1 
ATOM   2786 N  N     . LEU A 1 355 ? 39.558 11.274  -13.979 1.00 14.16 ? 352 LEU A N     1 
ATOM   2787 C  CA    . LEU A 1 355 ? 39.482 10.516  -15.226 1.00 15.48 ? 352 LEU A CA    1 
ATOM   2788 C  C     . LEU A 1 355 ? 40.041 11.323  -16.386 1.00 15.94 ? 352 LEU A C     1 
ATOM   2789 O  O     . LEU A 1 355 ? 40.753 10.790  -17.235 1.00 14.32 ? 352 LEU A O     1 
ATOM   2790 C  CB    . LEU A 1 355 ? 38.043 10.117  -15.532 1.00 15.67 ? 352 LEU A CB    1 
ATOM   2791 C  CG    . LEU A 1 355 ? 37.485 8.906   -14.795 1.00 16.72 ? 352 LEU A CG    1 
ATOM   2792 C  CD1   . LEU A 1 355 ? 36.037 8.717   -15.175 1.00 17.04 ? 352 LEU A CD1   1 
ATOM   2793 C  CD2   . LEU A 1 355 ? 38.278 7.648   -15.119 1.00 16.38 ? 352 LEU A CD2   1 
ATOM   2794 N  N     . THR A 1 356 ? 39.708 12.610  -16.436 1.00 15.13 ? 353 THR A N     1 
ATOM   2795 C  CA    . THR A 1 356 ? 40.160 13.437  -17.545 1.00 16.65 ? 353 THR A CA    1 
ATOM   2796 C  C     . THR A 1 356 ? 41.682 13.568  -17.518 1.00 17.41 ? 353 THR A C     1 
ATOM   2797 O  O     . THR A 1 356 ? 42.341 13.467  -18.556 1.00 17.41 ? 353 THR A O     1 
ATOM   2798 C  CB    . THR A 1 356 ? 39.476 14.818  -17.518 1.00 18.61 ? 353 THR A CB    1 
ATOM   2799 O  OG1   . THR A 1 356 ? 38.073 14.632  -17.748 1.00 18.25 ? 353 THR A OG1   1 
ATOM   2800 C  CG2   . THR A 1 356 ? 40.026 15.710  -18.597 1.00 21.29 ? 353 THR A CG2   1 
ATOM   2801 N  N     . LYS A 1 357 ? 42.247 13.766  -16.331 1.00 16.80 ? 354 LYS A N     1 
ATOM   2802 C  CA    . LYS A 1 357 ? 43.695 13.792  -16.198 1.00 13.50 ? 354 LYS A CA    1 
ATOM   2803 C  C     . LYS A 1 357 ? 44.308 12.451  -16.608 1.00 15.62 ? 354 LYS A C     1 
ATOM   2804 O  O     . LYS A 1 357 ? 45.320 12.403  -17.311 1.00 15.99 ? 354 LYS A O     1 
ATOM   2805 C  CB    . LYS A 1 357 ? 44.103 14.135  -14.764 1.00 15.87 ? 354 LYS A CB    1 
ATOM   2806 C  CG    . LYS A 1 357 ? 45.608 14.263  -14.604 1.00 20.82 ? 354 LYS A CG    1 
ATOM   2807 C  CD    . LYS A 1 357 ? 45.966 15.357  -13.611 1.00 41.21 ? 354 LYS A CD    1 
ATOM   2808 C  CE    . LYS A 1 357 ? 47.373 15.879  -13.869 1.00 41.40 ? 354 LYS A CE    1 
ATOM   2809 N  NZ    . LYS A 1 357 ? 48.357 14.768  -13.920 1.00 27.35 ? 354 LYS A NZ    1 
ATOM   2810 N  N     . ASP A 1 358 ? 43.691 11.361  -16.173 1.00 14.62 ? 355 ASP A N     1 
ATOM   2811 C  CA    . ASP A 1 358 ? 44.213 10.030  -16.486 1.00 14.59 ? 355 ASP A CA    1 
ATOM   2812 C  C     . ASP A 1 358 ? 44.261 9.786   -17.993 1.00 16.50 ? 355 ASP A C     1 
ATOM   2813 O  O     . ASP A 1 358 ? 45.232 9.230   -18.502 1.00 15.38 ? 355 ASP A O     1 
ATOM   2814 C  CB    . ASP A 1 358 ? 43.371 8.950   -15.802 1.00 14.29 ? 355 ASP A CB    1 
ATOM   2815 C  CG    . ASP A 1 358 ? 43.907 7.563   -16.052 1.00 18.18 ? 355 ASP A CG    1 
ATOM   2816 O  OD1   . ASP A 1 358 ? 44.911 7.193   -15.405 1.00 16.55 ? 355 ASP A OD1   1 
ATOM   2817 O  OD2   . ASP A 1 358 ? 43.340 6.853   -16.908 1.00 15.98 ? 355 ASP A OD2   1 
ATOM   2818 N  N     . ARG A 1 359 ? 43.215 10.214  -18.699 1.00 15.10 ? 356 ARG A N     1 
ATOM   2819 C  CA    . ARG A 1 359 ? 43.143 10.025  -20.144 1.00 16.85 ? 356 ARG A CA    1 
ATOM   2820 C  C     . ARG A 1 359 ? 44.267 10.766  -20.865 1.00 15.97 ? 356 ARG A C     1 
ATOM   2821 O  O     . ARG A 1 359 ? 44.897 10.226  -21.786 1.00 16.84 ? 356 ARG A O     1 
ATOM   2822 C  CB    . ARG A 1 359 ? 41.783 10.491  -20.668 1.00 18.49 ? 356 ARG A CB    1 
ATOM   2823 C  CG    . ARG A 1 359 ? 41.544 10.195  -22.145 1.00 16.87 ? 356 ARG A CG    1 
ATOM   2824 C  CD    . ARG A 1 359 ? 40.140 10.629  -22.551 1.00 20.32 ? 356 ARG A CD    1 
ATOM   2825 N  NE    . ARG A 1 359 ? 39.944 12.068  -22.370 1.00 22.79 ? 356 ARG A NE    1 
ATOM   2826 C  CZ    . ARG A 1 359 ? 38.755 12.668  -22.291 1.00 28.41 ? 356 ARG A CZ    1 
ATOM   2827 N  NH1   . ARG A 1 359 ? 37.635 11.959  -22.371 1.00 31.11 ? 356 ARG A NH1   1 
ATOM   2828 N  NH2   . ARG A 1 359 ? 38.689 13.985  -22.130 1.00 28.83 ? 356 ARG A NH2   1 
ATOM   2829 N  N     . ASN A 1 360 ? 44.531 11.996  -20.430 1.00 14.36 ? 357 ASN A N     1 
ATOM   2830 C  CA    . ASN A 1 360 ? 45.600 12.801  -21.014 1.00 15.31 ? 357 ASN A CA    1 
ATOM   2831 C  C     . ASN A 1 360 ? 46.988 12.236  -20.701 1.00 17.92 ? 357 ASN A C     1 
ATOM   2832 O  O     . ASN A 1 360 ? 47.881 12.235  -21.549 1.00 17.52 ? 357 ASN A O     1 
ATOM   2833 C  CB    . ASN A 1 360 ? 45.515 14.237  -20.513 1.00 14.31 ? 357 ASN A CB    1 
ATOM   2834 C  CG    . ASN A 1 360 ? 44.372 15.005  -21.129 1.00 21.31 ? 357 ASN A CG    1 
ATOM   2835 O  OD1   . ASN A 1 360 ? 43.968 14.744  -22.263 1.00 23.50 ? 357 ASN A OD1   1 
ATOM   2836 N  ND2   . ASN A 1 360 ? 43.857 15.977  -20.392 1.00 22.87 ? 357 ASN A ND2   1 
ATOM   2837 N  N     . ASP A 1 361 ? 47.157 11.746  -19.474 1.00 16.58 ? 358 ASP A N     1 
ATOM   2838 C  CA    . ASP A 1 361 ? 48.457 11.264  -19.020 1.00 18.74 ? 358 ASP A CA    1 
ATOM   2839 C  C     . ASP A 1 361 ? 48.805 9.893   -19.561 1.00 18.14 ? 358 ASP A C     1 
ATOM   2840 O  O     . ASP A 1 361 ? 49.964 9.628   -19.899 1.00 17.00 ? 358 ASP A O     1 
ATOM   2841 C  CB    . ASP A 1 361 ? 48.501 11.216  -17.486 1.00 17.33 ? 358 ASP A CB    1 
ATOM   2842 C  CG    . ASP A 1 361 ? 48.599 12.594  -16.861 1.00 26.04 ? 358 ASP A CG    1 
ATOM   2843 O  OD1   . ASP A 1 361 ? 48.823 13.576  -17.609 1.00 24.99 ? 358 ASP A OD1   1 
ATOM   2844 O  OD2   . ASP A 1 361 ? 48.451 12.687  -15.621 1.00 28.36 ? 358 ASP A OD2   1 
ATOM   2845 N  N     . ASN A 1 362 ? 47.802 9.024   -19.626 1.00 16.30 ? 359 ASN A N     1 
ATOM   2846 C  CA    . ASN A 1 362 ? 48.054 7.598   -19.766 1.00 15.03 ? 359 ASN A CA    1 
ATOM   2847 C  C     . ASN A 1 362 ? 47.415 6.952   -20.994 1.00 15.85 ? 359 ASN A C     1 
ATOM   2848 O  O     . ASN A 1 362 ? 47.486 5.744   -21.141 1.00 17.22 ? 359 ASN A O     1 
ATOM   2849 C  CB    . ASN A 1 362 ? 47.593 6.879   -18.482 1.00 15.07 ? 359 ASN A CB    1 
ATOM   2850 C  CG    . ASN A 1 362 ? 48.363 7.347   -17.237 1.00 16.91 ? 359 ASN A CG    1 
ATOM   2851 O  OD1   . ASN A 1 362 ? 49.583 7.498   -17.268 1.00 16.18 ? 359 ASN A OD1   1 
ATOM   2852 N  ND2   . ASN A 1 362 ? 47.642 7.568   -16.134 1.00 14.21 ? 359 ASN A ND2   1 
ATOM   2853 N  N     . ASP A 1 363 ? 46.814 7.748   -21.876 1.00 17.62 ? 360 ASP A N     1 
ATOM   2854 C  CA    . ASP A 1 363 ? 46.311 7.233   -23.156 1.00 16.60 ? 360 ASP A CA    1 
ATOM   2855 C  C     . ASP A 1 363 ? 45.370 6.058   -22.995 1.00 19.05 ? 360 ASP A C     1 
ATOM   2856 O  O     . ASP A 1 363 ? 45.543 5.011   -23.631 1.00 18.99 ? 360 ASP A O     1 
ATOM   2857 C  CB    . ASP A 1 363 ? 47.474 6.806   -24.053 1.00 20.00 ? 360 ASP A CB    1 
ATOM   2858 C  CG    . ASP A 1 363 ? 48.425 7.936   -24.334 1.00 23.51 ? 360 ASP A CG    1 
ATOM   2859 O  OD1   . ASP A 1 363 ? 47.950 9.000   -24.779 1.00 24.06 ? 360 ASP A OD1   1 
ATOM   2860 O  OD2   . ASP A 1 363 ? 49.638 7.767   -24.086 1.00 26.02 ? 360 ASP A OD2   1 
ATOM   2861 N  N     . ARG A 1 364 ? 44.385 6.219   -22.126 1.00 16.83 ? 361 ARG A N     1 
ATOM   2862 C  CA    . ARG A 1 364 ? 43.383 5.186   -21.925 1.00 18.82 ? 361 ARG A CA    1 
ATOM   2863 C  C     . ARG A 1 364 ? 42.072 5.825   -21.491 1.00 17.42 ? 361 ARG A C     1 
ATOM   2864 O  O     . ARG A 1 364 ? 42.054 6.978   -21.018 1.00 17.34 ? 361 ARG A O     1 
ATOM   2865 C  CB    . ARG A 1 364 ? 43.855 4.176   -20.881 1.00 16.75 ? 361 ARG A CB    1 
ATOM   2866 C  CG    . ARG A 1 364 ? 44.114 4.810   -19.528 1.00 18.79 ? 361 ARG A CG    1 
ATOM   2867 C  CD    . ARG A 1 364 ? 44.585 3.789   -18.521 1.00 15.49 ? 361 ARG A CD    1 
ATOM   2868 N  NE    . ARG A 1 364 ? 44.670 4.369   -17.192 1.00 13.13 ? 361 ARG A NE    1 
ATOM   2869 C  CZ    . ARG A 1 364 ? 44.994 3.681   -16.100 1.00 18.33 ? 361 ARG A CZ    1 
ATOM   2870 N  NH1   . ARG A 1 364 ? 45.043 4.289   -14.922 1.00 13.31 ? 361 ARG A NH1   1 
ATOM   2871 N  NH2   . ARG A 1 364 ? 45.269 2.394   -16.190 1.00 17.41 ? 361 ARG A NH2   1 
ATOM   2872 N  N     . VAL A 1 365 ? 40.987 5.074   -21.646 1.00 17.43 ? 362 VAL A N     1 
ATOM   2873 C  CA    . VAL A 1 365 ? 39.653 5.516   -21.249 1.00 17.99 ? 362 VAL A CA    1 
ATOM   2874 C  C     . VAL A 1 365 ? 38.914 4.412   -20.493 1.00 20.79 ? 362 VAL A C     1 
ATOM   2875 O  O     . VAL A 1 365 ? 38.935 3.250   -20.892 1.00 19.85 ? 362 VAL A O     1 
ATOM   2876 C  CB    . VAL A 1 365 ? 38.808 5.951   -22.480 1.00 20.01 ? 362 VAL A CB    1 
ATOM   2877 C  CG1   A VAL A 1 365 ? 39.301 7.274   -23.034 0.46 21.63 ? 362 VAL A CG1   1 
ATOM   2878 C  CG1   B VAL A 1 365 ? 38.809 4.864   -23.551 0.54 24.38 ? 362 VAL A CG1   1 
ATOM   2879 C  CG2   A VAL A 1 365 ? 38.836 4.874   -23.557 0.46 24.37 ? 362 VAL A CG2   1 
ATOM   2880 C  CG2   B VAL A 1 365 ? 37.398 6.327   -22.074 0.54 24.32 ? 362 VAL A CG2   1 
ATOM   2881 N  N     . ALA A 1 366 ? 38.279 4.775   -19.384 1.00 15.30 ? 363 ALA A N     1 
ATOM   2882 C  CA    . ALA A 1 366 ? 37.441 3.838   -18.644 1.00 17.14 ? 363 ALA A CA    1 
ATOM   2883 C  C     . ALA A 1 366 ? 36.128 3.595   -19.389 1.00 18.22 ? 363 ALA A C     1 
ATOM   2884 O  O     . ALA A 1 366 ? 35.593 4.510   -20.019 1.00 23.67 ? 363 ALA A O     1 
ATOM   2885 C  CB    . ALA A 1 366 ? 37.166 4.369   -17.238 1.00 16.42 ? 363 ALA A CB    1 
ATOM   2886 N  N     . THR A 1 367 ? 35.599 2.380   -19.323 1.00 17.70 ? 364 THR A N     1 
ATOM   2887 C  CA    . THR A 1 367 ? 34.369 2.083   -20.060 1.00 16.54 ? 364 THR A CA    1 
ATOM   2888 C  C     . THR A 1 367 ? 33.208 1.614   -19.200 1.00 19.02 ? 364 THR A C     1 
ATOM   2889 O  O     . THR A 1 367 ? 32.085 1.457   -19.690 1.00 18.24 ? 364 THR A O     1 
ATOM   2890 C  CB    . THR A 1 367 ? 34.618 1.021   -21.147 1.00 18.41 ? 364 THR A CB    1 
ATOM   2891 O  OG1   . THR A 1 367 ? 34.863 -0.252  -20.536 1.00 20.56 ? 364 THR A OG1   1 
ATOM   2892 C  CG2   . THR A 1 367 ? 35.811 1.426   -21.987 1.00 18.18 ? 364 THR A CG2   1 
ATOM   2893 N  N     . GLN A 1 368 ? 33.467 1.380   -17.921 1.00 17.60 ? 365 GLN A N     1 
ATOM   2894 C  CA    . GLN A 1 368 ? 32.426 0.894   -17.035 1.00 17.92 ? 365 GLN A CA    1 
ATOM   2895 C  C     . GLN A 1 368 ? 32.431 1.698   -15.744 1.00 18.30 ? 365 GLN A C     1 
ATOM   2896 O  O     . GLN A 1 368 ? 33.487 2.001   -15.198 1.00 20.60 ? 365 GLN A O     1 
ATOM   2897 C  CB    . GLN A 1 368 ? 32.620 -0.589  -16.734 1.00 21.24 ? 365 GLN A CB    1 
ATOM   2898 C  CG    . GLN A 1 368 ? 31.505 -1.202  -15.914 1.00 25.45 ? 365 GLN A CG    1 
ATOM   2899 C  CD    . GLN A 1 368 ? 31.697 -2.688  -15.692 1.00 31.22 ? 365 GLN A CD    1 
ATOM   2900 O  OE1   . GLN A 1 368 ? 32.618 -3.104  -14.991 1.00 35.82 ? 365 GLN A OE1   1 
ATOM   2901 N  NE2   . GLN A 1 368 ? 30.827 -3.496  -16.285 1.00 35.22 ? 365 GLN A NE2   1 
ATOM   2902 N  N     . LEU A 1 369 ? 31.240 2.067   -15.288 1.00 18.66 ? 366 LEU A N     1 
ATOM   2903 C  CA    . LEU A 1 369 ? 31.082 2.751   -14.006 1.00 21.77 ? 366 LEU A CA    1 
ATOM   2904 C  C     . LEU A 1 369 ? 30.455 1.793   -13.006 1.00 20.49 ? 366 LEU A C     1 
ATOM   2905 O  O     . LEU A 1 369 ? 29.379 1.252   -13.258 1.00 22.82 ? 366 LEU A O     1 
ATOM   2906 C  CB    . LEU A 1 369 ? 30.216 4.006   -14.163 1.00 19.64 ? 366 LEU A CB    1 
ATOM   2907 C  CG    . LEU A 1 369 ? 29.969 4.833   -12.895 1.00 21.85 ? 366 LEU A CG    1 
ATOM   2908 C  CD1   . LEU A 1 369 ? 31.235 5.581   -12.487 1.00 23.19 ? 366 LEU A CD1   1 
ATOM   2909 C  CD2   . LEU A 1 369 ? 28.802 5.794   -13.101 1.00 27.02 ? 366 LEU A CD2   1 
ATOM   2910 N  N     . VAL A 1 370 ? 31.131 1.559   -11.885 1.00 18.65 ? 367 VAL A N     1 
ATOM   2911 C  CA    . VAL A 1 370 ? 30.578 0.722   -10.833 1.00 15.90 ? 367 VAL A CA    1 
ATOM   2912 C  C     . VAL A 1 370 ? 30.048 1.598   -9.711  1.00 20.53 ? 367 VAL A C     1 
ATOM   2913 O  O     . VAL A 1 370 ? 30.751 2.491   -9.233  1.00 21.37 ? 367 VAL A O     1 
ATOM   2914 C  CB    . VAL A 1 370 ? 31.624 -0.259  -10.253 1.00 17.27 ? 367 VAL A CB    1 
ATOM   2915 C  CG1   . VAL A 1 370 ? 31.025 -1.061  -9.106  1.00 24.72 ? 367 VAL A CG1   1 
ATOM   2916 C  CG2   . VAL A 1 370 ? 32.144 -1.174  -11.348 1.00 20.30 ? 367 VAL A CG2   1 
ATOM   2917 N  N     . VAL A 1 371 ? 28.813 1.346   -9.298  1.00 17.49 ? 368 VAL A N     1 
ATOM   2918 C  CA    . VAL A 1 371 ? 28.201 2.102   -8.213  1.00 18.53 ? 368 VAL A CA    1 
ATOM   2919 C  C     . VAL A 1 371 ? 27.961 1.193   -7.023  1.00 20.19 ? 368 VAL A C     1 
ATOM   2920 O  O     . VAL A 1 371 ? 27.356 0.129   -7.150  1.00 21.98 ? 368 VAL A O     1 
ATOM   2921 C  CB    . VAL A 1 371 ? 26.882 2.755   -8.660  1.00 23.07 ? 368 VAL A CB    1 
ATOM   2922 C  CG1   . VAL A 1 371 ? 26.358 3.694   -7.583  1.00 21.18 ? 368 VAL A CG1   1 
ATOM   2923 C  CG2   . VAL A 1 371 ? 27.103 3.516   -9.952  1.00 22.41 ? 368 VAL A CG2   1 
ATOM   2924 N  N     . SER A 1 372 ? 28.476 1.592   -5.864  1.00 19.54 ? 369 SER A N     1 
ATOM   2925 C  CA    . SER A 1 372 ? 28.290 0.807   -4.660  1.00 20.35 ? 369 SER A CA    1 
ATOM   2926 C  C     . SER A 1 372 ? 27.730 1.671   -3.536  1.00 21.70 ? 369 SER A C     1 
ATOM   2927 O  O     . SER A 1 372 ? 28.040 2.860   -3.437  1.00 21.32 ? 369 SER A O     1 
ATOM   2928 C  CB    . SER A 1 372 ? 29.606 0.164   -4.232  1.00 24.73 ? 369 SER A CB    1 
ATOM   2929 O  OG    . SER A 1 372 ? 29.428 -0.624  -3.071  1.00 28.48 ? 369 SER A OG    1 
ATOM   2930 N  N     . ILE A 1 373 ? 26.873 1.076   -2.716  1.00 22.92 ? 370 ILE A N     1 
ATOM   2931 C  CA    . ILE A 1 373 ? 26.317 1.780   -1.568  1.00 22.24 ? 370 ILE A CA    1 
ATOM   2932 C  C     . ILE A 1 373 ? 26.279 0.880   -0.344  1.00 24.74 ? 370 ILE A C     1 
ATOM   2933 O  O     . ILE A 1 373 ? 26.359 -0.349  -0.442  1.00 24.26 ? 370 ILE A O     1 
ATOM   2934 C  CB    . ILE A 1 373 ? 24.882 2.326   -1.840  1.00 26.30 ? 370 ILE A CB    1 
ATOM   2935 C  CG1   . ILE A 1 373 ? 23.882 1.186   -2.031  1.00 31.38 ? 370 ILE A CG1   1 
ATOM   2936 C  CG2   . ILE A 1 373 ? 24.860 3.321   -3.014  1.00 22.60 ? 370 ILE A CG2   1 
ATOM   2937 C  CD1   . ILE A 1 373 ? 22.503 1.677   -2.430  1.00 32.03 ? 370 ILE A CD1   1 
ATOM   2938 N  N     . ARG A 1 374 ? 26.175 1.507   0.821   1.00 23.57 ? 371 ARG A N     1 
ATOM   2939 C  CA    . ARG A 1 374 ? 25.928 0.777   2.049   1.00 26.30 ? 371 ARG A CA    1 
ATOM   2940 C  C     . ARG A 1 374 ? 24.690 1.366   2.697   1.00 31.24 ? 371 ARG A C     1 
ATOM   2941 O  O     . ARG A 1 374 ? 24.456 2.575   2.630   1.00 27.30 ? 371 ARG A O     1 
ATOM   2942 C  CB    . ARG A 1 374 ? 27.136 0.848   2.977   1.00 30.70 ? 371 ARG A CB    1 
ATOM   2943 C  CG    . ARG A 1 374 ? 27.068 -0.042  4.195   1.00 35.97 ? 371 ARG A CG    1 
ATOM   2944 C  CD    . ARG A 1 374 ? 28.317 0.173   5.009   1.00 44.87 ? 371 ARG A CD    1 
ATOM   2945 N  NE    . ARG A 1 374 ? 28.295 -0.492  6.305   1.00 54.79 ? 371 ARG A NE    1 
ATOM   2946 C  CZ    . ARG A 1 374 ? 29.063 -0.118  7.321   1.00 59.49 ? 371 ARG A CZ    1 
ATOM   2947 N  NH1   . ARG A 1 374 ? 29.892 0.906   7.174   1.00 59.19 ? 371 ARG A NH1   1 
ATOM   2948 N  NH2   . ARG A 1 374 ? 29.005 -0.751  8.483   1.00 63.76 ? 371 ARG A NH2   1 
ATOM   2949 N  N     . VAL A 1 375 ? 23.974 0.445   3.355   1.00 34.10 ? 372 VAL A N     1 
ATOM   2950 C  CA    . VAL A 1 375 ? 22.737 0.844   3.983   1.00 36.87 ? 372 VAL A CA    1 
ATOM   2951 C  C     . VAL A 1 375 ? 22.837 0.717   5.477   1.00 31.64 ? 372 VAL A C     1 
ATOM   2952 O  O     . VAL A 1 375 ? 23.502 -0.132  5.972   1.00 30.50 ? 372 VAL A O     1 
ATOM   2953 C  CB    . VAL A 1 375 ? 21.570 0.015   3.514   1.00 39.30 ? 372 VAL A CB    1 
ATOM   2954 C  CG1   . VAL A 1 375 ? 21.329 0.228   2.042   1.00 40.97 ? 372 VAL A CG1   1 
ATOM   2955 C  CG2   . VAL A 1 375 ? 21.749 -1.408  3.871   1.00 41.94 ? 372 VAL A CG2   1 
ATOM   2956 N  N     . GLN A 1 376 ? 22.205 1.596   6.198   1.00 34.31 ? 373 GLN A N     1 
ATOM   2957 C  CA    . GLN A 1 376 ? 22.384 1.614   7.622   1.00 37.92 ? 373 GLN A CA    1 
ATOM   2958 C  C     . GLN A 1 376 ? 22.039 0.296   8.208   1.00 36.08 ? 373 GLN A C     1 
ATOM   2959 O  O     . GLN A 1 376 ? 21.082 -0.287  7.899   1.00 42.17 ? 373 GLN A O     1 
ATOM   2960 C  CB    . GLN A 1 376 ? 21.502 2.670   8.270   1.00 37.30 ? 373 GLN A CB    1 
ATOM   2961 C  CG    . GLN A 1 376 ? 21.941 3.058   9.689   1.00 45.77 ? 373 GLN A CG    1 
ATOM   2962 C  CD    . GLN A 1 376 ? 21.767 4.540   9.963   1.00 48.68 ? 373 GLN A CD    1 
ATOM   2963 O  OE1   . GLN A 1 376 ? 20.682 5.035   9.835   1.00 43.21 ? 373 GLN A OE1   1 
ATOM   2964 N  NE2   . GLN A 1 376 ? 22.889 5.270   10.266  1.00 45.28 ? 373 GLN A NE2   1 
ATOM   2965 N  N     . GLY A 1 377 ? 22.882 -0.153  9.083   1.00 42.79 ? 374 GLY A N     1 
ATOM   2966 C  CA    . GLY A 1 377 ? 22.660 -1.371  9.804   1.00 53.33 ? 374 GLY A CA    1 
ATOM   2967 C  C     . GLY A 1 377 ? 23.394 -2.543  9.181   1.00 53.41 ? 374 GLY A C     1 
ATOM   2968 O  O     . GLY A 1 377 ? 23.687 -3.465  9.862   1.00 51.91 ? 374 GLY A O     1 
ATOM   2969 N  N     . ASP A 1 378 ? 23.758 -2.441  7.908   1.00 44.68 ? 375 ASP A N     1 
ATOM   2970 C  CA    . ASP A 1 378 ? 24.575 -3.438  7.308   1.00 47.13 ? 375 ASP A CA    1 
ATOM   2971 C  C     . ASP A 1 378 ? 25.968 -3.105  7.759   1.00 55.80 ? 375 ASP A C     1 
ATOM   2972 O  O     . ASP A 1 378 ? 26.423 -1.980  7.779   1.00 58.19 ? 375 ASP A O     1 
ATOM   2973 C  CB    . ASP A 1 378 ? 24.448 -3.410  5.790   1.00 45.65 ? 375 ASP A CB    1 
ATOM   2974 C  CG    . ASP A 1 378 ? 25.074 -4.610  5.101   1.00 45.22 ? 375 ASP A CG    1 
ATOM   2975 O  OD1   . ASP A 1 378 ? 25.844 -5.374  5.675   1.00 45.03 ? 375 ASP A OD1   1 
ATOM   2976 O  OD2   . ASP A 1 378 ? 24.815 -4.741  3.931   1.00 42.47 ? 375 ASP A OD2   1 
ATOM   2977 N  N     . LYS A 1 379 ? 26.695 -4.078  8.159   1.00 55.39 ? 376 LYS A N     1 
ATOM   2978 C  CA    . LYS A 1 379 ? 28.060 -3.715  8.530   1.00 58.99 ? 376 LYS A CA    1 
ATOM   2979 C  C     . LYS A 1 379 ? 29.057 -4.398  7.580   1.00 64.02 ? 376 LYS A C     1 
ATOM   2980 O  O     . LYS A 1 379 ? 30.276 -4.354  7.763   1.00 63.51 ? 376 LYS A O     1 
ATOM   2981 C  CB    . LYS A 1 379 ? 28.307 -4.001  10.032  1.00 66.51 ? 376 LYS A CB    1 
ATOM   2982 C  CG    . LYS A 1 379 ? 29.616 -4.653  10.486  1.00 71.32 ? 376 LYS A CG    1 
ATOM   2983 C  CD    . LYS A 1 379 ? 29.592 -4.953  11.985  1.00 77.06 ? 376 LYS A CD    1 
ATOM   2984 C  CE    . LYS A 1 379 ? 29.742 -3.645  12.787  1.00 74.64 ? 376 LYS A CE    1 
ATOM   2985 N  NZ    . LYS A 1 379 ? 29.593 -3.772  14.267  1.00 64.74 ? 376 LYS A NZ    1 
ATOM   2986 N  N     . ARG A 1 380 ? 28.524 -4.974  6.507   1.00 57.04 ? 377 ARG A N     1 
ATOM   2987 C  CA    . ARG A 1 380 ? 29.345 -5.253  5.335   1.00 55.31 ? 377 ARG A CA    1 
ATOM   2988 C  C     . ARG A 1 380 ? 29.840 -3.929  4.757   1.00 53.73 ? 377 ARG A C     1 
ATOM   2989 O  O     . ARG A 1 380 ? 29.150 -2.912  4.847   1.00 55.09 ? 377 ARG A O     1 
ATOM   2990 C  CB    . ARG A 1 380 ? 28.561 -6.028  4.273   1.00 51.27 ? 377 ARG A CB    1 
ATOM   2991 C  CG    . ARG A 1 380 ? 28.110 -7.414  4.700   1.00 52.84 ? 377 ARG A CG    1 
ATOM   2992 C  CD    . ARG A 1 380 ? 27.352 -8.094  3.577   1.00 41.06 ? 377 ARG A CD    1 
ATOM   2993 N  NE    . ARG A 1 380 ? 26.113 -7.394  3.251   1.00 39.67 ? 377 ARG A NE    1 
ATOM   2994 C  CZ    . ARG A 1 380 ? 25.342 -7.701  2.214   1.00 39.17 ? 377 ARG A CZ    1 
ATOM   2995 N  NH1   . ARG A 1 380 ? 25.694 -8.691  1.404   1.00 33.43 ? 377 ARG A NH1   1 
ATOM   2996 N  NH2   . ARG A 1 380 ? 24.227 -7.020  1.983   1.00 36.48 ? 377 ARG A NH2   1 
ATOM   2997 N  N     . LEU A 1 381 ? 31.035 -3.939  4.178   1.00 48.53 ? 378 LEU A N     1 
ATOM   2998 C  CA    . LEU A 1 381 ? 31.572 -2.752  3.528   1.00 49.59 ? 378 LEU A CA    1 
ATOM   2999 C  C     . LEU A 1 381 ? 30.600 -2.267  2.456   1.00 49.84 ? 378 LEU A C     1 
ATOM   3000 O  O     . LEU A 1 381 ? 30.169 -1.113  2.472   1.00 48.15 ? 378 LEU A O     1 
ATOM   3001 C  CB    . LEU A 1 381 ? 32.947 -3.047  2.924   1.00 54.39 ? 378 LEU A CB    1 
ATOM   3002 C  CG    . LEU A 1 381 ? 33.588 -2.048  1.950   1.00 53.29 ? 378 LEU A CG    1 
ATOM   3003 C  CD1   . LEU A 1 381 ? 33.551 -0.617  2.485   1.00 51.05 ? 378 LEU A CD1   1 
ATOM   3004 C  CD2   . LEU A 1 381 ? 35.023 -2.469  1.635   1.00 47.06 ? 378 LEU A CD2   1 
ATOM   3005 N  N     . SER A 1 382 ? 30.246 -3.158  1.538   1.00 50.23 ? 379 SER A N     1 
ATOM   3006 C  CA    . SER A 1 382 ? 29.280 -2.833  0.497   1.00 43.45 ? 379 SER A CA    1 
ATOM   3007 C  C     . SER A 1 382 ? 27.990 -3.612  0.686   1.00 39.12 ? 379 SER A C     1 
ATOM   3008 O  O     . SER A 1 382 ? 28.017 -4.819  0.922   1.00 39.36 ? 379 SER A O     1 
ATOM   3009 C  CB    . SER A 1 382 ? 29.856 -3.123  -0.890  1.00 42.33 ? 379 SER A CB    1 
ATOM   3010 O  OG    . SER A 1 382 ? 28.855 -2.999  -1.889  1.00 39.60 ? 379 SER A OG    1 
ATOM   3011 N  N     . SER A 1 383 ? 26.862 -2.918  0.570   1.00 31.98 ? 380 SER A N     1 
ATOM   3012 C  CA    . SER A 1 383 ? 25.560 -3.566  0.621   1.00 36.14 ? 380 SER A CA    1 
ATOM   3013 C  C     . SER A 1 383 ? 25.101 -3.973  -0.772  1.00 40.68 ? 380 SER A C     1 
ATOM   3014 O  O     . SER A 1 383 ? 24.421 -4.985  -0.937  1.00 35.78 ? 380 SER A O     1 
ATOM   3015 C  CB    . SER A 1 383 ? 24.516 -2.645  1.261   1.00 37.78 ? 380 SER A CB    1 
ATOM   3016 O  OG    . SER A 1 383 ? 24.865 -2.313  2.594   1.00 36.54 ? 380 SER A OG    1 
ATOM   3017 N  N     . LEU A 1 384 ? 25.477 -3.178  -1.770  1.00 39.16 ? 381 LEU A N     1 
ATOM   3018 C  CA    . LEU A 1 384 ? 25.003 -3.378  -3.134  1.00 31.07 ? 381 LEU A CA    1 
ATOM   3019 C  C     . LEU A 1 384 ? 25.944 -2.760  -4.158  1.00 33.74 ? 381 LEU A C     1 
ATOM   3020 O  O     . LEU A 1 384 ? 26.355 -1.610  -4.014  1.00 26.64 ? 381 LEU A O     1 
ATOM   3021 C  CB    . LEU A 1 384 ? 23.604 -2.784  -3.304  1.00 30.06 ? 381 LEU A CB    1 
ATOM   3022 C  CG    . LEU A 1 384 ? 23.070 -2.666  -4.736  1.00 33.74 ? 381 LEU A CG    1 
ATOM   3023 C  CD1   . LEU A 1 384 ? 21.642 -3.165  -4.822  1.00 40.58 ? 381 LEU A CD1   1 
ATOM   3024 C  CD2   . LEU A 1 384 ? 23.148 -1.228  -5.237  1.00 36.85 ? 381 LEU A CD2   1 
ATOM   3025 N  N     . ARG A 1 385 ? 26.260 -3.527  -5.197  1.00 28.31 ? 382 ARG A N     1 
ATOM   3026 C  CA    . ARG A 1 385 ? 27.083 -3.050  -6.304  1.00 22.87 ? 382 ARG A CA    1 
ATOM   3027 C  C     . ARG A 1 385 ? 26.337 -3.219  -7.623  1.00 24.36 ? 382 ARG A C     1 
ATOM   3028 O  O     . ARG A 1 385 ? 25.819 -4.300  -7.914  1.00 26.59 ? 382 ARG A O     1 
ATOM   3029 C  CB    . ARG A 1 385 ? 28.413 -3.811  -6.353  1.00 29.47 ? 382 ARG A CB    1 
ATOM   3030 C  CG    . ARG A 1 385 ? 29.608 -3.020  -5.857  1.00 39.20 ? 382 ARG A CG    1 
ATOM   3031 C  CD    . ARG A 1 385 ? 30.812 -3.921  -5.576  1.00 40.94 ? 382 ARG A CD    1 
ATOM   3032 N  NE    . ARG A 1 385 ? 30.561 -4.847  -4.471  1.00 47.57 ? 382 ARG A NE    1 
ATOM   3033 C  CZ    . ARG A 1 385 ? 31.458 -5.709  -3.994  1.00 44.96 ? 382 ARG A CZ    1 
ATOM   3034 N  NH1   . ARG A 1 385 ? 32.672 -5.776  -4.529  1.00 32.82 ? 382 ARG A NH1   1 
ATOM   3035 N  NH2   . ARG A 1 385 ? 31.139 -6.513  -2.985  1.00 37.72 ? 382 ARG A NH2   1 
ATOM   3036 N  N     . ARG A 1 386 ? 26.269 -2.151  -8.409  1.00 19.00 ? 383 ARG A N     1 
ATOM   3037 C  CA    . ARG A 1 386 ? 25.647 -2.202  -9.729  1.00 24.04 ? 383 ARG A CA    1 
ATOM   3038 C  C     . ARG A 1 386 ? 26.538 -1.496  -10.744 1.00 25.14 ? 383 ARG A C     1 
ATOM   3039 O  O     . ARG A 1 386 ? 27.199 -0.515  -10.419 1.00 21.57 ? 383 ARG A O     1 
ATOM   3040 C  CB    . ARG A 1 386 ? 24.260 -1.564  -9.701  1.00 22.55 ? 383 ARG A CB    1 
ATOM   3041 C  CG    . ARG A 1 386 ? 23.270 -2.297  -8.823  1.00 27.36 ? 383 ARG A CG    1 
ATOM   3042 C  CD    . ARG A 1 386 ? 22.852 -3.597  -9.480  1.00 25.32 ? 383 ARG A CD    1 
ATOM   3043 N  NE    . ARG A 1 386 ? 21.682 -4.191  -8.846  1.00 24.16 ? 383 ARG A NE    1 
ATOM   3044 C  CZ    . ARG A 1 386 ? 21.746 -5.113  -7.894  1.00 30.28 ? 383 ARG A CZ    1 
ATOM   3045 N  NH1   . ARG A 1 386 ? 22.928 -5.543  -7.466  1.00 29.90 ? 383 ARG A NH1   1 
ATOM   3046 N  NH2   . ARG A 1 386 ? 20.632 -5.609  -7.373  1.00 35.57 ? 383 ARG A NH2   1 
ATOM   3047 N  N     . CYS A 1 387 ? 26.577 -1.999  -11.974 1.00 26.90 ? 384 CYS A N     1 
ATOM   3048 C  CA    . CYS A 1 387 ? 27.400 -1.366  -12.997 1.00 27.16 ? 384 CYS A CA    1 
ATOM   3049 C  C     . CYS A 1 387 ? 26.570 -0.767  -14.110 1.00 31.14 ? 384 CYS A C     1 
ATOM   3050 O  O     . CYS A 1 387 ? 25.457 -1.216  -14.391 1.00 29.59 ? 384 CYS A O     1 
ATOM   3051 C  CB    . CYS A 1 387 ? 28.400 -2.370  -13.591 1.00 32.47 ? 384 CYS A CB    1 
ATOM   3052 S  SG    A CYS A 1 387 ? 27.681 -3.813  -14.460 0.63 31.80 ? 384 CYS A SG    1 
ATOM   3053 S  SG    B CYS A 1 387 ? 29.416 -3.165  -12.365 0.37 30.02 ? 384 CYS A SG    1 
ATOM   3054 N  N     . CYS A 1 388 ? 27.119 0.257   -14.742 1.00 25.92 ? 385 CYS A N     1 
ATOM   3055 C  CA    . CYS A 1 388 ? 26.528 0.771   -15.962 1.00 31.29 ? 385 CYS A CA    1 
ATOM   3056 C  C     . CYS A 1 388 ? 27.619 1.236   -16.905 1.00 29.80 ? 385 CYS A C     1 
ATOM   3057 O  O     . CYS A 1 388 ? 28.787 1.311   -16.529 1.00 26.24 ? 385 CYS A O     1 
ATOM   3058 C  CB    . CYS A 1 388 ? 25.551 1.902   -15.653 1.00 32.76 ? 385 CYS A CB    1 
ATOM   3059 S  SG    . CYS A 1 388 ? 26.284 3.385   -14.980 1.00 31.30 ? 385 CYS A SG    1 
ATOM   3060 N  N     . ALA A 1 389 ? 27.243 1.537   -18.140 1.00 25.57 ? 386 ALA A N     1 
ATOM   3061 C  CA    . ALA A 1 389 ? 28.223 1.962   -19.124 1.00 22.52 ? 386 ALA A CA    1 
ATOM   3062 C  C     . ALA A 1 389 ? 28.757 3.356   -18.812 1.00 25.41 ? 386 ALA A C     1 
ATOM   3063 O  O     . ALA A 1 389 ? 28.005 4.269   -18.464 1.00 26.82 ? 386 ALA A O     1 
ATOM   3064 C  CB    . ALA A 1 389 ? 27.619 1.921   -20.527 1.00 22.60 ? 386 ALA A CB    1 
ATOM   3065 N  N     . LEU A 1 390 ? 30.069 3.505   -18.919 1.00 20.90 ? 387 LEU A N     1 
ATOM   3066 C  CA    . LEU A 1 390 ? 30.712 4.799   -18.805 1.00 21.22 ? 387 LEU A CA    1 
ATOM   3067 C  C     . LEU A 1 390 ? 31.114 5.235   -20.203 1.00 21.76 ? 387 LEU A C     1 
ATOM   3068 O  O     . LEU A 1 390 ? 32.140 4.795   -20.725 1.00 24.50 ? 387 LEU A O     1 
ATOM   3069 C  CB    . LEU A 1 390 ? 31.930 4.722   -17.880 1.00 23.18 ? 387 LEU A CB    1 
ATOM   3070 C  CG    . LEU A 1 390 ? 32.292 5.953   -17.046 1.00 20.83 ? 387 LEU A CG    1 
ATOM   3071 C  CD1   . LEU A 1 390 ? 33.477 5.618   -16.148 1.00 21.06 ? 387 LEU A CD1   1 
ATOM   3072 C  CD2   . LEU A 1 390 ? 32.600 7.167   -17.907 1.00 23.79 ? 387 LEU A CD2   1 
ATOM   3073 N  N     . THR A 1 391 ? 30.303 6.094   -20.808 1.00 25.36 ? 388 THR A N     1 
ATOM   3074 C  CA    . THR A 1 391 ? 30.473 6.458   -22.208 1.00 24.24 ? 388 THR A CA    1 
ATOM   3075 C  C     . THR A 1 391 ? 30.998 7.876   -22.417 1.00 27.20 ? 388 THR A C     1 
ATOM   3076 O  O     . THR A 1 391 ? 31.503 8.200   -23.487 1.00 26.75 ? 388 THR A O     1 
ATOM   3077 C  CB    . THR A 1 391 ? 29.144 6.316   -22.971 1.00 31.98 ? 388 THR A CB    1 
ATOM   3078 O  OG1   . THR A 1 391 ? 28.157 7.153   -22.359 1.00 35.73 ? 388 THR A OG1   1 
ATOM   3079 C  CG2   . THR A 1 391 ? 28.660 4.872   -22.939 1.00 29.57 ? 388 THR A CG2   1 
ATOM   3080 N  N     . ARG A 1 392 ? 30.858 8.720   -21.400 1.00 24.14 ? 389 ARG A N     1 
ATOM   3081 C  CA    . ARG A 1 392 ? 31.366 10.086  -21.450 1.00 24.71 ? 389 ARG A CA    1 
ATOM   3082 C  C     . ARG A 1 392 ? 31.920 10.521  -20.104 1.00 19.62 ? 389 ARG A C     1 
ATOM   3083 O  O     . ARG A 1 392 ? 31.340 10.234  -19.061 1.00 24.35 ? 389 ARG A O     1 
ATOM   3084 C  CB    . ARG A 1 392 ? 30.276 11.066  -21.881 1.00 30.15 ? 389 ARG A CB    1 
ATOM   3085 C  CG    . ARG A 1 392 ? 29.957 11.017  -23.348 1.00 34.47 ? 389 ARG A CG    1 
ATOM   3086 C  CD    . ARG A 1 392 ? 29.036 12.150  -23.720 1.00 41.25 ? 389 ARG A CD    1 
ATOM   3087 N  NE    . ARG A 1 392 ? 28.013 11.691  -24.647 1.00 50.89 ? 389 ARG A NE    1 
ATOM   3088 C  CZ    . ARG A 1 392 ? 27.576 12.398  -25.681 1.00 37.48 ? 389 ARG A CZ    1 
ATOM   3089 N  NH1   . ARG A 1 392 ? 28.068 13.607  -25.921 1.00 44.64 ? 389 ARG A NH1   1 
ATOM   3090 N  NH2   . ARG A 1 392 ? 26.647 11.895  -26.473 1.00 35.18 ? 389 ARG A NH2   1 
ATOM   3091 N  N     . TYR A 1 393 ? 33.041 11.224  -20.140 1.00 21.45 ? 390 TYR A N     1 
ATOM   3092 C  CA    . TYR A 1 393 ? 33.620 11.800  -18.934 1.00 19.49 ? 390 TYR A CA    1 
ATOM   3093 C  C     . TYR A 1 393 ? 32.848 13.064  -18.568 1.00 24.54 ? 390 TYR A C     1 
ATOM   3094 O  O     . TYR A 1 393 ? 33.315 14.184  -18.789 1.00 25.15 ? 390 TYR A O     1 
ATOM   3095 C  CB    . TYR A 1 393 ? 35.102 12.096  -19.146 1.00 19.29 ? 390 TYR A CB    1 
ATOM   3096 C  CG    . TYR A 1 393 ? 35.991 10.867  -19.076 1.00 18.79 ? 390 TYR A CG    1 
ATOM   3097 C  CD1   . TYR A 1 393 ? 37.373 10.985  -19.137 1.00 19.13 ? 390 TYR A CD1   1 
ATOM   3098 C  CD2   . TYR A 1 393 ? 35.446 9.595   -18.937 1.00 23.39 ? 390 TYR A CD2   1 
ATOM   3099 C  CE1   . TYR A 1 393 ? 38.190 9.864   -19.064 1.00 15.35 ? 390 TYR A CE1   1 
ATOM   3100 C  CE2   . TYR A 1 393 ? 36.259 8.463   -18.861 1.00 20.36 ? 390 TYR A CE2   1 
ATOM   3101 C  CZ    . TYR A 1 393 ? 37.626 8.608   -18.932 1.00 20.35 ? 390 TYR A CZ    1 
ATOM   3102 O  OH    . TYR A 1 393 ? 38.435 7.490   -18.847 1.00 20.17 ? 390 TYR A OH    1 
ATOM   3103 N  N     . ASP A 1 394 ? 31.646 12.870  -18.035 1.00 21.36 ? 391 ASP A N     1 
ATOM   3104 C  CA    . ASP A 1 394 ? 30.791 13.982  -17.655 1.00 22.43 ? 391 ASP A CA    1 
ATOM   3105 C  C     . ASP A 1 394 ? 30.146 13.680  -16.315 1.00 19.82 ? 391 ASP A C     1 
ATOM   3106 O  O     . ASP A 1 394 ? 29.449 12.672  -16.158 1.00 22.00 ? 391 ASP A O     1 
ATOM   3107 C  CB    . ASP A 1 394 ? 29.726 14.239  -18.721 1.00 27.07 ? 391 ASP A CB    1 
ATOM   3108 C  CG    . ASP A 1 394 ? 28.871 15.437  -18.392 1.00 27.99 ? 391 ASP A CG    1 
ATOM   3109 O  OD1   . ASP A 1 394 ? 27.859 15.258  -17.690 1.00 26.83 ? 391 ASP A OD1   1 
ATOM   3110 O  OD2   . ASP A 1 394 ? 29.225 16.557  -18.822 1.00 44.45 ? 391 ASP A OD2   1 
ATOM   3111 N  N     . ALA A 1 395 ? 30.405 14.553  -15.346 1.00 19.05 ? 392 ALA A N     1 
ATOM   3112 C  CA    . ALA A 1 395 ? 29.992 14.318  -13.966 1.00 20.18 ? 392 ALA A CA    1 
ATOM   3113 C  C     . ALA A 1 395 ? 28.475 14.258  -13.786 1.00 18.69 ? 392 ALA A C     1 
ATOM   3114 O  O     . ALA A 1 395 ? 27.966 13.409  -13.055 1.00 18.28 ? 392 ALA A O     1 
ATOM   3115 C  CB    . ALA A 1 395 ? 30.593 15.393  -13.055 1.00 17.12 ? 392 ALA A CB    1 
ATOM   3116 N  N     . HIS A 1 396 ? 27.746 15.156  -14.445 1.00 25.07 ? 393 HIS A N     1 
ATOM   3117 C  CA    . HIS A 1 396 ? 26.292 15.149  -14.327 1.00 26.19 ? 393 HIS A CA    1 
ATOM   3118 C  C     . HIS A 1 396 ? 25.695 13.883  -14.920 1.00 18.25 ? 393 HIS A C     1 
ATOM   3119 O  O     . HIS A 1 396 ? 24.776 13.304  -14.348 1.00 23.75 ? 393 HIS A O     1 
ATOM   3120 C  CB    . HIS A 1 396 ? 25.689 16.391  -14.989 1.00 23.71 ? 393 HIS A CB    1 
ATOM   3121 C  CG    . HIS A 1 396 ? 25.953 17.656  -14.232 1.00 29.63 ? 393 HIS A CG    1 
ATOM   3122 N  ND1   . HIS A 1 396 ? 26.959 18.534  -14.572 1.00 38.79 ? 393 HIS A ND1   1 
ATOM   3123 C  CD2   . HIS A 1 396 ? 25.354 18.179  -13.135 1.00 31.25 ? 393 HIS A CD2   1 
ATOM   3124 C  CE1   . HIS A 1 396 ? 26.959 19.550  -13.727 1.00 30.82 ? 393 HIS A CE1   1 
ATOM   3125 N  NE2   . HIS A 1 396 ? 25.996 19.358  -12.845 1.00 31.52 ? 393 HIS A NE2   1 
ATOM   3126 N  N     . LYS A 1 397 ? 26.228 13.437  -16.053 1.00 20.50 ? 394 LYS A N     1 
ATOM   3127 C  CA    . LYS A 1 397 ? 25.782 12.166  -16.613 1.00 24.05 ? 394 LYS A CA    1 
ATOM   3128 C  C     . LYS A 1 397 ? 26.124 10.982  -15.714 1.00 20.86 ? 394 LYS A C     1 
ATOM   3129 O  O     . LYS A 1 397 ? 25.293 10.107  -15.481 1.00 23.64 ? 394 LYS A O     1 
ATOM   3130 C  CB    . LYS A 1 397 ? 26.378 11.927  -17.999 1.00 21.87 ? 394 LYS A CB    1 
ATOM   3131 C  CG    . LYS A 1 397 ? 26.083 10.518  -18.522 1.00 27.34 ? 394 LYS A CG    1 
ATOM   3132 C  CD    . LYS A 1 397 ? 26.422 10.351  -19.993 1.00 32.85 ? 394 LYS A CD    1 
ATOM   3133 C  CE    . LYS A 1 397 ? 26.120 8.930   -20.460 1.00 31.69 ? 394 LYS A CE    1 
ATOM   3134 N  NZ    . LYS A 1 397 ? 24.753 8.468   -20.057 1.00 37.83 ? 394 LYS A NZ    1 
ATOM   3135 N  N     . MET A 1 398 ? 27.353 10.941  -15.210 1.00 19.87 ? 395 MET A N     1 
ATOM   3136 C  CA    . MET A 1 398 ? 27.741 9.816   -14.380 1.00 20.62 ? 395 MET A CA    1 
ATOM   3137 C  C     . MET A 1 398 ? 26.910 9.752   -13.093 1.00 18.85 ? 395 MET A C     1 
ATOM   3138 O  O     . MET A 1 398 ? 26.525 8.670   -12.652 1.00 20.80 ? 395 MET A O     1 
ATOM   3139 C  CB    . MET A 1 398 ? 29.237 9.879   -14.066 1.00 20.14 ? 395 MET A CB    1 
ATOM   3140 C  CG    . MET A 1 398 ? 30.096 9.445   -15.242 1.00 17.95 ? 395 MET A CG    1 
ATOM   3141 S  SD    . MET A 1 398 ? 31.824 9.257   -14.767 1.00 24.18 ? 395 MET A SD    1 
ATOM   3142 C  CE    . MET A 1 398 ? 32.289 10.969  -14.536 1.00 23.62 ? 395 MET A CE    1 
ATOM   3143 N  N     . SER A 1 399 ? 26.604 10.912  -12.516 1.00 21.60 ? 396 SER A N     1 
ATOM   3144 C  CA    . SER A 1 399 ? 25.842 10.940  -11.270 1.00 20.47 ? 396 SER A CA    1 
ATOM   3145 C  C     . SER A 1 399 ? 24.371 10.595  -11.522 1.00 19.77 ? 396 SER A C     1 
ATOM   3146 O  O     . SER A 1 399 ? 23.725 9.960   -10.696 1.00 19.89 ? 396 SER A O     1 
ATOM   3147 C  CB    . SER A 1 399 ? 25.967 12.304  -10.575 1.00 20.48 ? 396 SER A CB    1 
ATOM   3148 O  OG    . SER A 1 399 ? 25.517 13.378  -11.380 1.00 25.32 ? 396 SER A OG    1 
ATOM   3149 N  N     . HIS A 1 400 ? 23.861 10.997  -12.680 1.00 24.05 ? 397 HIS A N     1 
ATOM   3150 C  CA    . HIS A 1 400 ? 22.498 10.637  -13.058 1.00 27.19 ? 397 HIS A CA    1 
ATOM   3151 C  C     . HIS A 1 400 ? 22.387 9.129   -13.296 1.00 24.87 ? 397 HIS A C     1 
ATOM   3152 O  O     . HIS A 1 400 ? 21.455 8.482   -12.829 1.00 25.62 ? 397 HIS A O     1 
ATOM   3153 C  CB    . HIS A 1 400 ? 22.070 11.412  -14.304 1.00 30.13 ? 397 HIS A CB    1 
ATOM   3154 C  CG    . HIS A 1 400 ? 20.652 11.164  -14.711 1.00 38.33 ? 397 HIS A CG    1 
ATOM   3155 N  ND1   . HIS A 1 400 ? 20.271 10.074  -15.464 1.00 41.86 ? 397 HIS A ND1   1 
ATOM   3156 C  CD2   . HIS A 1 400 ? 19.521 11.871  -14.476 1.00 42.91 ? 397 HIS A CD2   1 
ATOM   3157 C  CE1   . HIS A 1 400 ? 18.967 10.118  -15.673 1.00 43.42 ? 397 HIS A CE1   1 
ATOM   3158 N  NE2   . HIS A 1 400 ? 18.489 11.200  -15.085 1.00 42.25 ? 397 HIS A NE2   1 
ATOM   3159 N  N     . ASP A 1 401 ? 23.365 8.572   -14.005 1.00 25.92 ? 398 ASP A N     1 
ATOM   3160 C  CA    . ASP A 1 401 ? 23.409 7.139   -14.263 1.00 23.77 ? 398 ASP A CA    1 
ATOM   3161 C  C     . ASP A 1 401 ? 23.572 6.323   -12.986 1.00 22.84 ? 398 ASP A C     1 
ATOM   3162 O  O     . ASP A 1 401 ? 22.983 5.256   -12.844 1.00 24.83 ? 398 ASP A O     1 
ATOM   3163 C  CB    . ASP A 1 401 ? 24.545 6.811   -15.232 1.00 23.52 ? 398 ASP A CB    1 
ATOM   3164 C  CG    . ASP A 1 401 ? 24.275 7.311   -16.643 1.00 30.16 ? 398 ASP A CG    1 
ATOM   3165 O  OD1   . ASP A 1 401 ? 23.135 7.751   -16.924 1.00 28.39 ? 398 ASP A OD1   1 
ATOM   3166 O  OD2   . ASP A 1 401 ? 25.201 7.246   -17.479 1.00 27.74 ? 398 ASP A OD2   1 
ATOM   3167 N  N     . ALA A 1 402 ? 24.389 6.822   -12.060 1.00 22.60 ? 399 ALA A N     1 
ATOM   3168 C  CA    . ALA A 1 402 ? 24.572 6.155   -10.781 1.00 22.65 ? 399 ALA A CA    1 
ATOM   3169 C  C     . ALA A 1 402 ? 23.264 6.126   -10.004 1.00 19.10 ? 399 ALA A C     1 
ATOM   3170 O  O     . ALA A 1 402 ? 22.914 5.122   -9.380  1.00 20.94 ? 399 ALA A O     1 
ATOM   3171 C  CB    . ALA A 1 402 ? 25.656 6.852   -9.961  1.00 22.04 ? 399 ALA A CB    1 
ATOM   3172 N  N     . PHE A 1 403 ? 22.550 7.245   -10.034 1.00 22.77 ? 400 PHE A N     1 
ATOM   3173 C  CA    . PHE A 1 403 ? 21.282 7.331   -9.331  1.00 26.21 ? 400 PHE A CA    1 
ATOM   3174 C  C     . PHE A 1 403 ? 20.292 6.328   -9.917  1.00 28.08 ? 400 PHE A C     1 
ATOM   3175 O  O     . PHE A 1 403 ? 19.602 5.624   -9.187  1.00 29.66 ? 400 PHE A O     1 
ATOM   3176 C  CB    . PHE A 1 403 ? 20.719 8.745   -9.408  1.00 24.27 ? 400 PHE A CB    1 
ATOM   3177 C  CG    . PHE A 1 403 ? 19.450 8.926   -8.642  1.00 37.72 ? 400 PHE A CG    1 
ATOM   3178 C  CD1   . PHE A 1 403 ? 18.240 9.063   -9.305  1.00 35.78 ? 400 PHE A CD1   1 
ATOM   3179 C  CD2   . PHE A 1 403 ? 19.463 8.952   -7.259  1.00 33.95 ? 400 PHE A CD2   1 
ATOM   3180 C  CE1   . PHE A 1 403 ? 17.063 9.225   -8.598  1.00 44.48 ? 400 PHE A CE1   1 
ATOM   3181 C  CE2   . PHE A 1 403 ? 18.292 9.115   -6.547  1.00 42.99 ? 400 PHE A CE2   1 
ATOM   3182 C  CZ    . PHE A 1 403 ? 17.089 9.251   -7.216  1.00 45.05 ? 400 PHE A CZ    1 
ATOM   3183 N  N     . THR A 1 404 ? 20.251 6.263   -11.243 1.00 31.06 ? 401 THR A N     1 
ATOM   3184 C  CA    . THR A 1 404 ? 19.354 5.351   -11.947 1.00 30.46 ? 401 THR A CA    1 
ATOM   3185 C  C     . THR A 1 404 ? 19.556 3.883   -11.548 1.00 31.65 ? 401 THR A C     1 
ATOM   3186 O  O     . THR A 1 404 ? 18.587 3.138   -11.396 1.00 31.88 ? 401 THR A O     1 
ATOM   3187 C  CB    . THR A 1 404 ? 19.518 5.495   -13.479 1.00 29.36 ? 401 THR A CB    1 
ATOM   3188 O  OG1   . THR A 1 404 ? 19.106 6.807   -13.881 1.00 28.02 ? 401 THR A OG1   1 
ATOM   3189 C  CG2   . THR A 1 404 ? 18.682 4.463   -14.223 1.00 32.51 ? 401 THR A CG2   1 
ATOM   3190 N  N     . VAL A 1 405 ? 20.801 3.459   -11.360 1.00 25.73 ? 402 VAL A N     1 
ATOM   3191 C  CA    . VAL A 1 405 ? 21.047 2.055   -11.054 1.00 25.40 ? 402 VAL A CA    1 
ATOM   3192 C  C     . VAL A 1 405 ? 20.829 1.722   -9.578  1.00 29.93 ? 402 VAL A C     1 
ATOM   3193 O  O     . VAL A 1 405 ? 20.738 0.547   -9.228  1.00 29.05 ? 402 VAL A O     1 
ATOM   3194 C  CB    . VAL A 1 405 ? 22.474 1.615   -11.468 1.00 31.65 ? 402 VAL A CB    1 
ATOM   3195 C  CG1   . VAL A 1 405 ? 22.762 2.057   -12.889 1.00 33.51 ? 402 VAL A CG1   1 
ATOM   3196 C  CG2   . VAL A 1 405 ? 23.512 2.169   -10.520 1.00 31.09 ? 402 VAL A CG2   1 
ATOM   3197 N  N     . ILE A 1 406 ? 20.730 2.742   -8.722  1.00 29.32 ? 403 ILE A N     1 
ATOM   3198 C  CA    . ILE A 1 406 ? 20.557 2.516   -7.285  1.00 33.21 ? 403 ILE A CA    1 
ATOM   3199 C  C     . ILE A 1 406 ? 19.183 2.906   -6.734  1.00 35.93 ? 403 ILE A C     1 
ATOM   3200 O  O     . ILE A 1 406 ? 18.805 2.461   -5.647  1.00 37.30 ? 403 ILE A O     1 
ATOM   3201 C  CB    . ILE A 1 406 ? 21.615 3.285   -6.451  1.00 31.24 ? 403 ILE A CB    1 
ATOM   3202 C  CG1   . ILE A 1 406 ? 21.391 4.799   -6.559  1.00 27.62 ? 403 ILE A CG1   1 
ATOM   3203 C  CG2   . ILE A 1 406 ? 23.004 2.893   -6.879  1.00 31.29 ? 403 ILE A CG2   1 
ATOM   3204 C  CD1   . ILE A 1 406 ? 21.978 5.601   -5.403  1.00 33.30 ? 403 ILE A CD1   1 
ATOM   3205 N  N     . LYS A 1 407 ? 18.444 3.724   -7.478  1.00 33.30 ? 404 LYS A N     1 
ATOM   3206 C  CA    . LYS A 1 407 ? 17.204 4.327   -6.981  1.00 40.20 ? 404 LYS A CA    1 
ATOM   3207 C  C     . LYS A 1 407 ? 16.166 3.312   -6.483  1.00 47.37 ? 404 LYS A C     1 
ATOM   3208 O  O     . LYS A 1 407 ? 15.309 3.647   -5.662  1.00 50.17 ? 404 LYS A O     1 
ATOM   3209 C  CB    . LYS A 1 407 ? 16.577 5.201   -8.070  1.00 39.66 ? 404 LYS A CB    1 
ATOM   3210 C  CG    . LYS A 1 407 ? 16.159 4.425   -9.306  1.00 38.32 ? 404 LYS A CG    1 
ATOM   3211 C  CD    . LYS A 1 407 ? 15.613 5.341   -10.384 1.00 41.54 ? 404 LYS A CD    1 
ATOM   3212 C  CE    . LYS A 1 407 ? 15.242 4.549   -11.625 1.00 45.69 ? 404 LYS A CE    1 
ATOM   3213 N  NZ    . LYS A 1 407 ? 14.736 5.431   -12.709 1.00 53.40 ? 404 LYS A NZ    1 
ATOM   3214 N  N     . ASN A 1 408 ? 16.255 2.076   -6.928  1.00 44.49 ? 405 ASN A N     1 
ATOM   3215 C  CA    . ASN A 1 408 ? 15.292 1.076   -6.532  1.00 47.30 ? 405 ASN A CA    1 
ATOM   3216 C  C     . ASN A 1 408 ? 15.605 0.445   -5.200  1.00 49.11 ? 405 ASN A C     1 
ATOM   3217 O  O     . ASN A 1 408 ? 14.870 -0.367  -4.683  1.00 45.36 ? 405 ASN A O     1 
ATOM   3218 C  CB    . ASN A 1 408 ? 15.103 0.055   -7.625  1.00 47.80 ? 405 ASN A CB    1 
ATOM   3219 C  CG    . ASN A 1 408 ? 13.984 0.425   -8.524  1.00 57.86 ? 405 ASN A CG    1 
ATOM   3220 O  OD1   . ASN A 1 408 ? 12.824 0.405   -8.117  1.00 60.67 ? 405 ASN A OD1   1 
ATOM   3221 N  ND2   . ASN A 1 408 ? 14.318 0.870   -9.727  1.00 58.81 ? 405 ASN A ND2   1 
ATOM   3222 N  N     . CYS A 1 409 ? 16.739 0.834   -4.647  1.00 43.54 ? 406 CYS A N     1 
ATOM   3223 C  CA    . CYS A 1 409 ? 17.115 0.381   -3.336  1.00 45.23 ? 406 CYS A CA    1 
ATOM   3224 C  C     . CYS A 1 409 ? 16.305 1.033   -2.295  1.00 43.91 ? 406 CYS A C     1 
ATOM   3225 O  O     . CYS A 1 409 ? 16.276 0.589   -1.198  1.00 48.14 ? 406 CYS A O     1 
ATOM   3226 C  CB    . CYS A 1 409 ? 18.551 0.755   -3.040  1.00 47.14 ? 406 CYS A CB    1 
ATOM   3227 S  SG    . CYS A 1 409 ? 19.520 -0.371  -3.912  1.00 57.17 ? 406 CYS A SG    1 
ATOM   3228 N  N     . ASN A 1 410 ? 15.673 2.143   -2.665  1.00 42.60 ? 407 ASN A N     1 
ATOM   3229 C  CA    . ASN A 1 410 ? 14.893 2.944   -1.734  1.00 42.50 ? 407 ASN A CA    1 
ATOM   3230 C  C     . ASN A 1 410 ? 13.535 2.324   -1.451  1.00 47.52 ? 407 ASN A C     1 
ATOM   3231 O  O     . ASN A 1 410 ? 12.642 2.339   -2.299  1.00 45.84 ? 407 ASN A O     1 
ATOM   3232 C  CB    . ASN A 1 410 ? 14.719 4.368   -2.267  1.00 39.83 ? 407 ASN A CB    1 
ATOM   3233 C  CG    . ASN A 1 410 ? 14.085 5.298   -1.250  1.00 35.73 ? 407 ASN A CG    1 
ATOM   3234 O  OD1   . ASN A 1 410 ? 13.828 4.908   -0.110  1.00 37.64 ? 407 ASN A OD1   1 
ATOM   3235 N  ND2   . ASN A 1 410 ? 13.831 6.536   -1.657  1.00 40.88 ? 407 ASN A ND2   1 
ATOM   3236 N  N     . THR A 1 411 ? 13.390 1.775   -0.253  1.00 45.61 ? 408 THR A N     1 
ATOM   3237 C  CA    . THR A 1 411 ? 12.145 1.130   0.149   1.00 49.06 ? 408 THR A CA    1 
ATOM   3238 C  C     . THR A 1 411 ? 11.116 2.153   0.597   1.00 48.28 ? 408 THR A C     1 
ATOM   3239 O  O     . THR A 1 411 ? 9.993  1.778   0.783   1.00 52.66 ? 408 THR A O     1 
ATOM   3240 C  CB    . THR A 1 411 ? 12.305 0.035   1.223   1.00 46.26 ? 408 THR A CB    1 
ATOM   3241 O  OG1   . THR A 1 411 ? 12.649 0.606   2.478   1.00 51.93 ? 408 THR A OG1   1 
ATOM   3242 C  CG2   . THR A 1 411 ? 13.333 -1.039  0.835   1.00 44.51 ? 408 THR A CG2   1 
ATOM   3243 N  N     . SER A 1 412 ? 11.499 3.416   0.745   1.00 45.02 ? 409 SER A N     1 
ATOM   3244 C  CA    . SER A 1 412 ? 10.556 4.449   1.166   1.00 50.21 ? 409 SER A CA    1 
ATOM   3245 C  C     . SER A 1 412 ? 9.366  4.566   0.210   1.00 52.71 ? 409 SER A C     1 
ATOM   3246 O  O     . SER A 1 412 ? 9.535  4.538   -1.010  1.00 53.51 ? 409 SER A O     1 
ATOM   3247 C  CB    . SER A 1 412 ? 11.263 5.801   1.292   1.00 51.85 ? 409 SER A CB    1 
ATOM   3248 O  OG    . SER A 1 412 ? 10.332 6.868   1.259   1.00 55.72 ? 409 SER A OG    1 
ATOM   3249 N  N     . GLY A 1 413 ? 8.199  4.725   0.794   1.00 58.53 ? 410 GLY A N     1 
ATOM   3250 C  CA    . GLY A 1 413 ? 6.994  5.083   0.080   1.00 59.62 ? 410 GLY A CA    1 
ATOM   3251 C  C     . GLY A 1 413 ? 6.974  6.460   -0.549  1.00 62.59 ? 410 GLY A C     1 
ATOM   3252 O  O     . GLY A 1 413 ? 6.356  6.666   -1.564  1.00 59.77 ? 410 GLY A O     1 
ATOM   3253 N  N     . ILE A 1 414 ? 7.601  7.409   0.138   1.00 61.96 ? 411 ILE A N     1 
ATOM   3254 C  CA    . ILE A 1 414 ? 7.628  8.794   -0.226  1.00 61.83 ? 411 ILE A CA    1 
ATOM   3255 C  C     . ILE A 1 414 ? 8.816  9.029   -1.120  1.00 63.98 ? 411 ILE A C     1 
ATOM   3256 O  O     . ILE A 1 414 ? 9.902  8.572   -0.827  1.00 57.13 ? 411 ILE A O     1 
ATOM   3257 C  CB    . ILE A 1 414 ? 7.725  9.728   1.017   1.00 61.72 ? 411 ILE A CB    1 
ATOM   3258 C  CG1   . ILE A 1 414 ? 6.830  9.245   2.163   1.00 59.25 ? 411 ILE A CG1   1 
ATOM   3259 C  CG2   . ILE A 1 414 ? 7.317  11.147  0.661   1.00 58.37 ? 411 ILE A CG2   1 
ATOM   3260 C  CD1   . ILE A 1 414 ? 7.257  7.941   2.791   1.00 58.21 ? 411 ILE A CD1   1 
ATOM   3261 N  N     . GLN A 1 415 ? 8.588  9.676   -2.259  1.00 70.33 ? 412 GLN A N     1 
ATOM   3262 C  CA    . GLN A 1 415 ? 9.625  9.822   -3.275  1.00 66.06 ? 412 GLN A CA    1 
ATOM   3263 C  C     . GLN A 1 415 ? 10.818 10.609  -2.751  1.00 64.98 ? 412 GLN A C     1 
ATOM   3264 O  O     . GLN A 1 415 ? 11.972 10.246  -2.981  1.00 62.25 ? 412 GLN A O     1 
ATOM   3265 C  CB    . GLN A 1 415 ? 9.058  10.500  -4.525  1.00 66.86 ? 412 GLN A CB    1 
ATOM   3266 C  CG    . GLN A 1 415 ? 10.116 11.007  -5.491  1.00 75.31 ? 412 GLN A CG    1 
ATOM   3267 C  CD    . GLN A 1 415 ? 9.656  12.222  -6.272  1.00 84.48 ? 412 GLN A CD    1 
ATOM   3268 O  OE1   . GLN A 1 415 ? 9.183  13.202  -5.697  1.00 79.58 ? 412 GLN A OE1   1 
ATOM   3269 N  NE2   . GLN A 1 415 ? 9.793  12.164  -7.592  1.00 81.53 ? 412 GLN A NE2   1 
ATOM   3270 N  N     . THR A 1 416 ? 10.522 11.691  -2.046  1.00 61.33 ? 413 THR A N     1 
ATOM   3271 C  CA    . THR A 1 416 ? 11.525 12.557  -1.495  1.00 59.15 ? 413 THR A CA    1 
ATOM   3272 C  C     . THR A 1 416 ? 12.401 11.944  -0.492  1.00 51.87 ? 413 THR A C     1 
ATOM   3273 O  O     . THR A 1 416 ? 13.544 12.303  -0.363  1.00 48.11 ? 413 THR A O     1 
ATOM   3274 C  CB    . THR A 1 416 ? 10.818 13.722  -0.850  1.00 61.05 ? 413 THR A CB    1 
ATOM   3275 O  OG1   . THR A 1 416 ? 9.637  13.924  -1.584  1.00 63.25 ? 413 THR A OG1   1 
ATOM   3276 C  CG2   . THR A 1 416 ? 11.644 14.981  -0.941  1.00 63.09 ? 413 THR A CG2   1 
ATOM   3277 N  N     . GLU A 1 417 ? 11.824 11.098  0.314   1.00 50.08 ? 414 GLU A N     1 
ATOM   3278 C  CA    . GLU A 1 417 ? 12.601 10.474  1.376   1.00 49.69 ? 414 GLU A CA    1 
ATOM   3279 C  C     . GLU A 1 417 ? 13.402 9.277   0.884   1.00 47.43 ? 414 GLU A C     1 
ATOM   3280 O  O     . GLU A 1 417 ? 13.021 8.613   -0.080  1.00 47.62 ? 414 GLU A O     1 
ATOM   3281 C  CB    . GLU A 1 417 ? 11.674 10.048  2.515   1.00 51.28 ? 414 GLU A CB    1 
ATOM   3282 C  CG    . GLU A 1 417 ? 10.798 11.178  3.014   1.00 50.95 ? 414 GLU A CG    1 
ATOM   3283 C  CD    . GLU A 1 417 ? 11.567 12.474  3.155   1.00 46.32 ? 414 GLU A CD    1 
ATOM   3284 O  OE1   . GLU A 1 417 ? 12.374 12.579  4.102   1.00 43.57 ? 414 GLU A OE1   1 
ATOM   3285 O  OE2   . GLU A 1 417 ? 11.365 13.382  2.320   1.00 47.59 ? 414 GLU A OE2   1 
ATOM   3286 N  N     . TRP A 1 418 ? 14.520 9.013   1.550   1.00 39.31 ? 415 TRP A N     1 
ATOM   3287 C  CA    . TRP A 1 418 ? 15.326 7.847   1.236   1.00 34.84 ? 415 TRP A CA    1 
ATOM   3288 C  C     . TRP A 1 418 ? 15.448 6.935   2.445   1.00 37.99 ? 415 TRP A C     1 
ATOM   3289 O  O     . TRP A 1 418 ? 15.946 7.340   3.495   1.00 36.06 ? 415 TRP A O     1 
ATOM   3290 C  CB    . TRP A 1 418 ? 16.718 8.249   0.752   1.00 35.55 ? 415 TRP A CB    1 
ATOM   3291 C  CG    . TRP A 1 418 ? 17.380 7.139   0.021   1.00 32.26 ? 415 TRP A CG    1 
ATOM   3292 C  CD1   . TRP A 1 418 ? 17.928 6.015   0.559   1.00 32.16 ? 415 TRP A CD1   1 
ATOM   3293 C  CD2   . TRP A 1 418 ? 17.532 7.024   -1.394  1.00 33.07 ? 415 TRP A CD2   1 
ATOM   3294 N  NE1   . TRP A 1 418 ? 18.423 5.208   -0.436  1.00 36.21 ? 415 TRP A NE1   1 
ATOM   3295 C  CE2   . TRP A 1 418 ? 18.193 5.808   -1.647  1.00 32.41 ? 415 TRP A CE2   1 
ATOM   3296 C  CE3   . TRP A 1 418 ? 17.181 7.838   -2.474  1.00 36.15 ? 415 TRP A CE3   1 
ATOM   3297 C  CZ2   . TRP A 1 418 ? 18.512 5.383   -2.935  1.00 36.48 ? 415 TRP A CZ2   1 
ATOM   3298 C  CZ3   . TRP A 1 418 ? 17.499 7.416   -3.753  1.00 39.42 ? 415 TRP A CZ3   1 
ATOM   3299 C  CH2   . TRP A 1 418 ? 18.159 6.201   -3.973  1.00 34.77 ? 415 TRP A CH2   1 
ATOM   3300 N  N     . SER A 1 419 ? 14.997 5.696   2.290   1.00 43.18 ? 416 SER A N     1 
ATOM   3301 C  CA    . SER A 1 419 ? 15.069 4.728   3.373   1.00 36.73 ? 416 SER A CA    1 
ATOM   3302 C  C     . SER A 1 419 ? 15.422 3.338   2.851   1.00 43.27 ? 416 SER A C     1 
ATOM   3303 O  O     . SER A 1 419 ? 14.998 2.962   1.758   1.00 45.36 ? 416 SER A O     1 
ATOM   3304 C  CB    . SER A 1 419 ? 13.746 4.682   4.140   1.00 50.31 ? 416 SER A CB    1 
ATOM   3305 O  OG    . SER A 1 419 ? 12.736 4.059   3.366   1.00 54.43 ? 416 SER A OG    1 
ATOM   3306 N  N     . PRO A 1 420 ? 16.230 2.584   3.617   1.00 41.38 ? 417 PRO A N     1 
ATOM   3307 C  CA    . PRO A 1 420 ? 16.916 3.077   4.817   1.00 42.25 ? 417 PRO A CA    1 
ATOM   3308 C  C     . PRO A 1 420 ? 18.050 4.008   4.417   1.00 35.44 ? 417 PRO A C     1 
ATOM   3309 O  O     . PRO A 1 420 ? 18.533 3.894   3.290   1.00 39.46 ? 417 PRO A O     1 
ATOM   3310 C  CB    . PRO A 1 420 ? 17.451 1.803   5.473   1.00 41.08 ? 417 PRO A CB    1 
ATOM   3311 C  CG    . PRO A 1 420 ? 17.610 0.846   4.345   1.00 40.28 ? 417 PRO A CG    1 
ATOM   3312 C  CD    . PRO A 1 420 ? 16.507 1.157   3.374   1.00 39.67 ? 417 PRO A CD    1 
ATOM   3313 N  N     . PRO A 1 421 ? 18.446 4.930   5.306   1.00 40.61 ? 418 PRO A N     1 
ATOM   3314 C  CA    . PRO A 1 421 ? 19.492 5.895   4.961   1.00 36.21 ? 418 PRO A CA    1 
ATOM   3315 C  C     . PRO A 1 421 ? 20.777 5.233   4.468   1.00 25.88 ? 418 PRO A C     1 
ATOM   3316 O  O     . PRO A 1 421 ? 21.088 4.110   4.872   1.00 29.12 ? 418 PRO A O     1 
ATOM   3317 C  CB    . PRO A 1 421 ? 19.729 6.636   6.276   1.00 35.25 ? 418 PRO A CB    1 
ATOM   3318 C  CG    . PRO A 1 421 ? 18.431 6.526   6.999   1.00 41.03 ? 418 PRO A CG    1 
ATOM   3319 C  CD    . PRO A 1 421 ? 17.903 5.165   6.657   1.00 38.26 ? 418 PRO A CD    1 
ATOM   3320 N  N     . LEU A 1 422 ? 21.499 5.935   3.599   1.00 31.03 ? 419 LEU A N     1 
ATOM   3321 C  CA    . LEU A 1 422 ? 22.733 5.427   3.005   1.00 29.24 ? 419 LEU A CA    1 
ATOM   3322 C  C     . LEU A 1 422 ? 23.938 5.869   3.827   1.00 21.84 ? 419 LEU A C     1 
ATOM   3323 O  O     . LEU A 1 422 ? 24.075 7.048   4.137   1.00 25.43 ? 419 LEU A O     1 
ATOM   3324 C  CB    . LEU A 1 422 ? 22.878 5.913   1.557   1.00 27.32 ? 419 LEU A CB    1 
ATOM   3325 C  CG    . LEU A 1 422 ? 21.764 5.542   0.574   1.00 27.26 ? 419 LEU A CG    1 
ATOM   3326 C  CD1   . LEU A 1 422 ? 22.059 6.063   -0.841  1.00 29.36 ? 419 LEU A CD1   1 
ATOM   3327 C  CD2   . LEU A 1 422 ? 21.550 4.040   0.575   1.00 32.02 ? 419 LEU A CD2   1 
ATOM   3328 N  N     . THR A 1 423 ? 24.807 4.925   4.176   1.00 22.56 ? 420 THR A N     1 
ATOM   3329 C  CA    . THR A 1 423 ? 25.967 5.244   5.006   1.00 23.58 ? 420 THR A CA    1 
ATOM   3330 C  C     . THR A 1 423 ? 27.272 5.212   4.212   1.00 21.72 ? 420 THR A C     1 
ATOM   3331 O  O     . THR A 1 423 ? 28.354 5.433   4.764   1.00 20.38 ? 420 THR A O     1 
ATOM   3332 C  CB    . THR A 1 423 ? 26.065 4.285   6.195   1.00 28.44 ? 420 THR A CB    1 
ATOM   3333 O  OG1   . THR A 1 423 ? 26.066 2.934   5.718   1.00 34.02 ? 420 THR A OG1   1 
ATOM   3334 C  CG2   . THR A 1 423 ? 24.874 4.492   7.130   1.00 30.36 ? 420 THR A CG2   1 
ATOM   3335 N  N     . MET A 1 424 ? 27.165 4.939   2.916   1.00 19.73 ? 421 MET A N     1 
ATOM   3336 C  CA    . MET A 1 424 ? 28.331 4.972   2.035   1.00 18.19 ? 421 MET A CA    1 
ATOM   3337 C  C     . MET A 1 424 ? 27.889 5.082   0.584   1.00 20.88 ? 421 MET A C     1 
ATOM   3338 O  O     . MET A 1 424 ? 26.915 4.441   0.192   1.00 18.48 ? 421 MET A O     1 
ATOM   3339 C  CB    . MET A 1 424 ? 29.194 3.722   2.224   1.00 22.12 ? 421 MET A CB    1 
ATOM   3340 C  CG    . MET A 1 424 ? 30.479 3.702   1.386   1.00 22.80 ? 421 MET A CG    1 
ATOM   3341 S  SD    . MET A 1 424 ? 30.211 3.054   -0.287  1.00 25.03 ? 421 MET A SD    1 
ATOM   3342 C  CE    . MET A 1 424 ? 29.769 1.356   0.077   1.00 28.64 ? 421 MET A CE    1 
ATOM   3343 N  N     . LEU A 1 425 ? 28.599 5.909   -0.184  1.00 18.86 ? 422 LEU A N     1 
ATOM   3344 C  CA    . LEU A 1 425 ? 28.474 5.990   -1.639  1.00 14.87 ? 422 LEU A CA    1 
ATOM   3345 C  C     . LEU A 1 425 ? 29.849 5.771   -2.266  1.00 16.35 ? 422 LEU A C     1 
ATOM   3346 O  O     . LEU A 1 425 ? 30.860 6.188   -1.707  1.00 17.46 ? 422 LEU A O     1 
ATOM   3347 C  CB    . LEU A 1 425 ? 27.938 7.348   -2.087  1.00 16.67 ? 422 LEU A CB    1 
ATOM   3348 C  CG    . LEU A 1 425 ? 26.533 7.785   -1.693  1.00 22.41 ? 422 LEU A CG    1 
ATOM   3349 C  CD1   . LEU A 1 425 ? 26.298 9.191   -2.208  1.00 22.96 ? 422 LEU A CD1   1 
ATOM   3350 C  CD2   . LEU A 1 425 ? 25.497 6.824   -2.254  1.00 21.64 ? 422 LEU A CD2   1 
ATOM   3351 N  N     . PHE A 1 426 ? 29.888 5.160   -3.443  1.00 16.70 ? 423 PHE A N     1 
ATOM   3352 C  CA    . PHE A 1 426 ? 31.151 4.755   -4.048  1.00 16.73 ? 423 PHE A CA    1 
ATOM   3353 C  C     . PHE A 1 426 ? 30.970 4.725   -5.558  1.00 20.63 ? 423 PHE A C     1 
ATOM   3354 O  O     . PHE A 1 426 ? 30.090 4.025   -6.061  1.00 23.53 ? 423 PHE A O     1 
ATOM   3355 C  CB    . PHE A 1 426 ? 31.574 3.386   -3.492  1.00 21.32 ? 423 PHE A CB    1 
ATOM   3356 C  CG    A PHE A 1 426 ? 32.983 2.955   -3.857  0.58 22.44 ? 423 PHE A CG    1 
ATOM   3357 C  CG    B PHE A 1 426 ? 32.704 2.743   -4.233  0.42 22.13 ? 423 PHE A CG    1 
ATOM   3358 C  CD1   A PHE A 1 426 ? 33.444 1.705   -3.468  0.58 25.93 ? 423 PHE A CD1   1 
ATOM   3359 C  CD1   B PHE A 1 426 ? 34.014 3.125   -3.992  0.42 20.21 ? 423 PHE A CD1   1 
ATOM   3360 C  CD2   A PHE A 1 426 ? 33.841 3.782   -4.570  0.58 18.13 ? 423 PHE A CD2   1 
ATOM   3361 C  CD2   B PHE A 1 426 ? 32.462 1.730   -5.145  0.42 23.78 ? 423 PHE A CD2   1 
ATOM   3362 C  CE1   A PHE A 1 426 ? 34.720 1.284   -3.788  0.58 27.36 ? 423 PHE A CE1   1 
ATOM   3363 C  CE1   B PHE A 1 426 ? 35.058 2.524   -4.665  0.42 24.37 ? 423 PHE A CE1   1 
ATOM   3364 C  CE2   A PHE A 1 426 ? 35.126 3.367   -4.895  0.58 20.55 ? 423 PHE A CE2   1 
ATOM   3365 C  CE2   B PHE A 1 426 ? 33.502 1.119   -5.812  0.42 22.77 ? 423 PHE A CE2   1 
ATOM   3366 C  CZ    A PHE A 1 426 ? 35.567 2.118   -4.503  0.58 26.88 ? 423 PHE A CZ    1 
ATOM   3367 C  CZ    B PHE A 1 426 ? 34.802 1.517   -5.569  0.42 23.57 ? 423 PHE A CZ    1 
ATOM   3368 N  N     . LEU A 1 427 ? 31.758 5.523   -6.273  1.00 13.84 ? 424 LEU A N     1 
ATOM   3369 C  CA    . LEU A 1 427 ? 31.786 5.465   -7.731  1.00 14.66 ? 424 LEU A CA    1 
ATOM   3370 C  C     . LEU A 1 427 ? 33.152 4.976   -8.161  1.00 17.30 ? 424 LEU A C     1 
ATOM   3371 O  O     . LEU A 1 427 ? 34.163 5.500   -7.708  1.00 17.16 ? 424 LEU A O     1 
ATOM   3372 C  CB    . LEU A 1 427 ? 31.503 6.825   -8.362  1.00 15.28 ? 424 LEU A CB    1 
ATOM   3373 C  CG    . LEU A 1 427 ? 30.148 7.457   -8.052  1.00 19.61 ? 424 LEU A CG    1 
ATOM   3374 C  CD1   . LEU A 1 427 ? 30.028 8.826   -8.727  1.00 18.49 ? 424 LEU A CD1   1 
ATOM   3375 C  CD2   . LEU A 1 427 ? 29.004 6.519   -8.450  1.00 19.18 ? 424 LEU A CD2   1 
ATOM   3376 N  N     . CYS A 1 428 ? 33.192 3.988   -9.048  1.00 17.35 ? 425 CYS A N     1 
ATOM   3377 C  CA    . CYS A 1 428 ? 34.476 3.449   -9.502  1.00 15.78 ? 425 CYS A CA    1 
ATOM   3378 C  C     . CYS A 1 428 ? 34.497 3.268   -11.011 1.00 20.24 ? 425 CYS A C     1 
ATOM   3379 O  O     . CYS A 1 428 ? 33.616 2.603   -11.561 1.00 19.84 ? 425 CYS A O     1 
ATOM   3380 C  CB    . CYS A 1 428 ? 34.767 2.113   -8.833  1.00 16.99 ? 425 CYS A CB    1 
ATOM   3381 S  SG    . CYS A 1 428 ? 36.442 1.471   -9.157  1.00 22.93 ? 425 CYS A SG    1 
ATOM   3382 N  N     . ALA A 1 429 ? 35.507 3.849   -11.659 1.00 15.00 ? 426 ALA A N     1 
ATOM   3383 C  CA    . ALA A 1 429 ? 35.678 3.735   -13.100 1.00 15.82 ? 426 ALA A CA    1 
ATOM   3384 C  C     . ALA A 1 429 ? 36.618 2.559   -13.390 1.00 15.84 ? 426 ALA A C     1 
ATOM   3385 O  O     . ALA A 1 429 ? 37.707 2.462   -12.815 1.00 15.70 ? 426 ALA A O     1 
ATOM   3386 C  CB    . ALA A 1 429 ? 36.225 5.027   -13.680 1.00 17.69 ? 426 ALA A CB    1 
ATOM   3387 N  N     . THR A 1 430 ? 36.177 1.657   -14.262 1.00 16.52 ? 427 THR A N     1 
ATOM   3388 C  CA    . THR A 1 430 ? 36.889 0.399   -14.492 1.00 18.79 ? 427 THR A CA    1 
ATOM   3389 C  C     . THR A 1 430 ? 36.902 0.072   -15.974 1.00 19.55 ? 427 THR A C     1 
ATOM   3390 O  O     . THR A 1 430 ? 36.335 0.810   -16.781 1.00 15.95 ? 427 THR A O     1 
ATOM   3391 C  CB    . THR A 1 430 ? 36.233 -0.784  -13.741 1.00 20.90 ? 427 THR A CB    1 
ATOM   3392 O  OG1   . THR A 1 430 ? 34.963 -1.082  -14.335 1.00 24.74 ? 427 THR A OG1   1 
ATOM   3393 C  CG2   . THR A 1 430 ? 36.019 -0.464  -12.257 1.00 23.85 ? 427 THR A CG2   1 
ATOM   3394 N  N     . LYS A 1 431 ? 37.538 -1.052  -16.306 1.00 19.17 ? 428 LYS A N     1 
ATOM   3395 C  CA    . LYS A 1 431 ? 37.598 -1.588  -17.670 1.00 21.01 ? 428 LYS A CA    1 
ATOM   3396 C  C     . LYS A 1 431 ? 38.197 -0.619  -18.690 1.00 14.59 ? 428 LYS A C     1 
ATOM   3397 O  O     . LYS A 1 431 ? 37.553 -0.236  -19.674 1.00 17.40 ? 428 LYS A O     1 
ATOM   3398 C  CB    . LYS A 1 431 ? 36.211 -2.048  -18.121 1.00 19.69 ? 428 LYS A CB    1 
ATOM   3399 C  CG    . LYS A 1 431 ? 35.695 -3.232  -17.320 1.00 27.72 ? 428 LYS A CG    1 
ATOM   3400 C  CD    . LYS A 1 431 ? 34.530 -3.935  -18.008 1.00 33.21 ? 428 LYS A CD    1 
ATOM   3401 C  CE    . LYS A 1 431 ? 33.945 -5.024  -17.116 1.00 35.31 ? 428 LYS A CE    1 
ATOM   3402 N  NZ    . LYS A 1 431 ? 34.993 -5.867  -16.472 1.00 43.33 ? 428 LYS A NZ    1 
ATOM   3403 N  N     . PHE A 1 432 ? 39.442 -0.228  -18.450 1.00 17.60 ? 429 PHE A N     1 
ATOM   3404 C  CA    . PHE A 1 432 ? 40.128 0.706   -19.336 1.00 16.70 ? 429 PHE A CA    1 
ATOM   3405 C  C     . PHE A 1 432 ? 40.444 0.127   -20.711 1.00 25.53 ? 429 PHE A C     1 
ATOM   3406 O  O     . PHE A 1 432 ? 40.753 -1.059  -20.840 1.00 21.41 ? 429 PHE A O     1 
ATOM   3407 C  CB    . PHE A 1 432 ? 41.415 1.210   -18.671 1.00 18.01 ? 429 PHE A CB    1 
ATOM   3408 C  CG    . PHE A 1 432 ? 41.169 2.199   -17.561 1.00 20.95 ? 429 PHE A CG    1 
ATOM   3409 C  CD1   . PHE A 1 432 ? 41.045 3.548   -17.837 1.00 16.81 ? 429 PHE A CD1   1 
ATOM   3410 C  CD2   . PHE A 1 432 ? 41.056 1.779   -16.245 1.00 26.03 ? 429 PHE A CD2   1 
ATOM   3411 C  CE1   . PHE A 1 432 ? 40.809 4.467   -16.824 1.00 17.02 ? 429 PHE A CE1   1 
ATOM   3412 C  CE2   . PHE A 1 432 ? 40.823 2.693   -15.224 1.00 24.85 ? 429 PHE A CE2   1 
ATOM   3413 C  CZ    . PHE A 1 432 ? 40.705 4.038   -15.514 1.00 22.87 ? 429 PHE A CZ    1 
ATOM   3414 N  N     . SER A 1 433 ? 40.339 0.982   -21.728 1.00 19.11 ? 430 SER A N     1 
ATOM   3415 C  CA    . SER A 1 433 ? 40.746 0.654   -23.094 1.00 17.99 ? 430 SER A CA    1 
ATOM   3416 C  C     . SER A 1 433 ? 41.715 1.702   -23.597 1.00 19.46 ? 430 SER A C     1 
ATOM   3417 O  O     . SER A 1 433 ? 41.610 2.874   -23.233 1.00 20.12 ? 430 SER A O     1 
ATOM   3418 C  CB    . SER A 1 433 ? 39.536 0.571   -24.029 1.00 24.62 ? 430 SER A CB    1 
ATOM   3419 O  OG    . SER A 1 433 ? 38.665 -0.472  -23.639 1.00 35.89 ? 430 SER A OG    1 
ATOM   3420 N  N     . ALA A 1 434 ? 42.658 1.287   -24.434 1.00 19.94 ? 431 ALA A N     1 
ATOM   3421 C  CA    . ALA A 1 434 ? 43.647 2.217   -24.947 1.00 21.75 ? 431 ALA A CA    1 
ATOM   3422 C  C     . ALA A 1 434 ? 42.954 3.280   -25.783 1.00 26.76 ? 431 ALA A C     1 
ATOM   3423 O  O     . ALA A 1 434 ? 41.951 3.010   -26.449 1.00 30.14 ? 431 ALA A O     1 
ATOM   3424 C  CB    . ALA A 1 434 ? 44.707 1.488   -25.767 1.00 26.98 ? 431 ALA A CB    1 
ATOM   3425 N  N     . SER A 1 435 ? 43.478 4.498   -25.718 1.00 22.32 ? 432 SER A N     1 
ATOM   3426 C  CA    . SER A 1 435 ? 42.902 5.616   -26.457 1.00 24.79 ? 432 SER A CA    1 
ATOM   3427 C  C     . SER A 1 435 ? 43.986 6.594   -26.882 1.00 27.75 ? 432 SER A C     1 
ATOM   3428 O  O     . SER A 1 435 ? 43.696 7.670   -27.391 1.00 30.00 ? 432 SER A O     1 
ATOM   3429 C  CB    . SER A 1 435 ? 41.853 6.334   -25.614 1.00 26.25 ? 432 SER A CB    1 
ATOM   3430 O  OG    . SER A 1 435 ? 42.460 7.001   -24.520 1.00 33.69 ? 432 SER A OG    1 
ATOM   3431 O  OXT   . SER A 1 435 ? 45.176 6.339   -26.713 1.00 35.98 ? 432 SER A OXT   1 
ATOM   3432 O  "O3'" . DC  B 2 1   ? 27.936 4.365   11.530  1.00 45.65 ? 1   DC  T "O3'" 1 
ATOM   3433 P  P     . DA  B 2 2   ? 28.377 4.171   13.117  1.00 66.28 ? 2   DA  T P     1 
ATOM   3434 O  OP1   . DA  B 2 2   ? 28.622 2.726   13.346  1.00 53.63 ? 2   DA  T OP1   1 
ATOM   3435 O  OP2   . DA  B 2 2   ? 27.382 4.898   13.939  1.00 60.50 ? 2   DA  T OP2   1 
ATOM   3436 O  "O5'" . DA  B 2 2   ? 29.757 4.965   13.264  1.00 49.09 ? 2   DA  T "O5'" 1 
ATOM   3437 C  "C5'" . DA  B 2 2   ? 30.893 4.586   12.499  1.00 43.30 ? 2   DA  T "C5'" 1 
ATOM   3438 C  "C4'" . DA  B 2 2   ? 32.133 5.318   12.986  1.00 41.80 ? 2   DA  T "C4'" 1 
ATOM   3439 O  "O4'" . DA  B 2 2   ? 31.995 6.736   12.723  1.00 39.98 ? 2   DA  T "O4'" 1 
ATOM   3440 C  "C3'" . DA  B 2 2   ? 32.405 5.204   14.483  1.00 40.65 ? 2   DA  T "C3'" 1 
ATOM   3441 O  "O3'" . DA  B 2 2   ? 33.795 5.225   14.712  1.00 41.49 ? 2   DA  T "O3'" 1 
ATOM   3442 C  "C2'" . DA  B 2 2   ? 31.736 6.451   15.047  1.00 43.29 ? 2   DA  T "C2'" 1 
ATOM   3443 C  "C1'" . DA  B 2 2   ? 32.011 7.457   13.941  1.00 38.49 ? 2   DA  T "C1'" 1 
ATOM   3444 N  N9    . DA  B 2 2   ? 31.011 8.514   13.860  1.00 37.25 ? 2   DA  T N9    1 
ATOM   3445 C  C8    . DA  B 2 2   ? 29.760 8.514   14.412  1.00 36.62 ? 2   DA  T C8    1 
ATOM   3446 N  N7    . DA  B 2 2   ? 29.078 9.609   14.168  1.00 35.55 ? 2   DA  T N7    1 
ATOM   3447 C  C5    . DA  B 2 2   ? 29.944 10.373  13.402  1.00 32.71 ? 2   DA  T C5    1 
ATOM   3448 C  C6    . DA  B 2 2   ? 29.826 11.651  12.823  1.00 28.95 ? 2   DA  T C6    1 
ATOM   3449 N  N6    . DA  B 2 2   ? 28.730 12.411  12.929  1.00 36.76 ? 2   DA  T N6    1 
ATOM   3450 N  N1    . DA  B 2 2   ? 30.879 12.118  12.121  1.00 34.70 ? 2   DA  T N1    1 
ATOM   3451 C  C2    . DA  B 2 2   ? 31.973 11.355  12.012  1.00 27.88 ? 2   DA  T C2    1 
ATOM   3452 N  N3    . DA  B 2 2   ? 32.202 10.146  12.512  1.00 30.86 ? 2   DA  T N3    1 
ATOM   3453 C  C4    . DA  B 2 2   ? 31.140 9.711   13.207  1.00 31.99 ? 2   DA  T C4    1 
ATOM   3454 P  P     A DT  B 2 3   ? 34.542 3.892   15.200  0.55 43.36 ? 3   DT  T P     1 
ATOM   3455 P  P     B DT  B 2 3   ? 34.558 3.883   15.147  0.45 43.34 ? 3   DT  T P     1 
ATOM   3456 O  OP1   A DT  B 2 3   ? 33.586 2.770   15.063  0.55 44.04 ? 3   DT  T OP1   1 
ATOM   3457 O  OP1   B DT  B 2 3   ? 33.579 3.013   15.838  0.45 43.83 ? 3   DT  T OP1   1 
ATOM   3458 O  OP2   A DT  B 2 3   ? 35.172 4.191   16.504  0.55 42.06 ? 3   DT  T OP2   1 
ATOM   3459 O  OP2   B DT  B 2 3   ? 35.808 4.291   15.829  0.45 40.49 ? 3   DT  T OP2   1 
ATOM   3460 O  "O5'" A DT  B 2 3   ? 35.707 3.686   14.122  0.55 40.56 ? 3   DT  T "O5'" 1 
ATOM   3461 O  "O5'" B DT  B 2 3   ? 34.953 3.194   13.755  0.45 39.53 ? 3   DT  T "O5'" 1 
ATOM   3462 C  "C5'" A DT  B 2 3   ? 36.609 4.741   13.844  0.55 38.19 ? 3   DT  T "C5'" 1 
ATOM   3463 C  "C5'" B DT  B 2 3   ? 36.239 3.424   13.187  0.45 35.83 ? 3   DT  T "C5'" 1 
ATOM   3464 C  "C4'" A DT  B 2 3   ? 37.413 4.438   12.599  0.55 34.75 ? 3   DT  T "C4'" 1 
ATOM   3465 C  "C4'" B DT  B 2 3   ? 36.278 4.757   12.462  0.45 34.82 ? 3   DT  T "C4'" 1 
ATOM   3466 O  "O4'" A DT  B 2 3   ? 38.476 3.522   12.931  0.55 36.90 ? 3   DT  T "O4'" 1 
ATOM   3467 O  "O4'" B DT  B 2 3   ? 37.661 5.133   12.220  0.45 33.50 ? 3   DT  T "O4'" 1 
ATOM   3468 C  "C3'" A DT  B 2 3   ? 36.605 3.776   11.482  0.55 35.93 ? 3   DT  T "C3'" 1 
ATOM   3469 C  "C3'" B DT  B 2 3   ? 35.592 4.762   11.097  0.45 32.76 ? 3   DT  T "C3'" 1 
ATOM   3470 O  "O3'" A DT  B 2 3   ? 36.615 4.592   10.311  0.55 32.43 ? 3   DT  T "O3'" 1 
ATOM   3471 O  "O3'" B DT  B 2 3   ? 34.936 6.013   10.889  0.45 31.72 ? 3   DT  T "O3'" 1 
ATOM   3472 C  "C2'" A DT  B 2 3   ? 37.283 2.419   11.259  0.55 35.22 ? 3   DT  T "C2'" 1 
ATOM   3473 C  "C2'" B DT  B 2 3   ? 36.764 4.565   10.139  0.45 31.96 ? 3   DT  T "C2'" 1 
ATOM   3474 C  "C1'" A DT  B 2 3   ? 38.659 2.625   11.867  0.55 33.80 ? 3   DT  T "C1'" 1 
ATOM   3475 C  "C1'" B DT  B 2 3   ? 37.856 5.360   10.841  0.45 30.28 ? 3   DT  T "C1'" 1 
ATOM   3476 N  N1    A DT  B 2 3   ? 39.255 1.382   12.411  0.55 38.59 ? 3   DT  T N1    1 
ATOM   3477 N  N1    B DT  B 2 3   ? 39.238 4.926   10.475  0.45 32.38 ? 3   DT  T N1    1 
ATOM   3478 C  C2    A DT  B 2 3   ? 40.448 0.934   11.902  0.55 38.75 ? 3   DT  T C2    1 
ATOM   3479 C  C2    B DT  B 2 3   ? 40.160 5.871   10.080  0.45 30.02 ? 3   DT  T C2    1 
ATOM   3480 O  O2    A DT  B 2 3   ? 41.048 1.506   11.010  0.55 38.31 ? 3   DT  T O2    1 
ATOM   3481 O  O2    B DT  B 2 3   ? 39.914 7.065   10.016  0.45 31.19 ? 3   DT  T O2    1 
ATOM   3482 N  N3    A DT  B 2 3   ? 40.916 -0.220  12.473  0.55 40.90 ? 3   DT  T N3    1 
ATOM   3483 N  N3    B DT  B 2 3   ? 41.394 5.366   9.767   0.45 29.46 ? 3   DT  T N3    1 
ATOM   3484 C  C4    A DT  B 2 3   ? 40.322 -0.950  13.488  0.55 43.55 ? 3   DT  T C4    1 
ATOM   3485 C  C4    B DT  B 2 3   ? 41.790 4.043   9.801   0.45 28.07 ? 3   DT  T C4    1 
ATOM   3486 O  O4    A DT  B 2 3   ? 40.820 -1.974  13.938  0.55 45.82 ? 3   DT  T O4    1 
ATOM   3487 O  O4    B DT  B 2 3   ? 42.925 3.690   9.498   0.45 29.51 ? 3   DT  T O4    1 
ATOM   3488 C  C5    A DT  B 2 3   ? 39.069 -0.421  13.977  0.55 43.38 ? 3   DT  T C5    1 
ATOM   3489 C  C5    B DT  B 2 3   ? 40.775 3.104   10.222  0.45 31.26 ? 3   DT  T C5    1 
ATOM   3490 C  C7    A DT  B 2 3   ? 38.331 -1.126  15.074  0.55 39.56 ? 3   DT  T C7    1 
ATOM   3491 C  C7    B DT  B 2 3   ? 41.087 1.640   10.302  0.45 34.91 ? 3   DT  T C7    1 
ATOM   3492 C  C6    A DT  B 2 3   ? 38.603 0.707   13.423  0.55 38.58 ? 3   DT  T C6    1 
ATOM   3493 C  C6    B DT  B 2 3   ? 39.564 3.587   10.537  0.45 31.12 ? 3   DT  T C6    1 
ATOM   3494 P  P     A DT  B 2 4   ? 35.225 5.166   9.747   0.50 30.84 ? 4   DT  T P     1 
ATOM   3495 P  P     B DT  B 2 4   ? 34.009 6.251   9.595   0.50 26.51 ? 4   DT  T P     1 
ATOM   3496 O  OP1   A DT  B 2 4   ? 34.618 6.004   10.805  0.50 32.06 ? 4   DT  T OP1   1 
ATOM   3497 O  OP1   B DT  B 2 4   ? 33.185 7.449   9.843   0.50 31.44 ? 4   DT  T OP1   1 
ATOM   3498 O  OP2   A DT  B 2 4   ? 34.488 4.006   9.201   0.50 31.16 ? 4   DT  T OP2   1 
ATOM   3499 O  OP2   B DT  B 2 4   ? 33.382 4.967   9.214   0.50 31.75 ? 4   DT  T OP2   1 
ATOM   3500 O  "O5'" A DT  B 2 4   ? 35.636 6.077   8.495   0.50 23.70 ? 4   DT  T "O5'" 1 
ATOM   3501 O  "O5'" B DT  B 2 4   ? 35.056 6.606   8.450   0.50 24.00 ? 4   DT  T "O5'" 1 
ATOM   3502 C  "C5'" A DT  B 2 4   ? 36.022 7.449   8.656   0.50 21.51 ? 4   DT  T "C5'" 1 
ATOM   3503 C  "C5'" B DT  B 2 4   ? 36.020 7.595   8.685   0.50 21.40 ? 4   DT  T "C5'" 1 
ATOM   3504 C  "C4'" . DT  B 2 4   ? 36.769 7.918   7.413   1.00 19.85 ? 4   DT  T "C4'" 1 
ATOM   3505 O  "O4'" . DT  B 2 4   ? 37.994 7.154   7.318   1.00 19.11 ? 4   DT  T "O4'" 1 
ATOM   3506 C  "C3'" . DT  B 2 4   ? 36.025 7.670   6.107   1.00 18.06 ? 4   DT  T "C3'" 1 
ATOM   3507 O  "O3'" A DT  B 2 4   ? 36.336 8.715   5.210   0.50 15.51 ? 4   DT  T "O3'" 1 
ATOM   3508 O  "O3'" B DT  B 2 4   ? 36.335 8.716   5.210   0.50 15.51 ? 4   DT  T "O3'" 1 
ATOM   3509 C  "C2'" . DT  B 2 4   ? 36.593 6.321   5.637   1.00 16.94 ? 4   DT  T "C2'" 1 
ATOM   3510 C  "C1'" . DT  B 2 4   ? 38.034 6.463   6.085   1.00 18.16 ? 4   DT  T "C1'" 1 
ATOM   3511 N  N1    . DT  B 2 4   ? 38.769 5.212   6.327   1.00 19.62 ? 4   DT  T N1    1 
ATOM   3512 C  C2    . DT  B 2 4   ? 40.087 5.195   5.989   1.00 17.41 ? 4   DT  T C2    1 
ATOM   3513 O  O2    . DT  B 2 4   ? 40.635 6.135   5.435   1.00 15.98 ? 4   DT  T O2    1 
ATOM   3514 N  N3    . DT  B 2 4   ? 40.741 4.036   6.282   1.00 17.69 ? 4   DT  T N3    1 
ATOM   3515 C  C4    . DT  B 2 4   ? 40.231 2.920   6.896   1.00 16.86 ? 4   DT  T C4    1 
ATOM   3516 O  O4    . DT  B 2 4   ? 40.917 1.932   7.117   1.00 19.39 ? 4   DT  T O4    1 
ATOM   3517 C  C5    . DT  B 2 4   ? 38.832 3.005   7.264   1.00 18.71 ? 4   DT  T C5    1 
ATOM   3518 C  C7    . DT  B 2 4   ? 38.153 1.843   7.931   1.00 23.25 ? 4   DT  T C7    1 
ATOM   3519 C  C6    . DT  B 2 4   ? 38.175 4.147   6.976   1.00 17.69 ? 4   DT  T C6    1 
ATOM   3520 P  P     . DA  B 2 5   ? 35.716 8.756   3.731   1.00 15.72 ? 5   DA  T P     1 
ATOM   3521 O  OP1   . DA  B 2 5   ? 35.419 10.174  3.432   1.00 18.08 ? 5   DA  T OP1   1 
ATOM   3522 O  OP2   . DA  B 2 5   ? 34.672 7.718   3.618   1.00 16.55 ? 5   DA  T OP2   1 
ATOM   3523 O  "O5'" . DA  B 2 5   ? 36.914 8.269   2.815   1.00 13.99 ? 5   DA  T "O5'" 1 
ATOM   3524 C  "C5'" . DA  B 2 5   ? 38.073 9.093   2.674   1.00 13.40 ? 5   DA  T "C5'" 1 
ATOM   3525 C  "C4'" . DA  B 2 5   ? 39.013 8.471   1.672   1.00 12.28 ? 5   DA  T "C4'" 1 
ATOM   3526 O  "O4'" . DA  B 2 5   ? 39.589 7.248   2.220   1.00 14.71 ? 5   DA  T "O4'" 1 
ATOM   3527 C  "C3'" . DA  B 2 5   ? 38.357 8.072   0.353   1.00 13.61 ? 5   DA  T "C3'" 1 
ATOM   3528 O  "O3'" . DA  B 2 5   ? 39.262 8.341   -0.704  1.00 13.18 ? 5   DA  T "O3'" 1 
ATOM   3529 C  "C2'" . DA  B 2 5   ? 38.134 6.570   0.530   1.00 15.16 ? 5   DA  T "C2'" 1 
ATOM   3530 C  "C1'" . DA  B 2 5   ? 39.396 6.197   1.301   1.00 12.93 ? 5   DA  T "C1'" 1 
ATOM   3531 N  N9    . DA  B 2 5   ? 39.298 4.960   2.049   1.00 12.08 ? 5   DA  T N9    1 
ATOM   3532 C  C8    . DA  B 2 5   ? 38.201 4.463   2.692   1.00 14.94 ? 5   DA  T C8    1 
ATOM   3533 N  N7    . DA  B 2 5   ? 38.426 3.329   3.318   1.00 16.35 ? 5   DA  T N7    1 
ATOM   3534 C  C5    . DA  B 2 5   ? 39.768 3.071   3.071   1.00 14.62 ? 5   DA  T C5    1 
ATOM   3535 C  C6    . DA  B 2 5   ? 40.616 2.014   3.452   1.00 17.27 ? 5   DA  T C6    1 
ATOM   3536 N  N6    . DA  B 2 5   ? 40.213 0.979   4.198   1.00 19.49 ? 5   DA  T N6    1 
ATOM   3537 N  N1    . DA  B 2 5   ? 41.897 2.061   3.033   1.00 16.24 ? 5   DA  T N1    1 
ATOM   3538 C  C2    . DA  B 2 5   ? 42.297 3.102   2.286   1.00 13.82 ? 5   DA  T C2    1 
ATOM   3539 N  N3    . DA  B 2 5   ? 41.592 4.153   1.865   1.00 14.57 ? 5   DA  T N3    1 
ATOM   3540 C  C4    . DA  B 2 5   ? 40.322 4.073   2.302   1.00 11.91 ? 5   DA  T C4    1 
ATOM   3541 P  P     . DT  B 2 6   ? 38.771 8.361   -2.230  1.00 14.04 ? 6   DT  T P     1 
ATOM   3542 O  OP1   . DT  B 2 6   ? 39.931 8.804   -3.028  1.00 15.73 ? 6   DT  T OP1   1 
ATOM   3543 O  OP2   . DT  B 2 6   ? 37.498 9.114   -2.332  1.00 13.74 ? 6   DT  T OP2   1 
ATOM   3544 O  "O5'" . DT  B 2 6   ? 38.381 6.830   -2.498  1.00 17.91 ? 6   DT  T "O5'" 1 
ATOM   3545 C  "C5'" . DT  B 2 6   ? 39.097 6.059   -3.428  1.00 21.45 ? 6   DT  T "C5'" 1 
ATOM   3546 C  "C4'" . DT  B 2 6   ? 40.287 5.355   -2.796  1.00 16.00 ? 6   DT  T "C4'" 1 
ATOM   3547 O  "O4'" . DT  B 2 6   ? 39.891 4.640   -1.610  1.00 18.26 ? 6   DT  T "O4'" 1 
ATOM   3548 C  "C3'" . DT  B 2 6   ? 40.886 4.305   -3.704  1.00 18.73 ? 6   DT  T "C3'" 1 
ATOM   3549 O  "O3'" . DT  B 2 6   ? 41.940 4.880   -4.423  1.00 16.76 ? 6   DT  T "O3'" 1 
ATOM   3550 C  "C2'" . DT  B 2 6   ? 41.368 3.191   -2.767  1.00 20.97 ? 6   DT  T "C2'" 1 
ATOM   3551 C  "C1'" . DT  B 2 6   ? 40.797 3.587   -1.406  1.00 18.22 ? 6   DT  T "C1'" 1 
ATOM   3552 N  N1    . DT  B 2 6   ? 40.095 2.501   -0.694  1.00 18.14 ? 6   DT  T N1    1 
ATOM   3553 C  C2    . DT  B 2 6   ? 40.809 1.420   -0.251  1.00 15.75 ? 6   DT  T C2    1 
ATOM   3554 O  O2    . DT  B 2 6   ? 42.002 1.278   -0.454  1.00 18.71 ? 6   DT  T O2    1 
ATOM   3555 N  N3    . DT  B 2 6   ? 40.076 0.499   0.450   1.00 17.33 ? 6   DT  T N3    1 
ATOM   3556 C  C4    . DT  B 2 6   ? 38.728 0.553   0.749   1.00 18.12 ? 6   DT  T C4    1 
ATOM   3557 O  O4    . DT  B 2 6   ? 38.160 -0.324  1.397   1.00 22.19 ? 6   DT  T O4    1 
ATOM   3558 C  C5    . DT  B 2 6   ? 38.040 1.724   0.266   1.00 18.98 ? 6   DT  T C5    1 
ATOM   3559 C  C7    . DT  B 2 6   ? 36.571 1.896   0.533   1.00 25.47 ? 6   DT  T C7    1 
ATOM   3560 C  C6    . DT  B 2 6   ? 38.750 2.633   -0.416  1.00 18.18 ? 6   DT  T C6    1 
ATOM   3561 P  P     . DG  B 2 7   ? 42.106 4.547   -5.979  1.00 17.48 ? 7   DG  T P     1 
ATOM   3562 O  OP1   . DG  B 2 7   ? 43.291 5.308   -6.422  1.00 17.81 ? 7   DG  T OP1   1 
ATOM   3563 O  OP2   . DG  B 2 7   ? 40.833 4.647   -6.704  1.00 15.20 ? 7   DG  T OP2   1 
ATOM   3564 O  "O5'" . DG  B 2 7   ? 42.417 2.976   -5.985  1.00 19.49 ? 7   DG  T "O5'" 1 
ATOM   3565 C  "C5'" . DG  B 2 7   ? 43.702 2.521   -5.670  1.00 24.53 ? 7   DG  T "C5'" 1 
ATOM   3566 C  "C4'" . DG  B 2 7   ? 43.713 1.014   -5.601  1.00 14.91 ? 7   DG  T "C4'" 1 
ATOM   3567 O  "O4'" . DG  B 2 7   ? 42.983 0.575   -4.445  1.00 18.08 ? 7   DG  T "O4'" 1 
ATOM   3568 C  "C3'" . DG  B 2 7   ? 43.072 0.291   -6.795  1.00 22.86 ? 7   DG  T "C3'" 1 
ATOM   3569 O  "O3'" . DG  B 2 7   ? 44.065 -0.439  -7.466  1.00 22.81 ? 7   DG  T "O3'" 1 
ATOM   3570 C  "C2'" . DG  B 2 7   ? 42.031 -0.635  -6.149  1.00 21.90 ? 7   DG  T "C2'" 1 
ATOM   3571 C  "C1'" . DG  B 2 7   ? 42.526 -0.710  -4.717  1.00 24.85 ? 7   DG  T "C1'" 1 
ATOM   3572 N  N9    . DG  B 2 7   ? 41.483 -1.070  -3.769  1.00 20.09 ? 7   DG  T N9    1 
ATOM   3573 C  C8    . DG  B 2 7   ? 40.278 -0.444  -3.572  1.00 18.66 ? 7   DG  T C8    1 
ATOM   3574 N  N7    . DG  B 2 7   ? 39.537 -1.018  -2.666  1.00 19.93 ? 7   DG  T N7    1 
ATOM   3575 C  C5    . DG  B 2 7   ? 40.297 -2.106  -2.252  1.00 16.64 ? 7   DG  T C5    1 
ATOM   3576 C  C6    . DG  B 2 7   ? 40.012 -3.089  -1.291  1.00 16.89 ? 7   DG  T C6    1 
ATOM   3577 O  O6    . DG  B 2 7   ? 38.988 -3.204  -0.592  1.00 19.88 ? 7   DG  T O6    1 
ATOM   3578 N  N1    . DG  B 2 7   ? 41.053 -4.016  -1.178  1.00 14.78 ? 7   DG  T N1    1 
ATOM   3579 C  C2    . DG  B 2 7   ? 42.228 -3.973  -1.893  1.00 15.31 ? 7   DG  T C2    1 
ATOM   3580 N  N2    . DG  B 2 7   ? 43.120 -4.949  -1.647  1.00 19.40 ? 7   DG  T N2    1 
ATOM   3581 N  N3    . DG  B 2 7   ? 42.507 -3.047  -2.804  1.00 17.67 ? 7   DG  T N3    1 
ATOM   3582 C  C4    . DG  B 2 7   ? 41.496 -2.147  -2.920  1.00 16.34 ? 7   DG  T C4    1 
ATOM   3583 P  P     . DA  B 2 8   ? 43.721 -1.377  -8.727  1.00 20.02 ? 8   DA  T P     1 
ATOM   3584 O  OP1   . DA  B 2 8   ? 44.805 -1.110  -9.676  1.00 19.35 ? 8   DA  T OP1   1 
ATOM   3585 O  OP2   . DA  B 2 8   ? 42.292 -1.326  -9.151  1.00 23.67 ? 8   DA  T OP2   1 
ATOM   3586 O  "O5'" . DA  B 2 8   ? 44.016 -2.843  -8.175  1.00 22.56 ? 8   DA  T "O5'" 1 
ATOM   3587 C  "C5'" . DA  B 2 8   ? 45.299 -3.146  -7.653  1.00 19.65 ? 8   DA  T "C5'" 1 
ATOM   3588 C  "C4'" . DA  B 2 8   ? 45.349 -4.593  -7.224  1.00 20.16 ? 8   DA  T "C4'" 1 
ATOM   3589 O  "O4'" . DA  B 2 8   ? 44.458 -4.766  -6.092  1.00 19.56 ? 8   DA  T "O4'" 1 
ATOM   3590 C  "C3'" . DA  B 2 8   ? 44.886 -5.579  -8.301  1.00 24.36 ? 8   DA  T "C3'" 1 
ATOM   3591 O  "O3'" . DA  B 2 8   ? 45.744 -6.701  -8.345  1.00 22.40 ? 8   DA  T "O3'" 1 
ATOM   3592 C  "C2'" . DA  B 2 8   ? 43.480 -5.966  -7.862  1.00 22.94 ? 8   DA  T "C2'" 1 
ATOM   3593 C  "C1'" . DA  B 2 8   ? 43.558 -5.824  -6.347  1.00 25.12 ? 8   DA  T "C1'" 1 
ATOM   3594 N  N9    . DA  B 2 8   ? 42.275 -5.477  -5.763  1.00 20.71 ? 8   DA  T N9    1 
ATOM   3595 C  C8    . DA  B 2 8   ? 41.461 -4.447  -6.144  1.00 20.54 ? 8   DA  T C8    1 
ATOM   3596 N  N7    . DA  B 2 8   ? 40.349 -4.370  -5.463  1.00 16.20 ? 8   DA  T N7    1 
ATOM   3597 C  C5    . DA  B 2 8   ? 40.438 -5.422  -4.566  1.00 16.37 ? 8   DA  T C5    1 
ATOM   3598 C  C6    . DA  B 2 8   ? 39.565 -5.883  -3.571  1.00 16.30 ? 8   DA  T C6    1 
ATOM   3599 N  N6    . DA  B 2 8   ? 38.393 -5.298  -3.302  1.00 16.07 ? 8   DA  T N6    1 
ATOM   3600 N  N1    . DA  B 2 8   ? 39.944 -6.964  -2.850  1.00 17.27 ? 8   DA  T N1    1 
ATOM   3601 C  C2    . DA  B 2 8   ? 41.122 -7.539  -3.130  1.00 14.71 ? 8   DA  T C2    1 
ATOM   3602 N  N3    . DA  B 2 8   ? 42.029 -7.201  -4.050  1.00 15.52 ? 8   DA  T N3    1 
ATOM   3603 C  C4    . DA  B 2 8   ? 41.617 -6.123  -4.747  1.00 18.10 ? 8   DA  T C4    1 
ATOM   3604 P  P     . DC  B 2 9   ? 45.612 -7.787  -9.522  1.00 24.08 ? 9   DC  T P     1 
ATOM   3605 O  OP1   . DC  B 2 9   ? 46.994 -8.242  -9.792  1.00 27.84 ? 9   DC  T OP1   1 
ATOM   3606 O  OP2   . DC  B 2 9   ? 44.767 -7.268  -10.619 1.00 28.48 ? 9   DC  T OP2   1 
ATOM   3607 O  "O5'" . DC  B 2 9   ? 44.787 -8.970  -8.840  1.00 21.95 ? 9   DC  T "O5'" 1 
ATOM   3608 C  "C5'" . DC  B 2 9   ? 45.278 -9.551  -7.664  1.00 22.77 ? 9   DC  T "C5'" 1 
ATOM   3609 C  "C4'" . DC  B 2 9   ? 44.240 -10.460 -7.077  1.00 25.30 ? 9   DC  T "C4'" 1 
ATOM   3610 O  "O4'" . DC  B 2 9   ? 43.154 -9.672  -6.524  1.00 26.20 ? 9   DC  T "O4'" 1 
ATOM   3611 C  "C3'" . DC  B 2 9   ? 43.588 -11.407 -8.087  1.00 27.46 ? 9   DC  T "C3'" 1 
ATOM   3612 O  "O3'" . DC  B 2 9   ? 43.444 -12.647 -7.486  1.00 35.68 ? 9   DC  T "O3'" 1 
ATOM   3613 C  "C2'" . DC  B 2 9   ? 42.227 -10.763 -8.323  1.00 24.69 ? 9   DC  T "C2'" 1 
ATOM   3614 C  "C1'" . DC  B 2 9   ? 41.947 -10.274 -6.923  1.00 26.07 ? 9   DC  T "C1'" 1 
ATOM   3615 N  N1    . DC  B 2 9   ? 40.830 -9.310  -6.827  1.00 22.50 ? 9   DC  T N1    1 
ATOM   3616 C  C2    . DC  B 2 9   ? 39.922 -9.436  -5.778  1.00 20.64 ? 9   DC  T C2    1 
ATOM   3617 O  O2    . DC  B 2 9   ? 40.096 -10.327 -4.934  1.00 20.31 ? 9   DC  T O2    1 
ATOM   3618 N  N3    . DC  B 2 9   ? 38.888 -8.577  -5.702  1.00 18.64 ? 9   DC  T N3    1 
ATOM   3619 C  C4    . DC  B 2 9   ? 38.740 -7.623  -6.624  1.00 25.21 ? 9   DC  T C4    1 
ATOM   3620 N  N4    . DC  B 2 9   ? 37.698 -6.800  -6.500  1.00 22.58 ? 9   DC  T N4    1 
ATOM   3621 C  C5    . DC  B 2 9   ? 39.649 -7.485  -7.716  1.00 25.15 ? 9   DC  T C5    1 
ATOM   3622 C  C6    . DC  B 2 9   ? 40.671 -8.347  -7.778  1.00 24.73 ? 9   DC  T C6    1 
ATOM   3623 P  P     . DG  B 2 10  ? 43.180 -13.961 -8.362  1.00 29.86 ? 10  DG  T P     1 
ATOM   3624 O  OP1   . DG  B 2 10  ? 44.480 -14.654 -8.446  1.00 37.58 ? 10  DG  T OP1   1 
ATOM   3625 O  OP2   . DG  B 2 10  ? 42.391 -13.649 -9.578  1.00 28.56 ? 10  DG  T OP2   1 
ATOM   3626 O  "O5'" . DG  B 2 10  ? 42.257 -14.818 -7.411  1.00 30.26 ? 10  DG  T "O5'" 1 
ATOM   3627 C  "C5'" . DG  B 2 10  ? 42.406 -14.710 -6.017  1.00 29.82 ? 10  DG  T "C5'" 1 
ATOM   3628 C  "C4'" . DG  B 2 10  ? 41.228 -15.347 -5.332  1.00 25.05 ? 10  DG  T "C4'" 1 
ATOM   3629 O  "O4'" . DG  B 2 10  ? 40.204 -14.349 -5.114  1.00 29.19 ? 10  DG  T "O4'" 1 
ATOM   3630 C  "C3'" . DG  B 2 10  ? 40.575 -16.468 -6.135  1.00 32.97 ? 10  DG  T "C3'" 1 
ATOM   3631 O  "O3'" . DG  B 2 10  ? 40.145 -17.505 -5.264  1.00 31.28 ? 10  DG  T "O3'" 1 
ATOM   3632 C  "C2'" . DG  B 2 10  ? 39.402 -15.768 -6.817  1.00 29.42 ? 10  DG  T "C2'" 1 
ATOM   3633 C  "C1'" . DG  B 2 10  ? 39.021 -14.706 -5.796  1.00 26.96 ? 10  DG  T "C1'" 1 
ATOM   3634 N  N9    . DG  B 2 10  ? 38.471 -13.501 -6.403  1.00 21.92 ? 10  DG  T N9    1 
ATOM   3635 C  C8    . DG  B 2 10  ? 39.070 -12.701 -7.347  1.00 24.44 ? 10  DG  T C8    1 
ATOM   3636 N  N7    . DG  B 2 10  ? 38.337 -11.684 -7.710  1.00 22.02 ? 10  DG  T N7    1 
ATOM   3637 C  C5    . DG  B 2 10  ? 37.175 -11.819 -6.956  1.00 21.93 ? 10  DG  T C5    1 
ATOM   3638 C  C6    . DG  B 2 10  ? 36.016 -11.014 -6.916  1.00 21.67 ? 10  DG  T C6    1 
ATOM   3639 O  O6    . DG  B 2 10  ? 35.772 -9.988  -7.563  1.00 23.51 ? 10  DG  T O6    1 
ATOM   3640 N  N1    . DG  B 2 10  ? 35.076 -11.510 -6.011  1.00 24.02 ? 10  DG  T N1    1 
ATOM   3641 C  C2    . DG  B 2 10  ? 35.241 -12.643 -5.242  1.00 23.07 ? 10  DG  T C2    1 
ATOM   3642 N  N2    . DG  B 2 10  ? 34.224 -12.968 -4.432  1.00 26.86 ? 10  DG  T N2    1 
ATOM   3643 N  N3    . DG  B 2 10  ? 36.326 -13.405 -5.268  1.00 22.53 ? 10  DG  T N3    1 
ATOM   3644 C  C4    . DG  B 2 10  ? 37.250 -12.934 -6.142  1.00 20.97 ? 10  DG  T C4    1 
ATOM   3645 P  P     . DC  B 2 11  ? 39.498 -18.857 -5.851  1.00 31.20 ? 11  DC  T P     1 
ATOM   3646 O  OP1   . DC  B 2 11  ? 40.008 -19.957 -5.000  1.00 35.49 ? 11  DC  T OP1   1 
ATOM   3647 O  OP2   . DC  B 2 11  ? 39.704 -18.954 -7.308  1.00 31.12 ? 11  DC  T OP2   1 
ATOM   3648 O  "O5'" . DC  B 2 11  ? 37.930 -18.640 -5.619  1.00 30.16 ? 11  DC  T "O5'" 1 
ATOM   3649 C  "C5'" . DC  B 2 11  ? 37.433 -18.292 -4.336  1.00 23.91 ? 11  DC  T "C5'" 1 
ATOM   3650 C  "C4'" . DC  B 2 11  ? 35.912 -18.281 -4.334  1.00 21.70 ? 11  DC  T "C4'" 1 
ATOM   3651 O  "O4'" . DC  B 2 11  ? 35.424 -17.032 -4.890  1.00 21.74 ? 11  DC  T "O4'" 1 
ATOM   3652 C  "C3'" . DC  B 2 11  ? 35.247 -19.399 -5.138  1.00 17.65 ? 11  DC  T "C3'" 1 
ATOM   3653 O  "O3'" . DC  B 2 11  ? 34.167 -19.932 -4.370  1.00 17.82 ? 11  DC  T "O3'" 1 
ATOM   3654 C  "C2'" . DC  B 2 11  ? 34.771 -18.685 -6.424  1.00 22.02 ? 11  DC  T "C2'" 1 
ATOM   3655 C  "C1'" . DC  B 2 11  ? 34.479 -17.282 -5.916  1.00 21.43 ? 11  DC  T "C1'" 1 
ATOM   3656 N  N1    . DC  B 2 11  ? 34.642 -16.181 -6.932  1.00 18.95 ? 11  DC  T N1    1 
ATOM   3657 C  C2    . DC  B 2 11  ? 33.613 -15.247 -7.117  1.00 16.21 ? 11  DC  T C2    1 
ATOM   3658 O  O2    . DC  B 2 11  ? 32.557 -15.371 -6.485  1.00 21.36 ? 11  DC  T O2    1 
ATOM   3659 N  N3    . DC  B 2 11  ? 33.794 -14.231 -8.004  1.00 17.46 ? 11  DC  T N3    1 
ATOM   3660 C  C4    . DC  B 2 11  ? 34.939 -14.132 -8.679  1.00 18.71 ? 11  DC  T C4    1 
ATOM   3661 N  N4    . DC  B 2 11  ? 35.070 -13.107 -9.539  1.00 16.28 ? 11  DC  T N4    1 
ATOM   3662 C  C5    . DC  B 2 11  ? 36.002 -15.064 -8.497  1.00 14.32 ? 11  DC  T C5    1 
ATOM   3663 C  C6    . DC  B 2 11  ? 35.816 -16.060 -7.612  1.00 18.99 ? 11  DC  T C6    1 
ATOM   3664 P  P     . DT  B 2 12  ? 33.435 -21.297 -4.810  1.00 18.70 ? 12  DT  T P     1 
ATOM   3665 O  OP1   . DT  B 2 12  ? 32.912 -21.896 -3.556  1.00 18.87 ? 12  DT  T OP1   1 
ATOM   3666 O  OP2   . DT  B 2 12  ? 34.299 -22.063 -5.715  1.00 16.32 ? 12  DT  T OP2   1 
ATOM   3667 O  "O5'" . DT  B 2 12  ? 32.193 -20.761 -5.645  1.00 18.11 ? 12  DT  T "O5'" 1 
ATOM   3668 C  "C5'" . DT  B 2 12  ? 31.130 -20.152 -4.977  1.00 17.76 ? 12  DT  T "C5'" 1 
ATOM   3669 C  "C4'" . DT  B 2 12  ? 30.110 -19.688 -5.971  1.00 21.06 ? 12  DT  T "C4'" 1 
ATOM   3670 O  "O4'" . DT  B 2 12  ? 30.655 -18.567 -6.710  1.00 21.83 ? 12  DT  T "O4'" 1 
ATOM   3671 C  "C3'" . DT  B 2 12  ? 29.733 -20.740 -7.022  1.00 21.39 ? 12  DT  T "C3'" 1 
ATOM   3672 O  "O3'" . DT  B 2 12  ? 28.332 -20.688 -7.278  1.00 25.93 ? 12  DT  T "O3'" 1 
ATOM   3673 C  "C2'" . DT  B 2 12  ? 30.536 -20.291 -8.237  1.00 19.62 ? 12  DT  T "C2'" 1 
ATOM   3674 C  "C1'" . DT  B 2 12  ? 30.404 -18.792 -8.073  1.00 25.13 ? 12  DT  T "C1'" 1 
ATOM   3675 N  N1    . DT  B 2 12  ? 31.340 -17.992 -8.885  1.00 25.12 ? 12  DT  T N1    1 
ATOM   3676 C  C2    . DT  B 2 12  ? 30.940 -16.749 -9.301  1.00 22.45 ? 12  DT  T C2    1 
ATOM   3677 O  O2    . DT  B 2 12  ? 29.860 -16.271 -9.019  1.00 27.83 ? 12  DT  T O2    1 
ATOM   3678 N  N3    . DT  B 2 12  ? 31.848 -16.080 -10.059 1.00 21.98 ? 12  DT  T N3    1 
ATOM   3679 C  C4    . DT  B 2 12  ? 33.095 -16.518 -10.451 1.00 18.02 ? 12  DT  T C4    1 
ATOM   3680 O  O4    . DT  B 2 12  ? 33.838 -15.829 -11.150 1.00 24.57 ? 12  DT  T O4    1 
ATOM   3681 C  C5    . DT  B 2 12  ? 33.461 -17.839 -9.986  1.00 19.80 ? 12  DT  T C5    1 
ATOM   3682 C  C7    . DT  B 2 12  ? 34.792 -18.424 -10.343 1.00 23.21 ? 12  DT  T C7    1 
ATOM   3683 C  C6    . DT  B 2 12  ? 32.571 -18.510 -9.234  1.00 21.38 ? 12  DT  T C6    1 
ATOM   3684 O  "O5'" . DA  C 3 1   ? 29.134 -7.957  -15.221 1.00 44.80 ? 1   DA  P "O5'" 1 
ATOM   3685 C  "C5'" . DA  C 3 1   ? 27.825 -8.213  -15.697 1.00 34.05 ? 1   DA  P "C5'" 1 
ATOM   3686 C  "C4'" . DA  C 3 1   ? 26.920 -8.709  -14.579 1.00 32.84 ? 1   DA  P "C4'" 1 
ATOM   3687 O  "O4'" . DA  C 3 1   ? 27.308 -10.048 -14.190 1.00 34.83 ? 1   DA  P "O4'" 1 
ATOM   3688 C  "C3'" . DA  C 3 1   ? 26.917 -7.870  -13.303 1.00 31.52 ? 1   DA  P "C3'" 1 
ATOM   3689 O  "O3'" . DA  C 3 1   ? 25.600 -7.820  -12.762 1.00 29.05 ? 1   DA  P "O3'" 1 
ATOM   3690 C  "C2'" . DA  C 3 1   ? 27.886 -8.609  -12.375 1.00 32.08 ? 1   DA  P "C2'" 1 
ATOM   3691 C  "C1'" . DA  C 3 1   ? 27.868 -10.054 -12.893 1.00 31.85 ? 1   DA  P "C1'" 1 
ATOM   3692 N  N9    . DA  C 3 1   ? 29.201 -10.657 -12.975 1.00 27.63 ? 1   DA  P N9    1 
ATOM   3693 C  C8    . DA  C 3 1   ? 30.243 -10.256 -13.767 1.00 29.99 ? 1   DA  P C8    1 
ATOM   3694 N  N7    . DA  C 3 1   ? 31.328 -10.986 -13.626 1.00 29.10 ? 1   DA  P N7    1 
ATOM   3695 C  C5    . DA  C 3 1   ? 30.974 -11.928 -12.674 1.00 22.69 ? 1   DA  P C5    1 
ATOM   3696 C  C6    . DA  C 3 1   ? 31.679 -12.998 -12.085 1.00 22.56 ? 1   DA  P C6    1 
ATOM   3697 N  N6    . DA  C 3 1   ? 32.943 -13.304 -12.388 1.00 24.78 ? 1   DA  P N6    1 
ATOM   3698 N  N1    . DA  C 3 1   ? 31.025 -13.748 -11.171 1.00 25.92 ? 1   DA  P N1    1 
ATOM   3699 C  C2    . DA  C 3 1   ? 29.757 -13.447 -10.872 1.00 19.13 ? 1   DA  P C2    1 
ATOM   3700 N  N3    . DA  C 3 1   ? 28.990 -12.470 -11.363 1.00 22.79 ? 1   DA  P N3    1 
ATOM   3701 C  C4    . DA  C 3 1   ? 29.666 -11.742 -12.264 1.00 26.90 ? 1   DA  P C4    1 
ATOM   3702 P  P     . DG  C 3 2   ? 25.182 -6.653  -11.727 1.00 33.93 ? 2   DG  P P     1 
ATOM   3703 O  OP1   . DG  C 3 2   ? 23.713 -6.545  -11.746 1.00 28.56 ? 2   DG  P OP1   1 
ATOM   3704 O  OP2   . DG  C 3 2   ? 26.044 -5.473  -11.966 1.00 33.35 ? 2   DG  P OP2   1 
ATOM   3705 O  "O5'" . DG  C 3 2   ? 25.610 -7.236  -10.305 1.00 28.88 ? 2   DG  P "O5'" 1 
ATOM   3706 C  "C5'" . DG  C 3 2   ? 24.762 -8.144  -9.657  1.00 28.54 ? 2   DG  P "C5'" 1 
ATOM   3707 C  "C4'" . DG  C 3 2   ? 25.480 -8.783  -8.502  1.00 20.52 ? 2   DG  P "C4'" 1 
ATOM   3708 O  "O4'" . DG  C 3 2   ? 26.698 -9.398  -8.973  1.00 22.62 ? 2   DG  P "O4'" 1 
ATOM   3709 C  "C3'" . DG  C 3 2   ? 25.885 -7.816  -7.388  1.00 23.41 ? 2   DG  P "C3'" 1 
ATOM   3710 O  "O3'" . DG  C 3 2   ? 25.336 -8.286  -6.180  1.00 24.79 ? 2   DG  P "O3'" 1 
ATOM   3711 C  "C2'" . DG  C 3 2   ? 27.421 -7.876  -7.389  1.00 21.89 ? 2   DG  P "C2'" 1 
ATOM   3712 C  "C1'" . DG  C 3 2   ? 27.674 -9.247  -7.989  1.00 23.79 ? 2   DG  P "C1'" 1 
ATOM   3713 N  N9    . DG  C 3 2   ? 28.996 -9.403  -8.591  1.00 23.70 ? 2   DG  P N9    1 
ATOM   3714 C  C8    . DG  C 3 2   ? 29.643 -8.536  -9.446  1.00 23.69 ? 2   DG  P C8    1 
ATOM   3715 N  N7    . DG  C 3 2   ? 30.830 -8.953  -9.807  1.00 24.60 ? 2   DG  P N7    1 
ATOM   3716 C  C5    . DG  C 3 2   ? 30.970 -10.178 -9.154  1.00 21.30 ? 2   DG  P C5    1 
ATOM   3717 C  C6    . DG  C 3 2   ? 32.047 -11.098 -9.148  1.00 18.99 ? 2   DG  P C6    1 
ATOM   3718 O  O6    . DG  C 3 2   ? 33.128 -11.029 -9.756  1.00 21.24 ? 2   DG  P O6    1 
ATOM   3719 N  N1    . DG  C 3 2   ? 31.772 -12.205 -8.342  1.00 23.28 ? 2   DG  P N1    1 
ATOM   3720 C  C2    . DG  C 3 2   ? 30.609 -12.395 -7.637  1.00 20.71 ? 2   DG  P C2    1 
ATOM   3721 N  N2    . DG  C 3 2   ? 30.518 -13.528 -6.920  1.00 20.71 ? 2   DG  P N2    1 
ATOM   3722 N  N3    . DG  C 3 2   ? 29.599 -11.543 -7.637  1.00 23.16 ? 2   DG  P N3    1 
ATOM   3723 C  C4    . DG  C 3 2   ? 29.851 -10.459 -8.404  1.00 23.69 ? 2   DG  P C4    1 
ATOM   3724 P  P     . DC  C 3 3   ? 25.577 -7.529  -4.786  1.00 29.84 ? 3   DC  P P     1 
ATOM   3725 O  OP1   . DC  C 3 3   ? 24.264 -7.509  -4.107  1.00 35.83 ? 3   DC  P OP1   1 
ATOM   3726 O  OP2   . DC  C 3 3   ? 26.373 -6.295  -4.944  1.00 27.60 ? 3   DC  P OP2   1 
ATOM   3727 O  "O5'" . DC  C 3 3   ? 26.548 -8.520  -3.997  1.00 33.87 ? 3   DC  P "O5'" 1 
ATOM   3728 C  "C5'" . DC  C 3 3   ? 26.269 -9.909  -3.943  1.00 35.62 ? 3   DC  P "C5'" 1 
ATOM   3729 C  "C4'" . DC  C 3 3   ? 27.446 -10.650 -3.339  1.00 35.83 ? 3   DC  P "C4'" 1 
ATOM   3730 O  "O4'" . DC  C 3 3   ? 28.504 -10.725 -4.318  1.00 30.40 ? 3   DC  P "O4'" 1 
ATOM   3731 C  "C3'" . DC  C 3 3   ? 28.046 -9.982  -2.094  1.00 32.31 ? 3   DC  P "C3'" 1 
ATOM   3732 O  "O3'" . DC  C 3 3   ? 27.964 -10.855 -0.977  1.00 36.67 ? 3   DC  P "O3'" 1 
ATOM   3733 C  "C2'" . DC  C 3 3   ? 29.501 -9.680  -2.470  1.00 37.28 ? 3   DC  P "C2'" 1 
ATOM   3734 C  "C1'" . DC  C 3 3   ? 29.746 -10.569 -3.686  1.00 35.96 ? 3   DC  P "C1'" 1 
ATOM   3735 N  N1    . DC  C 3 3   ? 30.686 -9.956  -4.654  1.00 31.51 ? 3   DC  P N1    1 
ATOM   3736 C  C2    . DC  C 3 3   ? 31.900 -10.585 -4.927  1.00 25.24 ? 3   DC  P C2    1 
ATOM   3737 O  O2    . DC  C 3 3   ? 32.163 -11.651 -4.366  1.00 32.15 ? 3   DC  P O2    1 
ATOM   3738 N  N3    . DC  C 3 3   ? 32.757 -10.006 -5.801  1.00 30.49 ? 3   DC  P N3    1 
ATOM   3739 C  C4    . DC  C 3 3   ? 32.437 -8.851  -6.380  1.00 28.08 ? 3   DC  P C4    1 
ATOM   3740 N  N4    . DC  C 3 3   ? 33.315 -8.317  -7.238  1.00 30.42 ? 3   DC  P N4    1 
ATOM   3741 C  C5    . DC  C 3 3   ? 31.198 -8.194  -6.115  1.00 32.74 ? 3   DC  P C5    1 
ATOM   3742 C  C6    . DC  C 3 3   ? 30.364 -8.771  -5.248  1.00 29.62 ? 3   DC  P C6    1 
ATOM   3743 P  P     . DG  C 3 4   ? 28.531 -10.391 0.455   1.00 32.47 ? 4   DG  P P     1 
ATOM   3744 O  OP1   . DG  C 3 4   ? 27.737 -11.102 1.482   1.00 44.68 ? 4   DG  P OP1   1 
ATOM   3745 O  OP2   . DG  C 3 4   ? 28.652 -8.914  0.495   1.00 36.29 ? 4   DG  P OP2   1 
ATOM   3746 O  "O5'" . DG  C 3 4   ? 30.016 -10.980 0.476   1.00 30.18 ? 4   DG  P "O5'" 1 
ATOM   3747 C  "C5'" . DG  C 3 4   ? 30.222 -12.358 0.224   1.00 32.34 ? 4   DG  P "C5'" 1 
ATOM   3748 C  "C4'" . DG  C 3 4   ? 31.701 -12.683 0.263   1.00 37.34 ? 4   DG  P "C4'" 1 
ATOM   3749 O  "O4'" . DG  C 3 4   ? 32.348 -12.094 -0.892  1.00 34.88 ? 4   DG  P "O4'" 1 
ATOM   3750 C  "C3'" . DG  C 3 4   ? 32.429 -12.142 1.494   1.00 34.48 ? 4   DG  P "C3'" 1 
ATOM   3751 O  "O3'" . DG  C 3 4   ? 33.170 -13.177 2.112   1.00 37.07 ? 4   DG  P "O3'" 1 
ATOM   3752 C  "C2'" . DG  C 3 4   ? 33.330 -11.038 0.946   1.00 29.19 ? 4   DG  P "C2'" 1 
ATOM   3753 C  "C1'" . DG  C 3 4   ? 33.541 -11.464 -0.497  1.00 27.71 ? 4   DG  P "C1'" 1 
ATOM   3754 N  N9    . DG  C 3 4   ? 33.775 -10.344 -1.393  1.00 26.26 ? 4   DG  P N9    1 
ATOM   3755 C  C8    . DG  C 3 4   ? 32.926 -9.287  -1.639  1.00 27.18 ? 4   DG  P C8    1 
ATOM   3756 N  N7    . DG  C 3 4   ? 33.399 -8.432  -2.499  1.00 23.75 ? 4   DG  P N7    1 
ATOM   3757 C  C5    . DG  C 3 4   ? 34.642 -8.956  -2.847  1.00 24.42 ? 4   DG  P C5    1 
ATOM   3758 C  C6    . DG  C 3 4   ? 35.614 -8.466  -3.741  1.00 20.94 ? 4   DG  P C6    1 
ATOM   3759 O  O6    . DG  C 3 4   ? 35.578 -7.431  -4.421  1.00 27.08 ? 4   DG  P O6    1 
ATOM   3760 N  N1    . DG  C 3 4   ? 36.732 -9.304  -3.804  1.00 19.53 ? 4   DG  P N1    1 
ATOM   3761 C  C2    . DG  C 3 4   ? 36.876 -10.471 -3.089  1.00 17.53 ? 4   DG  P C2    1 
ATOM   3762 N  N2    . DG  C 3 4   ? 38.025 -11.144 -3.272  1.00 19.36 ? 4   DG  P N2    1 
ATOM   3763 N  N3    . DG  C 3 4   ? 35.966 -10.942 -2.249  1.00 18.47 ? 4   DG  P N3    1 
ATOM   3764 C  C4    . DG  C 3 4   ? 34.880 -10.134 -2.178  1.00 24.22 ? 4   DG  P C4    1 
ATOM   3765 P  P     . DT  C 3 5   ? 33.887 -12.921 3.528   1.00 33.82 ? 5   DT  P P     1 
ATOM   3766 O  OP1   . DT  C 3 5   ? 33.717 -14.148 4.331   1.00 37.06 ? 5   DT  P OP1   1 
ATOM   3767 O  OP2   . DT  C 3 5   ? 33.474 -11.608 4.059   1.00 32.00 ? 5   DT  P OP2   1 
ATOM   3768 O  "O5'" . DT  C 3 5   ? 35.427 -12.767 3.127   1.00 30.28 ? 5   DT  P "O5'" 1 
ATOM   3769 C  "C5'" . DT  C 3 5   ? 35.983 -13.656 2.199   1.00 21.64 ? 5   DT  P "C5'" 1 
ATOM   3770 C  "C4'" . DT  C 3 5   ? 37.413 -13.259 1.875   1.00 16.85 ? 5   DT  P "C4'" 1 
ATOM   3771 O  "O4'" . DT  C 3 5   ? 37.423 -12.239 0.857   1.00 17.22 ? 5   DT  P "O4'" 1 
ATOM   3772 C  "C3'" . DT  C 3 5   ? 38.226 -12.717 3.049   1.00 18.08 ? 5   DT  P "C3'" 1 
ATOM   3773 O  "O3'" . DT  C 3 5   ? 39.430 -13.443 3.119   1.00 19.74 ? 5   DT  P "O3'" 1 
ATOM   3774 C  "C2'" . DT  C 3 5   ? 38.471 -11.243 2.691   1.00 16.50 ? 5   DT  P "C2'" 1 
ATOM   3775 C  "C1'" . DT  C 3 5   ? 38.410 -11.278 1.179   1.00 17.37 ? 5   DT  P "C1'" 1 
ATOM   3776 N  N1    . DT  C 3 5   ? 37.996 -10.006 0.557   1.00 17.57 ? 5   DT  P N1    1 
ATOM   3777 C  C2    . DT  C 3 5   ? 38.833 -9.399  -0.348  1.00 16.82 ? 5   DT  P C2    1 
ATOM   3778 O  O2    . DT  C 3 5   ? 39.926 -9.841  -0.651  1.00 17.69 ? 5   DT  P O2    1 
ATOM   3779 N  N3    . DT  C 3 5   ? 38.344 -8.251  -0.896  1.00 17.12 ? 5   DT  P N3    1 
ATOM   3780 C  C4    . DT  C 3 5   ? 37.136 -7.647  -0.638  1.00 16.59 ? 5   DT  P C4    1 
ATOM   3781 O  O4    . DT  C 3 5   ? 36.800 -6.598  -1.192  1.00 16.98 ? 5   DT  P O4    1 
ATOM   3782 C  C5    . DT  C 3 5   ? 36.296 -8.328  0.329   1.00 17.14 ? 5   DT  P C5    1 
ATOM   3783 C  C7    . DT  C 3 5   ? 34.957 -7.767  0.697   1.00 24.18 ? 5   DT  P C7    1 
ATOM   3784 C  C6    . DT  C 3 5   ? 36.761 -9.466  0.875   1.00 18.31 ? 5   DT  P C6    1 
ATOM   3785 P  P     . DC  C 3 6   ? 40.415 -13.312 4.381   1.00 15.54 ? 6   DC  P P     1 
ATOM   3786 O  OP1   . DC  C 3 6   ? 41.112 -14.622 4.483   1.00 15.52 ? 6   DC  P OP1   1 
ATOM   3787 O  OP2   . DC  C 3 6   ? 39.712 -12.765 5.557   1.00 15.28 ? 6   DC  P OP2   1 
ATOM   3788 O  "O5'" . DC  C 3 6   ? 41.445 -12.188 3.929   1.00 15.33 ? 6   DC  P "O5'" 1 
ATOM   3789 C  "C5'" . DC  C 3 6   ? 42.342 -12.439 2.871   1.00 13.31 ? 6   DC  P "C5'" 1 
ATOM   3790 C  "C4'" . DC  C 3 6   ? 43.078 -11.173 2.531   1.00 17.33 ? 6   DC  P "C4'" 1 
ATOM   3791 O  "O4'" . DC  C 3 6   ? 42.177 -10.255 1.882   1.00 16.40 ? 6   DC  P "O4'" 1 
ATOM   3792 C  "C3'" . DC  C 3 6   ? 43.645 -10.424 3.743   1.00 13.30 ? 6   DC  P "C3'" 1 
ATOM   3793 O  "O3'" . DC  C 3 6   ? 45.071 -10.551 3.730   1.00 13.12 ? 6   DC  P "O3'" 1 
ATOM   3794 C  "C2'" . DC  C 3 6   ? 43.182 -8.961  3.537   1.00 16.60 ? 6   DC  P "C2'" 1 
ATOM   3795 C  "C1'" . DC  C 3 6   ? 42.648 -8.963  2.107   1.00 14.52 ? 6   DC  P "C1'" 1 
ATOM   3796 N  N1    . DC  C 3 6   ? 41.531 -8.008  1.894   1.00 12.06 ? 6   DC  P N1    1 
ATOM   3797 C  C2    . DC  C 3 6   ? 41.606 -7.083  0.849   1.00 14.96 ? 6   DC  P C2    1 
ATOM   3798 O  O2    . DC  C 3 6   ? 42.592 -7.091  0.110   1.00 15.65 ? 6   DC  P O2    1 
ATOM   3799 N  N3    . DC  C 3 6   ? 40.581 -6.201  0.678   1.00 14.86 ? 6   DC  P N3    1 
ATOM   3800 C  C4    . DC  C 3 6   ? 39.528 -6.240  1.495   1.00 17.42 ? 6   DC  P C4    1 
ATOM   3801 N  N4    . DC  C 3 6   ? 38.543 -5.358  1.289   1.00 18.87 ? 6   DC  P N4    1 
ATOM   3802 C  C5    . DC  C 3 6   ? 39.435 -7.177  2.560   1.00 16.95 ? 6   DC  P C5    1 
ATOM   3803 C  C6    . DC  C 3 6   ? 40.449 -8.037  2.724   1.00 15.91 ? 6   DC  P C6    1 
ATOM   3804 P  P     . DA  C 3 7   ? 45.989 -9.788  4.798   1.00 13.92 ? 7   DA  P P     1 
ATOM   3805 O  OP1   . DA  C 3 7   ? 47.230 -10.598 4.931   1.00 14.74 ? 7   DA  P OP1   1 
ATOM   3806 O  OP2   . DA  C 3 7   ? 45.187 -9.494  6.005   1.00 15.98 ? 7   DA  P OP2   1 
ATOM   3807 O  "O5'" . DA  C 3 7   ? 46.289 -8.393  4.106   1.00 14.29 ? 7   DA  P "O5'" 1 
ATOM   3808 C  "C5'" . DA  C 3 7   ? 46.838 -8.365  2.810   1.00 14.84 ? 7   DA  P "C5'" 1 
ATOM   3809 C  "C4'" . DA  C 3 7   ? 46.719 -6.974  2.220   1.00 16.85 ? 7   DA  P "C4'" 1 
ATOM   3810 O  "O4'" . DA  C 3 7   ? 45.357 -6.689  1.878   1.00 16.08 ? 7   DA  P "O4'" 1 
ATOM   3811 C  "C3'" . DA  C 3 7   ? 47.027 -5.849  3.171   1.00 18.97 ? 7   DA  P "C3'" 1 
ATOM   3812 O  "O3'" . DA  C 3 7   ? 48.430 -5.777  3.461   1.00 24.41 ? 7   DA  P "O3'" 1 
ATOM   3813 C  "C2'" . DA  C 3 7   ? 46.466 -4.653  2.414   1.00 18.90 ? 7   DA  P "C2'" 1 
ATOM   3814 C  "C1'" . DA  C 3 7   ? 45.256 -5.277  1.725   1.00 18.94 ? 7   DA  P "C1'" 1 
ATOM   3815 N  N9    . DA  C 3 7   ? 43.974 -4.818  2.237   1.00 14.85 ? 7   DA  P N9    1 
ATOM   3816 C  C8    . DA  C 3 7   ? 43.185 -5.405  3.192   1.00 17.96 ? 7   DA  P C8    1 
ATOM   3817 N  N7    . DA  C 3 7   ? 42.055 -4.759  3.414   1.00 17.01 ? 7   DA  P N7    1 
ATOM   3818 C  C5    . DA  C 3 7   ? 42.119 -3.675  2.540   1.00 13.67 ? 7   DA  P C5    1 
ATOM   3819 C  C6    . DA  C 3 7   ? 41.244 -2.601  2.294   1.00 17.70 ? 7   DA  P C6    1 
ATOM   3820 N  N6    . DA  C 3 7   ? 40.076 -2.455  2.916   1.00 20.24 ? 7   DA  P N6    1 
ATOM   3821 N  N1    . DA  C 3 7   ? 41.617 -1.689  1.368   1.00 14.96 ? 7   DA  P N1    1 
ATOM   3822 C  C2    . DA  C 3 7   ? 42.791 -1.848  0.741   1.00 16.79 ? 7   DA  P C2    1 
ATOM   3823 N  N3    . DA  C 3 7   ? 43.703 -2.809  0.903   1.00 16.19 ? 7   DA  P N3    1 
ATOM   3824 C  C4    . DA  C 3 7   ? 43.296 -3.696  1.821   1.00 15.41 ? 7   DA  P C4    1 
ATOM   3825 P  P     A DT  C 3 8   ? 49.539 -5.231  2.443   0.31 23.80 ? 8   DT  P P     1 
ATOM   3826 P  P     B DT  C 3 8   ? 49.039 -4.532  4.283   0.69 17.74 ? 8   DT  P P     1 
ATOM   3827 O  OP1   A DT  C 3 8   ? 49.233 -5.612  1.050   0.31 24.67 ? 8   DT  P OP1   1 
ATOM   3828 O  OP1   B DT  C 3 8   ? 50.487 -4.811  4.413   0.69 19.03 ? 8   DT  P OP1   1 
ATOM   3829 O  OP2   A DT  C 3 8   ? 50.834 -5.635  3.033   0.31 21.06 ? 8   DT  P OP2   1 
ATOM   3830 O  OP2   B DT  C 3 8   ? 48.199 -4.363  5.495   0.69 18.29 ? 8   DT  P OP2   1 
ATOM   3831 O  "O5'" A DT  C 3 8   ? 49.427 -3.662  2.635   0.31 19.13 ? 8   DT  P "O5'" 1 
ATOM   3832 O  "O5'" B DT  C 3 8   ? 48.804 -3.208  3.387   0.69 18.72 ? 8   DT  P "O5'" 1 
ATOM   3833 C  "C5'" A DT  C 3 8   ? 49.769 -2.862  1.600   0.31 16.80 ? 8   DT  P "C5'" 1 
ATOM   3834 C  "C5'" B DT  C 3 8   ? 49.516 -2.914  2.119   0.69 18.43 ? 8   DT  P "C5'" 1 
ATOM   3835 C  "C4'" . DT  C 3 8   ? 49.237 -1.455  1.768   1.00 15.05 ? 8   DT  P "C4'" 1 
ATOM   3836 O  "O4'" . DT  C 3 8   ? 47.795 -1.347  1.827   1.00 15.26 ? 8   DT  P "O4'" 1 
ATOM   3837 C  "C3'" . DT  C 3 8   ? 49.809 -0.549  2.859   1.00 12.30 ? 8   DT  P "C3'" 1 
ATOM   3838 O  "O3'" . DT  C 3 8   ? 50.562 0.522   2.272   1.00 12.07 ? 8   DT  P "O3'" 1 
ATOM   3839 C  "C2'" . DT  C 3 8   ? 48.566 -0.040  3.613   1.00 15.54 ? 8   DT  P "C2'" 1 
ATOM   3840 C  "C1'" . DT  C 3 8   ? 47.452 -0.213  2.588   1.00 15.03 ? 8   DT  P "C1'" 1 
ATOM   3841 N  N1    . DT  C 3 8   ? 46.106 -0.431  3.201   1.00 13.72 ? 8   DT  P N1    1 
ATOM   3842 C  C2    . DT  C 3 8   ? 45.095 0.459   2.925   1.00 15.01 ? 8   DT  P C2    1 
ATOM   3843 O  O2    . DT  C 3 8   ? 45.236 1.423   2.196   1.00 17.70 ? 8   DT  P O2    1 
ATOM   3844 N  N3    . DT  C 3 8   ? 43.900 0.180   3.536   1.00 15.13 ? 8   DT  P N3    1 
ATOM   3845 C  C4    . DT  C 3 8   ? 43.621 -0.872  4.373   1.00 16.12 ? 8   DT  P C4    1 
ATOM   3846 O  O4    . DT  C 3 8   ? 42.510 -1.032  4.877   1.00 16.84 ? 8   DT  P O4    1 
ATOM   3847 C  C5    . DT  C 3 8   ? 44.723 -1.767  4.628   1.00 14.99 ? 8   DT  P C5    1 
ATOM   3848 C  C7    . DT  C 3 8   ? 44.531 -2.956  5.527   1.00 18.55 ? 8   DT  P C7    1 
ATOM   3849 C  C6    . DT  C 3 8   ? 45.901 -1.508  4.033   1.00 15.72 ? 8   DT  P C6    1 
HETATM 3850 MN MN    . MN  D 4 .   ? 52.877 0.358   2.159   1.00 11.12 ? 501 MN  A MN    1 
HETATM 3851 CA CA    A CA  E 5 .   ? 54.965 2.724   3.905   0.10 10.41 ? 502 CA  A CA    1 
HETATM 3852 MN MN    B MN  F 4 .   ? 54.960 2.728   3.901   0.90 10.33 ? 503 MN  A MN    1 
HETATM 3853 C  C1    . GOL G 6 .   ? 60.284 -24.863 12.233  1.00 12.76 ? 504 GOL A C1    1 
HETATM 3854 O  O1    . GOL G 6 .   ? 58.898 -24.983 12.287  1.00 16.14 ? 504 GOL A O1    1 
HETATM 3855 C  C2    . GOL G 6 .   ? 60.550 -24.475 10.780  1.00 21.57 ? 504 GOL A C2    1 
HETATM 3856 O  O2    . GOL G 6 .   ? 60.656 -23.094 10.584  1.00 14.39 ? 504 GOL A O2    1 
HETATM 3857 C  C3    . GOL G 6 .   ? 61.268 -25.448 9.840   1.00 25.05 ? 504 GOL A C3    1 
HETATM 3858 O  O3    . GOL G 6 .   ? 61.539 -24.872 8.570   1.00 15.78 ? 504 GOL A O3    1 
HETATM 3859 C  C1    . GOL H 6 .   ? 54.423 28.157  4.675   1.00 26.47 ? 505 GOL A C1    1 
HETATM 3860 O  O1    . GOL H 6 .   ? 53.107 27.854  4.243   1.00 24.35 ? 505 GOL A O1    1 
HETATM 3861 C  C2    . GOL H 6 .   ? 54.919 27.155  5.721   1.00 34.16 ? 505 GOL A C2    1 
HETATM 3862 O  O2    . GOL H 6 .   ? 54.391 25.870  5.471   1.00 37.93 ? 505 GOL A O2    1 
HETATM 3863 C  C3    . GOL H 6 .   ? 56.445 27.111  5.697   1.00 29.51 ? 505 GOL A C3    1 
HETATM 3864 O  O3    . GOL H 6 .   ? 56.987 26.137  6.578   1.00 20.62 ? 505 GOL A O3    1 
HETATM 3865 P  PG    . DTP I 7 .   ? 55.376 2.697   7.310   1.00 11.66 ? 506 DTP A PG    1 
HETATM 3866 O  O1G   . DTP I 7 .   ? 55.087 1.788   8.500   1.00 11.11 ? 506 DTP A O1G   1 
HETATM 3867 O  O2G   . DTP I 7 .   ? 56.713 3.376   7.437   1.00 12.35 ? 506 DTP A O2G   1 
HETATM 3868 O  O3G   . DTP I 7 .   ? 55.262 1.950   6.011   1.00 12.02 ? 506 DTP A O3G   1 
HETATM 3869 P  PB    . DTP I 7 .   ? 53.224 4.189   6.202   1.00 10.97 ? 506 DTP A PB    1 
HETATM 3870 O  O1B   . DTP I 7 .   ? 53.938 4.420   4.880   1.00 9.91  ? 506 DTP A O1B   1 
HETATM 3871 O  O2B   . DTP I 7 .   ? 52.416 5.387   6.644   1.00 10.43 ? 506 DTP A O2B   1 
HETATM 3872 O  O3B   . DTP I 7 .   ? 54.276 3.850   7.365   1.00 9.13  ? 506 DTP A O3B   1 
HETATM 3873 P  PA    . DTP I 7 .   ? 51.730 2.109   4.888   1.00 12.28 ? 506 DTP A PA    1 
HETATM 3874 O  O1A   . DTP I 7 .   ? 50.928 0.966   5.479   1.00 13.62 ? 506 DTP A O1A   1 
HETATM 3875 O  O2A   . DTP I 7 .   ? 52.847 1.640   3.996   1.00 11.43 ? 506 DTP A O2A   1 
HETATM 3876 O  O3A   . DTP I 7 .   ? 52.249 2.939   6.148   1.00 10.38 ? 506 DTP A O3A   1 
HETATM 3877 O  "O5'" . DTP I 7 .   ? 50.727 3.044   4.110   1.00 12.05 ? 506 DTP A "O5'" 1 
HETATM 3878 C  "C5'" . DTP I 7 .   ? 51.151 4.019   3.192   1.00 11.45 ? 506 DTP A "C5'" 1 
HETATM 3879 C  "C4'" . DTP I 7 .   ? 50.211 5.229   3.205   1.00 10.75 ? 506 DTP A "C4'" 1 
HETATM 3880 O  "O4'" . DTP I 7 .   ? 48.937 4.781   2.800   1.00 12.18 ? 506 DTP A "O4'" 1 
HETATM 3881 C  "C3'" . DTP I 7 .   ? 50.062 5.816   4.529   1.00 9.67  ? 506 DTP A "C3'" 1 
HETATM 3882 O  "O3'" . DTP I 7 .   ? 51.025 6.857   4.757   1.00 10.93 ? 506 DTP A "O3'" 1 
HETATM 3883 C  "C2'" . DTP I 7 .   ? 48.695 6.355   4.540   1.00 11.50 ? 506 DTP A "C2'" 1 
HETATM 3884 C  "C1'" . DTP I 7 .   ? 47.958 5.433   3.623   1.00 12.97 ? 506 DTP A "C1'" 1 
HETATM 3885 N  N9    . DTP I 7 .   ? 47.209 4.447   4.328   1.00 11.40 ? 506 DTP A N9    1 
HETATM 3886 C  C8    . DTP I 7 .   ? 47.663 3.264   4.816   1.00 12.32 ? 506 DTP A C8    1 
HETATM 3887 N  N7    . DTP I 7 .   ? 46.684 2.597   5.423   1.00 14.09 ? 506 DTP A N7    1 
HETATM 3888 C  C5    . DTP I 7 .   ? 45.557 3.317   5.315   1.00 13.31 ? 506 DTP A C5    1 
HETATM 3889 C  C6    . DTP I 7 .   ? 44.244 3.152   5.741   1.00 15.39 ? 506 DTP A C6    1 
HETATM 3890 N  N6    . DTP I 7 .   ? 43.879 1.976   6.455   1.00 16.80 ? 506 DTP A N6    1 
HETATM 3891 N  N1    . DTP I 7 .   ? 43.344 4.096   5.477   1.00 12.84 ? 506 DTP A N1    1 
HETATM 3892 C  C2    . DTP I 7 .   ? 43.649 5.227   4.807   1.00 12.24 ? 506 DTP A C2    1 
HETATM 3893 N  N3    . DTP I 7 .   ? 44.926 5.432   4.372   1.00 12.71 ? 506 DTP A N3    1 
HETATM 3894 C  C4    . DTP I 7 .   ? 45.870 4.502   4.624   1.00 11.38 ? 506 DTP A C4    1 
HETATM 3895 O  O     . HOH J 8 .   ? 68.410 -15.796 -7.695  1.00 22.96 ? 601 HOH A O     1 
HETATM 3896 O  O     . HOH J 8 .   ? 80.530 -15.844 7.586   1.00 33.27 ? 602 HOH A O     1 
HETATM 3897 O  O     . HOH J 8 .   ? 57.823 12.033  -12.236 1.00 31.27 ? 603 HOH A O     1 
HETATM 3898 O  O     . HOH J 8 .   ? 43.910 -33.109 5.695   1.00 32.36 ? 604 HOH A O     1 
HETATM 3899 O  O     . HOH J 8 .   ? 45.999 20.599  11.406  1.00 28.24 ? 605 HOH A O     1 
HETATM 3900 O  O     . HOH J 8 .   ? 60.369 6.144   -15.552 1.00 25.15 ? 606 HOH A O     1 
HETATM 3901 O  O     . HOH J 8 .   ? 48.412 -36.795 2.525   1.00 21.23 ? 607 HOH A O     1 
HETATM 3902 O  O     . HOH J 8 .   ? 53.155 24.237  4.092   1.00 27.42 ? 608 HOH A O     1 
HETATM 3903 O  O     . HOH J 8 .   ? 34.993 5.467   2.029   1.00 17.57 ? 609 HOH A O     1 
HETATM 3904 O  O     . HOH J 8 .   ? 24.503 -8.274  -0.751  1.00 46.72 ? 610 HOH A O     1 
HETATM 3905 O  O     . HOH J 8 .   ? 60.979 -15.791 13.635  1.00 27.26 ? 611 HOH A O     1 
HETATM 3906 O  O     . HOH J 8 .   ? 70.421 0.548   11.436  1.00 27.89 ? 612 HOH A O     1 
HETATM 3907 O  O     . HOH J 8 .   ? 66.113 -2.490  12.721  1.00 28.00 ? 613 HOH A O     1 
HETATM 3908 O  O     . HOH J 8 .   ? 58.526 -12.080 -11.370 1.00 13.23 ? 614 HOH A O     1 
HETATM 3909 O  O     . HOH J 8 .   ? 30.905 1.137   3.378   1.00 45.30 ? 615 HOH A O     1 
HETATM 3910 O  O     . HOH J 8 .   ? 50.090 -27.538 18.497  1.00 27.88 ? 616 HOH A O     1 
HETATM 3911 O  O     . HOH J 8 .   ? 48.595 -5.926  -10.722 1.00 35.96 ? 617 HOH A O     1 
HETATM 3912 O  O     . HOH J 8 .   ? 40.942 13.942  -6.298  1.00 32.74 ? 618 HOH A O     1 
HETATM 3913 O  O     . HOH J 8 .   ? 65.610 -6.556  -13.788 1.00 18.32 ? 619 HOH A O     1 
HETATM 3914 O  O     . HOH J 8 .   ? 69.712 -12.924 -11.468 1.00 26.56 ? 620 HOH A O     1 
HETATM 3915 O  O     . HOH J 8 .   ? 37.288 15.188  -20.328 1.00 33.46 ? 621 HOH A O     1 
HETATM 3916 O  O     . HOH J 8 .   ? 65.288 -34.711 -5.953  1.00 27.53 ? 622 HOH A O     1 
HETATM 3917 O  O     . HOH J 8 .   ? 50.676 17.555  -5.757  1.00 25.91 ? 623 HOH A O     1 
HETATM 3918 O  O     . HOH J 8 .   ? 39.943 7.088   13.482  1.00 29.61 ? 624 HOH A O     1 
HETATM 3919 O  O     . HOH J 8 .   ? 45.539 1.972   18.157  1.00 32.29 ? 625 HOH A O     1 
HETATM 3920 O  O     . HOH J 8 .   ? 53.335 -28.194 15.202  1.00 16.99 ? 626 HOH A O     1 
HETATM 3921 O  O     . HOH J 8 .   ? 42.663 13.035  -23.737 1.00 27.45 ? 627 HOH A O     1 
HETATM 3922 O  O     . HOH J 8 .   ? 45.636 8.228   -13.117 1.00 33.21 ? 628 HOH A O     1 
HETATM 3923 O  O     . HOH J 8 .   ? 41.318 16.940  -14.761 1.00 20.71 ? 629 HOH A O     1 
HETATM 3924 O  O     . HOH J 8 .   ? 81.428 -10.904 -8.176  1.00 41.05 ? 630 HOH A O     1 
HETATM 3925 O  O     . HOH J 8 .   ? 48.013 10.867  -13.789 1.00 32.96 ? 631 HOH A O     1 
HETATM 3926 O  O     . HOH J 8 .   ? 59.195 27.150  7.559   1.00 21.67 ? 632 HOH A O     1 
HETATM 3927 O  O     . HOH J 8 .   ? 53.983 15.249  -6.778  1.00 17.23 ? 633 HOH A O     1 
HETATM 3928 O  O     . HOH J 8 .   ? 67.314 -8.339  9.970   1.00 21.38 ? 634 HOH A O     1 
HETATM 3929 O  O     . HOH J 8 .   ? 52.334 20.189  4.962   1.00 17.34 ? 635 HOH A O     1 
HETATM 3930 O  O     . HOH J 8 .   ? 36.295 -0.725  -24.752 1.00 41.38 ? 636 HOH A O     1 
HETATM 3931 O  O     . HOH J 8 .   ? 65.563 5.788   2.239   1.00 19.94 ? 637 HOH A O     1 
HETATM 3932 O  O     . HOH J 8 .   ? 43.064 -25.383 17.329  1.00 36.20 ? 638 HOH A O     1 
HETATM 3933 O  O     . HOH J 8 .   ? 57.718 -7.402  8.001   1.00 18.06 ? 639 HOH A O     1 
HETATM 3934 O  O     . HOH J 8 .   ? 33.948 3.002   2.943   1.00 28.01 ? 640 HOH A O     1 
HETATM 3935 O  O     . HOH J 8 .   ? 52.735 1.284   9.585   1.00 17.22 ? 641 HOH A O     1 
HETATM 3936 O  O     . HOH J 8 .   ? 37.202 18.573  16.705  1.00 33.29 ? 642 HOH A O     1 
HETATM 3937 O  O     . HOH J 8 .   ? 62.764 -17.060 -7.165  1.00 24.33 ? 643 HOH A O     1 
HETATM 3938 O  O     . HOH J 8 .   ? 57.854 -23.463 14.179  1.00 9.04  ? 644 HOH A O     1 
HETATM 3939 O  O     . HOH J 8 .   ? 76.366 2.727   6.689   1.00 27.01 ? 645 HOH A O     1 
HETATM 3940 O  O     . HOH J 8 .   ? 72.084 -3.931  -13.992 1.00 25.18 ? 646 HOH A O     1 
HETATM 3941 O  O     . HOH J 8 .   ? 53.738 5.996   -12.316 1.00 20.52 ? 647 HOH A O     1 
HETATM 3942 O  O     . HOH J 8 .   ? 73.118 2.038   8.048   1.00 26.55 ? 648 HOH A O     1 
HETATM 3943 O  O     . HOH J 8 .   ? 56.396 -13.973 -5.774  1.00 11.57 ? 649 HOH A O     1 
HETATM 3944 O  O     . HOH J 8 .   ? 52.866 -19.739 22.099  1.00 25.34 ? 650 HOH A O     1 
HETATM 3945 O  O     . HOH J 8 .   ? 33.158 10.523  5.488   1.00 22.36 ? 651 HOH A O     1 
HETATM 3946 O  O     . HOH J 8 .   ? 58.373 -18.033 19.717  1.00 20.79 ? 652 HOH A O     1 
HETATM 3947 O  O     . HOH J 8 .   ? 57.287 -16.434 -11.328 1.00 21.00 ? 653 HOH A O     1 
HETATM 3948 O  O     . HOH J 8 .   ? 63.165 12.777  -10.757 1.00 24.47 ? 654 HOH A O     1 
HETATM 3949 O  O     . HOH J 8 .   ? 48.318 -33.333 -3.620  1.00 28.04 ? 655 HOH A O     1 
HETATM 3950 O  O     . HOH J 8 .   ? 72.318 2.023   12.033  1.00 31.51 ? 656 HOH A O     1 
HETATM 3951 O  O     . HOH J 8 .   ? 38.978 4.802   15.714  1.00 39.58 ? 657 HOH A O     1 
HETATM 3952 O  O     . HOH J 8 .   ? 64.055 -3.385  6.083   1.00 12.09 ? 658 HOH A O     1 
HETATM 3953 O  O     . HOH J 8 .   ? 22.206 -4.440  3.426   1.00 49.17 ? 659 HOH A O     1 
HETATM 3954 O  O     . HOH J 8 .   ? 83.634 -8.022  0.616   1.00 35.20 ? 660 HOH A O     1 
HETATM 3955 O  O     . HOH J 8 .   ? 60.626 -28.427 8.361   1.00 27.46 ? 661 HOH A O     1 
HETATM 3956 O  O     . HOH J 8 .   ? 49.742 -9.383  -8.364  1.00 24.94 ? 662 HOH A O     1 
HETATM 3957 O  O     . HOH J 8 .   ? 41.088 7.705   -18.560 1.00 15.62 ? 663 HOH A O     1 
HETATM 3958 O  O     . HOH J 8 .   ? 52.006 5.782   9.261   1.00 13.08 ? 664 HOH A O     1 
HETATM 3959 O  O     . HOH J 8 .   ? 27.779 6.752   -16.945 1.00 23.54 ? 665 HOH A O     1 
HETATM 3960 O  O     . HOH J 8 .   ? 76.679 1.049   -5.782  1.00 30.70 ? 666 HOH A O     1 
HETATM 3961 O  O     . HOH J 8 .   ? 62.559 14.788  -9.089  1.00 12.39 ? 667 HOH A O     1 
HETATM 3962 O  O     . HOH J 8 .   ? 30.946 1.717   -22.107 1.00 26.70 ? 668 HOH A O     1 
HETATM 3963 O  O     . HOH J 8 .   ? 41.666 -30.506 -6.407  1.00 21.87 ? 669 HOH A O     1 
HETATM 3964 O  O     . HOH J 8 .   ? 48.693 -0.116  9.626   1.00 37.49 ? 670 HOH A O     1 
HETATM 3965 O  O     . HOH J 8 .   ? 50.004 -15.849 -8.848  1.00 31.70 ? 671 HOH A O     1 
HETATM 3966 O  O     . HOH J 8 .   ? 42.169 -19.024 14.773  1.00 23.75 ? 672 HOH A O     1 
HETATM 3967 O  O     . HOH J 8 .   ? 71.094 3.561   -0.295  1.00 15.09 ? 673 HOH A O     1 
HETATM 3968 O  O     . HOH J 8 .   ? 40.696 11.348  -3.517  1.00 14.49 ? 674 HOH A O     1 
HETATM 3969 O  O     . HOH J 8 .   ? 47.245 -0.423  -8.445  1.00 27.05 ? 675 HOH A O     1 
HETATM 3970 O  O     . HOH J 8 .   ? 34.311 5.967   -21.893 1.00 33.68 ? 676 HOH A O     1 
HETATM 3971 O  O     . HOH J 8 .   ? 37.016 16.026  -4.262  1.00 20.50 ? 677 HOH A O     1 
HETATM 3972 O  O     . HOH J 8 .   ? 67.380 -20.731 8.772   1.00 11.13 ? 678 HOH A O     1 
HETATM 3973 O  O     . HOH J 8 .   ? 78.074 -0.980  5.384   1.00 18.78 ? 679 HOH A O     1 
HETATM 3974 O  O     . HOH J 8 .   ? 59.898 14.017  -8.709  1.00 17.95 ? 680 HOH A O     1 
HETATM 3975 O  O     . HOH J 8 .   ? 69.278 8.091   3.932   1.00 28.95 ? 681 HOH A O     1 
HETATM 3976 O  O     . HOH J 8 .   ? 29.718 3.743   6.381   1.00 36.04 ? 682 HOH A O     1 
HETATM 3977 O  O     . HOH J 8 .   ? 53.780 -28.493 4.126   1.00 12.96 ? 683 HOH A O     1 
HETATM 3978 O  O     . HOH J 8 .   ? 45.530 15.869  -1.540  1.00 14.81 ? 684 HOH A O     1 
HETATM 3979 O  O     . HOH J 8 .   ? 54.608 -0.674  5.832   1.00 16.99 ? 685 HOH A O     1 
HETATM 3980 O  O     . HOH J 8 .   ? 64.408 -24.475 -7.916  1.00 38.01 ? 686 HOH A O     1 
HETATM 3981 O  O     . HOH J 8 .   ? 62.427 7.478   7.091   1.00 13.55 ? 687 HOH A O     1 
HETATM 3982 O  O     . HOH J 8 .   ? 20.403 17.606  -5.151  1.00 36.35 ? 688 HOH A O     1 
HETATM 3983 O  O     . HOH J 8 .   ? 52.300 15.768  -4.680  1.00 14.19 ? 689 HOH A O     1 
HETATM 3984 O  O     . HOH J 8 .   ? 41.164 6.753   19.118  1.00 18.71 ? 690 HOH A O     1 
HETATM 3985 O  O     . HOH J 8 .   ? 51.565 5.142   -10.858 1.00 19.11 ? 691 HOH A O     1 
HETATM 3986 O  O     . HOH J 8 .   ? 40.567 16.653  6.007   1.00 24.10 ? 692 HOH A O     1 
HETATM 3987 O  O     . HOH J 8 .   ? 75.259 0.435   -3.695  1.00 28.98 ? 693 HOH A O     1 
HETATM 3988 O  O     . HOH J 8 .   ? 53.481 19.314  -1.481  1.00 18.99 ? 694 HOH A O     1 
HETATM 3989 O  O     . HOH J 8 .   ? 52.685 3.703   17.869  1.00 26.51 ? 695 HOH A O     1 
HETATM 3990 O  O     . HOH J 8 .   ? 50.256 -14.808 -3.310  1.00 38.52 ? 696 HOH A O     1 
HETATM 3991 O  O     . HOH J 8 .   ? 47.587 15.984  -17.908 1.00 30.57 ? 697 HOH A O     1 
HETATM 3992 O  O     . HOH J 8 .   ? 21.642 13.514  6.801   1.00 35.32 ? 698 HOH A O     1 
HETATM 3993 O  O     . HOH J 8 .   ? 45.473 17.931  -3.505  1.00 25.01 ? 699 HOH A O     1 
HETATM 3994 O  O     . HOH J 8 .   ? 43.355 -33.228 -0.503  1.00 16.02 ? 700 HOH A O     1 
HETATM 3995 O  O     . HOH J 8 .   ? 35.904 10.843  0.790   1.00 19.34 ? 701 HOH A O     1 
HETATM 3996 O  O     . HOH J 8 .   ? 61.226 20.939  11.842  1.00 24.81 ? 702 HOH A O     1 
HETATM 3997 O  O     . HOH J 8 .   ? 70.562 -17.235 12.449  1.00 26.66 ? 703 HOH A O     1 
HETATM 3998 O  O     . HOH J 8 .   ? 55.500 17.477  -0.640  1.00 12.73 ? 704 HOH A O     1 
HETATM 3999 O  O     . HOH J 8 .   ? 70.725 -19.006 1.436   1.00 14.83 ? 705 HOH A O     1 
HETATM 4000 O  O     . HOH J 8 .   ? 41.522 15.835  -22.802 1.00 22.17 ? 706 HOH A O     1 
HETATM 4001 O  O     . HOH J 8 .   ? 55.495 -1.377  -14.728 1.00 28.02 ? 707 HOH A O     1 
HETATM 4002 O  O     . HOH J 8 .   ? 63.286 -7.331  12.875  1.00 27.43 ? 708 HOH A O     1 
HETATM 4003 O  O     . HOH J 8 .   ? 59.949 11.485  -10.273 1.00 18.08 ? 709 HOH A O     1 
HETATM 4004 O  O     . HOH J 8 .   ? 63.001 -26.574 7.003   1.00 18.03 ? 710 HOH A O     1 
HETATM 4005 O  O     . HOH J 8 .   ? 47.103 -22.703 17.368  1.00 24.69 ? 711 HOH A O     1 
HETATM 4006 O  O     . HOH J 8 .   ? 50.166 -17.215 15.433  1.00 16.70 ? 712 HOH A O     1 
HETATM 4007 O  O     . HOH J 8 .   ? 47.875 -27.219 -7.274  1.00 28.03 ? 713 HOH A O     1 
HETATM 4008 O  O     . HOH J 8 .   ? 50.439 -13.195 -0.927  1.00 29.76 ? 714 HOH A O     1 
HETATM 4009 O  O     . HOH J 8 .   ? 48.797 -9.523  10.380  1.00 24.34 ? 715 HOH A O     1 
HETATM 4010 O  O     . HOH J 8 .   ? 67.059 -16.651 9.699   1.00 13.78 ? 716 HOH A O     1 
HETATM 4011 O  O     . HOH J 8 .   ? 51.486 -35.325 7.756   1.00 33.38 ? 717 HOH A O     1 
HETATM 4012 O  O     . HOH J 8 .   ? 59.807 13.073  11.358  1.00 19.60 ? 718 HOH A O     1 
HETATM 4013 O  O     . HOH J 8 .   ? 77.724 3.179   -1.347  1.00 39.84 ? 719 HOH A O     1 
HETATM 4014 O  O     . HOH J 8 .   ? 68.807 16.309  -3.990  1.00 14.25 ? 720 HOH A O     1 
HETATM 4015 O  O     . HOH J 8 .   ? 65.200 -9.146  12.377  1.00 35.37 ? 721 HOH A O     1 
HETATM 4016 O  O     . HOH J 8 .   ? 60.525 -0.258  -16.113 1.00 34.56 ? 722 HOH A O     1 
HETATM 4017 O  O     . HOH J 8 .   ? 44.064 10.966  -12.400 1.00 19.40 ? 723 HOH A O     1 
HETATM 4018 O  O     . HOH J 8 .   ? 56.392 1.222   13.166  1.00 26.57 ? 724 HOH A O     1 
HETATM 4019 O  O     . HOH J 8 .   ? 53.667 13.499  -9.902  1.00 18.07 ? 725 HOH A O     1 
HETATM 4020 O  O     . HOH J 8 .   ? 60.789 -23.464 6.312   1.00 17.28 ? 726 HOH A O     1 
HETATM 4021 O  O     . HOH J 8 .   ? 48.919 2.720   21.176  1.00 24.09 ? 727 HOH A O     1 
HETATM 4022 O  O     . HOH J 8 .   ? 43.788 -14.478 5.627   1.00 12.86 ? 728 HOH A O     1 
HETATM 4023 O  O     . HOH J 8 .   ? 72.191 -7.661  11.700  1.00 17.02 ? 729 HOH A O     1 
HETATM 4024 O  O     . HOH J 8 .   ? 58.892 4.686   22.984  1.00 21.99 ? 730 HOH A O     1 
HETATM 4025 O  O     . HOH J 8 .   ? 69.104 -17.581 -1.257  1.00 12.44 ? 731 HOH A O     1 
HETATM 4026 O  O     . HOH J 8 .   ? 40.325 9.021   26.890  1.00 21.60 ? 732 HOH A O     1 
HETATM 4027 O  O     . HOH J 8 .   ? 69.612 10.034  -8.450  1.00 25.18 ? 733 HOH A O     1 
HETATM 4028 O  O     . HOH J 8 .   ? 62.730 9.505   -13.464 1.00 30.32 ? 734 HOH A O     1 
HETATM 4029 O  O     . HOH J 8 .   ? 46.846 16.380  25.567  1.00 23.43 ? 735 HOH A O     1 
HETATM 4030 O  O     . HOH J 8 .   ? 49.456 17.581  -11.172 1.00 38.02 ? 736 HOH A O     1 
HETATM 4031 O  O     . HOH J 8 .   ? 56.132 18.780  18.246  1.00 19.73 ? 737 HOH A O     1 
HETATM 4032 O  O     . HOH J 8 .   ? 54.206 -9.455  5.326   1.00 17.27 ? 738 HOH A O     1 
HETATM 4033 O  O     . HOH J 8 .   ? 59.347 4.906   16.750  1.00 21.52 ? 739 HOH A O     1 
HETATM 4034 O  O     . HOH J 8 .   ? 56.253 -2.886  4.164   1.00 29.02 ? 740 HOH A O     1 
HETATM 4035 O  O     . HOH J 8 .   ? 51.228 5.480   -8.224  1.00 16.93 ? 741 HOH A O     1 
HETATM 4036 O  O     . HOH J 8 .   ? 53.544 7.384   -14.730 1.00 24.20 ? 742 HOH A O     1 
HETATM 4037 O  O     . HOH J 8 .   ? 20.223 10.056  8.923   1.00 36.81 ? 743 HOH A O     1 
HETATM 4038 O  O     . HOH J 8 .   ? 42.770 15.667  23.601  1.00 20.19 ? 744 HOH A O     1 
HETATM 4039 O  O     . HOH J 8 .   ? 52.531 -5.343  -0.845  1.00 19.58 ? 745 HOH A O     1 
HETATM 4040 O  O     . HOH J 8 .   ? 61.542 -31.677 -10.455 1.00 36.00 ? 746 HOH A O     1 
HETATM 4041 O  O     . HOH J 8 .   ? 44.370 10.106  -24.514 1.00 29.98 ? 747 HOH A O     1 
HETATM 4042 O  O     . HOH J 8 .   ? 48.314 19.762  4.455   1.00 26.39 ? 748 HOH A O     1 
HETATM 4043 O  O     . HOH J 8 .   ? 78.961 3.523   1.962   1.00 35.02 ? 749 HOH A O     1 
HETATM 4044 O  O     . HOH J 8 .   ? 51.473 6.307   -18.931 1.00 27.02 ? 750 HOH A O     1 
HETATM 4045 O  O     . HOH J 8 .   ? 67.458 -6.472  12.815  1.00 22.90 ? 751 HOH A O     1 
HETATM 4046 O  O     . HOH J 8 .   ? 34.862 17.578  -12.720 1.00 27.90 ? 752 HOH A O     1 
HETATM 4047 O  O     . HOH J 8 .   ? 64.545 6.584   -0.461  1.00 18.02 ? 753 HOH A O     1 
HETATM 4048 O  O     . HOH J 8 .   ? 53.034 -26.413 -3.950  1.00 22.72 ? 754 HOH A O     1 
HETATM 4049 O  O     . HOH J 8 .   ? 59.800 10.486  19.859  1.00 20.84 ? 755 HOH A O     1 
HETATM 4050 O  O     . HOH J 8 .   ? 51.342 8.783   -15.526 1.00 24.46 ? 756 HOH A O     1 
HETATM 4051 O  O     . HOH J 8 .   ? 70.655 -16.009 7.730   1.00 16.20 ? 757 HOH A O     1 
HETATM 4052 O  O     . HOH J 8 .   ? 39.511 -2.187  -14.393 1.00 26.19 ? 758 HOH A O     1 
HETATM 4053 O  O     . HOH J 8 .   ? 63.459 -17.139 15.077  1.00 26.63 ? 759 HOH A O     1 
HETATM 4054 O  O     . HOH J 8 .   ? 77.947 -16.643 10.781  1.00 39.07 ? 760 HOH A O     1 
HETATM 4055 O  O     . HOH J 8 .   ? 51.369 -33.671 10.562  1.00 34.90 ? 761 HOH A O     1 
HETATM 4056 O  O     . HOH J 8 .   ? 49.955 2.933   12.841  1.00 23.57 ? 762 HOH A O     1 
HETATM 4057 O  O     . HOH J 8 .   ? 33.545 7.620   17.351  1.00 34.17 ? 763 HOH A O     1 
HETATM 4058 O  O     . HOH J 8 .   ? 55.430 2.781   20.791  1.00 26.27 ? 764 HOH A O     1 
HETATM 4059 O  O     . HOH J 8 .   ? 66.603 4.210   10.635  1.00 29.11 ? 765 HOH A O     1 
HETATM 4060 O  O     . HOH J 8 .   ? 44.448 7.294   2.341   1.00 15.93 ? 766 HOH A O     1 
HETATM 4061 O  O     . HOH J 8 .   ? 53.855 -32.449 -2.832  1.00 30.83 ? 767 HOH A O     1 
HETATM 4062 O  O     . HOH J 8 .   ? 49.793 -8.959  12.851  1.00 26.96 ? 768 HOH A O     1 
HETATM 4063 O  O     . HOH J 8 .   ? 43.600 12.044  -7.263  1.00 16.92 ? 769 HOH A O     1 
HETATM 4064 O  O     . HOH J 8 .   ? 51.103 0.554   -15.946 1.00 26.40 ? 770 HOH A O     1 
HETATM 4065 O  O     . HOH J 8 .   ? 52.652 -12.585 -3.868  1.00 23.38 ? 771 HOH A O     1 
HETATM 4066 O  O     . HOH J 8 .   ? 63.264 -18.923 -1.558  1.00 18.61 ? 772 HOH A O     1 
HETATM 4067 O  O     . HOH J 8 .   ? 34.581 19.881  -16.089 1.00 26.53 ? 773 HOH A O     1 
HETATM 4068 O  O     . HOH J 8 .   ? 71.541 6.066   -7.159  1.00 18.11 ? 774 HOH A O     1 
HETATM 4069 O  O     . HOH J 8 .   ? 52.535 8.430   25.587  1.00 32.71 ? 775 HOH A O     1 
HETATM 4070 O  O     . HOH J 8 .   ? 40.420 -28.534 -9.961  1.00 27.67 ? 776 HOH A O     1 
HETATM 4071 O  O     . HOH J 8 .   ? 49.929 -3.022  -17.189 1.00 19.71 ? 777 HOH A O     1 
HETATM 4072 O  O     . HOH J 8 .   ? 65.787 -15.177 11.663  1.00 16.77 ? 778 HOH A O     1 
HETATM 4073 O  O     . HOH J 8 .   ? 60.652 13.874  6.244   1.00 27.65 ? 779 HOH A O     1 
HETATM 4074 O  O     . HOH J 8 .   ? 65.873 8.586   8.944   1.00 27.26 ? 780 HOH A O     1 
HETATM 4075 O  O     . HOH J 8 .   ? 57.464 -34.924 8.487   1.00 25.92 ? 781 HOH A O     1 
HETATM 4076 O  O     . HOH J 8 .   ? 59.350 11.104  8.535   1.00 17.25 ? 782 HOH A O     1 
HETATM 4077 O  O     . HOH J 8 .   ? 62.956 -23.588 3.507   1.00 27.08 ? 783 HOH A O     1 
HETATM 4078 O  O     . HOH J 8 .   ? 44.888 -14.353 10.423  1.00 14.99 ? 784 HOH A O     1 
HETATM 4079 O  O     . HOH J 8 .   ? 23.281 14.207  -9.143  1.00 27.65 ? 785 HOH A O     1 
HETATM 4080 O  O     . HOH J 8 .   ? 69.139 -13.512 5.067   1.00 10.73 ? 786 HOH A O     1 
HETATM 4081 O  O     . HOH J 8 .   ? 65.565 -22.911 3.219   1.00 13.21 ? 787 HOH A O     1 
HETATM 4082 O  O     . HOH J 8 .   ? 54.272 15.553  23.226  1.00 29.51 ? 788 HOH A O     1 
HETATM 4083 O  O     . HOH J 8 .   ? 44.692 -17.057 -0.425  1.00 25.34 ? 789 HOH A O     1 
HETATM 4084 O  O     . HOH J 8 .   ? 46.208 -9.473  10.740  1.00 29.88 ? 790 HOH A O     1 
HETATM 4085 O  O     . HOH J 8 .   ? 51.097 -8.807  -5.177  1.00 26.84 ? 791 HOH A O     1 
HETATM 4086 O  O     . HOH J 8 .   ? 65.353 12.942  3.019   1.00 27.96 ? 792 HOH A O     1 
HETATM 4087 O  O     . HOH J 8 .   ? 46.794 -0.270  -15.168 1.00 18.54 ? 793 HOH A O     1 
HETATM 4088 O  O     . HOH J 8 .   ? 21.988 11.840  -9.482  1.00 27.12 ? 794 HOH A O     1 
HETATM 4089 O  O     . HOH J 8 .   ? 40.909 -29.795 13.011  1.00 30.62 ? 795 HOH A O     1 
HETATM 4090 O  O     . HOH J 8 .   ? 42.978 -1.490  -24.911 1.00 22.39 ? 796 HOH A O     1 
HETATM 4091 O  O     . HOH J 8 .   ? 52.843 -1.195  3.651   1.00 13.47 ? 797 HOH A O     1 
HETATM 4092 O  O     . HOH J 8 .   ? 34.622 14.957  11.353  1.00 22.28 ? 798 HOH A O     1 
HETATM 4093 O  O     . HOH J 8 .   ? 65.873 -25.814 0.288   1.00 33.78 ? 799 HOH A O     1 
HETATM 4094 O  O     . HOH J 8 .   ? 50.488 -34.704 -0.684  1.00 18.78 ? 800 HOH A O     1 
HETATM 4095 O  O     . HOH J 8 .   ? 58.041 -27.512 11.310  1.00 16.83 ? 801 HOH A O     1 
HETATM 4096 O  O     . HOH J 8 .   ? 39.544 18.647  18.129  1.00 25.44 ? 802 HOH A O     1 
HETATM 4097 O  O     . HOH J 8 .   ? 83.812 -5.123  2.614   1.00 29.39 ? 803 HOH A O     1 
HETATM 4098 O  O     . HOH J 8 .   ? 67.570 6.453   0.910   1.00 27.29 ? 804 HOH A O     1 
HETATM 4099 O  O     . HOH J 8 .   ? 42.134 8.139   3.294   1.00 16.90 ? 805 HOH A O     1 
HETATM 4100 O  O     . HOH J 8 .   ? 28.703 9.617   -26.489 1.00 45.41 ? 806 HOH A O     1 
HETATM 4101 O  O     . HOH J 8 .   ? 57.589 23.331  14.195  1.00 28.44 ? 807 HOH A O     1 
HETATM 4102 O  O     . HOH J 8 .   ? 11.900 0.508   -4.367  1.00 48.20 ? 808 HOH A O     1 
HETATM 4103 O  O     . HOH J 8 .   ? 37.825 10.679  21.547  1.00 34.77 ? 809 HOH A O     1 
HETATM 4104 O  O     . HOH J 8 .   ? 39.273 2.313   -7.372  1.00 26.20 ? 810 HOH A O     1 
HETATM 4105 O  O     . HOH J 8 .   ? 50.676 -6.452  -5.494  1.00 27.79 ? 811 HOH A O     1 
HETATM 4106 O  O     . HOH J 8 .   ? 69.059 -10.817 12.010  1.00 28.27 ? 812 HOH A O     1 
HETATM 4107 O  O     . HOH J 8 .   ? 49.059 -34.662 10.164  1.00 31.66 ? 813 HOH A O     1 
HETATM 4108 O  O     . HOH J 8 .   ? 62.246 -6.740  -14.755 1.00 36.76 ? 814 HOH A O     1 
HETATM 4109 O  O     . HOH J 8 .   ? 52.999 -33.430 -0.269  1.00 18.93 ? 815 HOH A O     1 
HETATM 4110 O  O     . HOH J 8 .   ? 60.266 -17.846 -7.477  1.00 25.50 ? 816 HOH A O     1 
HETATM 4111 O  O     . HOH J 8 .   ? 53.630 -20.487 -2.620  1.00 17.22 ? 817 HOH A O     1 
HETATM 4112 O  O     . HOH J 8 .   ? 31.390 -5.797  1.360   1.00 48.46 ? 818 HOH A O     1 
HETATM 4113 O  O     . HOH J 8 .   ? 41.250 21.571  2.259   1.00 26.46 ? 819 HOH A O     1 
HETATM 4114 O  O     . HOH J 8 .   ? 46.424 0.174   6.969   1.00 24.92 ? 820 HOH A O     1 
HETATM 4115 O  O     . HOH J 8 .   ? 37.443 13.557  21.646  1.00 26.97 ? 821 HOH A O     1 
HETATM 4116 O  O     . HOH J 8 .   ? 65.162 20.014  6.680   1.00 28.86 ? 822 HOH A O     1 
HETATM 4117 O  O     . HOH J 8 .   ? 48.614 -22.259 -5.712  1.00 21.33 ? 823 HOH A O     1 
HETATM 4118 O  O     . HOH J 8 .   ? 60.364 -18.435 -4.571  1.00 12.14 ? 824 HOH A O     1 
HETATM 4119 O  O     . HOH J 8 .   ? 42.119 -22.534 -2.663  1.00 18.98 ? 825 HOH A O     1 
HETATM 4120 O  O     . HOH J 8 .   ? 73.135 -7.381  9.001   1.00 12.70 ? 826 HOH A O     1 
HETATM 4121 O  O     . HOH J 8 .   ? 69.670 -18.731 -9.713  1.00 31.59 ? 827 HOH A O     1 
HETATM 4122 O  O     . HOH J 8 .   ? 80.519 -3.906  13.816  1.00 38.38 ? 828 HOH A O     1 
HETATM 4123 O  O     . HOH J 8 .   ? 71.728 1.314   18.831  1.00 35.18 ? 829 HOH A O     1 
HETATM 4124 O  O     . HOH J 8 .   ? 51.369 21.789  7.102   1.00 25.98 ? 830 HOH A O     1 
HETATM 4125 O  O     . HOH J 8 .   ? 33.202 2.448   -0.405  1.00 28.24 ? 831 HOH A O     1 
HETATM 4126 O  O     . HOH J 8 .   ? 41.503 20.193  4.797   1.00 24.82 ? 832 HOH A O     1 
HETATM 4127 O  O     . HOH J 8 .   ? 38.503 -17.998 10.235  1.00 23.28 ? 833 HOH A O     1 
HETATM 4128 O  O     . HOH J 8 .   ? 46.658 19.364  1.515   1.00 22.39 ? 834 HOH A O     1 
HETATM 4129 O  O     . HOH J 8 .   ? 45.264 17.008  -18.053 1.00 26.83 ? 835 HOH A O     1 
HETATM 4130 O  O     . HOH J 8 .   ? 54.571 -11.332 3.397   1.00 12.57 ? 836 HOH A O     1 
HETATM 4131 O  O     . HOH J 8 .   ? 64.054 -9.316  -14.378 1.00 17.79 ? 837 HOH A O     1 
HETATM 4132 O  O     . HOH J 8 .   ? 44.048 -15.165 1.281   1.00 17.91 ? 838 HOH A O     1 
HETATM 4133 O  O     . HOH J 8 .   ? 45.168 -32.717 8.683   1.00 40.89 ? 839 HOH A O     1 
HETATM 4134 O  O     . HOH J 8 .   ? 68.436 -16.898 -11.944 1.00 35.85 ? 840 HOH A O     1 
HETATM 4135 O  O     . HOH J 8 .   ? 49.086 -15.604 13.511  1.00 16.84 ? 841 HOH A O     1 
HETATM 4136 O  O     . HOH J 8 .   ? 45.164 0.524   -18.449 1.00 22.83 ? 842 HOH A O     1 
HETATM 4137 O  O     . HOH J 8 .   ? 42.375 15.413  -8.831  1.00 31.42 ? 843 HOH A O     1 
HETATM 4138 O  O     . HOH J 8 .   ? 67.382 -25.779 -6.622  1.00 44.57 ? 844 HOH A O     1 
HETATM 4139 O  O     . HOH J 8 .   ? 63.278 -11.667 12.790  1.00 41.13 ? 845 HOH A O     1 
HETATM 4140 O  O     . HOH J 8 .   ? 59.586 -31.488 3.901   1.00 29.42 ? 846 HOH A O     1 
HETATM 4141 O  O     . HOH J 8 .   ? 59.519 9.607   10.844  1.00 12.62 ? 847 HOH A O     1 
HETATM 4142 O  O     . HOH J 8 .   ? 65.725 -4.200  -15.189 1.00 31.33 ? 848 HOH A O     1 
HETATM 4143 O  O     . HOH J 8 .   ? 63.336 -4.702  -15.726 1.00 37.47 ? 849 HOH A O     1 
HETATM 4144 O  O     . HOH J 8 .   ? 46.223 16.703  1.159   1.00 12.72 ? 850 HOH A O     1 
HETATM 4145 O  O     . HOH J 8 .   ? 38.790 -19.972 12.299  1.00 30.74 ? 851 HOH A O     1 
HETATM 4146 O  O     . HOH J 8 .   ? 41.200 -3.011  -23.003 1.00 21.26 ? 852 HOH A O     1 
HETATM 4147 O  O     . HOH J 8 .   ? 61.847 1.737   14.010  1.00 33.33 ? 853 HOH A O     1 
HETATM 4148 O  O     . HOH J 8 .   ? 60.071 14.398  3.344   1.00 26.02 ? 854 HOH A O     1 
HETATM 4149 O  O     . HOH J 8 .   ? 61.485 14.587  8.803   1.00 25.33 ? 855 HOH A O     1 
HETATM 4150 O  O     . HOH J 8 .   ? 65.523 -21.715 14.555  1.00 30.61 ? 856 HOH A O     1 
HETATM 4151 O  O     . HOH J 8 .   ? 49.437 -14.829 18.497  1.00 28.16 ? 857 HOH A O     1 
HETATM 4152 O  O     . HOH J 8 .   ? 62.171 -2.175  12.400  1.00 32.01 ? 858 HOH A O     1 
HETATM 4153 O  O     . HOH J 8 .   ? 35.340 20.705  0.562   1.00 26.21 ? 859 HOH A O     1 
HETATM 4154 O  O     . HOH J 8 .   ? 53.599 -8.496  8.605   1.00 29.92 ? 860 HOH A O     1 
HETATM 4155 O  O     . HOH J 8 .   ? 69.780 -8.946  10.782  1.00 28.44 ? 861 HOH A O     1 
HETATM 4156 O  O     . HOH J 8 .   ? 47.361 -16.693 -0.860  1.00 26.85 ? 862 HOH A O     1 
HETATM 4157 O  O     . HOH J 8 .   ? 47.442 13.736  -11.274 1.00 31.82 ? 863 HOH A O     1 
HETATM 4158 O  O     . HOH J 8 .   ? 61.488 -17.443 -13.246 1.00 42.93 ? 864 HOH A O     1 
HETATM 4159 O  O     . HOH J 8 .   ? 41.274 -23.912 -5.020  1.00 22.01 ? 865 HOH A O     1 
HETATM 4160 O  O     . HOH J 8 .   ? 42.198 -9.081  9.520   1.00 33.54 ? 866 HOH A O     1 
HETATM 4161 O  O     . HOH J 8 .   ? 40.626 7.698   24.268  1.00 35.09 ? 867 HOH A O     1 
HETATM 4162 O  O     . HOH J 8 .   ? 43.539 9.685   -9.955  1.00 18.56 ? 868 HOH A O     1 
HETATM 4163 O  O     . HOH J 8 .   ? 36.680 12.961  11.973  1.00 22.25 ? 869 HOH A O     1 
HETATM 4164 O  O     . HOH J 8 .   ? 32.260 -1.555  -3.292  1.00 37.69 ? 870 HOH A O     1 
HETATM 4165 O  O     . HOH J 8 .   ? 49.191 -29.588 15.809  1.00 33.98 ? 871 HOH A O     1 
HETATM 4166 O  O     . HOH J 8 .   ? 55.635 -32.918 4.944   1.00 28.74 ? 872 HOH A O     1 
HETATM 4167 O  O     . HOH J 8 .   ? 40.958 -1.645  -16.280 1.00 27.14 ? 873 HOH A O     1 
HETATM 4168 O  O     . HOH J 8 .   ? 49.218 7.220   -7.590  1.00 22.13 ? 874 HOH A O     1 
HETATM 4169 O  O     . HOH J 8 .   ? 48.873 14.033  28.309  1.00 30.57 ? 875 HOH A O     1 
HETATM 4170 O  O     . HOH J 8 .   ? 55.351 1.556   -17.442 1.00 41.66 ? 876 HOH A O     1 
HETATM 4171 O  O     . HOH J 8 .   ? 47.274 2.350   -0.930  1.00 16.12 ? 877 HOH A O     1 
HETATM 4172 O  O     . HOH J 8 .   ? 57.787 -0.171  -14.678 1.00 27.81 ? 878 HOH A O     1 
HETATM 4173 O  O     . HOH J 8 .   ? 53.899 17.364  -3.228  1.00 16.44 ? 879 HOH A O     1 
HETATM 4174 O  O     . HOH J 8 .   ? 65.575 -22.317 -7.947  1.00 29.18 ? 880 HOH A O     1 
HETATM 4175 O  O     . HOH J 8 .   ? 73.219 -19.610 -2.777  1.00 21.56 ? 881 HOH A O     1 
HETATM 4176 O  O     . HOH J 8 .   ? 35.365 22.415  -3.320  1.00 35.55 ? 882 HOH A O     1 
HETATM 4177 O  O     . HOH J 8 .   ? 71.193 6.256   7.431   1.00 33.87 ? 883 HOH A O     1 
HETATM 4178 O  O     . HOH J 8 .   ? 64.978 19.598  1.887   1.00 21.55 ? 884 HOH A O     1 
HETATM 4179 O  O     . HOH J 8 .   ? 68.036 -14.488 -10.061 1.00 23.41 ? 885 HOH A O     1 
HETATM 4180 O  O     . HOH J 8 .   ? 46.749 -14.640 14.807  1.00 27.26 ? 886 HOH A O     1 
HETATM 4181 O  O     . HOH J 8 .   ? 38.712 21.190  5.774   1.00 31.94 ? 887 HOH A O     1 
HETATM 4182 O  O     . HOH J 8 .   ? 58.925 -30.500 -1.036  1.00 36.06 ? 888 HOH A O     1 
HETATM 4183 O  O     . HOH J 8 .   ? 38.322 10.430  9.674   1.00 24.97 ? 889 HOH A O     1 
HETATM 4184 O  O     . HOH J 8 .   ? 62.006 -18.946 21.855  1.00 35.55 ? 890 HOH A O     1 
HETATM 4185 O  O     . HOH J 8 .   ? 69.346 4.519   3.996   1.00 22.64 ? 891 HOH A O     1 
HETATM 4186 O  O     . HOH J 8 .   ? 47.454 21.686  9.787   1.00 32.61 ? 892 HOH A O     1 
HETATM 4187 O  O     . HOH J 8 .   ? 38.303 -22.685 10.966  1.00 32.85 ? 893 HOH A O     1 
HETATM 4188 O  O     . HOH J 8 .   ? 62.673 11.887  5.735   1.00 31.30 ? 894 HOH A O     1 
HETATM 4189 O  O     . HOH J 8 .   ? 29.029 8.107   -18.823 1.00 24.98 ? 895 HOH A O     1 
HETATM 4190 O  O     . HOH J 8 .   ? 49.320 8.354   -13.635 1.00 25.36 ? 896 HOH A O     1 
HETATM 4191 O  O     . HOH J 8 .   ? 46.651 -18.579 -2.667  1.00 31.88 ? 897 HOH A O     1 
HETATM 4192 O  O     . HOH J 8 .   ? 43.093 -30.914 -10.631 1.00 35.64 ? 898 HOH A O     1 
HETATM 4193 O  O     . HOH J 8 .   ? 38.460 13.558  24.553  1.00 32.19 ? 899 HOH A O     1 
HETATM 4194 O  O     . HOH J 8 .   ? 19.042 14.282  6.574   1.00 41.40 ? 900 HOH A O     1 
HETATM 4195 O  O     . HOH J 8 .   ? 43.831 -28.842 15.786  1.00 33.76 ? 901 HOH A O     1 
HETATM 4196 O  O     . HOH J 8 .   ? 60.992 9.972   6.949   1.00 25.61 ? 902 HOH A O     1 
HETATM 4197 O  O     . HOH J 8 .   ? 12.190 3.081   -5.372  1.00 50.23 ? 903 HOH A O     1 
HETATM 4198 O  O     . HOH J 8 .   ? 25.706 14.372  5.307   1.00 31.82 ? 904 HOH A O     1 
HETATM 4199 O  O     . HOH J 8 .   ? 35.971 21.868  12.367  1.00 30.52 ? 905 HOH A O     1 
HETATM 4200 O  O     . HOH J 8 .   ? 50.934 15.901  -12.351 1.00 41.00 ? 906 HOH A O     1 
HETATM 4201 O  O     . HOH J 8 .   ? 62.030 -13.147 -13.728 1.00 29.58 ? 907 HOH A O     1 
HETATM 4202 O  O     . HOH J 8 .   ? 61.883 15.922  2.397   1.00 29.62 ? 908 HOH A O     1 
HETATM 4203 O  O     . HOH J 8 .   ? 62.014 24.128  9.881   1.00 28.36 ? 909 HOH A O     1 
HETATM 4204 O  O     . HOH J 8 .   ? 38.876 -3.619  -20.082 1.00 24.73 ? 910 HOH A O     1 
HETATM 4205 O  O     . HOH J 8 .   ? 51.149 4.525   24.604  1.00 27.48 ? 911 HOH A O     1 
HETATM 4206 O  O     . HOH J 8 .   ? 36.788 21.765  4.410   1.00 37.39 ? 912 HOH A O     1 
HETATM 4207 O  O     . HOH J 8 .   ? 74.977 -22.343 -6.259  1.00 37.87 ? 913 HOH A O     1 
HETATM 4208 O  O     . HOH J 8 .   ? 50.634 11.029  -13.772 1.00 38.05 ? 914 HOH A O     1 
HETATM 4209 O  O     . HOH J 8 .   ? 51.315 3.427   10.364  1.00 21.56 ? 915 HOH A O     1 
HETATM 4210 O  O     . HOH J 8 .   ? 53.124 -20.166 -5.057  1.00 23.93 ? 916 HOH A O     1 
HETATM 4211 O  O     . HOH J 8 .   ? 37.302 -7.449  -18.269 1.00 41.01 ? 917 HOH A O     1 
HETATM 4212 O  O     . HOH J 8 .   ? 48.832 -24.045 19.285  1.00 38.17 ? 918 HOH A O     1 
HETATM 4213 O  O     . HOH J 8 .   ? 61.821 7.855   16.227  1.00 31.96 ? 919 HOH A O     1 
HETATM 4214 O  O     . HOH J 8 .   ? 68.837 -15.117 -14.727 1.00 47.13 ? 920 HOH A O     1 
HETATM 4215 O  O     . HOH J 8 .   ? 67.801 -5.097  -17.177 1.00 37.27 ? 921 HOH A O     1 
HETATM 4216 O  O     . HOH J 8 .   ? 42.827 17.085  -17.199 1.00 30.20 ? 922 HOH A O     1 
HETATM 4217 O  O     . HOH J 8 .   ? 50.896 -22.756 -5.650  1.00 28.57 ? 923 HOH A O     1 
HETATM 4218 O  O     . HOH J 8 .   ? 57.309 -18.960 22.187  1.00 24.55 ? 924 HOH A O     1 
HETATM 4219 O  O     . HOH J 8 .   ? 47.047 15.822  -23.562 1.00 25.41 ? 925 HOH A O     1 
HETATM 4220 O  O     . HOH J 8 .   ? 48.078 10.626  -9.508  1.00 23.38 ? 926 HOH A O     1 
HETATM 4221 O  O     . HOH J 8 .   ? 70.412 -21.638 0.876   1.00 26.80 ? 927 HOH A O     1 
HETATM 4222 O  O     . HOH J 8 .   ? 67.815 1.947   11.939  1.00 31.46 ? 928 HOH A O     1 
HETATM 4223 O  O     . HOH J 8 .   ? 68.080 -27.852 -7.599  1.00 48.81 ? 929 HOH A O     1 
HETATM 4224 O  O     . HOH J 8 .   ? 33.935 22.287  -0.616  1.00 41.12 ? 930 HOH A O     1 
HETATM 4225 O  O     . HOH J 8 .   ? 68.334 -21.563 -8.209  1.00 36.50 ? 931 HOH A O     1 
HETATM 4226 O  O     . HOH J 8 .   ? 51.481 -8.692  4.935   1.00 27.14 ? 932 HOH A O     1 
HETATM 4227 O  O     . HOH J 8 .   ? 64.439 -15.491 13.737  1.00 33.99 ? 933 HOH A O     1 
HETATM 4228 O  O     . HOH J 8 .   ? 53.198 0.224   12.100  1.00 26.18 ? 934 HOH A O     1 
HETATM 4229 O  O     . HOH J 8 .   ? 55.193 -17.456 -13.177 1.00 27.84 ? 935 HOH A O     1 
HETATM 4230 O  O     . HOH J 8 .   ? 59.896 -29.230 -8.613  1.00 36.07 ? 936 HOH A O     1 
HETATM 4231 O  O     . HOH J 8 .   ? 49.036 12.037  -11.512 1.00 30.05 ? 937 HOH A O     1 
HETATM 4232 O  O     . HOH J 8 .   ? 44.134 0.442   -21.094 1.00 32.48 ? 938 HOH A O     1 
HETATM 4233 O  O     . HOH J 8 .   ? 61.986 -25.272 4.909   1.00 26.84 ? 939 HOH A O     1 
HETATM 4234 O  O     . HOH J 8 .   ? 39.849 4.680   18.101  1.00 35.41 ? 940 HOH A O     1 
HETATM 4235 O  O     . HOH J 8 .   ? 34.730 13.914  21.893  1.00 33.83 ? 941 HOH A O     1 
HETATM 4236 O  O     . HOH J 8 .   ? 55.278 -7.341  6.642   1.00 24.91 ? 942 HOH A O     1 
HETATM 4237 O  O     . HOH J 8 .   ? 40.052 -18.409 -1.454  1.00 30.81 ? 943 HOH A O     1 
HETATM 4238 O  O     . HOH J 8 .   ? 71.261 9.044   -6.678  1.00 34.64 ? 944 HOH A O     1 
HETATM 4239 O  O     . HOH J 8 .   ? 73.452 4.558   -1.251  1.00 34.12 ? 945 HOH A O     1 
HETATM 4240 O  O     . HOH J 8 .   ? 69.598 5.258   1.300   1.00 32.07 ? 946 HOH A O     1 
HETATM 4241 O  O     . HOH J 8 .   ? 44.172 -1.323  -16.433 1.00 37.27 ? 947 HOH A O     1 
HETATM 4242 O  O     . HOH J 8 .   ? 61.981 12.125  9.344   1.00 32.41 ? 948 HOH A O     1 
HETATM 4243 O  O     . HOH J 8 .   ? 46.394 1.895   20.328  1.00 37.80 ? 949 HOH A O     1 
HETATM 4244 O  O     . HOH J 8 .   ? 44.829 -14.807 12.962  1.00 33.00 ? 950 HOH A O     1 
HETATM 4245 O  O     . HOH J 8 .   ? 49.703 26.112  2.948   1.00 28.29 ? 951 HOH A O     1 
HETATM 4246 O  O     . HOH J 8 .   ? 47.987 0.980   -18.846 1.00 28.50 ? 952 HOH A O     1 
HETATM 4247 O  O     . HOH J 8 .   ? 61.695 11.498  -12.229 1.00 24.83 ? 953 HOH A O     1 
HETATM 4248 O  O     . HOH J 8 .   ? 47.300 -20.191 18.434  1.00 29.31 ? 954 HOH A O     1 
HETATM 4249 O  O     . HOH J 8 .   ? 77.783 -17.351 8.691   1.00 40.80 ? 955 HOH A O     1 
HETATM 4250 O  O     . HOH J 8 .   ? 43.281 20.114  -12.020 1.00 31.93 ? 956 HOH A O     1 
HETATM 4251 O  O     . HOH J 8 .   ? 47.955 -19.159 -5.407  1.00 34.44 ? 957 HOH A O     1 
HETATM 4252 O  O     . HOH J 8 .   ? 42.725 5.303   20.669  1.00 38.71 ? 958 HOH A O     1 
HETATM 4253 O  O     . HOH J 8 .   ? 57.936 -14.314 -12.954 1.00 21.41 ? 959 HOH A O     1 
HETATM 4254 O  O     . HOH J 8 .   ? 52.640 2.637   -17.472 1.00 40.06 ? 960 HOH A O     1 
HETATM 4255 O  O     . HOH J 8 .   ? 54.417 -34.995 1.153   1.00 28.36 ? 961 HOH A O     1 
HETATM 4256 O  O     . HOH J 8 .   ? 49.220 -0.338  -16.662 1.00 27.97 ? 962 HOH A O     1 
HETATM 4257 O  O     . HOH J 8 .   ? 59.279 -28.101 -2.016  1.00 36.53 ? 963 HOH A O     1 
HETATM 4258 O  O     . HOH J 8 .   ? 58.546 15.265  -10.621 1.00 23.29 ? 964 HOH A O     1 
HETATM 4259 O  O     . HOH J 8 .   ? 51.506 13.526  -11.386 1.00 29.71 ? 965 HOH A O     1 
HETATM 4260 O  O     . HOH J 8 .   ? 55.974 13.719  -11.427 1.00 24.80 ? 966 HOH A O     1 
HETATM 4261 O  O     . HOH J 8 .   ? 44.307 15.711  26.068  1.00 24.52 ? 967 HOH A O     1 
HETATM 4262 O  O     . HOH J 8 .   ? 47.760 7.870   -9.649  1.00 20.93 ? 968 HOH A O     1 
HETATM 4263 O  O     . HOH J 8 .   ? 49.862 0.715   20.150  1.00 30.62 ? 969 HOH A O     1 
HETATM 4264 O  O     . HOH J 8 .   ? 43.443 16.181  -10.672 1.00 39.02 ? 970 HOH A O     1 
HETATM 4265 O  O     . HOH J 8 .   ? 61.720 8.905   18.840  1.00 29.05 ? 971 HOH A O     1 
HETATM 4266 O  O     . HOH J 8 .   ? 60.488 13.241  -14.213 1.00 30.12 ? 972 HOH A O     1 
HETATM 4267 O  O     . HOH J 8 .   ? 62.546 -29.447 -12.346 1.00 29.20 ? 973 HOH A O     1 
HETATM 4268 O  O     . HOH J 8 .   ? 44.430 13.170  -10.426 1.00 34.41 ? 974 HOH A O     1 
HETATM 4269 O  O     . HOH J 8 .   ? 39.080 18.669  -15.119 1.00 37.45 ? 975 HOH A O     1 
HETATM 4270 O  O     . HOH J 8 .   ? 53.809 16.254  -9.420  1.00 26.19 ? 976 HOH A O     1 
HETATM 4271 O  O     . HOH J 8 .   ? 56.554 21.510  18.134  1.00 25.65 ? 977 HOH A O     1 
HETATM 4272 O  O     . HOH J 8 .   ? 37.472 -28.991 9.436   1.00 37.39 ? 978 HOH A O     1 
HETATM 4273 O  O     . HOH J 8 .   ? 49.001 6.637   -11.734 1.00 19.78 ? 979 HOH A O     1 
HETATM 4274 O  O     . HOH J 8 .   ? 58.129 17.779  19.876  1.00 29.17 ? 980 HOH A O     1 
HETATM 4275 O  O     . HOH J 8 .   ? 48.229 -17.912 17.213  1.00 29.51 ? 981 HOH A O     1 
HETATM 4276 O  O     . HOH J 8 .   ? 38.072 -15.681 11.768  1.00 33.89 ? 982 HOH A O     1 
HETATM 4277 O  O     . HOH J 8 .   ? 60.265 9.691   22.276  1.00 35.10 ? 983 HOH A O     1 
HETATM 4278 O  O     . HOH J 8 .   ? 47.727 16.746  28.109  1.00 28.74 ? 984 HOH A O     1 
HETATM 4279 O  O     . HOH J 8 .   ? 61.524 8.044   9.812   1.00 22.74 ? 985 HOH A O     1 
HETATM 4280 O  O     . HOH K 8 .   ? 35.003 5.874   17.933  1.00 39.55 ? 101 HOH T O     1 
HETATM 4281 O  O     . HOH K 8 .   ? 33.917 9.073   11.471  1.00 35.29 ? 102 HOH T O     1 
HETATM 4282 O  O     . HOH K 8 .   ? 41.654 -19.944 -3.379  1.00 27.27 ? 103 HOH T O     1 
HETATM 4283 O  O     . HOH K 8 .   ? 37.323 -0.121  -3.016  1.00 34.65 ? 104 HOH T O     1 
HETATM 4284 O  O     . HOH K 8 .   ? 37.764 -18.550 -8.800  1.00 37.05 ? 105 HOH T O     1 
HETATM 4285 O  O     . HOH K 8 .   ? 43.346 5.420   -9.020  1.00 20.22 ? 106 HOH T O     1 
HETATM 4286 O  O     . HOH K 8 .   ? 36.646 -2.115  -1.180  1.00 29.73 ? 107 HOH T O     1 
HETATM 4287 O  O     . HOH K 8 .   ? 44.219 -8.711  -3.669  1.00 26.44 ? 108 HOH T O     1 
HETATM 4288 O  O     . HOH K 8 .   ? 36.231 2.484   4.640   1.00 24.90 ? 109 HOH T O     1 
HETATM 4289 O  O     . HOH K 8 .   ? 38.576 -10.248 -9.991  1.00 31.48 ? 110 HOH T O     1 
HETATM 4290 O  O     . HOH K 8 .   ? 32.147 14.009  10.630  1.00 31.08 ? 111 HOH T O     1 
HETATM 4291 O  O     . HOH K 8 .   ? 40.728 -3.613  -9.339  1.00 29.17 ? 112 HOH T O     1 
HETATM 4292 O  O     . HOH K 8 .   ? 36.822 -23.195 -5.332  1.00 25.38 ? 113 HOH T O     1 
HETATM 4293 O  O     . HOH K 8 .   ? 41.956 -7.350  -10.669 1.00 32.23 ? 114 HOH T O     1 
HETATM 4294 O  O     . HOH K 8 .   ? 30.646 5.053   8.436   1.00 40.53 ? 115 HOH T O     1 
HETATM 4295 O  O     . HOH K 8 .   ? 45.655 5.061   -4.827  1.00 25.46 ? 116 HOH T O     1 
HETATM 4296 O  O     . HOH K 8 .   ? 36.827 -3.131  -4.346  1.00 30.33 ? 117 HOH T O     1 
HETATM 4297 O  O     . HOH K 8 .   ? 45.586 -5.202  -3.096  1.00 36.16 ? 118 HOH T O     1 
HETATM 4298 O  O     . HOH K 8 .   ? 43.794 5.424   0.523   1.00 18.65 ? 119 HOH T O     1 
HETATM 4299 O  O     . HOH K 8 .   ? 38.507 -2.369  -6.525  1.00 34.02 ? 120 HOH T O     1 
HETATM 4300 O  O     . HOH K 8 .   ? 40.474 -0.834  7.963   1.00 42.17 ? 121 HOH T O     1 
HETATM 4301 O  O     . HOH K 8 .   ? 37.568 -12.855 -11.090 1.00 30.38 ? 122 HOH T O     1 
HETATM 4302 O  O     . HOH K 8 .   ? 42.490 -11.539 -11.698 1.00 40.43 ? 123 HOH T O     1 
HETATM 4303 O  O     . HOH K 8 .   ? 38.081 -21.637 -3.415  1.00 28.77 ? 124 HOH T O     1 
HETATM 4304 O  O     . HOH K 8 .   ? 34.387 -15.930 -14.141 1.00 39.09 ? 125 HOH T O     1 
HETATM 4305 O  O     . HOH K 8 .   ? 37.415 -0.220  4.720   1.00 30.55 ? 126 HOH T O     1 
HETATM 4306 O  O     . HOH K 8 .   ? 37.668 -4.530  -8.718  1.00 47.15 ? 127 HOH T O     1 
HETATM 4307 O  O     . HOH K 8 .   ? 38.660 -1.018  10.343  1.00 45.10 ? 128 HOH T O     1 
HETATM 4308 O  O     . HOH K 8 .   ? 33.329 10.394  8.351   1.00 36.71 ? 129 HOH T O     1 
HETATM 4309 O  O     . HOH K 8 .   ? 46.776 -8.655  -4.464  1.00 31.58 ? 130 HOH T O     1 
HETATM 4310 O  O     . HOH K 8 .   ? 40.809 -9.880  -11.114 1.00 39.06 ? 131 HOH T O     1 
HETATM 4311 O  O     . HOH K 8 .   ? 35.982 10.850  10.352  1.00 26.85 ? 132 HOH T O     1 
HETATM 4312 O  O     . HOH K 8 .   ? 45.030 7.393   -10.260 1.00 16.87 ? 133 HOH T O     1 
HETATM 4313 O  O     . HOH L 8 .   ? 27.854 -5.234  -10.486 1.00 35.05 ? 101 HOH P O     1 
HETATM 4314 O  O     . HOH L 8 .   ? 38.306 -10.815 6.297   1.00 31.91 ? 102 HOH P O     1 
HETATM 4315 O  O     . HOH L 8 .   ? 49.050 2.323   1.256   0.95 13.37 ? 103 HOH P O     1 
HETATM 4316 O  O     . HOH L 8 .   ? 41.732 -11.682 -0.926  1.00 21.26 ? 104 HOH P O     1 
HETATM 4317 O  O     . HOH L 8 .   ? 48.042 -2.090  6.844   1.00 25.98 ? 105 HOH P O     1 
HETATM 4318 O  O     . HOH L 8 .   ? 42.793 -9.045  7.057   1.00 19.95 ? 106 HOH P O     1 
HETATM 4319 O  O     . HOH L 8 .   ? 32.381 -7.629  -11.511 1.00 41.53 ? 107 HOH P O     1 
HETATM 4320 O  O     . HOH L 8 .   ? 49.284 -10.115 6.619   1.00 19.42 ? 108 HOH P O     1 
HETATM 4321 O  O     . HOH L 8 .   ? 46.093 3.816   1.096   1.00 17.99 ? 109 HOH P O     1 
HETATM 4322 O  O     . HOH L 8 .   ? 44.701 -8.449  -1.086  1.00 23.54 ? 110 HOH P O     1 
HETATM 4323 O  O     . HOH L 8 .   ? 30.644 -6.419  -13.307 1.00 41.95 ? 111 HOH P O     1 
HETATM 4324 O  O     . HOH L 8 .   ? 40.179 -5.433  5.526   1.00 30.46 ? 112 HOH P O     1 
HETATM 4325 O  O     . HOH L 8 .   ? 46.144 -2.556  -0.655  1.00 24.26 ? 113 HOH P O     1 
HETATM 4326 O  O     . HOH L 8 .   ? 26.257 -12.835 -10.404 1.00 26.71 ? 114 HOH P O     1 
HETATM 4327 O  O     . HOH L 8 .   ? 41.474 -15.765 1.787   1.00 18.82 ? 115 HOH P O     1 
HETATM 4328 O  O     . HOH L 8 .   ? 35.271 -9.277  -10.829 1.00 50.21 ? 116 HOH P O     1 
HETATM 4329 O  O     . HOH L 8 .   ? 31.125 -14.182 -2.924  1.00 32.18 ? 117 HOH P O     1 
HETATM 4330 O  O     . HOH L 8 .   ? 50.609 -7.490  6.738   1.00 37.67 ? 118 HOH P O     1 
HETATM 4331 O  O     . HOH L 8 .   ? 38.460 -1.981  6.057   1.00 38.92 ? 119 HOH P O     1 
HETATM 4332 O  O     . HOH L 8 .   ? 40.365 -9.080  5.831   1.00 23.66 ? 120 HOH P O     1 
HETATM 4333 O  O     . HOH L 8 .   ? 45.859 -10.756 -0.090  1.00 22.19 ? 121 HOH P O     1 
HETATM 4334 O  O     . HOH L 8 .   ? 30.863 -5.047  -9.545  1.00 41.44 ? 122 HOH P O     1 
HETATM 4335 O  O     . HOH L 8 .   ? 44.117 -12.927 -0.413  1.00 21.79 ? 123 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1   501 501 MN  MN  A . 
E 5 CA  1   502 502 CA  CA  A . 
F 4 MN  1   503 503 MN  MN  A . 
G 6 GOL 1   504 505 GOL GOL A . 
H 6 GOL 1   505 506 GOL GOL A . 
I 7 DTP 1   506 504 DTP DTP A . 
J 8 HOH 1   601 658 HOH HOH A . 
J 8 HOH 2   602 746 HOH HOH A . 
J 8 HOH 3   603 847 HOH HOH A . 
J 8 HOH 4   604 796 HOH HOH A . 
J 8 HOH 5   605 961 HOH HOH A . 
J 8 HOH 6   606 854 HOH HOH A . 
J 8 HOH 7   607 686 HOH HOH A . 
J 8 HOH 8   608 915 HOH HOH A . 
J 8 HOH 9   609 642 HOH HOH A . 
J 8 HOH 10  610 798 HOH HOH A . 
J 8 HOH 11  611 831 HOH HOH A . 
J 8 HOH 12  612 758 HOH HOH A . 
J 8 HOH 13  613 4   HOH HOH A . 
J 8 HOH 14  614 656 HOH HOH A . 
J 8 HOH 15  615 942 HOH HOH A . 
J 8 HOH 16  616 825 HOH HOH A . 
J 8 HOH 17  617 939 HOH HOH A . 
J 8 HOH 18  618 761 HOH HOH A . 
J 8 HOH 19  619 626 HOH HOH A . 
J 8 HOH 20  620 898 HOH HOH A . 
J 8 HOH 21  621 781 HOH HOH A . 
J 8 HOH 22  622 806 HOH HOH A . 
J 8 HOH 23  623 764 HOH HOH A . 
J 8 HOH 24  624 765 HOH HOH A . 
J 8 HOH 25  625 732 HOH HOH A . 
J 8 HOH 26  626 623 HOH HOH A . 
J 8 HOH 27  627 895 HOH HOH A . 
J 8 HOH 28  628 754 HOH HOH A . 
J 8 HOH 29  629 639 HOH HOH A . 
J 8 HOH 30  630 896 HOH HOH A . 
J 8 HOH 31  631 894 HOH HOH A . 
J 8 HOH 32  632 802 HOH HOH A . 
J 8 HOH 33  633 706 HOH HOH A . 
J 8 HOH 34  634 877 HOH HOH A . 
J 8 HOH 35  635 646 HOH HOH A . 
J 8 HOH 36  636 963 HOH HOH A . 
J 8 HOH 37  637 725 HOH HOH A . 
J 8 HOH 38  638 887 HOH HOH A . 
J 8 HOH 39  639 662 HOH HOH A . 
J 8 HOH 40  640 870 HOH HOH A . 
J 8 HOH 41  641 643 HOH HOH A . 
J 8 HOH 42  642 922 HOH HOH A . 
J 8 HOH 43  643 803 HOH HOH A . 
J 8 HOH 44  644 606 HOH HOH A . 
J 8 HOH 45  645 738 HOH HOH A . 
J 8 HOH 46  646 760 HOH HOH A . 
J 8 HOH 47  647 762 HOH HOH A . 
J 8 HOH 48  648 923 HOH HOH A . 
J 8 HOH 49  649 602 HOH HOH A . 
J 8 HOH 50  650 865 HOH HOH A . 
J 8 HOH 51  651 645 HOH HOH A . 
J 8 HOH 52  652 737 HOH HOH A . 
J 8 HOH 53  653 811 HOH HOH A . 
J 8 HOH 54  654 678 HOH HOH A . 
J 8 HOH 55  655 828 HOH HOH A . 
J 8 HOH 56  656 744 HOH HOH A . 
J 8 HOH 57  657 134 HOH HOH A . 
J 8 HOH 58  658 603 HOH HOH A . 
J 8 HOH 59  659 889 HOH HOH A . 
J 8 HOH 60  660 974 HOH HOH A . 
J 8 HOH 61  661 715 HOH HOH A . 
J 8 HOH 62  662 730 HOH HOH A . 
J 8 HOH 63  663 671 HOH HOH A . 
J 8 HOH 64  664 609 HOH HOH A . 
J 8 HOH 65  665 808 HOH HOH A . 
J 8 HOH 66  666 872 HOH HOH A . 
J 8 HOH 67  667 620 HOH HOH A . 
J 8 HOH 68  668 912 HOH HOH A . 
J 8 HOH 69  669 721 HOH HOH A . 
J 8 HOH 70  670 794 HOH HOH A . 
J 8 HOH 71  671 910 HOH HOH A . 
J 8 HOH 72  672 664 HOH HOH A . 
J 8 HOH 73  673 634 HOH HOH A . 
J 8 HOH 74  674 624 HOH HOH A . 
J 8 HOH 75  675 973 HOH HOH A . 
J 8 HOH 76  676 735 HOH HOH A . 
J 8 HOH 77  677 690 HOH HOH A . 
J 8 HOH 78  678 605 HOH HOH A . 
J 8 HOH 79  679 717 HOH HOH A . 
J 8 HOH 80  680 640 HOH HOH A . 
J 8 HOH 81  681 5   HOH HOH A . 
J 8 HOH 82  682 742 HOH HOH A . 
J 8 HOH 83  683 614 HOH HOH A . 
J 8 HOH 84  684 621 HOH HOH A . 
J 8 HOH 85  685 722 HOH HOH A . 
J 8 HOH 86  686 727 HOH HOH A . 
J 8 HOH 87  687 617 HOH HOH A . 
J 8 HOH 88  688 903 HOH HOH A . 
J 8 HOH 89  689 638 HOH HOH A . 
J 8 HOH 90  690 661 HOH HOH A . 
J 8 HOH 91  691 652 HOH HOH A . 
J 8 HOH 92  692 633 HOH HOH A . 
J 8 HOH 93  693 729 HOH HOH A . 
J 8 HOH 94  694 848 HOH HOH A . 
J 8 HOH 95  695 775 HOH HOH A . 
J 8 HOH 96  696 849 HOH HOH A . 
J 8 HOH 97  697 772 HOH HOH A . 
J 8 HOH 98  698 857 HOH HOH A . 
J 8 HOH 99  699 774 HOH HOH A . 
J 8 HOH 100 700 630 HOH HOH A . 
J 8 HOH 101 701 101 HOH HOH A . 
J 8 HOH 102 702 756 HOH HOH A . 
J 8 HOH 103 703 767 HOH HOH A . 
J 8 HOH 104 704 632 HOH HOH A . 
J 8 HOH 105 705 689 HOH HOH A . 
J 8 HOH 106 706 713 HOH HOH A . 
J 8 HOH 107 707 779 HOH HOH A . 
J 8 HOH 108 708 736 HOH HOH A . 
J 8 HOH 109 709 627 HOH HOH A . 
J 8 HOH 110 710 660 HOH HOH A . 
J 8 HOH 111 711 814 HOH HOH A . 
J 8 HOH 112 712 647 HOH HOH A . 
J 8 HOH 113 713 709 HOH HOH A . 
J 8 HOH 114 714 835 HOH HOH A . 
J 8 HOH 115 715 679 HOH HOH A . 
J 8 HOH 116 716 611 HOH HOH A . 
J 8 HOH 117 717 780 HOH HOH A . 
J 8 HOH 118 718 701 HOH HOH A . 
J 8 HOH 119 719 953 HOH HOH A . 
J 8 HOH 120 720 610 HOH HOH A . 
J 8 HOH 121 721 938 HOH HOH A . 
J 8 HOH 122 722 960 HOH HOH A . 
J 8 HOH 123 723 673 HOH HOH A . 
J 8 HOH 124 724 888 HOH HOH A . 
J 8 HOH 125 725 649 HOH HOH A . 
J 8 HOH 126 726 651 HOH HOH A . 
J 8 HOH 127 727 663 HOH HOH A . 
J 8 HOH 128 728 604 HOH HOH A . 
J 8 HOH 129 729 787 HOH HOH A . 
J 8 HOH 130 730 751 HOH HOH A . 
J 8 HOH 131 731 612 HOH HOH A . 
J 8 HOH 132 732 691 HOH HOH A . 
J 8 HOH 133 733 827 HOH HOH A . 
J 8 HOH 134 734 726 HOH HOH A . 
J 8 HOH 135 735 790 HOH HOH A . 
J 8 HOH 136 736 948 HOH HOH A . 
J 8 HOH 137 737 748 HOH HOH A . 
J 8 HOH 138 738 644 HOH HOH A . 
J 8 HOH 139 739 675 HOH HOH A . 
J 8 HOH 140 740 975 HOH HOH A . 
J 8 HOH 141 741 629 HOH HOH A . 
J 8 HOH 142 742 718 HOH HOH A . 
J 8 HOH 143 743 952 HOH HOH A . 
J 8 HOH 144 744 659 HOH HOH A . 
J 8 HOH 145 745 838 HOH HOH A . 
J 8 HOH 146 746 739 HOH HOH A . 
J 8 HOH 147 747 837 HOH HOH A . 
J 8 HOH 148 748 693 HOH HOH A . 
J 8 HOH 149 749 801 HOH HOH A . 
J 8 HOH 150 750 885 HOH HOH A . 
J 8 HOH 151 751 793 HOH HOH A . 
J 8 HOH 152 752 883 HOH HOH A . 
J 8 HOH 153 753 692 HOH HOH A . 
J 8 HOH 154 754 855 HOH HOH A . 
J 8 HOH 155 755 680 HOH HOH A . 
J 8 HOH 156 756 711 HOH HOH A . 
J 8 HOH 157 757 655 HOH HOH A . 
J 8 HOH 158 758 879 HOH HOH A . 
J 8 HOH 159 759 873 HOH HOH A . 
J 8 HOH 160 760 792 HOH HOH A . 
J 8 HOH 161 761 819 HOH HOH A . 
J 8 HOH 162 762 666 HOH HOH A . 
J 8 HOH 163 763 899 HOH HOH A . 
J 8 HOH 164 764 800 HOH HOH A . 
J 8 HOH 165 765 891 HOH HOH A . 
J 8 HOH 166 766 682 HOH HOH A . 
J 8 HOH 167 767 927 HOH HOH A . 
J 8 HOH 168 768 807 HOH HOH A . 
J 8 HOH 169 769 615 HOH HOH A . 
J 8 HOH 170 770 696 HOH HOH A . 
J 8 HOH 171 771 741 HOH HOH A . 
J 8 HOH 172 772 685 HOH HOH A . 
J 8 HOH 173 773 815 HOH HOH A . 
J 8 HOH 174 774 669 HOH HOH A . 
J 8 HOH 175 775 789 HOH HOH A . 
J 8 HOH 176 776 823 HOH HOH A . 
J 8 HOH 177 777 674 HOH HOH A . 
J 8 HOH 178 778 672 HOH HOH A . 
J 8 HOH 179 779 784 HOH HOH A . 
J 8 HOH 180 780 816 HOH HOH A . 
J 8 HOH 181 781 743 HOH HOH A . 
J 8 HOH 182 782 619 HOH HOH A . 
J 8 HOH 183 783 782 HOH HOH A . 
J 8 HOH 184 784 667 HOH HOH A . 
J 8 HOH 185 785 703 HOH HOH A . 
J 8 HOH 186 786 618 HOH HOH A . 
J 8 HOH 187 787 665 HOH HOH A . 
J 8 HOH 188 788 972 HOH HOH A . 
J 8 HOH 189 789 6   HOH HOH A . 
J 8 HOH 190 790 778 HOH HOH A . 
J 8 HOH 191 791 705 HOH HOH A . 
J 8 HOH 192 792 768 HOH HOH A . 
J 8 HOH 193 793 657 HOH HOH A . 
J 8 HOH 194 794 8   HOH HOH A . 
J 8 HOH 195 795 886 HOH HOH A . 
J 8 HOH 196 796 740 HOH HOH A . 
J 8 HOH 197 797 601 HOH HOH A . 
J 8 HOH 198 798 684 HOH HOH A . 
J 8 HOH 199 799 852 HOH HOH A . 
J 8 HOH 200 800 668 HOH HOH A . 
J 8 HOH 201 801 841 HOH HOH A . 
J 8 HOH 202 802 878 HOH HOH A . 
J 8 HOH 203 803 702 HOH HOH A . 
J 8 HOH 204 804 866 HOH HOH A . 
J 8 HOH 205 805 683 HOH HOH A . 
J 8 HOH 206 806 919 HOH HOH A . 
J 8 HOH 207 807 818 HOH HOH A . 
J 8 HOH 208 808 940 HOH HOH A . 
J 8 HOH 209 809 769 HOH HOH A . 
J 8 HOH 210 810 7   HOH HOH A . 
J 8 HOH 211 811 867 HOH HOH A . 
J 8 HOH 212 812 862 HOH HOH A . 
J 8 HOH 213 813 851 HOH HOH A . 
J 8 HOH 214 814 839 HOH HOH A . 
J 8 HOH 215 815 688 HOH HOH A . 
J 8 HOH 216 816 648 HOH HOH A . 
J 8 HOH 217 817 622 HOH HOH A . 
J 8 HOH 218 818 955 HOH HOH A . 
J 8 HOH 219 819 853 HOH HOH A . 
J 8 HOH 220 820 817 HOH HOH A . 
J 8 HOH 221 821 926 HOH HOH A . 
J 8 HOH 222 822 913 HOH HOH A . 
J 8 HOH 223 823 654 HOH HOH A . 
J 8 HOH 224 824 613 HOH HOH A . 
J 8 HOH 225 825 637 HOH HOH A . 
J 8 HOH 226 826 608 HOH HOH A . 
J 8 HOH 227 827 921 HOH HOH A . 
J 8 HOH 228 828 804 HOH HOH A . 
J 8 HOH 229 829 783 HOH HOH A . 
J 8 HOH 230 830 776 HOH HOH A . 
J 8 HOH 231 831 755 HOH HOH A . 
J 8 HOH 232 832 704 HOH HOH A . 
J 8 HOH 233 833 777 HOH HOH A . 
J 8 HOH 234 834 723 HOH HOH A . 
J 8 HOH 235 835 695 HOH HOH A . 
J 8 HOH 236 836 616 HOH HOH A . 
J 8 HOH 237 837 650 HOH HOH A . 
J 8 HOH 238 838 681 HOH HOH A . 
J 8 HOH 239 839 967 HOH HOH A . 
J 8 HOH 240 840 957 HOH HOH A . 
J 8 HOH 241 841 636 HOH HOH A . 
J 8 HOH 242 842 805 HOH HOH A . 
J 8 HOH 243 843 914 HOH HOH A . 
J 8 HOH 244 844 917 HOH HOH A . 
J 8 HOH 245 845 925 HOH HOH A . 
J 8 HOH 246 846 826 HOH HOH A . 
J 8 HOH 247 847 607 HOH HOH A . 
J 8 HOH 248 848 773 HOH HOH A . 
J 8 HOH 249 849 901 HOH HOH A . 
J 8 HOH 250 850 628 HOH HOH A . 
J 8 HOH 251 851 771 HOH HOH A . 
J 8 HOH 252 852 908 HOH HOH A . 
J 8 HOH 253 853 795 HOH HOH A . 
J 8 HOH 254 854 809 HOH HOH A . 
J 8 HOH 255 855 687 HOH HOH A . 
J 8 HOH 256 856 788 HOH HOH A . 
J 8 HOH 257 857 858 HOH HOH A . 
J 8 HOH 258 858 924 HOH HOH A . 
J 8 HOH 259 859 763 HOH HOH A . 
J 8 HOH 260 860 797 HOH HOH A . 
J 8 HOH 261 861 861 HOH HOH A . 
J 8 HOH 262 862 720 HOH HOH A . 
J 8 HOH 263 863 893 HOH HOH A . 
J 8 HOH 264 864 842 HOH HOH A . 
J 8 HOH 265 865 707 HOH HOH A . 
J 8 HOH 266 866 752 HOH HOH A . 
J 8 HOH 267 867 935 HOH HOH A . 
J 8 HOH 268 868 653 HOH HOH A . 
J 8 HOH 269 869 733 HOH HOH A . 
J 8 HOH 270 870 791 HOH HOH A . 
J 8 HOH 271 871 843 HOH HOH A . 
J 8 HOH 272 872 810 HOH HOH A . 
J 8 HOH 273 873 820 HOH HOH A . 
J 8 HOH 274 874 631 HOH HOH A . 
J 8 HOH 275 875 3   HOH HOH A . 
J 8 HOH 276 876 949 HOH HOH A . 
J 8 HOH 277 877 1   HOH HOH A . 
J 8 HOH 278 878 750 HOH HOH A . 
J 8 HOH 279 879 635 HOH HOH A . 
J 8 HOH 280 880 757 HOH HOH A . 
J 8 HOH 281 881 976 HOH HOH A . 
J 8 HOH 282 882 846 HOH HOH A . 
J 8 HOH 283 883 931 HOH HOH A . 
J 8 HOH 284 884 830 HOH HOH A . 
J 8 HOH 285 885 833 HOH HOH A . 
J 8 HOH 286 886 714 HOH HOH A . 
J 8 HOH 287 887 876 HOH HOH A . 
J 8 HOH 288 888 941 HOH HOH A . 
J 8 HOH 289 889 868 HOH HOH A . 
J 8 HOH 290 890 904 HOH HOH A . 
J 8 HOH 291 891 694 HOH HOH A . 
J 8 HOH 292 892 875 HOH HOH A . 
J 8 HOH 293 893 962 HOH HOH A . 
J 8 HOH 294 894 918 HOH HOH A . 
J 8 HOH 295 895 759 HOH HOH A . 
J 8 HOH 296 896 731 HOH HOH A . 
J 8 HOH 297 897 880 HOH HOH A . 
J 8 HOH 298 898 945 HOH HOH A . 
J 8 HOH 299 899 892 HOH HOH A . 
J 8 HOH 300 900 799 HOH HOH A . 
J 8 HOH 301 901 821 HOH HOH A . 
J 8 HOH 302 902 970 HOH HOH A . 
J 8 HOH 303 903 932 HOH HOH A . 
J 8 HOH 304 904 114 HOH HOH A . 
J 8 HOH 305 905 958 HOH HOH A . 
J 8 HOH 306 906 929 HOH HOH A . 
J 8 HOH 307 907 753 HOH HOH A . 
J 8 HOH 308 908 969 HOH HOH A . 
J 8 HOH 309 909 859 HOH HOH A . 
J 8 HOH 310 910 812 HOH HOH A . 
J 8 HOH 311 911 890 HOH HOH A . 
J 8 HOH 312 912 137 HOH HOH A . 
J 8 HOH 313 913 902 HOH HOH A . 
J 8 HOH 314 914 900 HOH HOH A . 
J 8 HOH 315 915 670 HOH HOH A . 
J 8 HOH 316 916 699 HOH HOH A . 
J 8 HOH 317 917 954 HOH HOH A . 
J 8 HOH 318 918 863 HOH HOH A . 
J 8 HOH 319 919 864 HOH HOH A . 
J 8 HOH 320 920 920 HOH HOH A . 
J 8 HOH 321 921 840 HOH HOH A . 
J 8 HOH 322 922 834 HOH HOH A . 
J 8 HOH 323 923 909 HOH HOH A . 
J 8 HOH 324 924 786 HOH HOH A . 
J 8 HOH 325 925 824 HOH HOH A . 
J 8 HOH 326 926 676 HOH HOH A . 
J 8 HOH 327 927 829 HOH HOH A . 
J 8 HOH 328 928 869 HOH HOH A . 
J 8 HOH 329 929 947 HOH HOH A . 
J 8 HOH 330 930 934 HOH HOH A . 
J 8 HOH 331 931 936 HOH HOH A . 
J 8 HOH 332 932 719 HOH HOH A . 
J 8 HOH 333 933 964 HOH HOH A . 
J 8 HOH 334 934 971 HOH HOH A . 
J 8 HOH 335 935 943 HOH HOH A . 
J 8 HOH 336 936 959 HOH HOH A . 
J 8 HOH 337 937 844 HOH HOH A . 
J 8 HOH 338 938 766 HOH HOH A . 
J 8 HOH 339 939 728 HOH HOH A . 
J 8 HOH 340 940 111 HOH HOH A . 
J 8 HOH 341 941 916 HOH HOH A . 
J 8 HOH 342 942 785 HOH HOH A . 
J 8 HOH 343 943 126 HOH HOH A . 
J 8 HOH 344 944 874 HOH HOH A . 
J 8 HOH 345 945 710 HOH HOH A . 
J 8 HOH 346 946 822 HOH HOH A . 
J 8 HOH 347 947 928 HOH HOH A . 
J 8 HOH 348 948 907 HOH HOH A . 
J 8 HOH 349 949 882 HOH HOH A . 
J 8 HOH 350 950 965 HOH HOH A . 
J 8 HOH 351 951 716 HOH HOH A . 
J 8 HOH 352 952 881 HOH HOH A . 
J 8 HOH 353 953 906 HOH HOH A . 
J 8 HOH 354 954 724 HOH HOH A . 
J 8 HOH 355 955 836 HOH HOH A . 
J 8 HOH 356 956 968 HOH HOH A . 
J 8 HOH 357 957 871 HOH HOH A . 
J 8 HOH 358 958 950 HOH HOH A . 
J 8 HOH 359 959 708 HOH HOH A . 
J 8 HOH 360 960 856 HOH HOH A . 
J 8 HOH 361 961 944 HOH HOH A . 
J 8 HOH 362 962 884 HOH HOH A . 
J 8 HOH 363 963 930 HOH HOH A . 
J 8 HOH 364 964 745 HOH HOH A . 
J 8 HOH 365 965 832 HOH HOH A . 
J 8 HOH 366 966 698 HOH HOH A . 
J 8 HOH 367 967 905 HOH HOH A . 
J 8 HOH 368 968 697 HOH HOH A . 
J 8 HOH 369 969 860 HOH HOH A . 
J 8 HOH 370 970 951 HOH HOH A . 
J 8 HOH 371 971 937 HOH HOH A . 
J 8 HOH 372 972 911 HOH HOH A . 
J 8 HOH 373 973 956 HOH HOH A . 
J 8 HOH 374 974 734 HOH HOH A . 
J 8 HOH 375 975 933 HOH HOH A . 
J 8 HOH 376 976 712 HOH HOH A . 
J 8 HOH 377 977 747 HOH HOH A . 
J 8 HOH 378 978 966 HOH HOH A . 
J 8 HOH 379 979 625 HOH HOH A . 
J 8 HOH 380 980 845 HOH HOH A . 
J 8 HOH 381 981 749 HOH HOH A . 
J 8 HOH 382 982 946 HOH HOH A . 
J 8 HOH 383 983 770 HOH HOH A . 
J 8 HOH 384 984 2   HOH HOH A . 
J 8 HOH 385 985 813 HOH HOH A . 
K 8 HOH 1   101 113 HOH HOH T . 
K 8 HOH 2   102 105 HOH HOH T . 
K 8 HOH 3   103 121 HOH HOH T . 
K 8 HOH 4   104 132 HOH HOH T . 
K 8 HOH 5   105 118 HOH HOH T . 
K 8 HOH 6   106 102 HOH HOH T . 
K 8 HOH 7   107 128 HOH HOH T . 
K 8 HOH 8   108 107 HOH HOH T . 
K 8 HOH 9   109 110 HOH HOH T . 
K 8 HOH 10  110 115 HOH HOH T . 
K 8 HOH 11  111 112 HOH HOH T . 
K 8 HOH 12  112 106 HOH HOH T . 
K 8 HOH 13  113 104 HOH HOH T . 
K 8 HOH 14  114 103 HOH HOH T . 
K 8 HOH 15  115 125 HOH HOH T . 
K 8 HOH 16  116 129 HOH HOH T . 
K 8 HOH 17  117 120 HOH HOH T . 
K 8 HOH 18  118 123 HOH HOH T . 
K 8 HOH 19  119 116 HOH HOH T . 
K 8 HOH 20  120 117 HOH HOH T . 
K 8 HOH 21  121 122 HOH HOH T . 
K 8 HOH 22  122 114 HOH HOH T . 
K 8 HOH 23  123 119 HOH HOH T . 
K 8 HOH 24  124 136 HOH HOH T . 
K 8 HOH 25  125 135 HOH HOH T . 
K 8 HOH 26  126 127 HOH HOH T . 
K 8 HOH 27  127 133 HOH HOH T . 
K 8 HOH 28  128 131 HOH HOH T . 
K 8 HOH 29  129 109 HOH HOH T . 
K 8 HOH 30  130 108 HOH HOH T . 
K 8 HOH 31  131 130 HOH HOH T . 
K 8 HOH 32  132 897 HOH HOH T . 
K 8 HOH 33  133 641 HOH HOH T . 
L 8 HOH 1   101 109 HOH HOH P . 
L 8 HOH 2   102 112 HOH HOH P . 
L 8 HOH 3   103 677 HOH HOH P . 
L 8 HOH 4   104 103 HOH HOH P . 
L 8 HOH 5   105 9   HOH HOH P . 
L 8 HOH 6   106 101 HOH HOH P . 
L 8 HOH 7   107 119 HOH HOH P . 
L 8 HOH 8   108 700 HOH HOH P . 
L 8 HOH 9   109 106 HOH HOH P . 
L 8 HOH 10  110 102 HOH HOH P . 
L 8 HOH 11  111 117 HOH HOH P . 
L 8 HOH 12  112 116 HOH HOH P . 
L 8 HOH 13  113 108 HOH HOH P . 
L 8 HOH 14  114 110 HOH HOH P . 
L 8 HOH 15  115 104 HOH HOH P . 
L 8 HOH 16  116 118 HOH HOH P . 
L 8 HOH 17  117 113 HOH HOH P . 
L 8 HOH 18  118 850 HOH HOH P . 
L 8 HOH 19  119 124 HOH HOH P . 
L 8 HOH 20  120 107 HOH HOH P . 
L 8 HOH 21  121 111 HOH HOH P . 
L 8 HOH 22  122 115 HOH HOH P . 
L 8 HOH 23  123 105 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5750  ? 
1 MORE         -55   ? 
1 'SSA (A^2)'  21920 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 87.3  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 101.5 ? 
3  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 88.3  ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 167.9 ? 
5  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 90.6  ? 
6  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 90.3  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 98.1  ? 
8  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 171.9 ? 
9  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 84.7  ? 
10 O1B   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 85.4  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 83.8  ? 
12 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 100.9 ? 
13 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 169.7 ? 
14 O1B   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 85.0  ? 
15 O2A   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 85.7  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 87.1  ? 
17 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 101.5 ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 88.5  ? 
19 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 167.6 ? 
20 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 90.6  ? 
21 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 90.6  ? 
22 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 98.1  ? 
23 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 172.3 ? 
24 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 84.9  ? 
25 O1B   ? I DTP .   ? A DTP 506 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 85.5  ? 
26 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 83.5  ? 
27 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 100.6 ? 
28 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 169.9 ? 
29 O1B   ? I DTP .   ? A DTP 506 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 84.9  ? 
30 O2A   ? I DTP .   ? A DTP 506 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O3G   ? I DTP .   ? A DTP 506 ? 1_555 85.7  ? 
31 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 92.3  ? 
32 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 89.5  ? 
33 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 94.0  ? 
34 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 173.6 ? 
35 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 89.1  ? 
36 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 84.2  ? 
37 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? J HOH .   ? A HOH 797 ? 1_555 89.3  ? 
38 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? J HOH .   ? A HOH 797 ? 1_555 172.0 ? 
39 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? J HOH .   ? A HOH 797 ? 1_555 93.8  ? 
40 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? J HOH .   ? A HOH 797 ? 1_555 90.1  ? 
41 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 101.5 ? 
42 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 91.0  ? 
43 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 167.7 ? 
44 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 84.6  ? 
45 O     ? J HOH .   ? A HOH 797 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   ? I DTP .   ? A DTP 506 ? 1_555 81.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Database references'        
3 2 'Structure model' 'Derived calculations'       
4 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' pdbx_audit_support    
3 2 'Structure model' pdbx_struct_oper_list 
4 3 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_CSD'                  
2 2 'Structure model' '_pdbx_audit_support.funding_organization'  
3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 3 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .    2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .    4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .    5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_1             312 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_2             312 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.559 
_pdbx_validate_rmsd_bond.bond_target_value         1.474 
_pdbx_validate_rmsd_bond.bond_deviation            0.085 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.014 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DC 9 ? ? "C1'" T DC 9 ? ? N1    T DC 9 ? ? 110.54 108.30 2.24  0.30 N 
2 1 "O4'" P DA 7 ? ? "C4'" P DA 7 ? ? "C3'" P DA 7 ? ? 101.34 104.50 -3.16 0.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 26.18   62.50   
2 1 TYR A 39  ? ? 65.06   -175.63 
3 1 LYS A 40  ? ? -159.47 -33.92  
4 1 SER A 62  ? ? 80.65   -8.82   
5 1 SER A 217 ? ? -154.01 -158.52 
6 1 SER A 257 ? ? 92.32   -11.36  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KFE 'double helix'        
5KFE 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.023  -0.114 -0.054 -1.135 -3.903  5.251  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.011  -0.087 0.263  0.489  -16.163 4.888  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.208 -0.147 -0.399 -7.216 -2.585  -0.799 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.130  -0.119 0.062  5.859  -1.631  -0.470 4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.232  -0.037 -0.383 13.358 -6.885  1.873  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.445 -0.242 -0.019 -1.915 -3.186  5.267  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.000  -0.118 0.126  -5.920 -3.324  -0.517 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.144 -0.185 -0.196 14.118 -1.344  3.370  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.904  -0.994 3.323 -3.042 3.220 25.622 -3.078 -2.831 3.051 7.192  6.794   
25.995 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.556 -1.133 3.474 6.794  8.444 28.861 -3.779 2.372  2.837 16.236 -13.064 
30.789 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.554 -0.486 3.077 -3.388 0.850 34.686 -0.934 0.438  3.103 1.422  5.665   
34.856 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.517  -0.705 3.215 4.420  1.024 30.080 -1.547 -0.108 3.231 1.959  -8.456  
30.413 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.277 -0.634 3.774 -5.753 4.310 34.541 -1.781 -0.525 3.668 7.163  9.561   
35.259 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.571 -0.663 3.471 -1.165 1.665 36.965 -1.281 0.734  3.455 2.623  1.835   
37.019 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.265  0.144  2.981 0.164  2.246 27.043 -0.210 -0.528 2.985 4.792  -0.351  
27.135 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           DK036146-08 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION'                MN  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 water                               HOH 
#