data_5KFG
# 
_entry.id   5KFG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KFG         
WWPDB D_1000222118 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KFG 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gao, Y.'  1 ? 
primary 'Yang, W.' 2 ? 
# 
_cell.length_a           98.380 
_cell.length_b           98.380 
_cell.length_c           82.160 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           5KFG 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.entry_id                         5KFG 
_symmetry.Int_Tables_number                169 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 R61A ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ?    ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ?    ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                 54.938    2   ?       ?    ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ?    ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ?    ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ?    ? ? 
8 non-polymer syn 1,2-ETHANEDIOL                                       62.068    1   ?       ?    ? ? 
9 water       nat water                                                18.015    438 ?       ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' ? 9606 ? 
3 1 sample 1 8  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5KFG       5KFG   ? 2 ? 1 
3 PDB 5KFG       5KFG   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KFG A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5KFG T 1 ? 12  ? 5KFG   1 ? 12  ? 1 12  
3 3 5KFG P 1 ? 8   ? 5KFG   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KFG GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5KFG PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5KFG HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL'               'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ?                               'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KFG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.10 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.40 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.d_resolution_high            1.550 
_reflns.pdbx_number_measured_all     450906 
_reflns.number_obs                   65402 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_netI_over_sigmaI        24.180 
_reflns.pdbx_chi_squared             0.985 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.pdbx_Rrim_I_all              0.060 
_reflns.pdbx_CC_half                 1.000 
_reflns.B_iso_Wilson_estimate        23.668 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5KFG 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.9680 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  1.550 1.590 32849 ? 4830 0 0.657 3.320  ? ? ? ? ? 4830 ? ? ? ? ? 100.000 0.712 ? 0.841 
1 2  1.590 1.630 31964 ? 4684 0 0.559 3.970  ? ? ? ? ? 4685 ? ? ? ? ? 100.000 0.606 ? 0.880 
1 3  1.630 1.680 31300 ? 4580 0 0.452 4.950  ? ? ? ? ? 4580 ? ? ? ? ? 100.000 0.490 ? 0.910 
1 4  1.680 1.730 30821 ? 4483 0 0.364 6.060  ? ? ? ? ? 4483 ? ? ? ? ? 100.000 0.394 ? 0.947 
1 5  1.730 1.790 29511 ? 4286 0 0.291 7.470  ? ? ? ? ? 4286 ? ? ? ? ? 100.000 0.315 ? 0.966 
1 6  1.790 1.850 28846 ? 4181 0 0.232 9.320  ? ? ? ? ? 4181 ? ? ? ? ? 100.000 0.252 ? 0.975 
1 7  1.850 1.920 27610 ? 3999 0 0.182 11.750 ? ? ? ? ? 3999 ? ? ? ? ? 100.000 0.197 ? 0.986 
1 8  1.920 2.000 27020 ? 3898 0 0.134 15.420 ? ? ? ? ? 3898 ? ? ? ? ? 100.000 0.146 ? 0.991 
1 9  2.000 2.090 25536 ? 3681 0 0.103 19.480 ? ? ? ? ? 3681 ? ? ? ? ? 100.000 0.112 ? 0.994 
1 10 2.090 2.190 24853 ? 3571 0 0.080 24.390 ? ? ? ? ? 3571 ? ? ? ? ? 100.000 0.086 ? 0.997 
1 11 2.190 2.310 23519 ? 3383 0 0.065 29.040 ? ? ? ? ? 3383 ? ? ? ? ? 100.000 0.071 ? 0.998 
1 12 2.310 2.450 22250 ? 3190 0 0.054 33.710 ? ? ? ? ? 3190 ? ? ? ? ? 100.000 0.059 ? 0.998 
1 13 2.450 2.620 21036 ? 3025 0 0.050 36.870 ? ? ? ? ? 3026 ? ? ? ? ? 100.000 0.054 ? 0.998 
1 14 2.620 2.830 19345 ? 2796 0 0.040 43.830 ? ? ? ? ? 2797 ? ? ? ? ? 100.000 0.043 ? 0.999 
1 15 2.830 3.100 17923 ? 2589 0 0.034 50.830 ? ? ? ? ? 2590 ? ? ? ? ? 100.000 0.036 ? 0.999 
1 16 3.100 3.470 16091 ? 2334 0 0.026 62.900 ? ? ? ? ? 2341 ? ? ? ? ? 99.700  0.029 ? 0.999 
1 17 3.470 4.000 14100 ? 2062 0 0.022 71.400 ? ? ? ? ? 2066 ? ? ? ? ? 99.800  0.024 ? 1.000 
1 18 4.000 4.900 12058 ? 1745 0 0.018 76.610 ? ? ? ? ? 1753 ? ? ? ? ? 99.500  0.020 ? 1.000 
1 19 4.900 6.930 9367  ? 1354 0 0.019 75.230 ? ? ? ? ? 1362 ? ? ? ? ? 99.400  0.021 ? 1.000 
1 20 6.930 ?     4907  ? 731  0 0.020 80.790 ? ? ? ? ? 772  ? ? ? ? ? 94.700  0.022 ? 0.999 
# 
_refine.entry_id                                 5KFG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            1.5500 
_refine.ls_d_res_low                             19.9680 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.9400 
_refine.ls_number_reflns_obs                     65402 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1760 
_refine.ls_R_factor_R_work                       0.1737 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2042 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 7.7700 
_refine.ls_number_reflns_R_free                  5080 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               22.4785 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1600 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4ECQ 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                93.750 
_refine.B_iso_min                                6.440 
_refine.pdbx_overall_phase_error                 19.7600 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.5500 
_refine_hist.d_res_low                        19.9680 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             438 
_refine_hist.number_atoms_total               4240 
_refine_hist.pdbx_number_residues_total       450 
_refine_hist.pdbx_B_iso_mean_ligand           15.80 
_refine_hist.pdbx_B_iso_mean_solvent          28.42 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
# 
_refine_ls_shell.R_factor_R_free                  0.2574 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2219 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.d_res_high                       1.5500 
_refine_ls_shell.d_res_low                        1.5676 
_refine_ls_shell.number_reflns_R_free             154 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
# 
_struct.entry_id                     5KFG 
_struct.title                        'Human DNA polymerase eta-DNA ternary complex: reaction with 10 mM Mn2+ for 30s' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KFG 
_struct_keywords.text            
'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, replication, transferase-DNA complex' 
_struct_keywords.pdbx_keywords   'replication, transferase/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 9 ? 
L N N 9 ? 
M N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 AB2 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 AB3 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 AB4 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 AB5 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 AB6 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 AB7 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 AB8 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 AB9 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 AC1 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 AC2 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 AC3 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   A ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.207 ? 
metalc2  metalc ? ? A ASP 16  OD1   B ? ? 1_555 F MN  . MN  B ? A ASP 13  A MN  503 1_555 ? ? ? ? ? ? ?            2.293 ? 
metalc3  metalc ? ? A ASP 16  OD2   A ? ? 1_555 D MN  . MN  ? ? A ASP 13  A MN  501 1_555 ? ? ? ? ? ? ?            2.714 ? 
metalc4  metalc ? ? A ASP 16  OD2   B ? ? 1_555 D MN  . MN  ? ? A ASP 13  A MN  501 1_555 ? ? ? ? ? ? ?            2.102 ? 
metalc5  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.234 ? 
metalc6  metalc ? ? A MET 17  O     ? ? ? 1_555 F MN  . MN  B ? A MET 14  A MN  503 1_555 ? ? ? ? ? ? ?            2.235 ? 
metalc7  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 D MN  . MN  ? ? A ASP 115 A MN  501 1_555 ? ? ? ? ? ? ?            2.219 ? 
metalc8  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.265 ? 
metalc9  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 F MN  . MN  B ? A ASP 115 A MN  503 1_555 ? ? ? ? ? ? ?            2.266 ? 
metalc10 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MN  . MN  ? ? A GLU 116 A MN  501 1_555 ? ? ? ? ? ? ?            2.119 ? 
metalc11 metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc12 metalc ? ? D MN  .   MN    ? ? ? 1_555 K HOH . O   ? ? A MN  501 A HOH 728 1_555 ? ? ? ? ? ? ?            2.156 ? 
metalc13 metalc ? ? D MN  .   MN    ? ? ? 1_555 I DTP . O1A ? ? A MN  501 A DTP 506 1_555 ? ? ? ? ? ? ?            2.369 ? 
metalc14 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1B ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc15 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1A ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.443 ? 
metalc16 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1G ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc17 metalc ? ? F MN  .   MN    B ? ? 1_555 I DTP . O1B ? ? A MN  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc18 metalc ? ? F MN  .   MN    B ? ? 1_555 I DTP . O1A ? ? A MN  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.442 ? 
metalc19 metalc ? ? F MN  .   MN    B ? ? 1_555 I DTP . O1G ? ? A MN  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.348 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 1.56   
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -2.91  
3 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -11.17 
4 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -9.01  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? THR A 430 ? GLU A 414 THR A 427 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? THR A 430 ? GLU A 414 THR A 427 
AA5 3 GLN A 368 ? VAL A 375 ? GLN A 365 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
AA6 1 ARG A 364 ? VAL A 365 ? ARG A 361 VAL A 362 
AA6 2 SER A 433 ? ALA A 434 ? SER A 430 ALA A 431 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
AA6 1 2 N VAL A 365 ? N VAL A 362 O SER A 433 ? O SER A 430 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  501 ? 8  'binding site for residue MN A 501'  
AC2 Software A CA  502 ? 5  'binding site for residue CA A 502'  
AC3 Software A MN  503 ? 5  'binding site for residue MN A 503'  
AC4 Software A GOL 504 ? 10 'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 10 'binding site for residue GOL A 505' 
AC6 Software A DTP 506 ? 27 'binding site for residue DTP A 506' 
AC7 Software A EDO 507 ? 7  'binding site for residue EDO A 507' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4  AC1 8  CA  E .   ? CA  A 502 . ? 1_555 ? 
5  AC1 8  MN  F .   ? MN  A 503 . ? 1_555 ? 
6  AC1 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
7  AC1 8  HOH K .   ? HOH A 728 . ? 1_555 ? 
8  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
9  AC2 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 5  MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
12 AC2 5  MN  D .   ? MN  A 501 . ? 1_555 ? 
13 AC2 5  DTP I .   ? DTP A 506 . ? 1_555 ? 
14 AC3 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
15 AC3 5  MET A 17  ? MET A 14  . ? 1_555 ? 
16 AC3 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
17 AC3 5  MN  D .   ? MN  A 501 . ? 1_555 ? 
18 AC3 5  DTP I .   ? DTP A 506 . ? 1_555 ? 
19 AC4 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
20 AC4 10 GLN A 28  ? GLN A 25  . ? 6_545 ? 
21 AC4 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
22 AC4 10 SER A 251 ? SER A 248 . ? 1_555 ? 
23 AC4 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
24 AC4 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
25 AC4 10 HOH K .   ? HOH A 633 . ? 1_555 ? 
26 AC4 10 HOH K .   ? HOH A 703 . ? 1_555 ? 
27 AC4 10 HOH K .   ? HOH A 744 . ? 1_555 ? 
28 AC4 10 HOH K .   ? HOH A 828 . ? 1_555 ? 
29 AC5 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
30 AC5 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
31 AC5 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
32 AC5 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
33 AC5 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
34 AC5 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
35 AC5 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
36 AC5 10 HOH K .   ? HOH A 615 . ? 1_555 ? 
37 AC5 10 HOH K .   ? HOH A 621 . ? 5_664 ? 
38 AC5 10 HOH K .   ? HOH A 662 . ? 1_555 ? 
39 AC6 27 ASP A 16  ? ASP A 13  . ? 1_555 ? 
40 AC6 27 MET A 17  ? MET A 14  . ? 1_555 ? 
41 AC6 27 ASP A 18  ? ASP A 15  . ? 1_555 ? 
42 AC6 27 CYS A 19  ? CYS A 16  . ? 1_555 ? 
43 AC6 27 PHE A 20  ? PHE A 17  . ? 1_555 ? 
44 AC6 27 PHE A 21  ? PHE A 18  . ? 1_555 ? 
45 AC6 27 ILE A 51  ? ILE A 48  . ? 1_555 ? 
46 AC6 27 ALA A 52  ? ALA A 49  . ? 1_555 ? 
47 AC6 27 TYR A 55  ? TYR A 52  . ? 1_555 ? 
48 AC6 27 ARG A 58  ? ARG A 55  . ? 1_555 ? 
49 AC6 27 ARG A 64  ? ARG A 61  . ? 1_555 ? 
50 AC6 27 ASP A 118 ? ASP A 115 . ? 1_555 ? 
51 AC6 27 LYS A 234 ? LYS A 231 . ? 1_555 ? 
52 AC6 27 MN  D .   ? MN  A 501 . ? 1_555 ? 
53 AC6 27 CA  E .   ? CA  A 502 . ? 1_555 ? 
54 AC6 27 MN  F .   ? MN  A 503 . ? 1_555 ? 
55 AC6 27 HOH K .   ? HOH A 643 . ? 1_555 ? 
56 AC6 27 HOH K .   ? HOH A 648 . ? 1_555 ? 
57 AC6 27 HOH K .   ? HOH A 653 . ? 1_555 ? 
58 AC6 27 HOH K .   ? HOH A 728 . ? 1_555 ? 
59 AC6 27 HOH K .   ? HOH A 768 . ? 1_555 ? 
60 AC6 27 HOH K .   ? HOH A 807 . ? 1_555 ? 
61 AC6 27 DT  C 8   ? DT  P 8   . ? 1_555 ? 
62 AC6 27 HOH M .   ? HOH P 103 . ? 1_555 ? 
63 AC6 27 DT  B 3   ? DT  T 3   . ? 1_555 ? 
64 AC6 27 DT  B 4   ? DT  T 4   . ? 1_555 ? 
65 AC6 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
66 AC7 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
67 AC7 7  LYS A 227 ? LYS A 224 . ? 1_555 ? 
68 AC7 7  CYS A 230 ? CYS A 227 . ? 1_555 ? 
69 AC7 7  GLY A 231 ? GLY A 228 . ? 1_555 ? 
70 AC7 7  LYS A 234 ? LYS A 231 . ? 1_555 ? 
71 AC7 7  HOH K .   ? HOH A 643 . ? 1_555 ? 
72 AC7 7  HOH K .   ? HOH A 718 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KFG 
_atom_sites.fract_transf_matrix[1][1]   0.010165 
_atom_sites.fract_transf_matrix[1][2]   0.005869 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011737 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012171 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.654 -34.100 -3.473  1.00 43.21 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.065 -33.779 -3.611  1.00 42.99 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.373 -32.836 -4.762  1.00 45.48 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.079 -31.642 -4.684  1.00 50.00 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 67.971 -33.371 -5.841  1.00 45.23 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.399 -32.621 -7.033  1.00 47.25 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.248 -32.109 -7.907  1.00 47.13 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.442 -31.175 -8.692  1.00 52.02 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.239 -33.649 -7.805  1.00 45.00 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.696 -34.974 -7.377  1.00 44.65 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.314 -34.801 -5.934  1.00 44.30 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.069 -32.710 -7.772  1.00 37.62 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 64.906 -32.303 -8.560  1.00 45.33 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 63.947 -31.435 -7.752  1.00 46.13 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 62.926 -30.981 -8.270  1.00 42.17 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.170 -33.536 -9.094  1.00 35.10 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.073 -34.531 -9.749  1.00 33.63 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.759 -34.260 -10.915 1.00 30.74 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.414 -35.794 -9.397  1.00 27.80 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.480 -35.314 -11.254 1.00 30.36 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.290 -36.258 -10.350 1.00 29.06 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.277 -31.207 -6.483  1.00 47.51 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.420 -30.418 -5.603  1.00 49.22 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.661 -28.925 -5.796  1.00 49.47 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.668 -28.380 -5.335  1.00 46.34 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.644 -30.804 -4.136  1.00 51.46 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.690 -31.877 -3.627  1.00 57.53 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.003 -31.269 -3.407  1.00 72.65 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 60.141 -32.181 -4.686  1.00 55.14 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.726 -28.274 -6.484  1.00 49.67 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.809 -26.840 -6.737  1.00 47.34 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 62.865 -26.065 -5.428  1.00 43.43 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.204 -26.423 -4.450  1.00 39.92 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.636 -26.373 -7.582  1.00 44.07 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.665 -25.005 -5.411  1.00 35.92 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 63.917 -24.275 -4.176  1.00 30.15 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.426 -22.833 -4.229  1.00 24.54 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.632 -22.073 -3.282  1.00 24.22 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.406 -24.279 -3.842  1.00 33.18 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.131 -23.662 -4.914  1.00 29.49 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 65.895 -25.707 -3.643  1.00 32.35 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.778 -22.464 -5.331  1.00 25.12 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.212 -21.132 -5.472  1.00 22.66 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.266 -20.046 -5.354  1.00 21.19 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.068 -19.050 -4.647  1.00 20.31 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.393 -20.246 -6.034  1.00 18.95 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.518 -19.322 -5.952  1.00 15.07 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 65.872 -18.759 -7.314  1.00 15.70 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 66.972 -18.243 -7.508  1.00 16.30 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.749 -20.015 -5.354  1.00 15.02 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.678 -20.251 -3.848  1.00 17.67 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 67.905 -20.980 -3.326  1.00 18.59 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.725 -20.424 -2.582  1.00 21.79 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.043 -22.230 -3.723  1.00 19.74 ? 5   GLN A NE2   1 
ATOM   55   N  N     A ASP A 1 9   ? 64.916 -18.849 -8.233  0.53 16.99 ? 6   ASP A N     1 
ATOM   56   N  N     B ASP A 1 9   ? 64.937 -18.734 -8.259  0.47 17.08 ? 6   ASP A N     1 
ATOM   57   C  CA    A ASP A 1 9   ? 65.095 -18.486 -9.631  0.53 19.93 ? 6   ASP A CA    1 
ATOM   58   C  CA    B ASP A 1 9   ? 65.257 -18.410 -9.644  0.47 19.94 ? 6   ASP A CA    1 
ATOM   59   C  C     A ASP A 1 9   ? 65.069 -16.974 -9.875  0.53 16.29 ? 6   ASP A C     1 
ATOM   60   C  C     B ASP A 1 9   ? 65.071 -16.921 -9.918  0.47 16.30 ? 6   ASP A C     1 
ATOM   61   O  O     A ASP A 1 9   ? 65.662 -16.488 -10.833 0.53 20.88 ? 6   ASP A O     1 
ATOM   62   O  O     B ASP A 1 9   ? 65.585 -16.393 -10.904 0.47 21.05 ? 6   ASP A O     1 
ATOM   63   C  CB    A ASP A 1 9   ? 64.011 -19.168 -10.490 0.53 20.99 ? 6   ASP A CB    1 
ATOM   64   C  CB    B ASP A 1 9   ? 64.392 -19.233 -10.600 0.47 21.50 ? 6   ASP A CB    1 
ATOM   65   C  CG    A ASP A 1 9   ? 62.598 -19.082 -9.867  0.53 19.67 ? 6   ASP A CG    1 
ATOM   66   C  CG    B ASP A 1 9   ? 65.150 -20.391 -11.220 0.47 25.43 ? 6   ASP A CG    1 
ATOM   67   O  OD1   A ASP A 1 9   ? 62.404 -19.459 -8.686  0.53 20.34 ? 6   ASP A OD1   1 
ATOM   68   O  OD1   B ASP A 1 9   ? 66.276 -20.679 -10.763 0.47 28.38 ? 6   ASP A OD1   1 
ATOM   69   O  OD2   A ASP A 1 9   ? 61.661 -18.622 -10.566 0.53 25.37 ? 6   ASP A OD2   1 
ATOM   70   O  OD2   B ASP A 1 9   ? 64.619 -21.014 -12.163 0.47 28.49 ? 6   ASP A OD2   1 
ATOM   71   N  N     . ARG A 1 10  ? 64.383 -16.239 -9.008  1.00 15.05 ? 7   ARG A N     1 
ATOM   72   C  CA    . ARG A 1 10  ? 64.176 -14.805 -9.214  1.00 14.77 ? 7   ARG A CA    1 
ATOM   73   C  C     . ARG A 1 10  ? 64.811 -13.963 -8.124  1.00 12.84 ? 7   ARG A C     1 
ATOM   74   O  O     . ARG A 1 10  ? 65.036 -14.443 -7.011  1.00 13.60 ? 7   ARG A O     1 
ATOM   75   C  CB    . ARG A 1 10  ? 62.680 -14.462 -9.254  1.00 11.67 ? 7   ARG A CB    1 
ATOM   76   C  CG    . ARG A 1 10  ? 61.892 -15.104 -10.375 1.00 15.16 ? 7   ARG A CG    1 
ATOM   77   C  CD    . ARG A 1 10  ? 60.421 -14.737 -10.247 1.00 14.92 ? 7   ARG A CD    1 
ATOM   78   N  NE    . ARG A 1 10  ? 59.772 -15.384 -9.109  1.00 13.62 ? 7   ARG A NE    1 
ATOM   79   C  CZ    . ARG A 1 10  ? 58.701 -14.900 -8.482  1.00 12.53 ? 7   ARG A CZ    1 
ATOM   80   N  NH1   . ARG A 1 10  ? 58.164 -15.562 -7.461  1.00 11.36 ? 7   ARG A NH1   1 
ATOM   81   N  NH2   . ARG A 1 10  ? 58.176 -13.737 -8.860  1.00 13.44 ? 7   ARG A NH2   1 
ATOM   82   N  N     . VAL A 1 11  ? 65.069 -12.695 -8.437  1.00 11.10 ? 8   VAL A N     1 
ATOM   83   C  CA    . VAL A 1 11  ? 65.357 -11.704 -7.401  1.00 7.90  ? 8   VAL A CA    1 
ATOM   84   C  C     . VAL A 1 11  ? 64.213 -10.693 -7.413  1.00 10.75 ? 8   VAL A C     1 
ATOM   85   O  O     . VAL A 1 11  ? 63.974 -10.061 -8.430  1.00 12.10 ? 8   VAL A O     1 
ATOM   86   C  CB    . VAL A 1 11  ? 66.701 -10.977 -7.612  1.00 11.88 ? 8   VAL A CB    1 
ATOM   87   C  CG1   . VAL A 1 11  ? 66.949 -9.973  -6.495  1.00 13.72 ? 8   VAL A CG1   1 
ATOM   88   C  CG2   . VAL A 1 11  ? 67.842 -11.996 -7.652  1.00 12.66 ? 8   VAL A CG2   1 
ATOM   89   N  N     . VAL A 1 12  ? 63.504 -10.569 -6.290  1.00 9.39  ? 9   VAL A N     1 
ATOM   90   C  CA    . VAL A 1 12  ? 62.329 -9.701  -6.197  1.00 8.71  ? 9   VAL A CA    1 
ATOM   91   C  C     . VAL A 1 12  ? 62.518 -8.750  -5.030  1.00 9.98  ? 9   VAL A C     1 
ATOM   92   O  O     . VAL A 1 12  ? 62.948 -9.166  -3.949  1.00 10.00 ? 9   VAL A O     1 
ATOM   93   C  CB    . VAL A 1 12  ? 61.033 -10.499 -5.973  1.00 6.55  ? 9   VAL A CB    1 
ATOM   94   C  CG1   . VAL A 1 12  ? 59.836 -9.576  -5.735  1.00 11.99 ? 9   VAL A CG1   1 
ATOM   95   C  CG2   . VAL A 1 12  ? 60.760 -11.407 -7.170  1.00 9.47  ? 9   VAL A CG2   1 
ATOM   96   N  N     . ALA A 1 13  ? 62.212 -7.473  -5.234  1.00 9.66  ? 10  ALA A N     1 
ATOM   97   C  CA    . ALA A 1 13  ? 62.255 -6.533  -4.126  1.00 9.46  ? 10  ALA A CA    1 
ATOM   98   C  C     . ALA A 1 13  ? 60.898 -5.917  -3.928  1.00 9.24  ? 10  ALA A C     1 
ATOM   99   O  O     . ALA A 1 13  ? 60.101 -5.863  -4.865  1.00 10.96 ? 10  ALA A O     1 
ATOM   100  C  CB    . ALA A 1 13  ? 63.309 -5.445  -4.358  1.00 11.13 ? 10  ALA A CB    1 
ATOM   101  N  N     . LEU A 1 14  ? 60.646 -5.463  -2.703  1.00 8.28  ? 11  LEU A N     1 
ATOM   102  C  CA    . LEU A 1 14  ? 59.476 -4.665  -2.389  1.00 9.02  ? 11  LEU A CA    1 
ATOM   103  C  C     . LEU A 1 14  ? 59.986 -3.381  -1.777  1.00 12.13 ? 11  LEU A C     1 
ATOM   104  O  O     . LEU A 1 14  ? 60.725 -3.416  -0.792  1.00 12.81 ? 11  LEU A O     1 
ATOM   105  C  CB    . LEU A 1 14  ? 58.540 -5.412  -1.444  1.00 13.07 ? 11  LEU A CB    1 
ATOM   106  C  CG    . LEU A 1 14  ? 57.183 -4.829  -1.011  1.00 13.70 ? 11  LEU A CG    1 
ATOM   107  C  CD1   . LEU A 1 14  ? 57.314 -3.932  0.209   1.00 12.37 ? 11  LEU A CD1   1 
ATOM   108  C  CD2   . LEU A 1 14  ? 56.465 -4.091  -2.174  1.00 10.81 ? 11  LEU A CD2   1 
ATOM   109  N  N     . VAL A 1 15  ? 59.620 -2.254  -2.380  1.00 9.74  ? 12  VAL A N     1 
ATOM   110  C  CA    . VAL A 1 15  ? 60.020 -0.941  -1.880  1.00 9.87  ? 12  VAL A CA    1 
ATOM   111  C  C     . VAL A 1 15  ? 58.785 -0.253  -1.320  1.00 10.91 ? 12  VAL A C     1 
ATOM   112  O  O     . VAL A 1 15  ? 57.776 -0.142  -2.015  1.00 13.09 ? 12  VAL A O     1 
ATOM   113  C  CB    . VAL A 1 15  ? 60.648 -0.078  -2.986  1.00 10.78 ? 12  VAL A CB    1 
ATOM   114  C  CG1   . VAL A 1 15  ? 61.060 1.280   -2.421  1.00 11.42 ? 12  VAL A CG1   1 
ATOM   115  C  CG2   . VAL A 1 15  ? 61.839 -0.803  -3.601  1.00 14.04 ? 12  VAL A CG2   1 
ATOM   116  N  N     . ASP A 1 16  ? 58.864 0.179   -0.061  1.00 10.40 ? 13  ASP A N     1 
ATOM   117  C  CA    A ASP A 1 16  ? 57.722 0.716   0.673   0.21 12.44 ? 13  ASP A CA    1 
ATOM   118  C  CA    B ASP A 1 16  ? 57.712 0.752   0.632   0.79 12.50 ? 13  ASP A CA    1 
ATOM   119  C  C     . ASP A 1 16  ? 58.100 2.052   1.318   1.00 9.87  ? 13  ASP A C     1 
ATOM   120  O  O     . ASP A 1 16  ? 59.051 2.099   2.091   1.00 11.22 ? 13  ASP A O     1 
ATOM   121  C  CB    A ASP A 1 16  ? 57.286 -0.292  1.743   0.21 11.93 ? 13  ASP A CB    1 
ATOM   122  C  CB    B ASP A 1 16  ? 57.159 -0.231  1.663   0.79 11.87 ? 13  ASP A CB    1 
ATOM   123  C  CG    A ASP A 1 16  ? 55.842 -0.131  2.151   0.21 13.89 ? 13  ASP A CG    1 
ATOM   124  C  CG    B ASP A 1 16  ? 56.000 0.342   2.436   0.79 11.56 ? 13  ASP A CG    1 
ATOM   125  O  OD1   A ASP A 1 16  ? 55.499 0.929   2.698   0.21 11.26 ? 13  ASP A OD1   1 
ATOM   126  O  OD1   B ASP A 1 16  ? 56.238 0.870   3.532   0.79 14.27 ? 13  ASP A OD1   1 
ATOM   127  O  OD2   A ASP A 1 16  ? 55.050 -1.076  1.937   0.21 13.35 ? 13  ASP A OD2   1 
ATOM   128  O  OD2   B ASP A 1 16  ? 54.855 0.275   1.934   0.79 14.85 ? 13  ASP A OD2   1 
ATOM   129  N  N     . MET A 1 17  ? 57.363 3.122   1.040   1.00 8.30  ? 14  MET A N     1 
ATOM   130  C  CA    . MET A 1 17  ? 57.760 4.420   1.581   1.00 9.84  ? 14  MET A CA    1 
ATOM   131  C  C     . MET A 1 17  ? 57.566 4.484   3.098   1.00 9.02  ? 14  MET A C     1 
ATOM   132  O  O     . MET A 1 17  ? 56.631 3.898   3.612   1.00 11.13 ? 14  MET A O     1 
ATOM   133  C  CB    . MET A 1 17  ? 56.967 5.544   0.912   1.00 12.82 ? 14  MET A CB    1 
ATOM   134  C  CG    . MET A 1 17  ? 56.996 5.506   -0.597  1.00 11.07 ? 14  MET A CG    1 
ATOM   135  S  SD    . MET A 1 17  ? 58.659 5.522   -1.289  1.00 13.56 ? 14  MET A SD    1 
ATOM   136  C  CE    . MET A 1 17  ? 59.255 7.061   -0.701  1.00 17.33 ? 14  MET A CE    1 
ATOM   137  N  N     . ASP A 1 18  ? 58.460 5.162   3.812   1.00 8.02  ? 15  ASP A N     1 
ATOM   138  C  CA    . ASP A 1 18  ? 58.290 5.311   5.264   1.00 9.42  ? 15  ASP A CA    1 
ATOM   139  C  C     . ASP A 1 18  ? 57.224 6.353   5.576   1.00 9.20  ? 15  ASP A C     1 
ATOM   140  O  O     . ASP A 1 18  ? 57.274 7.458   5.024   1.00 11.17 ? 15  ASP A O     1 
ATOM   141  C  CB    . ASP A 1 18  ? 59.578 5.773   5.938   1.00 11.25 ? 15  ASP A CB    1 
ATOM   142  C  CG    . ASP A 1 18  ? 60.731 4.786   5.764   1.00 11.66 ? 15  ASP A CG    1 
ATOM   143  O  OD1   . ASP A 1 18  ? 60.470 3.580   5.618   1.00 14.22 ? 15  ASP A OD1   1 
ATOM   144  O  OD2   . ASP A 1 18  ? 61.888 5.241   5.793   1.00 17.96 ? 15  ASP A OD2   1 
ATOM   145  N  N     . CYS A 1 19  ? 56.281 5.983   6.446   1.00 8.69  ? 16  CYS A N     1 
ATOM   146  C  CA    . CYS A 1 19  ? 55.177 6.855   6.912   1.00 9.36  ? 16  CYS A CA    1 
ATOM   147  C  C     . CYS A 1 19  ? 54.771 7.839   5.806   1.00 8.98  ? 16  CYS A C     1 
ATOM   148  O  O     . CYS A 1 19  ? 54.923 9.058   5.950   1.00 8.73  ? 16  CYS A O     1 
ATOM   149  C  CB    . CYS A 1 19  ? 55.524 7.604   8.214   1.00 10.32 ? 16  CYS A CB    1 
ATOM   150  S  SG    . CYS A 1 19  ? 57.069 8.523   8.294   1.00 12.54 ? 16  CYS A SG    1 
ATOM   151  N  N     . PHE A 1 20  ? 54.278 7.298   4.695   1.00 8.76  ? 17  PHE A N     1 
ATOM   152  C  CA    . PHE A 1 20  ? 54.295 8.024   3.424   1.00 7.66  ? 17  PHE A CA    1 
ATOM   153  C  C     . PHE A 1 20  ? 53.558 9.364   3.440   1.00 8.06  ? 17  PHE A C     1 
ATOM   154  O  O     . PHE A 1 20  ? 54.156 10.382  3.092   1.00 7.37  ? 17  PHE A O     1 
ATOM   155  C  CB    . PHE A 1 20  ? 53.722 7.139   2.299   1.00 8.29  ? 17  PHE A CB    1 
ATOM   156  C  CG    . PHE A 1 20  ? 53.779 7.781   0.938   1.00 8.21  ? 17  PHE A CG    1 
ATOM   157  C  CD1   . PHE A 1 20  ? 54.944 8.380   0.483   1.00 10.29 ? 17  PHE A CD1   1 
ATOM   158  C  CD2   . PHE A 1 20  ? 52.661 7.799   0.122   1.00 9.92  ? 17  PHE A CD2   1 
ATOM   159  C  CE1   . PHE A 1 20  ? 54.988 8.978   -0.785  1.00 11.45 ? 17  PHE A CE1   1 
ATOM   160  C  CE2   . PHE A 1 20  ? 52.709 8.390   -1.147  1.00 11.47 ? 17  PHE A CE2   1 
ATOM   161  C  CZ    . PHE A 1 20  ? 53.866 8.970   -1.592  1.00 10.40 ? 17  PHE A CZ    1 
ATOM   162  N  N     . PHE A 1 21  ? 52.294 9.386   3.860   1.00 7.99  ? 18  PHE A N     1 
ATOM   163  C  CA    . PHE A 1 21  ? 51.573 10.660  3.786   1.00 7.35  ? 18  PHE A CA    1 
ATOM   164  C  C     . PHE A 1 21  ? 52.229 11.703  4.698   1.00 9.66  ? 18  PHE A C     1 
ATOM   165  O  O     . PHE A 1 21  ? 52.205 12.890  4.396   1.00 9.72  ? 18  PHE A O     1 
ATOM   166  C  CB    . PHE A 1 21  ? 50.088 10.529  4.169   1.00 7.71  ? 18  PHE A CB    1 
ATOM   167  C  CG    . PHE A 1 21  ? 49.235 9.796   3.179   1.00 8.83  ? 18  PHE A CG    1 
ATOM   168  C  CD1   . PHE A 1 21  ? 49.774 9.060   2.126   1.00 7.98  ? 18  PHE A CD1   1 
ATOM   169  C  CD2   . PHE A 1 21  ? 47.864 9.851   3.306   1.00 9.52  ? 18  PHE A CD2   1 
ATOM   170  C  CE1   . PHE A 1 21  ? 48.933 8.391   1.229   1.00 11.48 ? 18  PHE A CE1   1 
ATOM   171  C  CE2   . PHE A 1 21  ? 47.020 9.190   2.414   1.00 9.25  ? 18  PHE A CE2   1 
ATOM   172  C  CZ    . PHE A 1 21  ? 47.562 8.448   1.386   1.00 10.10 ? 18  PHE A CZ    1 
ATOM   173  N  N     . VAL A 1 22  ? 52.794 11.261  5.822   1.00 7.43  ? 19  VAL A N     1 
ATOM   174  C  CA    . VAL A 1 22  ? 53.524 12.182  6.692   1.00 7.44  ? 19  VAL A CA    1 
ATOM   175  C  C     . VAL A 1 22  ? 54.731 12.779  5.968   1.00 9.31  ? 19  VAL A C     1 
ATOM   176  O  O     . VAL A 1 22  ? 54.968 13.994  6.042   1.00 9.30  ? 19  VAL A O     1 
ATOM   177  C  CB    . VAL A 1 22  ? 53.960 11.474  7.994   1.00 6.63  ? 19  VAL A CB    1 
ATOM   178  C  CG1   . VAL A 1 22  ? 55.072 12.259  8.713   1.00 11.67 ? 19  VAL A CG1   1 
ATOM   179  C  CG2   . VAL A 1 22  ? 52.739 11.245  8.908   1.00 10.37 ? 19  VAL A CG2   1 
ATOM   180  N  N     . GLN A 1 23  ? 55.495 11.957  5.256   1.00 8.85  ? 20  GLN A N     1 
ATOM   181  C  CA    . GLN A 1 23  ? 56.655 12.503  4.541   1.00 6.94  ? 20  GLN A CA    1 
ATOM   182  C  C     . GLN A 1 23  ? 56.230 13.499  3.481   1.00 8.17  ? 20  GLN A C     1 
ATOM   183  O  O     . GLN A 1 23  ? 56.932 14.489  3.251   1.00 8.67  ? 20  GLN A O     1 
ATOM   184  C  CB    . GLN A 1 23  ? 57.474 11.405  3.883   1.00 9.73  ? 20  GLN A CB    1 
ATOM   185  C  CG    . GLN A 1 23  ? 58.315 10.581  4.827   1.00 12.16 ? 20  GLN A CG    1 
ATOM   186  C  CD    . GLN A 1 23  ? 59.418 9.896   4.060   1.00 11.01 ? 20  GLN A CD    1 
ATOM   187  O  OE1   . GLN A 1 23  ? 60.464 10.491  3.803   1.00 12.76 ? 20  GLN A OE1   1 
ATOM   188  N  NE2   . GLN A 1 23  ? 59.182 8.648   3.661   1.00 13.74 ? 20  GLN A NE2   1 
ATOM   189  N  N     . VAL A 1 24  ? 55.131 13.216  2.790   1.00 7.36  ? 21  VAL A N     1 
ATOM   190  C  CA    . VAL A 1 24  ? 54.619 14.162  1.790   1.00 7.32  ? 21  VAL A CA    1 
ATOM   191  C  C     . VAL A 1 24  ? 54.320 15.497  2.464   1.00 8.76  ? 21  VAL A C     1 
ATOM   192  O  O     . VAL A 1 24  ? 54.697 16.558  1.947   1.00 9.69  ? 21  VAL A O     1 
ATOM   193  C  CB    . VAL A 1 24  ? 53.359 13.625  1.077   1.00 6.92  ? 21  VAL A CB    1 
ATOM   194  C  CG1   . VAL A 1 24  ? 52.771 14.670  0.120   1.00 8.05  ? 21  VAL A CG1   1 
ATOM   195  C  CG2   . VAL A 1 24  ? 53.700 12.336  0.317   1.00 7.66  ? 21  VAL A CG2   1 
ATOM   196  N  N     . GLU A 1 25  ? 53.668 15.463  3.623   1.00 7.15  ? 22  GLU A N     1 
ATOM   197  C  CA    . GLU A 1 25  ? 53.354 16.722  4.300   1.00 7.58  ? 22  GLU A CA    1 
ATOM   198  C  C     . GLU A 1 25  ? 54.612 17.380  4.880   1.00 9.80  ? 22  GLU A C     1 
ATOM   199  O  O     . GLU A 1 25  ? 54.698 18.603  4.930   1.00 9.46  ? 22  GLU A O     1 
ATOM   200  C  CB    . GLU A 1 25  ? 52.295 16.492  5.389   1.00 7.60  ? 22  GLU A CB    1 
ATOM   201  C  CG    . GLU A 1 25  ? 50.969 16.015  4.846   1.00 8.65  ? 22  GLU A CG    1 
ATOM   202  C  CD    . GLU A 1 25  ? 50.250 17.061  3.996   1.00 10.41 ? 22  GLU A CD    1 
ATOM   203  O  OE1   . GLU A 1 25  ? 50.510 18.269  4.180   1.00 12.56 ? 22  GLU A OE1   1 
ATOM   204  O  OE2   . GLU A 1 25  ? 49.425 16.663  3.141   1.00 13.43 ? 22  GLU A OE2   1 
ATOM   205  N  N     . GLN A 1 26  ? 55.586 16.579  5.321   1.00 8.66  ? 23  GLN A N     1 
ATOM   206  C  CA    . GLN A 1 26  ? 56.825 17.137  5.873   1.00 8.37  ? 23  GLN A CA    1 
ATOM   207  C  C     . GLN A 1 26  ? 57.715 17.783  4.805   1.00 9.41  ? 23  GLN A C     1 
ATOM   208  O  O     . GLN A 1 26  ? 58.430 18.755  5.073   1.00 9.51  ? 23  GLN A O     1 
ATOM   209  C  CB    . GLN A 1 26  ? 57.614 16.049  6.599   1.00 9.81  ? 23  GLN A CB    1 
ATOM   210  C  CG    . GLN A 1 26  ? 57.008 15.634  7.922   1.00 10.33 ? 23  GLN A CG    1 
ATOM   211  C  CD    . GLN A 1 26  ? 57.769 14.480  8.537   1.00 10.29 ? 23  GLN A CD    1 
ATOM   212  O  OE1   . GLN A 1 26  ? 58.209 13.582  7.831   1.00 11.94 ? 23  GLN A OE1   1 
ATOM   213  N  NE2   . GLN A 1 26  ? 57.937 14.511  9.854   1.00 12.60 ? 23  GLN A NE2   1 
ATOM   214  N  N     . ARG A 1 27  ? 57.685 17.239  3.594   1.00 8.30  ? 24  ARG A N     1 
ATOM   215  C  CA    . ARG A 1 27  ? 58.414 17.863  2.498   1.00 7.67  ? 24  ARG A CA    1 
ATOM   216  C  C     . ARG A 1 27  ? 57.833 19.254  2.249   1.00 9.67  ? 24  ARG A C     1 
ATOM   217  O  O     . ARG A 1 27  ? 58.569 20.222  2.119   1.00 10.51 ? 24  ARG A O     1 
ATOM   218  C  CB    . ARG A 1 27  ? 58.336 17.014  1.230   1.00 8.22  ? 24  ARG A CB    1 
ATOM   219  C  CG    . ARG A 1 27  ? 59.128 17.630  0.072   1.00 8.75  ? 24  ARG A CG    1 
ATOM   220  C  CD    . ARG A 1 27  ? 59.182 16.712  -1.135  1.00 10.80 ? 24  ARG A CD    1 
ATOM   221  N  NE    . ARG A 1 27  ? 57.879 16.626  -1.781  1.00 9.49  ? 24  ARG A NE    1 
ATOM   222  C  CZ    . ARG A 1 27  ? 57.666 16.047  -2.955  1.00 8.68  ? 24  ARG A CZ    1 
ATOM   223  N  NH1   . ARG A 1 27  ? 58.671 15.480  -3.623  1.00 10.04 ? 24  ARG A NH1   1 
ATOM   224  N  NH2   . ARG A 1 27  ? 56.441 16.037  -3.459  1.00 11.70 ? 24  ARG A NH2   1 
ATOM   225  N  N     . GLN A 1 28  ? 56.507 19.336  2.240   1.00 7.76  ? 25  GLN A N     1 
ATOM   226  C  CA    . GLN A 1 28  ? 55.799 20.583  1.940   1.00 8.99  ? 25  GLN A CA    1 
ATOM   227  C  C     . GLN A 1 28  ? 55.975 21.626  3.033   1.00 11.87 ? 25  GLN A C     1 
ATOM   228  O  O     . GLN A 1 28  ? 56.090 22.822  2.753   1.00 11.06 ? 25  GLN A O     1 
ATOM   229  C  CB    . GLN A 1 28  ? 54.305 20.314  1.733   1.00 9.44  ? 25  GLN A CB    1 
ATOM   230  C  CG    . GLN A 1 28  ? 53.536 21.527  1.197   1.00 11.20 ? 25  GLN A CG    1 
ATOM   231  C  CD    . GLN A 1 28  ? 52.056 21.221  1.013   1.00 13.43 ? 25  GLN A CD    1 
ATOM   232  O  OE1   . GLN A 1 28  ? 51.699 20.141  0.564   1.00 14.96 ? 25  GLN A OE1   1 
ATOM   233  N  NE2   . GLN A 1 28  ? 51.197 22.188  1.329   1.00 22.42 ? 25  GLN A NE2   1 
ATOM   234  N  N     . ASN A 1 29  ? 55.944 21.169  4.280   1.00 8.92  ? 26  ASN A N     1 
ATOM   235  C  CA    . ASN A 1 29  ? 56.007 22.042  5.441   1.00 10.74 ? 26  ASN A CA    1 
ATOM   236  C  C     . ASN A 1 29  ? 57.166 21.648  6.339   1.00 10.33 ? 26  ASN A C     1 
ATOM   237  O  O     . ASN A 1 29  ? 57.035 20.758  7.168   1.00 10.33 ? 26  ASN A O     1 
ATOM   238  C  CB    . ASN A 1 29  ? 54.694 21.992  6.228   1.00 10.97 ? 26  ASN A CB    1 
ATOM   239  C  CG    . ASN A 1 29  ? 54.685 22.963  7.408   1.00 12.05 ? 26  ASN A CG    1 
ATOM   240  O  OD1   . ASN A 1 29  ? 55.670 23.645  7.662   1.00 13.96 ? 26  ASN A OD1   1 
ATOM   241  N  ND2   . ASN A 1 29  ? 53.558 23.039  8.112   1.00 17.03 ? 26  ASN A ND2   1 
ATOM   242  N  N     . PRO A 1 30  ? 58.313 22.309  6.166   1.00 10.58 ? 27  PRO A N     1 
ATOM   243  C  CA    . PRO A 1 30  ? 59.519 21.993  6.933   1.00 11.10 ? 27  PRO A CA    1 
ATOM   244  C  C     . PRO A 1 30  ? 59.335 22.056  8.452   1.00 12.46 ? 27  PRO A C     1 
ATOM   245  O  O     . PRO A 1 30  ? 60.085 21.383  9.161   1.00 12.93 ? 27  PRO A O     1 
ATOM   246  C  CB    . PRO A 1 30  ? 60.513 23.065  6.465   1.00 15.31 ? 27  PRO A CB    1 
ATOM   247  C  CG    . PRO A 1 30  ? 60.070 23.370  5.068   1.00 14.05 ? 27  PRO A CG    1 
ATOM   248  C  CD    . PRO A 1 30  ? 58.572 23.300  5.106   1.00 11.77 ? 27  PRO A CD    1 
ATOM   249  N  N     . HIS A 1 31  ? 58.360 22.822  8.937   1.00 11.15 ? 28  HIS A N     1 
ATOM   250  C  CA    . HIS A 1 31  ? 58.087 22.867  10.379  1.00 16.19 ? 28  HIS A CA    1 
ATOM   251  C  C     . HIS A 1 31  ? 57.708 21.506  10.950  1.00 16.40 ? 28  HIS A C     1 
ATOM   252  O  O     . HIS A 1 31  ? 57.819 21.277  12.160  1.00 17.32 ? 28  HIS A O     1 
ATOM   253  C  CB    . HIS A 1 31  ? 56.962 23.857  10.683  1.00 17.08 ? 28  HIS A CB    1 
ATOM   254  C  CG    . HIS A 1 31  ? 57.382 25.287  10.622  1.00 20.89 ? 28  HIS A CG    1 
ATOM   255  N  ND1   . HIS A 1 31  ? 56.608 26.265  10.034  1.00 28.14 ? 28  HIS A ND1   1 
ATOM   256  C  CD2   . HIS A 1 31  ? 58.491 25.910  11.086  1.00 22.51 ? 28  HIS A CD2   1 
ATOM   257  C  CE1   . HIS A 1 31  ? 57.224 27.429  10.138  1.00 23.86 ? 28  HIS A CE1   1 
ATOM   258  N  NE2   . HIS A 1 31  ? 58.371 27.240  10.767  1.00 25.08 ? 28  HIS A NE2   1 
ATOM   259  N  N     . LEU A 1 32  ? 57.244 20.603  10.091  1.00 12.80 ? 29  LEU A N     1 
ATOM   260  C  CA    . LEU A 1 32  ? 56.811 19.279  10.550  1.00 11.90 ? 29  LEU A CA    1 
ATOM   261  C  C     . LEU A 1 32  ? 57.944 18.259  10.569  1.00 12.37 ? 29  LEU A C     1 
ATOM   262  O  O     . LEU A 1 32  ? 57.795 17.169  11.117  1.00 10.88 ? 29  LEU A O     1 
ATOM   263  C  CB    . LEU A 1 32  ? 55.685 18.742  9.662   1.00 9.97  ? 29  LEU A CB    1 
ATOM   264  C  CG    . LEU A 1 32  ? 54.466 19.640  9.528   1.00 12.20 ? 29  LEU A CG    1 
ATOM   265  C  CD1   . LEU A 1 32  ? 53.441 18.973  8.618   1.00 13.38 ? 29  LEU A CD1   1 
ATOM   266  C  CD2   . LEU A 1 32  ? 53.864 19.909  10.902  1.00 17.83 ? 29  LEU A CD2   1 
ATOM   267  N  N     . ARG A 1 33  ? 59.076 18.598  9.955   1.00 10.35 ? 30  ARG A N     1 
ATOM   268  C  CA    . ARG A 1 33  ? 60.171 17.646  9.841   1.00 11.36 ? 30  ARG A CA    1 
ATOM   269  C  C     . ARG A 1 33  ? 60.772 17.303  11.201  1.00 11.63 ? 30  ARG A C     1 
ATOM   270  O  O     . ARG A 1 33  ? 60.888 18.165  12.061  1.00 13.66 ? 30  ARG A O     1 
ATOM   271  C  CB    . ARG A 1 33  ? 61.258 18.198  8.911   1.00 11.68 ? 30  ARG A CB    1 
ATOM   272  C  CG    . ARG A 1 33  ? 60.740 18.480  7.509   1.00 10.67 ? 30  ARG A CG    1 
ATOM   273  C  CD    . ARG A 1 33  ? 61.799 19.058  6.602   1.00 14.13 ? 30  ARG A CD    1 
ATOM   274  N  NE    . ARG A 1 33  ? 61.239 19.336  5.278   1.00 13.21 ? 30  ARG A NE    1 
ATOM   275  C  CZ    . ARG A 1 33  ? 61.939 19.844  4.268   1.00 16.20 ? 30  ARG A CZ    1 
ATOM   276  N  NH1   . ARG A 1 33  ? 63.223 20.133  4.430   1.00 15.53 ? 30  ARG A NH1   1 
ATOM   277  N  NH2   . ARG A 1 33  ? 61.349 20.072  3.103   1.00 13.45 ? 30  ARG A NH2   1 
ATOM   278  N  N     . ASN A 1 34  ? 61.113 16.025  11.380  1.00 13.96 ? 31  ASN A N     1 
ATOM   279  C  CA    . ASN A 1 34  ? 61.752 15.548  12.612  1.00 16.07 ? 31  ASN A CA    1 
ATOM   280  C  C     . ASN A 1 34  ? 60.944 15.870  13.858  1.00 19.19 ? 31  ASN A C     1 
ATOM   281  O  O     . ASN A 1 34  ? 61.485 16.260  14.901  1.00 20.57 ? 31  ASN A O     1 
ATOM   282  C  CB    . ASN A 1 34  ? 63.157 16.133  12.739  1.00 22.00 ? 31  ASN A CB    1 
ATOM   283  C  CG    . ASN A 1 34  ? 64.011 15.832  11.525  1.00 23.32 ? 31  ASN A CG    1 
ATOM   284  O  OD1   . ASN A 1 34  ? 64.289 14.670  11.231  1.00 32.17 ? 31  ASN A OD1   1 
ATOM   285  N  ND2   . ASN A 1 34  ? 64.419 16.874  10.807  1.00 28.39 ? 31  ASN A ND2   1 
ATOM   286  N  N     . LYS A 1 35  ? 59.636 15.699  13.733  1.00 13.27 ? 32  LYS A N     1 
ATOM   287  C  CA    . LYS A 1 35  ? 58.698 15.990  14.800  1.00 13.20 ? 32  LYS A CA    1 
ATOM   288  C  C     . LYS A 1 35  ? 57.733 14.848  14.943  1.00 13.87 ? 32  LYS A C     1 
ATOM   289  O  O     . LYS A 1 35  ? 57.487 14.142  13.971  1.00 12.84 ? 32  LYS A O     1 
ATOM   290  C  CB    . LYS A 1 35  ? 57.905 17.266  14.501  1.00 14.72 ? 32  LYS A CB    1 
ATOM   291  C  CG    . LYS A 1 35  ? 58.747 18.528  14.515  1.00 17.99 ? 32  LYS A CG    1 
ATOM   292  C  CD    . LYS A 1 35  ? 58.987 19.006  15.935  1.00 30.43 ? 32  LYS A CD    1 
ATOM   293  C  CE    . LYS A 1 35  ? 60.092 20.064  15.982  1.00 36.42 ? 32  LYS A CE    1 
ATOM   294  N  NZ    . LYS A 1 35  ? 60.026 21.039  14.857  1.00 37.18 ? 32  LYS A NZ    1 
ATOM   295  N  N     . PRO A 1 36  ? 57.158 14.681  16.144  1.00 12.51 ? 33  PRO A N     1 
ATOM   296  C  CA    . PRO A 1 36  ? 56.003 13.796  16.273  1.00 11.23 ? 33  PRO A CA    1 
ATOM   297  C  C     . PRO A 1 36  ? 54.857 14.423  15.491  1.00 10.38 ? 33  PRO A C     1 
ATOM   298  O  O     . PRO A 1 36  ? 54.410 15.522  15.817  1.00 11.34 ? 33  PRO A O     1 
ATOM   299  C  CB    . PRO A 1 36  ? 55.716 13.784  17.775  1.00 11.57 ? 33  PRO A CB    1 
ATOM   300  C  CG    . PRO A 1 36  ? 56.286 15.069  18.293  1.00 15.56 ? 33  PRO A CG    1 
ATOM   301  C  CD    . PRO A 1 36  ? 57.466 15.400  17.398  1.00 14.18 ? 33  PRO A CD    1 
ATOM   302  N  N     . CYS A 1 37  ? 54.416 13.750  14.443  1.00 11.48 ? 34  CYS A N     1 
ATOM   303  C  CA    A CYS A 1 37  ? 53.486 14.322  13.475  0.40 11.77 ? 34  CYS A CA    1 
ATOM   304  C  CA    B CYS A 1 37  ? 53.337 14.315  13.663  0.60 11.79 ? 34  CYS A CA    1 
ATOM   305  C  C     . CYS A 1 37  ? 52.546 13.229  12.969  1.00 11.33 ? 34  CYS A C     1 
ATOM   306  O  O     . CYS A 1 37  ? 52.965 12.076  12.890  1.00 11.87 ? 34  CYS A O     1 
ATOM   307  C  CB    A CYS A 1 37  ? 54.284 14.962  12.320  0.40 11.84 ? 34  CYS A CB    1 
ATOM   308  C  CB    B CYS A 1 37  ? 53.873 15.333  12.658  0.60 12.74 ? 34  CYS A CB    1 
ATOM   309  S  SG    A CYS A 1 37  ? 53.376 15.660  10.903  0.40 12.61 ? 34  CYS A SG    1 
ATOM   310  S  SG    B CYS A 1 37  ? 54.936 14.638  11.415  0.60 12.48 ? 34  CYS A SG    1 
ATOM   311  N  N     . ALA A 1 38  ? 51.331 13.592  12.570  1.00 8.16  ? 35  ALA A N     1 
ATOM   312  C  CA    . ALA A 1 38  ? 50.414 12.641  11.970  1.00 9.44  ? 35  ALA A CA    1 
ATOM   313  C  C     . ALA A 1 38  ? 49.591 13.340  10.916  1.00 9.46  ? 35  ALA A C     1 
ATOM   314  O  O     . ALA A 1 38  ? 49.470 14.561  10.939  1.00 10.67 ? 35  ALA A O     1 
ATOM   315  C  CB    . ALA A 1 38  ? 49.519 12.017  13.014  1.00 10.79 ? 35  ALA A CB    1 
ATOM   316  N  N     . VAL A 1 39  ? 49.022 12.556  10.007  1.00 7.93  ? 36  VAL A N     1 
ATOM   317  C  CA    . VAL A 1 39  ? 48.098 13.087  9.016   1.00 8.09  ? 36  VAL A CA    1 
ATOM   318  C  C     . VAL A 1 39  ? 46.703 12.642  9.381   1.00 11.78 ? 36  VAL A C     1 
ATOM   319  O  O     . VAL A 1 39  ? 46.480 11.474  9.720   1.00 10.61 ? 36  VAL A O     1 
ATOM   320  C  CB    . VAL A 1 39  ? 48.475 12.625  7.603   1.00 8.13  ? 36  VAL A CB    1 
ATOM   321  C  CG1   . VAL A 1 39  ? 47.414 13.028  6.583   1.00 10.42 ? 36  VAL A CG1   1 
ATOM   322  C  CG2   . VAL A 1 39  ? 49.835 13.202  7.225   1.00 10.02 ? 36  VAL A CG2   1 
ATOM   323  N  N     . VAL A 1 40  ? 45.771 13.591  9.334   1.00 11.59 ? 37  VAL A N     1 
ATOM   324  C  CA    . VAL A 1 40  ? 44.416 13.379  9.806   1.00 11.51 ? 37  VAL A CA    1 
ATOM   325  C  C     . VAL A 1 40  ? 43.417 13.700  8.703   1.00 13.51 ? 37  VAL A C     1 
ATOM   326  O  O     . VAL A 1 40  ? 43.676 14.564  7.865   1.00 14.09 ? 37  VAL A O     1 
ATOM   327  C  CB    . VAL A 1 40  ? 44.120 14.263  11.066  1.00 14.26 ? 37  VAL A CB    1 
ATOM   328  C  CG1   A VAL A 1 40  ? 44.880 13.747  12.269  0.46 12.44 ? 37  VAL A CG1   1 
ATOM   329  C  CG1   B VAL A 1 40  ? 43.915 15.718  10.681  0.54 14.74 ? 37  VAL A CG1   1 
ATOM   330  C  CG2   A VAL A 1 40  ? 44.443 15.726  10.797  0.46 14.83 ? 37  VAL A CG2   1 
ATOM   331  C  CG2   B VAL A 1 40  ? 42.939 13.770  11.812  0.54 12.99 ? 37  VAL A CG2   1 
ATOM   332  N  N     . GLN A 1 41  ? 42.281 13.015  8.682   1.00 11.80 ? 38  GLN A N     1 
ATOM   333  C  CA    . GLN A 1 41  ? 41.225 13.472  7.782   1.00 13.69 ? 38  GLN A CA    1 
ATOM   334  C  C     . GLN A 1 41  ? 39.989 13.823  8.583   1.00 11.54 ? 38  GLN A C     1 
ATOM   335  O  O     . GLN A 1 41  ? 39.619 13.136  9.532   1.00 13.43 ? 38  GLN A O     1 
ATOM   336  C  CB    . GLN A 1 41  ? 40.924 12.456  6.668   1.00 21.41 ? 38  GLN A CB    1 
ATOM   337  C  CG    . GLN A 1 41  ? 40.594 11.061  7.085   1.00 23.22 ? 38  GLN A CG    1 
ATOM   338  C  CD    . GLN A 1 41  ? 40.611 10.082  5.902   1.00 20.28 ? 38  GLN A CD    1 
ATOM   339  O  OE1   . GLN A 1 41  ? 40.957 10.434  4.761   1.00 23.12 ? 38  GLN A OE1   1 
ATOM   340  N  NE2   . GLN A 1 41  ? 40.235 8.852   6.178   1.00 23.40 ? 38  GLN A NE2   1 
ATOM   341  N  N     . TYR A 1 42  ? 39.395 14.939  8.169   1.00 13.19 ? 39  TYR A N     1 
ATOM   342  C  CA    . TYR A 1 42  ? 38.279 15.596  8.828   1.00 15.78 ? 39  TYR A CA    1 
ATOM   343  C  C     . TYR A 1 42  ? 38.777 16.101  10.179  1.00 19.05 ? 39  TYR A C     1 
ATOM   344  O  O     . TYR A 1 42  ? 39.969 15.980  10.489  1.00 19.48 ? 39  TYR A O     1 
ATOM   345  C  CB    . TYR A 1 42  ? 37.078 14.660  8.907   1.00 15.16 ? 39  TYR A CB    1 
ATOM   346  C  CG    . TYR A 1 42  ? 36.686 14.129  7.524   1.00 13.71 ? 39  TYR A CG    1 
ATOM   347  C  CD1   . TYR A 1 42  ? 36.304 15.002  6.515   1.00 15.86 ? 39  TYR A CD1   1 
ATOM   348  C  CD2   . TYR A 1 42  ? 36.738 12.765  7.222   1.00 12.88 ? 39  TYR A CD2   1 
ATOM   349  C  CE1   . TYR A 1 42  ? 35.952 14.539  5.254   1.00 17.46 ? 39  TYR A CE1   1 
ATOM   350  C  CE2   . TYR A 1 42  ? 36.381 12.292  5.953   1.00 14.77 ? 39  TYR A CE2   1 
ATOM   351  C  CZ    . TYR A 1 42  ? 35.990 13.185  4.981   1.00 14.21 ? 39  TYR A CZ    1 
ATOM   352  O  OH    . TYR A 1 42  ? 35.628 12.736  3.726   1.00 14.41 ? 39  TYR A OH    1 
ATOM   353  N  N     . LYS A 1 43  ? 37.906 16.715  10.960  1.00 21.33 ? 40  LYS A N     1 
ATOM   354  C  CA    . LYS A 1 43  ? 38.374 17.394  12.175  1.00 20.64 ? 40  LYS A CA    1 
ATOM   355  C  C     . LYS A 1 43  ? 37.290 17.517  13.227  1.00 26.78 ? 40  LYS A C     1 
ATOM   356  O  O     . LYS A 1 43  ? 37.555 17.436  14.431  1.00 23.51 ? 40  LYS A O     1 
ATOM   357  C  CB    . LYS A 1 43  ? 38.919 18.784  11.831  1.00 23.57 ? 40  LYS A CB    1 
ATOM   358  C  CG    . LYS A 1 43  ? 40.437 18.884  11.927  1.00 37.11 ? 40  LYS A CG    1 
ATOM   359  C  CD    . LYS A 1 43  ? 40.867 19.268  13.335  1.00 34.09 ? 40  LYS A CD    1 
ATOM   360  C  CE    . LYS A 1 43  ? 42.386 19.179  13.509  1.00 32.49 ? 40  LYS A CE    1 
ATOM   361  N  NZ    . LYS A 1 43  ? 42.874 20.118  14.557  1.00 33.84 ? 40  LYS A NZ    1 
ATOM   362  N  N     . SER A 1 44  ? 36.061 17.718  12.767  1.00 21.09 ? 41  SER A N     1 
ATOM   363  C  CA    . SER A 1 44  ? 34.944 17.960  13.663  1.00 24.73 ? 41  SER A CA    1 
ATOM   364  C  C     . SER A 1 44  ? 34.676 16.813  14.633  1.00 24.52 ? 41  SER A C     1 
ATOM   365  O  O     . SER A 1 44  ? 34.399 17.048  15.810  1.00 28.79 ? 41  SER A O     1 
ATOM   366  C  CB    . SER A 1 44  ? 33.693 18.261  12.845  1.00 31.55 ? 41  SER A CB    1 
ATOM   367  O  OG    . SER A 1 44  ? 33.834 19.526  12.223  1.00 38.99 ? 41  SER A OG    1 
ATOM   368  N  N     . TRP A 1 45  ? 34.757 15.576  14.147  1.00 25.34 ? 42  TRP A N     1 
ATOM   369  C  CA    . TRP A 1 45  ? 34.529 14.418  15.008  1.00 21.00 ? 42  TRP A CA    1 
ATOM   370  C  C     . TRP A 1 45  ? 35.841 13.970  15.637  1.00 21.12 ? 42  TRP A C     1 
ATOM   371  O  O     . TRP A 1 45  ? 36.728 13.447  14.955  1.00 20.69 ? 42  TRP A O     1 
ATOM   372  C  CB    . TRP A 1 45  ? 33.888 13.270  14.223  1.00 21.61 ? 42  TRP A CB    1 
ATOM   373  C  CG    . TRP A 1 45  ? 33.444 12.105  15.066  1.00 28.15 ? 42  TRP A CG    1 
ATOM   374  C  CD1   . TRP A 1 45  ? 34.153 10.970  15.339  1.00 26.72 ? 42  TRP A CD1   1 
ATOM   375  C  CD2   . TRP A 1 45  ? 32.184 11.958  15.724  1.00 29.03 ? 42  TRP A CD2   1 
ATOM   376  N  NE1   . TRP A 1 45  ? 33.415 10.129  16.136  1.00 32.14 ? 42  TRP A NE1   1 
ATOM   377  C  CE2   . TRP A 1 45  ? 32.201 10.711  16.384  1.00 33.29 ? 42  TRP A CE2   1 
ATOM   378  C  CE3   . TRP A 1 45  ? 31.041 12.759  15.819  1.00 31.75 ? 42  TRP A CE3   1 
ATOM   379  C  CZ2   . TRP A 1 45  ? 31.119 10.249  17.134  1.00 36.53 ? 42  TRP A CZ2   1 
ATOM   380  C  CZ3   . TRP A 1 45  ? 29.967 12.297  16.564  1.00 33.95 ? 42  TRP A CZ3   1 
ATOM   381  C  CH2   . TRP A 1 45  ? 30.012 11.053  17.209  1.00 34.46 ? 42  TRP A CH2   1 
ATOM   382  N  N     . LYS A 1 46  ? 35.950 14.222  16.940  1.00 22.73 ? 43  LYS A N     1 
ATOM   383  C  CA    . LYS A 1 46  ? 37.062 13.775  17.777  1.00 18.48 ? 43  LYS A CA    1 
ATOM   384  C  C     . LYS A 1 46  ? 38.433 14.174  17.246  1.00 18.05 ? 43  LYS A C     1 
ATOM   385  O  O     . LYS A 1 46  ? 39.419 13.472  17.465  1.00 17.80 ? 43  LYS A O     1 
ATOM   386  C  CB    . LYS A 1 46  ? 36.993 12.261  17.963  1.00 22.39 ? 43  LYS A CB    1 
ATOM   387  C  CG    . LYS A 1 46  ? 35.756 11.784  18.716  1.00 26.67 ? 43  LYS A CG    1 
ATOM   388  C  CD    . LYS A 1 46  ? 35.689 10.269  18.749  1.00 28.15 ? 43  LYS A CD    1 
ATOM   389  C  CE    . LYS A 1 46  ? 34.611 9.779   19.697  1.00 39.32 ? 43  LYS A CE    1 
ATOM   390  N  NZ    . LYS A 1 46  ? 34.920 10.169  21.106  1.00 49.67 ? 43  LYS A NZ    1 
ATOM   391  N  N     . GLY A 1 47  ? 38.488 15.303  16.551  1.00 17.23 ? 44  GLY A N     1 
ATOM   392  C  CA    . GLY A 1 47  ? 39.738 15.869  16.089  1.00 16.68 ? 44  GLY A CA    1 
ATOM   393  C  C     . GLY A 1 47  ? 40.184 15.357  14.740  1.00 13.43 ? 44  GLY A C     1 
ATOM   394  O  O     . GLY A 1 47  ? 41.205 15.790  14.230  1.00 16.27 ? 44  GLY A O     1 
ATOM   395  N  N     . GLY A 1 48  ? 39.399 14.438  14.179  1.00 17.05 ? 45  GLY A N     1 
ATOM   396  C  CA    . GLY A 1 48  ? 39.712 13.818  12.909  1.00 17.61 ? 45  GLY A CA    1 
ATOM   397  C  C     . GLY A 1 48  ? 40.354 12.456  13.099  1.00 19.03 ? 45  GLY A C     1 
ATOM   398  O  O     . GLY A 1 48  ? 40.896 12.148  14.163  1.00 16.19 ? 45  GLY A O     1 
ATOM   399  N  N     . GLY A 1 49  ? 40.349 11.650  12.047  1.00 13.27 ? 46  GLY A N     1 
ATOM   400  C  CA    . GLY A 1 49  ? 40.895 10.308  12.143  1.00 12.69 ? 46  GLY A CA    1 
ATOM   401  C  C     . GLY A 1 49  ? 42.309 10.252  11.592  1.00 13.38 ? 46  GLY A C     1 
ATOM   402  O  O     . GLY A 1 49  ? 42.567 10.748  10.496  1.00 12.89 ? 46  GLY A O     1 
ATOM   403  N  N     . ILE A 1 50  ? 43.221 9.644   12.344  1.00 12.16 ? 47  ILE A N     1 
ATOM   404  C  CA    . ILE A 1 50  ? 44.615 9.567   11.915  1.00 9.36  ? 47  ILE A CA    1 
ATOM   405  C  C     . ILE A 1 50  ? 44.826 8.472   10.871  1.00 10.87 ? 47  ILE A C     1 
ATOM   406  O  O     . ILE A 1 50  ? 44.387 7.341   11.061  1.00 12.59 ? 47  ILE A O     1 
ATOM   407  C  CB    . ILE A 1 50  ? 45.526 9.302   13.127  1.00 11.15 ? 47  ILE A CB    1 
ATOM   408  C  CG1   . ILE A 1 50  ? 45.530 10.536  14.024  1.00 17.33 ? 47  ILE A CG1   1 
ATOM   409  C  CG2   . ILE A 1 50  ? 46.939 8.899   12.694  1.00 12.78 ? 47  ILE A CG2   1 
ATOM   410  C  CD1   . ILE A 1 50  ? 46.355 10.372  15.256  1.00 21.90 ? 47  ILE A CD1   1 
ATOM   411  N  N     . ILE A 1 51  ? 45.510 8.799   9.781   1.00 9.91  ? 48  ILE A N     1 
ATOM   412  C  CA    . ILE A 1 51  ? 45.770 7.795   8.757   1.00 10.55 ? 48  ILE A CA    1 
ATOM   413  C  C     . ILE A 1 51  ? 47.258 7.563   8.501   1.00 11.16 ? 48  ILE A C     1 
ATOM   414  O  O     . ILE A 1 51  ? 47.602 6.618   7.814   1.00 12.07 ? 48  ILE A O     1 
ATOM   415  C  CB    . ILE A 1 51  ? 45.068 8.127   7.417   1.00 14.60 ? 48  ILE A CB    1 
ATOM   416  C  CG1   . ILE A 1 51  ? 45.523 9.473   6.831   1.00 11.59 ? 48  ILE A CG1   1 
ATOM   417  C  CG2   . ILE A 1 51  ? 43.538 8.074   7.590   1.00 16.37 ? 48  ILE A CG2   1 
ATOM   418  C  CD1   . ILE A 1 51  ? 44.964 9.722   5.414   1.00 14.02 ? 48  ILE A CD1   1 
ATOM   419  N  N     . ALA A 1 52  ? 48.132 8.386   9.071   1.00 10.23 ? 49  ALA A N     1 
ATOM   420  C  CA    . ALA A 1 52  ? 49.582 8.166   8.950   1.00 8.01  ? 49  ALA A CA    1 
ATOM   421  C  C     . ALA A 1 52  ? 50.288 8.827   10.121  1.00 7.37  ? 49  ALA A C     1 
ATOM   422  O  O     . ALA A 1 52  ? 49.830 9.864   10.600  1.00 9.56  ? 49  ALA A O     1 
ATOM   423  C  CB    . ALA A 1 52  ? 50.122 8.713   7.607   1.00 8.70  ? 49  ALA A CB    1 
ATOM   424  N  N     . VAL A 1 53  ? 51.382 8.221   10.600  1.00 7.66  ? 50  VAL A N     1 
ATOM   425  C  CA    . VAL A 1 53  ? 52.050 8.634   11.839  1.00 7.96  ? 50  VAL A CA    1 
ATOM   426  C  C     . VAL A 1 53  ? 53.562 8.599   11.702  1.00 8.26  ? 50  VAL A C     1 
ATOM   427  O  O     . VAL A 1 53  ? 54.115 7.565   11.293  1.00 9.43  ? 50  VAL A O     1 
ATOM   428  C  CB    . VAL A 1 53  ? 51.668 7.687   13.014  1.00 9.04  ? 50  VAL A CB    1 
ATOM   429  C  CG1   . VAL A 1 53  ? 52.212 8.203   14.338  1.00 11.20 ? 50  VAL A CG1   1 
ATOM   430  C  CG2   . VAL A 1 53  ? 50.165 7.499   13.102  1.00 12.76 ? 50  VAL A CG2   1 
ATOM   431  N  N     . SER A 1 54  ? 54.234 9.686   12.073  1.00 8.59  ? 51  SER A N     1 
ATOM   432  C  CA    . SER A 1 54  ? 55.692 9.734   12.012  1.00 10.66 ? 51  SER A CA    1 
ATOM   433  C  C     . SER A 1 54  ? 56.280 8.813   13.069  1.00 11.28 ? 51  SER A C     1 
ATOM   434  O  O     . SER A 1 54  ? 55.625 8.497   14.068  1.00 10.17 ? 51  SER A O     1 
ATOM   435  C  CB    . SER A 1 54  ? 56.206 11.166  12.205  1.00 10.30 ? 51  SER A CB    1 
ATOM   436  O  OG    . SER A 1 54  ? 56.267 11.501  13.585  1.00 10.53 ? 51  SER A OG    1 
ATOM   437  N  N     . TYR A 1 55  ? 57.510 8.363   12.838  1.00 11.04 ? 52  TYR A N     1 
ATOM   438  C  CA    . TYR A 1 55  ? 58.134 7.441   13.781  1.00 10.38 ? 52  TYR A CA    1 
ATOM   439  C  C     . TYR A 1 55  ? 58.360 8.089   15.144  1.00 11.47 ? 52  TYR A C     1 
ATOM   440  O  O     . TYR A 1 55  ? 58.262 7.409   16.165  1.00 12.11 ? 52  TYR A O     1 
ATOM   441  C  CB    . TYR A 1 55  ? 59.432 6.877   13.188  1.00 10.57 ? 52  TYR A CB    1 
ATOM   442  C  CG    . TYR A 1 55  ? 59.102 5.781   12.206  1.00 10.68 ? 52  TYR A CG    1 
ATOM   443  C  CD1   . TYR A 1 55  ? 58.703 6.084   10.908  1.00 11.67 ? 52  TYR A CD1   1 
ATOM   444  C  CD2   . TYR A 1 55  ? 59.106 4.448   12.592  1.00 14.21 ? 52  TYR A CD2   1 
ATOM   445  C  CE1   . TYR A 1 55  ? 58.342 5.091   10.017  1.00 12.23 ? 52  TYR A CE1   1 
ATOM   446  C  CE2   . TYR A 1 55  ? 58.761 3.441   11.700  1.00 13.33 ? 52  TYR A CE2   1 
ATOM   447  C  CZ    . TYR A 1 55  ? 58.375 3.758   10.418  1.00 13.34 ? 52  TYR A CZ    1 
ATOM   448  O  OH    . TYR A 1 55  ? 58.024 2.751   9.540   1.00 14.66 ? 52  TYR A OH    1 
ATOM   449  N  N     . GLU A 1 56  ? 58.609 9.395   15.170  1.00 12.85 ? 53  GLU A N     1 
ATOM   450  C  CA    . GLU A 1 56  ? 58.685 10.106  16.446  1.00 12.43 ? 53  GLU A CA    1 
ATOM   451  C  C     . GLU A 1 56  ? 57.369 9.999   17.224  1.00 12.40 ? 53  GLU A C     1 
ATOM   452  O  O     . GLU A 1 56  ? 57.367 9.848   18.444  1.00 16.11 ? 53  GLU A O     1 
ATOM   453  C  CB    . GLU A 1 56  ? 59.034 11.584  16.234  1.00 13.55 ? 53  GLU A CB    1 
ATOM   454  C  CG    . GLU A 1 56  ? 60.415 11.865  15.654  1.00 17.30 ? 53  GLU A CG    1 
ATOM   455  C  CD    . GLU A 1 56  ? 60.511 11.695  14.135  1.00 23.58 ? 53  GLU A CD    1 
ATOM   456  O  OE1   . GLU A 1 56  ? 59.539 11.230  13.488  1.00 20.21 ? 53  GLU A OE1   1 
ATOM   457  O  OE2   . GLU A 1 56  ? 61.581 12.038  13.585  1.00 28.11 ? 53  GLU A OE2   1 
ATOM   458  N  N     . ALA A 1 57  ? 56.240 10.117  16.527  1.00 9.63  ? 54  ALA A N     1 
ATOM   459  C  CA    . ALA A 1 57  ? 54.951 10.036  17.197  1.00 10.46 ? 54  ALA A CA    1 
ATOM   460  C  C     . ALA A 1 57  ? 54.613 8.606   17.609  1.00 11.06 ? 54  ALA A C     1 
ATOM   461  O  O     . ALA A 1 57  ? 53.957 8.397   18.618  1.00 12.00 ? 54  ALA A O     1 
ATOM   462  C  CB    . ALA A 1 57  ? 53.842 10.606  16.298  1.00 10.32 ? 54  ALA A CB    1 
ATOM   463  N  N     . ARG A 1 58  ? 55.053 7.619   16.830  1.00 10.99 ? 55  ARG A N     1 
ATOM   464  C  CA    . ARG A 1 58  ? 54.793 6.224   17.181  1.00 11.54 ? 55  ARG A CA    1 
ATOM   465  C  C     . ARG A 1 58  ? 55.419 5.868   18.526  1.00 11.04 ? 55  ARG A C     1 
ATOM   466  O  O     . ARG A 1 58  ? 54.900 5.006   19.247  1.00 14.07 ? 55  ARG A O     1 
ATOM   467  C  CB    . ARG A 1 58  ? 55.329 5.286   16.106  1.00 11.49 ? 55  ARG A CB    1 
ATOM   468  C  CG    . ARG A 1 58  ? 54.660 5.474   14.788  1.00 12.45 ? 55  ARG A CG    1 
ATOM   469  C  CD    . ARG A 1 58  ? 55.187 4.499   13.766  1.00 11.15 ? 55  ARG A CD    1 
ATOM   470  N  NE    . ARG A 1 58  ? 54.799 4.954   12.429  1.00 9.85  ? 55  ARG A NE    1 
ATOM   471  C  CZ    . ARG A 1 58  ? 54.875 4.235   11.319  1.00 13.91 ? 55  ARG A CZ    1 
ATOM   472  N  NH1   . ARG A 1 58  ? 55.306 2.978   11.358  1.00 14.21 ? 55  ARG A NH1   1 
ATOM   473  N  NH2   . ARG A 1 58  ? 54.491 4.784   10.157  1.00 13.30 ? 55  ARG A NH2   1 
ATOM   474  N  N     . ALA A 1 59  ? 56.515 6.542   18.859  1.00 10.98 ? 56  ALA A N     1 
ATOM   475  C  CA    . ALA A 1 59  ? 57.203 6.311   20.137  1.00 12.04 ? 56  ALA A CA    1 
ATOM   476  C  C     . ALA A 1 59  ? 56.293 6.636   21.325  1.00 15.63 ? 56  ALA A C     1 
ATOM   477  O  O     . ALA A 1 59  ? 56.481 6.104   22.427  1.00 17.43 ? 56  ALA A O     1 
ATOM   478  C  CB    . ALA A 1 59  ? 58.486 7.132   20.212  1.00 14.24 ? 56  ALA A CB    1 
ATOM   479  N  N     . PHE A 1 60  ? 55.308 7.505   21.110  1.00 11.31 ? 57  PHE A N     1 
ATOM   480  C  CA    . PHE A 1 60  ? 54.359 7.874   22.167  1.00 12.17 ? 57  PHE A CA    1 
ATOM   481  C  C     . PHE A 1 60  ? 53.144 6.958   22.188  1.00 13.22 ? 57  PHE A C     1 
ATOM   482  O  O     . PHE A 1 60  ? 52.284 7.065   23.066  1.00 16.38 ? 57  PHE A O     1 
ATOM   483  C  CB    . PHE A 1 60  ? 53.881 9.322   21.998  1.00 12.71 ? 57  PHE A CB    1 
ATOM   484  C  CG    . PHE A 1 60  ? 54.928 10.356  22.276  1.00 13.75 ? 57  PHE A CG    1 
ATOM   485  C  CD1   . PHE A 1 60  ? 54.981 10.989  23.513  1.00 17.66 ? 57  PHE A CD1   1 
ATOM   486  C  CD2   . PHE A 1 60  ? 55.846 10.713  21.304  1.00 14.90 ? 57  PHE A CD2   1 
ATOM   487  C  CE1   . PHE A 1 60  ? 55.933 11.961  23.773  1.00 23.61 ? 57  PHE A CE1   1 
ATOM   488  C  CE2   . PHE A 1 60  ? 56.798 11.676  21.554  1.00 18.07 ? 57  PHE A CE2   1 
ATOM   489  C  CZ    . PHE A 1 60  ? 56.841 12.304  22.792  1.00 23.02 ? 57  PHE A CZ    1 
ATOM   490  N  N     . GLY A 1 61  ? 53.049 6.084   21.195  1.00 13.44 ? 58  GLY A N     1 
ATOM   491  C  CA    . GLY A 1 61  ? 51.935 5.156   21.093  1.00 14.75 ? 58  GLY A CA    1 
ATOM   492  C  C     . GLY A 1 61  ? 50.838 5.589   20.137  1.00 12.05 ? 58  GLY A C     1 
ATOM   493  O  O     . GLY A 1 61  ? 49.755 4.986   20.085  1.00 13.22 ? 58  GLY A O     1 
ATOM   494  N  N     . VAL A 1 62  ? 51.107 6.643   19.362  1.00 12.61 ? 59  VAL A N     1 
ATOM   495  C  CA    . VAL A 1 62  ? 50.138 7.098   18.376  1.00 13.54 ? 59  VAL A CA    1 
ATOM   496  C  C     . VAL A 1 62  ? 50.078 6.100   17.229  1.00 12.79 ? 59  VAL A C     1 
ATOM   497  O  O     . VAL A 1 62  ? 51.112 5.639   16.739  1.00 11.68 ? 59  VAL A O     1 
ATOM   498  C  CB    . VAL A 1 62  ? 50.481 8.512   17.850  1.00 11.86 ? 59  VAL A CB    1 
ATOM   499  C  CG1   . VAL A 1 62  ? 49.448 8.972   16.817  1.00 13.31 ? 59  VAL A CG1   1 
ATOM   500  C  CG2   . VAL A 1 62  ? 50.525 9.500   19.015  1.00 13.41 ? 59  VAL A CG2   1 
ATOM   501  N  N     . THR A 1 63  ? 48.864 5.763   16.803  1.00 13.76 ? 60  THR A N     1 
ATOM   502  C  CA    . THR A 1 63  ? 48.682 4.802   15.721  1.00 13.33 ? 60  THR A CA    1 
ATOM   503  C  C     . THR A 1 63  ? 47.654 5.255   14.710  1.00 15.38 ? 60  THR A C     1 
ATOM   504  O  O     . THR A 1 63  ? 46.855 6.152   14.964  1.00 15.75 ? 60  THR A O     1 
ATOM   505  C  CB    . THR A 1 63  ? 48.233 3.419   16.242  1.00 16.59 ? 60  THR A CB    1 
ATOM   506  O  OG1   . THR A 1 63  ? 46.967 3.545   16.901  1.00 19.17 ? 60  THR A OG1   1 
ATOM   507  C  CG2   . THR A 1 63  ? 49.246 2.857   17.203  1.00 17.03 ? 60  THR A CG2   1 
ATOM   508  N  N     . ARG A 1 64  ? 47.661 4.616   13.567  1.00 15.49 ? 61  ARG A N     1 
ATOM   509  C  CA    . ARG A 1 64  ? 46.594 4.755   12.629  1.00 18.25 ? 61  ARG A CA    1 
ATOM   510  C  C     . ARG A 1 64  ? 45.259 4.327   13.223  1.00 19.02 ? 61  ARG A C     1 
ATOM   511  O  O     . ARG A 1 64  ? 45.211 3.486   14.060  1.00 20.63 ? 61  ARG A O     1 
ATOM   512  C  CB    . ARG A 1 64  ? 46.943 3.960   11.349  1.00 20.75 ? 61  ARG A CB    1 
ATOM   513  C  CG    . ARG A 1 64  ? 45.903 3.844   10.277  1.00 30.20 ? 61  ARG A CG    1 
ATOM   514  C  CD    . ARG A 1 64  ? 46.478 3.004   9.158   1.00 24.85 ? 61  ARG A CD    1 
ATOM   515  N  NE    . ARG A 1 64  ? 47.478 3.766   8.493   1.00 26.26 ? 61  ARG A NE    1 
ATOM   516  C  CZ    . ARG A 1 64  ? 48.667 3.351   8.078   1.00 26.91 ? 61  ARG A CZ    1 
ATOM   517  N  NH1   . ARG A 1 64  ? 49.072 2.077   8.152   1.00 24.93 ? 61  ARG A NH1   1 
ATOM   518  N  NH2   . ARG A 1 64  ? 49.414 4.259   7.525   1.00 17.74 ? 61  ARG A NH2   1 
ATOM   519  N  N     . SER A 1 65  ? 44.198 4.954   12.736  1.00 18.79 ? 62  SER A N     1 
ATOM   520  C  CA    . SER A 1 65  ? 42.811 4.694   13.154  1.00 24.14 ? 62  SER A CA    1 
ATOM   521  C  C     . SER A 1 65  ? 42.438 5.353   14.480  1.00 20.62 ? 62  SER A C     1 
ATOM   522  O  O     . SER A 1 65  ? 41.284 5.341   14.890  1.00 31.66 ? 62  SER A O     1 
ATOM   523  C  CB    . SER A 1 65  ? 42.531 3.199   13.249  1.00 31.24 ? 62  SER A CB    1 
ATOM   524  O  OG    . SER A 1 65  ? 42.749 2.739   14.568  1.00 39.19 ? 62  SER A OG    1 
ATOM   525  N  N     . MET A 1 66  ? 43.424 5.922   15.150  1.00 22.28 ? 63  MET A N     1 
ATOM   526  C  CA    . MET A 1 66  ? 43.196 6.666   16.374  1.00 19.02 ? 63  MET A CA    1 
ATOM   527  C  C     . MET A 1 66  ? 42.537 8.006   16.036  1.00 15.57 ? 63  MET A C     1 
ATOM   528  O  O     . MET A 1 66  ? 42.872 8.608   15.019  1.00 15.64 ? 63  MET A O     1 
ATOM   529  C  CB    . MET A 1 66  ? 44.538 6.857   17.069  1.00 21.20 ? 63  MET A CB    1 
ATOM   530  C  CG    . MET A 1 66  ? 44.548 7.291   18.480  1.00 22.77 ? 63  MET A CG    1 
ATOM   531  S  SD    . MET A 1 66  ? 46.243 7.016   19.066  1.00 19.29 ? 63  MET A SD    1 
ATOM   532  C  CE    . MET A 1 66  ? 46.217 5.314   19.566  1.00 20.99 ? 63  MET A CE    1 
ATOM   533  N  N     . TRP A 1 67  ? 41.599 8.468   16.861  1.00 15.09 ? 64  TRP A N     1 
ATOM   534  C  CA    . TRP A 1 67  ? 41.115 9.847   16.751  1.00 13.10 ? 64  TRP A CA    1 
ATOM   535  C  C     . TRP A 1 67  ? 42.196 10.811  17.215  1.00 14.43 ? 64  TRP A C     1 
ATOM   536  O  O     . TRP A 1 67  ? 42.881 10.533  18.192  1.00 13.40 ? 64  TRP A O     1 
ATOM   537  C  CB    . TRP A 1 67  ? 39.850 10.056  17.584  1.00 15.07 ? 64  TRP A CB    1 
ATOM   538  C  CG    . TRP A 1 67  ? 38.754 9.193   17.145  1.00 16.42 ? 64  TRP A CG    1 
ATOM   539  C  CD1   . TRP A 1 67  ? 38.181 8.175   17.843  1.00 20.93 ? 64  TRP A CD1   1 
ATOM   540  C  CD2   . TRP A 1 67  ? 38.096 9.238   15.876  1.00 21.28 ? 64  TRP A CD2   1 
ATOM   541  N  NE1   . TRP A 1 67  ? 37.190 7.590   17.089  1.00 26.64 ? 64  TRP A NE1   1 
ATOM   542  C  CE2   . TRP A 1 67  ? 37.124 8.222   15.876  1.00 27.67 ? 64  TRP A CE2   1 
ATOM   543  C  CE3   . TRP A 1 67  ? 38.231 10.048  14.743  1.00 17.93 ? 64  TRP A CE3   1 
ATOM   544  C  CZ2   . TRP A 1 67  ? 36.286 7.995   14.787  1.00 27.58 ? 64  TRP A CZ2   1 
ATOM   545  C  CZ3   . TRP A 1 67  ? 37.404 9.820   13.663  1.00 19.51 ? 64  TRP A CZ3   1 
ATOM   546  C  CH2   . TRP A 1 67  ? 36.443 8.802   13.691  1.00 20.01 ? 64  TRP A CH2   1 
ATOM   547  N  N     . ALA A 1 68  ? 42.337 11.948  16.546  1.00 13.08 ? 65  ALA A N     1 
ATOM   548  C  CA    . ALA A 1 68  ? 43.389 12.892  16.914  1.00 12.89 ? 65  ALA A CA    1 
ATOM   549  C  C     . ALA A 1 68  ? 43.251 13.367  18.368  1.00 12.43 ? 65  ALA A C     1 
ATOM   550  O  O     . ALA A 1 68  ? 44.259 13.567  19.047  1.00 13.20 ? 65  ALA A O     1 
ATOM   551  C  CB    . ALA A 1 68  ? 43.396 14.089  15.964  1.00 16.46 ? 65  ALA A CB    1 
ATOM   552  N  N     . ASP A 1 69  ? 42.019 13.541  18.850  1.00 15.22 ? 66  ASP A N     1 
ATOM   553  C  CA    . ASP A 1 69  ? 41.840 13.982  20.236  1.00 12.76 ? 66  ASP A CA    1 
ATOM   554  C  C     . ASP A 1 69  ? 42.449 12.956  21.196  1.00 12.53 ? 66  ASP A C     1 
ATOM   555  O  O     . ASP A 1 69  ? 42.989 13.311  22.251  1.00 14.60 ? 66  ASP A O     1 
ATOM   556  C  CB    . ASP A 1 69  ? 40.374 14.188  20.581  1.00 16.07 ? 66  ASP A CB    1 
ATOM   557  C  CG    . ASP A 1 69  ? 39.781 15.440  19.953  1.00 16.11 ? 66  ASP A CG    1 
ATOM   558  O  OD1   . ASP A 1 69  ? 40.526 16.275  19.392  1.00 20.25 ? 66  ASP A OD1   1 
ATOM   559  O  OD2   . ASP A 1 69  ? 38.550 15.576  20.035  1.00 22.10 ? 66  ASP A OD2   1 
ATOM   560  N  N     . ASP A 1 70  ? 42.366 11.682  20.822  1.00 13.16 ? 67  ASP A N     1 
ATOM   561  C  CA    . ASP A 1 70  ? 42.904 10.624  21.659  1.00 13.38 ? 67  ASP A CA    1 
ATOM   562  C  C     . ASP A 1 70  ? 44.420 10.538  21.523  1.00 11.30 ? 67  ASP A C     1 
ATOM   563  O  O     . ASP A 1 70  ? 45.134 10.324  22.502  1.00 11.46 ? 67  ASP A O     1 
ATOM   564  C  CB    . ASP A 1 70  ? 42.240 9.290   21.302  1.00 15.48 ? 67  ASP A CB    1 
ATOM   565  C  CG    . ASP A 1 70  ? 40.751 9.283   21.633  1.00 22.78 ? 67  ASP A CG    1 
ATOM   566  O  OD1   . ASP A 1 70  ? 40.347 10.017  22.564  1.00 21.91 ? 67  ASP A OD1   1 
ATOM   567  O  OD2   . ASP A 1 70  ? 39.986 8.565   20.951  1.00 21.34 ? 67  ASP A OD2   1 
ATOM   568  N  N     . ALA A 1 71  ? 44.924 10.734  20.308  1.00 11.44 ? 68  ALA A N     1 
ATOM   569  C  CA    . ALA A 1 71  ? 46.365 10.769  20.091  1.00 11.54 ? 68  ALA A CA    1 
ATOM   570  C  C     . ALA A 1 71  ? 47.023 11.875  20.905  1.00 11.29 ? 68  ALA A C     1 
ATOM   571  O  O     . ALA A 1 71  ? 48.109 11.692  21.434  1.00 13.00 ? 68  ALA A O     1 
ATOM   572  C  CB    . ALA A 1 71  ? 46.683 10.954  18.615  1.00 13.84 ? 68  ALA A CB    1 
ATOM   573  N  N     . LYS A 1 72  ? 46.343 13.012  21.003  1.00 11.79 ? 69  LYS A N     1 
ATOM   574  C  CA    . LYS A 1 72  ? 46.839 14.150  21.770  1.00 11.81 ? 69  LYS A CA    1 
ATOM   575  C  C     . LYS A 1 72  ? 46.958 13.830  23.256  1.00 13.49 ? 69  LYS A C     1 
ATOM   576  O  O     . LYS A 1 72  ? 47.753 14.437  23.966  1.00 13.92 ? 69  LYS A O     1 
ATOM   577  C  CB    . LYS A 1 72  ? 45.925 15.366  21.570  1.00 14.20 ? 69  LYS A CB    1 
ATOM   578  C  CG    . LYS A 1 72  ? 46.241 16.183  20.300  1.00 16.92 ? 69  LYS A CG    1 
ATOM   579  C  CD    . LYS A 1 72  ? 47.557 16.948  20.455  1.00 15.98 ? 69  LYS A CD    1 
ATOM   580  C  CE    . LYS A 1 72  ? 47.724 18.046  19.412  1.00 21.94 ? 69  LYS A CE    1 
ATOM   581  N  NZ    . LYS A 1 72  ? 48.997 18.808  19.638  1.00 17.41 ? 69  LYS A NZ    1 
ATOM   582  N  N     . LYS A 1 73  ? 46.170 12.874  23.732  1.00 11.16 ? 70  LYS A N     1 
ATOM   583  C  CA    . LYS A 1 73  ? 46.308 12.454  25.127  1.00 11.71 ? 70  LYS A CA    1 
ATOM   584  C  C     . LYS A 1 73  ? 47.641 11.736  25.351  1.00 16.11 ? 70  LYS A C     1 
ATOM   585  O  O     . LYS A 1 73  ? 48.258 11.873  26.413  1.00 16.66 ? 70  LYS A O     1 
ATOM   586  C  CB    . LYS A 1 73  ? 45.128 11.558  25.521  1.00 11.18 ? 70  LYS A CB    1 
ATOM   587  C  CG    . LYS A 1 73  ? 43.786 12.215  25.274  1.00 11.62 ? 70  LYS A CG    1 
ATOM   588  C  CD    . LYS A 1 73  ? 42.631 11.257  25.538  1.00 13.78 ? 70  LYS A CD    1 
ATOM   589  C  CE    . LYS A 1 73  ? 41.287 11.943  25.322  1.00 17.05 ? 70  LYS A CE    1 
ATOM   590  N  NZ    . LYS A 1 73  ? 40.192 10.930  25.201  1.00 19.56 ? 70  LYS A NZ    1 
ATOM   591  N  N     . LEU A 1 74  ? 48.093 10.989  24.344  1.00 13.72 ? 71  LEU A N     1 
ATOM   592  C  CA    . LEU A 1 74  ? 49.367 10.272  24.441  1.00 12.43 ? 71  LEU A CA    1 
ATOM   593  C  C     . LEU A 1 74  ? 50.560 11.168  24.133  1.00 15.82 ? 71  LEU A C     1 
ATOM   594  O  O     . LEU A 1 74  ? 51.662 10.960  24.639  1.00 16.56 ? 71  LEU A O     1 
ATOM   595  C  CB    . LEU A 1 74  ? 49.385 9.077   23.483  1.00 12.20 ? 71  LEU A CB    1 
ATOM   596  C  CG    . LEU A 1 74  ? 48.329 8.001   23.720  1.00 14.04 ? 71  LEU A CG    1 
ATOM   597  C  CD1   . LEU A 1 74  ? 48.462 6.963   22.614  1.00 15.49 ? 71  LEU A CD1   1 
ATOM   598  C  CD2   . LEU A 1 74  ? 48.512 7.358   25.081  1.00 13.70 ? 71  LEU A CD2   1 
ATOM   599  N  N     . CYS A 1 75  ? 50.315 12.162  23.292  1.00 11.88 ? 72  CYS A N     1 
ATOM   600  C  CA    . CYS A 1 75  ? 51.360 13.001  22.736  1.00 14.63 ? 72  CYS A CA    1 
ATOM   601  C  C     . CYS A 1 75  ? 50.830 14.426  22.602  1.00 15.32 ? 72  CYS A C     1 
ATOM   602  O  O     . CYS A 1 75  ? 50.338 14.814  21.546  1.00 14.40 ? 72  CYS A O     1 
ATOM   603  C  CB    . CYS A 1 75  ? 51.793 12.438  21.386  1.00 13.10 ? 72  CYS A CB    1 
ATOM   604  S  SG    . CYS A 1 75  ? 53.152 13.324  20.580  1.00 16.06 ? 72  CYS A SG    1 
ATOM   605  N  N     . PRO A 1 76  ? 50.890 15.210  23.689  1.00 13.26 ? 73  PRO A N     1 
ATOM   606  C  CA    . PRO A 1 76  ? 50.283 16.541  23.674  1.00 14.06 ? 73  PRO A CA    1 
ATOM   607  C  C     . PRO A 1 76  ? 50.882 17.479  22.622  1.00 13.32 ? 73  PRO A C     1 
ATOM   608  O  O     . PRO A 1 76  ? 50.183 18.377  22.145  1.00 17.58 ? 73  PRO A O     1 
ATOM   609  C  CB    . PRO A 1 76  ? 50.558 17.064  25.090  1.00 18.13 ? 73  PRO A CB    1 
ATOM   610  C  CG    . PRO A 1 76  ? 50.679 15.844  25.921  1.00 20.02 ? 73  PRO A CG    1 
ATOM   611  C  CD    . PRO A 1 76  ? 51.307 14.796  25.038  1.00 18.94 ? 73  PRO A CD    1 
ATOM   612  N  N     . ASP A 1 77  ? 52.144 17.267  22.272  1.00 16.20 ? 74  ASP A N     1 
ATOM   613  C  CA    . ASP A 1 77  ? 52.811 18.134  21.299  1.00 18.61 ? 74  ASP A CA    1 
ATOM   614  C  C     . ASP A 1 77  ? 52.723 17.603  19.869  1.00 16.32 ? 74  ASP A C     1 
ATOM   615  O  O     . ASP A 1 77  ? 53.410 18.107  18.971  1.00 15.38 ? 74  ASP A O     1 
ATOM   616  C  CB    . ASP A 1 77  ? 54.281 18.320  21.671  1.00 21.73 ? 74  ASP A CB    1 
ATOM   617  C  CG    . ASP A 1 77  ? 54.466 19.069  22.975  1.00 30.40 ? 74  ASP A CG    1 
ATOM   618  O  OD1   . ASP A 1 77  ? 55.389 18.710  23.739  1.00 38.56 ? 74  ASP A OD1   1 
ATOM   619  O  OD2   . ASP A 1 77  ? 53.684 20.005  23.241  1.00 35.52 ? 74  ASP A OD2   1 
ATOM   620  N  N     . LEU A 1 78  ? 51.887 16.594  19.658  1.00 11.57 ? 75  LEU A N     1 
ATOM   621  C  CA    . LEU A 1 78  ? 51.721 16.000  18.324  1.00 10.66 ? 75  LEU A CA    1 
ATOM   622  C  C     . LEU A 1 78  ? 51.335 17.056  17.305  1.00 13.32 ? 75  LEU A C     1 
ATOM   623  O  O     . LEU A 1 78  ? 50.393 17.809  17.525  1.00 13.47 ? 75  LEU A O     1 
ATOM   624  C  CB    . LEU A 1 78  ? 50.647 14.913  18.355  1.00 10.39 ? 75  LEU A CB    1 
ATOM   625  C  CG    . LEU A 1 78  ? 50.280 14.196  17.049  1.00 8.86  ? 75  LEU A CG    1 
ATOM   626  C  CD1   . LEU A 1 78  ? 51.420 13.286  16.588  1.00 11.89 ? 75  LEU A CD1   1 
ATOM   627  C  CD2   . LEU A 1 78  ? 49.016 13.412  17.302  1.00 12.45 ? 75  LEU A CD2   1 
ATOM   628  N  N     . LEU A 1 79  ? 52.054 17.115  16.193  1.00 10.39 ? 76  LEU A N     1 
ATOM   629  C  CA    . LEU A 1 79  ? 51.671 18.046  15.143  1.00 9.34  ? 76  LEU A CA    1 
ATOM   630  C  C     . LEU A 1 79  ? 50.772 17.324  14.147  1.00 13.45 ? 76  LEU A C     1 
ATOM   631  O  O     . LEU A 1 79  ? 50.903 16.126  13.944  1.00 12.09 ? 76  LEU A O     1 
ATOM   632  C  CB    . LEU A 1 79  ? 52.904 18.626  14.459  1.00 9.65  ? 76  LEU A CB    1 
ATOM   633  C  CG    . LEU A 1 79  ? 53.849 19.352  15.417  1.00 9.31  ? 76  LEU A CG    1 
ATOM   634  C  CD1   . LEU A 1 79  ? 55.045 19.947  14.696  1.00 13.09 ? 76  LEU A CD1   1 
ATOM   635  C  CD2   . LEU A 1 79  ? 53.082 20.425  16.191  1.00 11.32 ? 76  LEU A CD2   1 
ATOM   636  N  N     . LEU A 1 80  ? 49.875 18.059  13.507  1.00 11.56 ? 77  LEU A N     1 
ATOM   637  C  CA    . LEU A 1 80  ? 48.933 17.440  12.584  1.00 11.51 ? 77  LEU A CA    1 
ATOM   638  C  C     . LEU A 1 80  ? 48.909 18.181  11.263  1.00 16.68 ? 77  LEU A C     1 
ATOM   639  O  O     . LEU A 1 80  ? 48.974 19.413  11.220  1.00 19.79 ? 77  LEU A O     1 
ATOM   640  C  CB    . LEU A 1 80  ? 47.527 17.401  13.177  1.00 12.57 ? 77  LEU A CB    1 
ATOM   641  C  CG    . LEU A 1 80  ? 47.341 16.657  14.490  1.00 15.43 ? 77  LEU A CG    1 
ATOM   642  C  CD1   . LEU A 1 80  ? 45.914 16.846  14.971  1.00 18.20 ? 77  LEU A CD1   1 
ATOM   643  C  CD2   . LEU A 1 80  ? 47.657 15.190  14.285  1.00 13.61 ? 77  LEU A CD2   1 
ATOM   644  N  N     . ALA A 1 81  ? 48.824 17.412  10.189  1.00 10.11 ? 78  ALA A N     1 
ATOM   645  C  CA    . ALA A 1 81  ? 48.521 17.953  8.869   1.00 9.75  ? 78  ALA A CA    1 
ATOM   646  C  C     . ALA A 1 81  ? 47.217 17.328  8.398   1.00 12.39 ? 78  ALA A C     1 
ATOM   647  O  O     . ALA A 1 81  ? 47.002 16.135  8.578   1.00 12.76 ? 78  ALA A O     1 
ATOM   648  C  CB    . ALA A 1 81  ? 49.656 17.672  7.889   1.00 12.26 ? 78  ALA A CB    1 
ATOM   649  N  N     . GLN A 1 82  ? 46.336 18.135  7.814   1.00 13.23 ? 79  GLN A N     1 
ATOM   650  C  CA    . GLN A 1 82  ? 45.017 17.658  7.388   1.00 11.56 ? 79  GLN A CA    1 
ATOM   651  C  C     . GLN A 1 82  ? 44.990 17.311  5.918   1.00 11.54 ? 79  GLN A C     1 
ATOM   652  O  O     . GLN A 1 82  ? 45.542 18.053  5.100   1.00 14.04 ? 79  GLN A O     1 
ATOM   653  C  CB    . GLN A 1 82  ? 43.938 18.721  7.637   1.00 15.12 ? 79  GLN A CB    1 
ATOM   654  C  CG    . GLN A 1 82  ? 43.738 19.114  9.070   1.00 21.12 ? 79  GLN A CG    1 
ATOM   655  C  CD    . GLN A 1 82  ? 42.665 20.175  9.196   1.00 30.97 ? 79  GLN A CD    1 
ATOM   656  O  OE1   . GLN A 1 82  ? 42.928 21.280  9.655   1.00 30.76 ? 79  GLN A OE1   1 
ATOM   657  N  NE2   . GLN A 1 82  ? 41.448 19.839  8.776   1.00 32.28 ? 79  GLN A NE2   1 
ATOM   658  N  N     . VAL A 1 83  ? 44.323 16.209  5.584   1.00 12.98 ? 80  VAL A N     1 
ATOM   659  C  CA    . VAL A 1 83  ? 44.030 15.886  4.193   1.00 11.41 ? 80  VAL A CA    1 
ATOM   660  C  C     . VAL A 1 83  ? 43.138 16.968  3.590   1.00 13.08 ? 80  VAL A C     1 
ATOM   661  O  O     . VAL A 1 83  ? 42.203 17.450  4.228   1.00 12.26 ? 80  VAL A O     1 
ATOM   662  C  CB    . VAL A 1 83  ? 43.340 14.521  4.076   1.00 11.39 ? 80  VAL A CB    1 
ATOM   663  C  CG1   . VAL A 1 83  ? 42.905 14.220  2.644   1.00 11.79 ? 80  VAL A CG1   1 
ATOM   664  C  CG2   . VAL A 1 83  ? 44.254 13.416  4.635   1.00 11.99 ? 80  VAL A CG2   1 
ATOM   665  N  N     . ARG A 1 84  ? 43.448 17.336  2.357   1.00 11.19 ? 81  ARG A N     1 
ATOM   666  C  CA    . ARG A 1 84  ? 42.679 18.339  1.631   1.00 11.93 ? 81  ARG A CA    1 
ATOM   667  C  C     . ARG A 1 84  ? 41.216 17.932  1.532   1.00 12.95 ? 81  ARG A C     1 
ATOM   668  O  O     . ARG A 1 84  ? 40.899 16.746  1.388   1.00 13.02 ? 81  ARG A O     1 
ATOM   669  C  CB    . ARG A 1 84  ? 43.270 18.523  0.234   1.00 15.61 ? 81  ARG A CB    1 
ATOM   670  C  CG    . ARG A 1 84  ? 42.419 19.385  -0.696  1.00 19.14 ? 81  ARG A CG    1 
ATOM   671  C  CD    . ARG A 1 84  ? 43.119 19.582  -2.025  1.00 28.11 ? 81  ARG A CD    1 
ATOM   672  N  NE    . ARG A 1 84  ? 42.212 20.055  -3.066  1.00 40.50 ? 81  ARG A NE    1 
ATOM   673  C  CZ    . ARG A 1 84  ? 42.465 19.976  -4.370  1.00 47.93 ? 81  ARG A CZ    1 
ATOM   674  N  NH1   . ARG A 1 84  ? 43.603 19.446  -4.796  1.00 41.33 ? 81  ARG A NH1   1 
ATOM   675  N  NH2   . ARG A 1 84  ? 41.582 20.433  -5.250  1.00 42.12 ? 81  ARG A NH2   1 
ATOM   676  N  N     . GLU A 1 85  ? 40.321 18.909  1.637   1.00 12.45 ? 82  GLU A N     1 
ATOM   677  C  CA    . GLU A 1 85  ? 38.924 18.642  1.379   1.00 14.72 ? 82  GLU A CA    1 
ATOM   678  C  C     . GLU A 1 85  ? 38.468 19.423  0.162   1.00 15.97 ? 82  GLU A C     1 
ATOM   679  O  O     . GLU A 1 85  ? 38.742 20.614  0.038   1.00 19.03 ? 82  GLU A O     1 
ATOM   680  C  CB    . GLU A 1 85  ? 38.081 18.975  2.605   1.00 17.34 ? 82  GLU A CB    1 
ATOM   681  C  CG    . GLU A 1 85  ? 38.161 17.871  3.645   1.00 20.24 ? 82  GLU A CG    1 
ATOM   682  C  CD    . GLU A 1 85  ? 37.451 18.213  4.946   1.00 27.77 ? 82  GLU A CD    1 
ATOM   683  O  OE1   . GLU A 1 85  ? 36.246 18.567  4.918   1.00 31.36 ? 82  GLU A OE1   1 
ATOM   684  O  OE2   . GLU A 1 85  ? 38.114 18.121  6.001   1.00 27.06 ? 82  GLU A OE2   1 
ATOM   685  N  N     . SER A 1 86  ? 37.804 18.717  -0.751  1.00 15.10 ? 83  SER A N     1 
ATOM   686  C  CA    . SER A 1 86  ? 37.233 19.306  -1.951  1.00 13.40 ? 83  SER A CA    1 
ATOM   687  C  C     . SER A 1 86  ? 35.869 18.698  -2.182  1.00 17.04 ? 83  SER A C     1 
ATOM   688  O  O     . SER A 1 86  ? 35.693 17.493  -2.010  1.00 16.04 ? 83  SER A O     1 
ATOM   689  C  CB    . SER A 1 86  ? 38.117 19.059  -3.172  1.00 14.76 ? 83  SER A CB    1 
ATOM   690  O  OG    . SER A 1 86  ? 39.400 19.611  -2.980  1.00 28.16 ? 83  SER A OG    1 
ATOM   691  N  N     . ARG A 1 87  ? 34.914 19.531  -2.584  1.00 19.17 ? 84  ARG A N     1 
ATOM   692  C  CA    . ARG A 1 87  ? 33.543 19.089  -2.824  1.00 18.73 ? 84  ARG A CA    1 
ATOM   693  C  C     . ARG A 1 87  ? 32.955 18.315  -1.658  1.00 16.04 ? 84  ARG A C     1 
ATOM   694  O  O     . ARG A 1 87  ? 32.212 17.353  -1.854  1.00 19.44 ? 84  ARG A O     1 
ATOM   695  C  CB    . ARG A 1 87  ? 33.479 18.238  -4.094  1.00 19.38 ? 84  ARG A CB    1 
ATOM   696  C  CG    . ARG A 1 87  ? 34.109 18.898  -5.299  1.00 28.04 ? 84  ARG A CG    1 
ATOM   697  C  CD    . ARG A 1 87  ? 33.913 18.055  -6.547  1.00 25.09 ? 84  ARG A CD    1 
ATOM   698  N  NE    . ARG A 1 87  ? 34.775 18.504  -7.634  1.00 32.06 ? 84  ARG A NE    1 
ATOM   699  C  CZ    . ARG A 1 87  ? 36.078 18.244  -7.714  1.00 33.25 ? 84  ARG A CZ    1 
ATOM   700  N  NH1   . ARG A 1 87  ? 36.692 17.542  -6.760  1.00 32.59 ? 84  ARG A NH1   1 
ATOM   701  N  NH2   . ARG A 1 87  ? 36.774 18.706  -8.746  1.00 35.41 ? 84  ARG A NH2   1 
ATOM   702  N  N     . GLY A 1 88  ? 33.294 18.726  -0.443  1.00 17.90 ? 85  GLY A N     1 
ATOM   703  C  CA    . GLY A 1 88  ? 32.724 18.133  0.753   1.00 18.48 ? 85  GLY A CA    1 
ATOM   704  C  C     . GLY A 1 88  ? 33.370 16.846  1.242   1.00 16.82 ? 85  GLY A C     1 
ATOM   705  O  O     . GLY A 1 88  ? 32.903 16.231  2.203   1.00 16.37 ? 85  GLY A O     1 
ATOM   706  N  N     . LYS A 1 89  ? 34.451 16.430  0.588   1.00 13.60 ? 86  LYS A N     1 
ATOM   707  C  CA    . LYS A 1 89  ? 35.065 15.149  0.925   1.00 12.62 ? 86  LYS A CA    1 
ATOM   708  C  C     . LYS A 1 89  ? 36.588 15.216  0.961   1.00 11.80 ? 86  LYS A C     1 
ATOM   709  O  O     . LYS A 1 89  ? 37.200 16.094  0.370   1.00 11.78 ? 86  LYS A O     1 
ATOM   710  C  CB    . LYS A 1 89  ? 34.621 14.071  -0.072  1.00 16.28 ? 86  LYS A CB    1 
ATOM   711  C  CG    . LYS A 1 89  ? 35.141 14.259  -1.479  1.00 15.12 ? 86  LYS A CG    1 
ATOM   712  C  CD    . LYS A 1 89  ? 34.633 13.176  -2.437  1.00 16.85 ? 86  LYS A CD    1 
ATOM   713  C  CE    . LYS A 1 89  ? 35.189 11.800  -2.088  1.00 15.58 ? 86  LYS A CE    1 
ATOM   714  N  NZ    . LYS A 1 89  ? 36.683 11.772  -2.207  1.00 14.27 ? 86  LYS A NZ    1 
ATOM   715  N  N     . ALA A 1 90  ? 37.192 14.265  1.658   1.00 13.79 ? 87  ALA A N     1 
ATOM   716  C  CA    . ALA A 1 90  ? 38.643 14.135  1.636   1.00 14.13 ? 87  ALA A CA    1 
ATOM   717  C  C     . ALA A 1 90  ? 39.093 13.884  0.204   1.00 13.45 ? 87  ALA A C     1 
ATOM   718  O  O     . ALA A 1 90  ? 38.437 13.157  -0.547  1.00 16.25 ? 87  ALA A O     1 
ATOM   719  C  CB    . ALA A 1 90  ? 39.099 13.010  2.556   1.00 15.96 ? 87  ALA A CB    1 
ATOM   720  N  N     . ASN A 1 91  ? 40.200 14.513  -0.171  1.00 11.34 ? 88  ASN A N     1 
ATOM   721  C  CA    . ASN A 1 91  ? 40.728 14.397  -1.519  1.00 14.26 ? 88  ASN A CA    1 
ATOM   722  C  C     . ASN A 1 91  ? 42.191 13.993  -1.434  1.00 11.69 ? 88  ASN A C     1 
ATOM   723  O  O     . ASN A 1 91  ? 43.006 14.715  -0.848  1.00 12.14 ? 88  ASN A O     1 
ATOM   724  C  CB    . ASN A 1 91  ? 40.565 15.711  -2.283  1.00 14.63 ? 88  ASN A CB    1 
ATOM   725  C  CG    . ASN A 1 91  ? 40.941 15.578  -3.744  1.00 19.17 ? 88  ASN A CG    1 
ATOM   726  O  OD1   . ASN A 1 91  ? 42.088 15.321  -4.069  1.00 14.55 ? 88  ASN A OD1   1 
ATOM   727  N  ND2   . ASN A 1 91  ? 39.964 15.739  -4.633  1.00 22.66 ? 88  ASN A ND2   1 
ATOM   728  N  N     . LEU A 1 92  ? 42.530 12.835  -1.998  1.00 10.40 ? 89  LEU A N     1 
ATOM   729  C  CA    . LEU A 1 92  ? 43.876 12.284  -1.805  1.00 10.75 ? 89  LEU A CA    1 
ATOM   730  C  C     . LEU A 1 92  ? 44.836 12.581  -2.964  1.00 11.87 ? 89  LEU A C     1 
ATOM   731  O  O     . LEU A 1 92  ? 45.878 11.941  -3.082  1.00 11.79 ? 89  LEU A O     1 
ATOM   732  C  CB    . LEU A 1 92  ? 43.786 10.775  -1.576  1.00 11.28 ? 89  LEU A CB    1 
ATOM   733  C  CG    . LEU A 1 92  ? 42.795 10.343  -0.494  1.00 10.63 ? 89  LEU A CG    1 
ATOM   734  C  CD1   . LEU A 1 92  ? 42.667 8.832   -0.479  1.00 12.94 ? 89  LEU A CD1   1 
ATOM   735  C  CD2   . LEU A 1 92  ? 43.288 10.863  0.863   1.00 14.86 ? 89  LEU A CD2   1 
ATOM   736  N  N     . THR A 1 93  ? 44.516 13.576  -3.791  1.00 10.55 ? 90  THR A N     1 
ATOM   737  C  CA    . THR A 1 93  ? 45.320 13.844  -4.984  1.00 11.78 ? 90  THR A CA    1 
ATOM   738  C  C     . THR A 1 93  ? 46.806 14.104  -4.717  1.00 11.58 ? 90  THR A C     1 
ATOM   739  O  O     . THR A 1 93  ? 47.665 13.604  -5.459  1.00 11.48 ? 90  THR A O     1 
ATOM   740  C  CB    . THR A 1 93  ? 44.728 15.036  -5.770  1.00 13.50 ? 90  THR A CB    1 
ATOM   741  O  OG1   . THR A 1 93  ? 43.416 14.671  -6.212  1.00 16.74 ? 90  THR A OG1   1 
ATOM   742  C  CG2   . THR A 1 93  ? 45.582 15.376  -6.984  1.00 13.88 ? 90  THR A CG2   1 
ATOM   743  N  N     . LYS A 1 94  ? 47.114 14.873  -3.674  1.00 10.79 ? 91  LYS A N     1 
ATOM   744  C  CA    . LYS A 1 94  ? 48.502 15.182  -3.349  1.00 10.08 ? 91  LYS A CA    1 
ATOM   745  C  C     . LYS A 1 94  ? 49.328 13.909  -3.172  1.00 9.91  ? 91  LYS A C     1 
ATOM   746  O  O     . LYS A 1 94  ? 50.475 13.836  -3.622  1.00 11.42 ? 91  LYS A O     1 
ATOM   747  C  CB    . LYS A 1 94  ? 48.583 16.040  -2.077  1.00 11.16 ? 91  LYS A CB    1 
ATOM   748  C  CG    . LYS A 1 94  ? 49.993 16.565  -1.770  1.00 11.64 ? 91  LYS A CG    1 
ATOM   749  C  CD    . LYS A 1 94  ? 50.115 17.084  -0.327  1.00 13.69 ? 91  LYS A CD    1 
ATOM   750  C  CE    . LYS A 1 94  ? 49.141 18.212  -0.043  1.00 17.50 ? 91  LYS A CE    1 
ATOM   751  N  NZ    . LYS A 1 94  ? 49.344 18.779  1.317   1.00 11.22 ? 91  LYS A NZ    1 
ATOM   752  N  N     . TYR A 1 95  ? 48.734 12.898  -2.550  1.00 10.06 ? 92  TYR A N     1 
ATOM   753  C  CA    . TYR A 1 95  ? 49.460 11.674  -2.231  1.00 8.07  ? 92  TYR A CA    1 
ATOM   754  C  C     . TYR A 1 95  ? 49.541 10.781  -3.452  1.00 11.05 ? 92  TYR A C     1 
ATOM   755  O  O     . TYR A 1 95  ? 50.552 10.105  -3.664  1.00 10.75 ? 92  TYR A O     1 
ATOM   756  C  CB    . TYR A 1 95  ? 48.795 10.946  -1.045  1.00 7.80  ? 92  TYR A CB    1 
ATOM   757  C  CG    . TYR A 1 95  ? 48.489 11.929  0.060   1.00 8.99  ? 92  TYR A CG    1 
ATOM   758  C  CD1   . TYR A 1 95  ? 47.191 12.313  0.314   1.00 10.60 ? 92  TYR A CD1   1 
ATOM   759  C  CD2   . TYR A 1 95  ? 49.511 12.547  0.777   1.00 9.18  ? 92  TYR A CD2   1 
ATOM   760  C  CE1   . TYR A 1 95  ? 46.896 13.260  1.286   1.00 10.82 ? 92  TYR A CE1   1 
ATOM   761  C  CE2   . TYR A 1 95  ? 49.238 13.481  1.743   1.00 9.67  ? 92  TYR A CE2   1 
ATOM   762  C  CZ    . TYR A 1 95  ? 47.916 13.833  1.996   1.00 9.65  ? 92  TYR A CZ    1 
ATOM   763  O  OH    . TYR A 1 95  ? 47.586 14.779  2.943   1.00 12.10 ? 92  TYR A OH    1 
ATOM   764  N  N     . ARG A 1 96  ? 48.497 10.795  -4.276  1.00 10.89 ? 93  ARG A N     1 
ATOM   765  C  CA    . ARG A 1 96  ? 48.564 10.049  -5.538  1.00 11.45 ? 93  ARG A CA    1 
ATOM   766  C  C     . ARG A 1 96  ? 49.650 10.610  -6.452  1.00 12.68 ? 93  ARG A C     1 
ATOM   767  O  O     . ARG A 1 96  ? 50.393 9.855   -7.099  1.00 12.66 ? 93  ARG A O     1 
ATOM   768  C  CB    . ARG A 1 96  ? 47.212 10.075  -6.265  1.00 10.40 ? 93  ARG A CB    1 
ATOM   769  C  CG    . ARG A 1 96  ? 46.175 9.191   -5.625  1.00 11.97 ? 93  ARG A CG    1 
ATOM   770  C  CD    . ARG A 1 96  ? 44.922 9.010   -6.477  1.00 12.81 ? 93  ARG A CD    1 
ATOM   771  N  NE    . ARG A 1 96  ? 43.911 8.307   -5.694  1.00 13.77 ? 93  ARG A NE    1 
ATOM   772  C  CZ    . ARG A 1 96  ? 42.889 8.899   -5.081  1.00 14.09 ? 93  ARG A CZ    1 
ATOM   773  N  NH1   . ARG A 1 96  ? 42.057 8.159   -4.356  1.00 12.68 ? 93  ARG A NH1   1 
ATOM   774  N  NH2   . ARG A 1 96  ? 42.705 10.211  -5.189  1.00 15.08 ? 93  ARG A NH2   1 
ATOM   775  N  N     . GLU A 1 97  ? 49.746 11.938  -6.518  1.00 11.70 ? 94  GLU A N     1 
ATOM   776  C  CA    . GLU A 1 97  ? 50.761 12.576  -7.353  1.00 10.11 ? 94  GLU A CA    1 
ATOM   777  C  C     . GLU A 1 97  ? 52.177 12.313  -6.814  1.00 11.23 ? 94  GLU A C     1 
ATOM   778  O  O     . GLU A 1 97  ? 53.097 12.066  -7.590  1.00 10.28 ? 94  GLU A O     1 
ATOM   779  C  CB    . GLU A 1 97  ? 50.472 14.074  -7.489  1.00 11.20 ? 94  GLU A CB    1 
ATOM   780  C  CG    . GLU A 1 97  ? 49.222 14.293  -8.320  1.00 17.04 ? 94  GLU A CG    1 
ATOM   781  C  CD    . GLU A 1 97  ? 48.823 15.743  -8.498  1.00 29.96 ? 94  GLU A CD    1 
ATOM   782  O  OE1   . GLU A 1 97  ? 49.330 16.626  -7.770  1.00 30.64 ? 94  GLU A OE1   1 
ATOM   783  O  OE2   . GLU A 1 97  ? 47.978 15.993  -9.387  1.00 23.74 ? 94  GLU A OE2   1 
ATOM   784  N  N     . ALA A 1 98  ? 52.337 12.310  -5.495  1.00 10.39 ? 95  ALA A N     1 
ATOM   785  C  CA    . ALA A 1 98  ? 53.635 11.995  -4.901  1.00 10.60 ? 95  ALA A CA    1 
ATOM   786  C  C     . ALA A 1 98  ? 54.007 10.543  -5.174  1.00 10.08 ? 95  ALA A C     1 
ATOM   787  O  O     . ALA A 1 98  ? 55.174 10.230  -5.405  1.00 9.88  ? 95  ALA A O     1 
ATOM   788  C  CB    . ALA A 1 98  ? 53.623 12.268  -3.395  1.00 8.72  ? 95  ALA A CB    1 
ATOM   789  N  N     . SER A 1 99  ? 53.006 9.668   -5.158  1.00 9.56  ? 96  SER A N     1 
ATOM   790  C  CA    . SER A 1 99  ? 53.212 8.270   -5.511  1.00 9.71  ? 96  SER A CA    1 
ATOM   791  C  C     . SER A 1 99  ? 53.763 8.135   -6.923  1.00 11.44 ? 96  SER A C     1 
ATOM   792  O  O     . SER A 1 99  ? 54.693 7.367   -7.170  1.00 10.08 ? 96  SER A O     1 
ATOM   793  C  CB    . SER A 1 99  ? 51.900 7.492   -5.400  1.00 11.49 ? 96  SER A CB    1 
ATOM   794  O  OG    . SER A 1 99  ? 52.098 6.139   -5.760  1.00 14.73 ? 96  SER A OG    1 
ATOM   795  N  N     . VAL A 1 100 ? 53.176 8.875   -7.855  1.00 9.57  ? 97  VAL A N     1 
ATOM   796  C  CA    . VAL A 1 100 ? 53.665 8.825   -9.239  1.00 9.04  ? 97  VAL A CA    1 
ATOM   797  C  C     . VAL A 1 100 ? 55.141 9.234   -9.329  1.00 9.91  ? 97  VAL A C     1 
ATOM   798  O  O     . VAL A 1 100 ? 55.925 8.619   -10.068 1.00 11.09 ? 97  VAL A O     1 
ATOM   799  C  CB    . VAL A 1 100 ? 52.793 9.710   -10.138 1.00 10.64 ? 97  VAL A CB    1 
ATOM   800  C  CG1   . VAL A 1 100 ? 53.413 9.872   -11.539 1.00 13.79 ? 97  VAL A CG1   1 
ATOM   801  C  CG2   . VAL A 1 100 ? 51.403 9.106   -10.235 1.00 14.86 ? 97  VAL A CG2   1 
ATOM   802  N  N     . GLU A 1 101 ? 55.548 10.237  -8.553  1.00 8.59  ? 98  GLU A N     1 
ATOM   803  C  CA    . GLU A 1 101 ? 56.956 10.648  -8.523  1.00 10.08 ? 98  GLU A CA    1 
ATOM   804  C  C     . GLU A 1 101 ? 57.869 9.464   -8.232  1.00 11.10 ? 98  GLU A C     1 
ATOM   805  O  O     . GLU A 1 101 ? 58.899 9.260   -8.883  1.00 12.47 ? 98  GLU A O     1 
ATOM   806  C  CB    . GLU A 1 101 ? 57.216 11.699  -7.443  1.00 11.69 ? 98  GLU A CB    1 
ATOM   807  C  CG    . GLU A 1 101 ? 56.650 13.087  -7.690  1.00 15.99 ? 98  GLU A CG    1 
ATOM   808  C  CD    . GLU A 1 101 ? 57.051 14.068  -6.589  1.00 13.98 ? 98  GLU A CD    1 
ATOM   809  O  OE1   . GLU A 1 101 ? 58.261 14.401  -6.475  1.00 15.73 ? 98  GLU A OE1   1 
ATOM   810  O  OE2   . GLU A 1 101 ? 56.149 14.498  -5.823  1.00 16.11 ? 98  GLU A OE2   1 
ATOM   811  N  N     . VAL A 1 102 ? 57.482 8.691   -7.228  1.00 8.64  ? 99  VAL A N     1 
ATOM   812  C  CA    . VAL A 1 102 ? 58.314 7.583   -6.783  1.00 9.69  ? 99  VAL A CA    1 
ATOM   813  C  C     . VAL A 1 102 ? 58.270 6.435   -7.775  1.00 10.21 ? 99  VAL A C     1 
ATOM   814  O  O     . VAL A 1 102 ? 59.313 5.852   -8.094  1.00 12.84 ? 99  VAL A O     1 
ATOM   815  C  CB    . VAL A 1 102 ? 57.884 7.066   -5.396  1.00 10.59 ? 99  VAL A CB    1 
ATOM   816  C  CG1   . VAL A 1 102 ? 58.689 5.827   -5.033  1.00 15.41 ? 99  VAL A CG1   1 
ATOM   817  C  CG2   . VAL A 1 102 ? 58.066 8.163   -4.350  1.00 12.38 ? 99  VAL A CG2   1 
ATOM   818  N  N     . MET A 1 103 ? 57.070 6.096   -8.250  1.00 8.98  ? 100 MET A N     1 
ATOM   819  C  CA    . MET A 1 103 ? 56.919 4.989   -9.190  1.00 10.73 ? 100 MET A CA    1 
ATOM   820  C  C     . MET A 1 103 ? 57.677 5.249   -10.486 1.00 13.52 ? 100 MET A C     1 
ATOM   821  O  O     . MET A 1 103 ? 58.234 4.319   -11.060 1.00 13.18 ? 100 MET A O     1 
ATOM   822  C  CB    . MET A 1 103 ? 55.445 4.734   -9.503  1.00 16.29 ? 100 MET A CB    1 
ATOM   823  C  CG    . MET A 1 103 ? 54.544 4.520   -8.297  1.00 16.35 ? 100 MET A CG    1 
ATOM   824  S  SD    . MET A 1 103 ? 54.888 2.948   -7.489  1.00 19.49 ? 100 MET A SD    1 
ATOM   825  C  CE    . MET A 1 103 ? 53.994 3.075   -5.903  1.00 12.18 ? 100 MET A CE    1 
ATOM   826  N  N     . GLU A 1 104 ? 57.724 6.501   -10.946 1.00 10.37 ? 101 GLU A N     1 
ATOM   827  C  CA    . GLU A 1 104 ? 58.441 6.768   -12.196 1.00 14.23 ? 101 GLU A CA    1 
ATOM   828  C  C     . GLU A 1 104 ? 59.962 6.598   -12.026 1.00 13.46 ? 101 GLU A C     1 
ATOM   829  O  O     . GLU A 1 104 ? 60.652 6.121   -12.941 1.00 14.23 ? 101 GLU A O     1 
ATOM   830  C  CB    . GLU A 1 104 ? 58.071 8.168   -12.735 1.00 13.21 ? 101 GLU A CB    1 
ATOM   831  C  CG    . GLU A 1 104 ? 56.597 8.220   -13.186 1.00 18.00 ? 101 GLU A CG    1 
ATOM   832  C  CD    . GLU A 1 104 ? 56.217 9.501   -13.915 1.00 25.72 ? 101 GLU A CD    1 
ATOM   833  O  OE1   . GLU A 1 104 ? 56.994 10.478  -13.852 1.00 29.07 ? 101 GLU A OE1   1 
ATOM   834  O  OE2   . GLU A 1 104 ? 55.129 9.532   -14.536 1.00 27.36 ? 101 GLU A OE2   1 
ATOM   835  N  N     . ILE A 1 105 ? 60.483 6.937   -10.855 1.00 10.24 ? 102 ILE A N     1 
ATOM   836  C  CA    . ILE A 1 105 ? 61.906 6.726   -10.566 1.00 11.64 ? 102 ILE A CA    1 
ATOM   837  C  C     . ILE A 1 105 ? 62.223 5.236   -10.517 1.00 11.15 ? 102 ILE A C     1 
ATOM   838  O  O     . ILE A 1 105 ? 63.174 4.764   -11.158 1.00 12.86 ? 102 ILE A O     1 
ATOM   839  C  CB    . ILE A 1 105 ? 62.306 7.402   -9.247  1.00 12.22 ? 102 ILE A CB    1 
ATOM   840  C  CG1   . ILE A 1 105 ? 62.186 8.920   -9.375  1.00 11.10 ? 102 ILE A CG1   1 
ATOM   841  C  CG2   . ILE A 1 105 ? 63.732 7.047   -8.864  1.00 13.36 ? 102 ILE A CG2   1 
ATOM   842  C  CD1   . ILE A 1 105 ? 62.214 9.616   -8.034  1.00 12.14 ? 102 ILE A CD1   1 
ATOM   843  N  N     . MET A 1 106 ? 61.400 4.479   -9.804  1.00 11.58 ? 103 MET A N     1 
ATOM   844  C  CA    . MET A 1 106 ? 61.634 3.040   -9.710  1.00 12.17 ? 103 MET A CA    1 
ATOM   845  C  C     . MET A 1 106 ? 61.604 2.382   -11.076 1.00 12.41 ? 103 MET A C     1 
ATOM   846  O  O     . MET A 1 106 ? 62.408 1.482   -11.349 1.00 13.29 ? 103 MET A O     1 
ATOM   847  C  CB    . MET A 1 106 ? 60.605 2.382   -8.783  1.00 11.63 ? 103 MET A CB    1 
ATOM   848  C  CG    A MET A 1 106 ? 60.626 2.835   -7.340  0.57 10.02 ? 103 MET A CG    1 
ATOM   849  C  CG    B MET A 1 106 ? 60.959 2.649   -7.316  0.43 9.68  ? 103 MET A CG    1 
ATOM   850  S  SD    A MET A 1 106 ? 59.374 1.869   -6.455  0.57 13.18 ? 103 MET A SD    1 
ATOM   851  S  SD    B MET A 1 106 ? 59.934 1.758   -6.134  0.43 13.88 ? 103 MET A SD    1 
ATOM   852  C  CE    A MET A 1 106 ? 59.884 0.201   -6.841  0.57 13.70 ? 103 MET A CE    1 
ATOM   853  C  CE    B MET A 1 106 ? 58.340 2.478   -6.516  0.43 17.28 ? 103 MET A CE    1 
ATOM   854  N  N     . SER A 1 107 ? 60.705 2.849   -11.942 1.00 10.49 ? 104 SER A N     1 
ATOM   855  C  CA    A SER A 1 107 ? 60.541 2.263   -13.268 0.26 12.61 ? 104 SER A CA    1 
ATOM   856  C  CA    B SER A 1 107 ? 60.539 2.258   -13.267 0.74 12.49 ? 104 SER A CA    1 
ATOM   857  C  C     . SER A 1 107 ? 61.791 2.410   -14.138 1.00 14.54 ? 104 SER A C     1 
ATOM   858  O  O     . SER A 1 107 ? 61.925 1.710   -15.144 1.00 17.11 ? 104 SER A O     1 
ATOM   859  C  CB    A SER A 1 107 ? 59.340 2.888   -13.982 0.26 15.08 ? 104 SER A CB    1 
ATOM   860  C  CB    B SER A 1 107 ? 59.330 2.877   -13.978 0.74 15.04 ? 104 SER A CB    1 
ATOM   861  O  OG    A SER A 1 107 ? 59.480 4.293   -14.085 0.26 17.03 ? 104 SER A OG    1 
ATOM   862  O  OG    B SER A 1 107 ? 58.120 2.472   -13.361 0.74 17.14 ? 104 SER A OG    1 
ATOM   863  N  N     . ARG A 1 108 ? 62.695 3.319   -13.765 1.00 13.95 ? 105 ARG A N     1 
ATOM   864  C  CA    . ARG A 1 108 ? 63.959 3.485   -14.514 1.00 14.75 ? 105 ARG A CA    1 
ATOM   865  C  C     . ARG A 1 108 ? 64.864 2.273   -14.316 1.00 19.59 ? 105 ARG A C     1 
ATOM   866  O  O     . ARG A 1 108 ? 65.709 1.974   -15.167 1.00 19.81 ? 105 ARG A O     1 
ATOM   867  C  CB    . ARG A 1 108 ? 64.727 4.742   -14.084 1.00 15.34 ? 105 ARG A CB    1 
ATOM   868  C  CG    . ARG A 1 108 ? 64.033 6.064   -14.349 1.00 17.17 ? 105 ARG A CG    1 
ATOM   869  C  CD    . ARG A 1 108 ? 65.025 7.222   -14.495 1.00 20.68 ? 105 ARG A CD    1 
ATOM   870  N  NE    . ARG A 1 108 ? 66.011 7.316   -13.419 1.00 21.50 ? 105 ARG A NE    1 
ATOM   871  C  CZ    . ARG A 1 108 ? 65.946 8.176   -12.403 1.00 17.87 ? 105 ARG A CZ    1 
ATOM   872  N  NH1   . ARG A 1 108 ? 66.897 8.177   -11.479 1.00 21.09 ? 105 ARG A NH1   1 
ATOM   873  N  NH2   . ARG A 1 108 ? 64.937 9.029   -12.308 1.00 17.96 ? 105 ARG A NH2   1 
ATOM   874  N  N     . PHE A 1 109 ? 64.703 1.591   -13.182 1.00 18.60 ? 106 PHE A N     1 
ATOM   875  C  CA    . PHE A 1 109 ? 65.600 0.490   -12.820 1.00 18.88 ? 106 PHE A CA    1 
ATOM   876  C  C     . PHE A 1 109 ? 65.087 -0.856  -13.299 1.00 23.14 ? 106 PHE A C     1 
ATOM   877  O  O     . PHE A 1 109 ? 65.866 -1.737  -13.685 1.00 25.78 ? 106 PHE A O     1 
ATOM   878  C  CB    . PHE A 1 109 ? 65.803 0.456   -11.305 1.00 15.10 ? 106 PHE A CB    1 
ATOM   879  C  CG    . PHE A 1 109 ? 66.547 1.638   -10.772 1.00 18.84 ? 106 PHE A CG    1 
ATOM   880  C  CD1   . PHE A 1 109 ? 65.902 2.848   -10.565 1.00 15.71 ? 106 PHE A CD1   1 
ATOM   881  C  CD2   . PHE A 1 109 ? 67.896 1.542   -10.460 1.00 15.11 ? 106 PHE A CD2   1 
ATOM   882  C  CE1   . PHE A 1 109 ? 66.581 3.942   -10.065 1.00 16.98 ? 106 PHE A CE1   1 
ATOM   883  C  CE2   . PHE A 1 109 ? 68.581 2.632   -9.959  1.00 19.75 ? 106 PHE A CE2   1 
ATOM   884  C  CZ    . PHE A 1 109 ? 67.930 3.838   -9.762  1.00 17.81 ? 106 PHE A CZ    1 
ATOM   885  N  N     . ALA A 1 110 ? 63.772 -1.014  -13.277 1.00 20.05 ? 107 ALA A N     1 
ATOM   886  C  CA    . ALA A 1 110 ? 63.157 -2.281  -13.620 1.00 22.26 ? 107 ALA A CA    1 
ATOM   887  C  C     . ALA A 1 110 ? 61.668 -2.123  -13.809 1.00 21.05 ? 107 ALA A C     1 
ATOM   888  O  O     . ALA A 1 110 ? 61.091 -1.098  -13.457 1.00 21.42 ? 107 ALA A O     1 
ATOM   889  C  CB    . ALA A 1 110 ? 63.436 -3.315  -12.549 1.00 23.20 ? 107 ALA A CB    1 
ATOM   890  N  N     . VAL A 1 111 ? 61.053 -3.154  -14.369 1.00 25.49 ? 108 VAL A N     1 
ATOM   891  C  CA    . VAL A 1 111 ? 59.609 -3.234  -14.453 1.00 29.30 ? 108 VAL A CA    1 
ATOM   892  C  C     . VAL A 1 111 ? 59.035 -3.337  -13.035 1.00 21.60 ? 108 VAL A C     1 
ATOM   893  O  O     . VAL A 1 111 ? 59.522 -4.131  -12.225 1.00 24.61 ? 108 VAL A O     1 
ATOM   894  C  CB    . VAL A 1 111 ? 59.178 -4.438  -15.302 1.00 38.04 ? 108 VAL A CB    1 
ATOM   895  C  CG1   . VAL A 1 111 ? 57.794 -4.939  -14.881 1.00 30.54 ? 108 VAL A CG1   1 
ATOM   896  C  CG2   . VAL A 1 111 ? 59.237 -4.083  -16.786 1.00 41.19 ? 108 VAL A CG2   1 
ATOM   897  N  N     . ILE A 1 112 ? 58.033 -2.514  -12.724 1.00 21.61 ? 109 ILE A N     1 
ATOM   898  C  CA    . ILE A 1 112 ? 57.446 -2.561  -11.387 1.00 19.12 ? 109 ILE A CA    1 
ATOM   899  C  C     . ILE A 1 112 ? 55.978 -2.949  -11.389 1.00 13.74 ? 109 ILE A C     1 
ATOM   900  O  O     . ILE A 1 112 ? 55.264 -2.787  -12.387 1.00 15.80 ? 109 ILE A O     1 
ATOM   901  C  CB    . ILE A 1 112 ? 57.593 -1.200  -10.635 1.00 16.84 ? 109 ILE A CB    1 
ATOM   902  C  CG1   . ILE A 1 112 ? 56.606 -0.162  -11.162 1.00 20.69 ? 109 ILE A CG1   1 
ATOM   903  C  CG2   . ILE A 1 112 ? 59.050 -0.728  -10.654 1.00 20.52 ? 109 ILE A CG2   1 
ATOM   904  C  CD1   . ILE A 1 112 ? 56.586 1.136   -10.356 1.00 19.83 ? 109 ILE A CD1   1 
ATOM   905  N  N     . GLU A 1 113 ? 55.546 -3.521  -10.267 1.00 11.79 ? 110 GLU A N     1 
ATOM   906  C  CA    . GLU A 1 113 ? 54.132 -3.737  -9.992  1.00 9.30  ? 110 GLU A CA    1 
ATOM   907  C  C     . GLU A 1 113 ? 53.678 -2.808  -8.878  1.00 10.87 ? 110 GLU A C     1 
ATOM   908  O  O     . GLU A 1 113 ? 54.114 -2.948  -7.741  1.00 11.58 ? 110 GLU A O     1 
ATOM   909  C  CB    . GLU A 1 113 ? 53.848 -5.193  -9.578  1.00 9.92  ? 110 GLU A CB    1 
ATOM   910  C  CG    . GLU A 1 113 ? 52.393 -5.437  -9.210  1.00 11.69 ? 110 GLU A CG    1 
ATOM   911  C  CD    . GLU A 1 113 ? 52.110 -6.877  -8.796  1.00 19.21 ? 110 GLU A CD    1 
ATOM   912  O  OE1   . GLU A 1 113 ? 51.017 -7.125  -8.231  1.00 22.25 ? 110 GLU A OE1   1 
ATOM   913  O  OE2   . GLU A 1 113 ? 52.967 -7.754  -9.043  1.00 15.30 ? 110 GLU A OE2   1 
ATOM   914  N  N     . ARG A 1 114 ? 52.800 -1.862  -9.196  1.00 11.28 ? 111 ARG A N     1 
ATOM   915  C  CA    . ARG A 1 114 ? 52.237 -0.977  -8.172  1.00 10.09 ? 111 ARG A CA    1 
ATOM   916  C  C     . ARG A 1 114 ? 51.329 -1.782  -7.253  1.00 14.83 ? 111 ARG A C     1 
ATOM   917  O  O     . ARG A 1 114 ? 50.296 -2.293  -7.685  1.00 20.30 ? 111 ARG A O     1 
ATOM   918  C  CB    . ARG A 1 114 ? 51.458 0.173   -8.821  1.00 12.51 ? 111 ARG A CB    1 
ATOM   919  C  CG    . ARG A 1 114 ? 50.839 1.174   -7.826  1.00 13.55 ? 111 ARG A CG    1 
ATOM   920  C  CD    . ARG A 1 114 ? 49.755 2.008   -8.504  1.00 14.30 ? 111 ARG A CD    1 
ATOM   921  N  NE    . ARG A 1 114 ? 49.408 3.223   -7.768  1.00 16.79 ? 111 ARG A NE    1 
ATOM   922  C  CZ    . ARG A 1 114 ? 48.463 3.305   -6.835  1.00 20.36 ? 111 ARG A CZ    1 
ATOM   923  N  NH1   . ARG A 1 114 ? 47.753 2.233   -6.488  1.00 22.15 ? 111 ARG A NH1   1 
ATOM   924  N  NH2   . ARG A 1 114 ? 48.233 4.472   -6.242  1.00 17.68 ? 111 ARG A NH2   1 
ATOM   925  N  N     . ALA A 1 115 ? 51.711 -1.899  -5.987  1.00 10.19 ? 112 ALA A N     1 
ATOM   926  C  CA    . ALA A 1 115 ? 50.981 -2.734  -5.049  1.00 9.97  ? 112 ALA A CA    1 
ATOM   927  C  C     . ALA A 1 115 ? 50.070 -1.922  -4.141  1.00 13.27 ? 112 ALA A C     1 
ATOM   928  O  O     . ALA A 1 115 ? 49.106 -2.450  -3.569  1.00 17.03 ? 112 ALA A O     1 
ATOM   929  C  CB    . ALA A 1 115 ? 51.951 -3.557  -4.209  1.00 11.75 ? 112 ALA A CB    1 
ATOM   930  N  N     . SER A 1 116 ? 50.400 -0.648  -3.992  1.00 11.01 ? 113 SER A N     1 
ATOM   931  C  CA    . SER A 1 116 ? 49.606 0.278   -3.199  1.00 12.74 ? 113 SER A CA    1 
ATOM   932  C  C     . SER A 1 116 ? 50.035 1.687   -3.551  1.00 10.70 ? 113 SER A C     1 
ATOM   933  O  O     . SER A 1 116 ? 50.926 1.879   -4.367  1.00 11.36 ? 113 SER A O     1 
ATOM   934  C  CB    . SER A 1 116 ? 49.786 0.046   -1.699  1.00 13.24 ? 113 SER A CB    1 
ATOM   935  O  OG    . SER A 1 116 ? 50.963 0.694   -1.228  1.00 15.37 ? 113 SER A OG    1 
ATOM   936  N  N     . ILE A 1 117 ? 49.435 2.675   -2.899  1.00 11.37 ? 114 ILE A N     1 
ATOM   937  C  CA    . ILE A 1 117 ? 49.809 4.054   -3.157  1.00 9.28  ? 114 ILE A CA    1 
ATOM   938  C  C     . ILE A 1 117 ? 51.286 4.305   -2.801  1.00 9.26  ? 114 ILE A C     1 
ATOM   939  O  O     . ILE A 1 117 ? 51.902 5.217   -3.343  1.00 12.14 ? 114 ILE A O     1 
ATOM   940  C  CB    . ILE A 1 117 ? 48.885 5.038   -2.386  1.00 8.32  ? 114 ILE A CB    1 
ATOM   941  C  CG1   . ILE A 1 117 ? 48.970 6.446   -2.986  1.00 11.74 ? 114 ILE A CG1   1 
ATOM   942  C  CG2   . ILE A 1 117 ? 49.207 5.018   -0.891  1.00 10.54 ? 114 ILE A CG2   1 
ATOM   943  C  CD1   . ILE A 1 117 ? 47.874 7.392   -2.487  1.00 12.21 ? 114 ILE A CD1   1 
ATOM   944  N  N     . ASP A 1 118 ? 51.874 3.500   -1.912  1.00 9.90  ? 115 ASP A N     1 
ATOM   945  C  CA    . ASP A 1 118 ? 53.242 3.819   -1.503  1.00 11.11 ? 115 ASP A CA    1 
ATOM   946  C  C     . ASP A 1 118 ? 54.214 2.648   -1.618  1.00 12.83 ? 115 ASP A C     1 
ATOM   947  O  O     . ASP A 1 118 ? 55.293 2.676   -1.016  1.00 12.92 ? 115 ASP A O     1 
ATOM   948  C  CB    . ASP A 1 118 ? 53.251 4.361   -0.069  1.00 10.62 ? 115 ASP A CB    1 
ATOM   949  C  CG    . ASP A 1 118 ? 53.329 3.263   0.978   1.00 11.94 ? 115 ASP A CG    1 
ATOM   950  O  OD1   . ASP A 1 118 ? 52.694 2.189   0.808   1.00 11.92 ? 115 ASP A OD1   1 
ATOM   951  O  OD2   . ASP A 1 118 ? 54.094 3.459   1.959   1.00 11.37 ? 115 ASP A OD2   1 
ATOM   952  N  N     . GLU A 1 119 ? 53.863 1.626   -2.390  1.00 10.07 ? 116 GLU A N     1 
ATOM   953  C  CA    . GLU A 1 119 ? 54.818 0.544   -2.562  1.00 12.87 ? 116 GLU A CA    1 
ATOM   954  C  C     . GLU A 1 119 ? 54.698 -0.189  -3.870  1.00 10.70 ? 116 GLU A C     1 
ATOM   955  O  O     . GLU A 1 119 ? 53.635 -0.215  -4.498  1.00 11.09 ? 116 GLU A O     1 
ATOM   956  C  CB    . GLU A 1 119 ? 54.698 -0.453  -1.427  1.00 14.45 ? 116 GLU A CB    1 
ATOM   957  C  CG    . GLU A 1 119 ? 53.526 -1.386  -1.542  1.00 11.28 ? 116 GLU A CG    1 
ATOM   958  C  CD    . GLU A 1 119 ? 53.056 -1.831  -0.177  1.00 20.85 ? 116 GLU A CD    1 
ATOM   959  O  OE1   . GLU A 1 119 ? 53.351 -2.977  0.220   1.00 19.97 ? 116 GLU A OE1   1 
ATOM   960  O  OE2   . GLU A 1 119 ? 52.421 -1.008  0.515   1.00 18.34 ? 116 GLU A OE2   1 
ATOM   961  N  N     . ALA A 1 120 ? 55.825 -0.749  -4.290  1.00 9.85  ? 117 ALA A N     1 
ATOM   962  C  CA    . ALA A 1 120 ? 55.873 -1.477  -5.537  1.00 9.19  ? 117 ALA A CA    1 
ATOM   963  C  C     . ALA A 1 120 ? 56.850 -2.632  -5.452  1.00 10.70 ? 117 ALA A C     1 
ATOM   964  O  O     . ALA A 1 120 ? 57.892 -2.537  -4.797  1.00 10.89 ? 117 ALA A O     1 
ATOM   965  C  CB    . ALA A 1 120 ? 56.258 -0.545  -6.691  1.00 13.85 ? 117 ALA A CB    1 
ATOM   966  N  N     . TYR A 1 121 ? 56.504 -3.721  -6.129  1.00 9.31  ? 118 TYR A N     1 
ATOM   967  C  CA    . TYR A 1 121 ? 57.443 -4.818  -6.323  1.00 9.73  ? 118 TYR A CA    1 
ATOM   968  C  C     . TYR A 1 121 ? 58.272 -4.576  -7.557  1.00 11.03 ? 118 TYR A C     1 
ATOM   969  O  O     . TYR A 1 121 ? 57.802 -3.973  -8.526  1.00 12.67 ? 118 TYR A O     1 
ATOM   970  C  CB    . TYR A 1 121 ? 56.709 -6.147  -6.444  1.00 8.47  ? 118 TYR A CB    1 
ATOM   971  C  CG    . TYR A 1 121 ? 55.980 -6.533  -5.182  1.00 10.11 ? 118 TYR A CG    1 
ATOM   972  C  CD1   . TYR A 1 121 ? 54.651 -6.178  -4.993  1.00 10.85 ? 118 TYR A CD1   1 
ATOM   973  C  CD2   . TYR A 1 121 ? 56.621 -7.251  -4.186  1.00 12.50 ? 118 TYR A CD2   1 
ATOM   974  C  CE1   . TYR A 1 121 ? 53.975 -6.520  -3.832  1.00 13.33 ? 118 TYR A CE1   1 
ATOM   975  C  CE2   . TYR A 1 121 ? 55.955 -7.605  -3.026  1.00 12.72 ? 118 TYR A CE2   1 
ATOM   976  C  CZ    . TYR A 1 121 ? 54.638 -7.231  -2.853  1.00 14.18 ? 118 TYR A CZ    1 
ATOM   977  O  OH    . TYR A 1 121 ? 53.971 -7.583  -1.704  1.00 16.22 ? 118 TYR A OH    1 
ATOM   978  N  N     . VAL A 1 122 ? 59.486 -5.113  -7.522  1.00 10.22 ? 119 VAL A N     1 
ATOM   979  C  CA    . VAL A 1 122 ? 60.503 -4.958  -8.545  1.00 14.33 ? 119 VAL A CA    1 
ATOM   980  C  C     . VAL A 1 122 ? 61.002 -6.345  -8.904  1.00 15.45 ? 119 VAL A C     1 
ATOM   981  O  O     . VAL A 1 122 ? 61.424 -7.074  -8.015  1.00 12.20 ? 119 VAL A O     1 
ATOM   982  C  CB    . VAL A 1 122 ? 61.690 -4.120  -8.007  1.00 16.72 ? 119 VAL A CB    1 
ATOM   983  C  CG1   . VAL A 1 122 ? 62.455 -3.495  -9.126  1.00 26.19 ? 119 VAL A CG1   1 
ATOM   984  C  CG2   . VAL A 1 122 ? 61.187 -3.069  -7.029  1.00 20.86 ? 119 VAL A CG2   1 
ATOM   985  N  N     . ASP A 1 123 ? 60.977 -6.728  -10.176 1.00 17.32 ? 120 ASP A N     1 
ATOM   986  C  CA    . ASP A 1 123 ? 61.658 -7.960  -10.568 1.00 13.86 ? 120 ASP A CA    1 
ATOM   987  C  C     . ASP A 1 123 ? 63.049 -7.609  -11.058 1.00 14.69 ? 120 ASP A C     1 
ATOM   988  O  O     . ASP A 1 123 ? 63.208 -7.034  -12.131 1.00 18.19 ? 120 ASP A O     1 
ATOM   989  C  CB    . ASP A 1 123 ? 60.877 -8.725  -11.639 1.00 22.19 ? 120 ASP A CB    1 
ATOM   990  C  CG    . ASP A 1 123 ? 61.429 -10.118 -11.876 1.00 23.37 ? 120 ASP A CG    1 
ATOM   991  O  OD1   . ASP A 1 123 ? 62.657 -10.269 -12.001 1.00 18.73 ? 120 ASP A OD1   1 
ATOM   992  O  OD2   . ASP A 1 123 ? 60.638 -11.090 -11.919 1.00 35.64 ? 120 ASP A OD2   1 
ATOM   993  N  N     . LEU A 1 124 ? 64.054 -7.947  -10.256 1.00 11.58 ? 121 LEU A N     1 
ATOM   994  C  CA    . LEU A 1 124 ? 65.426 -7.524  -10.521 1.00 13.82 ? 121 LEU A CA    1 
ATOM   995  C  C     . LEU A 1 124 ? 66.298 -8.604  -11.146 1.00 12.50 ? 121 LEU A C     1 
ATOM   996  O  O     . LEU A 1 124 ? 67.511 -8.405  -11.285 1.00 13.84 ? 121 LEU A O     1 
ATOM   997  C  CB    . LEU A 1 124 ? 66.089 -7.058  -9.225  1.00 14.85 ? 121 LEU A CB    1 
ATOM   998  C  CG    . LEU A 1 124 ? 65.535 -5.800  -8.567  1.00 13.14 ? 121 LEU A CG    1 
ATOM   999  C  CD1   . LEU A 1 124 ? 66.086 -5.669  -7.164  1.00 19.27 ? 121 LEU A CD1   1 
ATOM   1000 C  CD2   . LEU A 1 124 ? 65.875 -4.575  -9.414  1.00 22.38 ? 121 LEU A CD2   1 
ATOM   1001 N  N     . THR A 1 125 ? 65.695 -9.737  -11.490 1.00 12.57 ? 122 THR A N     1 
ATOM   1002 C  CA    . THR A 1 125 ? 66.461 -10.872 -11.983 1.00 12.00 ? 122 THR A CA    1 
ATOM   1003 C  C     . THR A 1 125 ? 67.380 -10.487 -13.152 1.00 12.96 ? 122 THR A C     1 
ATOM   1004 O  O     . THR A 1 125 ? 68.578 -10.777 -13.116 1.00 15.66 ? 122 THR A O     1 
ATOM   1005 C  CB    . THR A 1 125 ? 65.539 -12.001 -12.399 1.00 16.16 ? 122 THR A CB    1 
ATOM   1006 O  OG1   . THR A 1 125 ? 64.658 -12.305 -11.310 1.00 14.42 ? 122 THR A OG1   1 
ATOM   1007 C  CG2   . THR A 1 125 ? 66.350 -13.239 -12.758 1.00 18.98 ? 122 THR A CG2   1 
ATOM   1008 N  N     . SER A 1 126 ? 66.830 -9.812  -14.163 1.00 15.31 ? 123 SER A N     1 
ATOM   1009 C  CA    . SER A 1 126 ? 67.633 -9.419  -15.329 1.00 15.63 ? 123 SER A CA    1 
ATOM   1010 C  C     . SER A 1 126 ? 68.679 -8.355  -14.991 1.00 16.33 ? 123 SER A C     1 
ATOM   1011 O  O     . SER A 1 126 ? 69.825 -8.448  -15.432 1.00 17.48 ? 123 SER A O     1 
ATOM   1012 C  CB    . SER A 1 126 ? 66.730 -8.914  -16.450 1.00 22.47 ? 123 SER A CB    1 
ATOM   1013 O  OG    A SER A 1 126 ? 65.819 -9.910  -16.861 0.43 20.53 ? 123 SER A OG    1 
ATOM   1014 O  OG    B SER A 1 126 ? 66.013 -7.767  -16.046 0.57 20.70 ? 123 SER A OG    1 
ATOM   1015 N  N     . ALA A 1 127 ? 68.290 -7.349  -14.212 1.00 15.64 ? 124 ALA A N     1 
ATOM   1016 C  CA    . ALA A 1 127 ? 69.221 -6.299  -13.809 1.00 17.01 ? 124 ALA A CA    1 
ATOM   1017 C  C     . ALA A 1 127 ? 70.400 -6.873  -13.031 1.00 16.58 ? 124 ALA A C     1 
ATOM   1018 O  O     . ALA A 1 127 ? 71.529 -6.392  -13.150 1.00 17.40 ? 124 ALA A O     1 
ATOM   1019 C  CB    . ALA A 1 127 ? 68.506 -5.229  -12.968 1.00 15.51 ? 124 ALA A CB    1 
ATOM   1020 N  N     . VAL A 1 128 ? 70.131 -7.906  -12.229 1.00 15.82 ? 125 VAL A N     1 
ATOM   1021 C  CA    . VAL A 1 128 ? 71.180 -8.545  -11.451 1.00 14.70 ? 125 VAL A CA    1 
ATOM   1022 C  C     . VAL A 1 128 ? 72.163 -9.283  -12.361 1.00 19.00 ? 125 VAL A C     1 
ATOM   1023 O  O     . VAL A 1 128 ? 73.379 -9.187  -12.174 1.00 19.05 ? 125 VAL A O     1 
ATOM   1024 C  CB    . VAL A 1 128 ? 70.578 -9.519  -10.410 1.00 14.63 ? 125 VAL A CB    1 
ATOM   1025 C  CG1   . VAL A 1 128 ? 71.607 -10.573 -9.991  1.00 18.21 ? 125 VAL A CG1   1 
ATOM   1026 C  CG2   . VAL A 1 128 ? 70.095 -8.735  -9.211  1.00 15.74 ? 125 VAL A CG2   1 
ATOM   1027 N  N     . GLN A 1 129 ? 71.629 -10.004 -13.340 1.00 16.38 ? 126 GLN A N     1 
ATOM   1028 C  CA    . GLN A 1 129 ? 72.472 -10.701 -14.310 1.00 24.31 ? 126 GLN A CA    1 
ATOM   1029 C  C     . GLN A 1 129 ? 73.412 -9.732  -15.017 1.00 23.78 ? 126 GLN A C     1 
ATOM   1030 O  O     . GLN A 1 129 ? 74.593 -10.019 -15.180 1.00 25.87 ? 126 GLN A O     1 
ATOM   1031 C  CB    . GLN A 1 129 ? 71.621 -11.453 -15.333 1.00 21.81 ? 126 GLN A CB    1 
ATOM   1032 C  CG    . GLN A 1 129 ? 70.761 -12.554 -14.724 1.00 35.00 ? 126 GLN A CG    1 
ATOM   1033 C  CD    . GLN A 1 129 ? 71.586 -13.683 -14.126 1.00 43.29 ? 126 GLN A CD    1 
ATOM   1034 O  OE1   . GLN A 1 129 ? 71.161 -14.343 -13.175 1.00 45.93 ? 126 GLN A OE1   1 
ATOM   1035 N  NE2   . GLN A 1 129 ? 72.762 -13.927 -14.697 1.00 48.26 ? 126 GLN A NE2   1 
ATOM   1036 N  N     . GLU A 1 130 ? 72.900 -8.571  -15.413 1.00 24.49 ? 127 GLU A N     1 
ATOM   1037 C  CA    . GLU A 1 130 ? 73.755 -7.595  -16.081 1.00 28.86 ? 127 GLU A CA    1 
ATOM   1038 C  C     . GLU A 1 130 ? 74.813 -7.001  -15.164 1.00 31.49 ? 127 GLU A C     1 
ATOM   1039 O  O     . GLU A 1 130 ? 75.965 -6.837  -15.569 1.00 27.26 ? 127 GLU A O     1 
ATOM   1040 C  CB    . GLU A 1 130 ? 72.924 -6.468  -16.690 1.00 31.02 ? 127 GLU A CB    1 
ATOM   1041 C  CG    . GLU A 1 130 ? 71.772 -6.950  -17.518 1.00 31.07 ? 127 GLU A CG    1 
ATOM   1042 C  CD    . GLU A 1 130 ? 71.403 -5.960  -18.601 1.00 63.11 ? 127 GLU A CD    1 
ATOM   1043 O  OE1   . GLU A 1 130 ? 71.997 -4.856  -18.622 1.00 55.78 ? 127 GLU A OE1   1 
ATOM   1044 O  OE2   . GLU A 1 130 ? 70.539 -6.299  -19.441 1.00 69.12 ? 127 GLU A OE2   1 
ATOM   1045 N  N     . ARG A 1 131 ? 74.436 -6.670  -13.935 1.00 21.95 ? 128 ARG A N     1 
ATOM   1046 C  CA    . ARG A 1 131 ? 75.402 -6.091  -13.014 1.00 26.05 ? 128 ARG A CA    1 
ATOM   1047 C  C     . ARG A 1 131 ? 76.498 -7.100  -12.676 1.00 26.16 ? 128 ARG A C     1 
ATOM   1048 O  O     . ARG A 1 131 ? 77.660 -6.727  -12.500 1.00 26.62 ? 128 ARG A O     1 
ATOM   1049 C  CB    . ARG A 1 131 ? 74.715 -5.602  -11.739 1.00 19.03 ? 128 ARG A CB    1 
ATOM   1050 C  CG    . ARG A 1 131 ? 75.682 -5.042  -10.712 1.00 26.09 ? 128 ARG A CG    1 
ATOM   1051 C  CD    . ARG A 1 131 ? 76.303 -3.747  -11.199 1.00 23.46 ? 128 ARG A CD    1 
ATOM   1052 N  NE    . ARG A 1 131 ? 75.245 -2.779  -11.423 1.00 31.39 ? 128 ARG A NE    1 
ATOM   1053 C  CZ    . ARG A 1 131 ? 74.822 -1.932  -10.491 1.00 25.21 ? 128 ARG A CZ    1 
ATOM   1054 N  NH1   . ARG A 1 131 ? 75.398 -1.925  -9.296  1.00 22.76 ? 128 ARG A NH1   1 
ATOM   1055 N  NH2   . ARG A 1 131 ? 73.843 -1.083  -10.761 1.00 38.82 ? 128 ARG A NH2   1 
ATOM   1056 N  N     . LEU A 1 132 ? 76.125 -8.375  -12.605 1.00 23.35 ? 129 LEU A N     1 
ATOM   1057 C  CA    . LEU A 1 132 ? 77.088 -9.443  -12.323 1.00 23.00 ? 129 LEU A CA    1 
ATOM   1058 C  C     . LEU A 1 132 ? 78.155 -9.531  -13.411 1.00 32.78 ? 129 LEU A C     1 
ATOM   1059 O  O     . LEU A 1 132 ? 79.318 -9.811  -13.122 1.00 33.03 ? 129 LEU A O     1 
ATOM   1060 C  CB    . LEU A 1 132 ? 76.369 -10.786 -12.164 1.00 25.86 ? 129 LEU A CB    1 
ATOM   1061 C  CG    . LEU A 1 132 ? 75.917 -11.087 -10.727 1.00 21.94 ? 129 LEU A CG    1 
ATOM   1062 C  CD1   . LEU A 1 132 ? 74.999 -12.298 -10.650 1.00 24.49 ? 129 LEU A CD1   1 
ATOM   1063 C  CD2   . LEU A 1 132 ? 77.132 -11.272 -9.818  1.00 24.84 ? 129 LEU A CD2   1 
ATOM   1064 N  N     . GLN A 1 133 ? 77.762 -9.283  -14.658 1.00 31.77 ? 130 GLN A N     1 
ATOM   1065 C  CA    . GLN A 1 133 ? 78.722 -9.250  -15.762 1.00 33.90 ? 130 GLN A CA    1 
ATOM   1066 C  C     . GLN A 1 133 ? 79.673 -8.063  -15.627 1.00 38.40 ? 130 GLN A C     1 
ATOM   1067 O  O     . GLN A 1 133 ? 80.876 -8.200  -15.848 1.00 46.65 ? 130 GLN A O     1 
ATOM   1068 C  CB    . GLN A 1 133 ? 78.001 -9.192  -17.107 1.00 36.94 ? 130 GLN A CB    1 
ATOM   1069 C  CG    . GLN A 1 133 ? 77.219 -10.451 -17.441 1.00 44.05 ? 130 GLN A CG    1 
ATOM   1070 C  CD    . GLN A 1 133 ? 76.520 -10.366 -18.787 1.00 62.74 ? 130 GLN A CD    1 
ATOM   1071 O  OE1   . GLN A 1 133 ? 75.687 -9.485  -19.016 1.00 57.45 ? 130 GLN A OE1   1 
ATOM   1072 N  NE2   . GLN A 1 133 ? 76.854 -11.287 -19.687 1.00 70.96 ? 130 GLN A NE2   1 
ATOM   1073 N  N     . LYS A 1 134 ? 79.137 -6.903  -15.260 1.00 38.00 ? 131 LYS A N     1 
ATOM   1074 C  CA    . LYS A 1 134 ? 79.971 -5.721  -15.035 1.00 41.50 ? 131 LYS A CA    1 
ATOM   1075 C  C     . LYS A 1 134 ? 81.008 -5.972  -13.948 1.00 48.03 ? 131 LYS A C     1 
ATOM   1076 O  O     . LYS A 1 134 ? 82.167 -5.581  -14.084 1.00 51.11 ? 131 LYS A O     1 
ATOM   1077 C  CB    . LYS A 1 134 ? 79.123 -4.503  -14.651 1.00 42.09 ? 131 LYS A CB    1 
ATOM   1078 C  CG    . LYS A 1 134 ? 78.549 -3.732  -15.826 1.00 42.95 ? 131 LYS A CG    1 
ATOM   1079 C  CD    . LYS A 1 134 ? 77.950 -2.401  -15.378 1.00 47.55 ? 131 LYS A CD    1 
ATOM   1080 C  CE    . LYS A 1 134 ? 76.651 -2.591  -14.609 1.00 47.31 ? 131 LYS A CE    1 
ATOM   1081 N  NZ    . LYS A 1 134 ? 76.053 -1.292  -14.190 1.00 48.78 ? 131 LYS A NZ    1 
ATOM   1082 N  N     . LEU A 1 135 ? 80.582 -6.629  -12.872 1.00 40.97 ? 132 LEU A N     1 
ATOM   1083 C  CA    . LEU A 1 135 ? 81.448 -6.860  -11.724 1.00 51.07 ? 132 LEU A CA    1 
ATOM   1084 C  C     . LEU A 1 135 ? 82.677 -7.687  -12.084 1.00 53.07 ? 132 LEU A C     1 
ATOM   1085 O  O     . LEU A 1 135 ? 83.764 -7.436  -11.565 1.00 56.12 ? 132 LEU A O     1 
ATOM   1086 C  CB    . LEU A 1 135 ? 80.671 -7.544  -10.596 1.00 49.18 ? 132 LEU A CB    1 
ATOM   1087 C  CG    . LEU A 1 135 ? 79.727 -6.620  -9.823  1.00 45.83 ? 132 LEU A CG    1 
ATOM   1088 C  CD1   . LEU A 1 135 ? 79.138 -7.335  -8.616  1.00 44.41 ? 132 LEU A CD1   1 
ATOM   1089 C  CD2   . LEU A 1 135 ? 80.447 -5.346  -9.404  1.00 46.67 ? 132 LEU A CD2   1 
ATOM   1090 N  N     . GLN A 1 136 ? 82.500 -8.663  -12.972 1.00 51.03 ? 133 GLN A N     1 
ATOM   1091 C  CA    . GLN A 1 136 ? 83.600 -9.515  -13.427 1.00 57.81 ? 133 GLN A CA    1 
ATOM   1092 C  C     . GLN A 1 136 ? 84.234 -10.293 -12.274 1.00 54.44 ? 133 GLN A C     1 
ATOM   1093 O  O     . GLN A 1 136 ? 85.451 -10.264 -12.098 1.00 53.06 ? 133 GLN A O     1 
ATOM   1094 C  CB    . GLN A 1 136 ? 84.674 -8.680  -14.132 1.00 52.99 ? 133 GLN A CB    1 
ATOM   1095 C  CG    . GLN A 1 136 ? 84.202 -7.932  -15.367 1.00 51.45 ? 133 GLN A CG    1 
ATOM   1096 C  CD    . GLN A 1 136 ? 84.470 -8.695  -16.650 1.00 61.48 ? 133 GLN A CD    1 
ATOM   1097 O  OE1   . GLN A 1 136 ? 85.163 -9.714  -16.647 1.00 63.37 ? 133 GLN A OE1   1 
ATOM   1098 N  NE2   . GLN A 1 136 ? 83.935 -8.195  -17.757 1.00 59.42 ? 133 GLN A NE2   1 
ATOM   1099 N  N     . GLY A 1 137 ? 83.409 -10.978 -11.489 1.00 49.32 ? 134 GLY A N     1 
ATOM   1100 C  CA    . GLY A 1 137 ? 83.896 -11.765 -10.368 1.00 46.65 ? 134 GLY A CA    1 
ATOM   1101 C  C     . GLY A 1 137 ? 84.592 -10.930 -9.307  1.00 52.23 ? 134 GLY A C     1 
ATOM   1102 O  O     . GLY A 1 137 ? 85.391 -11.443 -8.526  1.00 53.76 ? 134 GLY A O     1 
ATOM   1103 N  N     . GLN A 1 138 ? 84.302 -9.633  -9.289  1.00 46.36 ? 135 GLN A N     1 
ATOM   1104 C  CA    . GLN A 1 138 ? 84.827 -8.749  -8.256  1.00 50.97 ? 135 GLN A CA    1 
ATOM   1105 C  C     . GLN A 1 138 ? 83.943 -8.842  -7.019  1.00 46.02 ? 135 GLN A C     1 
ATOM   1106 O  O     . GLN A 1 138 ? 82.718 -8.830  -7.133  1.00 44.01 ? 135 GLN A O     1 
ATOM   1107 C  CB    . GLN A 1 138 ? 84.898 -7.309  -8.763  1.00 50.13 ? 135 GLN A CB    1 
ATOM   1108 C  CG    . GLN A 1 138 ? 85.490 -6.313  -7.789  1.00 59.18 ? 135 GLN A CG    1 
ATOM   1109 C  CD    . GLN A 1 138 ? 85.533 -4.912  -8.358  1.00 64.74 ? 135 GLN A CD    1 
ATOM   1110 O  OE1   . GLN A 1 138 ? 86.164 -4.669  -9.386  1.00 71.26 ? 135 GLN A OE1   1 
ATOM   1111 N  NE2   . GLN A 1 138 ? 84.853 -3.981  -7.696  1.00 54.25 ? 135 GLN A NE2   1 
ATOM   1112 N  N     . PRO A 1 139 ? 84.561 -8.951  -5.832  1.00 43.75 ? 136 PRO A N     1 
ATOM   1113 C  CA    . PRO A 1 139 ? 83.795 -9.079  -4.589  1.00 38.62 ? 136 PRO A CA    1 
ATOM   1114 C  C     . PRO A 1 139 ? 82.952 -7.844  -4.301  1.00 37.51 ? 136 PRO A C     1 
ATOM   1115 O  O     . PRO A 1 139 ? 83.257 -6.755  -4.781  1.00 35.59 ? 136 PRO A O     1 
ATOM   1116 C  CB    . PRO A 1 139 ? 84.885 -9.261  -3.529  1.00 43.86 ? 136 PRO A CB    1 
ATOM   1117 C  CG    . PRO A 1 139 ? 86.081 -8.600  -4.114  1.00 46.14 ? 136 PRO A CG    1 
ATOM   1118 C  CD    . PRO A 1 139 ? 86.010 -8.926  -5.576  1.00 46.80 ? 136 PRO A CD    1 
ATOM   1119 N  N     . ILE A 1 140 ? 81.893 -8.026  -3.525  1.00 33.68 ? 137 ILE A N     1 
ATOM   1120 C  CA    . ILE A 1 140 ? 81.013 -6.925  -3.179  1.00 26.15 ? 137 ILE A CA    1 
ATOM   1121 C  C     . ILE A 1 140 ? 81.433 -6.330  -1.848  1.00 22.32 ? 137 ILE A C     1 
ATOM   1122 O  O     . ILE A 1 140 ? 81.458 -7.010  -0.828  1.00 26.35 ? 137 ILE A O     1 
ATOM   1123 C  CB    . ILE A 1 140 ? 79.551 -7.387  -3.129  1.00 27.94 ? 137 ILE A CB    1 
ATOM   1124 C  CG1   . ILE A 1 140 ? 79.143 -7.892  -4.518  1.00 31.41 ? 137 ILE A CG1   1 
ATOM   1125 C  CG2   . ILE A 1 140 ? 78.648 -6.254  -2.669  1.00 23.05 ? 137 ILE A CG2   1 
ATOM   1126 C  CD1   . ILE A 1 140 ? 77.794 -8.553  -4.579  1.00 31.94 ? 137 ILE A CD1   1 
ATOM   1127 N  N     . SER A 1 141 ? 81.779 -5.051  -1.874  1.00 22.75 ? 138 SER A N     1 
ATOM   1128 C  CA    . SER A 1 141 ? 82.231 -4.354  -0.677  1.00 24.31 ? 138 SER A CA    1 
ATOM   1129 C  C     . SER A 1 141 ? 81.049 -3.993  0.224   1.00 21.73 ? 138 SER A C     1 
ATOM   1130 O  O     . SER A 1 141 ? 79.956 -3.703  -0.266  1.00 20.83 ? 138 SER A O     1 
ATOM   1131 C  CB    . SER A 1 141 ? 83.016 -3.098  -1.074  1.00 22.42 ? 138 SER A CB    1 
ATOM   1132 O  OG    . SER A 1 141 ? 83.096 -2.168  -0.008  1.00 31.05 ? 138 SER A OG    1 
ATOM   1133 N  N     . ALA A 1 142 ? 81.269 -4.007  1.534   1.00 18.67 ? 139 ALA A N     1 
ATOM   1134 C  CA    . ALA A 1 142 ? 80.240 -3.593  2.481   1.00 18.66 ? 139 ALA A CA    1 
ATOM   1135 C  C     . ALA A 1 142 ? 79.801 -2.155  2.211   1.00 22.37 ? 139 ALA A C     1 
ATOM   1136 O  O     . ALA A 1 142 ? 78.670 -1.771  2.519   1.00 20.96 ? 139 ALA A O     1 
ATOM   1137 C  CB    . ALA A 1 142 ? 80.736 -3.738  3.911   1.00 19.87 ? 139 ALA A CB    1 
ATOM   1138 N  N     . ASP A 1 143 ? 80.693 -1.365  1.617   1.00 21.42 ? 140 ASP A N     1 
ATOM   1139 C  CA    . ASP A 1 143 ? 80.404 0.040   1.349   1.00 25.66 ? 140 ASP A CA    1 
ATOM   1140 C  C     . ASP A 1 143 ? 79.278 0.198   0.340   1.00 25.81 ? 140 ASP A C     1 
ATOM   1141 O  O     . ASP A 1 143 ? 78.649 1.258   0.263   1.00 24.22 ? 140 ASP A O     1 
ATOM   1142 C  CB    . ASP A 1 143 ? 81.654 0.763   0.846   1.00 22.44 ? 140 ASP A CB    1 
ATOM   1143 C  CG    . ASP A 1 143 ? 82.761 0.800   1.882   1.00 39.92 ? 140 ASP A CG    1 
ATOM   1144 O  OD1   . ASP A 1 143 ? 82.455 0.691   3.089   1.00 34.37 ? 140 ASP A OD1   1 
ATOM   1145 O  OD2   . ASP A 1 143 ? 83.939 0.949   1.488   1.00 53.46 ? 140 ASP A OD2   1 
ATOM   1146 N  N     . LEU A 1 144 ? 79.023 -0.856  -0.431  1.00 18.37 ? 141 LEU A N     1 
ATOM   1147 C  CA    . LEU A 1 144 ? 77.949 -0.831  -1.410  1.00 18.89 ? 141 LEU A CA    1 
ATOM   1148 C  C     . LEU A 1 144 ? 76.592 -1.149  -0.787  1.00 16.97 ? 141 LEU A C     1 
ATOM   1149 O  O     . LEU A 1 144 ? 75.566 -0.973  -1.430  1.00 16.19 ? 141 LEU A O     1 
ATOM   1150 C  CB    . LEU A 1 144 ? 78.228 -1.815  -2.528  1.00 17.49 ? 141 LEU A CB    1 
ATOM   1151 C  CG    . LEU A 1 144 ? 79.484 -1.537  -3.346  1.00 22.43 ? 141 LEU A CG    1 
ATOM   1152 C  CD1   . LEU A 1 144 ? 79.618 -2.577  -4.437  1.00 24.19 ? 141 LEU A CD1   1 
ATOM   1153 C  CD2   . LEU A 1 144 ? 79.421 -0.134  -3.933  1.00 25.70 ? 141 LEU A CD2   1 
ATOM   1154 N  N     . LEU A 1 145 ? 76.598 -1.594  0.466   1.00 14.24 ? 142 LEU A N     1 
ATOM   1155 C  CA    . LEU A 1 145 ? 75.372 -1.968  1.169   1.00 14.43 ? 142 LEU A CA    1 
ATOM   1156 C  C     . LEU A 1 145 ? 75.231 -1.227  2.503   1.00 14.44 ? 142 LEU A C     1 
ATOM   1157 O  O     . LEU A 1 145 ? 75.103 -1.839  3.563   1.00 14.95 ? 142 LEU A O     1 
ATOM   1158 C  CB    . LEU A 1 145 ? 75.359 -3.491  1.380   1.00 13.39 ? 142 LEU A CB    1 
ATOM   1159 C  CG    . LEU A 1 145 ? 75.283 -4.311  0.094   1.00 13.52 ? 142 LEU A CG    1 
ATOM   1160 C  CD1   . LEU A 1 145 ? 75.720 -5.774  0.313   1.00 17.48 ? 142 LEU A CD1   1 
ATOM   1161 C  CD2   . LEU A 1 145 ? 73.893 -4.267  -0.491  1.00 17.31 ? 142 LEU A CD2   1 
ATOM   1162 N  N     . PRO A 1 146 ? 75.219 0.115   2.457   1.00 15.60 ? 143 PRO A N     1 
ATOM   1163 C  CA    . PRO A 1 146 ? 75.315 0.896   3.695   1.00 15.42 ? 143 PRO A CA    1 
ATOM   1164 C  C     . PRO A 1 146 ? 74.057 0.913   4.554   1.00 15.80 ? 143 PRO A C     1 
ATOM   1165 O  O     . PRO A 1 146 ? 74.141 1.339   5.699   1.00 17.56 ? 143 PRO A O     1 
ATOM   1166 C  CB    . PRO A 1 146 ? 75.626 2.305   3.180   1.00 18.06 ? 143 PRO A CB    1 
ATOM   1167 C  CG    . PRO A 1 146 ? 74.982 2.345   1.836   1.00 18.22 ? 143 PRO A CG    1 
ATOM   1168 C  CD    . PRO A 1 146 ? 75.219 0.975   1.262   1.00 14.48 ? 143 PRO A CD    1 
ATOM   1169 N  N     . SER A 1 147 ? 72.918 0.447   4.039   1.00 14.98 ? 144 SER A N     1 
ATOM   1170 C  CA    . SER A 1 147 ? 71.708 0.434   4.861   1.00 13.97 ? 144 SER A CA    1 
ATOM   1171 C  C     . SER A 1 147 ? 71.032 -0.944  4.856   1.00 13.42 ? 144 SER A C     1 
ATOM   1172 O  O     . SER A 1 147 ? 69.849 -1.069  5.179   1.00 13.23 ? 144 SER A O     1 
ATOM   1173 C  CB    . SER A 1 147 ? 70.716 1.510   4.391   1.00 16.47 ? 144 SER A CB    1 
ATOM   1174 O  OG    . SER A 1 147 ? 70.247 1.252   3.077   1.00 15.73 ? 144 SER A OG    1 
ATOM   1175 N  N     . THR A 1 148 ? 71.817 -1.968  4.539   1.00 12.59 ? 145 THR A N     1 
ATOM   1176 C  CA    . THR A 1 148 ? 71.303 -3.333  4.387   1.00 11.73 ? 145 THR A CA    1 
ATOM   1177 C  C     . THR A 1 148 ? 71.503 -4.189  5.638   1.00 10.84 ? 145 THR A C     1 
ATOM   1178 O  O     . THR A 1 148 ? 72.599 -4.237  6.211   1.00 14.23 ? 145 THR A O     1 
ATOM   1179 C  CB    . THR A 1 148 ? 71.985 -4.039  3.193   1.00 10.71 ? 145 THR A CB    1 
ATOM   1180 O  OG1   . THR A 1 148 ? 71.650 -3.364  1.974   1.00 11.26 ? 145 THR A OG1   1 
ATOM   1181 C  CG2   . THR A 1 148 ? 71.513 -5.496  3.090   1.00 11.27 ? 145 THR A CG2   1 
ATOM   1182 N  N     . TYR A 1 149 ? 70.430 -4.868  6.031   1.00 10.34 ? 146 TYR A N     1 
ATOM   1183 C  CA    . TYR A 1 149 ? 70.441 -5.908  7.066   1.00 11.67 ? 146 TYR A CA    1 
ATOM   1184 C  C     . TYR A 1 149 ? 70.370 -7.264  6.410   1.00 16.03 ? 146 TYR A C     1 
ATOM   1185 O  O     . TYR A 1 149 ? 69.612 -7.449  5.457   1.00 12.90 ? 146 TYR A O     1 
ATOM   1186 C  CB    . TYR A 1 149 ? 69.249 -5.766  8.014   1.00 10.72 ? 146 TYR A CB    1 
ATOM   1187 C  CG    . TYR A 1 149 ? 69.423 -4.710  9.069   1.00 11.23 ? 146 TYR A CG    1 
ATOM   1188 C  CD1   . TYR A 1 149 ? 69.843 -5.052  10.342  1.00 14.23 ? 146 TYR A CD1   1 
ATOM   1189 C  CD2   . TYR A 1 149 ? 69.159 -3.367  8.791   1.00 15.18 ? 146 TYR A CD2   1 
ATOM   1190 C  CE1   . TYR A 1 149 ? 70.012 -4.094  11.309  1.00 14.85 ? 146 TYR A CE1   1 
ATOM   1191 C  CE2   . TYR A 1 149 ? 69.326 -2.397  9.763   1.00 16.15 ? 146 TYR A CE2   1 
ATOM   1192 C  CZ    . TYR A 1 149 ? 69.755 -2.776  11.022  1.00 17.16 ? 146 TYR A CZ    1 
ATOM   1193 O  OH    . TYR A 1 149 ? 69.939 -1.839  12.017  1.00 26.69 ? 146 TYR A OH    1 
ATOM   1194 N  N     . ILE A 1 150 ? 71.146 -8.216  6.917   1.00 10.09 ? 147 ILE A N     1 
ATOM   1195 C  CA    . ILE A 1 150 ? 71.035 -9.600  6.463   1.00 10.56 ? 147 ILE A CA    1 
ATOM   1196 C  C     . ILE A 1 150 ? 70.282 -10.390 7.521   1.00 11.03 ? 147 ILE A C     1 
ATOM   1197 O  O     . ILE A 1 150 ? 70.811 -10.626 8.602   1.00 12.12 ? 147 ILE A O     1 
ATOM   1198 C  CB    . ILE A 1 150 ? 72.414 -10.256 6.231   1.00 9.11  ? 147 ILE A CB    1 
ATOM   1199 C  CG1   . ILE A 1 150 ? 73.295 -9.387  5.328   1.00 10.69 ? 147 ILE A CG1   1 
ATOM   1200 C  CG2   . ILE A 1 150 ? 72.237 -11.672 5.650   1.00 13.96 ? 147 ILE A CG2   1 
ATOM   1201 C  CD1   . ILE A 1 150 ? 72.721 -9.183  3.916   1.00 14.01 ? 147 ILE A CD1   1 
ATOM   1202 N  N     . GLU A 1 151 ? 69.041 -10.771 7.235   1.00 9.83  ? 148 GLU A N     1 
ATOM   1203 C  CA    . GLU A 1 151 ? 68.206 -11.419 8.248   1.00 10.08 ? 148 GLU A CA    1 
ATOM   1204 C  C     . GLU A 1 151 ? 68.811 -12.751 8.708   1.00 12.08 ? 148 GLU A C     1 
ATOM   1205 O  O     . GLU A 1 151 ? 69.230 -13.565 7.883   1.00 12.76 ? 148 GLU A O     1 
ATOM   1206 C  CB    . GLU A 1 151 ? 66.778 -11.643 7.718   1.00 11.30 ? 148 GLU A CB    1 
ATOM   1207 C  CG    . GLU A 1 151 ? 65.864 -12.454 8.681   1.00 14.40 ? 148 GLU A CG    1 
ATOM   1208 C  CD    . GLU A 1 151 ? 65.653 -11.792 10.038  1.00 17.12 ? 148 GLU A CD    1 
ATOM   1209 O  OE1   . GLU A 1 151 ? 65.372 -12.513 11.022  1.00 17.54 ? 148 GLU A OE1   1 
ATOM   1210 O  OE2   . GLU A 1 151 ? 65.752 -10.553 10.129  1.00 19.15 ? 148 GLU A OE2   1 
ATOM   1211 N  N     . GLY A 1 152 ? 68.873 -12.929 10.033  1.00 12.28 ? 149 GLY A N     1 
ATOM   1212 C  CA    . GLY A 1 152 ? 69.469 -14.114 10.636  1.00 13.94 ? 149 GLY A CA    1 
ATOM   1213 C  C     . GLY A 1 152 ? 70.908 -13.943 11.092  1.00 16.68 ? 149 GLY A C     1 
ATOM   1214 O  O     . GLY A 1 152 ? 71.435 -14.798 11.808  1.00 17.38 ? 149 GLY A O     1 
ATOM   1215 N  N     . LEU A 1 153 ? 71.551 -12.859 10.670  1.00 12.17 ? 150 LEU A N     1 
ATOM   1216 C  CA    . LEU A 1 153 ? 72.945 -12.612 11.022  1.00 13.11 ? 150 LEU A CA    1 
ATOM   1217 C  C     . LEU A 1 153 ? 73.050 -11.313 11.812  1.00 18.96 ? 150 LEU A C     1 
ATOM   1218 O  O     . LEU A 1 153 ? 72.220 -10.427 11.658  1.00 17.23 ? 150 LEU A O     1 
ATOM   1219 C  CB    . LEU A 1 153 ? 73.814 -12.566 9.762   1.00 12.75 ? 150 LEU A CB    1 
ATOM   1220 C  CG    . LEU A 1 153 ? 73.878 -13.857 8.951   1.00 15.75 ? 150 LEU A CG    1 
ATOM   1221 C  CD1   . LEU A 1 153 ? 74.733 -13.677 7.724   1.00 15.93 ? 150 LEU A CD1   1 
ATOM   1222 C  CD2   . LEU A 1 153 ? 74.384 -15.025 9.819   1.00 17.11 ? 150 LEU A CD2   1 
ATOM   1223 N  N     . PRO A 1 154 ? 74.072 -11.190 12.675  1.00 14.68 ? 151 PRO A N     1 
ATOM   1224 C  CA    . PRO A 1 154 ? 75.143 -12.154 12.940  1.00 15.40 ? 151 PRO A CA    1 
ATOM   1225 C  C     . PRO A 1 154 ? 74.689 -13.336 13.777  1.00 14.42 ? 151 PRO A C     1 
ATOM   1226 O  O     . PRO A 1 154 ? 73.676 -13.272 14.467  1.00 19.69 ? 151 PRO A O     1 
ATOM   1227 C  CB    . PRO A 1 154 ? 76.178 -11.317 13.703  1.00 16.27 ? 151 PRO A CB    1 
ATOM   1228 C  CG    . PRO A 1 154 ? 75.365 -10.270 14.397  1.00 18.64 ? 151 PRO A CG    1 
ATOM   1229 C  CD    . PRO A 1 154 ? 74.225 -9.953  13.461  1.00 17.81 ? 151 PRO A CD    1 
ATOM   1230 N  N     . GLN A 1 155 ? 75.460 -14.413 13.707  1.00 18.20 ? 152 GLN A N     1 
ATOM   1231 C  CA    . GLN A 1 155 ? 75.197 -15.597 14.505  1.00 25.68 ? 152 GLN A CA    1 
ATOM   1232 C  C     . GLN A 1 155 ? 76.500 -16.082 15.129  1.00 34.32 ? 152 GLN A C     1 
ATOM   1233 O  O     . GLN A 1 155 ? 77.581 -15.804 14.610  1.00 35.28 ? 152 GLN A O     1 
ATOM   1234 C  CB    . GLN A 1 155 ? 74.586 -16.707 13.656  1.00 29.74 ? 152 GLN A CB    1 
ATOM   1235 C  CG    . GLN A 1 155 ? 75.593 -17.801 13.316  1.00 40.17 ? 152 GLN A CG    1 
ATOM   1236 C  CD    . GLN A 1 155 ? 75.010 -18.930 12.508  1.00 37.61 ? 152 GLN A CD    1 
ATOM   1237 O  OE1   . GLN A 1 155 ? 73.824 -19.261 12.628  1.00 37.77 ? 152 GLN A OE1   1 
ATOM   1238 N  NE2   . GLN A 1 155 ? 75.843 -19.535 11.671  1.00 27.63 ? 152 GLN A NE2   1 
ATOM   1239 N  N     . GLY A 1 156 ? 76.370 -16.810 16.235  1.00 39.75 ? 153 GLY A N     1 
ATOM   1240 C  CA    . GLY A 1 156 ? 77.500 -17.347 16.960  1.00 51.12 ? 153 GLY A CA    1 
ATOM   1241 C  C     . GLY A 1 156 ? 78.412 -16.279 17.546  1.00 57.63 ? 153 GLY A C     1 
ATOM   1242 O  O     . GLY A 1 156 ? 77.938 -15.270 18.059  1.00 68.01 ? 153 GLY A O     1 
ATOM   1243 N  N     . PRO A 1 157 ? 79.747 -16.524 17.498  1.00 67.06 ? 154 PRO A N     1 
ATOM   1244 C  CA    . PRO A 1 157 ? 80.852 -15.613 17.877  1.00 68.96 ? 154 PRO A CA    1 
ATOM   1245 C  C     . PRO A 1 157 ? 80.553 -14.192 17.409  1.00 62.95 ? 154 PRO A C     1 
ATOM   1246 O  O     . PRO A 1 157 ? 81.389 -13.288 17.467  1.00 61.11 ? 154 PRO A O     1 
ATOM   1247 C  CB    . PRO A 1 157 ? 82.056 -16.201 17.157  1.00 52.36 ? 154 PRO A CB    1 
ATOM   1248 C  CG    . PRO A 1 157 ? 81.668 -17.659 16.859  1.00 47.30 ? 154 PRO A CG    1 
ATOM   1249 C  CD    . PRO A 1 157 ? 80.238 -17.888 17.213  1.00 53.95 ? 154 PRO A CD    1 
ATOM   1250 N  N     . THR A 1 163 ? 78.936 -5.138  19.644  1.00 69.42 ? 160 THR A N     1 
ATOM   1251 C  CA    . THR A 1 163 ? 77.773 -6.020  19.748  1.00 66.58 ? 160 THR A CA    1 
ATOM   1252 C  C     . THR A 1 163 ? 76.630 -5.357  20.503  1.00 61.77 ? 160 THR A C     1 
ATOM   1253 O  O     . THR A 1 163 ? 75.592 -5.969  20.737  1.00 66.97 ? 160 THR A O     1 
ATOM   1254 C  CB    . THR A 1 163 ? 78.115 -7.335  20.462  1.00 64.08 ? 160 THR A CB    1 
ATOM   1255 O  OG1   . THR A 1 163 ? 78.606 -7.044  21.777  1.00 75.30 ? 160 THR A OG1   1 
ATOM   1256 C  CG2   . THR A 1 163 ? 79.164 -8.113  19.691  1.00 63.68 ? 160 THR A CG2   1 
ATOM   1257 N  N     . VAL A 1 164 ? 76.829 -4.099  20.873  1.00 53.01 ? 161 VAL A N     1 
ATOM   1258 C  CA    . VAL A 1 164 ? 75.916 -3.378  21.752  1.00 54.49 ? 161 VAL A CA    1 
ATOM   1259 C  C     . VAL A 1 164 ? 74.987 -2.394  21.024  1.00 49.32 ? 161 VAL A C     1 
ATOM   1260 O  O     . VAL A 1 164 ? 73.832 -2.219  21.420  1.00 49.40 ? 161 VAL A O     1 
ATOM   1261 C  CB    . VAL A 1 164 ? 76.731 -2.630  22.841  1.00 60.76 ? 161 VAL A CB    1 
ATOM   1262 C  CG1   . VAL A 1 164 ? 75.850 -1.755  23.713  1.00 45.41 ? 161 VAL A CG1   1 
ATOM   1263 C  CG2   . VAL A 1 164 ? 77.462 -3.638  23.711  1.00 54.77 ? 161 VAL A CG2   1 
ATOM   1264 N  N     . GLN A 1 165 ? 75.483 -1.776  19.954  1.00 40.06 ? 162 GLN A N     1 
ATOM   1265 C  CA    . GLN A 1 165 ? 74.721 -0.799  19.172  1.00 41.56 ? 162 GLN A CA    1 
ATOM   1266 C  C     . GLN A 1 165 ? 74.035 -1.458  17.981  1.00 35.47 ? 162 GLN A C     1 
ATOM   1267 O  O     . GLN A 1 165 ? 74.504 -2.482  17.489  1.00 34.70 ? 162 GLN A O     1 
ATOM   1268 C  CB    . GLN A 1 165 ? 75.644 0.319   18.693  1.00 43.18 ? 162 GLN A CB    1 
ATOM   1269 C  CG    . GLN A 1 165 ? 76.842 -0.186  17.899  1.00 48.47 ? 162 GLN A CG    1 
ATOM   1270 C  CD    . GLN A 1 165 ? 77.569 0.905   17.139  1.00 53.02 ? 162 GLN A CD    1 
ATOM   1271 O  OE1   . GLN A 1 165 ? 77.528 0.952   15.907  1.00 56.02 ? 162 GLN A OE1   1 
ATOM   1272 N  NE2   . GLN A 1 165 ? 78.247 1.782   17.867  1.00 57.27 ? 162 GLN A NE2   1 
ATOM   1273 N  N     . LYS A 1 166 ? 72.934 -0.876  17.513  1.00 33.19 ? 163 LYS A N     1 
ATOM   1274 C  CA    . LYS A 1 166 ? 72.204 -1.470  16.395  1.00 33.72 ? 163 LYS A CA    1 
ATOM   1275 C  C     . LYS A 1 166 ? 73.026 -1.448  15.105  1.00 24.04 ? 163 LYS A C     1 
ATOM   1276 O  O     . LYS A 1 166 ? 73.094 -2.449  14.390  1.00 21.65 ? 163 LYS A O     1 
ATOM   1277 C  CB    . LYS A 1 166 ? 70.861 -0.766  16.170  1.00 35.44 ? 163 LYS A CB    1 
ATOM   1278 C  CG    . LYS A 1 166 ? 69.865 -1.642  15.415  1.00 39.59 ? 163 LYS A CG    1 
ATOM   1279 C  CD    . LYS A 1 166 ? 68.489 -1.003  15.296  1.00 44.71 ? 163 LYS A CD    1 
ATOM   1280 C  CE    . LYS A 1 166 ? 67.707 -1.582  14.124  1.00 39.76 ? 163 LYS A CE    1 
ATOM   1281 N  NZ    . LYS A 1 166 ? 67.542 -3.071  14.209  1.00 38.33 ? 163 LYS A NZ    1 
ATOM   1282 N  N     . GLU A 1 167 ? 73.645 -0.313  14.797  1.00 26.56 ? 164 GLU A N     1 
ATOM   1283 C  CA    . GLU A 1 167 ? 74.462 -0.215  13.591  1.00 29.13 ? 164 GLU A CA    1 
ATOM   1284 C  C     . GLU A 1 167 ? 75.623 -1.204  13.652  1.00 24.87 ? 164 GLU A C     1 
ATOM   1285 O  O     . GLU A 1 167 ? 76.013 -1.769  12.636  1.00 23.77 ? 164 GLU A O     1 
ATOM   1286 C  CB    . GLU A 1 167 ? 74.976 1.219   13.392  1.00 28.40 ? 164 GLU A CB    1 
ATOM   1287 C  CG    . GLU A 1 167 ? 75.954 1.421   12.218  1.00 22.44 ? 164 GLU A CG    1 
ATOM   1288 C  CD    . GLU A 1 167 ? 75.365 1.107   10.844  1.00 31.97 ? 164 GLU A CD    1 
ATOM   1289 O  OE1   . GLU A 1 167 ? 76.160 1.013   9.879   1.00 29.40 ? 164 GLU A OE1   1 
ATOM   1290 O  OE2   . GLU A 1 167 ? 74.126 0.960   10.719  1.00 28.75 ? 164 GLU A OE2   1 
ATOM   1291 N  N     . GLY A 1 168 ? 76.159 -1.417  14.850  1.00 32.44 ? 165 GLY A N     1 
ATOM   1292 C  CA    . GLY A 1 168 ? 77.240 -2.361  15.041  1.00 27.40 ? 165 GLY A CA    1 
ATOM   1293 C  C     . GLY A 1 168 ? 76.815 -3.774  14.705  1.00 22.23 ? 165 GLY A C     1 
ATOM   1294 O  O     . GLY A 1 168 ? 77.550 -4.511  14.052  1.00 26.88 ? 165 GLY A O     1 
ATOM   1295 N  N     . MET A 1 169 ? 75.623 -4.147  15.161  1.00 25.82 ? 166 MET A N     1 
ATOM   1296 C  CA    . MET A 1 169 ? 75.028 -5.442  14.842  1.00 21.70 ? 166 MET A CA    1 
ATOM   1297 C  C     . MET A 1 169 ? 74.795 -5.578  13.337  1.00 21.04 ? 166 MET A C     1 
ATOM   1298 O  O     . MET A 1 169 ? 75.097 -6.620  12.736  1.00 21.32 ? 166 MET A O     1 
ATOM   1299 C  CB    . MET A 1 169 ? 73.705 -5.622  15.592  1.00 30.71 ? 166 MET A CB    1 
ATOM   1300 C  CG    . MET A 1 169 ? 73.852 -5.868  17.083  1.00 43.12 ? 166 MET A CG    1 
ATOM   1301 S  SD    . MET A 1 169 ? 74.386 -7.550  17.447  1.00 56.56 ? 166 MET A SD    1 
ATOM   1302 C  CE    . MET A 1 169 ? 72.996 -8.486  16.802  1.00 35.84 ? 166 MET A CE    1 
ATOM   1303 N  N     . ARG A 1 170 ? 74.260 -4.524  12.724  1.00 17.94 ? 167 ARG A N     1 
ATOM   1304 C  CA    . ARG A 1 170 ? 74.013 -4.550  11.283  1.00 18.16 ? 167 ARG A CA    1 
ATOM   1305 C  C     . ARG A 1 170 ? 75.288 -4.873  10.520  1.00 16.68 ? 167 ARG A C     1 
ATOM   1306 O  O     . ARG A 1 170 ? 75.292 -5.746  9.652   1.00 17.85 ? 167 ARG A O     1 
ATOM   1307 C  CB    . ARG A 1 170 ? 73.440 -3.216  10.782  1.00 17.73 ? 167 ARG A CB    1 
ATOM   1308 C  CG    . ARG A 1 170 ? 73.075 -3.243  9.292   1.00 15.98 ? 167 ARG A CG    1 
ATOM   1309 C  CD    . ARG A 1 170 ? 72.893 -1.839  8.722   1.00 18.23 ? 167 ARG A CD    1 
ATOM   1310 N  NE    . ARG A 1 170 ? 74.171 -1.152  8.506   1.00 17.57 ? 167 ARG A NE    1 
ATOM   1311 C  CZ    . ARG A 1 170 ? 74.970 -1.358  7.462   1.00 16.86 ? 167 ARG A CZ    1 
ATOM   1312 N  NH1   . ARG A 1 170 ? 74.641 -2.227  6.520   1.00 15.12 ? 167 ARG A NH1   1 
ATOM   1313 N  NH2   . ARG A 1 170 ? 76.097 -0.678  7.350   1.00 21.85 ? 167 ARG A NH2   1 
ATOM   1314 N  N     . LYS A 1 171 ? 76.370 -4.160  10.834  1.00 16.51 ? 168 LYS A N     1 
ATOM   1315 C  CA    . LYS A 1 171 ? 77.629 -4.365  10.136  1.00 18.90 ? 168 LYS A CA    1 
ATOM   1316 C  C     . LYS A 1 171 ? 78.213 -5.741  10.415  1.00 16.15 ? 168 LYS A C     1 
ATOM   1317 O  O     . LYS A 1 171 ? 78.781 -6.359  9.519   1.00 17.59 ? 168 LYS A O     1 
ATOM   1318 C  CB    . LYS A 1 171 ? 78.647 -3.289  10.516  1.00 23.65 ? 168 LYS A CB    1 
ATOM   1319 C  CG    . LYS A 1 171 ? 78.464 -1.988  9.768   1.00 28.79 ? 168 LYS A CG    1 
ATOM   1320 C  CD    . LYS A 1 171 ? 79.697 -1.104  9.923   1.00 37.48 ? 168 LYS A CD    1 
ATOM   1321 C  CE    . LYS A 1 171 ? 79.632 0.089   8.985   1.00 40.77 ? 168 LYS A CE    1 
ATOM   1322 N  NZ    . LYS A 1 171 ? 80.931 0.805   8.910   1.00 39.78 ? 168 LYS A NZ    1 
ATOM   1323 N  N     . GLN A 1 172 ? 78.076 -6.215  11.652  1.00 21.39 ? 169 GLN A N     1 
ATOM   1324 C  CA    . GLN A 1 172 ? 78.567 -7.542  12.007  1.00 19.02 ? 169 GLN A CA    1 
ATOM   1325 C  C     . GLN A 1 172 ? 77.910 -8.585  11.119  1.00 15.79 ? 169 GLN A C     1 
ATOM   1326 O  O     . GLN A 1 172 ? 78.575 -9.464  10.573  1.00 17.88 ? 169 GLN A O     1 
ATOM   1327 C  CB    . GLN A 1 172 ? 78.290 -7.866  13.473  1.00 22.39 ? 169 GLN A CB    1 
ATOM   1328 C  CG    . GLN A 1 172 ? 79.189 -7.155  14.465  1.00 33.83 ? 169 GLN A CG    1 
ATOM   1329 C  CD    . GLN A 1 172 ? 78.694 -7.296  15.896  1.00 45.33 ? 169 GLN A CD    1 
ATOM   1330 O  OE1   . GLN A 1 172 ? 77.728 -8.014  16.166  1.00 48.40 ? 169 GLN A OE1   1 
ATOM   1331 N  NE2   . GLN A 1 172 ? 79.353 -6.606  16.819  1.00 54.71 ? 169 GLN A NE2   1 
ATOM   1332 N  N     . GLY A 1 173 ? 76.593 -8.476  10.972  1.00 17.32 ? 170 GLY A N     1 
ATOM   1333 C  CA    . GLY A 1 173 ? 75.851 -9.438  10.183  1.00 13.82 ? 170 GLY A CA    1 
ATOM   1334 C  C     . GLY A 1 173 ? 76.218 -9.353  8.721   1.00 15.49 ? 170 GLY A C     1 
ATOM   1335 O  O     . GLY A 1 173 ? 76.374 -10.368 8.050   1.00 14.83 ? 170 GLY A O     1 
ATOM   1336 N  N     . LEU A 1 174 ? 76.365 -8.125  8.225   1.00 13.98 ? 171 LEU A N     1 
ATOM   1337 C  CA    . LEU A 1 174 ? 76.731 -7.910  6.833   1.00 12.60 ? 171 LEU A CA    1 
ATOM   1338 C  C     . LEU A 1 174 ? 78.110 -8.474  6.532   1.00 15.27 ? 171 LEU A C     1 
ATOM   1339 O  O     . LEU A 1 174 ? 78.332 -9.058  5.469   1.00 16.42 ? 171 LEU A O     1 
ATOM   1340 C  CB    . LEU A 1 174 ? 76.679 -6.412  6.488   1.00 13.41 ? 171 LEU A CB    1 
ATOM   1341 C  CG    . LEU A 1 174 ? 77.047 -6.068  5.047   1.00 14.29 ? 171 LEU A CG    1 
ATOM   1342 C  CD1   . LEU A 1 174 ? 76.108 -6.794  4.080   1.00 13.98 ? 171 LEU A CD1   1 
ATOM   1343 C  CD2   . LEU A 1 174 ? 77.013 -4.560  4.836   1.00 20.39 ? 171 LEU A CD2   1 
ATOM   1344 N  N     . PHE A 1 175 ? 79.036 -8.304  7.472   1.00 16.53 ? 172 PHE A N     1 
ATOM   1345 C  CA    . PHE A 1 175 ? 80.380 -8.823  7.265   1.00 19.27 ? 172 PHE A CA    1 
ATOM   1346 C  C     . PHE A 1 175 ? 80.362 -10.353 7.208   1.00 17.16 ? 172 PHE A C     1 
ATOM   1347 O  O     . PHE A 1 175 ? 81.011 -10.942 6.341   1.00 19.28 ? 172 PHE A O     1 
ATOM   1348 C  CB    . PHE A 1 175 ? 81.329 -8.335  8.358   1.00 18.62 ? 172 PHE A CB    1 
ATOM   1349 C  CG    . PHE A 1 175 ? 81.727 -6.889  8.220   1.00 32.56 ? 172 PHE A CG    1 
ATOM   1350 C  CD1   . PHE A 1 175 ? 82.140 -6.387  6.995   1.00 36.97 ? 172 PHE A CD1   1 
ATOM   1351 C  CD2   . PHE A 1 175 ? 81.718 -6.040  9.317   1.00 34.34 ? 172 PHE A CD2   1 
ATOM   1352 C  CE1   . PHE A 1 175 ? 82.514 -5.055  6.861   1.00 40.29 ? 172 PHE A CE1   1 
ATOM   1353 C  CE2   . PHE A 1 175 ? 82.092 -4.711  9.190   1.00 45.33 ? 172 PHE A CE2   1 
ATOM   1354 C  CZ    . PHE A 1 175 ? 82.487 -4.219  7.963   1.00 43.72 ? 172 PHE A CZ    1 
ATOM   1355 N  N     . GLN A 1 176 ? 79.621 -10.996 8.114   1.00 17.55 ? 173 GLN A N     1 
ATOM   1356 C  CA    . GLN A 1 176 ? 79.523 -12.464 8.092   1.00 15.85 ? 173 GLN A CA    1 
ATOM   1357 C  C     . GLN A 1 176 ? 78.995 -12.947 6.750   1.00 22.41 ? 173 GLN A C     1 
ATOM   1358 O  O     . GLN A 1 176 ? 79.521 -13.895 6.162   1.00 20.16 ? 173 GLN A O     1 
ATOM   1359 C  CB    . GLN A 1 176 ? 78.626 -12.993 9.228   1.00 18.30 ? 173 GLN A CB    1 
ATOM   1360 C  CG    . GLN A 1 176 ? 79.222 -12.799 10.623  1.00 20.68 ? 173 GLN A CG    1 
ATOM   1361 C  CD    . GLN A 1 176 ? 78.448 -13.519 11.715  1.00 22.00 ? 173 GLN A CD    1 
ATOM   1362 O  OE1   . GLN A 1 176 ? 77.372 -14.056 11.482  1.00 22.72 ? 173 GLN A OE1   1 
ATOM   1363 N  NE2   . GLN A 1 176 ? 79.009 -13.537 12.925  1.00 28.33 ? 173 GLN A NE2   1 
ATOM   1364 N  N     . TRP A 1 177 ? 77.950 -12.283 6.266   1.00 16.81 ? 174 TRP A N     1 
ATOM   1365 C  CA    . TRP A 1 177 ? 77.354 -12.621 4.982   1.00 14.32 ? 174 TRP A CA    1 
ATOM   1366 C  C     . TRP A 1 177 ? 78.347 -12.469 3.828   1.00 16.02 ? 174 TRP A C     1 
ATOM   1367 O  O     . TRP A 1 177 ? 78.540 -13.386 3.032   1.00 17.15 ? 174 TRP A O     1 
ATOM   1368 C  CB    . TRP A 1 177 ? 76.114 -11.735 4.746   1.00 11.54 ? 174 TRP A CB    1 
ATOM   1369 C  CG    . TRP A 1 177 ? 75.453 -11.905 3.411   1.00 14.34 ? 174 TRP A CG    1 
ATOM   1370 C  CD1   . TRP A 1 177 ? 75.553 -11.059 2.334   1.00 13.44 ? 174 TRP A CD1   1 
ATOM   1371 C  CD2   . TRP A 1 177 ? 74.565 -12.958 3.011   1.00 12.25 ? 174 TRP A CD2   1 
ATOM   1372 N  NE1   . TRP A 1 177 ? 74.793 -11.524 1.300   1.00 12.28 ? 174 TRP A NE1   1 
ATOM   1373 C  CE2   . TRP A 1 177 ? 74.170 -12.685 1.683   1.00 13.21 ? 174 TRP A CE2   1 
ATOM   1374 C  CE3   . TRP A 1 177 ? 74.058 -14.094 3.646   1.00 14.32 ? 174 TRP A CE3   1 
ATOM   1375 C  CZ2   . TRP A 1 177 ? 73.306 -13.519 0.972   1.00 11.57 ? 174 TRP A CZ2   1 
ATOM   1376 C  CZ3   . TRP A 1 177 ? 73.194 -14.927 2.940   1.00 14.93 ? 174 TRP A CZ3   1 
ATOM   1377 C  CH2   . TRP A 1 177 ? 72.822 -14.632 1.619   1.00 15.98 ? 174 TRP A CH2   1 
ATOM   1378 N  N     . LEU A 1 178 ? 78.947 -11.327 3.756   1.00 15.01 ? 175 LEU A N     1 
ATOM   1379 C  CA    . LEU A 1 178 ? 79.858 -11.081 2.666   1.00 12.98 ? 175 LEU A CA    1 
ATOM   1380 C  C     . LEU A 1 178 ? 81.064 -11.975 2.716   1.00 23.10 ? 175 LEU A C     1 
ATOM   1381 O  O     . LEU A 1 178 ? 81.558 -12.357 1.734   1.00 26.74 ? 175 LEU A O     1 
ATOM   1382 C  CB    . LEU A 1 178 ? 80.300 -9.633  2.592   1.00 18.38 ? 175 LEU A CB    1 
ATOM   1383 C  CG    . LEU A 1 178 ? 79.168 -8.636  2.367   1.00 17.40 ? 175 LEU A CG    1 
ATOM   1384 C  CD1   . LEU A 1 178 ? 79.674 -7.232  2.468   1.00 22.94 ? 175 LEU A CD1   1 
ATOM   1385 C  CD2   . LEU A 1 178 ? 78.505 -8.885  1.030   1.00 14.57 ? 175 LEU A CD2   1 
ATOM   1386 N  N     . ASP A 1 179 ? 81.500 -12.277 3.911   1.00 21.28 ? 176 ASP A N     1 
ATOM   1387 C  CA    . ASP A 1 179 ? 82.702 -13.064 4.090   1.00 28.32 ? 176 ASP A CA    1 
ATOM   1388 C  C     . ASP A 1 179 ? 82.515 -14.413 3.543   1.00 29.34 ? 176 ASP A C     1 
ATOM   1389 O  O     . ASP A 1 179 ? 83.416 -14.975 2.990   1.00 27.24 ? 176 ASP A O     1 
ATOM   1390 C  CB    . ASP A 1 179 ? 83.086 -13.185 5.550   1.00 24.49 ? 176 ASP A CB    1 
ATOM   1391 C  CG    . ASP A 1 179 ? 83.983 -12.096 5.975   1.00 37.00 ? 176 ASP A CG    1 
ATOM   1392 O  OD1   . ASP A 1 179 ? 84.738 -11.627 5.137   1.00 46.80 ? 176 ASP A OD1   1 
ATOM   1393 O  OD2   . ASP A 1 179 ? 83.944 -11.644 7.128   1.00 44.30 ? 176 ASP A OD2   1 
ATOM   1394 N  N     . SER A 1 180 ? 81.334 -14.931 3.756   1.00 21.51 ? 177 SER A N     1 
ATOM   1395 C  CA    . SER A 1 180 ? 80.887 -16.181 3.160   1.00 23.64 ? 177 SER A CA    1 
ATOM   1396 C  C     . SER A 1 180 ? 80.649 -16.311 1.644   1.00 30.20 ? 177 SER A C     1 
ATOM   1397 O  O     . SER A 1 180 ? 80.782 -17.364 1.110   1.00 39.21 ? 177 SER A O     1 
ATOM   1398 C  CB    . SER A 1 180 ? 79.682 -16.715 3.917   1.00 29.52 ? 177 SER A CB    1 
ATOM   1399 O  OG    . SER A 1 180 ? 79.997 -16.726 5.262   1.00 37.24 ? 177 SER A OG    1 
ATOM   1400 N  N     . LEU A 1 181 ? 80.215 -15.279 0.973   1.00 20.07 ? 178 LEU A N     1 
ATOM   1401 C  CA    . LEU A 1 181 ? 79.745 -15.378 -0.402  1.00 19.48 ? 178 LEU A CA    1 
ATOM   1402 C  C     . LEU A 1 181 ? 80.684 -15.957 -1.447  1.00 35.77 ? 178 LEU A C     1 
ATOM   1403 O  O     . LEU A 1 181 ? 81.804 -15.599 -1.470  1.00 29.12 ? 178 LEU A O     1 
ATOM   1404 C  CB    . LEU A 1 181 ? 79.467 -13.979 -0.912  1.00 28.29 ? 178 LEU A CB    1 
ATOM   1405 C  CG    . LEU A 1 181 ? 78.089 -13.428 -0.809  1.00 30.54 ? 178 LEU A CG    1 
ATOM   1406 C  CD1   . LEU A 1 181 ? 78.073 -12.049 -1.477  1.00 17.31 ? 178 LEU A CD1   1 
ATOM   1407 C  CD2   . LEU A 1 181 ? 77.133 -14.403 -1.438  1.00 21.04 ? 178 LEU A CD2   1 
ATOM   1408 N  N     . GLN A 1 182 ? 80.181 -16.797 -2.350  1.00 34.53 ? 179 GLN A N     1 
ATOM   1409 C  CA    . GLN A 1 182 ? 81.040 -17.232 -3.439  1.00 51.10 ? 179 GLN A CA    1 
ATOM   1410 C  C     . GLN A 1 182 ? 80.820 -16.473 -4.697  1.00 54.05 ? 179 GLN A C     1 
ATOM   1411 O  O     . GLN A 1 182 ? 79.906 -16.745 -5.431  1.00 54.91 ? 179 GLN A O     1 
ATOM   1412 C  CB    . GLN A 1 182 ? 80.923 -18.702 -3.746  1.00 55.21 ? 179 GLN A CB    1 
ATOM   1413 C  CG    . GLN A 1 182 ? 79.584 -19.156 -4.254  1.00 58.58 ? 179 GLN A CG    1 
ATOM   1414 C  CD    . GLN A 1 182 ? 79.610 -20.650 -4.477  1.00 65.61 ? 179 GLN A CD    1 
ATOM   1415 O  OE1   . GLN A 1 182 ? 80.654 -21.212 -4.714  1.00 79.73 ? 179 GLN A OE1   1 
ATOM   1416 N  NE2   . GLN A 1 182 ? 78.483 -21.273 -4.421  1.00 63.50 ? 179 GLN A NE2   1 
ATOM   1417 N  N     . ILE A 1 183 ? 81.714 -15.542 -4.950  1.00 46.34 ? 180 ILE A N     1 
ATOM   1418 C  CA    . ILE A 1 183 ? 81.477 -14.632 -6.017  1.00 54.47 ? 180 ILE A CA    1 
ATOM   1419 C  C     . ILE A 1 183 ? 81.905 -15.195 -7.367  1.00 58.66 ? 180 ILE A C     1 
ATOM   1420 O  O     . ILE A 1 183 ? 81.565 -14.657 -8.403  1.00 54.52 ? 180 ILE A O     1 
ATOM   1421 C  CB    . ILE A 1 183 ? 82.029 -13.273 -5.694  1.00 49.75 ? 180 ILE A CB    1 
ATOM   1422 C  CG1   . ILE A 1 183 ? 83.484 -13.425 -5.340  1.00 54.01 ? 180 ILE A CG1   1 
ATOM   1423 C  CG2   . ILE A 1 183 ? 81.292 -12.765 -4.485  1.00 44.15 ? 180 ILE A CG2   1 
ATOM   1424 C  CD1   . ILE A 1 183 ? 84.321 -13.842 -6.508  1.00 59.43 ? 180 ILE A CD1   1 
ATOM   1425 N  N     . ASP A 1 184 ? 82.585 -16.327 -7.337  1.00 63.49 ? 181 ASP A N     1 
ATOM   1426 C  CA    . ASP A 1 184 ? 82.893 -17.060 -8.536  1.00 60.18 ? 181 ASP A CA    1 
ATOM   1427 C  C     . ASP A 1 184 ? 81.654 -17.540 -9.279  1.00 62.56 ? 181 ASP A C     1 
ATOM   1428 O  O     . ASP A 1 184 ? 81.676 -17.591 -10.499 1.00 63.65 ? 181 ASP A O     1 
ATOM   1429 C  CB    . ASP A 1 184 ? 83.745 -18.288 -8.224  1.00 62.52 ? 181 ASP A CB    1 
ATOM   1430 C  CG    . ASP A 1 184 ? 84.691 -18.080 -7.083  1.00 76.09 ? 181 ASP A CG    1 
ATOM   1431 O  OD1   . ASP A 1 184 ? 85.928 -18.098 -7.342  1.00 81.19 ? 181 ASP A OD1   1 
ATOM   1432 O  OD2   . ASP A 1 184 ? 84.214 -17.994 -5.926  1.00 72.93 ? 181 ASP A OD2   1 
ATOM   1433 N  N     . ASN A 1 185 ? 80.628 -17.965 -8.545  1.00 56.65 ? 182 ASN A N     1 
ATOM   1434 C  CA    . ASN A 1 185 ? 79.456 -18.580 -9.159  1.00 57.97 ? 182 ASN A CA    1 
ATOM   1435 C  C     . ASN A 1 185 ? 78.413 -17.527 -9.527  1.00 53.14 ? 182 ASN A C     1 
ATOM   1436 O  O     . ASN A 1 185 ? 77.763 -16.954 -8.649  1.00 48.56 ? 182 ASN A O     1 
ATOM   1437 C  CB    . ASN A 1 185 ? 78.857 -19.628 -8.214  1.00 50.68 ? 182 ASN A CB    1 
ATOM   1438 C  CG    . ASN A 1 185 ? 77.678 -20.372 -8.822  1.00 48.40 ? 182 ASN A CG    1 
ATOM   1439 O  OD1   . ASN A 1 185 ? 77.415 -20.285 -10.025 1.00 46.63 ? 182 ASN A OD1   1 
ATOM   1440 N  ND2   . ASN A 1 185 ? 76.963 -21.119 -7.987  1.00 50.51 ? 182 ASN A ND2   1 
ATOM   1441 N  N     . LEU A 1 186 ? 78.256 -17.280 -10.825 1.00 48.21 ? 183 LEU A N     1 
ATOM   1442 C  CA    . LEU A 1 186 ? 77.332 -16.256 -11.313 1.00 49.66 ? 183 LEU A CA    1 
ATOM   1443 C  C     . LEU A 1 186 ? 75.864 -16.664 -11.176 1.00 43.44 ? 183 LEU A C     1 
ATOM   1444 O  O     . LEU A 1 186 ? 74.964 -15.850 -11.392 1.00 42.41 ? 183 LEU A O     1 
ATOM   1445 C  CB    . LEU A 1 186 ? 77.632 -15.923 -12.776 1.00 48.28 ? 183 LEU A CB    1 
ATOM   1446 C  CG    . LEU A 1 186 ? 78.988 -15.276 -13.061 1.00 58.18 ? 183 LEU A CG    1 
ATOM   1447 C  CD1   . LEU A 1 186 ? 79.150 -15.019 -14.553 1.00 58.81 ? 183 LEU A CD1   1 
ATOM   1448 C  CD2   . LEU A 1 186 ? 79.156 -13.984 -12.265 1.00 51.16 ? 183 LEU A CD2   1 
ATOM   1449 N  N     . THR A 1 187 ? 75.621 -17.923 -10.831 1.00 38.71 ? 184 THR A N     1 
ATOM   1450 C  CA    . THR A 1 187 ? 74.252 -18.385 -10.633 1.00 38.81 ? 184 THR A CA    1 
ATOM   1451 C  C     . THR A 1 187 ? 73.948 -18.731 -9.171  1.00 30.16 ? 184 THR A C     1 
ATOM   1452 O  O     . THR A 1 187 ? 72.897 -19.298 -8.890  1.00 35.82 ? 184 THR A O     1 
ATOM   1453 C  CB    . THR A 1 187 ? 73.932 -19.620 -11.513 1.00 43.96 ? 184 THR A CB    1 
ATOM   1454 O  OG1   . THR A 1 187 ? 74.686 -20.753 -11.059 1.00 47.23 ? 184 THR A OG1   1 
ATOM   1455 C  CG2   . THR A 1 187 ? 74.257 -19.340 -12.978 1.00 45.21 ? 184 THR A CG2   1 
ATOM   1456 N  N     . SER A 1 188 ? 74.858 -18.407 -8.249  1.00 30.34 ? 185 SER A N     1 
ATOM   1457 C  CA    . SER A 1 188 ? 74.567 -18.561 -6.816  1.00 19.86 ? 185 SER A CA    1 
ATOM   1458 C  C     . SER A 1 188 ? 73.405 -17.667 -6.415  1.00 18.06 ? 185 SER A C     1 
ATOM   1459 O  O     . SER A 1 188 ? 73.476 -16.442 -6.565  1.00 14.73 ? 185 SER A O     1 
ATOM   1460 C  CB    . SER A 1 188 ? 75.778 -18.227 -5.944  1.00 29.66 ? 185 SER A CB    1 
ATOM   1461 O  OG    . SER A 1 188 ? 75.415 -18.229 -4.563  1.00 28.24 ? 185 SER A OG    1 
ATOM   1462 N  N     . PRO A 1 189 ? 72.319 -18.269 -5.919  1.00 17.00 ? 186 PRO A N     1 
ATOM   1463 C  CA    . PRO A 1 189 ? 71.194 -17.419 -5.515  1.00 12.27 ? 186 PRO A CA    1 
ATOM   1464 C  C     . PRO A 1 189 ? 71.562 -16.396 -4.446  1.00 14.49 ? 186 PRO A C     1 
ATOM   1465 O  O     . PRO A 1 189 ? 71.027 -15.286 -4.484  1.00 12.27 ? 186 PRO A O     1 
ATOM   1466 C  CB    . PRO A 1 189 ? 70.177 -18.421 -4.970  1.00 15.75 ? 186 PRO A CB    1 
ATOM   1467 C  CG    . PRO A 1 189 ? 70.490 -19.690 -5.722  1.00 16.31 ? 186 PRO A CG    1 
ATOM   1468 C  CD    . PRO A 1 189 ? 71.983 -19.702 -5.858  1.00 15.58 ? 186 PRO A CD    1 
ATOM   1469 N  N     . ASP A 1 190 ? 72.441 -16.748 -3.508  1.00 13.41 ? 187 ASP A N     1 
ATOM   1470 C  CA    . ASP A 1 190 ? 72.812 -15.802 -2.459  1.00 9.62  ? 187 ASP A CA    1 
ATOM   1471 C  C     . ASP A 1 190 ? 73.539 -14.603 -3.060  1.00 10.93 ? 187 ASP A C     1 
ATOM   1472 O  O     . ASP A 1 190 ? 73.340 -13.465 -2.630  1.00 12.31 ? 187 ASP A O     1 
ATOM   1473 C  CB    . ASP A 1 190 ? 73.694 -16.470 -1.397  1.00 12.80 ? 187 ASP A CB    1 
ATOM   1474 C  CG    . ASP A 1 190 ? 72.919 -17.435 -0.508  1.00 19.42 ? 187 ASP A CG    1 
ATOM   1475 O  OD1   . ASP A 1 190 ? 71.681 -17.347 -0.419  1.00 14.01 ? 187 ASP A OD1   1 
ATOM   1476 O  OD2   . ASP A 1 190 ? 73.561 -18.307 0.098   1.00 19.76 ? 187 ASP A OD2   1 
ATOM   1477 N  N     . LEU A 1 191 ? 74.389 -14.865 -4.046  1.00 12.22 ? 188 LEU A N     1 
ATOM   1478 C  CA    . LEU A 1 191 ? 75.124 -13.791 -4.698  1.00 13.58 ? 188 LEU A CA    1 
ATOM   1479 C  C     . LEU A 1 191 ? 74.144 -12.922 -5.459  1.00 13.12 ? 188 LEU A C     1 
ATOM   1480 O  O     . LEU A 1 191 ? 74.237 -11.698 -5.417  1.00 11.91 ? 188 LEU A O     1 
ATOM   1481 C  CB    . LEU A 1 191 ? 76.197 -14.344 -5.644  1.00 18.05 ? 188 LEU A CB    1 
ATOM   1482 C  CG    . LEU A 1 191 ? 76.973 -13.315 -6.478  1.00 17.66 ? 188 LEU A CG    1 
ATOM   1483 C  CD1   . LEU A 1 191 ? 77.656 -12.302 -5.609  1.00 17.12 ? 188 LEU A CD1   1 
ATOM   1484 C  CD2   . LEU A 1 191 ? 77.992 -14.030 -7.370  1.00 20.78 ? 188 LEU A CD2   1 
ATOM   1485 N  N     . GLN A 1 192 ? 73.197 -13.563 -6.135  1.00 11.74 ? 189 GLN A N     1 
ATOM   1486 C  CA    . GLN A 1 192 ? 72.183 -12.832 -6.897  1.00 12.09 ? 189 GLN A CA    1 
ATOM   1487 C  C     . GLN A 1 192 ? 71.373 -11.897 -5.988  1.00 12.95 ? 189 GLN A C     1 
ATOM   1488 O  O     . GLN A 1 192 ? 71.163 -10.724 -6.318  1.00 12.40 ? 189 GLN A O     1 
ATOM   1489 C  CB    . GLN A 1 192 ? 71.276 -13.808 -7.634  1.00 13.45 ? 189 GLN A CB    1 
ATOM   1490 C  CG    . GLN A 1 192 ? 72.012 -14.504 -8.790  1.00 13.09 ? 189 GLN A CG    1 
ATOM   1491 C  CD    . GLN A 1 192 ? 71.235 -15.635 -9.407  1.00 27.68 ? 189 GLN A CD    1 
ATOM   1492 O  OE1   . GLN A 1 192 ? 70.257 -16.117 -8.842  1.00 31.19 ? 189 GLN A OE1   1 
ATOM   1493 N  NE2   . GLN A 1 192 ? 71.670 -16.071 -10.587 1.00 36.50 ? 189 GLN A NE2   1 
ATOM   1494 N  N     . LEU A 1 193 ? 70.944 -12.395 -4.834  1.00 11.19 ? 190 LEU A N     1 
ATOM   1495 C  CA    . LEU A 1 193 ? 70.240 -11.535 -3.873  1.00 8.07  ? 190 LEU A CA    1 
ATOM   1496 C  C     . LEU A 1 193 ? 71.099 -10.351 -3.439  1.00 10.12 ? 190 LEU A C     1 
ATOM   1497 O  O     . LEU A 1 193 ? 70.600 -9.249  -3.257  1.00 13.14 ? 190 LEU A O     1 
ATOM   1498 C  CB    . LEU A 1 193 ? 69.819 -12.325 -2.633  1.00 10.50 ? 190 LEU A CB    1 
ATOM   1499 C  CG    . LEU A 1 193 ? 68.734 -13.385 -2.756  1.00 9.69  ? 190 LEU A CG    1 
ATOM   1500 C  CD1   . LEU A 1 193 ? 68.387 -13.938 -1.373  1.00 13.96 ? 190 LEU A CD1   1 
ATOM   1501 C  CD2   . LEU A 1 193 ? 67.508 -12.794 -3.400  1.00 11.12 ? 190 LEU A CD2   1 
ATOM   1502 N  N     . THR A 1 194 ? 72.387 -10.597 -3.214  1.00 11.41 ? 191 THR A N     1 
ATOM   1503 C  CA    . THR A 1 194 ? 73.294 -9.566  -2.747  1.00 10.60 ? 191 THR A CA    1 
ATOM   1504 C  C     . THR A 1 194 ? 73.434 -8.453  -3.777  1.00 11.91 ? 191 THR A C     1 
ATOM   1505 O  O     . THR A 1 194 ? 73.400 -7.273  -3.430  1.00 13.10 ? 191 THR A O     1 
ATOM   1506 C  CB    . THR A 1 194 ? 74.677 -10.153 -2.444  1.00 12.17 ? 191 THR A CB    1 
ATOM   1507 O  OG1   . THR A 1 194 ? 74.532 -11.213 -1.492  1.00 13.30 ? 191 THR A OG1   1 
ATOM   1508 C  CG2   . THR A 1 194 ? 75.590 -9.094  -1.868  1.00 13.40 ? 191 THR A CG2   1 
ATOM   1509 N  N     . VAL A 1 195 ? 73.584 -8.844  -5.038  1.00 12.81 ? 192 VAL A N     1 
ATOM   1510 C  CA    . VAL A 1 195 ? 73.661 -7.858  -6.110  1.00 13.42 ? 192 VAL A CA    1 
ATOM   1511 C  C     . VAL A 1 195 ? 72.309 -7.137  -6.188  1.00 14.17 ? 192 VAL A C     1 
ATOM   1512 O  O     . VAL A 1 195 ? 72.258 -5.915  -6.379  1.00 11.30 ? 192 VAL A O     1 
ATOM   1513 C  CB    . VAL A 1 195 ? 74.042 -8.516  -7.444  1.00 12.22 ? 192 VAL A CB    1 
ATOM   1514 C  CG1   . VAL A 1 195 ? 73.923 -7.506  -8.595  1.00 14.69 ? 192 VAL A CG1   1 
ATOM   1515 C  CG2   . VAL A 1 195 ? 75.458 -9.060  -7.361  1.00 14.29 ? 192 VAL A CG2   1 
ATOM   1516 N  N     . GLY A 1 196 ? 71.219 -7.876  -6.001  1.00 10.14 ? 193 GLY A N     1 
ATOM   1517 C  CA    . GLY A 1 196 ? 69.895 -7.252  -5.937  1.00 10.80 ? 193 GLY A CA    1 
ATOM   1518 C  C     . GLY A 1 196 ? 69.847 -6.156  -4.885  1.00 11.62 ? 193 GLY A C     1 
ATOM   1519 O  O     . GLY A 1 196 ? 69.322 -5.057  -5.124  1.00 12.31 ? 193 GLY A O     1 
ATOM   1520 N  N     . ALA A 1 197 ? 70.403 -6.443  -3.712  1.00 10.69 ? 194 ALA A N     1 
ATOM   1521 C  CA    . ALA A 1 197 ? 70.431 -5.472  -2.631  1.00 7.53  ? 194 ALA A CA    1 
ATOM   1522 C  C     . ALA A 1 197 ? 71.264 -4.239  -2.998  1.00 10.98 ? 194 ALA A C     1 
ATOM   1523 O  O     . ALA A 1 197 ? 70.925 -3.115  -2.622  1.00 11.17 ? 194 ALA A O     1 
ATOM   1524 C  CB    . ALA A 1 197 ? 70.956 -6.122  -1.353  1.00 12.57 ? 194 ALA A CB    1 
ATOM   1525 N  N     . VAL A 1 198 ? 72.344 -4.447  -3.742  1.00 10.97 ? 195 VAL A N     1 
ATOM   1526 C  CA    . VAL A 1 198 ? 73.166 -3.316  -4.193  1.00 11.21 ? 195 VAL A CA    1 
ATOM   1527 C  C     . VAL A 1 198 ? 72.355 -2.382  -5.091  1.00 14.26 ? 195 VAL A C     1 
ATOM   1528 O  O     . VAL A 1 198 ? 72.390 -1.143  -4.935  1.00 13.90 ? 195 VAL A O     1 
ATOM   1529 C  CB    . VAL A 1 198 ? 74.419 -3.799  -4.936  1.00 11.21 ? 195 VAL A CB    1 
ATOM   1530 C  CG1   . VAL A 1 198 ? 75.177 -2.606  -5.550  1.00 13.54 ? 195 VAL A CG1   1 
ATOM   1531 C  CG2   . VAL A 1 198 ? 75.335 -4.568  -3.991  1.00 15.95 ? 195 VAL A CG2   1 
ATOM   1532 N  N     . ILE A 1 199 ? 71.594 -2.983  -6.000  1.00 11.37 ? 196 ILE A N     1 
ATOM   1533 C  CA    . ILE A 1 199 ? 70.748 -2.224  -6.911  1.00 11.10 ? 196 ILE A CA    1 
ATOM   1534 C  C     . ILE A 1 199 ? 69.661 -1.490  -6.118  1.00 13.10 ? 196 ILE A C     1 
ATOM   1535 O  O     . ILE A 1 199 ? 69.375 -0.329  -6.395  1.00 13.08 ? 196 ILE A O     1 
ATOM   1536 C  CB    . ILE A 1 199 ? 70.141 -3.122  -7.994  1.00 11.03 ? 196 ILE A CB    1 
ATOM   1537 C  CG1   . ILE A 1 199 ? 71.253 -3.602  -8.946  1.00 12.01 ? 196 ILE A CG1   1 
ATOM   1538 C  CG2   . ILE A 1 199 ? 69.066 -2.373  -8.777  1.00 11.33 ? 196 ILE A CG2   1 
ATOM   1539 C  CD1   . ILE A 1 199 ? 70.829 -4.697  -9.885  1.00 14.95 ? 196 ILE A CD1   1 
ATOM   1540 N  N     . VAL A 1 200 ? 69.088 -2.147  -5.113  1.00 10.68 ? 197 VAL A N     1 
ATOM   1541 C  CA    . VAL A 1 200 ? 68.036 -1.509  -4.330  1.00 9.57  ? 197 VAL A CA    1 
ATOM   1542 C  C     . VAL A 1 200 ? 68.581 -0.358  -3.485  1.00 13.74 ? 197 VAL A C     1 
ATOM   1543 O  O     . VAL A 1 200 ? 67.894 0.648   -3.310  1.00 10.63 ? 197 VAL A O     1 
ATOM   1544 C  CB    . VAL A 1 200 ? 67.308 -2.555  -3.467  1.00 9.46  ? 197 VAL A CB    1 
ATOM   1545 C  CG1   . VAL A 1 200 ? 66.298 -1.874  -2.555  1.00 11.48 ? 197 VAL A CG1   1 
ATOM   1546 C  CG2   . VAL A 1 200 ? 66.599 -3.514  -4.378  1.00 12.35 ? 197 VAL A CG2   1 
ATOM   1547 N  N     . GLU A 1 201 ? 69.823 -0.458  -3.006  1.00 11.64 ? 198 GLU A N     1 
ATOM   1548 C  CA    . GLU A 1 201 ? 70.459 0.692   -2.363  1.00 10.81 ? 198 GLU A CA    1 
ATOM   1549 C  C     . GLU A 1 201 ? 70.486 1.864   -3.340  1.00 12.33 ? 198 GLU A C     1 
ATOM   1550 O  O     . GLU A 1 201 ? 70.176 3.003   -2.964  1.00 12.53 ? 198 GLU A O     1 
ATOM   1551 C  CB    . GLU A 1 201 ? 71.901 0.381   -1.902  1.00 13.91 ? 198 GLU A CB    1 
ATOM   1552 C  CG    . GLU A 1 201 ? 72.039 -0.636  -0.753  1.00 14.16 ? 198 GLU A CG    1 
ATOM   1553 C  CD    . GLU A 1 201 ? 71.936 -0.042  0.647   1.00 15.19 ? 198 GLU A CD    1 
ATOM   1554 O  OE1   . GLU A 1 201 ? 71.584 1.154   0.800   1.00 15.96 ? 198 GLU A OE1   1 
ATOM   1555 O  OE2   . GLU A 1 201 ? 72.196 -0.786  1.627   1.00 14.53 ? 198 GLU A OE2   1 
ATOM   1556 N  N     . GLU A 1 202 ? 70.845 1.573   -4.592  1.00 13.35 ? 199 GLU A N     1 
ATOM   1557 C  CA    . GLU A 1 202 ? 70.931 2.607   -5.619  1.00 11.81 ? 199 GLU A CA    1 
ATOM   1558 C  C     . GLU A 1 202 ? 69.545 3.191   -5.925  1.00 13.83 ? 199 GLU A C     1 
ATOM   1559 O  O     . GLU A 1 202 ? 69.396 4.417   -6.042  1.00 13.83 ? 199 GLU A O     1 
ATOM   1560 C  CB    . GLU A 1 202 ? 71.581 2.048   -6.900  1.00 13.89 ? 199 GLU A CB    1 
ATOM   1561 C  CG    . GLU A 1 202 ? 73.076 1.750   -6.750  1.00 13.97 ? 199 GLU A CG    1 
ATOM   1562 C  CD    . GLU A 1 202 ? 73.621 0.766   -7.793  1.00 18.05 ? 199 GLU A CD    1 
ATOM   1563 O  OE1   . GLU A 1 202 ? 74.843 0.496   -7.762  1.00 27.78 ? 199 GLU A OE1   1 
ATOM   1564 O  OE2   . GLU A 1 202 ? 72.849 0.266   -8.633  1.00 23.22 ? 199 GLU A OE2   1 
ATOM   1565 N  N     . MET A 1 203 ? 68.540 2.321   -6.041  1.00 12.34 ? 200 MET A N     1 
ATOM   1566 C  CA    . MET A 1 203 ? 67.155 2.770   -6.244  1.00 12.58 ? 200 MET A CA    1 
ATOM   1567 C  C     . MET A 1 203 ? 66.677 3.646   -5.104  1.00 12.01 ? 200 MET A C     1 
ATOM   1568 O  O     . MET A 1 203 ? 66.056 4.696   -5.331  1.00 12.81 ? 200 MET A O     1 
ATOM   1569 C  CB    . MET A 1 203 ? 66.204 1.583   -6.381  1.00 12.54 ? 200 MET A CB    1 
ATOM   1570 C  CG    A MET A 1 203 ? 66.513 0.632   -7.503  0.60 10.81 ? 200 MET A CG    1 
ATOM   1571 C  CG    B MET A 1 203 ? 64.831 1.951   -6.846  0.40 13.00 ? 200 MET A CG    1 
ATOM   1572 S  SD    A MET A 1 203 ? 65.312 -0.704  -7.564  0.60 15.12 ? 200 MET A SD    1 
ATOM   1573 S  SD    B MET A 1 203 ? 63.736 0.524   -6.942  0.40 18.88 ? 200 MET A SD    1 
ATOM   1574 C  CE    A MET A 1 203 ? 63.823 0.224   -7.905  0.60 9.00  ? 200 MET A CE    1 
ATOM   1575 C  CE    B MET A 1 203 ? 64.532 -0.499  -8.166  0.40 17.90 ? 200 MET A CE    1 
ATOM   1576 N  N     . ARG A 1 204 ? 66.939 3.223   -3.870  1.00 8.47  ? 201 ARG A N     1 
ATOM   1577 C  CA    . ARG A 1 204 ? 66.470 3.968   -2.704  1.00 9.13  ? 201 ARG A CA    1 
ATOM   1578 C  C     . ARG A 1 204 ? 67.190 5.310   -2.595  1.00 13.84 ? 201 ARG A C     1 
ATOM   1579 O  O     . ARG A 1 204 ? 66.575 6.301   -2.224  1.00 11.19 ? 201 ARG A O     1 
ATOM   1580 C  CB    . ARG A 1 204 ? 66.632 3.139   -1.416  1.00 11.35 ? 201 ARG A CB    1 
ATOM   1581 C  CG    . ARG A 1 204 ? 65.674 1.939   -1.397  1.00 12.22 ? 201 ARG A CG    1 
ATOM   1582 C  CD    . ARG A 1 204 ? 65.766 1.144   -0.116  1.00 11.87 ? 201 ARG A CD    1 
ATOM   1583 N  NE    . ARG A 1 204 ? 65.785 1.998   1.055   1.00 12.26 ? 201 ARG A NE    1 
ATOM   1584 C  CZ    . ARG A 1 204 ? 66.845 2.134   1.845   1.00 12.80 ? 201 ARG A CZ    1 
ATOM   1585 N  NH1   . ARG A 1 204 ? 66.811 2.967   2.880   1.00 12.81 ? 201 ARG A NH1   1 
ATOM   1586 N  NH2   . ARG A 1 204 ? 67.940 1.431   1.602   1.00 15.82 ? 201 ARG A NH2   1 
ATOM   1587 N  N     . ALA A 1 205 ? 68.468 5.346   -2.978  1.00 11.72 ? 202 ALA A N     1 
ATOM   1588 C  CA    . ALA A 1 205 ? 69.229 6.596   -2.971  1.00 13.60 ? 202 ALA A CA    1 
ATOM   1589 C  C     . ALA A 1 205 ? 68.650 7.566   -4.004  1.00 10.94 ? 202 ALA A C     1 
ATOM   1590 O  O     . ALA A 1 205 ? 68.514 8.771   -3.735  1.00 12.69 ? 202 ALA A O     1 
ATOM   1591 C  CB    . ALA A 1 205 ? 70.712 6.323   -3.254  1.00 13.54 ? 202 ALA A CB    1 
ATOM   1592 N  N     . ALA A 1 206 ? 68.273 7.030   -5.165  1.00 10.94 ? 203 ALA A N     1 
ATOM   1593 C  CA    . ALA A 1 206 ? 67.693 7.846   -6.225  1.00 12.57 ? 203 ALA A CA    1 
ATOM   1594 C  C     . ALA A 1 206 ? 66.352 8.405   -5.782  1.00 11.18 ? 203 ALA A C     1 
ATOM   1595 O  O     . ALA A 1 206 ? 66.046 9.571   -6.021  1.00 13.29 ? 203 ALA A O     1 
ATOM   1596 C  CB    . ALA A 1 206 ? 67.546 7.046   -7.511  1.00 15.43 ? 203 ALA A CB    1 
ATOM   1597 N  N     . ILE A 1 207 ? 65.541 7.583   -5.125  1.00 10.19 ? 204 ILE A N     1 
ATOM   1598 C  CA    . ILE A 1 207 ? 64.242 8.072   -4.678  1.00 10.54 ? 204 ILE A CA    1 
ATOM   1599 C  C     . ILE A 1 207 ? 64.442 9.230   -3.696  1.00 12.28 ? 204 ILE A C     1 
ATOM   1600 O  O     . ILE A 1 207 ? 63.793 10.280  -3.820  1.00 10.23 ? 204 ILE A O     1 
ATOM   1601 C  CB    . ILE A 1 207 ? 63.402 6.944   -4.035  1.00 9.75  ? 204 ILE A CB    1 
ATOM   1602 C  CG1   . ILE A 1 207 ? 62.988 5.933   -5.098  1.00 9.20  ? 204 ILE A CG1   1 
ATOM   1603 C  CG2   . ILE A 1 207 ? 62.160 7.512   -3.351  1.00 9.64  ? 204 ILE A CG2   1 
ATOM   1604 C  CD1   . ILE A 1 207 ? 62.378 4.621   -4.524  1.00 12.71 ? 204 ILE A CD1   1 
ATOM   1605 N  N     . GLU A 1 208 ? 65.348 9.070   -2.737  1.00 10.96 ? 205 GLU A N     1 
ATOM   1606 C  CA    . GLU A 1 208 ? 65.526 10.109  -1.726  1.00 9.32  ? 205 GLU A CA    1 
ATOM   1607 C  C     . GLU A 1 208 ? 66.132 11.360  -2.352  1.00 11.00 ? 205 GLU A C     1 
ATOM   1608 O  O     . GLU A 1 208 ? 65.687 12.473  -2.075  1.00 11.73 ? 205 GLU A O     1 
ATOM   1609 C  CB    . GLU A 1 208 ? 66.400 9.626   -0.569  1.00 14.62 ? 205 GLU A CB    1 
ATOM   1610 C  CG    . GLU A 1 208 ? 66.534 10.688  0.521   1.00 12.51 ? 205 GLU A CG    1 
ATOM   1611 C  CD    . GLU A 1 208 ? 67.268 10.203  1.763   1.00 13.80 ? 205 GLU A CD    1 
ATOM   1612 O  OE1   . GLU A 1 208 ? 67.252 10.942  2.764   1.00 18.63 ? 205 GLU A OE1   1 
ATOM   1613 O  OE2   . GLU A 1 208 ? 67.847 9.091   1.734   1.00 19.79 ? 205 GLU A OE2   1 
ATOM   1614 N  N     . ARG A 1 209 ? 67.117 11.176  -3.230  1.00 11.97 ? 206 ARG A N     1 
ATOM   1615 C  CA    . ARG A 1 209 ? 67.722 12.341  -3.885  1.00 11.85 ? 206 ARG A CA    1 
ATOM   1616 C  C     . ARG A 1 209 ? 66.686 13.150  -4.665  1.00 12.40 ? 206 ARG A C     1 
ATOM   1617 O  O     . ARG A 1 209 ? 66.683 14.387  -4.607  1.00 14.06 ? 206 ARG A O     1 
ATOM   1618 C  CB    . ARG A 1 209 ? 68.866 11.929  -4.827  1.00 12.74 ? 206 ARG A CB    1 
ATOM   1619 C  CG    . ARG A 1 209 ? 69.615 13.160  -5.407  1.00 16.00 ? 206 ARG A CG    1 
ATOM   1620 C  CD    . ARG A 1 209 ? 70.661 12.795  -6.465  1.00 19.00 ? 206 ARG A CD    1 
ATOM   1621 N  NE    . ARG A 1 209 ? 70.085 12.530  -7.787  1.00 21.28 ? 206 ARG A NE    1 
ATOM   1622 C  CZ    . ARG A 1 209 ? 69.715 13.469  -8.659  1.00 18.51 ? 206 ARG A CZ    1 
ATOM   1623 N  NH1   . ARG A 1 209 ? 69.221 13.116  -9.839  1.00 18.38 ? 206 ARG A NH1   1 
ATOM   1624 N  NH2   . ARG A 1 209 ? 69.830 14.757  -8.357  1.00 17.53 ? 206 ARG A NH2   1 
ATOM   1625 N  N     . GLU A 1 210 ? 65.813 12.461  -5.390  1.00 10.75 ? 207 GLU A N     1 
ATOM   1626 C  CA    . GLU A 1 210 ? 64.983 13.114  -6.397  1.00 10.06 ? 207 GLU A CA    1 
ATOM   1627 C  C     . GLU A 1 210 ? 63.616 13.512  -5.873  1.00 11.70 ? 207 GLU A C     1 
ATOM   1628 O  O     . GLU A 1 210 ? 62.905 14.292  -6.528  1.00 10.91 ? 207 GLU A O     1 
ATOM   1629 C  CB    . GLU A 1 210 ? 64.844 12.217  -7.623  1.00 10.66 ? 207 GLU A CB    1 
ATOM   1630 C  CG    . GLU A 1 210 ? 66.169 11.938  -8.279  1.00 9.52  ? 207 GLU A CG    1 
ATOM   1631 C  CD    . GLU A 1 210 ? 66.078 11.023  -9.481  1.00 19.98 ? 207 GLU A CD    1 
ATOM   1632 O  OE1   . GLU A 1 210 ? 65.052 11.036  -10.193 1.00 17.57 ? 207 GLU A OE1   1 
ATOM   1633 O  OE2   . GLU A 1 210 ? 67.067 10.301  -9.732  1.00 23.97 ? 207 GLU A OE2   1 
ATOM   1634 N  N     . THR A 1 211 ? 63.248 13.017  -4.686  1.00 10.73 ? 208 THR A N     1 
ATOM   1635 C  CA    . THR A 1 211 ? 61.942 13.366  -4.125  1.00 11.29 ? 208 THR A CA    1 
ATOM   1636 C  C     . THR A 1 211 ? 62.008 13.899  -2.711  1.00 11.74 ? 208 THR A C     1 
ATOM   1637 O  O     . THR A 1 211 ? 61.074 14.553  -2.268  1.00 12.90 ? 208 THR A O     1 
ATOM   1638 C  CB    . THR A 1 211 ? 60.950 12.158  -4.098  1.00 10.38 ? 208 THR A CB    1 
ATOM   1639 O  OG1   . THR A 1 211 ? 61.382 11.180  -3.138  1.00 9.94  ? 208 THR A OG1   1 
ATOM   1640 C  CG2   . THR A 1 211 ? 60.822 11.531  -5.457  1.00 10.82 ? 208 THR A CG2   1 
ATOM   1641 N  N     . GLY A 1 212 ? 63.081 13.583  -1.983  1.00 9.57  ? 209 GLY A N     1 
ATOM   1642 C  CA    . GLY A 1 212 ? 63.156 13.891  -0.566  1.00 12.44 ? 209 GLY A CA    1 
ATOM   1643 C  C     . GLY A 1 212 ? 62.593 12.800  0.343   1.00 12.27 ? 209 GLY A C     1 
ATOM   1644 O  O     . GLY A 1 212 ? 62.717 12.901  1.556   1.00 17.27 ? 209 GLY A O     1 
ATOM   1645 N  N     . PHE A 1 213 ? 62.007 11.756  -0.242  1.00 11.37 ? 210 PHE A N     1 
ATOM   1646 C  CA    . PHE A 1 213 ? 61.317 10.727  0.534   1.00 11.18 ? 210 PHE A CA    1 
ATOM   1647 C  C     . PHE A 1 213 ? 62.238 9.546   0.828   1.00 11.52 ? 210 PHE A C     1 
ATOM   1648 O  O     . PHE A 1 213 ? 62.929 9.053   -0.058  1.00 13.23 ? 210 PHE A O     1 
ATOM   1649 C  CB    . PHE A 1 213 ? 60.085 10.211  -0.208  1.00 9.43  ? 210 PHE A CB    1 
ATOM   1650 C  CG    . PHE A 1 213 ? 59.067 11.272  -0.556  1.00 8.52  ? 210 PHE A CG    1 
ATOM   1651 C  CD1   . PHE A 1 213 ? 58.367 11.197  -1.751  1.00 11.61 ? 210 PHE A CD1   1 
ATOM   1652 C  CD2   . PHE A 1 213 ? 58.807 12.330  0.304   1.00 10.20 ? 210 PHE A CD2   1 
ATOM   1653 C  CE1   . PHE A 1 213 ? 57.423 12.168  -2.087  1.00 10.41 ? 210 PHE A CE1   1 
ATOM   1654 C  CE2   . PHE A 1 213 ? 57.871 13.299  -0.038  1.00 10.34 ? 210 PHE A CE2   1 
ATOM   1655 C  CZ    . PHE A 1 213 ? 57.174 13.202  -1.227  1.00 8.91  ? 210 PHE A CZ    1 
ATOM   1656 N  N     . GLN A 1 214 ? 62.218 9.093   2.075   1.00 10.46 ? 211 GLN A N     1 
ATOM   1657 C  CA    . GLN A 1 214 ? 62.923 7.883   2.485   1.00 10.89 ? 211 GLN A CA    1 
ATOM   1658 C  C     . GLN A 1 214 ? 62.010 6.665   2.421   1.00 10.54 ? 211 GLN A C     1 
ATOM   1659 O  O     . GLN A 1 214 ? 60.792 6.779   2.516   1.00 10.71 ? 211 GLN A O     1 
ATOM   1660 C  CB    . GLN A 1 214 ? 63.478 8.047   3.899   1.00 13.97 ? 211 GLN A CB    1 
ATOM   1661 C  CG    . GLN A 1 214 ? 64.646 9.027   3.948   1.00 12.85 ? 211 GLN A CG    1 
ATOM   1662 C  CD    . GLN A 1 214 ? 65.237 9.199   5.330   1.00 14.61 ? 211 GLN A CD    1 
ATOM   1663 O  OE1   . GLN A 1 214 ? 64.661 8.779   6.335   1.00 16.21 ? 211 GLN A OE1   1 
ATOM   1664 N  NE2   . GLN A 1 214 ? 66.404 9.834   5.383   1.00 18.53 ? 211 GLN A NE2   1 
ATOM   1665 N  N     . CYS A 1 215 ? 62.608 5.495   2.265   1.00 10.12 ? 212 CYS A N     1 
ATOM   1666 C  CA    . CYS A 1 215 ? 61.811 4.278   2.167   1.00 10.24 ? 212 CYS A CA    1 
ATOM   1667 C  C     . CYS A 1 215 ? 62.581 3.104   2.714   1.00 10.39 ? 212 CYS A C     1 
ATOM   1668 O  O     . CYS A 1 215 ? 63.793 3.183   2.957   1.00 12.23 ? 212 CYS A O     1 
ATOM   1669 C  CB    . CYS A 1 215 ? 61.406 3.988   0.723   1.00 10.54 ? 212 CYS A CB    1 
ATOM   1670 S  SG    . CYS A 1 215 ? 62.834 3.757   -0.346  1.00 16.89 ? 212 CYS A SG    1 
ATOM   1671 N  N     . SER A 1 216 ? 61.860 2.011   2.898   1.00 8.99  ? 213 SER A N     1 
ATOM   1672 C  CA    . SER A 1 216 ? 62.471 0.746   3.277   1.00 9.86  ? 213 SER A CA    1 
ATOM   1673 C  C     . SER A 1 216 ? 62.281 -0.236  2.150   1.00 10.73 ? 213 SER A C     1 
ATOM   1674 O  O     . SER A 1 216 ? 61.494 0.009   1.251   1.00 10.61 ? 213 SER A O     1 
ATOM   1675 C  CB    . SER A 1 216 ? 61.854 0.229   4.566   1.00 11.76 ? 213 SER A CB    1 
ATOM   1676 O  OG    . SER A 1 216 ? 62.102 1.164   5.608   1.00 14.03 ? 213 SER A OG    1 
ATOM   1677 N  N     . ALA A 1 217 ? 63.003 -1.351  2.184   1.00 9.21  ? 214 ALA A N     1 
ATOM   1678 C  CA    . ALA A 1 217 ? 62.853 -2.341  1.138   1.00 8.27  ? 214 ALA A CA    1 
ATOM   1679 C  C     . ALA A 1 217 ? 63.199 -3.722  1.631   1.00 10.34 ? 214 ALA A C     1 
ATOM   1680 O  O     . ALA A 1 217 ? 63.979 -3.870  2.574   1.00 9.24  ? 214 ALA A O     1 
ATOM   1681 C  CB    . ALA A 1 217 ? 63.712 -2.001  -0.061  1.00 10.76 ? 214 ALA A CB    1 
ATOM   1682 N  N     . GLY A 1 218 ? 62.586 -4.718  0.995   1.00 9.38  ? 215 GLY A N     1 
ATOM   1683 C  CA    . GLY A 1 218 ? 62.927 -6.120  1.218   1.00 7.93  ? 215 GLY A CA    1 
ATOM   1684 C  C     . GLY A 1 218 ? 63.467 -6.698  -0.074  1.00 8.14  ? 215 GLY A C     1 
ATOM   1685 O  O     . GLY A 1 218 ? 62.970 -6.377  -1.151  1.00 8.94  ? 215 GLY A O     1 
ATOM   1686 N  N     . ILE A 1 219 ? 64.491 -7.541  0.020   1.00 8.52  ? 216 ILE A N     1 
ATOM   1687 C  CA    . ILE A 1 219 ? 65.029 -8.238  -1.147  1.00 8.73  ? 216 ILE A CA    1 
ATOM   1688 C  C     . ILE A 1 219 ? 65.016 -9.722  -0.840  1.00 9.52  ? 216 ILE A C     1 
ATOM   1689 O  O     . ILE A 1 219 ? 65.604 -10.157 0.160   1.00 9.14  ? 216 ILE A O     1 
ATOM   1690 C  CB    . ILE A 1 219 ? 66.477 -7.802  -1.491  1.00 9.48  ? 216 ILE A CB    1 
ATOM   1691 C  CG1   . ILE A 1 219 ? 66.578 -6.271  -1.650  1.00 10.43 ? 216 ILE A CG1   1 
ATOM   1692 C  CG2   . ILE A 1 219 ? 66.964 -8.514  -2.745  1.00 12.52 ? 216 ILE A CG2   1 
ATOM   1693 C  CD1   . ILE A 1 219 ? 67.015 -5.555  -0.377  1.00 12.93 ? 216 ILE A CD1   1 
ATOM   1694 N  N     . SER A 1 220 ? 64.342 -10.490 -1.687  1.00 8.94  ? 217 SER A N     1 
ATOM   1695 C  CA    . SER A 1 220 ? 64.329 -11.937 -1.555  1.00 6.44  ? 217 SER A CA    1 
ATOM   1696 C  C     . SER A 1 220 ? 64.057 -12.579 -2.906  1.00 9.30  ? 217 SER A C     1 
ATOM   1697 O  O     . SER A 1 220 ? 64.321 -11.971 -3.951  1.00 8.86  ? 217 SER A O     1 
ATOM   1698 C  CB    . SER A 1 220 ? 63.280 -12.375 -0.524  1.00 11.45 ? 217 SER A CB    1 
ATOM   1699 O  OG    . SER A 1 220 ? 63.480 -13.732 -0.153  1.00 10.86 ? 217 SER A OG    1 
ATOM   1700 N  N     . HIS A 1 221 ? 63.563 -13.814 -2.887  1.00 11.51 ? 218 HIS A N     1 
ATOM   1701 C  CA    . HIS A 1 221 ? 63.346 -14.563 -4.120  1.00 10.76 ? 218 HIS A CA    1 
ATOM   1702 C  C     . HIS A 1 221 ? 61.900 -14.532 -4.614  1.00 10.81 ? 218 HIS A C     1 
ATOM   1703 O  O     . HIS A 1 221 ? 61.594 -15.115 -5.653  1.00 10.42 ? 218 HIS A O     1 
ATOM   1704 C  CB    . HIS A 1 221 ? 63.790 -16.026 -3.938  1.00 10.75 ? 218 HIS A CB    1 
ATOM   1705 C  CG    . HIS A 1 221 ? 65.278 -16.197 -3.823  1.00 12.44 ? 218 HIS A CG    1 
ATOM   1706 N  ND1   . HIS A 1 221 ? 66.140 -15.883 -4.848  1.00 11.68 ? 218 HIS A ND1   1 
ATOM   1707 C  CD2   . HIS A 1 221 ? 66.041 -16.691 -2.814  1.00 11.01 ? 218 HIS A CD2   1 
ATOM   1708 C  CE1   . HIS A 1 221 ? 67.383 -16.160 -4.470  1.00 14.67 ? 218 HIS A CE1   1 
ATOM   1709 N  NE2   . HIS A 1 221 ? 67.348 -16.645 -3.244  1.00 13.54 ? 218 HIS A NE2   1 
ATOM   1710 N  N     . ASN A 1 222 ? 61.017 -13.874 -3.877  1.00 7.77  ? 219 ASN A N     1 
ATOM   1711 C  CA    . ASN A 1 222 ? 59.622 -13.790 -4.284  1.00 8.29  ? 219 ASN A CA    1 
ATOM   1712 C  C     . ASN A 1 222 ? 58.937 -12.647 -3.548  1.00 9.27  ? 219 ASN A C     1 
ATOM   1713 O  O     . ASN A 1 222 ? 59.523 -12.035 -2.647  1.00 10.14 ? 219 ASN A O     1 
ATOM   1714 C  CB    . ASN A 1 222 ? 58.881 -15.113 -4.025  1.00 9.60  ? 219 ASN A CB    1 
ATOM   1715 C  CG    . ASN A 1 222 ? 58.998 -15.570 -2.588  1.00 10.85 ? 219 ASN A CG    1 
ATOM   1716 O  OD1   . ASN A 1 222 ? 58.500 -14.909 -1.683  1.00 10.03 ? 219 ASN A OD1   1 
ATOM   1717 N  ND2   . ASN A 1 222 ? 59.627 -16.729 -2.373  1.00 10.55 ? 219 ASN A ND2   1 
ATOM   1718 N  N     . LYS A 1 223 ? 57.705 -12.355 -3.947  1.00 8.19  ? 220 LYS A N     1 
ATOM   1719 C  CA    . LYS A 1 223 ? 56.995 -11.195 -3.426  1.00 9.34  ? 220 LYS A CA    1 
ATOM   1720 C  C     . LYS A 1 223 ? 56.665 -11.318 -1.942  1.00 9.03  ? 220 LYS A C     1 
ATOM   1721 O  O     . LYS A 1 223 ? 56.822 -10.347 -1.190  1.00 9.31  ? 220 LYS A O     1 
ATOM   1722 C  CB    . LYS A 1 223 ? 55.715 -10.954 -4.234  1.00 10.97 ? 220 LYS A CB    1 
ATOM   1723 C  CG    . LYS A 1 223 ? 55.993 -10.484 -5.666  1.00 12.14 ? 220 LYS A CG    1 
ATOM   1724 C  CD    . LYS A 1 223 ? 54.806 -9.727  -6.281  1.00 25.23 ? 220 LYS A CD    1 
ATOM   1725 C  CE    . LYS A 1 223 ? 53.638 -10.602 -6.515  1.00 26.01 ? 220 LYS A CE    1 
ATOM   1726 N  NZ    . LYS A 1 223 ? 52.533 -9.891  -7.258  1.00 16.34 ? 220 LYS A NZ    1 
ATOM   1727 N  N     . VAL A 1 224 ? 56.198 -12.485 -1.499  1.00 9.75  ? 221 VAL A N     1 
ATOM   1728 C  CA    . VAL A 1 224 ? 55.827 -12.624 -0.089  1.00 9.46  ? 221 VAL A CA    1 
ATOM   1729 C  C     . VAL A 1 224 ? 57.024 -12.435 0.846   1.00 8.63  ? 221 VAL A C     1 
ATOM   1730 O  O     . VAL A 1 224 ? 56.928 -11.702 1.846   1.00 10.34 ? 221 VAL A O     1 
ATOM   1731 C  CB    . VAL A 1 224 ? 55.186 -13.988 0.194   1.00 11.36 ? 221 VAL A CB    1 
ATOM   1732 C  CG1   . VAL A 1 224 ? 55.173 -14.285 1.677   1.00 15.12 ? 221 VAL A CG1   1 
ATOM   1733 C  CG2   . VAL A 1 224 ? 53.768 -13.997 -0.337  1.00 13.29 ? 221 VAL A CG2   1 
ATOM   1734 N  N     . LEU A 1 225 ? 58.155 -13.049 0.511   1.00 9.56  ? 222 LEU A N     1 
ATOM   1735 C  CA    . LEU A 1 225 ? 59.354 -12.872 1.332   1.00 9.25  ? 222 LEU A CA    1 
ATOM   1736 C  C     . LEU A 1 225 ? 59.904 -11.450 1.230   1.00 8.28  ? 222 LEU A C     1 
ATOM   1737 O  O     . LEU A 1 225 ? 60.388 -10.907 2.211   1.00 8.97  ? 222 LEU A O     1 
ATOM   1738 C  CB    . LEU A 1 225 ? 60.435 -13.878 0.938   1.00 9.39  ? 222 LEU A CB    1 
ATOM   1739 C  CG    . LEU A 1 225 ? 60.150 -15.325 1.352   1.00 9.54  ? 222 LEU A CG    1 
ATOM   1740 C  CD1   . LEU A 1 225 ? 61.333 -16.206 0.959   1.00 11.86 ? 222 LEU A CD1   1 
ATOM   1741 C  CD2   . LEU A 1 225 ? 59.827 -15.449 2.834   1.00 12.12 ? 222 LEU A CD2   1 
ATOM   1742 N  N     . ALA A 1 226 ? 59.821 -10.841 0.046   1.00 8.24  ? 223 ALA A N     1 
ATOM   1743 C  CA    . ALA A 1 226 ? 60.279 -9.466  -0.084  1.00 8.61  ? 223 ALA A CA    1 
ATOM   1744 C  C     . ALA A 1 226 ? 59.456 -8.519  0.788   1.00 9.39  ? 223 ALA A C     1 
ATOM   1745 O  O     . ALA A 1 226 ? 60.011 -7.619  1.442   1.00 8.89  ? 223 ALA A O     1 
ATOM   1746 C  CB    . ALA A 1 226 ? 60.233 -9.022  -1.533  1.00 11.34 ? 223 ALA A CB    1 
ATOM   1747 N  N     . LYS A 1 227 ? 58.176 -8.725  0.817   1.00 9.28  ? 224 LYS A N     1 
ATOM   1748 C  CA    . LYS A 1 227 ? 57.397 -7.878  1.631   1.00 8.94  ? 224 LYS A CA    1 
ATOM   1749 C  C     . LYS A 1 227 ? 57.630 -8.090  3.140   1.00 10.50 ? 224 LYS A C     1 
ATOM   1750 O  O     . LYS A 1 227 ? 57.656 -7.177  3.908   1.00 11.35 ? 224 LYS A O     1 
ATOM   1751 C  CB    . LYS A 1 227 ? 55.853 -8.102  1.418   1.00 11.74 ? 224 LYS A CB    1 
ATOM   1752 C  CG    A LYS A 1 227 ? 54.795 -7.483  2.227   0.60 11.67 ? 224 LYS A CG    1 
ATOM   1753 C  CG    B LYS A 1 227 ? 54.709 -7.610  2.368   0.40 12.30 ? 224 LYS A CG    1 
ATOM   1754 C  CD    A LYS A 1 227 ? 54.919 -5.968  2.082   0.60 15.81 ? 224 LYS A CD    1 
ATOM   1755 C  CD    B LYS A 1 227 ? 53.281 -7.636  1.900   0.40 13.69 ? 224 LYS A CD    1 
ATOM   1756 C  CE    A LYS A 1 227 ? 53.874 -5.244  2.937   0.60 21.93 ? 224 LYS A CE    1 
ATOM   1757 C  CE    B LYS A 1 227 ? 52.430 -6.693  2.771   0.40 19.73 ? 224 LYS A CE    1 
ATOM   1758 N  NZ    A LYS A 1 227 ? 53.921 -3.749  2.807   0.60 14.07 ? 224 LYS A NZ    1 
ATOM   1759 N  NZ    B LYS A 1 227 ? 53.199 -5.457  3.006   0.40 23.75 ? 224 LYS A NZ    1 
ATOM   1760 N  N     . LEU A 1 228 ? 57.735 -9.343  3.516   1.00 9.61  ? 225 LEU A N     1 
ATOM   1761 C  CA    . LEU A 1 228 ? 58.030 -9.655  4.905   1.00 10.57 ? 225 LEU A CA    1 
ATOM   1762 C  C     . LEU A 1 228 ? 59.367 -9.028  5.310   1.00 12.37 ? 225 LEU A C     1 
ATOM   1763 O  O     . LEU A 1 228 ? 59.473 -8.362  6.352   1.00 11.32 ? 225 LEU A O     1 
ATOM   1764 C  CB    . LEU A 1 228 ? 58.052 -11.168 5.109   1.00 11.83 ? 225 LEU A CB    1 
ATOM   1765 C  CG    . LEU A 1 228 ? 58.258 -11.604 6.559   1.00 14.91 ? 225 LEU A CG    1 
ATOM   1766 C  CD1   . LEU A 1 228 ? 57.057 -11.204 7.415   1.00 17.91 ? 225 LEU A CD1   1 
ATOM   1767 C  CD2   . LEU A 1 228 ? 58.484 -13.088 6.625   1.00 12.30 ? 225 LEU A CD2   1 
ATOM   1768 N  N     . ALA A 1 229 ? 60.374 -9.226  4.461   1.00 9.15  ? 226 ALA A N     1 
ATOM   1769 C  CA    . ALA A 1 229 ? 61.704 -8.654  4.678   1.00 10.84 ? 226 ALA A CA    1 
ATOM   1770 C  C     . ALA A 1 229 ? 61.661 -7.138  4.876   1.00 10.32 ? 226 ALA A C     1 
ATOM   1771 O  O     . ALA A 1 229 ? 62.341 -6.597  5.753   1.00 12.12 ? 226 ALA A O     1 
ATOM   1772 C  CB    . ALA A 1 229 ? 62.633 -8.996  3.510   1.00 8.77  ? 226 ALA A CB    1 
ATOM   1773 N  N     . CYS A 1 230 ? 60.886 -6.454  4.033   1.00 9.96  ? 227 CYS A N     1 
ATOM   1774 C  CA    . CYS A 1 230 ? 60.832 -5.002  4.065   1.00 11.36 ? 227 CYS A CA    1 
ATOM   1775 C  C     . CYS A 1 230 ? 60.480 -4.465  5.453   1.00 11.07 ? 227 CYS A C     1 
ATOM   1776 O  O     . CYS A 1 230 ? 61.092 -3.498  5.930   1.00 13.56 ? 227 CYS A O     1 
ATOM   1777 C  CB    . CYS A 1 230 ? 59.816 -4.513  3.039   1.00 9.10  ? 227 CYS A CB    1 
ATOM   1778 S  SG    . CYS A 1 230 ? 59.732 -2.706  2.894   1.00 11.89 ? 227 CYS A SG    1 
ATOM   1779 N  N     . GLY A 1 231 ? 59.560 -5.107  6.112   1.00 10.23 ? 228 GLY A N     1 
ATOM   1780 C  CA    . GLY A 1 231 ? 59.143 -4.661  7.415   1.00 14.34 ? 228 GLY A CA    1 
ATOM   1781 C  C     . GLY A 1 231 ? 60.024 -5.020  8.612   1.00 14.01 ? 228 GLY A C     1 
ATOM   1782 O  O     . GLY A 1 231 ? 59.773 -4.603  9.691   1.00 17.97 ? 228 GLY A O     1 
ATOM   1783 N  N     . LEU A 1 232 ? 61.017 -5.846  8.401   1.00 11.73 ? 229 LEU A N     1 
ATOM   1784 C  CA    . LEU A 1 232 ? 61.867 -6.295  9.492   1.00 11.55 ? 229 LEU A CA    1 
ATOM   1785 C  C     . LEU A 1 232 ? 62.696 -5.165  10.106  1.00 12.83 ? 229 LEU A C     1 
ATOM   1786 O  O     . LEU A 1 232 ? 63.037 -5.200  11.249  1.00 14.45 ? 229 LEU A O     1 
ATOM   1787 C  CB    . LEU A 1 232 ? 62.770 -7.425  9.049   1.00 11.52 ? 229 LEU A CB    1 
ATOM   1788 C  CG    . LEU A 1 232 ? 61.958 -8.670  8.809   1.00 14.33 ? 229 LEU A CG    1 
ATOM   1789 C  CD1   . LEU A 1 232 ? 62.787 -9.815  8.304   1.00 12.02 ? 229 LEU A CD1   1 
ATOM   1790 C  CD2   . LEU A 1 232 ? 61.071 -9.056  9.967   1.00 16.49 ? 229 LEU A CD2   1 
ATOM   1791 N  N     A ASN A 1 233 ? 63.120 -4.243  9.271   0.55 12.09 ? 230 ASN A N     1 
ATOM   1792 N  N     B ASN A 1 233 ? 63.103 -4.229  9.291   0.45 12.12 ? 230 ASN A N     1 
ATOM   1793 C  CA    A ASN A 1 233 ? 64.034 -3.187  9.712   0.55 12.52 ? 230 ASN A CA    1 
ATOM   1794 C  CA    B ASN A 1 233 ? 63.985 -3.167  9.751   0.45 12.56 ? 230 ASN A CA    1 
ATOM   1795 C  C     A ASN A 1 233 ? 63.713 -1.749  9.340   0.55 14.32 ? 230 ASN A C     1 
ATOM   1796 C  C     B ASN A 1 233 ? 63.519 -1.886  9.089   0.45 13.98 ? 230 ASN A C     1 
ATOM   1797 O  O     A ASN A 1 233 ? 64.574 -0.929  9.305   0.55 13.06 ? 230 ASN A O     1 
ATOM   1798 O  O     B ASN A 1 233 ? 63.917 -1.609  8.074   0.45 14.35 ? 230 ASN A O     1 
ATOM   1799 C  CB    A ASN A 1 233 ? 65.472 -3.471  9.326   0.55 12.44 ? 230 ASN A CB    1 
ATOM   1800 C  CB    B ASN A 1 233 ? 65.437 -3.439  9.355   0.45 12.47 ? 230 ASN A CB    1 
ATOM   1801 C  CG    A ASN A 1 233 ? 66.048 -4.654  10.051  0.55 13.74 ? 230 ASN A CG    1 
ATOM   1802 C  CG    B ASN A 1 233 ? 66.030 -4.645  10.058  0.45 13.73 ? 230 ASN A CG    1 
ATOM   1803 O  OD1   A ASN A 1 233 ? 66.323 -4.584  11.196  0.55 14.92 ? 230 ASN A OD1   1 
ATOM   1804 O  OD1   B ASN A 1 233 ? 66.305 -4.596  11.196  0.45 14.94 ? 230 ASN A OD1   1 
ATOM   1805 N  ND2   A ASN A 1 233 ? 66.230 -5.729  9.338   0.55 13.57 ? 230 ASN A ND2   1 
ATOM   1806 N  ND2   B ASN A 1 233 ? 66.227 -5.705  9.327   0.45 13.60 ? 230 ASN A ND2   1 
ATOM   1807 N  N     A LYS A 1 234 ? 62.483 -1.421  9.242   0.55 18.58 ? 231 LYS A N     1 
ATOM   1808 N  N     B LYS A 1 234 ? 62.548 -1.229  9.609   0.45 18.58 ? 231 LYS A N     1 
ATOM   1809 C  CA    A LYS A 1 234 ? 62.050 -0.043  8.955   0.55 15.61 ? 231 LYS A CA    1 
ATOM   1810 C  CA    B LYS A 1 234 ? 62.046 0.043   9.104   0.45 15.76 ? 231 LYS A CA    1 
ATOM   1811 C  C     A LYS A 1 234 ? 62.296 0.866   10.158  0.55 17.22 ? 231 LYS A C     1 
ATOM   1812 C  C     B LYS A 1 234 ? 62.386 0.948   10.239  0.45 17.41 ? 231 LYS A C     1 
ATOM   1813 O  O     A LYS A 1 234 ? 62.320 0.413   11.246  0.55 21.92 ? 231 LYS A O     1 
ATOM   1814 O  O     B LYS A 1 234 ? 62.333 0.482   11.309  0.45 21.77 ? 231 LYS A O     1 
ATOM   1815 C  CB    A LYS A 1 234 ? 60.591 -0.067  8.508   0.55 18.28 ? 231 LYS A CB    1 
ATOM   1816 C  CB    B LYS A 1 234 ? 60.534 0.014   9.008   0.45 18.07 ? 231 LYS A CB    1 
ATOM   1817 C  CG    A LYS A 1 234 ? 59.664 -0.476  9.580   0.55 18.04 ? 231 LYS A CG    1 
ATOM   1818 C  CG    B LYS A 1 234 ? 59.997 -0.534  7.755   0.45 14.18 ? 231 LYS A CG    1 
ATOM   1819 C  CD    A LYS A 1 234 ? 58.251 -0.700  9.061   0.55 18.04 ? 231 LYS A CD    1 
ATOM   1820 C  CD    B LYS A 1 234 ? 58.592 -0.006  7.416   0.45 18.22 ? 231 LYS A CD    1 
ATOM   1821 C  CE    A LYS A 1 234 ? 57.248 -0.386  10.172  0.55 15.92 ? 231 LYS A CE    1 
ATOM   1822 C  CE    B LYS A 1 234 ? 57.995 -0.786  6.268   0.45 21.07 ? 231 LYS A CE    1 
ATOM   1823 N  NZ    A LYS A 1 234 ? 55.850 -0.514  9.661   0.55 17.15 ? 231 LYS A NZ    1 
ATOM   1824 N  NZ    B LYS A 1 234 ? 58.030 0.034   5.072   0.45 16.59 ? 231 LYS A NZ    1 
ATOM   1825 N  N     . PRO A 1 235 ? 62.452 2.257   10.048  1.00 14.17 ? 232 PRO A N     1 
ATOM   1826 C  CA    . PRO A 1 235 ? 62.438 2.842   8.708   1.00 12.22 ? 232 PRO A CA    1 
ATOM   1827 C  C     . PRO A 1 235 ? 63.799 3.087   8.067   1.00 13.32 ? 232 PRO A C     1 
ATOM   1828 O  O     . PRO A 1 235 ? 64.763 2.933   8.713   1.00 13.24 ? 232 PRO A O     1 
ATOM   1829 C  CB    . PRO A 1 235 ? 61.797 4.205   8.958   1.00 14.18 ? 232 PRO A CB    1 
ATOM   1830 C  CG    . PRO A 1 235 ? 62.369 4.661   10.207  1.00 18.53 ? 232 PRO A CG    1 
ATOM   1831 C  CD    . PRO A 1 235 ? 62.459 3.458   11.044  1.00 18.35 ? 232 PRO A CD    1 
ATOM   1832 N  N     . ASN A 1 236 ? 63.794 3.495   6.798   1.00 12.29 ? 233 ASN A N     1 
ATOM   1833 C  CA    . ASN A 1 236 ? 65.014 3.915   6.121   1.00 12.23 ? 233 ASN A CA    1 
ATOM   1834 C  C     . ASN A 1 236 ? 66.104 2.842   6.097   1.00 9.87  ? 233 ASN A C     1 
ATOM   1835 O  O     . ASN A 1 236 ? 67.289 3.154   6.151   1.00 12.07 ? 233 ASN A O     1 
ATOM   1836 C  CB    . ASN A 1 236 ? 65.552 5.193   6.770   1.00 13.88 ? 233 ASN A CB    1 
ATOM   1837 C  CG    . ASN A 1 236 ? 66.552 5.908   5.893   1.00 14.92 ? 233 ASN A CG    1 
ATOM   1838 O  OD1   . ASN A 1 236 ? 66.479 5.835   4.674   1.00 17.09 ? 233 ASN A OD1   1 
ATOM   1839 N  ND2   . ASN A 1 236 ? 67.503 6.590   6.515   1.00 19.17 ? 233 ASN A ND2   1 
ATOM   1840 N  N     . ARG A 1 237 ? 65.693 1.580   6.011   1.00 10.01 ? 234 ARG A N     1 
ATOM   1841 C  CA    . ARG A 1 237 ? 66.654 0.477   5.920   1.00 11.43 ? 234 ARG A CA    1 
ATOM   1842 C  C     . ARG A 1 237 ? 66.127 -0.571  4.963   1.00 10.89 ? 234 ARG A C     1 
ATOM   1843 O  O     . ARG A 1 237 ? 64.950 -0.567  4.629   1.00 11.67 ? 234 ARG A O     1 
ATOM   1844 C  CB    . ARG A 1 237 ? 66.911 -0.164  7.291   1.00 12.36 ? 234 ARG A CB    1 
ATOM   1845 C  CG    . ARG A 1 237 ? 67.565 0.736   8.319   1.00 12.57 ? 234 ARG A CG    1 
ATOM   1846 C  CD    . ARG A 1 237 ? 68.995 1.074   7.941   1.00 15.19 ? 234 ARG A CD    1 
ATOM   1847 N  NE    . ARG A 1 237 ? 69.681 1.848   8.982   1.00 20.84 ? 234 ARG A NE    1 
ATOM   1848 C  CZ    . ARG A 1 237 ? 69.767 3.179   8.993   1.00 24.61 ? 234 ARG A CZ    1 
ATOM   1849 N  NH1   . ARG A 1 237 ? 69.205 3.896   8.026   1.00 23.44 ? 234 ARG A NH1   1 
ATOM   1850 N  NH2   . ARG A 1 237 ? 70.416 3.797   9.972   1.00 27.11 ? 234 ARG A NH2   1 
ATOM   1851 N  N     . GLN A 1 238 ? 66.990 -1.471  4.511   1.00 9.58  ? 235 GLN A N     1 
ATOM   1852 C  CA    . GLN A 1 238 ? 66.527 -2.566  3.670   1.00 9.25  ? 235 GLN A CA    1 
ATOM   1853 C  C     . GLN A 1 238 ? 67.041 -3.890  4.207   1.00 10.60 ? 235 GLN A C     1 
ATOM   1854 O  O     . GLN A 1 238 ? 68.093 -3.950  4.853   1.00 11.38 ? 235 GLN A O     1 
ATOM   1855 C  CB    . GLN A 1 238 ? 66.964 -2.375  2.214   1.00 10.78 ? 235 GLN A CB    1 
ATOM   1856 C  CG    . GLN A 1 238 ? 68.470 -2.223  2.027   1.00 11.07 ? 235 GLN A CG    1 
ATOM   1857 C  CD    . GLN A 1 238 ? 68.825 -1.953  0.577   1.00 12.33 ? 235 GLN A CD    1 
ATOM   1858 O  OE1   . GLN A 1 238 ? 68.397 -0.952  -0.004  1.00 13.91 ? 235 GLN A OE1   1 
ATOM   1859 N  NE2   . GLN A 1 238 ? 69.580 -2.860  -0.032  1.00 9.62  ? 235 GLN A NE2   1 
ATOM   1860 N  N     . THR A 1 239 ? 66.286 -4.951  3.943   1.00 9.25  ? 236 THR A N     1 
ATOM   1861 C  CA    . THR A 1 239 ? 66.602 -6.251  4.523   1.00 10.12 ? 236 THR A CA    1 
ATOM   1862 C  C     . THR A 1 239 ? 66.631 -7.322  3.449   1.00 10.79 ? 236 THR A C     1 
ATOM   1863 O  O     . THR A 1 239 ? 65.715 -7.425  2.637   1.00 10.83 ? 236 THR A O     1 
ATOM   1864 C  CB    . THR A 1 239 ? 65.585 -6.625  5.609   1.00 11.04 ? 236 THR A CB    1 
ATOM   1865 O  OG1   . THR A 1 239 ? 65.518 -5.565  6.566   1.00 11.59 ? 236 THR A OG1   1 
ATOM   1866 C  CG2   . THR A 1 239 ? 65.995 -7.913  6.354   1.00 11.95 ? 236 THR A CG2   1 
ATOM   1867 N  N     . LEU A 1 240 ? 67.692 -8.120  3.463   1.00 9.51  ? 237 LEU A N     1 
ATOM   1868 C  CA    . LEU A 1 240 ? 67.836 -9.257  2.567   1.00 8.41  ? 237 LEU A CA    1 
ATOM   1869 C  C     . LEU A 1 240 ? 67.420 -10.523 3.324   1.00 9.88  ? 237 LEU A C     1 
ATOM   1870 O  O     . LEU A 1 240 ? 67.986 -10.843 4.384   1.00 11.24 ? 237 LEU A O     1 
ATOM   1871 C  CB    . LEU A 1 240 ? 69.283 -9.348  2.050   1.00 10.09 ? 237 LEU A CB    1 
ATOM   1872 C  CG    . LEU A 1 240 ? 69.661 -10.362 0.971   1.00 10.47 ? 237 LEU A CG    1 
ATOM   1873 C  CD1   . LEU A 1 240 ? 71.010 -9.977  0.351   1.00 12.36 ? 237 LEU A CD1   1 
ATOM   1874 C  CD2   . LEU A 1 240 ? 69.756 -11.779 1.538   1.00 11.89 ? 237 LEU A CD2   1 
ATOM   1875 N  N     . VAL A 1 241 ? 66.417 -11.230 2.795   1.00 8.00  ? 238 VAL A N     1 
ATOM   1876 C  CA    . VAL A 1 241 ? 65.990 -12.517 3.361   1.00 9.60  ? 238 VAL A CA    1 
ATOM   1877 C  C     . VAL A 1 241 ? 66.368 -13.591 2.361   1.00 7.64  ? 238 VAL A C     1 
ATOM   1878 O  O     . VAL A 1 241 ? 65.792 -13.684 1.274   1.00 9.70  ? 238 VAL A O     1 
ATOM   1879 C  CB    . VAL A 1 241 ? 64.483 -12.532 3.664   1.00 8.73  ? 238 VAL A CB    1 
ATOM   1880 C  CG1   . VAL A 1 241 ? 63.960 -13.968 3.860   1.00 9.22  ? 238 VAL A CG1   1 
ATOM   1881 C  CG2   . VAL A 1 241 ? 64.186 -11.707 4.898   1.00 10.02 ? 238 VAL A CG2   1 
ATOM   1882 N  N     . SER A 1 242 ? 67.383 -14.372 2.721   1.00 8.18  ? 239 SER A N     1 
ATOM   1883 C  CA    . SER A 1 242 ? 67.873 -15.426 1.851   1.00 10.11 ? 239 SER A CA    1 
ATOM   1884 C  C     . SER A 1 242 ? 67.019 -16.687 1.971   1.00 7.63  ? 239 SER A C     1 
ATOM   1885 O  O     . SER A 1 242 ? 66.265 -16.849 2.922   1.00 9.30  ? 239 SER A O     1 
ATOM   1886 C  CB    . SER A 1 242 ? 69.320 -15.762 2.192   1.00 14.78 ? 239 SER A CB    1 
ATOM   1887 O  OG    . SER A 1 242 ? 69.384 -16.213 3.534   1.00 13.60 ? 239 SER A OG    1 
ATOM   1888 N  N     . HIS A 1 243 ? 67.162 -17.592 1.015   1.00 9.65  ? 240 HIS A N     1 
ATOM   1889 C  CA    . HIS A 1 243 ? 66.417 -18.840 1.106   1.00 8.94  ? 240 HIS A CA    1 
ATOM   1890 C  C     . HIS A 1 243 ? 66.805 -19.585 2.389   1.00 11.35 ? 240 HIS A C     1 
ATOM   1891 O  O     . HIS A 1 243 ? 65.939 -20.145 3.078   1.00 10.92 ? 240 HIS A O     1 
ATOM   1892 C  CB    . HIS A 1 243 ? 66.666 -19.716 -0.119  1.00 12.39 ? 240 HIS A CB    1 
ATOM   1893 C  CG    . HIS A 1 243 ? 65.902 -21.003 -0.096  1.00 14.03 ? 240 HIS A CG    1 
ATOM   1894 N  ND1   . HIS A 1 243 ? 64.553 -21.070 -0.368  1.00 17.27 ? 240 HIS A ND1   1 
ATOM   1895 C  CD2   . HIS A 1 243 ? 66.301 -22.272 0.158   1.00 18.23 ? 240 HIS A CD2   1 
ATOM   1896 C  CE1   . HIS A 1 243 ? 64.155 -22.328 -0.287  1.00 19.25 ? 240 HIS A CE1   1 
ATOM   1897 N  NE2   . HIS A 1 243 ? 65.193 -23.076 0.034   1.00 16.81 ? 240 HIS A NE2   1 
ATOM   1898 N  N     . GLY A 1 244 ? 68.096 -19.559 2.714   1.00 11.44 ? 241 GLY A N     1 
ATOM   1899 C  CA    . GLY A 1 244 ? 68.589 -20.261 3.896   1.00 11.88 ? 241 GLY A CA    1 
ATOM   1900 C  C     . GLY A 1 244 ? 68.088 -19.698 5.213   1.00 10.42 ? 241 GLY A C     1 
ATOM   1901 O  O     . GLY A 1 244 ? 68.061 -20.401 6.220   1.00 11.07 ? 241 GLY A O     1 
ATOM   1902 N  N     . SER A 1 245 ? 67.699 -18.427 5.226   1.00 10.13 ? 242 SER A N     1 
ATOM   1903 C  CA    . SER A 1 245 ? 67.207 -17.796 6.455   1.00 11.26 ? 242 SER A CA    1 
ATOM   1904 C  C     . SER A 1 245 ? 65.768 -18.200 6.803   1.00 9.58  ? 242 SER A C     1 
ATOM   1905 O  O     . SER A 1 245 ? 65.290 -17.925 7.911   1.00 9.97  ? 242 SER A O     1 
ATOM   1906 C  CB    . SER A 1 245 ? 67.283 -16.267 6.345   1.00 11.08 ? 242 SER A CB    1 
ATOM   1907 O  OG    . SER A 1 245 ? 66.230 -15.758 5.518   1.00 10.72 ? 242 SER A OG    1 
ATOM   1908 N  N     . VAL A 1 246 ? 65.078 -18.852 5.874   1.00 9.12  ? 243 VAL A N     1 
ATOM   1909 C  CA    . VAL A 1 246 ? 63.645 -19.087 6.057   1.00 8.62  ? 243 VAL A CA    1 
ATOM   1910 C  C     . VAL A 1 246 ? 63.284 -20.034 7.231   1.00 9.80  ? 243 VAL A C     1 
ATOM   1911 O  O     . VAL A 1 246 ? 62.407 -19.691 8.034   1.00 9.46  ? 243 VAL A O     1 
ATOM   1912 C  CB    . VAL A 1 246 ? 63.021 -19.586 4.738   1.00 8.53  ? 243 VAL A CB    1 
ATOM   1913 C  CG1   . VAL A 1 246 ? 61.575 -20.045 4.951   1.00 10.69 ? 243 VAL A CG1   1 
ATOM   1914 C  CG2   . VAL A 1 246 ? 63.083 -18.466 3.697   1.00 11.59 ? 243 VAL A CG2   1 
ATOM   1915 N  N     . PRO A 1 247 ? 63.955 -21.195 7.368   1.00 8.95  ? 244 PRO A N     1 
ATOM   1916 C  CA    . PRO A 1 247 ? 63.544 -22.056 8.495   1.00 9.17  ? 244 PRO A CA    1 
ATOM   1917 C  C     . PRO A 1 247 ? 63.580 -21.370 9.876   1.00 8.31  ? 244 PRO A C     1 
ATOM   1918 O  O     . PRO A 1 247 ? 62.611 -21.477 10.633  1.00 10.27 ? 244 PRO A O     1 
ATOM   1919 C  CB    . PRO A 1 247 ? 64.554 -23.212 8.432   1.00 12.27 ? 244 PRO A CB    1 
ATOM   1920 C  CG    . PRO A 1 247 ? 64.830 -23.351 6.934   1.00 10.88 ? 244 PRO A CG    1 
ATOM   1921 C  CD    . PRO A 1 247 ? 64.940 -21.874 6.492   1.00 8.72  ? 244 PRO A CD    1 
ATOM   1922 N  N     . GLN A 1 248 ? 64.671 -20.687 10.204  1.00 9.65  ? 245 GLN A N     1 
ATOM   1923 C  CA    . GLN A 1 248 ? 64.739 -19.978 11.481  1.00 11.19 ? 245 GLN A CA    1 
ATOM   1924 C  C     . GLN A 1 248 ? 63.725 -18.835 11.549  1.00 13.27 ? 245 GLN A C     1 
ATOM   1925 O  O     . GLN A 1 248 ? 63.017 -18.677 12.554  1.00 11.40 ? 245 GLN A O     1 
ATOM   1926 C  CB    . GLN A 1 248 ? 66.154 -19.451 11.731  1.00 13.06 ? 245 GLN A CB    1 
ATOM   1927 C  CG    . GLN A 1 248 ? 67.186 -20.548 11.978  1.00 21.13 ? 245 GLN A CG    1 
ATOM   1928 C  CD    . GLN A 1 248 ? 68.202 -20.181 13.058  1.00 26.24 ? 245 GLN A CD    1 
ATOM   1929 O  OE1   . GLN A 1 248 ? 67.845 -20.049 14.231  1.00 36.79 ? 245 GLN A OE1   1 
ATOM   1930 N  NE2   . GLN A 1 248 ? 69.481 -20.042 12.669  1.00 20.81 ? 245 GLN A NE2   1 
ATOM   1931 N  N     . LEU A 1 249 ? 63.641 -18.055 10.475  1.00 9.64  ? 246 LEU A N     1 
ATOM   1932 C  CA    . LEU A 1 249 ? 62.717 -16.925 10.427  1.00 10.21 ? 246 LEU A CA    1 
ATOM   1933 C  C     . LEU A 1 249 ? 61.274 -17.371 10.621  1.00 8.32  ? 246 LEU A C     1 
ATOM   1934 O  O     . LEU A 1 249 ? 60.513 -16.761 11.386  1.00 11.39 ? 246 LEU A O     1 
ATOM   1935 C  CB    . LEU A 1 249 ? 62.864 -16.194 9.095   1.00 10.00 ? 246 LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1 249 ? 61.935 -14.993 8.904   1.00 11.87 ? 246 LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1 249 ? 62.230 -13.933 9.967   1.00 13.03 ? 246 LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1 249 ? 62.070 -14.428 7.500   1.00 14.19 ? 246 LEU A CD2   1 
ATOM   1939 N  N     . PHE A 1 250 ? 60.906 -18.457 9.953   1.00 8.25  ? 247 PHE A N     1 
ATOM   1940 C  CA    . PHE A 1 250 ? 59.529 -18.921 10.030  1.00 9.79  ? 247 PHE A CA    1 
ATOM   1941 C  C     . PHE A 1 250 ? 59.221 -19.697 11.308  1.00 8.84  ? 247 PHE A C     1 
ATOM   1942 O  O     . PHE A 1 250 ? 58.048 -19.891 11.640  1.00 9.78  ? 247 PHE A O     1 
ATOM   1943 C  CB    . PHE A 1 250 ? 59.182 -19.781 8.812   1.00 9.62  ? 247 PHE A CB    1 
ATOM   1944 C  CG    . PHE A 1 250 ? 58.786 -18.989 7.595   1.00 8.96  ? 247 PHE A CG    1 
ATOM   1945 C  CD1   . PHE A 1 250 ? 58.252 -19.639 6.495   1.00 11.51 ? 247 PHE A CD1   1 
ATOM   1946 C  CD2   . PHE A 1 250 ? 58.953 -17.609 7.545   1.00 10.35 ? 247 PHE A CD2   1 
ATOM   1947 C  CE1   . PHE A 1 250 ? 57.857 -18.938 5.370   1.00 12.04 ? 247 PHE A CE1   1 
ATOM   1948 C  CE2   . PHE A 1 250 ? 58.582 -16.900 6.407   1.00 13.55 ? 247 PHE A CE2   1 
ATOM   1949 C  CZ    . PHE A 1 250 ? 58.030 -17.574 5.323   1.00 13.91 ? 247 PHE A CZ    1 
ATOM   1950 N  N     . SER A 1 251 ? 60.256 -20.135 12.033  1.00 7.77  ? 248 SER A N     1 
ATOM   1951 C  CA    . SER A 1 251 ? 60.029 -21.003 13.198  1.00 9.79  ? 248 SER A CA    1 
ATOM   1952 C  C     . SER A 1 251 ? 59.305 -20.281 14.326  1.00 9.65  ? 248 SER A C     1 
ATOM   1953 O  O     . SER A 1 251 ? 58.654 -20.921 15.131  1.00 9.27  ? 248 SER A O     1 
ATOM   1954 C  CB    . SER A 1 251 ? 61.353 -21.576 13.720  1.00 10.39 ? 248 SER A CB    1 
ATOM   1955 O  OG    . SER A 1 251 ? 62.137 -20.589 14.362  1.00 10.85 ? 248 SER A OG    1 
ATOM   1956 N  N     . GLN A 1 252 ? 59.396 -18.957 14.374  1.00 9.49  ? 249 GLN A N     1 
ATOM   1957 C  CA    . GLN A 1 252 ? 58.653 -18.191 15.377  1.00 11.75 ? 249 GLN A CA    1 
ATOM   1958 C  C     . GLN A 1 252 ? 57.790 -17.080 14.765  1.00 12.22 ? 249 GLN A C     1 
ATOM   1959 O  O     . GLN A 1 252 ? 57.443 -16.113 15.451  1.00 15.16 ? 249 GLN A O     1 
ATOM   1960 C  CB    . GLN A 1 252 ? 59.606 -17.572 16.383  1.00 18.53 ? 249 GLN A CB    1 
ATOM   1961 C  CG    . GLN A 1 252 ? 60.479 -18.537 17.113  1.00 15.53 ? 249 GLN A CG    1 
ATOM   1962 C  CD    . GLN A 1 252 ? 61.306 -17.810 18.136  1.00 19.48 ? 249 GLN A CD    1 
ATOM   1963 O  OE1   . GLN A 1 252 ? 60.878 -17.631 19.278  1.00 23.02 ? 249 GLN A OE1   1 
ATOM   1964 N  NE2   . GLN A 1 252 ? 62.468 -17.323 17.717  1.00 20.38 ? 249 GLN A NE2   1 
ATOM   1965 N  N     . MET A 1 253 ? 57.456 -17.216 13.485  1.00 10.45 ? 250 MET A N     1 
ATOM   1966 C  CA    . MET A 1 253 ? 56.739 -16.176 12.744  1.00 11.10 ? 250 MET A CA    1 
ATOM   1967 C  C     . MET A 1 253 ? 55.255 -16.473 12.787  1.00 10.12 ? 250 MET A C     1 
ATOM   1968 O  O     . MET A 1 253 ? 54.827 -17.445 12.193  1.00 10.84 ? 250 MET A O     1 
ATOM   1969 C  CB    . MET A 1 253 ? 57.223 -16.120 11.282  1.00 11.67 ? 250 MET A CB    1 
ATOM   1970 C  CG    . MET A 1 253 ? 56.548 -15.047 10.421  1.00 15.73 ? 250 MET A CG    1 
ATOM   1971 S  SD    . MET A 1 253 ? 56.913 -13.365 10.947  1.00 16.15 ? 250 MET A SD    1 
ATOM   1972 C  CE    . MET A 1 253 ? 58.702 -13.303 10.769  1.00 15.21 ? 250 MET A CE    1 
ATOM   1973 N  N     . PRO A 1 254 ? 54.465 -15.649 13.495  1.00 10.92 ? 251 PRO A N     1 
ATOM   1974 C  CA    . PRO A 1 254 ? 53.012 -15.859 13.503  1.00 11.01 ? 251 PRO A CA    1 
ATOM   1975 C  C     . PRO A 1 254 ? 52.469 -15.906 12.088  1.00 12.52 ? 251 PRO A C     1 
ATOM   1976 O  O     . PRO A 1 254 ? 52.864 -15.097 11.251  1.00 10.56 ? 251 PRO A O     1 
ATOM   1977 C  CB    . PRO A 1 254 ? 52.473 -14.638 14.264  1.00 13.04 ? 251 PRO A CB    1 
ATOM   1978 C  CG    . PRO A 1 254 ? 53.637 -14.179 15.101  1.00 14.04 ? 251 PRO A CG    1 
ATOM   1979 C  CD    . PRO A 1 254 ? 54.851 -14.432 14.226  1.00 13.44 ? 251 PRO A CD    1 
ATOM   1980 N  N     . ILE A 1 255 ? 51.587 -16.862 11.834  1.00 12.05 ? 252 ILE A N     1 
ATOM   1981 C  CA    . ILE A 1 255 ? 51.011 -17.069 10.519  1.00 11.12 ? 252 ILE A CA    1 
ATOM   1982 C  C     . ILE A 1 255 ? 50.389 -15.771 9.971   1.00 10.78 ? 252 ILE A C     1 
ATOM   1983 O  O     . ILE A 1 255 ? 50.522 -15.481 8.785   1.00 10.79 ? 252 ILE A O     1 
ATOM   1984 C  CB    . ILE A 1 255 ? 49.993 -18.231 10.582  1.00 13.38 ? 252 ILE A CB    1 
ATOM   1985 C  CG1   . ILE A 1 255 ? 50.768 -19.560 10.656  1.00 14.78 ? 252 ILE A CG1   1 
ATOM   1986 C  CG2   . ILE A 1 255 ? 49.029 -18.192 9.398   1.00 13.51 ? 252 ILE A CG2   1 
ATOM   1987 C  CD1   . ILE A 1 255 ? 49.979 -20.718 11.185  1.00 15.74 ? 252 ILE A CD1   1 
ATOM   1988 N  N     . ARG A 1 256 ? 49.779 -14.960 10.838  1.00 10.84 ? 253 ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 256 ? 49.087 -13.759 10.365  1.00 9.27  ? 253 ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 256 ? 50.026 -12.712 9.754   1.00 13.67 ? 253 ARG A C     1 
ATOM   1991 O  O     . ARG A 1 256 ? 49.565 -11.768 9.105   1.00 13.26 ? 253 ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 256 ? 48.288 -13.126 11.507  1.00 13.98 ? 253 ARG A CB    1 
ATOM   1993 C  CG    . ARG A 1 256 ? 49.165 -12.583 12.612  1.00 12.93 ? 253 ARG A CG    1 
ATOM   1994 C  CD    . ARG A 1 256 ? 48.352 -11.915 13.725  1.00 18.87 ? 253 ARG A CD    1 
ATOM   1995 N  NE    . ARG A 1 256 ? 49.241 -11.420 14.777  1.00 16.13 ? 253 ARG A NE    1 
ATOM   1996 C  CZ    . ARG A 1 256 ? 49.703 -12.162 15.782  1.00 18.16 ? 253 ARG A CZ    1 
ATOM   1997 N  NH1   . ARG A 1 256 ? 49.335 -13.438 15.900  1.00 17.57 ? 253 ARG A NH1   1 
ATOM   1998 N  NH2   . ARG A 1 256 ? 50.516 -11.617 16.686  1.00 18.86 ? 253 ARG A NH2   1 
ATOM   1999 N  N     . LYS A 1 257 ? 51.335 -12.861 9.957   1.00 11.74 ? 254 LYS A N     1 
ATOM   2000 C  CA    . LYS A 1 257 ? 52.268 -11.855 9.449   1.00 11.26 ? 254 LYS A CA    1 
ATOM   2001 C  C     . LYS A 1 257 ? 52.526 -12.002 7.957   1.00 12.23 ? 254 LYS A C     1 
ATOM   2002 O  O     . LYS A 1 257 ? 53.078 -11.093 7.332   1.00 15.55 ? 254 LYS A O     1 
ATOM   2003 C  CB    . LYS A 1 257 ? 53.602 -11.913 10.192  1.00 11.24 ? 254 LYS A CB    1 
ATOM   2004 C  CG    . LYS A 1 257 ? 53.482 -11.735 11.683  1.00 16.90 ? 254 LYS A CG    1 
ATOM   2005 C  CD    . LYS A 1 257 ? 52.822 -10.417 12.032  1.00 18.59 ? 254 LYS A CD    1 
ATOM   2006 C  CE    . LYS A 1 257 ? 52.835 -10.175 13.538  1.00 27.14 ? 254 LYS A CE    1 
ATOM   2007 N  NZ    . LYS A 1 257 ? 52.343 -8.801  13.880  1.00 30.84 ? 254 LYS A NZ    1 
ATOM   2008 N  N     . ILE A 1 258 ? 52.165 -13.151 7.388   1.00 11.48 ? 255 ILE A N     1 
ATOM   2009 C  CA    . ILE A 1 258 ? 52.453 -13.413 5.982   1.00 12.01 ? 255 ILE A CA    1 
ATOM   2010 C  C     . ILE A 1 258 ? 51.309 -12.870 5.136   1.00 10.55 ? 255 ILE A C     1 
ATOM   2011 O  O     . ILE A 1 258 ? 50.129 -13.067 5.471   1.00 13.25 ? 255 ILE A O     1 
ATOM   2012 C  CB    . ILE A 1 258 ? 52.658 -14.921 5.710   1.00 13.57 ? 255 ILE A CB    1 
ATOM   2013 C  CG1   . ILE A 1 258 ? 54.098 -15.323 6.038   1.00 20.88 ? 255 ILE A CG1   1 
ATOM   2014 C  CG2   . ILE A 1 258 ? 52.413 -15.255 4.255   1.00 13.84 ? 255 ILE A CG2   1 
ATOM   2015 C  CD1   . ILE A 1 258 ? 54.452 -15.235 7.484   1.00 25.00 ? 255 ILE A CD1   1 
ATOM   2016 N  N     . ARG A 1 259 ? 51.649 -12.189 4.045   1.00 13.49 ? 256 ARG A N     1 
ATOM   2017 C  CA    . ARG A 1 259 ? 50.644 -11.537 3.220   1.00 13.38 ? 256 ARG A CA    1 
ATOM   2018 C  C     . ARG A 1 259 ? 49.606 -12.527 2.687   1.00 16.19 ? 256 ARG A C     1 
ATOM   2019 O  O     . ARG A 1 259 ? 49.975 -13.561 2.123   1.00 14.64 ? 256 ARG A O     1 
ATOM   2020 C  CB    . ARG A 1 259 ? 51.314 -10.795 2.065   1.00 13.59 ? 256 ARG A CB    1 
ATOM   2021 C  CG    . ARG A 1 259 ? 50.403 -9.778  1.407   1.00 20.36 ? 256 ARG A CG    1 
ATOM   2022 C  CD    . ARG A 1 259 ? 50.098 -10.186 -0.007  1.00 35.83 ? 256 ARG A CD    1 
ATOM   2023 N  NE    . ARG A 1 259 ? 51.193 -9.841  -0.901  1.00 39.17 ? 256 ARG A NE    1 
ATOM   2024 C  CZ    . ARG A 1 259 ? 51.308 -10.291 -2.146  1.00 42.22 ? 256 ARG A CZ    1 
ATOM   2025 N  NH1   . ARG A 1 259 ? 50.391 -11.112 -2.645  1.00 47.36 ? 256 ARG A NH1   1 
ATOM   2026 N  NH2   . ARG A 1 259 ? 52.339 -9.915  -2.892  1.00 25.79 ? 256 ARG A NH2   1 
ATOM   2027 N  N     . SER A 1 260 ? 48.330 -12.175 2.902   1.00 12.21 ? 257 SER A N     1 
ATOM   2028 C  CA    . SER A 1 260 ? 47.112 -12.941 2.559   1.00 14.24 ? 257 SER A CA    1 
ATOM   2029 C  C     . SER A 1 260 ? 46.638 -13.822 3.719   1.00 14.98 ? 257 SER A C     1 
ATOM   2030 O  O     . SER A 1 260 ? 45.533 -14.348 3.665   1.00 13.31 ? 257 SER A O     1 
ATOM   2031 C  CB    . SER A 1 260 ? 47.286 -13.807 1.301   1.00 15.36 ? 257 SER A CB    1 
ATOM   2032 O  OG    . SER A 1 260 ? 47.898 -15.060 1.609   1.00 15.79 ? 257 SER A OG    1 
ATOM   2033 N  N     . LEU A 1 261 ? 47.455 -13.970 4.764   1.00 11.88 ? 258 LEU A N     1 
ATOM   2034 C  CA    . LEU A 1 261 ? 47.059 -14.779 5.923   1.00 12.57 ? 258 LEU A CA    1 
ATOM   2035 C  C     . LEU A 1 261 ? 46.654 -13.962 7.154   1.00 12.47 ? 258 LEU A C     1 
ATOM   2036 O  O     . LEU A 1 261 ? 46.482 -14.520 8.237   1.00 11.71 ? 258 LEU A O     1 
ATOM   2037 C  CB    . LEU A 1 261 ? 48.199 -15.749 6.300   1.00 10.17 ? 258 LEU A CB    1 
ATOM   2038 C  CG    . LEU A 1 261 ? 48.543 -16.745 5.183   1.00 11.03 ? 258 LEU A CG    1 
ATOM   2039 C  CD1   . LEU A 1 261 ? 49.641 -17.698 5.616   1.00 11.43 ? 258 LEU A CD1   1 
ATOM   2040 C  CD2   . LEU A 1 261 ? 47.310 -17.530 4.730   1.00 14.49 ? 258 LEU A CD2   1 
ATOM   2041 N  N     . GLY A 1 262 ? 46.467 -12.651 6.992   1.00 13.36 ? 259 GLY A N     1 
ATOM   2042 C  CA    . GLY A 1 262 ? 46.149 -11.790 8.121   1.00 14.60 ? 259 GLY A CA    1 
ATOM   2043 C  C     . GLY A 1 262 ? 44.678 -11.755 8.504   1.00 15.13 ? 259 GLY A C     1 
ATOM   2044 O  O     . GLY A 1 262 ? 44.308 -11.084 9.467   1.00 17.62 ? 259 GLY A O     1 
ATOM   2045 N  N     . GLY A 1 263 ? 43.841 -12.472 7.755   1.00 14.29 ? 260 GLY A N     1 
ATOM   2046 C  CA    . GLY A 1 263 ? 42.407 -12.477 8.006   1.00 14.73 ? 260 GLY A CA    1 
ATOM   2047 C  C     . GLY A 1 263 ? 41.815 -13.846 8.308   1.00 16.68 ? 260 GLY A C     1 
ATOM   2048 O  O     . GLY A 1 263 ? 42.412 -14.643 9.036   1.00 13.91 ? 260 GLY A O     1 
ATOM   2049 N  N     . LYS A 1 264 ? 40.642 -14.130 7.744   1.00 16.30 ? 261 LYS A N     1 
ATOM   2050 C  CA    . LYS A 1 264 ? 39.907 -15.340 8.101   1.00 16.15 ? 261 LYS A CA    1 
ATOM   2051 C  C     . LYS A 1 264 ? 40.650 -16.631 7.740   1.00 15.24 ? 261 LYS A C     1 
ATOM   2052 O  O     . LYS A 1 264 ? 40.649 -17.585 8.531   1.00 17.80 ? 261 LYS A O     1 
ATOM   2053 C  CB    . LYS A 1 264 ? 38.521 -15.328 7.441   1.00 16.49 ? 261 LYS A CB    1 
ATOM   2054 C  CG    . LYS A 1 264 ? 37.609 -14.251 8.015   1.00 23.61 ? 261 LYS A CG    1 
ATOM   2055 C  CD    . LYS A 1 264 ? 36.249 -14.228 7.305   1.00 24.70 ? 261 LYS A CD    1 
ATOM   2056 C  CE    . LYS A 1 264 ? 35.344 -13.144 7.877   1.00 40.84 ? 261 LYS A CE    1 
ATOM   2057 N  NZ    . LYS A 1 264 ? 34.019 -13.087 7.190   1.00 35.33 ? 261 LYS A NZ    1 
ATOM   2058 N  N     . LEU A 1 265 ? 41.281 -16.670 6.565   1.00 12.78 ? 262 LEU A N     1 
ATOM   2059 C  CA    . LEU A 1 265 ? 42.014 -17.866 6.154   1.00 13.00 ? 262 LEU A CA    1 
ATOM   2060 C  C     . LEU A 1 265 ? 43.123 -18.178 7.151   1.00 13.91 ? 262 LEU A C     1 
ATOM   2061 O  O     . LEU A 1 265 ? 43.263 -19.315 7.600   1.00 13.64 ? 262 LEU A O     1 
ATOM   2062 C  CB    . LEU A 1 265 ? 42.613 -17.712 4.752   1.00 13.00 ? 262 LEU A CB    1 
ATOM   2063 C  CG    . LEU A 1 265 ? 43.502 -18.867 4.284   1.00 15.26 ? 262 LEU A CG    1 
ATOM   2064 C  CD1   . LEU A 1 265 ? 42.685 -20.162 4.204   1.00 18.69 ? 262 LEU A CD1   1 
ATOM   2065 C  CD2   . LEU A 1 265 ? 44.120 -18.550 2.940   1.00 14.47 ? 262 LEU A CD2   1 
ATOM   2066 N  N     . GLY A 1 266 ? 43.911 -17.164 7.495   1.00 12.90 ? 263 GLY A N     1 
ATOM   2067 C  CA    . GLY A 1 266 ? 44.977 -17.358 8.465   1.00 11.03 ? 263 GLY A CA    1 
ATOM   2068 C  C     . GLY A 1 266 ? 44.459 -17.848 9.807   1.00 13.52 ? 263 GLY A C     1 
ATOM   2069 O  O     . GLY A 1 266 ? 45.055 -18.742 10.420  1.00 13.62 ? 263 GLY A O     1 
ATOM   2070 N  N     . ALA A 1 267 ? 43.344 -17.272 10.268  1.00 12.60 ? 264 ALA A N     1 
ATOM   2071 C  CA    . ALA A 1 267 ? 42.744 -17.727 11.513  1.00 14.61 ? 264 ALA A CA    1 
ATOM   2072 C  C     . ALA A 1 267 ? 42.315 -19.181 11.394  1.00 13.35 ? 264 ALA A C     1 
ATOM   2073 O  O     . ALA A 1 267 ? 42.428 -19.944 12.349  1.00 16.19 ? 264 ALA A O     1 
ATOM   2074 C  CB    . ALA A 1 267 ? 41.559 -16.836 11.901  1.00 17.28 ? 264 ALA A CB    1 
ATOM   2075 N  N     . SER A 1 268 ? 41.832 -19.576 10.220  1.00 12.84 ? 265 SER A N     1 
ATOM   2076 C  CA    . SER A 1 268 ? 41.381 -20.948 10.025  1.00 13.78 ? 265 SER A CA    1 
ATOM   2077 C  C     . SER A 1 268 ? 42.584 -21.908 10.010  1.00 13.58 ? 265 SER A C     1 
ATOM   2078 O  O     . SER A 1 268 ? 42.490 -23.026 10.522  1.00 14.42 ? 265 SER A O     1 
ATOM   2079 C  CB    . SER A 1 268 ? 40.557 -21.071 8.732   1.00 16.17 ? 265 SER A CB    1 
ATOM   2080 O  OG    A SER A 1 268 ? 39.626 -20.010 8.609   0.16 16.28 ? 265 SER A OG    1 
ATOM   2081 O  OG    B SER A 1 268 ? 41.364 -21.212 7.586   0.46 14.12 ? 265 SER A OG    1 
ATOM   2082 O  OG    C SER A 1 268 ? 40.114 -22.401 8.547   0.37 14.95 ? 265 SER A OG    1 
ATOM   2083 N  N     . VAL A 1 269 ? 43.715 -21.475 9.451   1.00 12.11 ? 266 VAL A N     1 
ATOM   2084 C  CA    . VAL A 1 269 ? 44.912 -22.317 9.448   1.00 13.55 ? 266 VAL A CA    1 
ATOM   2085 C  C     . VAL A 1 269 ? 45.312 -22.614 10.894  1.00 14.33 ? 266 VAL A C     1 
ATOM   2086 O  O     . VAL A 1 269 ? 45.557 -23.768 11.279  1.00 13.31 ? 266 VAL A O     1 
ATOM   2087 C  CB    . VAL A 1 269 ? 46.083 -21.653 8.684   1.00 13.01 ? 266 VAL A CB    1 
ATOM   2088 C  CG1   . VAL A 1 269 ? 47.360 -22.458 8.868   1.00 14.99 ? 266 VAL A CG1   1 
ATOM   2089 C  CG2   . VAL A 1 269 ? 45.743 -21.529 7.188   1.00 13.82 ? 266 VAL A CG2   1 
ATOM   2090 N  N     . ILE A 1 270 ? 45.316 -21.569 11.713  1.00 11.49 ? 267 ILE A N     1 
ATOM   2091 C  CA    . ILE A 1 270 ? 45.657 -21.683 13.125  1.00 13.18 ? 267 ILE A CA    1 
ATOM   2092 C  C     . ILE A 1 270 ? 44.692 -22.602 13.863  1.00 11.65 ? 267 ILE A C     1 
ATOM   2093 O  O     . ILE A 1 270 ? 45.128 -23.509 14.587  1.00 15.35 ? 267 ILE A O     1 
ATOM   2094 C  CB    . ILE A 1 270 ? 45.679 -20.283 13.771  1.00 13.86 ? 267 ILE A CB    1 
ATOM   2095 C  CG1   . ILE A 1 270 ? 46.855 -19.478 13.204  1.00 13.88 ? 267 ILE A CG1   1 
ATOM   2096 C  CG2   . ILE A 1 270 ? 45.749 -20.375 15.283  1.00 19.21 ? 267 ILE A CG2   1 
ATOM   2097 C  CD1   . ILE A 1 270 ? 46.778 -17.987 13.479  1.00 16.76 ? 267 ILE A CD1   1 
ATOM   2098 N  N     . GLU A 1 271 ? 43.388 -22.391 13.658  1.00 14.12 ? 268 GLU A N     1 
ATOM   2099 C  CA    . GLU A 1 271 ? 42.355 -23.150 14.367  1.00 15.17 ? 268 GLU A CA    1 
ATOM   2100 C  C     . GLU A 1 271 ? 42.312 -24.610 13.966  1.00 15.71 ? 268 GLU A C     1 
ATOM   2101 O  O     . GLU A 1 271 ? 42.298 -25.501 14.818  1.00 18.43 ? 268 GLU A O     1 
ATOM   2102 C  CB    . GLU A 1 271 ? 40.978 -22.527 14.132  1.00 22.59 ? 268 GLU A CB    1 
ATOM   2103 C  CG    . GLU A 1 271 ? 39.846 -23.223 14.889  1.00 36.23 ? 268 GLU A CG    1 
ATOM   2104 C  CD    . GLU A 1 271 ? 38.508 -22.534 14.698  1.00 45.34 ? 268 GLU A CD    1 
ATOM   2105 O  OE1   . GLU A 1 271 ? 38.451 -21.543 13.935  1.00 54.94 ? 268 GLU A OE1   1 
ATOM   2106 O  OE2   . GLU A 1 271 ? 37.517 -22.970 15.321  1.00 46.71 ? 268 GLU A OE2   1 
ATOM   2107 N  N     . ILE A 1 272 ? 42.271 -24.851 12.663  1.00 15.91 ? 269 ILE A N     1 
ATOM   2108 C  CA    . ILE A 1 272 ? 42.075 -26.197 12.153  1.00 14.55 ? 269 ILE A CA    1 
ATOM   2109 C  C     . ILE A 1 272 ? 43.293 -27.070 12.401  1.00 15.41 ? 269 ILE A C     1 
ATOM   2110 O  O     . ILE A 1 272 ? 43.175 -28.248 12.746  1.00 18.38 ? 269 ILE A O     1 
ATOM   2111 C  CB    . ILE A 1 272 ? 41.747 -26.173 10.645  1.00 16.54 ? 269 ILE A CB    1 
ATOM   2112 C  CG1   . ILE A 1 272 ? 40.350 -25.588 10.421  1.00 18.55 ? 269 ILE A CG1   1 
ATOM   2113 C  CG2   . ILE A 1 272 ? 41.843 -27.567 10.051  1.00 15.16 ? 269 ILE A CG2   1 
ATOM   2114 C  CD1   . ILE A 1 272 ? 39.957 -25.506 8.973   1.00 22.17 ? 269 ILE A CD1   1 
ATOM   2115 N  N     . LEU A 1 273 ? 44.478 -26.494 12.241  1.00 15.70 ? 270 LEU A N     1 
ATOM   2116 C  CA    . LEU A 1 273 ? 45.688 -27.295 12.353  1.00 15.48 ? 270 LEU A CA    1 
ATOM   2117 C  C     . LEU A 1 273 ? 46.292 -27.251 13.751  1.00 14.58 ? 270 LEU A C     1 
ATOM   2118 O  O     . LEU A 1 273 ? 47.164 -28.060 14.077  1.00 14.90 ? 270 LEU A O     1 
ATOM   2119 C  CB    . LEU A 1 273 ? 46.711 -26.834 11.326  1.00 15.10 ? 270 LEU A CB    1 
ATOM   2120 C  CG    . LEU A 1 273 ? 46.284 -26.941 9.865   1.00 14.45 ? 270 LEU A CG    1 
ATOM   2121 C  CD1   . LEU A 1 273 ? 47.418 -26.466 8.972   1.00 15.93 ? 270 LEU A CD1   1 
ATOM   2122 C  CD2   . LEU A 1 273 ? 45.907 -28.385 9.543   1.00 19.22 ? 270 LEU A CD2   1 
ATOM   2123 N  N     . GLY A 1 274 ? 45.834 -26.308 14.575  1.00 13.70 ? 271 GLY A N     1 
ATOM   2124 C  CA    . GLY A 1 274 ? 46.334 -26.173 15.935  1.00 12.73 ? 271 GLY A CA    1 
ATOM   2125 C  C     . GLY A 1 274 ? 47.795 -25.779 16.003  1.00 18.11 ? 271 GLY A C     1 
ATOM   2126 O  O     . GLY A 1 274 ? 48.555 -26.292 16.838  1.00 19.69 ? 271 GLY A O     1 
ATOM   2127 N  N     . ILE A 1 275 ? 48.187 -24.855 15.131  1.00 13.85 ? 272 ILE A N     1 
ATOM   2128 C  CA    . ILE A 1 275 ? 49.559 -24.347 15.087  1.00 14.37 ? 272 ILE A CA    1 
ATOM   2129 C  C     . ILE A 1 275 ? 49.568 -22.825 15.243  1.00 11.88 ? 272 ILE A C     1 
ATOM   2130 O  O     . ILE A 1 275 ? 48.511 -22.194 15.208  1.00 15.69 ? 272 ILE A O     1 
ATOM   2131 C  CB    . ILE A 1 275 ? 50.261 -24.735 13.767  1.00 12.91 ? 272 ILE A CB    1 
ATOM   2132 C  CG1   . ILE A 1 275 ? 49.512 -24.157 12.561  1.00 14.26 ? 272 ILE A CG1   1 
ATOM   2133 C  CG2   . ILE A 1 275 ? 50.365 -26.252 13.647  1.00 12.02 ? 272 ILE A CG2   1 
ATOM   2134 C  CD1   . ILE A 1 275 ? 50.230 -24.403 11.223  1.00 12.30 ? 272 ILE A CD1   1 
ATOM   2135 N  N     . GLU A 1 276 ? 50.750 -22.232 15.403  1.00 12.21 ? 273 GLU A N     1 
ATOM   2136 C  CA    . GLU A 1 276 ? 50.865 -20.783 15.573  1.00 12.05 ? 273 GLU A CA    1 
ATOM   2137 C  C     . GLU A 1 276 ? 51.802 -20.134 14.556  1.00 11.17 ? 273 GLU A C     1 
ATOM   2138 O  O     . GLU A 1 276 ? 51.616 -18.977 14.204  1.00 13.38 ? 273 GLU A O     1 
ATOM   2139 C  CB    . GLU A 1 276 ? 51.367 -20.438 16.982  1.00 13.66 ? 273 GLU A CB    1 
ATOM   2140 C  CG    . GLU A 1 276 ? 50.439 -20.889 18.122  1.00 18.69 ? 273 GLU A CG    1 
ATOM   2141 C  CD    . GLU A 1 276 ? 51.065 -20.727 19.508  1.00 29.55 ? 273 GLU A CD    1 
ATOM   2142 O  OE1   . GLU A 1 276 ? 50.773 -21.563 20.392  1.00 40.00 ? 273 GLU A OE1   1 
ATOM   2143 O  OE2   . GLU A 1 276 ? 51.840 -19.770 19.721  1.00 31.97 ? 273 GLU A OE2   1 
ATOM   2144 N  N     . TYR A 1 277 ? 52.826 -20.869 14.129  1.00 11.00 ? 274 TYR A N     1 
ATOM   2145 C  CA    . TYR A 1 277 ? 53.922 -20.282 13.352  1.00 10.58 ? 274 TYR A CA    1 
ATOM   2146 C  C     . TYR A 1 277 ? 53.999 -20.843 11.943  1.00 10.66 ? 274 TYR A C     1 
ATOM   2147 O  O     . TYR A 1 277 ? 53.672 -22.011 11.695  1.00 10.45 ? 274 TYR A O     1 
ATOM   2148 C  CB    . TYR A 1 277 ? 55.268 -20.507 14.057  1.00 11.52 ? 274 TYR A CB    1 
ATOM   2149 C  CG    . TYR A 1 277 ? 55.276 -19.997 15.483  1.00 11.21 ? 274 TYR A CG    1 
ATOM   2150 C  CD1   . TYR A 1 277 ? 55.497 -20.858 16.550  1.00 12.63 ? 274 TYR A CD1   1 
ATOM   2151 C  CD2   . TYR A 1 277 ? 55.018 -18.664 15.755  1.00 11.13 ? 274 TYR A CD2   1 
ATOM   2152 C  CE1   . TYR A 1 277 ? 55.486 -20.397 17.856  1.00 13.11 ? 274 TYR A CE1   1 
ATOM   2153 C  CE2   . TYR A 1 277 ? 55.000 -18.189 17.058  1.00 14.35 ? 274 TYR A CE2   1 
ATOM   2154 C  CZ    . TYR A 1 277 ? 55.230 -19.069 18.107  1.00 16.10 ? 274 TYR A CZ    1 
ATOM   2155 O  OH    . TYR A 1 277 ? 55.214 -18.625 19.414  1.00 17.39 ? 274 TYR A OH    1 
ATOM   2156 N  N     . MET A 1 278 ? 54.467 -20.008 11.024  1.00 8.61  ? 275 MET A N     1 
ATOM   2157 C  CA    . MET A 1 278 ? 54.535 -20.384 9.627   1.00 10.54 ? 275 MET A CA    1 
ATOM   2158 C  C     . MET A 1 278 ? 55.309 -21.687 9.433   1.00 10.79 ? 275 MET A C     1 
ATOM   2159 O  O     . MET A 1 278 ? 54.915 -22.545 8.635   1.00 10.96 ? 275 MET A O     1 
ATOM   2160 C  CB    . MET A 1 278 ? 55.182 -19.253 8.822   1.00 14.95 ? 275 MET A CB    1 
ATOM   2161 C  CG    . MET A 1 278 ? 54.843 -19.273 7.354   1.00 15.01 ? 275 MET A CG    1 
ATOM   2162 S  SD    . MET A 1 278 ? 53.081 -19.048 7.018   1.00 16.90 ? 275 MET A SD    1 
ATOM   2163 C  CE    . MET A 1 278 ? 53.084 -19.562 5.304   1.00 23.86 ? 275 MET A CE    1 
ATOM   2164 N  N     . GLY A 1 279 ? 56.412 -21.839 10.165  1.00 9.78  ? 276 GLY A N     1 
ATOM   2165 C  CA    . GLY A 1 279 ? 57.262 -23.003 9.975   1.00 10.21 ? 276 GLY A CA    1 
ATOM   2166 C  C     . GLY A 1 279 ? 56.558 -24.309 10.309  1.00 11.82 ? 276 GLY A C     1 
ATOM   2167 O  O     . GLY A 1 279 ? 56.893 -25.372 9.763   1.00 12.13 ? 276 GLY A O     1 
ATOM   2168 N  N     . GLU A 1 280 ? 55.574 -24.252 11.207  1.00 10.81 ? 277 GLU A N     1 
ATOM   2169 C  CA    . GLU A 1 280 ? 54.874 -25.468 11.595  1.00 10.64 ? 277 GLU A CA    1 
ATOM   2170 C  C     . GLU A 1 280 ? 54.081 -26.072 10.448  1.00 10.65 ? 277 GLU A C     1 
ATOM   2171 O  O     . GLU A 1 280 ? 53.704 -27.241 10.513  1.00 10.73 ? 277 GLU A O     1 
ATOM   2172 C  CB    . GLU A 1 280 ? 53.920 -25.211 12.768  1.00 10.41 ? 277 GLU A CB    1 
ATOM   2173 C  CG    . GLU A 1 280 ? 54.615 -24.895 14.078  1.00 10.56 ? 277 GLU A CG    1 
ATOM   2174 C  CD    . GLU A 1 280 ? 53.619 -24.625 15.177  1.00 15.30 ? 277 GLU A CD    1 
ATOM   2175 O  OE1   . GLU A 1 280 ? 53.243 -23.456 15.348  1.00 14.73 ? 277 GLU A OE1   1 
ATOM   2176 O  OE2   . GLU A 1 280 ? 53.200 -25.584 15.854  1.00 16.47 ? 277 GLU A OE2   1 
ATOM   2177 N  N     . LEU A 1 281 ? 53.812 -25.290 9.408   1.00 9.56  ? 278 LEU A N     1 
ATOM   2178 C  CA    . LEU A 1 281 ? 53.089 -25.813 8.251   1.00 9.06  ? 278 LEU A CA    1 
ATOM   2179 C  C     . LEU A 1 281 ? 53.861 -26.899 7.506   1.00 9.48  ? 278 LEU A C     1 
ATOM   2180 O  O     . LEU A 1 281 ? 53.252 -27.662 6.746   1.00 10.37 ? 278 LEU A O     1 
ATOM   2181 C  CB    . LEU A 1 281 ? 52.743 -24.682 7.277   1.00 10.48 ? 278 LEU A CB    1 
ATOM   2182 C  CG    . LEU A 1 281 ? 51.527 -23.848 7.675   1.00 11.20 ? 278 LEU A CG    1 
ATOM   2183 C  CD1   . LEU A 1 281 ? 51.534 -22.493 6.929   1.00 13.14 ? 278 LEU A CD1   1 
ATOM   2184 C  CD2   . LEU A 1 281 ? 50.243 -24.623 7.391   1.00 13.80 ? 278 LEU A CD2   1 
ATOM   2185 N  N     . THR A 1 282 ? 55.184 -26.967 7.675   1.00 10.43 ? 279 THR A N     1 
ATOM   2186 C  CA    . THR A 1 282 ? 55.960 -27.938 6.890   1.00 12.87 ? 279 THR A CA    1 
ATOM   2187 C  C     . THR A 1 282 ? 55.588 -29.387 7.215   1.00 11.97 ? 279 THR A C     1 
ATOM   2188 O  O     . THR A 1 282 ? 55.838 -30.275 6.419   1.00 12.56 ? 279 THR A O     1 
ATOM   2189 C  CB    . THR A 1 282 ? 57.492 -27.784 7.076   1.00 10.67 ? 279 THR A CB    1 
ATOM   2190 O  OG1   . THR A 1 282 ? 57.863 -28.056 8.440   1.00 13.35 ? 279 THR A OG1   1 
ATOM   2191 C  CG2   . THR A 1 282 ? 57.966 -26.378 6.664   1.00 10.90 ? 279 THR A CG2   1 
ATOM   2192 N  N     . GLN A 1 283 ? 54.977 -29.614 8.372   1.00 12.26 ? 280 GLN A N     1 
ATOM   2193 C  CA    . GLN A 1 283 ? 54.644 -30.981 8.790   1.00 12.05 ? 280 GLN A CA    1 
ATOM   2194 C  C     . GLN A 1 283 ? 53.356 -31.548 8.194   1.00 16.65 ? 280 GLN A C     1 
ATOM   2195 O  O     . GLN A 1 283 ? 52.916 -32.627 8.581   1.00 22.47 ? 280 GLN A O     1 
ATOM   2196 C  CB    . GLN A 1 283 ? 54.563 -31.014 10.309  1.00 14.71 ? 280 GLN A CB    1 
ATOM   2197 C  CG    A GLN A 1 283 ? 53.309 -30.385 10.831  0.45 13.83 ? 280 GLN A CG    1 
ATOM   2198 C  CG    B GLN A 1 283 ? 55.917 -30.715 10.891  0.55 11.42 ? 280 GLN A CG    1 
ATOM   2199 C  CD    A GLN A 1 283 ? 53.341 -30.161 12.323  0.45 21.48 ? 280 GLN A CD    1 
ATOM   2200 C  CD    B GLN A 1 283 ? 56.972 -31.589 10.245  0.55 14.13 ? 280 GLN A CD    1 
ATOM   2201 O  OE1   A GLN A 1 283 ? 53.688 -31.060 13.097  0.45 26.23 ? 280 GLN A OE1   1 
ATOM   2202 O  OE1   B GLN A 1 283 ? 56.968 -32.802 10.430  0.55 13.41 ? 280 GLN A OE1   1 
ATOM   2203 N  NE2   A GLN A 1 283 ? 52.974 -28.955 12.740  0.45 11.14 ? 280 GLN A NE2   1 
ATOM   2204 N  NE2   B GLN A 1 283 ? 57.847 -30.987 9.439   0.55 13.53 ? 280 GLN A NE2   1 
ATOM   2205 N  N     . PHE A 1 284 ? 52.753 -30.827 7.260   1.00 11.10 ? 281 PHE A N     1 
ATOM   2206 C  CA    . PHE A 1 284 ? 51.545 -31.299 6.596   1.00 11.74 ? 281 PHE A CA    1 
ATOM   2207 C  C     . PHE A 1 284 ? 51.823 -31.615 5.132   1.00 13.94 ? 281 PHE A C     1 
ATOM   2208 O  O     . PHE A 1 284 ? 52.655 -30.968 4.497   1.00 14.41 ? 281 PHE A O     1 
ATOM   2209 C  CB    . PHE A 1 284 ? 50.436 -30.264 6.729   1.00 11.94 ? 281 PHE A CB    1 
ATOM   2210 C  CG    . PHE A 1 284 ? 50.069 -29.985 8.155   1.00 12.71 ? 281 PHE A CG    1 
ATOM   2211 C  CD1   . PHE A 1 284 ? 49.146 -30.782 8.814   1.00 16.45 ? 281 PHE A CD1   1 
ATOM   2212 C  CD2   . PHE A 1 284 ? 50.692 -28.971 8.862   1.00 12.74 ? 281 PHE A CD2   1 
ATOM   2213 C  CE1   . PHE A 1 284 ? 48.820 -30.540 10.143  1.00 16.56 ? 281 PHE A CE1   1 
ATOM   2214 C  CE2   . PHE A 1 284 ? 50.373 -28.731 10.185  1.00 14.28 ? 281 PHE A CE2   1 
ATOM   2215 C  CZ    . PHE A 1 284 ? 49.441 -29.518 10.829  1.00 16.79 ? 281 PHE A CZ    1 
ATOM   2216 N  N     . THR A 1 285 ? 51.148 -32.622 4.589   1.00 12.81 ? 282 THR A N     1 
ATOM   2217 C  CA    . THR A 1 285 ? 51.331 -32.897 3.170   1.00 13.52 ? 282 THR A CA    1 
ATOM   2218 C  C     . THR A 1 285 ? 50.598 -31.855 2.349   1.00 9.92  ? 282 THR A C     1 
ATOM   2219 O  O     . THR A 1 285 ? 49.697 -31.188 2.851   1.00 11.22 ? 282 THR A O     1 
ATOM   2220 C  CB    . THR A 1 285 ? 50.816 -34.280 2.763   1.00 11.11 ? 282 THR A CB    1 
ATOM   2221 O  OG1   . THR A 1 285 ? 49.394 -34.321 2.915   1.00 15.12 ? 282 THR A OG1   1 
ATOM   2222 C  CG2   . THR A 1 285 ? 51.462 -35.355 3.612   1.00 16.13 ? 282 THR A CG2   1 
ATOM   2223 N  N     . GLU A 1 286 ? 50.968 -31.737 1.080   1.00 12.08 ? 283 GLU A N     1 
ATOM   2224 C  CA    . GLU A 1 286 ? 50.253 -30.843 0.187   1.00 13.22 ? 283 GLU A CA    1 
ATOM   2225 C  C     . GLU A 1 286 ? 48.769 -31.216 0.135   1.00 11.55 ? 283 GLU A C     1 
ATOM   2226 O  O     . GLU A 1 286 ? 47.897 -30.338 0.221   1.00 11.05 ? 283 GLU A O     1 
ATOM   2227 C  CB    . GLU A 1 286 ? 50.878 -30.854 -1.213  1.00 14.44 ? 283 GLU A CB    1 
ATOM   2228 C  CG    . GLU A 1 286 ? 50.312 -29.758 -2.091  1.00 13.04 ? 283 GLU A CG    1 
ATOM   2229 C  CD    . GLU A 1 286 ? 51.042 -29.614 -3.410  1.00 21.80 ? 283 GLU A CD    1 
ATOM   2230 O  OE1   . GLU A 1 286 ? 51.998 -30.371 -3.654  1.00 23.82 ? 283 GLU A OE1   1 
ATOM   2231 O  OE2   . GLU A 1 286 ? 50.656 -28.724 -4.201  1.00 20.46 ? 283 GLU A OE2   1 
ATOM   2232 N  N     . SER A 1 287 ? 48.478 -32.518 0.042   1.00 12.59 ? 284 SER A N     1 
ATOM   2233 C  CA    . SER A 1 287 ? 47.086 -32.961 -0.008  1.00 13.67 ? 284 SER A CA    1 
ATOM   2234 C  C     . SER A 1 287 ? 46.342 -32.615 1.277   1.00 10.54 ? 284 SER A C     1 
ATOM   2235 O  O     . SER A 1 287 ? 45.155 -32.258 1.239   1.00 12.76 ? 284 SER A O     1 
ATOM   2236 C  CB    . SER A 1 287 ? 47.005 -34.471 -0.269  1.00 15.35 ? 284 SER A CB    1 
ATOM   2237 O  OG    A SER A 1 287 ? 47.562 -34.781 -1.529  0.80 19.80 ? 284 SER A OG    1 
ATOM   2238 O  OG    B SER A 1 287 ? 47.744 -35.196 0.697   0.20 14.38 ? 284 SER A OG    1 
ATOM   2239 N  N     . GLN A 1 288 ? 47.035 -32.708 2.417   1.00 11.32 ? 285 GLN A N     1 
ATOM   2240 C  CA    . GLN A 1 288 ? 46.404 -32.344 3.678   1.00 11.06 ? 285 GLN A CA    1 
ATOM   2241 C  C     . GLN A 1 288 ? 46.010 -30.867 3.667   1.00 10.73 ? 285 GLN A C     1 
ATOM   2242 O  O     . GLN A 1 288 ? 44.897 -30.494 4.034   1.00 13.78 ? 285 GLN A O     1 
ATOM   2243 C  CB    . GLN A 1 288 ? 47.331 -32.633 4.857   1.00 9.89  ? 285 GLN A CB    1 
ATOM   2244 C  CG    . GLN A 1 288 ? 47.268 -34.045 5.367   1.00 16.92 ? 285 GLN A CG    1 
ATOM   2245 C  CD    . GLN A 1 288 ? 48.211 -34.254 6.535   1.00 21.29 ? 285 GLN A CD    1 
ATOM   2246 O  OE1   . GLN A 1 288 ? 49.381 -33.875 6.476   1.00 16.74 ? 285 GLN A OE1   1 
ATOM   2247 N  NE2   . GLN A 1 288 ? 47.697 -34.839 7.617   1.00 24.37 ? 285 GLN A NE2   1 
ATOM   2248 N  N     . LEU A 1 289 ? 46.927 -30.020 3.224   1.00 11.82 ? 286 LEU A N     1 
ATOM   2249 C  CA    . LEU A 1 289 ? 46.622 -28.597 3.204   1.00 11.21 ? 286 LEU A CA    1 
ATOM   2250 C  C     . LEU A 1 289 ? 45.514 -28.281 2.200   1.00 13.04 ? 286 LEU A C     1 
ATOM   2251 O  O     . LEU A 1 289 ? 44.634 -27.457 2.472   1.00 13.93 ? 286 LEU A O     1 
ATOM   2252 C  CB    . LEU A 1 289 ? 47.874 -27.788 2.894   1.00 10.08 ? 286 LEU A CB    1 
ATOM   2253 C  CG    . LEU A 1 289 ? 48.943 -27.886 3.987   1.00 11.38 ? 286 LEU A CG    1 
ATOM   2254 C  CD1   . LEU A 1 289 ? 50.209 -27.170 3.522   1.00 11.81 ? 286 LEU A CD1   1 
ATOM   2255 C  CD2   . LEU A 1 289 ? 48.435 -27.351 5.339   1.00 13.97 ? 286 LEU A CD2   1 
ATOM   2256 N  N     . GLN A 1 290 ? 45.556 -28.932 1.042   1.00 13.33 ? 287 GLN A N     1 
ATOM   2257 C  CA    . GLN A 1 290 ? 44.499 -28.745 0.056   1.00 14.76 ? 287 GLN A CA    1 
ATOM   2258 C  C     . GLN A 1 290 ? 43.143 -29.212 0.578   1.00 14.24 ? 287 GLN A C     1 
ATOM   2259 O  O     . GLN A 1 290 ? 42.109 -28.621 0.265   1.00 15.33 ? 287 GLN A O     1 
ATOM   2260 C  CB    . GLN A 1 290 ? 44.841 -29.486 -1.230  1.00 14.19 ? 287 GLN A CB    1 
ATOM   2261 C  CG    . GLN A 1 290 ? 46.004 -28.890 -1.992  1.00 14.95 ? 287 GLN A CG    1 
ATOM   2262 C  CD    . GLN A 1 290 ? 46.364 -29.726 -3.187  1.00 15.68 ? 287 GLN A CD    1 
ATOM   2263 O  OE1   . GLN A 1 290 ? 46.353 -30.954 -3.118  1.00 17.31 ? 287 GLN A OE1   1 
ATOM   2264 N  NE2   . GLN A 1 290 ? 46.701 -29.069 -4.293  1.00 19.14 ? 287 GLN A NE2   1 
ATOM   2265 N  N     . SER A 1 291 ? 43.137 -30.265 1.384   1.00 12.72 ? 288 SER A N     1 
ATOM   2266 C  CA    A SER A 1 291 ? 41.875 -30.761 1.929   0.62 12.74 ? 288 SER A CA    1 
ATOM   2267 C  CA    B SER A 1 291 ? 41.975 -30.761 1.929   0.38 12.79 ? 288 SER A CA    1 
ATOM   2268 C  C     . SER A 1 291 ? 41.196 -29.720 2.822   1.00 16.39 ? 288 SER A C     1 
ATOM   2269 O  O     . SER A 1 291 ? 39.971 -29.603 2.826   1.00 23.82 ? 288 SER A O     1 
ATOM   2270 C  CB    A SER A 1 291 ? 42.078 -32.077 2.699   0.62 13.90 ? 288 SER A CB    1 
ATOM   2271 C  CB    B SER A 1 291 ? 42.178 -32.078 2.699   0.38 13.92 ? 288 SER A CB    1 
ATOM   2272 O  OG    A SER A 1 291 ? 42.654 -31.855 3.986   0.62 13.24 ? 288 SER A OG    1 
ATOM   2273 O  OG    B SER A 1 291 ? 40.963 -32.539 3.289   0.38 18.49 ? 288 SER A OG    1 
ATOM   2274 N  N     . HIS A 1 292 ? 41.977 -28.945 3.569   1.00 15.08 ? 289 HIS A N     1 
ATOM   2275 C  CA    . HIS A 1 292 ? 41.378 -27.964 4.464   1.00 15.72 ? 289 HIS A CA    1 
ATOM   2276 C  C     . HIS A 1 292 ? 41.124 -26.618 3.807   1.00 17.81 ? 289 HIS A C     1 
ATOM   2277 O  O     . HIS A 1 292 ? 40.147 -25.948 4.123   1.00 21.13 ? 289 HIS A O     1 
ATOM   2278 C  CB    . HIS A 1 292 ? 42.261 -27.728 5.683   1.00 15.74 ? 289 HIS A CB    1 
ATOM   2279 C  CG    . HIS A 1 292 ? 42.457 -28.932 6.544   1.00 15.89 ? 289 HIS A CG    1 
ATOM   2280 N  ND1   . HIS A 1 292 ? 41.439 -29.495 7.284   1.00 26.67 ? 289 HIS A ND1   1 
ATOM   2281 C  CD2   . HIS A 1 292 ? 43.567 -29.654 6.814   1.00 20.09 ? 289 HIS A CD2   1 
ATOM   2282 C  CE1   . HIS A 1 292 ? 41.913 -30.526 7.961   1.00 20.12 ? 289 HIS A CE1   1 
ATOM   2283 N  NE2   . HIS A 1 292 ? 43.200 -30.644 7.695   1.00 26.75 ? 289 HIS A NE2   1 
ATOM   2284 N  N     . PHE A 1 293 ? 42.017 -26.202 2.912   1.00 14.03 ? 290 PHE A N     1 
ATOM   2285 C  CA    . PHE A 1 293 ? 42.014 -24.808 2.478   1.00 17.40 ? 290 PHE A CA    1 
ATOM   2286 C  C     . PHE A 1 293 ? 41.759 -24.637 0.982   1.00 17.93 ? 290 PHE A C     1 
ATOM   2287 O  O     . PHE A 1 293 ? 41.764 -23.516 0.467   1.00 17.36 ? 290 PHE A O     1 
ATOM   2288 C  CB    . PHE A 1 293 ? 43.342 -24.169 2.911   1.00 13.50 ? 290 PHE A CB    1 
ATOM   2289 C  CG    . PHE A 1 293 ? 43.652 -24.413 4.368   1.00 13.19 ? 290 PHE A CG    1 
ATOM   2290 C  CD1   . PHE A 1 293 ? 42.814 -23.906 5.359   1.00 15.07 ? 290 PHE A CD1   1 
ATOM   2291 C  CD2   . PHE A 1 293 ? 44.744 -25.174 4.751   1.00 12.54 ? 290 PHE A CD2   1 
ATOM   2292 C  CE1   . PHE A 1 293 ? 43.059 -24.160 6.696   1.00 14.13 ? 290 PHE A CE1   1 
ATOM   2293 C  CE2   . PHE A 1 293 ? 45.002 -25.426 6.099   1.00 13.35 ? 290 PHE A CE2   1 
ATOM   2294 C  CZ    . PHE A 1 293 ? 44.163 -24.917 7.064   1.00 13.86 ? 290 PHE A CZ    1 
ATOM   2295 N  N     . GLY A 1 294 ? 41.496 -25.747 0.296   1.00 16.85 ? 291 GLY A N     1 
ATOM   2296 C  CA    . GLY A 1 294 ? 41.265 -25.713 -1.131  1.00 16.71 ? 291 GLY A CA    1 
ATOM   2297 C  C     . GLY A 1 294 ? 42.524 -25.998 -1.909  1.00 16.39 ? 291 GLY A C     1 
ATOM   2298 O  O     . GLY A 1 294 ? 43.640 -25.845 -1.397  1.00 15.33 ? 291 GLY A O     1 
ATOM   2299 N  N     . GLU A 1 295 ? 42.343 -26.399 -3.163  1.00 14.75 ? 292 GLU A N     1 
ATOM   2300 C  CA    . GLU A 1 295 ? 43.450 -26.751 -4.032  1.00 15.64 ? 292 GLU A CA    1 
ATOM   2301 C  C     . GLU A 1 295 ? 44.492 -25.642 -4.162  1.00 15.23 ? 292 GLU A C     1 
ATOM   2302 O  O     . GLU A 1 295 ? 45.683 -25.887 -3.977  1.00 14.26 ? 292 GLU A O     1 
ATOM   2303 C  CB    . GLU A 1 295 ? 42.912 -27.129 -5.414  1.00 20.02 ? 292 GLU A CB    1 
ATOM   2304 C  CG    . GLU A 1 295 ? 43.944 -27.720 -6.331  1.00 21.89 ? 292 GLU A CG    1 
ATOM   2305 C  CD    . GLU A 1 295 ? 43.329 -28.305 -7.589  1.00 42.86 ? 292 GLU A CD    1 
ATOM   2306 O  OE1   . GLU A 1 295 ? 44.068 -28.937 -8.376  1.00 54.08 ? 292 GLU A OE1   1 
ATOM   2307 O  OE2   . GLU A 1 295 ? 42.102 -28.153 -7.782  1.00 29.20 ? 292 GLU A OE2   1 
ATOM   2308 N  N     . LYS A 1 296 ? 44.043 -24.424 -4.460  1.00 16.03 ? 293 LYS A N     1 
ATOM   2309 C  CA    . LYS A 1 296 ? 44.955 -23.310 -4.710  1.00 13.02 ? 293 LYS A CA    1 
ATOM   2310 C  C     . LYS A 1 296 ? 45.678 -22.889 -3.426  1.00 14.29 ? 293 LYS A C     1 
ATOM   2311 O  O     . LYS A 1 296 ? 46.914 -22.814 -3.391  1.00 14.85 ? 293 LYS A O     1 
ATOM   2312 C  CB    . LYS A 1 296 ? 44.184 -22.122 -5.309  1.00 16.29 ? 293 LYS A CB    1 
ATOM   2313 C  CG    . LYS A 1 296 ? 45.035 -20.917 -5.644  1.00 28.69 ? 293 LYS A CG    1 
ATOM   2314 C  CD    . LYS A 1 296 ? 44.273 -19.934 -6.530  1.00 33.13 ? 293 LYS A CD    1 
ATOM   2315 C  CE    . LYS A 1 296 ? 44.607 -18.490 -6.169  1.00 36.35 ? 293 LYS A CE    1 
ATOM   2316 N  NZ    . LYS A 1 296 ? 44.011 -18.108 -4.854  1.00 39.35 ? 293 LYS A NZ    1 
ATOM   2317 N  N     . ASN A 1 297 ? 44.911 -22.639 -2.374  1.00 14.51 ? 294 ASN A N     1 
ATOM   2318 C  CA    . ASN A 1 297 ? 45.507 -22.230 -1.095  1.00 11.99 ? 294 ASN A CA    1 
ATOM   2319 C  C     . ASN A 1 297 ? 46.427 -23.301 -0.531  1.00 12.59 ? 294 ASN A C     1 
ATOM   2320 O  O     . ASN A 1 297 ? 47.487 -22.986 0.009   1.00 11.82 ? 294 ASN A O     1 
ATOM   2321 C  CB    . ASN A 1 297 ? 44.431 -21.923 -0.056  1.00 18.02 ? 294 ASN A CB    1 
ATOM   2322 C  CG    . ASN A 1 297 ? 43.717 -20.626 -0.311  1.00 20.45 ? 294 ASN A CG    1 
ATOM   2323 O  OD1   . ASN A 1 297 ? 44.253 -19.714 -0.942  1.00 20.89 ? 294 ASN A OD1   1 
ATOM   2324 N  ND2   . ASN A 1 297 ? 42.487 -20.533 0.184   1.00 22.19 ? 294 ASN A ND2   1 
ATOM   2325 N  N     . GLY A 1 298 ? 45.999 -24.561 -0.616  1.00 14.18 ? 295 GLY A N     1 
ATOM   2326 C  CA    . GLY A 1 298 ? 46.793 -25.670 -0.095  1.00 12.49 ? 295 GLY A CA    1 
ATOM   2327 C  C     . GLY A 1 298 ? 48.158 -25.779 -0.761  1.00 11.37 ? 295 GLY A C     1 
ATOM   2328 O  O     . GLY A 1 298 ? 49.183 -25.946 -0.090  1.00 11.82 ? 295 GLY A O     1 
ATOM   2329 N  N     . SER A 1 299 ? 48.188 -25.690 -2.089  1.00 9.66  ? 296 SER A N     1 
ATOM   2330 C  CA    . SER A 1 299 ? 49.436 -25.713 -2.834  1.00 10.11 ? 296 SER A CA    1 
ATOM   2331 C  C     . SER A 1 299 ? 50.282 -24.494 -2.491  1.00 12.30 ? 296 SER A C     1 
ATOM   2332 O  O     . SER A 1 299 ? 51.493 -24.614 -2.316  1.00 11.97 ? 296 SER A O     1 
ATOM   2333 C  CB    . SER A 1 299 ? 49.159 -25.765 -4.340  1.00 14.29 ? 296 SER A CB    1 
ATOM   2334 O  OG    . SER A 1 299 ? 48.739 -27.067 -4.702  1.00 16.52 ? 296 SER A OG    1 
ATOM   2335 N  N     . TRP A 1 300 ? 49.634 -23.336 -2.379  1.00 11.99 ? 297 TRP A N     1 
ATOM   2336 C  CA    . TRP A 1 300 ? 50.344 -22.106 -2.043  1.00 9.35  ? 297 TRP A CA    1 
ATOM   2337 C  C     . TRP A 1 300 ? 50.971 -22.207 -0.653  1.00 10.12 ? 297 TRP A C     1 
ATOM   2338 O  O     . TRP A 1 300 ? 52.155 -21.892 -0.493  1.00 11.30 ? 297 TRP A O     1 
ATOM   2339 C  CB    . TRP A 1 300 ? 49.404 -20.905 -2.149  1.00 12.00 ? 297 TRP A CB    1 
ATOM   2340 C  CG    . TRP A 1 300 ? 50.084 -19.617 -1.863  1.00 11.53 ? 297 TRP A CG    1 
ATOM   2341 C  CD1   . TRP A 1 300 ? 50.793 -18.846 -2.750  1.00 16.16 ? 297 TRP A CD1   1 
ATOM   2342 C  CD2   . TRP A 1 300 ? 50.125 -18.920 -0.605  1.00 11.38 ? 297 TRP A CD2   1 
ATOM   2343 N  NE1   . TRP A 1 300 ? 51.277 -17.722 -2.114  1.00 19.82 ? 297 TRP A NE1   1 
ATOM   2344 C  CE2   . TRP A 1 300 ? 50.881 -17.746 -0.802  1.00 14.95 ? 297 TRP A CE2   1 
ATOM   2345 C  CE3   . TRP A 1 300 ? 49.596 -19.177 0.661   1.00 15.45 ? 297 TRP A CE3   1 
ATOM   2346 C  CZ2   . TRP A 1 300 ? 51.114 -16.828 0.225   1.00 14.21 ? 297 TRP A CZ2   1 
ATOM   2347 C  CZ3   . TRP A 1 300 ? 49.833 -18.269 1.675   1.00 19.08 ? 297 TRP A CZ3   1 
ATOM   2348 C  CH2   . TRP A 1 300 ? 50.590 -17.115 1.453   1.00 15.53 ? 297 TRP A CH2   1 
ATOM   2349 N  N     . LEU A 1 301 ? 50.209 -22.700 0.325   1.00 10.83 ? 298 LEU A N     1 
ATOM   2350 C  CA    . LEU A 1 301 ? 50.733 -22.850 1.685   1.00 10.00 ? 298 LEU A CA    1 
ATOM   2351 C  C     . LEU A 1 301 ? 51.878 -23.857 1.764   1.00 11.79 ? 298 LEU A C     1 
ATOM   2352 O  O     . LEU A 1 301 ? 52.874 -23.637 2.477   1.00 10.27 ? 298 LEU A O     1 
ATOM   2353 C  CB    . LEU A 1 301 ? 49.627 -23.279 2.647   1.00 8.68  ? 298 LEU A CB    1 
ATOM   2354 C  CG    . LEU A 1 301 ? 48.549 -22.229 2.968   1.00 11.27 ? 298 LEU A CG    1 
ATOM   2355 C  CD1   . LEU A 1 301 ? 47.352 -22.882 3.621   1.00 13.75 ? 298 LEU A CD1   1 
ATOM   2356 C  CD2   . LEU A 1 301 ? 49.115 -21.149 3.891   1.00 13.53 ? 298 LEU A CD2   1 
ATOM   2357 N  N     . TYR A 1 302 ? 51.744 -24.961 1.039   1.00 10.45 ? 299 TYR A N     1 
ATOM   2358 C  CA    . TYR A 1 302 ? 52.779 -25.992 1.052   1.00 10.65 ? 299 TYR A CA    1 
ATOM   2359 C  C     . TYR A 1 302 ? 54.136 -25.427 0.599   1.00 10.91 ? 299 TYR A C     1 
ATOM   2360 O  O     . TYR A 1 302 ? 55.167 -25.640 1.249   1.00 9.98  ? 299 TYR A O     1 
ATOM   2361 C  CB    . TYR A 1 302 ? 52.359 -27.176 0.163   1.00 12.08 ? 299 TYR A CB    1 
ATOM   2362 C  CG    . TYR A 1 302 ? 53.360 -28.300 0.178   1.00 11.66 ? 299 TYR A CG    1 
ATOM   2363 C  CD1   . TYR A 1 302 ? 53.334 -29.251 1.183   1.00 12.84 ? 299 TYR A CD1   1 
ATOM   2364 C  CD2   . TYR A 1 302 ? 54.355 -28.390 -0.786  1.00 12.93 ? 299 TYR A CD2   1 
ATOM   2365 C  CE1   . TYR A 1 302 ? 54.258 -30.282 1.223   1.00 13.18 ? 299 TYR A CE1   1 
ATOM   2366 C  CE2   . TYR A 1 302 ? 55.297 -29.410 -0.746  1.00 17.93 ? 299 TYR A CE2   1 
ATOM   2367 C  CZ    . TYR A 1 302 ? 55.232 -30.356 0.260   1.00 19.45 ? 299 TYR A CZ    1 
ATOM   2368 O  OH    . TYR A 1 302 ? 56.160 -31.378 0.318   1.00 22.48 ? 299 TYR A OH    1 
ATOM   2369 N  N     . ALA A 1 303 ? 54.131 -24.695 -0.506  1.00 11.16 ? 300 ALA A N     1 
ATOM   2370 C  CA    . ALA A 1 303 ? 55.342 -24.067 -1.002  1.00 9.96  ? 300 ALA A CA    1 
ATOM   2371 C  C     . ALA A 1 303 ? 55.767 -22.869 -0.136  1.00 8.56  ? 300 ALA A C     1 
ATOM   2372 O  O     . ALA A 1 303 ? 56.959 -22.693 0.167   1.00 10.43 ? 300 ALA A O     1 
ATOM   2373 C  CB    . ALA A 1 303 ? 55.144 -23.628 -2.452  1.00 12.93 ? 300 ALA A CB    1 
ATOM   2374 N  N     . MET A 1 304 ? 54.799 -22.063 0.289   1.00 9.38  ? 301 MET A N     1 
ATOM   2375 C  CA    . MET A 1 304 ? 55.143 -20.821 0.982   1.00 9.28  ? 301 MET A CA    1 
ATOM   2376 C  C     . MET A 1 304 ? 55.837 -21.073 2.302   1.00 8.71  ? 301 MET A C     1 
ATOM   2377 O  O     . MET A 1 304 ? 56.786 -20.347 2.641   1.00 9.96  ? 301 MET A O     1 
ATOM   2378 C  CB    . MET A 1 304 ? 53.912 -19.959 1.222   1.00 11.81 ? 301 MET A CB    1 
ATOM   2379 C  CG    . MET A 1 304 ? 54.258 -18.520 1.644   1.00 13.45 ? 301 MET A CG    1 
ATOM   2380 S  SD    . MET A 1 304 ? 55.044 -17.587 0.312   1.00 14.20 ? 301 MET A SD    1 
ATOM   2381 C  CE    . MET A 1 304 ? 56.743 -17.458 0.888   1.00 14.82 ? 301 MET A CE    1 
ATOM   2382 N  N     . CYS A 1 305 ? 55.409 -22.107 3.032   1.00 9.33  ? 302 CYS A N     1 
ATOM   2383 C  CA    . CYS A 1 305 ? 56.049 -22.368 4.336   1.00 11.26 ? 302 CYS A CA    1 
ATOM   2384 C  C     . CYS A 1 305 ? 57.489 -22.890 4.168   1.00 9.55  ? 302 CYS A C     1 
ATOM   2385 O  O     . CYS A 1 305 ? 58.244 -22.929 5.138   1.00 12.13 ? 302 CYS A O     1 
ATOM   2386 C  CB    . CYS A 1 305 ? 55.224 -23.349 5.181   1.00 9.11  ? 302 CYS A CB    1 
ATOM   2387 S  SG    . CYS A 1 305 ? 55.240 -25.040 4.575   1.00 9.77  ? 302 CYS A SG    1 
ATOM   2388 N  N     . ARG A 1 306 ? 57.876 -23.230 2.940   1.00 8.38  ? 303 ARG A N     1 
ATOM   2389 C  CA    . ARG A 1 306 ? 59.260 -23.579 2.611   1.00 9.36  ? 303 ARG A CA    1 
ATOM   2390 C  C     . ARG A 1 306 ? 60.012 -22.404 1.939   1.00 11.20 ? 303 ARG A C     1 
ATOM   2391 O  O     . ARG A 1 306 ? 61.153 -22.563 1.476   1.00 13.18 ? 303 ARG A O     1 
ATOM   2392 C  CB    . ARG A 1 306 ? 59.273 -24.819 1.711   1.00 9.60  ? 303 ARG A CB    1 
ATOM   2393 C  CG    . ARG A 1 306 ? 58.705 -26.045 2.402   1.00 10.08 ? 303 ARG A CG    1 
ATOM   2394 C  CD    . ARG A 1 306 ? 58.403 -27.211 1.457   1.00 11.95 ? 303 ARG A CD    1 
ATOM   2395 N  NE    . ARG A 1 306 ? 58.222 -28.432 2.248   1.00 14.11 ? 303 ARG A NE    1 
ATOM   2396 C  CZ    . ARG A 1 306 ? 57.117 -28.721 2.930   1.00 12.41 ? 303 ARG A CZ    1 
ATOM   2397 N  NH1   . ARG A 1 306 ? 57.043 -29.837 3.646   1.00 13.82 ? 303 ARG A NH1   1 
ATOM   2398 N  NH2   . ARG A 1 306 ? 56.070 -27.904 2.888   1.00 9.73  ? 303 ARG A NH2   1 
ATOM   2399 N  N     . GLY A 1 307 ? 59.383 -21.231 1.900   1.00 11.10 ? 304 GLY A N     1 
ATOM   2400 C  CA    . GLY A 1 307 ? 60.009 -20.046 1.332   1.00 11.07 ? 304 GLY A CA    1 
ATOM   2401 C  C     . GLY A 1 307 ? 59.803 -19.885 -0.170  1.00 10.36 ? 304 GLY A C     1 
ATOM   2402 O  O     . GLY A 1 307 ? 60.467 -19.074 -0.809  1.00 12.06 ? 304 GLY A O     1 
ATOM   2403 N  N     . ILE A 1 308 ? 58.906 -20.677 -0.738  1.00 9.44  ? 305 ILE A N     1 
ATOM   2404 C  CA    . ILE A 1 308 ? 58.721 -20.731 -2.187  1.00 11.49 ? 305 ILE A CA    1 
ATOM   2405 C  C     . ILE A 1 308 ? 57.368 -20.183 -2.625  1.00 13.25 ? 305 ILE A C     1 
ATOM   2406 O  O     . ILE A 1 308 ? 56.328 -20.573 -2.105  1.00 12.16 ? 305 ILE A O     1 
ATOM   2407 C  CB    . ILE A 1 308 ? 58.863 -22.182 -2.685  1.00 11.84 ? 305 ILE A CB    1 
ATOM   2408 C  CG1   . ILE A 1 308 ? 60.263 -22.700 -2.345  1.00 14.80 ? 305 ILE A CG1   1 
ATOM   2409 C  CG2   . ILE A 1 308 ? 58.547 -22.283 -4.163  1.00 11.59 ? 305 ILE A CG2   1 
ATOM   2410 C  CD1   . ILE A 1 308 ? 60.439 -24.195 -2.549  1.00 20.07 ? 305 ILE A CD1   1 
ATOM   2411 N  N     . GLU A 1 309 ? 57.383 -19.273 -3.593  1.00 9.55  ? 306 GLU A N     1 
ATOM   2412 C  CA    . GLU A 1 309 ? 56.140 -18.740 -4.142  1.00 15.40 ? 306 GLU A CA    1 
ATOM   2413 C  C     . GLU A 1 309 ? 56.411 -18.314 -5.569  1.00 16.50 ? 306 GLU A C     1 
ATOM   2414 O  O     . GLU A 1 309 ? 57.512 -17.861 -5.871  1.00 16.14 ? 306 GLU A O     1 
ATOM   2415 C  CB    . GLU A 1 309 ? 55.623 -17.558 -3.323  1.00 22.53 ? 306 GLU A CB    1 
ATOM   2416 C  CG    . GLU A 1 309 ? 54.351 -17.003 -3.905  1.00 31.36 ? 306 GLU A CG    1 
ATOM   2417 C  CD    . GLU A 1 309 ? 54.021 -15.603 -3.471  1.00 21.99 ? 306 GLU A CD    1 
ATOM   2418 O  OE1   . GLU A 1 309 ? 54.895 -14.697 -3.518  1.00 15.60 ? 306 GLU A OE1   1 
ATOM   2419 O  OE2   . GLU A 1 309 ? 52.849 -15.398 -3.114  1.00 27.53 ? 306 GLU A OE2   1 
ATOM   2420 N  N     . HIS A 1 310 ? 55.427 -18.442 -6.455  1.00 17.33 ? 307 HIS A N     1 
ATOM   2421 C  CA    . HIS A 1 310 ? 55.714 -18.180 -7.860  1.00 16.63 ? 307 HIS A CA    1 
ATOM   2422 C  C     . HIS A 1 310 ? 54.989 -16.966 -8.429  1.00 14.57 ? 307 HIS A C     1 
ATOM   2423 O  O     . HIS A 1 310 ? 55.191 -16.636 -9.593  1.00 20.94 ? 307 HIS A O     1 
ATOM   2424 C  CB    . HIS A 1 310 ? 55.394 -19.424 -8.686  1.00 23.98 ? 307 HIS A CB    1 
ATOM   2425 C  CG    . HIS A 1 310 ? 56.302 -20.578 -8.389  1.00 31.44 ? 307 HIS A CG    1 
ATOM   2426 N  ND1   . HIS A 1 310 ? 57.670 -20.436 -8.266  1.00 34.73 ? 307 HIS A ND1   1 
ATOM   2427 C  CD2   . HIS A 1 310 ? 56.037 -21.883 -8.145  1.00 33.19 ? 307 HIS A CD2   1 
ATOM   2428 C  CE1   . HIS A 1 310 ? 58.208 -21.608 -7.983  1.00 33.31 ? 307 HIS A CE1   1 
ATOM   2429 N  NE2   . HIS A 1 310 ? 57.240 -22.503 -7.906  1.00 33.09 ? 307 HIS A NE2   1 
ATOM   2430 N  N     . ASP A 1 311 ? 54.170 -16.302 -7.616  1.00 13.09 ? 308 ASP A N     1 
ATOM   2431 C  CA    . ASP A 1 311 ? 53.402 -15.130 -8.072  1.00 14.67 ? 308 ASP A CA    1 
ATOM   2432 C  C     . ASP A 1 311 ? 54.300 -14.108 -8.775  1.00 15.43 ? 308 ASP A C     1 
ATOM   2433 O  O     . ASP A 1 311 ? 55.247 -13.609 -8.183  1.00 13.13 ? 308 ASP A O     1 
ATOM   2434 C  CB    . ASP A 1 311 ? 52.702 -14.473 -6.886  1.00 13.83 ? 308 ASP A CB    1 
ATOM   2435 C  CG    . ASP A 1 311 ? 51.706 -13.407 -7.307  1.00 20.16 ? 308 ASP A CG    1 
ATOM   2436 O  OD1   . ASP A 1 311 ? 51.436 -12.500 -6.504  1.00 31.10 ? 308 ASP A OD1   1 
ATOM   2437 O  OD2   . ASP A 1 311 ? 51.175 -13.484 -8.431  1.00 29.64 ? 308 ASP A OD2   1 
ATOM   2438 N  N     . PRO A 1 312 ? 54.026 -13.812 -10.058 1.00 13.67 ? 309 PRO A N     1 
ATOM   2439 C  CA    . PRO A 1 312 ? 54.913 -12.907 -10.786 1.00 12.29 ? 309 PRO A CA    1 
ATOM   2440 C  C     . PRO A 1 312 ? 54.736 -11.454 -10.392 1.00 9.37  ? 309 PRO A C     1 
ATOM   2441 O  O     . PRO A 1 312 ? 53.656 -11.040 -9.963  1.00 12.21 ? 309 PRO A O     1 
ATOM   2442 C  CB    . PRO A 1 312 ? 54.499 -13.120 -12.255 1.00 13.21 ? 309 PRO A CB    1 
ATOM   2443 C  CG    . PRO A 1 312 ? 53.089 -13.520 -12.167 1.00 14.65 ? 309 PRO A CG    1 
ATOM   2444 C  CD    . PRO A 1 312 ? 52.998 -14.392 -10.939 1.00 15.39 ? 309 PRO A CD    1 
ATOM   2445 N  N     . VAL A 1 313 ? 55.818 -10.699 -10.503 1.00 9.96  ? 310 VAL A N     1 
ATOM   2446 C  CA    . VAL A 1 313 ? 55.743 -9.249  -10.486 1.00 10.95 ? 310 VAL A CA    1 
ATOM   2447 C  C     . VAL A 1 313 ? 55.048 -8.819  -11.773 1.00 13.08 ? 310 VAL A C     1 
ATOM   2448 O  O     . VAL A 1 313 ? 55.609 -8.972  -12.861 1.00 13.81 ? 310 VAL A O     1 
ATOM   2449 C  CB    . VAL A 1 313 ? 57.126 -8.626  -10.410 1.00 12.19 ? 310 VAL A CB    1 
ATOM   2450 C  CG1   . VAL A 1 313 ? 57.030 -7.102  -10.446 1.00 13.36 ? 310 VAL A CG1   1 
ATOM   2451 C  CG2   . VAL A 1 313 ? 57.834 -9.093  -9.145  1.00 12.38 ? 310 VAL A CG2   1 
ATOM   2452 N  N     . LYS A 1 314 ? 53.825 -8.316  -11.659 1.00 14.01 ? 311 LYS A N     1 
ATOM   2453 C  CA    . LYS A 1 314 ? 53.064 -7.974  -12.847 1.00 13.69 ? 311 LYS A CA    1 
ATOM   2454 C  C     . LYS A 1 314 ? 53.520 -6.624  -13.393 1.00 11.74 ? 311 LYS A C     1 
ATOM   2455 O  O     . LYS A 1 314 ? 53.740 -5.683  -12.634 1.00 14.79 ? 311 LYS A O     1 
ATOM   2456 C  CB    . LYS A 1 314 ? 51.570 -7.979  -12.529 1.00 17.21 ? 311 LYS A CB    1 
ATOM   2457 C  CG    . LYS A 1 314 ? 51.087 -9.389  -12.185 1.00 21.36 ? 311 LYS A CG    1 
ATOM   2458 C  CD    . LYS A 1 314 ? 49.734 -9.436  -11.506 1.00 37.18 ? 311 LYS A CD    1 
ATOM   2459 C  CE    . LYS A 1 314 ? 49.418 -10.875 -11.074 1.00 34.77 ? 311 LYS A CE    1 
ATOM   2460 N  NZ    . LYS A 1 314 ? 50.541 -11.520 -10.288 1.00 31.09 ? 311 LYS A NZ    1 
ATOM   2461 N  N     . PRO A 1 315 ? 53.691 -6.523  -14.715 1.00 11.07 ? 312 PRO A N     1 
ATOM   2462 C  CA    . PRO A 1 315 ? 54.063 -5.246  -15.319 1.00 10.43 ? 312 PRO A CA    1 
ATOM   2463 C  C     . PRO A 1 315 ? 52.893 -4.267  -15.290 1.00 15.98 ? 312 PRO A C     1 
ATOM   2464 O  O     . PRO A 1 315 ? 52.169 -4.128  -16.275 1.00 17.98 ? 312 PRO A O     1 
ATOM   2465 C  CB    . PRO A 1 315 ? 54.429 -5.636  -16.755 1.00 15.46 ? 312 PRO A CB    1 
ATOM   2466 C  CG    . PRO A 1 315 ? 53.576 -6.862  -17.018 1.00 14.63 ? 312 PRO A CG    1 
ATOM   2467 C  CD    . PRO A 1 315 ? 53.582 -7.606  -15.714 1.00 12.50 ? 312 PRO A CD    1 
ATOM   2468 N  N     . ARG A 1 316 ? 52.703 -3.598  -14.160 1.00 14.38 ? 313 ARG A N     1 
ATOM   2469 C  CA    . ARG A 1 316 ? 51.593 -2.662  -14.033 1.00 13.68 ? 313 ARG A CA    1 
ATOM   2470 C  C     . ARG A 1 316 ? 51.964 -1.541  -13.084 1.00 15.30 ? 313 ARG A C     1 
ATOM   2471 O  O     . ARG A 1 316 ? 52.063 -1.754  -11.879 1.00 14.67 ? 313 ARG A O     1 
ATOM   2472 C  CB    . ARG A 1 316 ? 50.331 -3.365  -13.537 1.00 16.68 ? 313 ARG A CB    1 
ATOM   2473 C  CG    . ARG A 1 316 ? 49.114 -2.470  -13.601 1.00 20.80 ? 313 ARG A CG    1 
ATOM   2474 C  CD    . ARG A 1 316 ? 47.906 -3.108  -12.965 1.00 18.91 ? 313 ARG A CD    1 
ATOM   2475 N  NE    . ARG A 1 316 ? 48.198 -3.666  -11.650 1.00 23.51 ? 313 ARG A NE    1 
ATOM   2476 C  CZ    . ARG A 1 316 ? 48.275 -2.952  -10.532 1.00 25.47 ? 313 ARG A CZ    1 
ATOM   2477 N  NH1   . ARG A 1 316 ? 48.102 -1.628  -10.563 1.00 26.77 ? 313 ARG A NH1   1 
ATOM   2478 N  NH2   . ARG A 1 316 ? 48.545 -3.560  -9.381  1.00 29.58 ? 313 ARG A NH2   1 
ATOM   2479 N  N     . GLN A 1 317 ? 52.171 -0.355  -13.644 1.00 14.08 ? 314 GLN A N     1 
ATOM   2480 C  CA    . GLN A 1 317 ? 52.583 0.810   -12.872 1.00 16.94 ? 314 GLN A CA    1 
ATOM   2481 C  C     . GLN A 1 317 ? 51.405 1.715   -12.489 1.00 17.43 ? 314 GLN A C     1 
ATOM   2482 O  O     . GLN A 1 317 ? 51.489 2.514   -11.549 1.00 19.35 ? 314 GLN A O     1 
ATOM   2483 C  CB    . GLN A 1 317 ? 53.606 1.599   -13.677 1.00 27.25 ? 314 GLN A CB    1 
ATOM   2484 C  CG    . GLN A 1 317 ? 54.279 2.671   -12.907 1.00 32.81 ? 314 GLN A CG    1 
ATOM   2485 C  CD    . GLN A 1 317 ? 55.263 3.412   -13.750 1.00 28.97 ? 314 GLN A CD    1 
ATOM   2486 O  OE1   . GLN A 1 317 ? 55.692 2.924   -14.804 1.00 31.99 ? 314 GLN A OE1   1 
ATOM   2487 N  NE2   . GLN A 1 317 ? 55.629 4.601   -13.309 1.00 28.43 ? 314 GLN A NE2   1 
ATOM   2488 N  N     . LEU A 1 318 ? 50.309 1.578   -13.222 1.00 15.86 ? 315 LEU A N     1 
ATOM   2489 C  CA    . LEU A 1 318 ? 49.130 2.415   -13.026 1.00 15.29 ? 315 LEU A CA    1 
ATOM   2490 C  C     . LEU A 1 318 ? 47.988 1.646   -12.380 1.00 13.08 ? 315 LEU A C     1 
ATOM   2491 O  O     . LEU A 1 318 ? 47.778 0.468   -12.684 1.00 15.64 ? 315 LEU A O     1 
ATOM   2492 C  CB    . LEU A 1 318 ? 48.637 2.972   -14.365 1.00 14.87 ? 315 LEU A CB    1 
ATOM   2493 C  CG    . LEU A 1 318 ? 49.611 3.709   -15.278 1.00 18.26 ? 315 LEU A CG    1 
ATOM   2494 C  CD1   . LEU A 1 318 ? 48.978 3.918   -16.651 1.00 18.40 ? 315 LEU A CD1   1 
ATOM   2495 C  CD2   . LEU A 1 318 ? 50.015 5.036   -14.660 1.00 17.97 ? 315 LEU A CD2   1 
ATOM   2496 N  N     . PRO A 1 319 ? 47.200 2.317   -11.527 1.00 13.09 ? 316 PRO A N     1 
ATOM   2497 C  CA    . PRO A 1 319 ? 46.012 1.642   -10.983 1.00 13.17 ? 316 PRO A CA    1 
ATOM   2498 C  C     . PRO A 1 319 ? 45.033 1.213   -12.083 1.00 13.31 ? 316 PRO A C     1 
ATOM   2499 O  O     . PRO A 1 319 ? 44.957 1.872   -13.113 1.00 16.43 ? 316 PRO A O     1 
ATOM   2500 C  CB    . PRO A 1 319 ? 45.389 2.689   -10.046 1.00 17.41 ? 316 PRO A CB    1 
ATOM   2501 C  CG    . PRO A 1 319 ? 46.067 3.970   -10.339 1.00 23.97 ? 316 PRO A CG    1 
ATOM   2502 C  CD    . PRO A 1 319 ? 47.358 3.700   -11.047 1.00 14.30 ? 316 PRO A CD    1 
ATOM   2503 N  N     . LYS A 1 320 ? 44.344 0.096   -11.855 1.00 16.10 ? 317 LYS A N     1 
ATOM   2504 C  CA    . LYS A 1 320 ? 43.381 -0.503  -12.783 1.00 16.64 ? 317 LYS A CA    1 
ATOM   2505 C  C     . LYS A 1 320 ? 42.004 0.126   -12.689 1.00 17.58 ? 317 LYS A C     1 
ATOM   2506 O  O     . LYS A 1 320 ? 41.140 -0.123  -13.532 1.00 18.22 ? 317 LYS A O     1 
ATOM   2507 C  CB    . LYS A 1 320 ? 43.212 -2.001  -12.487 1.00 25.15 ? 317 LYS A CB    1 
ATOM   2508 C  CG    . LYS A 1 320 ? 44.365 -2.894  -12.822 1.00 30.98 ? 317 LYS A CG    1 
ATOM   2509 C  CD    . LYS A 1 320 ? 43.941 -4.353  -12.668 1.00 30.13 ? 317 LYS A CD    1 
ATOM   2510 C  CE    . LYS A 1 320 ? 45.040 -5.293  -13.116 1.00 41.78 ? 317 LYS A CE    1 
ATOM   2511 N  NZ    . LYS A 1 320 ? 44.571 -6.700  -13.212 1.00 35.35 ? 317 LYS A NZ    1 
ATOM   2512 N  N     . THR A 1 321 ? 41.777 0.873   -11.612 1.00 16.15 ? 318 THR A N     1 
ATOM   2513 C  CA    . THR A 1 321 ? 40.480 1.484   -11.362 1.00 17.24 ? 318 THR A CA    1 
ATOM   2514 C  C     . THR A 1 321 ? 40.717 2.859   -10.765 1.00 16.09 ? 318 THR A C     1 
ATOM   2515 O  O     . THR A 1 321 ? 41.789 3.135   -10.213 1.00 16.73 ? 318 THR A O     1 
ATOM   2516 C  CB    . THR A 1 321 ? 39.596 0.640   -10.402 1.00 20.93 ? 318 THR A CB    1 
ATOM   2517 O  OG1   . THR A 1 321 ? 40.288 0.427   -9.162  1.00 17.52 ? 318 THR A OG1   1 
ATOM   2518 C  CG2   . THR A 1 321 ? 39.225 -0.717  -11.015 1.00 18.28 ? 318 THR A CG2   1 
ATOM   2519 N  N     . ILE A 1 322 ? 39.727 3.729   -10.917 1.00 13.54 ? 319 ILE A N     1 
ATOM   2520 C  CA    . ILE A 1 322 ? 39.770 5.064   -10.350 1.00 14.11 ? 319 ILE A CA    1 
ATOM   2521 C  C     . ILE A 1 322 ? 38.445 5.267   -9.627  1.00 13.16 ? 319 ILE A C     1 
ATOM   2522 O  O     . ILE A 1 322 ? 37.394 5.247   -10.256 1.00 15.75 ? 319 ILE A O     1 
ATOM   2523 C  CB    . ILE A 1 322 ? 39.989 6.133   -11.443 1.00 10.92 ? 319 ILE A CB    1 
ATOM   2524 C  CG1   . ILE A 1 322 ? 41.341 5.914   -12.141 1.00 15.66 ? 319 ILE A CG1   1 
ATOM   2525 C  CG2   . ILE A 1 322 ? 39.857 7.553   -10.872 1.00 16.11 ? 319 ILE A CG2   1 
ATOM   2526 C  CD1   . ILE A 1 322 ? 41.751 7.042   -13.074 1.00 17.46 ? 319 ILE A CD1   1 
ATOM   2527 N  N     . GLY A 1 323 ? 38.495 5.395   -8.306  1.00 13.91 ? 320 GLY A N     1 
ATOM   2528 C  CA    . GLY A 1 323 ? 37.278 5.444   -7.510  1.00 12.31 ? 320 GLY A CA    1 
ATOM   2529 C  C     . GLY A 1 323 ? 37.196 6.600   -6.528  1.00 11.53 ? 320 GLY A C     1 
ATOM   2530 O  O     . GLY A 1 323 ? 38.201 7.182   -6.143  1.00 15.26 ? 320 GLY A O     1 
ATOM   2531 N  N     . CYS A 1 324 ? 35.965 6.891   -6.114  1.00 14.13 ? 321 CYS A N     1 
ATOM   2532 C  CA    . CYS A 1 324 ? 35.612 8.013   -5.236  1.00 15.94 ? 321 CYS A CA    1 
ATOM   2533 C  C     . CYS A 1 324 ? 34.592 7.470   -4.252  1.00 15.04 ? 321 CYS A C     1 
ATOM   2534 O  O     . CYS A 1 324 ? 33.580 6.917   -4.681  1.00 17.08 ? 321 CYS A O     1 
ATOM   2535 C  CB    . CYS A 1 324 ? 35.014 9.203   -6.031  1.00 15.32 ? 321 CYS A CB    1 
ATOM   2536 S  SG    A CYS A 1 324 ? 36.152 10.015  -7.154  0.62 21.00 ? 321 CYS A SG    1 
ATOM   2537 S  SG    B CYS A 1 324 ? 35.358 10.835  -5.387  0.38 21.75 ? 321 CYS A SG    1 
ATOM   2538 N  N     . SER A 1 325 ? 34.829 7.614   -2.952  1.00 14.02 ? 322 SER A N     1 
ATOM   2539 C  CA    A SER A 1 325 ? 33.870 7.097   -1.988  0.53 15.15 ? 322 SER A CA    1 
ATOM   2540 C  CA    B SER A 1 325 ? 33.967 7.026   -1.934  0.47 15.23 ? 322 SER A CA    1 
ATOM   2541 C  C     . SER A 1 325 ? 33.759 7.974   -0.756  1.00 17.66 ? 322 SER A C     1 
ATOM   2542 O  O     . SER A 1 325 ? 34.687 8.698   -0.380  1.00 16.19 ? 322 SER A O     1 
ATOM   2543 C  CB    A SER A 1 325 ? 34.230 5.668   -1.574  0.53 18.01 ? 322 SER A CB    1 
ATOM   2544 C  CB    B SER A 1 325 ? 34.580 5.707   -1.449  0.47 17.23 ? 322 SER A CB    1 
ATOM   2545 O  OG    A SER A 1 325 ? 35.409 5.633   -0.796  0.53 17.70 ? 322 SER A OG    1 
ATOM   2546 O  OG    B SER A 1 325 ? 33.996 5.255   -0.243  0.47 18.56 ? 322 SER A OG    1 
ATOM   2547 N  N     . LYS A 1 326 ? 32.580 7.931   -0.149  1.00 15.20 ? 323 LYS A N     1 
ATOM   2548 C  CA    . LYS A 1 326 ? 32.370 8.675   1.083   1.00 15.11 ? 323 LYS A CA    1 
ATOM   2549 C  C     . LYS A 1 326 ? 31.398 7.964   1.990   1.00 16.85 ? 323 LYS A C     1 
ATOM   2550 O  O     . LYS A 1 326 ? 30.337 7.533   1.542   1.00 14.39 ? 323 LYS A O     1 
ATOM   2551 C  CB    . LYS A 1 326 ? 31.868 10.088  0.798   1.00 14.76 ? 323 LYS A CB    1 
ATOM   2552 C  CG    . LYS A 1 326 ? 31.673 10.892  2.089   1.00 16.88 ? 323 LYS A CG    1 
ATOM   2553 C  CD    . LYS A 1 326 ? 31.672 12.380  1.831   1.00 22.48 ? 323 LYS A CD    1 
ATOM   2554 C  CE    . LYS A 1 326 ? 31.455 13.147  3.125   1.00 25.64 ? 323 LYS A CE    1 
ATOM   2555 N  NZ    . LYS A 1 326 ? 32.402 12.690  4.162   1.00 28.48 ? 323 LYS A NZ    1 
ATOM   2556 N  N     . ASN A 1 327 ? 31.788 7.830   3.256   1.00 14.49 ? 324 ASN A N     1 
ATOM   2557 C  CA    . ASN A 1 327 ? 30.899 7.375   4.318   1.00 17.67 ? 324 ASN A CA    1 
ATOM   2558 C  C     . ASN A 1 327 ? 30.046 8.512   4.862   1.00 17.34 ? 324 ASN A C     1 
ATOM   2559 O  O     . ASN A 1 327 ? 30.452 9.676   4.864   1.00 16.43 ? 324 ASN A O     1 
ATOM   2560 C  CB    . ASN A 1 327 ? 31.689 6.768   5.479   1.00 21.20 ? 324 ASN A CB    1 
ATOM   2561 C  CG    . ASN A 1 327 ? 32.334 5.446   5.131   1.00 21.18 ? 324 ASN A CG    1 
ATOM   2562 O  OD1   . ASN A 1 327 ? 32.161 4.918   4.032   1.00 25.99 ? 324 ASN A OD1   1 
ATOM   2563 N  ND2   . ASN A 1 327 ? 33.094 4.901   6.075   1.00 27.87 ? 324 ASN A ND2   1 
ATOM   2564 N  N     . PHE A 1 328 ? 28.863 8.149   5.347   1.00 19.26 ? 325 PHE A N     1 
ATOM   2565 C  CA    . PHE A 1 328 ? 27.924 9.068   5.950   1.00 21.97 ? 325 PHE A CA    1 
ATOM   2566 C  C     . PHE A 1 328 ? 27.447 8.444   7.259   1.00 27.85 ? 325 PHE A C     1 
ATOM   2567 O  O     . PHE A 1 328 ? 26.442 7.807   7.359   1.00 24.35 ? 325 PHE A O     1 
ATOM   2568 C  CB    . PHE A 1 328 ? 26.784 9.386   4.987   1.00 24.84 ? 325 PHE A CB    1 
ATOM   2569 C  CG    . PHE A 1 328 ? 27.237 9.984   3.694   1.00 20.55 ? 325 PHE A CG    1 
ATOM   2570 C  CD1   . PHE A 1 328 ? 27.414 9.209   2.594   1.00 23.58 ? 325 PHE A CD1   1 
ATOM   2571 C  CD2   . PHE A 1 328 ? 27.492 11.297  3.592   1.00 19.21 ? 325 PHE A CD2   1 
ATOM   2572 C  CE1   . PHE A 1 328 ? 27.836 9.760   1.440   1.00 15.65 ? 325 PHE A CE1   1 
ATOM   2573 C  CE2   . PHE A 1 328 ? 27.905 11.866  2.440   1.00 20.45 ? 325 PHE A CE2   1 
ATOM   2574 C  CZ    . PHE A 1 328 ? 28.082 11.078  1.349   1.00 20.96 ? 325 PHE A CZ    1 
ATOM   2575 N  N     . PRO A 1 329 ? 28.276 8.551   8.279   1.00 24.41 ? 326 PRO A N     1 
ATOM   2576 C  CA    . PRO A 1 329 ? 28.071 7.782   9.500   1.00 28.95 ? 326 PRO A CA    1 
ATOM   2577 C  C     . PRO A 1 329 ? 27.011 8.336   10.406  1.00 31.67 ? 326 PRO A C     1 
ATOM   2578 O  O     . PRO A 1 329 ? 26.695 9.471   10.317  1.00 27.49 ? 326 PRO A O     1 
ATOM   2579 C  CB    . PRO A 1 329 ? 29.410 7.897   10.202  1.00 33.01 ? 326 PRO A CB    1 
ATOM   2580 C  CG    . PRO A 1 329 ? 29.930 9.172   9.713   1.00 32.82 ? 326 PRO A CG    1 
ATOM   2581 C  CD    . PRO A 1 329 ? 29.611 9.124   8.269   1.00 28.24 ? 326 PRO A CD    1 
ATOM   2582 N  N     . GLY A 1 330 ? 26.485 7.469   11.255  1.00 40.37 ? 327 GLY A N     1 
ATOM   2583 C  CA    . GLY A 1 330 ? 25.650 7.897   12.361  1.00 41.69 ? 327 GLY A CA    1 
ATOM   2584 C  C     . GLY A 1 330 ? 24.507 8.705   11.825  1.00 38.58 ? 327 GLY A C     1 
ATOM   2585 O  O     . GLY A 1 330 ? 23.737 8.250   11.019  1.00 37.66 ? 327 GLY A O     1 
ATOM   2586 N  N     . LYS A 1 331 ? 24.414 9.909   12.328  1.00 39.02 ? 328 LYS A N     1 
ATOM   2587 C  CA    . LYS A 1 331 ? 23.338 10.805  12.012  1.00 34.87 ? 328 LYS A CA    1 
ATOM   2588 C  C     . LYS A 1 331 ? 23.444 11.522  10.733  1.00 41.37 ? 328 LYS A C     1 
ATOM   2589 O  O     . LYS A 1 331 ? 22.520 12.159  10.333  1.00 37.93 ? 328 LYS A O     1 
ATOM   2590 C  CB    . LYS A 1 331 ? 23.101 11.769  13.157  1.00 45.08 ? 328 LYS A CB    1 
ATOM   2591 C  CG    . LYS A 1 331 ? 22.214 11.122  14.184  1.00 51.72 ? 328 LYS A CG    1 
ATOM   2592 C  CD    . LYS A 1 331 ? 22.213 11.885  15.484  1.00 56.13 ? 328 LYS A CD    1 
ATOM   2593 C  CE    . LYS A 1 331 ? 22.072 10.954  16.676  1.00 64.25 ? 328 LYS A CE    1 
ATOM   2594 N  NZ    . LYS A 1 331 ? 23.321 10.413  17.303  1.00 65.40 ? 328 LYS A NZ    1 
ATOM   2595 N  N     . THR A 1 332 ? 24.580 11.442  10.084  1.00 38.17 ? 329 THR A N     1 
ATOM   2596 C  CA    . THR A 1 332 ? 24.781 12.165  8.827   1.00 36.22 ? 329 THR A CA    1 
ATOM   2597 C  C     . THR A 1 332 ? 24.281 11.370  7.615   1.00 31.36 ? 329 THR A C     1 
ATOM   2598 O  O     . THR A 1 332 ? 24.370 11.844  6.482   1.00 29.80 ? 329 THR A O     1 
ATOM   2599 C  CB    . THR A 1 332 ? 26.266 12.520  8.595   1.00 32.12 ? 329 THR A CB    1 
ATOM   2600 O  OG1   . THR A 1 332 ? 27.015 11.323  8.343   1.00 29.60 ? 329 THR A OG1   1 
ATOM   2601 C  CG2   . THR A 1 332 ? 26.849 13.238  9.808   1.00 32.18 ? 329 THR A CG2   1 
ATOM   2602 N  N     . ALA A 1 333 ? 23.756 10.173  7.863   1.00 30.16 ? 330 ALA A N     1 
ATOM   2603 C  CA    . ALA A 1 333 ? 23.283 9.287   6.798   1.00 27.52 ? 330 ALA A CA    1 
ATOM   2604 C  C     . ALA A 1 333 ? 22.233 9.957   5.916   1.00 35.85 ? 330 ALA A C     1 
ATOM   2605 O  O     . ALA A 1 333 ? 21.332 10.638  6.409   1.00 38.49 ? 330 ALA A O     1 
ATOM   2606 C  CB    . ALA A 1 333 ? 22.735 8.004   7.394   1.00 29.86 ? 330 ALA A CB    1 
ATOM   2607 N  N     . LEU A 1 334 ? 22.353 9.754   4.608   1.00 27.87 ? 331 LEU A N     1 
ATOM   2608 C  CA    . LEU A 1 334 ? 21.520 10.448  3.634   1.00 30.60 ? 331 LEU A CA    1 
ATOM   2609 C  C     . LEU A 1 334 ? 20.084 9.918   3.636   1.00 30.63 ? 331 LEU A C     1 
ATOM   2610 O  O     . LEU A 1 334 ? 19.852 8.743   3.373   1.00 33.99 ? 331 LEU A O     1 
ATOM   2611 C  CB    . LEU A 1 334 ? 22.129 10.315  2.238   1.00 27.08 ? 331 LEU A CB    1 
ATOM   2612 C  CG    . LEU A 1 334 ? 23.635 10.567  2.159   1.00 24.01 ? 331 LEU A CG    1 
ATOM   2613 C  CD1   . LEU A 1 334 ? 24.107 10.430  0.725   1.00 24.02 ? 331 LEU A CD1   1 
ATOM   2614 C  CD2   . LEU A 1 334 ? 23.967 11.952  2.715   1.00 22.30 ? 331 LEU A CD2   1 
ATOM   2615 N  N     . ALA A 1 335 ? 19.127 10.795  3.922   1.00 34.84 ? 332 ALA A N     1 
ATOM   2616 C  CA    . ALA A 1 335 ? 17.745 10.370  4.129   1.00 34.75 ? 332 ALA A CA    1 
ATOM   2617 C  C     . ALA A 1 335 ? 16.767 11.066  3.189   1.00 41.37 ? 332 ALA A C     1 
ATOM   2618 O  O     . ALA A 1 335 ? 15.558 10.829  3.253   1.00 37.13 ? 332 ALA A O     1 
ATOM   2619 C  CB    . ALA A 1 335 ? 17.342 10.610  5.574   1.00 36.96 ? 332 ALA A CB    1 
ATOM   2620 N  N     . THR A 1 336 ? 17.288 11.935  2.330   1.00 31.73 ? 333 THR A N     1 
ATOM   2621 C  CA    . THR A 1 336 ? 16.478 12.581  1.311   1.00 33.45 ? 333 THR A CA    1 
ATOM   2622 C  C     . THR A 1 336 ? 17.062 12.326  -0.074  1.00 43.62 ? 333 THR A C     1 
ATOM   2623 O  O     . THR A 1 336 ? 18.276 12.191  -0.237  1.00 36.19 ? 333 THR A O     1 
ATOM   2624 C  CB    . THR A 1 336 ? 16.357 14.102  1.542   1.00 38.70 ? 333 THR A CB    1 
ATOM   2625 O  OG1   . THR A 1 336 ? 17.549 14.768  1.104   1.00 37.25 ? 333 THR A OG1   1 
ATOM   2626 C  CG2   . THR A 1 336 ? 16.110 14.405  3.012   1.00 37.77 ? 333 THR A CG2   1 
ATOM   2627 N  N     . ARG A 1 337 ? 16.185 12.253  -1.069  1.00 42.67 ? 334 ARG A N     1 
ATOM   2628 C  CA    . ARG A 1 337 ? 16.603 12.053  -2.450  1.00 36.02 ? 334 ARG A CA    1 
ATOM   2629 C  C     . ARG A 1 337 ? 17.529 13.171  -2.914  1.00 38.93 ? 334 ARG A C     1 
ATOM   2630 O  O     . ARG A 1 337 ? 18.500 12.920  -3.627  1.00 37.90 ? 334 ARG A O     1 
ATOM   2631 C  CB    . ARG A 1 337 ? 15.380 11.961  -3.366  1.00 45.73 ? 334 ARG A CB    1 
ATOM   2632 C  CG    . ARG A 1 337 ? 15.716 11.774  -4.832  1.00 49.42 ? 334 ARG A CG    1 
ATOM   2633 C  CD    . ARG A 1 337 ? 14.476 11.455  -5.656  1.00 51.05 ? 334 ARG A CD    1 
ATOM   2634 N  NE    . ARG A 1 337 ? 13.376 12.379  -5.392  1.00 56.77 ? 334 ARG A NE    1 
ATOM   2635 C  CZ    . ARG A 1 337 ? 13.338 13.644  -5.803  1.00 61.89 ? 334 ARG A CZ    1 
ATOM   2636 N  NH1   . ARG A 1 337 ? 14.344 14.154  -6.500  1.00 59.06 ? 334 ARG A NH1   1 
ATOM   2637 N  NH2   . ARG A 1 337 ? 12.288 14.402  -5.514  1.00 63.44 ? 334 ARG A NH2   1 
ATOM   2638 N  N     . GLU A 1 338 ? 17.232 14.400  -2.498  1.00 42.10 ? 335 GLU A N     1 
ATOM   2639 C  CA    . GLU A 1 338 ? 18.058 15.560  -2.838  1.00 41.05 ? 335 GLU A CA    1 
ATOM   2640 C  C     . GLU A 1 338 ? 19.476 15.415  -2.294  1.00 31.80 ? 335 GLU A C     1 
ATOM   2641 O  O     . GLU A 1 338 ? 20.452 15.795  -2.943  1.00 28.66 ? 335 GLU A O     1 
ATOM   2642 C  CB    . GLU A 1 338 ? 17.428 16.844  -2.294  1.00 42.42 ? 335 GLU A CB    1 
ATOM   2643 C  CG    . GLU A 1 338 ? 16.176 17.298  -3.030  1.00 53.08 ? 335 GLU A CG    1 
ATOM   2644 C  CD    . GLU A 1 338 ? 16.462 17.821  -4.429  1.00 61.31 ? 335 GLU A CD    1 
ATOM   2645 O  OE1   . GLU A 1 338 ? 17.648 17.916  -4.810  1.00 59.14 ? 335 GLU A OE1   1 
ATOM   2646 O  OE2   . GLU A 1 338 ? 15.493 18.135  -5.154  1.00 63.44 ? 335 GLU A OE2   1 
ATOM   2647 N  N     . GLN A 1 339 ? 19.576 14.876  -1.086  1.00 36.04 ? 336 GLN A N     1 
ATOM   2648 C  CA    . GLN A 1 339 ? 20.870 14.624  -0.469  1.00 33.97 ? 336 GLN A CA    1 
ATOM   2649 C  C     . GLN A 1 339 ? 21.672 13.614  -1.273  1.00 33.79 ? 336 GLN A C     1 
ATOM   2650 O  O     . GLN A 1 339 ? 22.837 13.851  -1.608  1.00 26.93 ? 336 GLN A O     1 
ATOM   2651 C  CB    . GLN A 1 339 ? 20.689 14.106  0.950   1.00 34.77 ? 336 GLN A CB    1 
ATOM   2652 C  CG    . GLN A 1 339 ? 20.995 15.098  2.036   1.00 34.06 ? 336 GLN A CG    1 
ATOM   2653 C  CD    . GLN A 1 339 ? 20.967 14.437  3.389   1.00 33.13 ? 336 GLN A CD    1 
ATOM   2654 O  OE1   . GLN A 1 339 ? 20.055 13.664  3.693   1.00 32.75 ? 336 GLN A OE1   1 
ATOM   2655 N  NE2   . GLN A 1 339 ? 21.978 14.708  4.202   1.00 29.05 ? 336 GLN A NE2   1 
ATOM   2656 N  N     . VAL A 1 340 ? 21.036 12.482  -1.559  1.00 30.40 ? 337 VAL A N     1 
ATOM   2657 C  CA    . VAL A 1 340 ? 21.665 11.401  -2.301  1.00 30.07 ? 337 VAL A CA    1 
ATOM   2658 C  C     . VAL A 1 340 ? 22.164 11.908  -3.646  1.00 32.45 ? 337 VAL A C     1 
ATOM   2659 O  O     . VAL A 1 340 ? 23.272 11.576  -4.070  1.00 27.49 ? 337 VAL A O     1 
ATOM   2660 C  CB    . VAL A 1 340 ? 20.692 10.224  -2.512  1.00 32.70 ? 337 VAL A CB    1 
ATOM   2661 C  CG1   . VAL A 1 340 ? 21.292 9.179   -3.450  1.00 25.51 ? 337 VAL A CG1   1 
ATOM   2662 C  CG2   . VAL A 1 340 ? 20.338 9.598   -1.182  1.00 28.68 ? 337 VAL A CG2   1 
ATOM   2663 N  N     . GLN A 1 341 ? 21.357 12.738  -4.297  1.00 28.19 ? 338 GLN A N     1 
ATOM   2664 C  CA    . GLN A 1 341 ? 21.710 13.270  -5.607  1.00 25.09 ? 338 GLN A CA    1 
ATOM   2665 C  C     . GLN A 1 341 ? 22.847 14.271  -5.534  1.00 29.16 ? 338 GLN A C     1 
ATOM   2666 O  O     . GLN A 1 341 ? 23.704 14.303  -6.416  1.00 26.61 ? 338 GLN A O     1 
ATOM   2667 C  CB    . GLN A 1 341 ? 20.499 13.918  -6.272  1.00 31.71 ? 338 GLN A CB    1 
ATOM   2668 C  CG    . GLN A 1 341 ? 19.459 12.915  -6.728  1.00 36.54 ? 338 GLN A CG    1 
ATOM   2669 C  CD    . GLN A 1 341 ? 18.209 13.578  -7.277  1.00 39.73 ? 338 GLN A CD    1 
ATOM   2670 O  OE1   . GLN A 1 341 ? 18.057 14.798  -7.218  1.00 46.37 ? 338 GLN A OE1   1 
ATOM   2671 N  NE2   . GLN A 1 341 ? 17.307 12.769  -7.819  1.00 47.50 ? 338 GLN A NE2   1 
ATOM   2672 N  N     . TRP A 1 342 ? 22.857 15.096  -4.493  1.00 25.49 ? 339 TRP A N     1 
ATOM   2673 C  CA    . TRP A 1 342 ? 23.899 16.107  -4.376  1.00 21.09 ? 339 TRP A CA    1 
ATOM   2674 C  C     . TRP A 1 342 ? 25.252 15.432  -4.146  1.00 19.36 ? 339 TRP A C     1 
ATOM   2675 O  O     . TRP A 1 342 ? 26.249 15.832  -4.729  1.00 19.38 ? 339 TRP A O     1 
ATOM   2676 C  CB    . TRP A 1 342 ? 23.583 17.101  -3.246  1.00 22.86 ? 339 TRP A CB    1 
ATOM   2677 C  CG    . TRP A 1 342 ? 24.542 18.257  -3.182  1.00 24.81 ? 339 TRP A CG    1 
ATOM   2678 C  CD1   . TRP A 1 342 ? 24.510 19.398  -3.931  1.00 27.76 ? 339 TRP A CD1   1 
ATOM   2679 C  CD2   . TRP A 1 342 ? 25.679 18.376  -2.321  1.00 23.93 ? 339 TRP A CD2   1 
ATOM   2680 N  NE1   . TRP A 1 342 ? 25.555 20.217  -3.593  1.00 30.10 ? 339 TRP A NE1   1 
ATOM   2681 C  CE2   . TRP A 1 342 ? 26.287 19.616  -2.604  1.00 24.52 ? 339 TRP A CE2   1 
ATOM   2682 C  CE3   . TRP A 1 342 ? 26.238 17.557  -1.336  1.00 23.26 ? 339 TRP A CE3   1 
ATOM   2683 C  CZ2   . TRP A 1 342 ? 27.435 20.055  -1.943  1.00 25.12 ? 339 TRP A CZ2   1 
ATOM   2684 C  CZ3   . TRP A 1 342 ? 27.375 17.999  -0.672  1.00 21.74 ? 339 TRP A CZ3   1 
ATOM   2685 C  CH2   . TRP A 1 342 ? 27.962 19.237  -0.982  1.00 20.89 ? 339 TRP A CH2   1 
ATOM   2686 N  N     . TRP A 1 343 ? 25.275 14.402  -3.313  1.00 20.77 ? 340 TRP A N     1 
ATOM   2687 C  CA    . TRP A 1 343 ? 26.533 13.726  -3.010  1.00 16.43 ? 340 TRP A CA    1 
ATOM   2688 C  C     . TRP A 1 343 ? 26.996 12.852  -4.165  1.00 19.48 ? 340 TRP A C     1 
ATOM   2689 O  O     . TRP A 1 343 ? 28.196 12.705  -4.386  1.00 19.04 ? 340 TRP A O     1 
ATOM   2690 C  CB    . TRP A 1 343 ? 26.411 12.900  -1.738  1.00 20.29 ? 340 TRP A CB    1 
ATOM   2691 C  CG    . TRP A 1 343 ? 26.552 13.738  -0.508  1.00 19.25 ? 340 TRP A CG    1 
ATOM   2692 C  CD1   . TRP A 1 343 ? 25.577 14.050  0.396   1.00 24.05 ? 340 TRP A CD1   1 
ATOM   2693 C  CD2   . TRP A 1 343 ? 27.747 14.389  -0.056  1.00 18.15 ? 340 TRP A CD2   1 
ATOM   2694 N  NE1   . TRP A 1 343 ? 26.099 14.850  1.393   1.00 23.10 ? 340 TRP A NE1   1 
ATOM   2695 C  CE2   . TRP A 1 343 ? 27.427 15.071  1.134   1.00 20.98 ? 340 TRP A CE2   1 
ATOM   2696 C  CE3   . TRP A 1 343 ? 29.060 14.453  -0.542  1.00 20.14 ? 340 TRP A CE3   1 
ATOM   2697 C  CZ2   . TRP A 1 343 ? 28.375 15.809  1.850   1.00 21.80 ? 340 TRP A CZ2   1 
ATOM   2698 C  CZ3   . TRP A 1 343 ? 29.997 15.192  0.171   1.00 19.30 ? 340 TRP A CZ3   1 
ATOM   2699 C  CH2   . TRP A 1 343 ? 29.648 15.858  1.353   1.00 24.77 ? 340 TRP A CH2   1 
ATOM   2700 N  N     . LEU A 1 344 ? 26.059 12.297  -4.927  1.00 17.85 ? 341 LEU A N     1 
ATOM   2701 C  CA    . LEU A 1 344 ? 26.467 11.541  -6.114  1.00 18.96 ? 341 LEU A CA    1 
ATOM   2702 C  C     . LEU A 1 344 ? 27.157 12.476  -7.091  1.00 18.07 ? 341 LEU A C     1 
ATOM   2703 O  O     . LEU A 1 344 ? 28.151 12.119  -7.728  1.00 17.45 ? 341 LEU A O     1 
ATOM   2704 C  CB    . LEU A 1 344 ? 25.278 10.858  -6.793  1.00 17.16 ? 341 LEU A CB    1 
ATOM   2705 C  CG    . LEU A 1 344 ? 24.713 9.591   -6.158  1.00 20.04 ? 341 LEU A CG    1 
ATOM   2706 C  CD1   . LEU A 1 344 ? 23.464 9.157   -6.918  1.00 25.14 ? 341 LEU A CD1   1 
ATOM   2707 C  CD2   . LEU A 1 344 ? 25.738 8.453   -6.112  1.00 18.76 ? 341 LEU A CD2   1 
ATOM   2708 N  N     . LEU A 1 345 ? 26.638 13.690  -7.200  1.00 17.54 ? 342 LEU A N     1 
ATOM   2709 C  CA    . LEU A 1 345 ? 27.242 14.687  -8.061  1.00 15.71 ? 342 LEU A CA    1 
ATOM   2710 C  C     . LEU A 1 345 ? 28.640 15.094  -7.571  1.00 18.62 ? 342 LEU A C     1 
ATOM   2711 O  O     . LEU A 1 345 ? 29.558 15.265  -8.373  1.00 17.02 ? 342 LEU A O     1 
ATOM   2712 C  CB    . LEU A 1 345 ? 26.335 15.921  -8.161  1.00 21.66 ? 342 LEU A CB    1 
ATOM   2713 C  CG    . LEU A 1 345 ? 26.861 17.049  -9.046  1.00 20.55 ? 342 LEU A CG    1 
ATOM   2714 C  CD1   . LEU A 1 345 ? 27.137 16.546  -10.469 1.00 21.70 ? 342 LEU A CD1   1 
ATOM   2715 C  CD2   . LEU A 1 345 ? 25.884 18.220  -9.068  1.00 28.80 ? 342 LEU A CD2   1 
ATOM   2716 N  N     . GLN A 1 346 ? 28.802 15.245  -6.260  1.00 17.19 ? 343 GLN A N     1 
ATOM   2717 C  CA    . GLN A 1 346 ? 30.110 15.625  -5.720  1.00 15.40 ? 343 GLN A CA    1 
ATOM   2718 C  C     . GLN A 1 346 ? 31.142 14.567  -6.083  1.00 14.76 ? 343 GLN A C     1 
ATOM   2719 O  O     . GLN A 1 346 ? 32.228 14.895  -6.573  1.00 15.77 ? 343 GLN A O     1 
ATOM   2720 C  CB    . GLN A 1 346 ? 30.079 15.789  -4.198  1.00 18.29 ? 343 GLN A CB    1 
ATOM   2721 C  CG    . GLN A 1 346 ? 29.119 16.855  -3.673  1.00 17.33 ? 343 GLN A CG    1 
ATOM   2722 C  CD    . GLN A 1 346 ? 29.057 18.093  -4.533  1.00 20.55 ? 343 GLN A CD    1 
ATOM   2723 O  OE1   . GLN A 1 346 ? 30.002 18.887  -4.600  1.00 24.44 ? 343 GLN A OE1   1 
ATOM   2724 N  NE2   . GLN A 1 346 ? 27.922 18.275  -5.201  1.00 21.60 ? 343 GLN A NE2   1 
ATOM   2725 N  N     . LEU A 1 347 ? 30.793 13.316  -5.806  1.00 16.36 ? 344 LEU A N     1 
ATOM   2726 C  CA    . LEU A 1 347 ? 31.648 12.184  -6.145  1.00 15.68 ? 344 LEU A CA    1 
ATOM   2727 C  C     . LEU A 1 347 ? 31.938 12.165  -7.642  1.00 17.03 ? 344 LEU A C     1 
ATOM   2728 O  O     . LEU A 1 347 ? 33.085 11.978  -8.049  1.00 14.56 ? 344 LEU A O     1 
ATOM   2729 C  CB    . LEU A 1 347 ? 31.009 10.858  -5.719  1.00 14.19 ? 344 LEU A CB    1 
ATOM   2730 C  CG    . LEU A 1 347 ? 31.000 10.531  -4.227  1.00 23.46 ? 344 LEU A CG    1 
ATOM   2731 C  CD1   . LEU A 1 347 ? 30.370 9.177   -3.963  1.00 25.17 ? 344 LEU A CD1   1 
ATOM   2732 C  CD2   . LEU A 1 347 ? 32.389 10.545  -3.696  1.00 24.47 ? 344 LEU A CD2   1 
ATOM   2733 N  N     . ALA A 1 348 ? 30.905 12.364  -8.460  1.00 16.45 ? 345 ALA A N     1 
ATOM   2734 C  CA    . ALA A 1 348 ? 31.073 12.275  -9.910  1.00 13.71 ? 345 ALA A CA    1 
ATOM   2735 C  C     . ALA A 1 348 ? 31.964 13.377  -10.444 1.00 14.09 ? 345 ALA A C     1 
ATOM   2736 O  O     . ALA A 1 348 ? 32.656 13.202  -11.448 1.00 15.25 ? 345 ALA A O     1 
ATOM   2737 C  CB    . ALA A 1 348 ? 29.708 12.330  -10.617 1.00 13.36 ? 345 ALA A CB    1 
ATOM   2738 N  N     . GLN A 1 349 ? 31.915 14.533  -9.790  1.00 14.85 ? 346 GLN A N     1 
ATOM   2739 C  CA    . GLN A 1 349 ? 32.731 15.652  -10.198 1.00 14.94 ? 346 GLN A CA    1 
ATOM   2740 C  C     . GLN A 1 349 ? 34.207 15.402  -9.891  1.00 13.61 ? 346 GLN A C     1 
ATOM   2741 O  O     . GLN A 1 349 ? 35.067 15.724  -10.699 1.00 14.49 ? 346 GLN A O     1 
ATOM   2742 C  CB    . GLN A 1 349 ? 32.246 16.938  -9.532  1.00 17.73 ? 346 GLN A CB    1 
ATOM   2743 C  CG    . GLN A 1 349 ? 31.011 17.519  -10.218 1.00 21.07 ? 346 GLN A CG    1 
ATOM   2744 C  CD    . GLN A 1 349 ? 30.483 18.766  -9.523  1.00 31.49 ? 346 GLN A CD    1 
ATOM   2745 O  OE1   . GLN A 1 349 ? 30.994 19.174  -8.482  1.00 35.87 ? 346 GLN A OE1   1 
ATOM   2746 N  NE2   . GLN A 1 349 ? 29.456 19.377  -10.105 1.00 39.50 ? 346 GLN A NE2   1 
ATOM   2747 N  N     . GLU A 1 350 ? 34.494 14.806  -8.741  1.00 13.53 ? 347 GLU A N     1 
ATOM   2748 C  CA    . GLU A 1 350 ? 35.875 14.442  -8.451  1.00 14.49 ? 347 GLU A CA    1 
ATOM   2749 C  C     . GLU A 1 350 ? 36.308 13.350  -9.431  1.00 13.19 ? 347 GLU A C     1 
ATOM   2750 O  O     . GLU A 1 350 ? 37.410 13.408  -9.969  1.00 15.08 ? 347 GLU A O     1 
ATOM   2751 C  CB    . GLU A 1 350 ? 36.070 13.964  -7.008  1.00 13.46 ? 347 GLU A CB    1 
ATOM   2752 C  CG    . GLU A 1 350 ? 37.523 13.505  -6.770  1.00 15.07 ? 347 GLU A CG    1 
ATOM   2753 C  CD    . GLU A 1 350 ? 37.799 12.951  -5.380  1.00 21.07 ? 347 GLU A CD    1 
ATOM   2754 O  OE1   . GLU A 1 350 ? 37.144 13.372  -4.406  1.00 20.72 ? 347 GLU A OE1   1 
ATOM   2755 O  OE2   . GLU A 1 350 ? 38.685 12.081  -5.260  1.00 17.03 ? 347 GLU A OE2   1 
ATOM   2756 N  N     . LEU A 1 351 ? 35.438 12.373  -9.657  1.00 12.13 ? 348 LEU A N     1 
ATOM   2757 C  CA    . LEU A 1 351 ? 35.745 11.277  -10.574 1.00 14.04 ? 348 LEU A CA    1 
ATOM   2758 C  C     . LEU A 1 351 ? 36.030 11.797  -11.982 1.00 13.90 ? 348 LEU A C     1 
ATOM   2759 O  O     . LEU A 1 351 ? 36.992 11.370  -12.620 1.00 15.71 ? 348 LEU A O     1 
ATOM   2760 C  CB    . LEU A 1 351 ? 34.606 10.262  -10.608 1.00 15.14 ? 348 LEU A CB    1 
ATOM   2761 C  CG    . LEU A 1 351 ? 34.920 8.953   -11.345 1.00 17.59 ? 348 LEU A CG    1 
ATOM   2762 C  CD1   . LEU A 1 351 ? 36.161 8.289   -10.735 1.00 21.97 ? 348 LEU A CD1   1 
ATOM   2763 C  CD2   . LEU A 1 351 ? 33.727 8.005   -11.304 1.00 18.78 ? 348 LEU A CD2   1 
ATOM   2764 N  N     . GLU A 1 352 ? 35.207 12.723  -12.471 1.00 15.91 ? 349 GLU A N     1 
ATOM   2765 C  CA    . GLU A 1 352 ? 35.436 13.279  -13.804 1.00 15.80 ? 349 GLU A CA    1 
ATOM   2766 C  C     . GLU A 1 352 ? 36.788 13.963  -13.897 1.00 15.32 ? 349 GLU A C     1 
ATOM   2767 O  O     . GLU A 1 352 ? 37.512 13.824  -14.888 1.00 15.92 ? 349 GLU A O     1 
ATOM   2768 C  CB    . GLU A 1 352 ? 34.335 14.283  -14.182 1.00 18.52 ? 349 GLU A CB    1 
ATOM   2769 C  CG    . GLU A 1 352 ? 34.694 15.091  -15.431 1.00 23.04 ? 349 GLU A CG    1 
ATOM   2770 C  CD    . GLU A 1 352 ? 33.629 16.098  -15.842 1.00 38.49 ? 349 GLU A CD    1 
ATOM   2771 O  OE1   . GLU A 1 352 ? 33.902 16.904  -16.757 1.00 46.14 ? 349 GLU A OE1   1 
ATOM   2772 O  OE2   . GLU A 1 352 ? 32.526 16.098  -15.253 1.00 31.13 ? 349 GLU A OE2   1 
ATOM   2773 N  N     . GLU A 1 353 ? 37.134 14.707  -12.852 1.00 14.91 ? 350 GLU A N     1 
ATOM   2774 C  CA    . GLU A 1 353 ? 38.395 15.424  -12.820 1.00 12.65 ? 350 GLU A CA    1 
ATOM   2775 C  C     . GLU A 1 353 ? 39.563 14.445  -12.930 1.00 15.86 ? 350 GLU A C     1 
ATOM   2776 O  O     . GLU A 1 353 ? 40.501 14.637  -13.712 1.00 15.77 ? 350 GLU A O     1 
ATOM   2777 C  CB    . GLU A 1 353 ? 38.494 16.242  -11.533 1.00 19.40 ? 350 GLU A CB    1 
ATOM   2778 C  CG    . GLU A 1 353 ? 39.715 17.134  -11.434 1.00 28.20 ? 350 GLU A CG    1 
ATOM   2779 C  CD    . GLU A 1 353 ? 39.583 18.142  -10.302 1.00 38.91 ? 350 GLU A CD    1 
ATOM   2780 O  OE1   . GLU A 1 353 ? 39.495 17.710  -9.132  1.00 48.95 ? 350 GLU A OE1   1 
ATOM   2781 O  OE2   . GLU A 1 353 ? 39.539 19.358  -10.586 1.00 47.43 ? 350 GLU A OE2   1 
ATOM   2782 N  N     . ARG A 1 354 ? 39.480 13.372  -12.158 1.00 15.23 ? 351 ARG A N     1 
ATOM   2783 C  CA    . ARG A 1 354 ? 40.570 12.409  -12.134 1.00 14.34 ? 351 ARG A CA    1 
ATOM   2784 C  C     . ARG A 1 354 ? 40.618 11.607  -13.422 1.00 13.55 ? 351 ARG A C     1 
ATOM   2785 O  O     . ARG A 1 354 ? 41.704 11.312  -13.915 1.00 13.34 ? 351 ARG A O     1 
ATOM   2786 C  CB    . ARG A 1 354 ? 40.442 11.497  -10.915 1.00 14.66 ? 351 ARG A CB    1 
ATOM   2787 C  CG    . ARG A 1 354 ? 40.841 12.216  -9.625  1.00 15.72 ? 351 ARG A CG    1 
ATOM   2788 C  CD    . ARG A 1 354 ? 40.394 11.478  -8.382  1.00 17.73 ? 351 ARG A CD    1 
ATOM   2789 N  NE    . ARG A 1 354 ? 40.887 10.109  -8.318  1.00 15.81 ? 351 ARG A NE    1 
ATOM   2790 C  CZ    . ARG A 1 354 ? 40.423 9.208   -7.460  1.00 17.07 ? 351 ARG A CZ    1 
ATOM   2791 N  NH1   . ARG A 1 354 ? 39.463 9.540   -6.586  1.00 16.90 ? 351 ARG A NH1   1 
ATOM   2792 N  NH2   . ARG A 1 354 ? 40.921 7.984   -7.470  1.00 16.69 ? 351 ARG A NH2   1 
ATOM   2793 N  N     . LEU A 1 355 ? 39.446 11.274  -13.963 1.00 14.25 ? 352 LEU A N     1 
ATOM   2794 C  CA    . LEU A 1 355 ? 39.356 10.523  -15.213 1.00 15.10 ? 352 LEU A CA    1 
ATOM   2795 C  C     . LEU A 1 355 ? 39.923 11.325  -16.370 1.00 16.62 ? 352 LEU A C     1 
ATOM   2796 O  O     . LEU A 1 355 ? 40.644 10.787  -17.209 1.00 15.64 ? 352 LEU A O     1 
ATOM   2797 C  CB    . LEU A 1 355 ? 37.913 10.153  -15.508 1.00 16.23 ? 352 LEU A CB    1 
ATOM   2798 C  CG    . LEU A 1 355 ? 37.359 8.951   -14.752 1.00 15.70 ? 352 LEU A CG    1 
ATOM   2799 C  CD1   . LEU A 1 355 ? 35.905 8.763   -15.101 1.00 17.14 ? 352 LEU A CD1   1 
ATOM   2800 C  CD2   . LEU A 1 355 ? 38.139 7.685   -15.096 1.00 17.15 ? 352 LEU A CD2   1 
ATOM   2801 N  N     . THR A 1 356 ? 39.582 12.610  -16.425 1.00 13.49 ? 353 THR A N     1 
ATOM   2802 C  CA    . THR A 1 356 ? 40.045 13.440  -17.528 1.00 16.76 ? 353 THR A CA    1 
ATOM   2803 C  C     . THR A 1 356 ? 41.560 13.577  -17.497 1.00 16.52 ? 353 THR A C     1 
ATOM   2804 O  O     . THR A 1 356 ? 42.213 13.479  -18.532 1.00 17.40 ? 353 THR A O     1 
ATOM   2805 C  CB    . THR A 1 356 ? 39.363 14.822  -17.506 1.00 19.10 ? 353 THR A CB    1 
ATOM   2806 O  OG1   . THR A 1 356 ? 37.954 14.633  -17.684 1.00 19.54 ? 353 THR A OG1   1 
ATOM   2807 C  CG2   . THR A 1 356 ? 39.878 15.691  -18.618 1.00 19.69 ? 353 THR A CG2   1 
ATOM   2808 N  N     . LYS A 1 357 ? 42.124 13.776  -16.309 1.00 16.40 ? 354 LYS A N     1 
ATOM   2809 C  CA    . LYS A 1 357 ? 43.567 13.808  -16.181 1.00 14.02 ? 354 LYS A CA    1 
ATOM   2810 C  C     . LYS A 1 357 ? 44.186 12.461  -16.568 1.00 15.39 ? 354 LYS A C     1 
ATOM   2811 O  O     . LYS A 1 357 ? 45.201 12.412  -17.256 1.00 15.59 ? 354 LYS A O     1 
ATOM   2812 C  CB    . LYS A 1 357 ? 43.976 14.182  -14.756 1.00 16.78 ? 354 LYS A CB    1 
ATOM   2813 C  CG    . LYS A 1 357 ? 45.476 14.340  -14.617 1.00 25.40 ? 354 LYS A CG    1 
ATOM   2814 C  CD    . LYS A 1 357 ? 45.843 15.334  -13.530 1.00 41.78 ? 354 LYS A CD    1 
ATOM   2815 C  CE    . LYS A 1 357 ? 47.268 15.836  -13.737 1.00 41.66 ? 354 LYS A CE    1 
ATOM   2816 N  NZ    . LYS A 1 357 ? 48.214 14.699  -13.911 1.00 28.94 ? 354 LYS A NZ    1 
ATOM   2817 N  N     . ASP A 1 358 ? 43.567 11.369  -16.130 1.00 14.49 ? 355 ASP A N     1 
ATOM   2818 C  CA    . ASP A 1 358 ? 44.090 10.041  -16.450 1.00 15.75 ? 355 ASP A CA    1 
ATOM   2819 C  C     . ASP A 1 358 ? 44.124 9.800   -17.959 1.00 15.96 ? 355 ASP A C     1 
ATOM   2820 O  O     . ASP A 1 358 ? 45.085 9.235   -18.472 1.00 15.88 ? 355 ASP A O     1 
ATOM   2821 C  CB    . ASP A 1 358 ? 43.256 8.955   -15.765 1.00 15.63 ? 355 ASP A CB    1 
ATOM   2822 C  CG    . ASP A 1 358 ? 43.786 7.564   -16.031 1.00 15.41 ? 355 ASP A CG    1 
ATOM   2823 O  OD1   . ASP A 1 358 ? 44.772 7.167   -15.363 1.00 15.84 ? 355 ASP A OD1   1 
ATOM   2824 O  OD2   . ASP A 1 358 ? 43.217 6.868   -16.901 1.00 15.67 ? 355 ASP A OD2   1 
ATOM   2825 N  N     . ARG A 1 359 ? 43.082 10.238  -18.665 1.00 15.33 ? 356 ARG A N     1 
ATOM   2826 C  CA    . ARG A 1 359 ? 42.996 10.036  -20.109 1.00 17.98 ? 356 ARG A CA    1 
ATOM   2827 C  C     . ARG A 1 359 ? 44.121 10.770  -20.844 1.00 16.55 ? 356 ARG A C     1 
ATOM   2828 O  O     . ARG A 1 359 ? 44.745 10.224  -21.764 1.00 17.40 ? 356 ARG A O     1 
ATOM   2829 C  CB    . ARG A 1 359 ? 41.630 10.504  -20.625 1.00 17.82 ? 356 ARG A CB    1 
ATOM   2830 C  CG    . ARG A 1 359 ? 41.360 10.158  -22.094 1.00 16.55 ? 356 ARG A CG    1 
ATOM   2831 C  CD    . ARG A 1 359 ? 39.963 10.623  -22.506 1.00 19.86 ? 356 ARG A CD    1 
ATOM   2832 N  NE    . ARG A 1 359 ? 39.813 12.075  -22.405 1.00 22.77 ? 356 ARG A NE    1 
ATOM   2833 C  CZ    . ARG A 1 359 ? 38.647 12.715  -22.295 1.00 27.27 ? 356 ARG A CZ    1 
ATOM   2834 N  NH1   . ARG A 1 359 ? 37.504 12.038  -22.265 1.00 31.22 ? 356 ARG A NH1   1 
ATOM   2835 N  NH2   . ARG A 1 359 ? 38.625 14.041  -22.218 1.00 28.04 ? 356 ARG A NH2   1 
ATOM   2836 N  N     . ASN A 1 360 ? 44.394 12.001  -20.417 1.00 14.57 ? 357 ASN A N     1 
ATOM   2837 C  CA    . ASN A 1 360 ? 45.464 12.803  -21.005 1.00 15.91 ? 357 ASN A CA    1 
ATOM   2838 C  C     . ASN A 1 360 ? 46.848 12.246  -20.682 1.00 17.50 ? 357 ASN A C     1 
ATOM   2839 O  O     . ASN A 1 360 ? 47.741 12.251  -21.525 1.00 18.62 ? 357 ASN A O     1 
ATOM   2840 C  CB    . ASN A 1 360 ? 45.375 14.245  -20.519 1.00 16.12 ? 357 ASN A CB    1 
ATOM   2841 C  CG    . ASN A 1 360 ? 44.244 15.009  -21.161 1.00 20.70 ? 357 ASN A CG    1 
ATOM   2842 O  OD1   . ASN A 1 360 ? 43.895 14.776  -22.320 1.00 25.41 ? 357 ASN A OD1   1 
ATOM   2843 N  ND2   . ASN A 1 360 ? 43.676 15.947  -20.414 1.00 20.71 ? 357 ASN A ND2   1 
ATOM   2844 N  N     . ASP A 1 361 ? 47.024 11.763  -19.453 1.00 15.97 ? 358 ASP A N     1 
ATOM   2845 C  CA    . ASP A 1 361 ? 48.330 11.270  -19.029 1.00 18.21 ? 358 ASP A CA    1 
ATOM   2846 C  C     . ASP A 1 361 ? 48.665 9.888   -19.568 1.00 16.60 ? 358 ASP A C     1 
ATOM   2847 O  O     . ASP A 1 361 ? 49.819 9.617   -19.921 1.00 18.05 ? 358 ASP A O     1 
ATOM   2848 C  CB    . ASP A 1 361 ? 48.429 11.230  -17.494 1.00 17.05 ? 358 ASP A CB    1 
ATOM   2849 C  CG    . ASP A 1 361 ? 48.540 12.613  -16.878 1.00 25.05 ? 358 ASP A CG    1 
ATOM   2850 O  OD1   . ASP A 1 361 ? 48.747 13.596  -17.633 1.00 25.66 ? 358 ASP A OD1   1 
ATOM   2851 O  OD2   . ASP A 1 361 ? 48.441 12.701  -15.633 1.00 27.29 ? 358 ASP A OD2   1 
ATOM   2852 N  N     . ASN A 1 362 ? 47.667 9.013   -19.618 1.00 17.20 ? 359 ASN A N     1 
ATOM   2853 C  CA    . ASN A 1 362 ? 47.936 7.587   -19.765 1.00 17.61 ? 359 ASN A CA    1 
ATOM   2854 C  C     . ASN A 1 362 ? 47.309 6.947   -20.999 1.00 16.71 ? 359 ASN A C     1 
ATOM   2855 O  O     . ASN A 1 362 ? 47.376 5.735   -21.151 1.00 17.35 ? 359 ASN A O     1 
ATOM   2856 C  CB    . ASN A 1 362 ? 47.481 6.852   -18.490 1.00 15.08 ? 359 ASN A CB    1 
ATOM   2857 C  CG    . ASN A 1 362 ? 48.237 7.331   -17.238 1.00 15.18 ? 359 ASN A CG    1 
ATOM   2858 O  OD1   . ASN A 1 362 ? 49.455 7.481   -17.254 1.00 15.86 ? 359 ASN A OD1   1 
ATOM   2859 N  ND2   . ASN A 1 362 ? 47.502 7.577   -16.155 1.00 14.46 ? 359 ASN A ND2   1 
ATOM   2860 N  N     . ASP A 1 363 ? 46.725 7.752   -21.886 1.00 17.77 ? 360 ASP A N     1 
ATOM   2861 C  CA    . ASP A 1 363 ? 46.187 7.243   -23.158 1.00 16.57 ? 360 ASP A CA    1 
ATOM   2862 C  C     . ASP A 1 363 ? 45.243 6.071   -22.988 1.00 19.30 ? 360 ASP A C     1 
ATOM   2863 O  O     . ASP A 1 363 ? 45.400 5.026   -23.635 1.00 18.71 ? 360 ASP A O     1 
ATOM   2864 C  CB    . ASP A 1 363 ? 47.324 6.820   -24.094 1.00 23.31 ? 360 ASP A CB    1 
ATOM   2865 C  CG    . ASP A 1 363 ? 48.230 7.968   -24.450 1.00 27.51 ? 360 ASP A CG    1 
ATOM   2866 O  OD1   . ASP A 1 363 ? 47.694 9.043   -24.793 1.00 25.93 ? 360 ASP A OD1   1 
ATOM   2867 O  OD2   . ASP A 1 363 ? 49.469 7.800   -24.377 1.00 32.45 ? 360 ASP A OD2   1 
ATOM   2868 N  N     . ARG A 1 364 ? 44.266 6.233   -22.108 1.00 17.00 ? 361 ARG A N     1 
ATOM   2869 C  CA    . ARG A 1 364 ? 43.275 5.194   -21.897 1.00 18.39 ? 361 ARG A CA    1 
ATOM   2870 C  C     . ARG A 1 364 ? 41.957 5.813   -21.478 1.00 16.54 ? 361 ARG A C     1 
ATOM   2871 O  O     . ARG A 1 364 ? 41.923 6.965   -21.024 1.00 18.59 ? 361 ARG A O     1 
ATOM   2872 C  CB    . ARG A 1 364 ? 43.752 4.210   -20.836 1.00 17.41 ? 361 ARG A CB    1 
ATOM   2873 C  CG    . ARG A 1 364 ? 44.069 4.877   -19.510 1.00 15.32 ? 361 ARG A CG    1 
ATOM   2874 C  CD    . ARG A 1 364 ? 44.494 3.836   -18.494 1.00 14.34 ? 361 ARG A CD    1 
ATOM   2875 N  NE    . ARG A 1 364 ? 44.558 4.396   -17.157 1.00 14.48 ? 361 ARG A NE    1 
ATOM   2876 C  CZ    . ARG A 1 364 ? 44.850 3.687   -16.070 1.00 17.93 ? 361 ARG A CZ    1 
ATOM   2877 N  NH1   . ARG A 1 364 ? 44.883 4.277   -14.883 1.00 13.86 ? 361 ARG A NH1   1 
ATOM   2878 N  NH2   . ARG A 1 364 ? 45.094 2.393   -16.170 1.00 17.43 ? 361 ARG A NH2   1 
ATOM   2879 N  N     . VAL A 1 365 ? 40.880 5.047   -21.622 1.00 15.52 ? 362 VAL A N     1 
ATOM   2880 C  CA    . VAL A 1 365 ? 39.543 5.490   -21.227 1.00 17.52 ? 362 VAL A CA    1 
ATOM   2881 C  C     . VAL A 1 365 ? 38.779 4.391   -20.485 1.00 20.54 ? 362 VAL A C     1 
ATOM   2882 O  O     . VAL A 1 365 ? 38.757 3.232   -20.904 1.00 19.29 ? 362 VAL A O     1 
ATOM   2883 C  CB    . VAL A 1 365 ? 38.712 5.948   -22.459 1.00 19.89 ? 362 VAL A CB    1 
ATOM   2884 C  CG1   A VAL A 1 365 ? 39.257 7.243   -23.026 0.47 17.96 ? 362 VAL A CG1   1 
ATOM   2885 C  CG1   B VAL A 1 365 ? 38.779 4.910   -23.576 0.53 24.02 ? 362 VAL A CG1   1 
ATOM   2886 C  CG2   A VAL A 1 365 ? 38.689 4.866   -23.531 0.47 24.02 ? 362 VAL A CG2   1 
ATOM   2887 C  CG2   B VAL A 1 365 ? 37.279 6.268   -22.071 0.53 19.90 ? 362 VAL A CG2   1 
ATOM   2888 N  N     . ALA A 1 366 ? 38.157 4.759   -19.369 1.00 15.53 ? 363 ALA A N     1 
ATOM   2889 C  CA    . ALA A 1 366 ? 37.313 3.838   -18.624 1.00 15.97 ? 363 ALA A CA    1 
ATOM   2890 C  C     . ALA A 1 366 ? 35.992 3.595   -19.360 1.00 17.30 ? 363 ALA A C     1 
ATOM   2891 O  O     . ALA A 1 366 ? 35.437 4.516   -19.966 1.00 24.52 ? 363 ALA A O     1 
ATOM   2892 C  CB    . ALA A 1 366 ? 37.051 4.389   -17.222 1.00 15.71 ? 363 ALA A CB    1 
ATOM   2893 N  N     . THR A 1 367 ? 35.482 2.370   -19.315 1.00 16.03 ? 364 THR A N     1 
ATOM   2894 C  CA    . THR A 1 367 ? 34.242 2.080   -20.033 1.00 16.99 ? 364 THR A CA    1 
ATOM   2895 C  C     . THR A 1 367 ? 33.087 1.600   -19.163 1.00 18.26 ? 364 THR A C     1 
ATOM   2896 O  O     . THR A 1 367 ? 31.963 1.437   -19.647 1.00 19.53 ? 364 THR A O     1 
ATOM   2897 C  CB    . THR A 1 367 ? 34.490 1.038   -21.136 1.00 18.57 ? 364 THR A CB    1 
ATOM   2898 O  OG1   . THR A 1 367 ? 34.769 -0.234  -20.544 1.00 20.81 ? 364 THR A OG1   1 
ATOM   2899 C  CG2   . THR A 1 367 ? 35.672 1.474   -22.002 1.00 19.58 ? 364 THR A CG2   1 
ATOM   2900 N  N     . GLN A 1 368 ? 33.349 1.372   -17.883 1.00 17.47 ? 365 GLN A N     1 
ATOM   2901 C  CA    . GLN A 1 368 ? 32.317 0.881   -16.992 1.00 19.56 ? 365 GLN A CA    1 
ATOM   2902 C  C     . GLN A 1 368 ? 32.324 1.696   -15.712 1.00 17.43 ? 365 GLN A C     1 
ATOM   2903 O  O     . GLN A 1 368 ? 33.377 1.962   -15.144 1.00 20.77 ? 365 GLN A O     1 
ATOM   2904 C  CB    . GLN A 1 368 ? 32.526 -0.599  -16.684 1.00 22.91 ? 365 GLN A CB    1 
ATOM   2905 C  CG    . GLN A 1 368 ? 31.442 -1.222  -15.832 1.00 27.26 ? 365 GLN A CG    1 
ATOM   2906 C  CD    . GLN A 1 368 ? 31.657 -2.712  -15.625 1.00 31.86 ? 365 GLN A CD    1 
ATOM   2907 O  OE1   . GLN A 1 368 ? 32.505 -3.120  -14.832 1.00 40.46 ? 365 GLN A OE1   1 
ATOM   2908 N  NE2   . GLN A 1 368 ? 30.885 -3.530  -16.330 1.00 36.05 ? 365 GLN A NE2   1 
ATOM   2909 N  N     . LEU A 1 369 ? 31.138 2.110   -15.288 1.00 17.44 ? 366 LEU A N     1 
ATOM   2910 C  CA    . LEU A 1 369 ? 30.967 2.803   -14.017 1.00 21.42 ? 366 LEU A CA    1 
ATOM   2911 C  C     . LEU A 1 369 ? 30.344 1.846   -13.009 1.00 19.61 ? 366 LEU A C     1 
ATOM   2912 O  O     . LEU A 1 369 ? 29.296 1.254   -13.271 1.00 22.50 ? 366 LEU A O     1 
ATOM   2913 C  CB    . LEU A 1 369 ? 30.091 4.051   -14.196 1.00 19.11 ? 366 LEU A CB    1 
ATOM   2914 C  CG    . LEU A 1 369 ? 29.805 4.857   -12.927 1.00 21.16 ? 366 LEU A CG    1 
ATOM   2915 C  CD1   . LEU A 1 369 ? 31.043 5.637   -12.508 1.00 23.93 ? 366 LEU A CD1   1 
ATOM   2916 C  CD2   . LEU A 1 369 ? 28.606 5.780   -13.147 1.00 23.79 ? 366 LEU A CD2   1 
ATOM   2917 N  N     . VAL A 1 370 ? 30.998 1.665   -11.866 1.00 17.63 ? 367 VAL A N     1 
ATOM   2918 C  CA    . VAL A 1 370 ? 30.450 0.814   -10.820 1.00 16.98 ? 367 VAL A CA    1 
ATOM   2919 C  C     . VAL A 1 370 ? 29.926 1.681   -9.685  1.00 21.06 ? 367 VAL A C     1 
ATOM   2920 O  O     . VAL A 1 370 ? 30.630 2.569   -9.208  1.00 20.69 ? 367 VAL A O     1 
ATOM   2921 C  CB    . VAL A 1 370 ? 31.500 -0.172  -10.270 1.00 18.09 ? 367 VAL A CB    1 
ATOM   2922 C  CG1   . VAL A 1 370 ? 30.917 -0.976  -9.114  1.00 24.46 ? 367 VAL A CG1   1 
ATOM   2923 C  CG2   . VAL A 1 370 ? 31.992 -1.081  -11.384 1.00 21.86 ? 367 VAL A CG2   1 
ATOM   2924 N  N     . VAL A 1 371 ? 28.691 1.426   -9.270  1.00 17.17 ? 368 VAL A N     1 
ATOM   2925 C  CA    . VAL A 1 371 ? 28.055 2.199   -8.205  1.00 17.04 ? 368 VAL A CA    1 
ATOM   2926 C  C     . VAL A 1 371 ? 27.814 1.285   -7.020  1.00 21.45 ? 368 VAL A C     1 
ATOM   2927 O  O     . VAL A 1 371 ? 27.241 0.209   -7.170  1.00 22.76 ? 368 VAL A O     1 
ATOM   2928 C  CB    . VAL A 1 371 ? 26.728 2.820   -8.680  1.00 23.65 ? 368 VAL A CB    1 
ATOM   2929 C  CG1   . VAL A 1 371 ? 26.171 3.768   -7.629  1.00 20.94 ? 368 VAL A CG1   1 
ATOM   2930 C  CG2   . VAL A 1 371 ? 26.936 3.548   -9.992  1.00 23.17 ? 368 VAL A CG2   1 
ATOM   2931 N  N     . SER A 1 372 ? 28.286 1.692   -5.844  1.00 20.79 ? 369 SER A N     1 
ATOM   2932 C  CA    . SER A 1 372 ? 28.085 0.894   -4.649  1.00 21.37 ? 369 SER A CA    1 
ATOM   2933 C  C     . SER A 1 372 ? 27.556 1.758   -3.508  1.00 21.64 ? 369 SER A C     1 
ATOM   2934 O  O     . SER A 1 372 ? 27.922 2.925   -3.371  1.00 21.61 ? 369 SER A O     1 
ATOM   2935 C  CB    . SER A 1 372 ? 29.386 0.207   -4.243  1.00 27.25 ? 369 SER A CB    1 
ATOM   2936 O  OG    . SER A 1 372 ? 29.215 -0.554  -3.063  1.00 31.33 ? 369 SER A OG    1 
ATOM   2937 N  N     . ILE A 1 373 ? 26.660 1.191   -2.712  1.00 22.41 ? 370 ILE A N     1 
ATOM   2938 C  CA    . ILE A 1 373 ? 26.137 1.900   -1.555  1.00 23.93 ? 370 ILE A CA    1 
ATOM   2939 C  C     . ILE A 1 373 ? 26.093 1.001   -0.328  1.00 27.52 ? 370 ILE A C     1 
ATOM   2940 O  O     . ILE A 1 373 ? 26.177 -0.230  -0.423  1.00 26.00 ? 370 ILE A O     1 
ATOM   2941 C  CB    . ILE A 1 373 ? 24.710 2.476   -1.804  1.00 27.71 ? 370 ILE A CB    1 
ATOM   2942 C  CG1   . ILE A 1 373 ? 23.685 1.355   -1.951  1.00 31.65 ? 370 ILE A CG1   1 
ATOM   2943 C  CG2   . ILE A 1 373 ? 24.685 3.442   -3.004  1.00 19.12 ? 370 ILE A CG2   1 
ATOM   2944 C  CD1   . ILE A 1 373 ? 22.329 1.849   -2.405  1.00 30.68 ? 370 ILE A CD1   1 
ATOM   2945 N  N     . ARG A 1 374 ? 25.978 1.635   0.834   1.00 22.58 ? 371 ARG A N     1 
ATOM   2946 C  CA    . ARG A 1 374 ? 25.720 0.919   2.067   1.00 27.72 ? 371 ARG A CA    1 
ATOM   2947 C  C     . ARG A 1 374 ? 24.469 1.515   2.684   1.00 30.55 ? 371 ARG A C     1 
ATOM   2948 O  O     . ARG A 1 374 ? 24.228 2.721   2.583   1.00 27.18 ? 371 ARG A O     1 
ATOM   2949 C  CB    . ARG A 1 374 ? 26.905 1.014   3.021   1.00 32.93 ? 371 ARG A CB    1 
ATOM   2950 C  CG    . ARG A 1 374 ? 26.850 0.063   4.192   1.00 37.56 ? 371 ARG A CG    1 
ATOM   2951 C  CD    . ARG A 1 374 ? 28.052 0.279   5.075   1.00 42.50 ? 371 ARG A CD    1 
ATOM   2952 N  NE    . ARG A 1 374 ? 28.056 -0.591  6.242   1.00 55.09 ? 371 ARG A NE    1 
ATOM   2953 C  CZ    . ARG A 1 374 ? 28.827 -0.392  7.306   1.00 59.05 ? 371 ARG A CZ    1 
ATOM   2954 N  NH1   . ARG A 1 374 ? 29.644 0.653   7.345   1.00 50.93 ? 371 ARG A NH1   1 
ATOM   2955 N  NH2   . ARG A 1 374 ? 28.777 -1.228  8.333   1.00 61.77 ? 371 ARG A NH2   1 
ATOM   2956 N  N     . VAL A 1 375 ? 23.697 0.662   3.336   1.00 35.18 ? 372 VAL A N     1 
ATOM   2957 C  CA    . VAL A 1 375 ? 22.469 1.098   3.968   1.00 41.52 ? 372 VAL A CA    1 
ATOM   2958 C  C     . VAL A 1 375 ? 22.588 0.923   5.458   1.00 30.67 ? 372 VAL A C     1 
ATOM   2959 O  O     . VAL A 1 375 ? 23.215 0.026   5.923   1.00 32.41 ? 372 VAL A O     1 
ATOM   2960 C  CB    . VAL A 1 375 ? 21.277 0.315   3.469   1.00 44.39 ? 372 VAL A CB    1 
ATOM   2961 C  CG1   . VAL A 1 375 ? 21.032 0.552   1.978   1.00 44.28 ? 372 VAL A CG1   1 
ATOM   2962 C  CG2   . VAL A 1 375 ? 21.451 -1.122  3.809   1.00 42.43 ? 372 VAL A CG2   1 
ATOM   2963 N  N     . GLN A 1 376 ? 21.956 1.801   6.190   1.00 36.12 ? 373 GLN A N     1 
ATOM   2964 C  CA    . GLN A 1 376 ? 22.119 1.807   7.623   1.00 39.87 ? 373 GLN A CA    1 
ATOM   2965 C  C     . GLN A 1 376 ? 21.746 0.462   8.184   1.00 38.03 ? 373 GLN A C     1 
ATOM   2966 O  O     . GLN A 1 376 ? 20.729 -0.069  7.889   1.00 43.67 ? 373 GLN A O     1 
ATOM   2967 C  CB    . GLN A 1 376 ? 21.223 2.880   8.223   1.00 39.20 ? 373 GLN A CB    1 
ATOM   2968 C  CG    . GLN A 1 376 ? 21.500 3.274   9.677   1.00 47.48 ? 373 GLN A CG    1 
ATOM   2969 C  CD    . GLN A 1 376 ? 21.215 4.731   9.915   1.00 46.48 ? 373 GLN A CD    1 
ATOM   2970 O  OE1   . GLN A 1 376 ? 20.113 5.177   9.721   1.00 43.66 ? 373 GLN A OE1   1 
ATOM   2971 N  NE2   . GLN A 1 376 ? 22.260 5.501   10.241  1.00 48.89 ? 373 GLN A NE2   1 
ATOM   2972 N  N     . GLY A 1 377 ? 22.577 -0.065  9.038   1.00 42.60 ? 374 GLY A N     1 
ATOM   2973 C  CA    . GLY A 1 377 ? 22.345 -1.343  9.656   1.00 51.85 ? 374 GLY A CA    1 
ATOM   2974 C  C     . GLY A 1 377 ? 23.171 -2.511  9.117   1.00 54.08 ? 374 GLY A C     1 
ATOM   2975 O  O     . GLY A 1 377 ? 23.483 -3.412  9.845   1.00 46.14 ? 374 GLY A O     1 
ATOM   2976 N  N     . ASP A 1 378 ? 23.633 -2.416  7.880   1.00 41.62 ? 375 ASP A N     1 
ATOM   2977 C  CA    . ASP A 1 378 ? 24.437 -3.448  7.315   1.00 47.15 ? 375 ASP A CA    1 
ATOM   2978 C  C     . ASP A 1 378 ? 25.840 -3.305  7.820   1.00 55.54 ? 375 ASP A C     1 
ATOM   2979 O  O     . ASP A 1 378 ? 26.423 -2.233  7.846   1.00 57.22 ? 375 ASP A O     1 
ATOM   2980 C  CB    . ASP A 1 378 ? 24.380 -3.372  5.799   1.00 47.42 ? 375 ASP A CB    1 
ATOM   2981 C  CG    . ASP A 1 378 ? 24.927 -4.599  5.117   1.00 46.57 ? 375 ASP A CG    1 
ATOM   2982 O  OD1   . ASP A 1 378 ? 25.578 -5.429  5.730   1.00 48.16 ? 375 ASP A OD1   1 
ATOM   2983 O  OD2   . ASP A 1 378 ? 24.706 -4.701  3.939   1.00 44.04 ? 375 ASP A OD2   1 
ATOM   2984 N  N     . LYS A 1 379 ? 26.413 -4.399  8.228   1.00 57.16 ? 376 LYS A N     1 
ATOM   2985 C  CA    . LYS A 1 379 ? 27.755 -4.298  8.792   1.00 62.14 ? 376 LYS A CA    1 
ATOM   2986 C  C     . LYS A 1 379 ? 28.789 -4.505  7.680   1.00 64.74 ? 376 LYS A C     1 
ATOM   2987 O  O     . LYS A 1 379 ? 29.972 -4.176  7.830   1.00 64.73 ? 376 LYS A O     1 
ATOM   2988 C  CB    . LYS A 1 379 ? 27.932 -5.302  9.945   1.00 69.21 ? 376 LYS A CB    1 
ATOM   2989 C  CG    . LYS A 1 379 ? 29.353 -5.799  10.200  1.00 68.24 ? 376 LYS A CG    1 
ATOM   2990 C  CD    . LYS A 1 379 ? 29.381 -7.123  10.945  1.00 69.91 ? 376 LYS A CD    1 
ATOM   2991 C  CE    . LYS A 1 379 ? 30.813 -7.615  11.113  1.00 76.29 ? 376 LYS A CE    1 
ATOM   2992 N  NZ    . LYS A 1 379 ? 31.004 -8.298  12.423  1.00 68.87 ? 376 LYS A NZ    1 
ATOM   2993 N  N     . ARG A 1 380 ? 28.327 -5.018  6.543   1.00 58.51 ? 377 ARG A N     1 
ATOM   2994 C  CA    . ARG A 1 380 ? 29.187 -5.176  5.372   1.00 57.48 ? 377 ARG A CA    1 
ATOM   2995 C  C     . ARG A 1 380 ? 29.638 -3.826  4.813   1.00 55.70 ? 377 ARG A C     1 
ATOM   2996 O  O     . ARG A 1 380 ? 28.904 -2.839  4.889   1.00 57.77 ? 377 ARG A O     1 
ATOM   2997 C  CB    . ARG A 1 380 ? 28.465 -5.969  4.279   1.00 54.40 ? 377 ARG A CB    1 
ATOM   2998 C  CG    . ARG A 1 380 ? 28.024 -7.358  4.702   1.00 54.94 ? 377 ARG A CG    1 
ATOM   2999 C  CD    . ARG A 1 380 ? 27.280 -8.057  3.581   1.00 43.76 ? 377 ARG A CD    1 
ATOM   3000 N  NE    . ARG A 1 380 ? 26.043 -7.370  3.220   1.00 41.76 ? 377 ARG A NE    1 
ATOM   3001 C  CZ    . ARG A 1 380 ? 25.289 -7.712  2.181   1.00 41.53 ? 377 ARG A CZ    1 
ATOM   3002 N  NH1   . ARG A 1 380 ? 25.660 -8.725  1.410   1.00 36.81 ? 377 ARG A NH1   1 
ATOM   3003 N  NH2   . ARG A 1 380 ? 24.174 -7.047  1.909   1.00 37.06 ? 377 ARG A NH2   1 
ATOM   3004 N  N     . LEU A 1 381 ? 30.850 -3.793  4.264   1.00 52.78 ? 378 LEU A N     1 
ATOM   3005 C  CA    . LEU A 1 381 ? 31.360 -2.615  3.572   1.00 52.03 ? 378 LEU A CA    1 
ATOM   3006 C  C     . LEU A 1 381 ? 30.351 -2.147  2.527   1.00 52.33 ? 378 LEU A C     1 
ATOM   3007 O  O     . LEU A 1 381 ? 29.882 -1.010  2.566   1.00 50.00 ? 378 LEU A O     1 
ATOM   3008 C  CB    . LEU A 1 381 ? 32.712 -2.923  2.916   1.00 55.48 ? 378 LEU A CB    1 
ATOM   3009 C  CG    . LEU A 1 381 ? 33.395 -1.910  1.981   1.00 57.33 ? 378 LEU A CG    1 
ATOM   3010 C  CD1   . LEU A 1 381 ? 33.264 -0.469  2.476   1.00 54.16 ? 378 LEU A CD1   1 
ATOM   3011 C  CD2   . LEU A 1 381 ? 34.865 -2.277  1.767   1.00 49.92 ? 378 LEU A CD2   1 
ATOM   3012 N  N     . SER A 1 382 ? 30.012 -3.035  1.599   1.00 54.33 ? 379 SER A N     1 
ATOM   3013 C  CA    . SER A 1 382 ? 29.041 -2.710  0.566   1.00 46.25 ? 379 SER A CA    1 
ATOM   3014 C  C     . SER A 1 382 ? 27.754 -3.491  0.762   1.00 43.22 ? 379 SER A C     1 
ATOM   3015 O  O     . SER A 1 382 ? 27.783 -4.687  1.053   1.00 40.54 ? 379 SER A O     1 
ATOM   3016 C  CB    . SER A 1 382 ? 29.609 -2.993  -0.826  1.00 43.50 ? 379 SER A CB    1 
ATOM   3017 O  OG    . SER A 1 382 ? 28.590 -2.910  -1.814  1.00 40.52 ? 379 SER A OG    1 
ATOM   3018 N  N     . SER A 1 383 ? 26.627 -2.806  0.599   1.00 34.39 ? 380 SER A N     1 
ATOM   3019 C  CA    . SER A 1 383 ? 25.326 -3.455  0.641   1.00 39.03 ? 380 SER A CA    1 
ATOM   3020 C  C     . SER A 1 383 ? 24.903 -3.884  -0.753  1.00 42.62 ? 380 SER A C     1 
ATOM   3021 O  O     . SER A 1 383 ? 24.265 -4.921  -0.925  1.00 38.57 ? 380 SER A O     1 
ATOM   3022 C  CB    . SER A 1 383 ? 24.267 -2.528  1.245   1.00 42.27 ? 380 SER A CB    1 
ATOM   3023 O  OG    . SER A 1 383 ? 24.560 -2.220  2.597   1.00 38.69 ? 380 SER A OG    1 
ATOM   3024 N  N     . LEU A 1 384 ? 25.270 -3.080  -1.747  1.00 42.12 ? 381 LEU A N     1 
ATOM   3025 C  CA    . LEU A 1 384 ? 24.835 -3.304  -3.118  1.00 34.56 ? 381 LEU A CA    1 
ATOM   3026 C  C     . LEU A 1 384 ? 25.813 -2.709  -4.120  1.00 34.25 ? 381 LEU A C     1 
ATOM   3027 O  O     . LEU A 1 384 ? 26.258 -1.573  -3.963  1.00 26.66 ? 381 LEU A O     1 
ATOM   3028 C  CB    . LEU A 1 384 ? 23.444 -2.708  -3.339  1.00 32.32 ? 381 LEU A CB    1 
ATOM   3029 C  CG    . LEU A 1 384 ? 22.926 -2.617  -4.776  1.00 35.14 ? 381 LEU A CG    1 
ATOM   3030 C  CD1   . LEU A 1 384 ? 21.498 -3.115  -4.860  1.00 44.56 ? 381 LEU A CD1   1 
ATOM   3031 C  CD2   . LEU A 1 384 ? 23.009 -1.188  -5.286  1.00 36.43 ? 381 LEU A CD2   1 
ATOM   3032 N  N     . ARG A 1 385 ? 26.125 -3.482  -5.155  1.00 31.55 ? 382 ARG A N     1 
ATOM   3033 C  CA    . ARG A 1 385 ? 27.011 -3.043  -6.225  1.00 27.19 ? 382 ARG A CA    1 
ATOM   3034 C  C     . ARG A 1 385 ? 26.290 -3.210  -7.558  1.00 24.64 ? 382 ARG A C     1 
ATOM   3035 O  O     . ARG A 1 385 ? 25.786 -4.295  -7.861  1.00 28.96 ? 382 ARG A O     1 
ATOM   3036 C  CB    . ARG A 1 385 ? 28.309 -3.858  -6.213  1.00 34.48 ? 382 ARG A CB    1 
ATOM   3037 C  CG    . ARG A 1 385 ? 29.570 -3.061  -5.916  1.00 41.83 ? 382 ARG A CG    1 
ATOM   3038 C  CD    . ARG A 1 385 ? 30.661 -3.972  -5.351  1.00 49.81 ? 382 ARG A CD    1 
ATOM   3039 N  NE    . ARG A 1 385 ? 31.672 -3.228  -4.600  1.00 59.02 ? 382 ARG A NE    1 
ATOM   3040 C  CZ    . ARG A 1 385 ? 32.650 -3.794  -3.896  1.00 62.20 ? 382 ARG A CZ    1 
ATOM   3041 N  NH1   . ARG A 1 385 ? 32.747 -5.120  -3.824  1.00 52.54 ? 382 ARG A NH1   1 
ATOM   3042 N  NH2   . ARG A 1 385 ? 33.523 -3.030  -3.248  1.00 62.42 ? 382 ARG A NH2   1 
ATOM   3043 N  N     . ARG A 1 386 ? 26.214 -2.142  -8.341  1.00 19.74 ? 383 ARG A N     1 
ATOM   3044 C  CA    . ARG A 1 386 ? 25.602 -2.214  -9.662  1.00 24.94 ? 383 ARG A CA    1 
ATOM   3045 C  C     . ARG A 1 386 ? 26.474 -1.504  -10.685 1.00 23.92 ? 383 ARG A C     1 
ATOM   3046 O  O     . ARG A 1 386 ? 27.045 -0.454  -10.400 1.00 20.88 ? 383 ARG A O     1 
ATOM   3047 C  CB    . ARG A 1 386 ? 24.206 -1.603  -9.641  1.00 25.66 ? 383 ARG A CB    1 
ATOM   3048 C  CG    . ARG A 1 386 ? 23.237 -2.345  -8.753  1.00 29.84 ? 383 ARG A CG    1 
ATOM   3049 C  CD    . ARG A 1 386 ? 22.752 -3.598  -9.445  1.00 26.18 ? 383 ARG A CD    1 
ATOM   3050 N  NE    . ARG A 1 386 ? 21.543 -4.130  -8.830  1.00 26.95 ? 383 ARG A NE    1 
ATOM   3051 C  CZ    . ARG A 1 386 ? 21.539 -5.061  -7.884  1.00 31.00 ? 383 ARG A CZ    1 
ATOM   3052 N  NH1   . ARG A 1 386 ? 22.685 -5.569  -7.445  1.00 35.17 ? 383 ARG A NH1   1 
ATOM   3053 N  NH2   . ARG A 1 386 ? 20.388 -5.492  -7.384  1.00 37.88 ? 383 ARG A NH2   1 
ATOM   3054 N  N     . CYS A 1 387 ? 26.593 -2.075  -11.878 1.00 27.58 ? 384 CYS A N     1 
ATOM   3055 C  CA    . CYS A 1 387 ? 27.397 -1.441  -12.915 1.00 26.65 ? 384 CYS A CA    1 
ATOM   3056 C  C     . CYS A 1 387 ? 26.527 -0.864  -14.016 1.00 29.99 ? 384 CYS A C     1 
ATOM   3057 O  O     . CYS A 1 387 ? 25.411 -1.329  -14.258 1.00 29.40 ? 384 CYS A O     1 
ATOM   3058 C  CB    . CYS A 1 387 ? 28.403 -2.438  -13.511 1.00 31.04 ? 384 CYS A CB    1 
ATOM   3059 S  SG    A CYS A 1 387 ? 27.686 -3.822  -14.461 0.69 31.14 ? 384 CYS A SG    1 
ATOM   3060 S  SG    B CYS A 1 387 ? 29.395 -3.290  -12.281 0.31 33.30 ? 384 CYS A SG    1 
ATOM   3061 N  N     . CYS A 1 388 ? 27.044 0.163   -14.677 1.00 25.48 ? 385 CYS A N     1 
ATOM   3062 C  CA    . CYS A 1 388 ? 26.410 0.696   -15.872 1.00 29.88 ? 385 CYS A CA    1 
ATOM   3063 C  C     . CYS A 1 388 ? 27.484 1.195   -16.827 1.00 28.28 ? 385 CYS A C     1 
ATOM   3064 O  O     . CYS A 1 388 ? 28.648 1.301   -16.452 1.00 26.15 ? 385 CYS A O     1 
ATOM   3065 C  CB    . CYS A 1 388 ? 25.422 1.806   -15.513 1.00 30.21 ? 385 CYS A CB    1 
ATOM   3066 S  SG    . CYS A 1 388 ? 26.165 3.334   -14.944 1.00 31.13 ? 385 CYS A SG    1 
ATOM   3067 N  N     . ALA A 1 389 ? 27.106 1.487   -18.066 1.00 25.90 ? 386 ALA A N     1 
ATOM   3068 C  CA    . ALA A 1 389 ? 28.096 1.915   -19.048 1.00 23.58 ? 386 ALA A CA    1 
ATOM   3069 C  C     . ALA A 1 389 ? 28.620 3.313   -18.744 1.00 26.18 ? 386 ALA A C     1 
ATOM   3070 O  O     . ALA A 1 389 ? 27.875 4.205   -18.332 1.00 26.53 ? 386 ALA A O     1 
ATOM   3071 C  CB    . ALA A 1 389 ? 27.515 1.860   -20.456 1.00 21.81 ? 386 ALA A CB    1 
ATOM   3072 N  N     . LEU A 1 390 ? 29.918 3.493   -18.931 1.00 18.81 ? 387 LEU A N     1 
ATOM   3073 C  CA    . LEU A 1 390 ? 30.536 4.796   -18.807 1.00 17.89 ? 387 LEU A CA    1 
ATOM   3074 C  C     . LEU A 1 390 ? 30.962 5.222   -20.203 1.00 19.86 ? 387 LEU A C     1 
ATOM   3075 O  O     . LEU A 1 390 ? 32.009 4.801   -20.691 1.00 22.36 ? 387 LEU A O     1 
ATOM   3076 C  CB    . LEU A 1 390 ? 31.733 4.743   -17.854 1.00 21.40 ? 387 LEU A CB    1 
ATOM   3077 C  CG    . LEU A 1 390 ? 32.144 6.004   -17.089 1.00 18.51 ? 387 LEU A CG    1 
ATOM   3078 C  CD1   . LEU A 1 390 ? 33.344 5.656   -16.212 1.00 18.42 ? 387 LEU A CD1   1 
ATOM   3079 C  CD2   . LEU A 1 390 ? 32.477 7.174   -17.995 1.00 23.73 ? 387 LEU A CD2   1 
ATOM   3080 N  N     . THR A 1 391 ? 30.143 6.050   -20.844 1.00 24.33 ? 388 THR A N     1 
ATOM   3081 C  CA    . THR A 1 391 ? 30.336 6.389   -22.249 1.00 25.16 ? 388 THR A CA    1 
ATOM   3082 C  C     . THR A 1 391 ? 30.876 7.805   -22.462 1.00 24.05 ? 388 THR A C     1 
ATOM   3083 O  O     . THR A 1 391 ? 31.412 8.119   -23.523 1.00 28.59 ? 388 THR A O     1 
ATOM   3084 C  CB    . THR A 1 391 ? 29.013 6.250   -23.034 1.00 31.43 ? 388 THR A CB    1 
ATOM   3085 O  OG1   . THR A 1 391 ? 28.054 7.179   -22.517 1.00 37.84 ? 388 THR A OG1   1 
ATOM   3086 C  CG2   . THR A 1 391 ? 28.450 4.831   -22.907 1.00 26.23 ? 388 THR A CG2   1 
ATOM   3087 N  N     . ARG A 1 392 ? 30.717 8.658   -21.454 1.00 25.03 ? 389 ARG A N     1 
ATOM   3088 C  CA    . ARG A 1 392 ? 31.232 10.018  -21.512 1.00 23.57 ? 389 ARG A CA    1 
ATOM   3089 C  C     . ARG A 1 392 ? 31.772 10.462  -20.156 1.00 19.79 ? 389 ARG A C     1 
ATOM   3090 O  O     . ARG A 1 392 ? 31.174 10.189  -19.119 1.00 25.07 ? 389 ARG A O     1 
ATOM   3091 C  CB    . ARG A 1 392 ? 30.149 10.994  -21.976 1.00 30.90 ? 389 ARG A CB    1 
ATOM   3092 C  CG    . ARG A 1 392 ? 30.108 11.206  -23.476 1.00 38.06 ? 389 ARG A CG    1 
ATOM   3093 C  CD    . ARG A 1 392 ? 29.309 12.458  -23.803 1.00 41.05 ? 389 ARG A CD    1 
ATOM   3094 N  NE    . ARG A 1 392 ? 27.904 12.309  -23.440 1.00 52.01 ? 389 ARG A NE    1 
ATOM   3095 C  CZ    . ARG A 1 392 ? 26.924 12.109  -24.316 1.00 48.45 ? 389 ARG A CZ    1 
ATOM   3096 N  NH1   . ARG A 1 392 ? 27.189 12.052  -25.621 1.00 41.47 ? 389 ARG A NH1   1 
ATOM   3097 N  NH2   . ARG A 1 392 ? 25.674 11.982  -23.889 1.00 47.76 ? 389 ARG A NH2   1 
ATOM   3098 N  N     . TYR A 1 393 ? 32.908 11.142  -20.174 1.00 20.53 ? 390 TYR A N     1 
ATOM   3099 C  CA    . TYR A 1 393 ? 33.466 11.725  -18.962 1.00 19.68 ? 390 TYR A CA    1 
ATOM   3100 C  C     . TYR A 1 393 ? 32.712 13.006  -18.611 1.00 27.03 ? 390 TYR A C     1 
ATOM   3101 O  O     . TYR A 1 393 ? 33.207 14.116  -18.832 1.00 26.24 ? 390 TYR A O     1 
ATOM   3102 C  CB    . TYR A 1 393 ? 34.953 12.012  -19.138 1.00 19.30 ? 390 TYR A CB    1 
ATOM   3103 C  CG    . TYR A 1 393 ? 35.854 10.793  -19.045 1.00 16.73 ? 390 TYR A CG    1 
ATOM   3104 C  CD1   . TYR A 1 393 ? 37.235 10.930  -19.103 1.00 18.85 ? 390 TYR A CD1   1 
ATOM   3105 C  CD2   . TYR A 1 393 ? 35.327 9.517   -18.892 1.00 26.24 ? 390 TYR A CD2   1 
ATOM   3106 C  CE1   . TYR A 1 393 ? 38.070 9.825   -19.008 1.00 14.81 ? 390 TYR A CE1   1 
ATOM   3107 C  CE2   . TYR A 1 393 ? 36.154 8.402   -18.802 1.00 22.53 ? 390 TYR A CE2   1 
ATOM   3108 C  CZ    . TYR A 1 393 ? 37.522 8.564   -18.864 1.00 22.12 ? 390 TYR A CZ    1 
ATOM   3109 O  OH    . TYR A 1 393 ? 38.345 7.457   -18.763 1.00 19.81 ? 390 TYR A OH    1 
ATOM   3110 N  N     . ASP A 1 394 ? 31.501 12.842  -18.091 1.00 21.40 ? 391 ASP A N     1 
ATOM   3111 C  CA    . ASP A 1 394 ? 30.681 13.975  -17.695 1.00 20.73 ? 391 ASP A CA    1 
ATOM   3112 C  C     . ASP A 1 394 ? 30.040 13.689  -16.351 1.00 17.99 ? 391 ASP A C     1 
ATOM   3113 O  O     . ASP A 1 394 ? 29.315 12.704  -16.194 1.00 22.68 ? 391 ASP A O     1 
ATOM   3114 C  CB    . ASP A 1 394 ? 29.611 14.271  -18.745 1.00 26.91 ? 391 ASP A CB    1 
ATOM   3115 C  CG    . ASP A 1 394 ? 28.755 15.453  -18.366 1.00 30.87 ? 391 ASP A CG    1 
ATOM   3116 O  OD1   . ASP A 1 394 ? 27.712 15.235  -17.722 1.00 29.43 ? 391 ASP A OD1   1 
ATOM   3117 O  OD2   . ASP A 1 394 ? 29.136 16.597  -18.690 1.00 46.72 ? 391 ASP A OD2   1 
ATOM   3118 N  N     . ALA A 1 395 ? 30.326 14.549  -15.379 1.00 20.31 ? 392 ALA A N     1 
ATOM   3119 C  CA    . ALA A 1 395 ? 29.892 14.323  -14.006 1.00 21.50 ? 392 ALA A CA    1 
ATOM   3120 C  C     . ALA A 1 395 ? 28.370 14.289  -13.846 1.00 19.63 ? 392 ALA A C     1 
ATOM   3121 O  O     . ALA A 1 395 ? 27.839 13.466  -13.104 1.00 19.47 ? 392 ALA A O     1 
ATOM   3122 C  CB    . ALA A 1 395 ? 30.500 15.383  -13.087 1.00 18.53 ? 392 ALA A CB    1 
ATOM   3123 N  N     . HIS A 1 396 ? 27.662 15.177  -14.536 1.00 25.12 ? 393 HIS A N     1 
ATOM   3124 C  CA    . HIS A 1 396 ? 26.208 15.185  -14.418 1.00 26.54 ? 393 HIS A CA    1 
ATOM   3125 C  C     . HIS A 1 396 ? 25.605 13.913  -14.991 1.00 20.17 ? 393 HIS A C     1 
ATOM   3126 O  O     . HIS A 1 396 ? 24.693 13.338  -14.399 1.00 24.48 ? 393 HIS A O     1 
ATOM   3127 C  CB    . HIS A 1 396 ? 25.620 16.425  -15.097 1.00 25.39 ? 393 HIS A CB    1 
ATOM   3128 C  CG    . HIS A 1 396 ? 25.903 17.696  -14.357 1.00 31.49 ? 393 HIS A CG    1 
ATOM   3129 N  ND1   . HIS A 1 396 ? 26.925 18.548  -14.705 1.00 40.81 ? 393 HIS A ND1   1 
ATOM   3130 C  CD2   . HIS A 1 396 ? 25.307 18.243  -13.269 1.00 31.43 ? 393 HIS A CD2   1 
ATOM   3131 C  CE1   . HIS A 1 396 ? 26.943 19.576  -13.871 1.00 32.93 ? 393 HIS A CE1   1 
ATOM   3132 N  NE2   . HIS A 1 396 ? 25.974 19.413  -12.993 1.00 34.30 ? 393 HIS A NE2   1 
ATOM   3133 N  N     . LYS A 1 397 ? 26.131 13.455  -16.124 1.00 21.36 ? 394 LYS A N     1 
ATOM   3134 C  CA    . LYS A 1 397 ? 25.683 12.181  -16.683 1.00 24.34 ? 394 LYS A CA    1 
ATOM   3135 C  C     . LYS A 1 397 ? 26.001 11.006  -15.770 1.00 21.39 ? 394 LYS A C     1 
ATOM   3136 O  O     . LYS A 1 397 ? 25.150 10.153  -15.525 1.00 22.68 ? 394 LYS A O     1 
ATOM   3137 C  CB    . LYS A 1 397 ? 26.295 11.929  -18.062 1.00 25.42 ? 394 LYS A CB    1 
ATOM   3138 C  CG    . LYS A 1 397 ? 25.973 10.530  -18.603 1.00 30.12 ? 394 LYS A CG    1 
ATOM   3139 C  CD    . LYS A 1 397 ? 26.376 10.360  -20.061 1.00 35.83 ? 394 LYS A CD    1 
ATOM   3140 C  CE    . LYS A 1 397 ? 26.102 8.937   -20.547 1.00 33.21 ? 394 LYS A CE    1 
ATOM   3141 N  NZ    . LYS A 1 397 ? 24.707 8.476   -20.260 1.00 39.44 ? 394 LYS A NZ    1 
ATOM   3142 N  N     . MET A 1 398 ? 27.232 10.950  -15.267 1.00 20.88 ? 395 MET A N     1 
ATOM   3143 C  CA    . MET A 1 398 ? 27.606 9.835   -14.416 1.00 21.53 ? 395 MET A CA    1 
ATOM   3144 C  C     . MET A 1 398 ? 26.771 9.796   -13.134 1.00 18.38 ? 395 MET A C     1 
ATOM   3145 O  O     . MET A 1 398 ? 26.367 8.723   -12.689 1.00 20.01 ? 395 MET A O     1 
ATOM   3146 C  CB    . MET A 1 398 ? 29.104 9.884   -14.091 1.00 20.04 ? 395 MET A CB    1 
ATOM   3147 C  CG    . MET A 1 398 ? 29.989 9.483   -15.269 1.00 17.57 ? 395 MET A CG    1 
ATOM   3148 S  SD    . MET A 1 398 ? 31.708 9.275   -14.764 1.00 24.44 ? 395 MET A SD    1 
ATOM   3149 C  CE    . MET A 1 398 ? 32.184 10.997  -14.681 1.00 24.30 ? 395 MET A CE    1 
ATOM   3150 N  N     . SER A 1 399 ? 26.485 10.962  -12.560 1.00 21.03 ? 396 SER A N     1 
ATOM   3151 C  CA    . SER A 1 399 ? 25.735 11.003  -11.308 1.00 21.31 ? 396 SER A CA    1 
ATOM   3152 C  C     . SER A 1 399 ? 24.265 10.665  -11.553 1.00 17.55 ? 396 SER A C     1 
ATOM   3153 O  O     . SER A 1 399 ? 23.616 10.042  -10.720 1.00 19.46 ? 396 SER A O     1 
ATOM   3154 C  CB    . SER A 1 399 ? 25.872 12.370  -10.621 1.00 21.60 ? 396 SER A CB    1 
ATOM   3155 O  OG    . SER A 1 399 ? 25.332 13.430  -11.390 1.00 25.62 ? 396 SER A OG    1 
ATOM   3156 N  N     . HIS A 1 400 ? 23.756 11.055  -12.713 1.00 24.86 ? 397 HIS A N     1 
ATOM   3157 C  CA    . HIS A 1 400 ? 22.391 10.695  -13.075 1.00 26.97 ? 397 HIS A CA    1 
ATOM   3158 C  C     . HIS A 1 400 ? 22.282 9.184   -13.303 1.00 25.23 ? 397 HIS A C     1 
ATOM   3159 O  O     . HIS A 1 400 ? 21.352 8.541   -12.832 1.00 25.12 ? 397 HIS A O     1 
ATOM   3160 C  CB    . HIS A 1 400 ? 21.947 11.463  -14.315 1.00 31.42 ? 397 HIS A CB    1 
ATOM   3161 C  CG    . HIS A 1 400 ? 20.535 11.180  -14.719 1.00 39.06 ? 397 HIS A CG    1 
ATOM   3162 N  ND1   . HIS A 1 400 ? 20.188 10.103  -15.504 1.00 41.66 ? 397 HIS A ND1   1 
ATOM   3163 C  CD2   . HIS A 1 400 ? 19.382 11.833  -14.440 1.00 46.67 ? 397 HIS A CD2   1 
ATOM   3164 C  CE1   . HIS A 1 400 ? 18.879 10.104  -15.695 1.00 46.16 ? 397 HIS A CE1   1 
ATOM   3165 N  NE2   . HIS A 1 400 ? 18.368 11.142  -15.061 1.00 42.48 ? 397 HIS A NE2   1 
ATOM   3166 N  N     . ASP A 1 401 ? 23.259 8.620   -14.010 1.00 25.68 ? 398 ASP A N     1 
ATOM   3167 C  CA    . ASP A 1 401 ? 23.303 7.182   -14.239 1.00 23.30 ? 398 ASP A CA    1 
ATOM   3168 C  C     . ASP A 1 401 ? 23.444 6.374   -12.958 1.00 24.62 ? 398 ASP A C     1 
ATOM   3169 O  O     . ASP A 1 401 ? 22.827 5.323   -12.820 1.00 26.49 ? 398 ASP A O     1 
ATOM   3170 C  CB    . ASP A 1 401 ? 24.445 6.823   -15.190 1.00 21.91 ? 398 ASP A CB    1 
ATOM   3171 C  CG    . ASP A 1 401 ? 24.192 7.293   -16.608 1.00 33.14 ? 398 ASP A CG    1 
ATOM   3172 O  OD1   . ASP A 1 401 ? 23.038 7.665   -16.920 1.00 32.32 ? 398 ASP A OD1   1 
ATOM   3173 O  OD2   . ASP A 1 401 ? 25.139 7.260   -17.419 1.00 29.14 ? 398 ASP A OD2   1 
ATOM   3174 N  N     . ALA A 1 402 ? 24.267 6.855   -12.025 1.00 21.69 ? 399 ALA A N     1 
ATOM   3175 C  CA    . ALA A 1 402 ? 24.433 6.182   -10.747 1.00 23.77 ? 399 ALA A CA    1 
ATOM   3176 C  C     . ALA A 1 402 ? 23.115 6.169   -9.990  1.00 18.11 ? 399 ALA A C     1 
ATOM   3177 O  O     . ALA A 1 402 ? 22.750 5.169   -9.363  1.00 22.70 ? 399 ALA A O     1 
ATOM   3178 C  CB    . ALA A 1 402 ? 25.517 6.868   -9.912  1.00 20.14 ? 399 ALA A CB    1 
ATOM   3179 N  N     . PHE A 1 403 ? 22.411 7.297   -10.034 1.00 23.15 ? 400 PHE A N     1 
ATOM   3180 C  CA    . PHE A 1 403 ? 21.142 7.408   -9.331  1.00 27.59 ? 400 PHE A CA    1 
ATOM   3181 C  C     . PHE A 1 403 ? 20.154 6.399   -9.897  1.00 29.61 ? 400 PHE A C     1 
ATOM   3182 O  O     . PHE A 1 403 ? 19.477 5.692   -9.155  1.00 30.22 ? 400 PHE A O     1 
ATOM   3183 C  CB    . PHE A 1 403 ? 20.579 8.822   -9.441  1.00 26.16 ? 400 PHE A CB    1 
ATOM   3184 C  CG    . PHE A 1 403 ? 19.312 9.024   -8.672  1.00 38.20 ? 400 PHE A CG    1 
ATOM   3185 C  CD1   . PHE A 1 403 ? 18.101 9.163   -9.332  1.00 34.74 ? 400 PHE A CD1   1 
ATOM   3186 C  CD2   . PHE A 1 403 ? 19.332 9.072   -7.288  1.00 35.68 ? 400 PHE A CD2   1 
ATOM   3187 C  CE1   . PHE A 1 403 ? 16.928 9.344   -8.625  1.00 45.16 ? 400 PHE A CE1   1 
ATOM   3188 C  CE2   . PHE A 1 403 ? 18.164 9.257   -6.572  1.00 47.06 ? 400 PHE A CE2   1 
ATOM   3189 C  CZ    . PHE A 1 403 ? 16.959 9.393   -7.242  1.00 47.69 ? 400 PHE A CZ    1 
ATOM   3190 N  N     . THR A 1 404 ? 20.105 6.325   -11.220 1.00 31.34 ? 401 THR A N     1 
ATOM   3191 C  CA    . THR A 1 404 ? 19.221 5.399   -11.916 1.00 30.00 ? 401 THR A CA    1 
ATOM   3192 C  C     . THR A 1 404 ? 19.416 3.942   -11.480 1.00 32.18 ? 401 THR A C     1 
ATOM   3193 O  O     . THR A 1 404 ? 18.442 3.214   -11.285 1.00 33.24 ? 401 THR A O     1 
ATOM   3194 C  CB    . THR A 1 404 ? 19.414 5.506   -13.446 1.00 29.69 ? 401 THR A CB    1 
ATOM   3195 O  OG1   . THR A 1 404 ? 19.015 6.810   -13.883 1.00 29.00 ? 401 THR A OG1   1 
ATOM   3196 C  CG2   . THR A 1 404 ? 18.583 4.461   -14.178 1.00 34.20 ? 401 THR A CG2   1 
ATOM   3197 N  N     . VAL A 1 405 ? 20.662 3.511   -11.303 1.00 23.98 ? 402 VAL A N     1 
ATOM   3198 C  CA    . VAL A 1 405 ? 20.899 2.109   -10.985 1.00 26.34 ? 402 VAL A CA    1 
ATOM   3199 C  C     . VAL A 1 405 ? 20.689 1.801   -9.502  1.00 30.47 ? 402 VAL A C     1 
ATOM   3200 O  O     . VAL A 1 405 ? 20.589 0.633   -9.133  1.00 33.29 ? 402 VAL A O     1 
ATOM   3201 C  CB    . VAL A 1 405 ? 22.315 1.660   -11.407 1.00 34.55 ? 402 VAL A CB    1 
ATOM   3202 C  CG1   . VAL A 1 405 ? 22.591 2.091   -12.833 1.00 34.00 ? 402 VAL A CG1   1 
ATOM   3203 C  CG2   . VAL A 1 405 ? 23.359 2.217   -10.475 1.00 33.32 ? 402 VAL A CG2   1 
ATOM   3204 N  N     . ILE A 1 406 ? 20.607 2.833   -8.659  1.00 30.14 ? 403 ILE A N     1 
ATOM   3205 C  CA    . ILE A 1 406 ? 20.402 2.622   -7.223  1.00 36.16 ? 403 ILE A CA    1 
ATOM   3206 C  C     . ILE A 1 406 ? 19.015 3.012   -6.706  1.00 38.11 ? 403 ILE A C     1 
ATOM   3207 O  O     . ILE A 1 406 ? 18.637 2.616   -5.601  1.00 38.94 ? 403 ILE A O     1 
ATOM   3208 C  CB    . ILE A 1 406 ? 21.427 3.409   -6.367  1.00 30.43 ? 403 ILE A CB    1 
ATOM   3209 C  CG1   . ILE A 1 406 ? 21.117 4.910   -6.399  1.00 26.34 ? 403 ILE A CG1   1 
ATOM   3210 C  CG2   . ILE A 1 406 ? 22.825 3.109   -6.819  1.00 27.64 ? 403 ILE A CG2   1 
ATOM   3211 C  CD1   . ILE A 1 406 ? 21.828 5.711   -5.317  1.00 33.68 ? 403 ILE A CD1   1 
ATOM   3212 N  N     . LYS A 1 407 ? 18.267 3.784   -7.492  1.00 32.55 ? 404 LYS A N     1 
ATOM   3213 C  CA    . LYS A 1 407 ? 17.029 4.406   -7.015  1.00 41.74 ? 404 LYS A CA    1 
ATOM   3214 C  C     . LYS A 1 407 ? 15.987 3.403   -6.510  1.00 49.35 ? 404 LYS A C     1 
ATOM   3215 O  O     . LYS A 1 407 ? 15.099 3.759   -5.731  1.00 49.32 ? 404 LYS A O     1 
ATOM   3216 C  CB    . LYS A 1 407 ? 16.419 5.267   -8.122  1.00 42.87 ? 404 LYS A CB    1 
ATOM   3217 C  CG    . LYS A 1 407 ? 16.009 4.475   -9.349  1.00 39.61 ? 404 LYS A CG    1 
ATOM   3218 C  CD    . LYS A 1 407 ? 15.527 5.380   -10.463 1.00 42.91 ? 404 LYS A CD    1 
ATOM   3219 C  CE    . LYS A 1 407 ? 15.179 4.567   -11.698 1.00 46.13 ? 404 LYS A CE    1 
ATOM   3220 N  NZ    . LYS A 1 407 ? 14.740 5.435   -12.822 1.00 52.91 ? 404 LYS A NZ    1 
ATOM   3221 N  N     . ASN A 1 408 ? 16.074 2.169   -6.966  1.00 44.69 ? 405 ASN A N     1 
ATOM   3222 C  CA    . ASN A 1 408 ? 15.119 1.151   -6.577  1.00 47.81 ? 405 ASN A CA    1 
ATOM   3223 C  C     . ASN A 1 408 ? 15.396 0.577   -5.218  1.00 50.16 ? 405 ASN A C     1 
ATOM   3224 O  O     . ASN A 1 408 ? 14.679 -0.241  -4.704  1.00 46.39 ? 405 ASN A O     1 
ATOM   3225 C  CB    . ASN A 1 408 ? 15.051 0.072   -7.619  1.00 47.63 ? 405 ASN A CB    1 
ATOM   3226 C  CG    . ASN A 1 408 ? 13.984 0.344   -8.628  1.00 58.86 ? 405 ASN A CG    1 
ATOM   3227 O  OD1   . ASN A 1 408 ? 12.808 0.252   -8.313  1.00 65.26 ? 405 ASN A OD1   1 
ATOM   3228 N  ND2   . ASN A 1 408 ? 14.380 0.695   -9.840  1.00 58.88 ? 405 ASN A ND2   1 
ATOM   3229 N  N     . CYS A 1 409 ? 16.506 1.021   -4.688  1.00 43.59 ? 406 CYS A N     1 
ATOM   3230 C  CA    . CYS A 1 409 ? 16.946 0.665   -3.391  1.00 48.03 ? 406 CYS A CA    1 
ATOM   3231 C  C     . CYS A 1 409 ? 16.113 1.230   -2.317  1.00 43.29 ? 406 CYS A C     1 
ATOM   3232 O  O     . CYS A 1 409 ? 16.062 0.690   -1.255  1.00 48.97 ? 406 CYS A O     1 
ATOM   3233 C  CB    . CYS A 1 409 ? 18.360 1.145   -3.225  1.00 49.53 ? 406 CYS A CB    1 
ATOM   3234 S  SG    . CYS A 1 409 ? 19.299 -0.124  -3.948  1.00 55.23 ? 406 CYS A SG    1 
ATOM   3235 N  N     . ASN A 1 410 ? 15.518 2.379   -2.631  1.00 40.58 ? 407 ASN A N     1 
ATOM   3236 C  CA    . ASN A 1 410 ? 14.735 3.168   -1.699  1.00 43.43 ? 407 ASN A CA    1 
ATOM   3237 C  C     . ASN A 1 410 ? 13.397 2.521   -1.418  1.00 48.03 ? 407 ASN A C     1 
ATOM   3238 O  O     . ASN A 1 410 ? 12.541 2.404   -2.295  1.00 48.51 ? 407 ASN A O     1 
ATOM   3239 C  CB    . ASN A 1 410 ? 14.531 4.586   -2.236  1.00 40.48 ? 407 ASN A CB    1 
ATOM   3240 C  CG    . ASN A 1 410 ? 13.891 5.508   -1.217  1.00 41.35 ? 407 ASN A CG    1 
ATOM   3241 O  OD1   . ASN A 1 410 ? 13.622 5.109   -0.084  1.00 41.52 ? 407 ASN A OD1   1 
ATOM   3242 N  ND2   . ASN A 1 410 ? 13.643 6.750   -1.616  1.00 45.01 ? 407 ASN A ND2   1 
ATOM   3243 N  N     . THR A 1 411 ? 13.235 2.101   -0.174  1.00 46.77 ? 408 THR A N     1 
ATOM   3244 C  CA    . THR A 1 411 ? 12.033 1.420   0.272   1.00 51.61 ? 408 THR A CA    1 
ATOM   3245 C  C     . THR A 1 411 ? 10.974 2.426   0.648   1.00 51.11 ? 408 THR A C     1 
ATOM   3246 O  O     . THR A 1 411 ? 9.830  2.084   0.665   1.00 53.15 ? 408 THR A O     1 
ATOM   3247 C  CB    . THR A 1 411 ? 12.379 0.424   1.376   1.00 49.12 ? 408 THR A CB    1 
ATOM   3248 O  OG1   . THR A 1 411 ? 11.256 -0.403  1.685   1.00 63.37 ? 408 THR A OG1   1 
ATOM   3249 C  CG2   . THR A 1 411 ? 12.864 1.093   2.601   1.00 48.49 ? 408 THR A CG2   1 
ATOM   3250 N  N     . SER A 1 412 ? 11.357 3.667   0.924   1.00 50.32 ? 409 SER A N     1 
ATOM   3251 C  CA    . SER A 1 412 ? 10.399 4.738   1.193   1.00 52.40 ? 409 SER A CA    1 
ATOM   3252 C  C     . SER A 1 412 ? 9.315  4.805   0.130   1.00 57.79 ? 409 SER A C     1 
ATOM   3253 O  O     . SER A 1 412 ? 9.609  4.913   -1.059  1.00 58.28 ? 409 SER A O     1 
ATOM   3254 C  CB    . SER A 1 412 ? 11.116 6.089   1.278   1.00 54.02 ? 409 SER A CB    1 
ATOM   3255 O  OG    . SER A 1 412 ? 10.214 7.175   1.148   1.00 60.16 ? 409 SER A OG    1 
ATOM   3256 N  N     . GLY A 1 413 ? 8.072  4.875   0.564   1.00 62.25 ? 410 GLY A N     1 
ATOM   3257 C  CA    . GLY A 1 413 ? 6.953  5.208   -0.302  1.00 63.50 ? 410 GLY A CA    1 
ATOM   3258 C  C     . GLY A 1 413 ? 6.939  6.608   -0.880  1.00 67.34 ? 410 GLY A C     1 
ATOM   3259 O  O     . GLY A 1 413 ? 6.483  6.808   -1.987  1.00 64.92 ? 410 GLY A O     1 
ATOM   3260 N  N     . ILE A 1 414 ? 7.392  7.556   -0.059  1.00 64.48 ? 411 ILE A N     1 
ATOM   3261 C  CA    . ILE A 1 414 ? 7.521  8.943   -0.376  1.00 67.94 ? 411 ILE A CA    1 
ATOM   3262 C  C     . ILE A 1 414 ? 8.726  9.097   -1.271  1.00 69.56 ? 411 ILE A C     1 
ATOM   3263 O  O     . ILE A 1 414 ? 9.797  8.583   -0.987  1.00 64.57 ? 411 ILE A O     1 
ATOM   3264 C  CB    . ILE A 1 414 ? 7.673  9.795   0.919   1.00 67.57 ? 411 ILE A CB    1 
ATOM   3265 C  CG1   . ILE A 1 414 ? 6.406  9.729   1.773   1.00 66.90 ? 411 ILE A CG1   1 
ATOM   3266 C  CG2   . ILE A 1 414 ? 7.897  11.247  0.587   1.00 65.06 ? 411 ILE A CG2   1 
ATOM   3267 C  CD1   . ILE A 1 414 ? 6.465  8.773   2.939   1.00 58.05 ? 411 ILE A CD1   1 
ATOM   3268 N  N     . GLN A 1 415 ? 8.502  9.858   -2.320  1.00 76.10 ? 412 GLN A N     1 
ATOM   3269 C  CA    . GLN A 1 415 ? 9.364  10.047  -3.466  1.00 73.57 ? 412 GLN A CA    1 
ATOM   3270 C  C     . GLN A 1 415 ? 10.656 10.638  -2.984  1.00 69.93 ? 412 GLN A C     1 
ATOM   3271 O  O     . GLN A 1 415 ? 11.751 10.174  -3.303  1.00 64.90 ? 412 GLN A O     1 
ATOM   3272 C  CB    . GLN A 1 415 ? 8.707  10.947  -4.513  1.00 73.75 ? 412 GLN A CB    1 
ATOM   3273 C  CG    . GLN A 1 415 ? 8.452  12.367  -4.042  1.00 80.28 ? 412 GLN A CG    1 
ATOM   3274 C  CD    . GLN A 1 415 ? 7.801  13.228  -5.105  1.00 89.91 ? 412 GLN A CD    1 
ATOM   3275 O  OE1   . GLN A 1 415 ? 7.206  12.712  -6.051  1.00 93.75 ? 412 GLN A OE1   1 
ATOM   3276 N  NE2   . GLN A 1 415 ? 7.911  14.544  -4.952  1.00 89.54 ? 412 GLN A NE2   1 
ATOM   3277 N  N     . THR A 1 416 ? 10.456 11.681  -2.201  1.00 67.32 ? 413 THR A N     1 
ATOM   3278 C  CA    . THR A 1 416 ? 11.440 12.584  -1.654  1.00 63.62 ? 413 THR A CA    1 
ATOM   3279 C  C     . THR A 1 416 ? 12.339 12.020  -0.606  1.00 57.08 ? 413 THR A C     1 
ATOM   3280 O  O     . THR A 1 416 ? 13.493 12.334  -0.508  1.00 53.34 ? 413 THR A O     1 
ATOM   3281 C  CB    . THR A 1 416 ? 10.674 13.735  -1.025  1.00 66.13 ? 413 THR A CB    1 
ATOM   3282 O  OG1   . THR A 1 416 ? 9.549  13.981  -1.833  1.00 69.69 ? 413 THR A OG1   1 
ATOM   3283 C  CG2   . THR A 1 416 ? 11.495 14.958  -0.995  1.00 62.25 ? 413 THR A CG2   1 
ATOM   3284 N  N     . GLU A 1 417 ? 11.757 11.224  0.237   1.00 54.66 ? 414 GLU A N     1 
ATOM   3285 C  CA    . GLU A 1 417 ? 12.487 10.591  1.327   1.00 55.02 ? 414 GLU A CA    1 
ATOM   3286 C  C     . GLU A 1 417 ? 13.304 9.403   0.845   1.00 53.23 ? 414 GLU A C     1 
ATOM   3287 O  O     . GLU A 1 417 ? 12.977 8.773   -0.161  1.00 50.45 ? 414 GLU A O     1 
ATOM   3288 C  CB    . GLU A 1 417 ? 11.526 10.154  2.434   1.00 54.13 ? 414 GLU A CB    1 
ATOM   3289 C  CG    . GLU A 1 417 ? 10.644 11.277  2.925   1.00 56.86 ? 414 GLU A CG    1 
ATOM   3290 C  CD    . GLU A 1 417 ? 11.429 12.553  3.133   1.00 52.50 ? 414 GLU A CD    1 
ATOM   3291 O  OE1   . GLU A 1 417 ? 12.222 12.617  4.098   1.00 49.96 ? 414 GLU A OE1   1 
ATOM   3292 O  OE2   . GLU A 1 417 ? 11.261 13.484  2.318   1.00 57.40 ? 414 GLU A OE2   1 
ATOM   3293 N  N     . TRP A 1 418 ? 14.379 9.110   1.565   1.00 43.19 ? 415 TRP A N     1 
ATOM   3294 C  CA    . TRP A 1 418 ? 15.190 7.947   1.255   1.00 38.05 ? 415 TRP A CA    1 
ATOM   3295 C  C     . TRP A 1 418 ? 15.322 7.048   2.467   1.00 38.63 ? 415 TRP A C     1 
ATOM   3296 O  O     . TRP A 1 418 ? 15.821 7.463   3.512   1.00 37.07 ? 415 TRP A O     1 
ATOM   3297 C  CB    . TRP A 1 418 ? 16.582 8.346   0.759   1.00 38.26 ? 415 TRP A CB    1 
ATOM   3298 C  CG    . TRP A 1 418 ? 17.239 7.222   0.033   1.00 34.45 ? 415 TRP A CG    1 
ATOM   3299 C  CD1   . TRP A 1 418 ? 17.765 6.089   0.576   1.00 32.26 ? 415 TRP A CD1   1 
ATOM   3300 C  CD2   . TRP A 1 418 ? 17.403 7.104   -1.383  1.00 34.36 ? 415 TRP A CD2   1 
ATOM   3301 N  NE1   . TRP A 1 418 ? 18.258 5.274   -0.415  1.00 36.99 ? 415 TRP A NE1   1 
ATOM   3302 C  CE2   . TRP A 1 418 ? 18.048 5.876   -1.627  1.00 34.69 ? 415 TRP A CE2   1 
ATOM   3303 C  CE3   . TRP A 1 418 ? 17.073 7.920   -2.466  1.00 33.92 ? 415 TRP A CE3   1 
ATOM   3304 C  CZ2   . TRP A 1 418 ? 18.373 5.446   -2.913  1.00 36.73 ? 415 TRP A CZ2   1 
ATOM   3305 C  CZ3   . TRP A 1 418 ? 17.397 7.493   -3.741  1.00 40.42 ? 415 TRP A CZ3   1 
ATOM   3306 C  CH2   . TRP A 1 418 ? 18.041 6.268   -3.954  1.00 33.82 ? 415 TRP A CH2   1 
ATOM   3307 N  N     . SER A 1 419 ? 14.882 5.807   2.318   1.00 43.87 ? 416 SER A N     1 
ATOM   3308 C  CA    . SER A 1 419 ? 14.969 4.857   3.409   1.00 39.24 ? 416 SER A CA    1 
ATOM   3309 C  C     . SER A 1 419 ? 15.299 3.454   2.902   1.00 44.21 ? 416 SER A C     1 
ATOM   3310 O  O     . SER A 1 419 ? 14.899 3.082   1.800   1.00 45.13 ? 416 SER A O     1 
ATOM   3311 C  CB    . SER A 1 419 ? 13.670 4.860   4.218   1.00 53.26 ? 416 SER A CB    1 
ATOM   3312 O  OG    . SER A 1 419 ? 12.589 4.343   3.467   1.00 55.63 ? 416 SER A OG    1 
ATOM   3313 N  N     . PRO A 1 420 ? 16.095 2.695   3.679   1.00 42.04 ? 417 PRO A N     1 
ATOM   3314 C  CA    . PRO A 1 420 ? 16.797 3.212   4.861   1.00 44.79 ? 417 PRO A CA    1 
ATOM   3315 C  C     . PRO A 1 420 ? 17.902 4.162   4.425   1.00 38.14 ? 417 PRO A C     1 
ATOM   3316 O  O     . PRO A 1 420 ? 18.362 4.037   3.288   1.00 42.93 ? 417 PRO A O     1 
ATOM   3317 C  CB    . PRO A 1 420 ? 17.377 1.956   5.513   1.00 42.87 ? 417 PRO A CB    1 
ATOM   3318 C  CG    . PRO A 1 420 ? 17.505 0.982   4.396   1.00 45.55 ? 417 PRO A CG    1 
ATOM   3319 C  CD    . PRO A 1 420 ? 16.366 1.263   3.459   1.00 40.55 ? 417 PRO A CD    1 
ATOM   3320 N  N     . PRO A 1 421 ? 18.292 5.114   5.288   1.00 42.91 ? 418 PRO A N     1 
ATOM   3321 C  CA    . PRO A 1 421 ? 19.309 6.089   4.884   1.00 38.05 ? 418 PRO A CA    1 
ATOM   3322 C  C     . PRO A 1 421 ? 20.598 5.429   4.399   1.00 30.95 ? 418 PRO A C     1 
ATOM   3323 O  O     . PRO A 1 421 ? 20.914 4.311   4.812   1.00 31.23 ? 418 PRO A O     1 
ATOM   3324 C  CB    . PRO A 1 421 ? 19.554 6.894   6.162   1.00 34.12 ? 418 PRO A CB    1 
ATOM   3325 C  CG    . PRO A 1 421 ? 18.304 6.732   6.961   1.00 44.25 ? 418 PRO A CG    1 
ATOM   3326 C  CD    . PRO A 1 421 ? 17.813 5.345   6.662   1.00 43.43 ? 418 PRO A CD    1 
ATOM   3327 N  N     . LEU A 1 422 ? 21.312 6.121   3.516   1.00 34.92 ? 419 LEU A N     1 
ATOM   3328 C  CA    . LEU A 1 422 ? 22.559 5.621   2.951   1.00 28.09 ? 419 LEU A CA    1 
ATOM   3329 C  C     . LEU A 1 422 ? 23.738 6.057   3.814   1.00 22.30 ? 419 LEU A C     1 
ATOM   3330 O  O     . LEU A 1 422 ? 23.843 7.227   4.173   1.00 27.69 ? 419 LEU A O     1 
ATOM   3331 C  CB    . LEU A 1 422 ? 22.740 6.120   1.510   1.00 25.38 ? 419 LEU A CB    1 
ATOM   3332 C  CG    . LEU A 1 422 ? 21.622 5.750   0.526   1.00 30.21 ? 419 LEU A CG    1 
ATOM   3333 C  CD1   . LEU A 1 422 ? 21.960 6.169   -0.917  1.00 29.20 ? 419 LEU A CD1   1 
ATOM   3334 C  CD2   . LEU A 1 422 ? 21.331 4.267   0.614   1.00 30.55 ? 419 LEU A CD2   1 
ATOM   3335 N  N     . THR A 1 423 ? 24.616 5.114   4.144   1.00 25.82 ? 420 THR A N     1 
ATOM   3336 C  CA    . THR A 1 423 ? 25.771 5.414   4.988   1.00 25.44 ? 420 THR A CA    1 
ATOM   3337 C  C     . THR A 1 423 ? 27.079 5.336   4.198   1.00 23.97 ? 420 THR A C     1 
ATOM   3338 O  O     . THR A 1 423 ? 28.165 5.513   4.755   1.00 21.24 ? 420 THR A O     1 
ATOM   3339 C  CB    . THR A 1 423 ? 25.842 4.465   6.194   1.00 29.41 ? 420 THR A CB    1 
ATOM   3340 O  OG1   . THR A 1 423 ? 25.788 3.106   5.741   1.00 33.92 ? 420 THR A OG1   1 
ATOM   3341 C  CG2   . THR A 1 423 ? 24.667 4.727   7.139   1.00 31.92 ? 420 THR A CG2   1 
ATOM   3342 N  N     . MET A 1 424 ? 26.966 5.064   2.903   1.00 20.75 ? 421 MET A N     1 
ATOM   3343 C  CA    . MET A 1 424 ? 28.131 5.082   2.019   1.00 17.76 ? 421 MET A CA    1 
ATOM   3344 C  C     . MET A 1 424 ? 27.700 5.182   0.565   1.00 21.08 ? 421 MET A C     1 
ATOM   3345 O  O     . MET A 1 424 ? 26.745 4.525   0.165   1.00 19.55 ? 421 MET A O     1 
ATOM   3346 C  CB    . MET A 1 424 ? 28.987 3.831   2.227   1.00 20.44 ? 421 MET A CB    1 
ATOM   3347 C  CG    . MET A 1 424 ? 30.290 3.793   1.417   1.00 23.03 ? 421 MET A CG    1 
ATOM   3348 S  SD    . MET A 1 424 ? 30.040 3.135   -0.251  1.00 23.98 ? 421 MET A SD    1 
ATOM   3349 C  CE    . MET A 1 424 ? 29.611 1.443   0.134   1.00 28.12 ? 421 MET A CE    1 
ATOM   3350 N  N     . LEU A 1 425 ? 28.405 6.017   -0.201  1.00 18.03 ? 422 LEU A N     1 
ATOM   3351 C  CA    . LEU A 1 425 ? 28.309 6.081   -1.656  1.00 15.46 ? 422 LEU A CA    1 
ATOM   3352 C  C     . LEU A 1 425 ? 29.688 5.853   -2.260  1.00 16.46 ? 422 LEU A C     1 
ATOM   3353 O  O     . LEU A 1 425 ? 30.692 6.297   -1.702  1.00 17.93 ? 422 LEU A O     1 
ATOM   3354 C  CB    . LEU A 1 425 ? 27.787 7.435   -2.128  1.00 17.33 ? 422 LEU A CB    1 
ATOM   3355 C  CG    . LEU A 1 425 ? 26.409 7.920   -1.687  1.00 22.14 ? 422 LEU A CG    1 
ATOM   3356 C  CD1   . LEU A 1 425 ? 26.162 9.312   -2.250  1.00 22.03 ? 422 LEU A CD1   1 
ATOM   3357 C  CD2   . LEU A 1 425 ? 25.341 6.949   -2.155  1.00 21.91 ? 422 LEU A CD2   1 
ATOM   3358 N  N     . PHE A 1 426 ? 29.735 5.208   -3.418  1.00 17.17 ? 423 PHE A N     1 
ATOM   3359 C  CA    . PHE A 1 426 ? 31.000 4.815   -4.026  1.00 15.81 ? 423 PHE A CA    1 
ATOM   3360 C  C     . PHE A 1 426 ? 30.816 4.799   -5.538  1.00 19.61 ? 423 PHE A C     1 
ATOM   3361 O  O     . PHE A 1 426 ? 29.916 4.127   -6.041  1.00 22.71 ? 423 PHE A O     1 
ATOM   3362 C  CB    . PHE A 1 426 ? 31.431 3.447   -3.473  1.00 20.52 ? 423 PHE A CB    1 
ATOM   3363 C  CG    A PHE A 1 426 ? 32.836 3.016   -3.859  0.51 21.35 ? 423 PHE A CG    1 
ATOM   3364 C  CG    B PHE A 1 426 ? 32.523 2.781   -4.243  0.49 21.04 ? 423 PHE A CG    1 
ATOM   3365 C  CD1   A PHE A 1 426 ? 33.289 1.747   -3.525  0.51 25.39 ? 423 PHE A CD1   1 
ATOM   3366 C  CD1   B PHE A 1 426 ? 33.848 3.099   -4.003  0.49 21.06 ? 423 PHE A CD1   1 
ATOM   3367 C  CD2   A PHE A 1 426 ? 33.700 3.865   -4.540  0.51 17.59 ? 423 PHE A CD2   1 
ATOM   3368 C  CD2   B PHE A 1 426 ? 32.228 1.800   -5.174  0.49 22.24 ? 423 PHE A CD2   1 
ATOM   3369 C  CE1   A PHE A 1 426 ? 34.564 1.330   -3.866  0.51 24.78 ? 423 PHE A CE1   1 
ATOM   3370 C  CE1   B PHE A 1 426 ? 34.859 2.472   -4.702  0.49 22.52 ? 423 PHE A CE1   1 
ATOM   3371 C  CE2   A PHE A 1 426 ? 34.981 3.453   -4.886  0.51 19.48 ? 423 PHE A CE2   1 
ATOM   3372 C  CE2   B PHE A 1 426 ? 33.233 1.161   -5.865  0.49 24.17 ? 423 PHE A CE2   1 
ATOM   3373 C  CZ    A PHE A 1 426 ? 35.414 2.187   -4.550  0.51 24.21 ? 423 PHE A CZ    1 
ATOM   3374 C  CZ    B PHE A 1 426 ? 34.551 1.497   -5.624  0.49 21.72 ? 423 PHE A CZ    1 
ATOM   3375 N  N     . LEU A 1 427 ? 31.618 5.586   -6.250  1.00 15.38 ? 424 LEU A N     1 
ATOM   3376 C  CA    . LEU A 1 427 ? 31.652 5.533   -7.712  1.00 15.47 ? 424 LEU A CA    1 
ATOM   3377 C  C     . LEU A 1 427 ? 33.013 5.052   -8.143  1.00 16.64 ? 424 LEU A C     1 
ATOM   3378 O  O     . LEU A 1 427 ? 34.021 5.563   -7.671  1.00 17.77 ? 424 LEU A O     1 
ATOM   3379 C  CB    . LEU A 1 427 ? 31.367 6.891   -8.340  1.00 14.26 ? 424 LEU A CB    1 
ATOM   3380 C  CG    . LEU A 1 427 ? 29.982 7.481   -8.085  1.00 20.86 ? 424 LEU A CG    1 
ATOM   3381 C  CD1   . LEU A 1 427 ? 29.849 8.829   -8.789  1.00 18.98 ? 424 LEU A CD1   1 
ATOM   3382 C  CD2   . LEU A 1 427 ? 28.898 6.505   -8.524  1.00 21.74 ? 424 LEU A CD2   1 
ATOM   3383 N  N     . CYS A 1 428 ? 33.057 4.074   -9.042  1.00 14.99 ? 425 CYS A N     1 
ATOM   3384 C  CA    . CYS A 1 428 ? 34.342 3.540   -9.497  1.00 15.70 ? 425 CYS A CA    1 
ATOM   3385 C  C     . CYS A 1 428 ? 34.362 3.336   -11.003 1.00 17.12 ? 425 CYS A C     1 
ATOM   3386 O  O     . CYS A 1 428 ? 33.491 2.654   -11.544 1.00 19.69 ? 425 CYS A O     1 
ATOM   3387 C  CB    . CYS A 1 428 ? 34.648 2.211   -8.814  1.00 17.27 ? 425 CYS A CB    1 
ATOM   3388 S  SG    . CYS A 1 428 ? 36.340 1.574   -9.111  1.00 22.49 ? 425 CYS A SG    1 
ATOM   3389 N  N     . ALA A 1 429 ? 35.361 3.921   -11.659 1.00 13.81 ? 426 ALA A N     1 
ATOM   3390 C  CA    . ALA A 1 429 ? 35.555 3.764   -13.089 1.00 13.93 ? 426 ALA A CA    1 
ATOM   3391 C  C     . ALA A 1 429 ? 36.487 2.575   -13.334 1.00 15.89 ? 426 ALA A C     1 
ATOM   3392 O  O     . ALA A 1 429 ? 37.558 2.469   -12.719 1.00 15.72 ? 426 ALA A O     1 
ATOM   3393 C  CB    . ALA A 1 429 ? 36.120 5.039   -13.691 1.00 15.78 ? 426 ALA A CB    1 
ATOM   3394 N  N     . THR A 1 430 ? 36.053 1.667   -14.204 1.00 17.46 ? 427 THR A N     1 
ATOM   3395 C  CA    . THR A 1 430 ? 36.755 0.401   -14.424 1.00 18.78 ? 427 THR A CA    1 
ATOM   3396 C  C     . THR A 1 430 ? 36.777 0.075   -15.914 1.00 19.51 ? 427 THR A C     1 
ATOM   3397 O  O     . THR A 1 430 ? 36.204 0.808   -16.727 1.00 15.79 ? 427 THR A O     1 
ATOM   3398 C  CB    . THR A 1 430 ? 36.080 -0.773  -13.667 1.00 19.38 ? 427 THR A CB    1 
ATOM   3399 O  OG1   . THR A 1 430 ? 34.811 -1.064  -14.268 1.00 24.34 ? 427 THR A OG1   1 
ATOM   3400 C  CG2   . THR A 1 430 ? 35.857 -0.432  -12.186 1.00 21.64 ? 427 THR A CG2   1 
ATOM   3401 N  N     . LYS A 1 431 ? 37.430 -1.039  -16.245 1.00 18.64 ? 428 LYS A N     1 
ATOM   3402 C  CA    . LYS A 1 431 ? 37.485 -1.588  -17.605 1.00 21.50 ? 428 LYS A CA    1 
ATOM   3403 C  C     . LYS A 1 431 ? 38.078 -0.648  -18.654 1.00 14.45 ? 428 LYS A C     1 
ATOM   3404 O  O     . LYS A 1 431 ? 37.437 -0.301  -19.655 1.00 18.27 ? 428 LYS A O     1 
ATOM   3405 C  CB    . LYS A 1 431 ? 36.104 -2.077  -18.047 1.00 19.75 ? 428 LYS A CB    1 
ATOM   3406 C  CG    . LYS A 1 431 ? 35.612 -3.261  -17.225 1.00 29.24 ? 428 LYS A CG    1 
ATOM   3407 C  CD    . LYS A 1 431 ? 34.415 -3.964  -17.861 1.00 34.52 ? 428 LYS A CD    1 
ATOM   3408 C  CE    . LYS A 1 431 ? 33.879 -5.067  -16.954 1.00 38.70 ? 428 LYS A CE    1 
ATOM   3409 N  NZ    . LYS A 1 431 ? 34.958 -5.956  -16.439 1.00 47.27 ? 428 LYS A NZ    1 
ATOM   3410 N  N     . PHE A 1 432 ? 39.316 -0.240  -18.415 1.00 18.75 ? 429 PHE A N     1 
ATOM   3411 C  CA    . PHE A 1 432 ? 39.997 0.673   -19.313 1.00 17.53 ? 429 PHE A CA    1 
ATOM   3412 C  C     . PHE A 1 432 ? 40.306 0.077   -20.677 1.00 24.25 ? 429 PHE A C     1 
ATOM   3413 O  O     . PHE A 1 432 ? 40.590 -1.121  -20.803 1.00 21.96 ? 429 PHE A O     1 
ATOM   3414 C  CB    . PHE A 1 432 ? 41.288 1.179   -18.665 1.00 17.89 ? 429 PHE A CB    1 
ATOM   3415 C  CG    . PHE A 1 432 ? 41.054 2.166   -17.553 1.00 19.33 ? 429 PHE A CG    1 
ATOM   3416 C  CD1   . PHE A 1 432 ? 40.993 3.517   -17.819 1.00 17.19 ? 429 PHE A CD1   1 
ATOM   3417 C  CD2   . PHE A 1 432 ? 40.887 1.737   -16.245 1.00 23.97 ? 429 PHE A CD2   1 
ATOM   3418 C  CE1   . PHE A 1 432 ? 40.766 4.437   -16.804 1.00 16.92 ? 429 PHE A CE1   1 
ATOM   3419 C  CE2   . PHE A 1 432 ? 40.665 2.648   -15.222 1.00 24.86 ? 429 PHE A CE2   1 
ATOM   3420 C  CZ    . PHE A 1 432 ? 40.608 4.000   -15.500 1.00 22.70 ? 429 PHE A CZ    1 
ATOM   3421 N  N     . SER A 1 433 ? 40.229 0.934   -21.691 1.00 19.90 ? 430 SER A N     1 
ATOM   3422 C  CA    . SER A 1 433 ? 40.650 0.603   -23.048 1.00 17.38 ? 430 SER A CA    1 
ATOM   3423 C  C     . SER A 1 433 ? 41.622 1.660   -23.534 1.00 19.70 ? 430 SER A C     1 
ATOM   3424 O  O     . SER A 1 433 ? 41.526 2.825   -23.146 1.00 19.65 ? 430 SER A O     1 
ATOM   3425 C  CB    . SER A 1 433 ? 39.448 0.511   -23.992 1.00 24.52 ? 430 SER A CB    1 
ATOM   3426 O  OG    . SER A 1 433 ? 38.553 -0.499  -23.570 1.00 39.33 ? 430 SER A OG    1 
ATOM   3427 N  N     . ALA A 1 434 ? 42.569 1.256   -24.373 1.00 21.71 ? 431 ALA A N     1 
ATOM   3428 C  CA    . ALA A 1 434 ? 43.559 2.193   -24.873 1.00 22.01 ? 431 ALA A CA    1 
ATOM   3429 C  C     . ALA A 1 434 ? 42.856 3.249   -25.711 1.00 26.95 ? 431 ALA A C     1 
ATOM   3430 O  O     . ALA A 1 434 ? 41.833 2.976   -26.343 1.00 30.61 ? 431 ALA A O     1 
ATOM   3431 C  CB    . ALA A 1 434 ? 44.634 1.471   -25.685 1.00 25.48 ? 431 ALA A CB    1 
ATOM   3432 N  N     . SER A 1 435 ? 43.388 4.465   -25.686 1.00 21.73 ? 432 SER A N     1 
ATOM   3433 C  CA    . SER A 1 435 ? 42.802 5.565   -26.445 1.00 26.48 ? 432 SER A CA    1 
ATOM   3434 C  C     . SER A 1 435 ? 43.886 6.537   -26.876 1.00 27.63 ? 432 SER A C     1 
ATOM   3435 O  O     . SER A 1 435 ? 43.598 7.653   -27.289 1.00 30.75 ? 432 SER A O     1 
ATOM   3436 C  CB    . SER A 1 435 ? 41.744 6.295   -25.621 1.00 27.93 ? 432 SER A CB    1 
ATOM   3437 O  OG    . SER A 1 435 ? 42.347 7.061   -24.592 1.00 36.20 ? 432 SER A OG    1 
ATOM   3438 O  OXT   . SER A 1 435 ? 45.076 6.238   -26.799 1.00 40.98 ? 432 SER A OXT   1 
ATOM   3439 O  "O3'" . DC  B 2 1   ? 27.734 4.560   11.562  1.00 53.88 ? 1   DC  T "O3'" 1 
ATOM   3440 P  P     . DA  B 2 2   ? 28.186 4.318   13.150  1.00 76.40 ? 2   DA  T P     1 
ATOM   3441 O  OP1   . DA  B 2 2   ? 28.412 2.862   13.313  1.00 63.51 ? 2   DA  T OP1   1 
ATOM   3442 O  OP2   . DA  B 2 2   ? 27.222 5.024   14.025  1.00 65.11 ? 2   DA  T OP2   1 
ATOM   3443 O  "O5'" . DA  B 2 2   ? 29.584 5.080   13.296  1.00 58.11 ? 2   DA  T "O5'" 1 
ATOM   3444 C  "C5'" . DA  B 2 2   ? 30.708 4.681   12.520  1.00 47.92 ? 2   DA  T "C5'" 1 
ATOM   3445 C  "C4'" . DA  B 2 2   ? 31.967 5.393   12.991  1.00 44.81 ? 2   DA  T "C4'" 1 
ATOM   3446 O  "O4'" . DA  B 2 2   ? 31.857 6.813   12.725  1.00 46.01 ? 2   DA  T "O4'" 1 
ATOM   3447 C  "C3'" . DA  B 2 2   ? 32.257 5.276   14.484  1.00 48.37 ? 2   DA  T "C3'" 1 
ATOM   3448 O  "O3'" . DA  B 2 2   ? 33.649 5.265   14.695  1.00 47.46 ? 2   DA  T "O3'" 1 
ATOM   3449 C  "C2'" . DA  B 2 2   ? 31.622 6.537   15.057  1.00 47.51 ? 2   DA  T "C2'" 1 
ATOM   3450 C  "C1'" . DA  B 2 2   ? 31.881 7.538   13.942  1.00 43.99 ? 2   DA  T "C1'" 1 
ATOM   3451 N  N9    . DA  B 2 2   ? 30.874 8.586   13.862  1.00 39.50 ? 2   DA  T N9    1 
ATOM   3452 C  C8    . DA  B 2 2   ? 29.615 8.570   14.399  1.00 39.60 ? 2   DA  T C8    1 
ATOM   3453 N  N7    . DA  B 2 2   ? 28.927 9.664   14.159  1.00 37.43 ? 2   DA  T N7    1 
ATOM   3454 C  C5    . DA  B 2 2   ? 29.802 10.445  13.416  1.00 36.39 ? 2   DA  T C5    1 
ATOM   3455 C  C6    . DA  B 2 2   ? 29.682 11.728  12.849  1.00 34.81 ? 2   DA  T C6    1 
ATOM   3456 N  N6    . DA  B 2 2   ? 28.581 12.482  12.949  1.00 40.41 ? 2   DA  T N6    1 
ATOM   3457 N  N1    . DA  B 2 2   ? 30.742 12.208  12.169  1.00 36.00 ? 2   DA  T N1    1 
ATOM   3458 C  C2    . DA  B 2 2   ? 31.841 11.451  12.065  1.00 29.53 ? 2   DA  T C2    1 
ATOM   3459 N  N3    . DA  B 2 2   ? 32.072 10.240  12.554  1.00 34.53 ? 2   DA  T N3    1 
ATOM   3460 C  C4    . DA  B 2 2   ? 31.003 9.790   13.227  1.00 36.04 ? 2   DA  T C4    1 
ATOM   3461 P  P     A DT  B 2 3   ? 34.359 3.929   15.228  0.57 48.29 ? 3   DT  T P     1 
ATOM   3462 P  P     B DT  B 2 3   ? 34.389 3.904   15.118  0.43 48.28 ? 3   DT  T P     1 
ATOM   3463 O  OP1   A DT  B 2 3   ? 33.399 2.815   15.040  0.57 48.87 ? 3   DT  T OP1   1 
ATOM   3464 O  OP1   B DT  B 2 3   ? 33.379 3.018   15.741  0.43 48.17 ? 3   DT  T OP1   1 
ATOM   3465 O  OP2   A DT  B 2 3   ? 34.917 4.227   16.566  0.57 45.90 ? 3   DT  T OP2   1 
ATOM   3466 O  OP2   B DT  B 2 3   ? 35.613 4.286   15.858  0.43 45.26 ? 3   DT  T OP2   1 
ATOM   3467 O  "O5'" A DT  B 2 3   ? 35.576 3.707   14.218  0.57 44.11 ? 3   DT  T "O5'" 1 
ATOM   3468 O  "O5'" B DT  B 2 3   ? 34.847 3.257   13.728  0.43 43.39 ? 3   DT  T "O5'" 1 
ATOM   3469 C  "C5'" A DT  B 2 3   ? 36.459 4.774   13.928  0.57 43.21 ? 3   DT  T "C5'" 1 
ATOM   3470 C  "C5'" B DT  B 2 3   ? 36.157 3.509   13.226  0.43 39.23 ? 3   DT  T "C5'" 1 
ATOM   3471 C  "C4'" A DT  B 2 3   ? 37.237 4.481   12.668  0.57 37.47 ? 3   DT  T "C4'" 1 
ATOM   3472 C  "C4'" B DT  B 2 3   ? 36.210 4.847   12.515  0.43 37.70 ? 3   DT  T "C4'" 1 
ATOM   3473 O  "O4'" A DT  B 2 3   ? 38.324 3.581   12.974  0.57 40.11 ? 3   DT  T "O4'" 1 
ATOM   3474 O  "O4'" B DT  B 2 3   ? 37.599 5.221   12.289  0.43 37.89 ? 3   DT  T "O4'" 1 
ATOM   3475 C  "C3'" A DT  B 2 3   ? 36.414 3.809   11.569  0.57 39.84 ? 3   DT  T "C3'" 1 
ATOM   3476 C  "C3'" B DT  B 2 3   ? 35.532 4.865   11.146  0.43 35.02 ? 3   DT  T "C3'" 1 
ATOM   3477 O  "O3'" A DT  B 2 3   ? 36.440 4.595   10.380  0.57 35.56 ? 3   DT  T "O3'" 1 
ATOM   3478 O  "O3'" B DT  B 2 3   ? 34.827 6.092   10.961  0.43 34.51 ? 3   DT  T "O3'" 1 
ATOM   3479 C  "C2'" A DT  B 2 3   ? 37.068 2.436   11.380  0.57 37.55 ? 3   DT  T "C2'" 1 
ATOM   3480 C  "C2'" B DT  B 2 3   ? 36.710 4.726   10.184  0.43 34.18 ? 3   DT  T "C2'" 1 
ATOM   3481 C  "C1'" A DT  B 2 3   ? 38.468 2.663   11.922  0.57 37.45 ? 3   DT  T "C1'" 1 
ATOM   3482 C  "C1'" B DT  B 2 3   ? 37.805 5.485   10.917  0.43 32.24 ? 3   DT  T "C1'" 1 
ATOM   3483 N  N1    A DT  B 2 3   ? 39.095 1.436   12.466  0.57 41.92 ? 3   DT  T N1    1 
ATOM   3484 N  N1    B DT  B 2 3   ? 39.182 5.036   10.548  0.43 35.07 ? 3   DT  T N1    1 
ATOM   3485 C  C2    A DT  B 2 3   ? 40.307 1.028   11.969  0.57 41.86 ? 3   DT  T C2    1 
ATOM   3486 C  C2    B DT  B 2 3   ? 40.117 5.967   10.145  0.43 31.51 ? 3   DT  T C2    1 
ATOM   3487 O  O2    A DT  B 2 3   ? 40.900 1.622   11.083  0.57 40.27 ? 3   DT  T O2    1 
ATOM   3488 O  O2    B DT  B 2 3   ? 39.887 7.163   10.078  0.43 33.68 ? 3   DT  T O2    1 
ATOM   3489 N  N3    A DT  B 2 3   ? 40.805 -0.112  12.541  0.57 45.01 ? 3   DT  T N3    1 
ATOM   3490 N  N3    B DT  B 2 3   ? 41.343 5.445   9.830   0.43 28.08 ? 3   DT  T N3    1 
ATOM   3491 C  C4    A DT  B 2 3   ? 40.223 -0.864  13.544  0.57 48.02 ? 3   DT  T C4    1 
ATOM   3492 C  C4    B DT  B 2 3   ? 41.719 4.115   9.868   0.43 28.88 ? 3   DT  T C4    1 
ATOM   3493 O  O4    A DT  B 2 3   ? 40.748 -1.877  13.995  0.57 51.23 ? 3   DT  T O4    1 
ATOM   3494 O  O4    B DT  B 2 3   ? 42.847 3.746   9.560   0.43 26.89 ? 3   DT  T O4    1 
ATOM   3495 C  C5    A DT  B 2 3   ? 38.951 -0.377  14.024  0.57 46.61 ? 3   DT  T C5    1 
ATOM   3496 C  C5    B DT  B 2 3   ? 40.694 3.193   10.297  0.43 32.95 ? 3   DT  T C5    1 
ATOM   3497 C  C7    A DT  B 2 3   ? 38.224 -1.110  15.111  0.57 42.62 ? 3   DT  T C7    1 
ATOM   3498 C  C7    B DT  B 2 3   ? 40.983 1.723   10.379  0.43 36.29 ? 3   DT  T C7    1 
ATOM   3499 C  C6    A DT  B 2 3   ? 38.455 0.737   13.468  0.57 41.72 ? 3   DT  T C6    1 
ATOM   3500 C  C6    B DT  B 2 3   ? 39.491 3.694   10.612  0.43 34.02 ? 3   DT  T C6    1 
ATOM   3501 P  P     A DT  B 2 4   ? 35.070 5.217   9.822   0.57 30.50 ? 4   DT  T P     1 
ATOM   3502 P  P     B DT  B 2 4   ? 33.856 6.291   9.694   0.43 27.84 ? 4   DT  T P     1 
ATOM   3503 O  OP1   A DT  B 2 4   ? 34.470 6.051   10.888  0.57 34.80 ? 4   DT  T OP1   1 
ATOM   3504 O  OP1   B DT  B 2 4   ? 32.972 7.442   9.968   0.43 34.89 ? 4   DT  T OP1   1 
ATOM   3505 O  OP2   A DT  B 2 4   ? 34.315 4.082   9.247   0.57 32.02 ? 4   DT  T OP2   1 
ATOM   3506 O  OP2   B DT  B 2 4   ? 33.288 4.980   9.316   0.43 33.37 ? 4   DT  T OP2   1 
ATOM   3507 O  "O5'" A DT  B 2 4   ? 35.515 6.132   8.579   0.57 22.04 ? 4   DT  T "O5'" 1 
ATOM   3508 O  "O5'" B DT  B 2 4   ? 34.856 6.696   8.525   0.43 23.61 ? 4   DT  T "O5'" 1 
ATOM   3509 C  "C5'" A DT  B 2 4   ? 35.822 7.527   8.729   0.57 22.07 ? 4   DT  T "C5'" 1 
ATOM   3510 C  "C5'" B DT  B 2 4   ? 35.817 7.686   8.758   0.43 22.12 ? 4   DT  T "C5'" 1 
ATOM   3511 C  "C4'" . DT  B 2 4   ? 36.549 8.030   7.484   1.00 20.58 ? 4   DT  T "C4'" 1 
ATOM   3512 O  "O4'" . DT  B 2 4   ? 37.796 7.304   7.382   1.00 20.15 ? 4   DT  T "O4'" 1 
ATOM   3513 C  "C3'" . DT  B 2 4   ? 35.808 7.765   6.174   1.00 19.16 ? 4   DT  T "C3'" 1 
ATOM   3514 O  "O3'" A DT  B 2 4   ? 36.129 8.795   5.260   0.57 15.83 ? 4   DT  T "O3'" 1 
ATOM   3515 O  "O3'" B DT  B 2 4   ? 36.129 8.796   5.260   0.43 15.86 ? 4   DT  T "O3'" 1 
ATOM   3516 C  "C2'" . DT  B 2 4   ? 36.383 6.413   5.730   1.00 20.34 ? 4   DT  T "C2'" 1 
ATOM   3517 C  "C1'" . DT  B 2 4   ? 37.826 6.571   6.172   1.00 18.13 ? 4   DT  T "C1'" 1 
ATOM   3518 N  N1    . DT  B 2 4   ? 38.569 5.322   6.435   1.00 17.66 ? 4   DT  T N1    1 
ATOM   3519 C  C2    . DT  B 2 4   ? 39.884 5.302   6.096   1.00 17.11 ? 4   DT  T C2    1 
ATOM   3520 O  O2    . DT  B 2 4   ? 40.426 6.233   5.533   1.00 16.73 ? 4   DT  T O2    1 
ATOM   3521 N  N3    . DT  B 2 4   ? 40.542 4.150   6.402   1.00 17.14 ? 4   DT  T N3    1 
ATOM   3522 C  C4    . DT  B 2 4   ? 40.036 3.036   7.022   1.00 18.05 ? 4   DT  T C4    1 
ATOM   3523 O  O4    . DT  B 2 4   ? 40.726 2.046   7.251   1.00 19.12 ? 4   DT  T O4    1 
ATOM   3524 C  C5    . DT  B 2 4   ? 38.636 3.122   7.385   1.00 19.89 ? 4   DT  T C5    1 
ATOM   3525 C  C7    . DT  B 2 4   ? 37.961 1.962   8.060   1.00 23.92 ? 4   DT  T C7    1 
ATOM   3526 C  C6    . DT  B 2 4   ? 37.976 4.257   7.087   1.00 17.90 ? 4   DT  T C6    1 
ATOM   3527 P  P     . DA  B 2 5   ? 35.491 8.835   3.787   1.00 15.90 ? 5   DA  T P     1 
ATOM   3528 O  OP1   . DA  B 2 5   ? 35.187 10.252  3.505   1.00 17.99 ? 5   DA  T OP1   1 
ATOM   3529 O  OP2   . DA  B 2 5   ? 34.442 7.802   3.675   1.00 16.99 ? 5   DA  T OP2   1 
ATOM   3530 O  "O5'" . DA  B 2 5   ? 36.691 8.364   2.860   1.00 14.14 ? 5   DA  T "O5'" 1 
ATOM   3531 C  "C5'" . DA  B 2 5   ? 37.862 9.170   2.745   1.00 13.38 ? 5   DA  T "C5'" 1 
ATOM   3532 C  "C4'" . DA  B 2 5   ? 38.808 8.556   1.743   1.00 12.13 ? 5   DA  T "C4'" 1 
ATOM   3533 O  "O4'" . DA  B 2 5   ? 39.409 7.347   2.304   1.00 16.34 ? 5   DA  T "O4'" 1 
ATOM   3534 C  "C3'" . DA  B 2 5   ? 38.155 8.123   0.436   1.00 12.82 ? 5   DA  T "C3'" 1 
ATOM   3535 O  "O3'" . DA  B 2 5   ? 39.065 8.374   -0.627  1.00 12.91 ? 5   DA  T "O3'" 1 
ATOM   3536 C  "C2'" . DA  B 2 5   ? 37.944 6.623   0.644   1.00 14.54 ? 5   DA  T "C2'" 1 
ATOM   3537 C  "C1'" . DA  B 2 5   ? 39.221 6.278   1.402   1.00 15.09 ? 5   DA  T "C1'" 1 
ATOM   3538 N  N9    . DA  B 2 5   ? 39.152 5.044   2.161   1.00 13.15 ? 5   DA  T N9    1 
ATOM   3539 C  C8    . DA  B 2 5   ? 38.077 4.538   2.830   1.00 16.27 ? 5   DA  T C8    1 
ATOM   3540 N  N7    . DA  B 2 5   ? 38.328 3.406   3.451   1.00 16.86 ? 5   DA  T N7    1 
ATOM   3541 C  C5    . DA  B 2 5   ? 39.670 3.167   3.180   1.00 15.89 ? 5   DA  T C5    1 
ATOM   3542 C  C6    . DA  B 2 5   ? 40.537 2.124   3.542   1.00 18.79 ? 5   DA  T C6    1 
ATOM   3543 N  N6    . DA  B 2 5   ? 40.164 1.092   4.301   1.00 20.61 ? 5   DA  T N6    1 
ATOM   3544 N  N1    . DA  B 2 5   ? 41.810 2.185   3.098   1.00 18.90 ? 5   DA  T N1    1 
ATOM   3545 C  C2    . DA  B 2 5   ? 42.180 3.228   2.339   1.00 16.90 ? 5   DA  T C2    1 
ATOM   3546 N  N3    . DA  B 2 5   ? 41.450 4.269   1.931   1.00 15.54 ? 5   DA  T N3    1 
ATOM   3547 C  C4    . DA  B 2 5   ? 40.191 4.171   2.394   1.00 13.46 ? 5   DA  T C4    1 
ATOM   3548 P  P     . DT  B 2 6   ? 38.585 8.382   -2.159  1.00 14.06 ? 6   DT  T P     1 
ATOM   3549 O  OP1   . DT  B 2 6   ? 39.740 8.815   -2.963  1.00 15.78 ? 6   DT  T OP1   1 
ATOM   3550 O  OP2   . DT  B 2 6   ? 37.307 9.139   -2.250  1.00 13.32 ? 6   DT  T OP2   1 
ATOM   3551 O  "O5'" . DT  B 2 6   ? 38.203 6.850   -2.431  1.00 16.71 ? 6   DT  T "O5'" 1 
ATOM   3552 C  "C5'" . DT  B 2 6   ? 38.927 6.076   -3.360  1.00 19.83 ? 6   DT  T "C5'" 1 
ATOM   3553 C  "C4'" . DT  B 2 6   ? 40.148 5.413   -2.743  1.00 14.55 ? 6   DT  T "C4'" 1 
ATOM   3554 O  "O4'" . DT  B 2 6   ? 39.791 4.704   -1.540  1.00 18.39 ? 6   DT  T "O4'" 1 
ATOM   3555 C  "C3'" . DT  B 2 6   ? 40.762 4.367   -3.648  1.00 17.71 ? 6   DT  T "C3'" 1 
ATOM   3556 O  "O3'" . DT  B 2 6   ? 41.797 4.957   -4.379  1.00 15.98 ? 6   DT  T "O3'" 1 
ATOM   3557 C  "C2'" . DT  B 2 6   ? 41.282 3.274   -2.701  1.00 21.12 ? 6   DT  T "C2'" 1 
ATOM   3558 C  "C1'" . DT  B 2 6   ? 40.729 3.675   -1.335  1.00 19.30 ? 6   DT  T "C1'" 1 
ATOM   3559 N  N1    . DT  B 2 6   ? 40.056 2.588   -0.619  1.00 18.55 ? 6   DT  T N1    1 
ATOM   3560 C  C2    . DT  B 2 6   ? 40.784 1.518   -0.175  1.00 16.34 ? 6   DT  T C2    1 
ATOM   3561 O  O2    . DT  B 2 6   ? 41.977 1.385   -0.379  1.00 20.18 ? 6   DT  T O2    1 
ATOM   3562 N  N3    . DT  B 2 6   ? 40.061 0.589   0.519   1.00 17.03 ? 6   DT  T N3    1 
ATOM   3563 C  C4    . DT  B 2 6   ? 38.713 0.627   0.813   1.00 21.33 ? 6   DT  T C4    1 
ATOM   3564 O  O4    . DT  B 2 6   ? 38.152 -0.261  1.453   1.00 22.12 ? 6   DT  T O4    1 
ATOM   3565 C  C5    . DT  B 2 6   ? 38.013 1.786   0.331   1.00 21.00 ? 6   DT  T C5    1 
ATOM   3566 C  C7    . DT  B 2 6   ? 36.544 1.942   0.591   1.00 23.69 ? 6   DT  T C7    1 
ATOM   3567 C  C6    . DT  B 2 6   ? 38.713 2.704   -0.342  1.00 18.66 ? 6   DT  T C6    1 
ATOM   3568 P  P     . DG  B 2 7   ? 41.972 4.601   -5.932  1.00 16.02 ? 7   DG  T P     1 
ATOM   3569 O  OP1   . DG  B 2 7   ? 43.139 5.375   -6.394  1.00 15.97 ? 7   DG  T OP1   1 
ATOM   3570 O  OP2   . DG  B 2 7   ? 40.679 4.671   -6.634  1.00 15.24 ? 7   DG  T OP2   1 
ATOM   3571 O  "O5'" . DG  B 2 7   ? 42.304 3.029   -5.923  1.00 18.87 ? 7   DG  T "O5'" 1 
ATOM   3572 C  "C5'" . DG  B 2 7   ? 43.610 2.573   -5.651  1.00 24.99 ? 7   DG  T "C5'" 1 
ATOM   3573 C  "C4'" . DG  B 2 7   ? 43.628 1.060   -5.540  1.00 14.96 ? 7   DG  T "C4'" 1 
ATOM   3574 O  "O4'" . DG  B 2 7   ? 42.896 0.651   -4.374  1.00 18.49 ? 7   DG  T "O4'" 1 
ATOM   3575 C  "C3'" . DG  B 2 7   ? 42.990 0.298   -6.710  1.00 23.89 ? 7   DG  T "C3'" 1 
ATOM   3576 O  "O3'" . DG  B 2 7   ? 43.987 -0.390  -7.418  1.00 23.08 ? 7   DG  T "O3'" 1 
ATOM   3577 C  "C2'" . DG  B 2 7   ? 42.014 -0.675  -6.036  1.00 21.95 ? 7   DG  T "C2'" 1 
ATOM   3578 C  "C1'" . DG  B 2 7   ? 42.481 -0.656  -4.592  1.00 21.99 ? 7   DG  T "C1'" 1 
ATOM   3579 N  N9    . DG  B 2 7   ? 41.424 -1.005  -3.652  1.00 20.44 ? 7   DG  T N9    1 
ATOM   3580 C  C8    . DG  B 2 7   ? 40.219 -0.369  -3.462  1.00 18.72 ? 7   DG  T C8    1 
ATOM   3581 N  N7    . DG  B 2 7   ? 39.466 -0.949  -2.563  1.00 21.14 ? 7   DG  T N7    1 
ATOM   3582 C  C5    . DG  B 2 7   ? 40.220 -2.045  -2.153  1.00 17.13 ? 7   DG  T C5    1 
ATOM   3583 C  C6    . DG  B 2 7   ? 39.926 -3.043  -1.200  1.00 17.14 ? 7   DG  T C6    1 
ATOM   3584 O  O6    . DG  B 2 7   ? 38.902 -3.164  -0.504  1.00 20.90 ? 7   DG  T O6    1 
ATOM   3585 N  N1    . DG  B 2 7   ? 40.964 -3.973  -1.093  1.00 16.59 ? 7   DG  T N1    1 
ATOM   3586 C  C2    . DG  B 2 7   ? 42.140 -3.922  -1.809  1.00 15.91 ? 7   DG  T C2    1 
ATOM   3587 N  N2    . DG  B 2 7   ? 43.032 -4.897  -1.574  1.00 18.84 ? 7   DG  T N2    1 
ATOM   3588 N  N3    . DG  B 2 7   ? 42.421 -2.988  -2.704  1.00 18.02 ? 7   DG  T N3    1 
ATOM   3589 C  C4    . DG  B 2 7   ? 41.420 -2.088  -2.815  1.00 15.51 ? 7   DG  T C4    1 
ATOM   3590 P  P     . DA  B 2 8   ? 43.621 -1.328  -8.675  1.00 20.64 ? 8   DA  T P     1 
ATOM   3591 O  OP1   . DA  B 2 8   ? 44.687 -1.068  -9.645  1.00 18.85 ? 8   DA  T OP1   1 
ATOM   3592 O  OP2   . DA  B 2 8   ? 42.183 -1.258  -9.066  1.00 22.28 ? 8   DA  T OP2   1 
ATOM   3593 O  "O5'" . DA  B 2 8   ? 43.916 -2.797  -8.121  1.00 23.03 ? 8   DA  T "O5'" 1 
ATOM   3594 C  "C5'" . DA  B 2 8   ? 45.198 -3.099  -7.600  1.00 19.71 ? 8   DA  T "C5'" 1 
ATOM   3595 C  "C4'" . DA  B 2 8   ? 45.242 -4.545  -7.169  1.00 19.54 ? 8   DA  T "C4'" 1 
ATOM   3596 O  "O4'" . DA  B 2 8   ? 44.349 -4.719  -6.037  1.00 20.14 ? 8   DA  T "O4'" 1 
ATOM   3597 C  "C3'" . DA  B 2 8   ? 44.777 -5.528  -8.245  1.00 25.80 ? 8   DA  T "C3'" 1 
ATOM   3598 O  "O3'" . DA  B 2 8   ? 45.620 -6.657  -8.264  1.00 22.25 ? 8   DA  T "O3'" 1 
ATOM   3599 C  "C2'" . DA  B 2 8   ? 43.359 -5.894  -7.814  1.00 22.39 ? 8   DA  T "C2'" 1 
ATOM   3600 C  "C1'" . DA  B 2 8   ? 43.435 -5.765  -6.299  1.00 23.84 ? 8   DA  T "C1'" 1 
ATOM   3601 N  N9    . DA  B 2 8   ? 42.152 -5.412  -5.709  1.00 20.95 ? 8   DA  T N9    1 
ATOM   3602 C  C8    . DA  B 2 8   ? 41.343 -4.374  -6.079  1.00 20.46 ? 8   DA  T C8    1 
ATOM   3603 N  N7    . DA  B 2 8   ? 40.236 -4.296  -5.390  1.00 16.43 ? 8   DA  T N7    1 
ATOM   3604 C  C5    . DA  B 2 8   ? 40.318 -5.355  -4.504  1.00 16.66 ? 8   DA  T C5    1 
ATOM   3605 C  C6    . DA  B 2 8   ? 39.447 -5.813  -3.503  1.00 17.14 ? 8   DA  T C6    1 
ATOM   3606 N  N6    . DA  B 2 8   ? 38.278 -5.229  -3.227  1.00 16.94 ? 8   DA  T N6    1 
ATOM   3607 N  N1    . DA  B 2 8   ? 39.821 -6.903  -2.794  1.00 15.73 ? 8   DA  T N1    1 
ATOM   3608 C  C2    . DA  B 2 8   ? 40.992 -7.482  -3.081  1.00 13.58 ? 8   DA  T C2    1 
ATOM   3609 N  N3    . DA  B 2 8   ? 41.896 -7.145  -4.005  1.00 15.12 ? 8   DA  T N3    1 
ATOM   3610 C  C4    . DA  B 2 8   ? 41.492 -6.061  -4.691  1.00 18.70 ? 8   DA  T C4    1 
ATOM   3611 P  P     . DC  B 2 9   ? 45.511 -7.746  -9.441  1.00 24.64 ? 9   DC  T P     1 
ATOM   3612 O  OP1   . DC  B 2 9   ? 46.911 -8.153  -9.677  1.00 24.82 ? 9   DC  T OP1   1 
ATOM   3613 O  OP2   . DC  B 2 9   ? 44.656 -7.263  -10.552 1.00 30.91 ? 9   DC  T OP2   1 
ATOM   3614 O  "O5'" . DC  B 2 9   ? 44.718 -8.945  -8.749  1.00 20.36 ? 9   DC  T "O5'" 1 
ATOM   3615 C  "C5'" . DC  B 2 9   ? 45.190 -9.454  -7.535  1.00 23.38 ? 9   DC  T "C5'" 1 
ATOM   3616 C  "C4'" . DC  B 2 9   ? 44.181 -10.403 -6.962  1.00 24.26 ? 9   DC  T "C4'" 1 
ATOM   3617 O  "O4'" . DC  B 2 9   ? 43.073 -9.661  -6.393  1.00 25.93 ? 9   DC  T "O4'" 1 
ATOM   3618 C  "C3'" . DC  B 2 9   ? 43.561 -11.357 -7.985  1.00 24.86 ? 9   DC  T "C3'" 1 
ATOM   3619 O  "O3'" . DC  B 2 9   ? 43.453 -12.605 -7.393  1.00 35.53 ? 9   DC  T "O3'" 1 
ATOM   3620 C  "C2'" . DC  B 2 9   ? 42.184 -10.742 -8.225  1.00 25.74 ? 9   DC  T "C2'" 1 
ATOM   3621 C  "C1'" . DC  B 2 9   ? 41.875 -10.267 -6.822  1.00 24.69 ? 9   DC  T "C1'" 1 
ATOM   3622 N  N1    . DC  B 2 9   ? 40.754 -9.297  -6.729  1.00 24.11 ? 9   DC  T N1    1 
ATOM   3623 C  C2    . DC  B 2 9   ? 39.828 -9.434  -5.701  1.00 20.98 ? 9   DC  T C2    1 
ATOM   3624 O  O2    . DC  B 2 9   ? 39.973 -10.352 -4.876  1.00 21.15 ? 9   DC  T O2    1 
ATOM   3625 N  N3    . DC  B 2 9   ? 38.797 -8.562  -5.625  1.00 19.88 ? 9   DC  T N3    1 
ATOM   3626 C  C4    . DC  B 2 9   ? 38.674 -7.584  -6.526  1.00 25.11 ? 9   DC  T C4    1 
ATOM   3627 N  N4    . DC  B 2 9   ? 37.637 -6.750  -6.403  1.00 22.22 ? 9   DC  T N4    1 
ATOM   3628 C  C5    . DC  B 2 9   ? 39.605 -7.432  -7.597  1.00 23.24 ? 9   DC  T C5    1 
ATOM   3629 C  C6    . DC  B 2 9   ? 40.622 -8.307  -7.659  1.00 24.39 ? 9   DC  T C6    1 
ATOM   3630 P  P     . DG  B 2 10  ? 43.235 -13.922 -8.276  1.00 30.49 ? 10  DG  T P     1 
ATOM   3631 O  OP1   . DG  B 2 10  ? 44.543 -14.604 -8.338  1.00 37.59 ? 10  DG  T OP1   1 
ATOM   3632 O  OP2   . DG  B 2 10  ? 42.462 -13.610 -9.500  1.00 30.54 ? 10  DG  T OP2   1 
ATOM   3633 O  "O5'" . DG  B 2 10  ? 42.299 -14.792 -7.350  1.00 28.13 ? 10  DG  T "O5'" 1 
ATOM   3634 C  "C5'" . DG  B 2 10  ? 42.429 -14.711 -5.956  1.00 29.62 ? 10  DG  T "C5'" 1 
ATOM   3635 C  "C4'" . DG  B 2 10  ? 41.217 -15.324 -5.311  1.00 26.66 ? 10  DG  T "C4'" 1 
ATOM   3636 O  "O4'" . DG  B 2 10  ? 40.208 -14.301 -5.129  1.00 30.75 ? 10  DG  T "O4'" 1 
ATOM   3637 C  "C3'" . DG  B 2 10  ? 40.569 -16.427 -6.145  1.00 34.84 ? 10  DG  T "C3'" 1 
ATOM   3638 O  "O3'" . DG  B 2 10  ? 40.132 -17.482 -5.300  1.00 33.26 ? 10  DG  T "O3'" 1 
ATOM   3639 C  "C2'" . DG  B 2 10  ? 39.405 -15.715 -6.831  1.00 31.80 ? 10  DG  T "C2'" 1 
ATOM   3640 C  "C1'" . DG  B 2 10  ? 39.022 -14.661 -5.804  1.00 28.13 ? 10  DG  T "C1'" 1 
ATOM   3641 N  N9    . DG  B 2 10  ? 38.455 -13.456 -6.402  1.00 22.97 ? 10  DG  T N9    1 
ATOM   3642 C  C8    . DG  B 2 10  ? 39.026 -12.662 -7.370  1.00 25.05 ? 10  DG  T C8    1 
ATOM   3643 N  N7    . DG  B 2 10  ? 38.279 -11.645 -7.719  1.00 21.88 ? 10  DG  T N7    1 
ATOM   3644 C  C5    . DG  B 2 10  ? 37.146 -11.772 -6.928  1.00 20.46 ? 10  DG  T C5    1 
ATOM   3645 C  C6    . DG  B 2 10  ? 35.988 -10.966 -6.861  1.00 20.63 ? 10  DG  T C6    1 
ATOM   3646 O  O6    . DG  B 2 10  ? 35.727 -9.944  -7.513  1.00 27.17 ? 10  DG  T O6    1 
ATOM   3647 N  N1    . DG  B 2 10  ? 35.071 -11.452 -5.928  1.00 24.76 ? 10  DG  T N1    1 
ATOM   3648 C  C2    . DG  B 2 10  ? 35.256 -12.582 -5.157  1.00 22.02 ? 10  DG  T C2    1 
ATOM   3649 N  N2    . DG  B 2 10  ? 34.261 -12.895 -4.316  1.00 27.49 ? 10  DG  T N2    1 
ATOM   3650 N  N3    . DG  B 2 10  ? 36.342 -13.350 -5.207  1.00 22.61 ? 10  DG  T N3    1 
ATOM   3651 C  C4    . DG  B 2 10  ? 37.242 -12.885 -6.110  1.00 19.66 ? 10  DG  T C4    1 
ATOM   3652 P  P     . DC  B 2 11  ? 39.455 -18.803 -5.918  1.00 31.58 ? 11  DC  T P     1 
ATOM   3653 O  OP1   . DC  B 2 11  ? 39.965 -19.937 -5.118  1.00 34.04 ? 11  DC  T OP1   1 
ATOM   3654 O  OP2   . DC  B 2 11  ? 39.642 -18.863 -7.380  1.00 32.63 ? 11  DC  T OP2   1 
ATOM   3655 O  "O5'" . DC  B 2 11  ? 37.898 -18.562 -5.659  1.00 29.41 ? 11  DC  T "O5'" 1 
ATOM   3656 C  "C5'" . DC  B 2 11  ? 37.421 -18.279 -4.358  1.00 26.11 ? 11  DC  T "C5'" 1 
ATOM   3657 C  "C4'" . DC  B 2 11  ? 35.902 -18.234 -4.349  1.00 20.96 ? 11  DC  T "C4'" 1 
ATOM   3658 O  "O4'" . DC  B 2 11  ? 35.446 -16.978 -4.911  1.00 22.39 ? 11  DC  T "O4'" 1 
ATOM   3659 C  "C3'" . DC  B 2 11  ? 35.209 -19.338 -5.151  1.00 16.91 ? 11  DC  T "C3'" 1 
ATOM   3660 O  "O3'" . DC  B 2 11  ? 34.115 -19.834 -4.380  1.00 17.92 ? 11  DC  T "O3'" 1 
ATOM   3661 C  "C2'" . DC  B 2 11  ? 34.750 -18.617 -6.436  1.00 21.13 ? 11  DC  T "C2'" 1 
ATOM   3662 C  "C1'" . DC  B 2 11  ? 34.479 -17.209 -5.923  1.00 21.98 ? 11  DC  T "C1'" 1 
ATOM   3663 N  N1    . DC  B 2 11  ? 34.633 -16.101 -6.944  1.00 20.31 ? 11  DC  T N1    1 
ATOM   3664 C  C2    . DC  B 2 11  ? 33.605 -15.161 -7.113  1.00 17.29 ? 11  DC  T C2    1 
ATOM   3665 O  O2    . DC  B 2 11  ? 32.560 -15.283 -6.474  1.00 21.63 ? 11  DC  T O2    1 
ATOM   3666 N  N3    . DC  B 2 11  ? 33.775 -14.140 -7.999  1.00 18.34 ? 11  DC  T N3    1 
ATOM   3667 C  C4    . DC  B 2 11  ? 34.904 -14.037 -8.687  1.00 17.03 ? 11  DC  T C4    1 
ATOM   3668 N  N4    . DC  B 2 11  ? 35.019 -13.007 -9.544  1.00 17.01 ? 11  DC  T N4    1 
ATOM   3669 C  C5    . DC  B 2 11  ? 35.971 -14.975 -8.526  1.00 14.66 ? 11  DC  T C5    1 
ATOM   3670 C  C6    . DC  B 2 11  ? 35.798 -15.976 -7.640  1.00 18.28 ? 11  DC  T C6    1 
ATOM   3671 P  P     . DT  B 2 12  ? 33.374 -21.203 -4.793  1.00 17.95 ? 12  DT  T P     1 
ATOM   3672 O  OP1   . DT  B 2 12  ? 32.854 -21.796 -3.539  1.00 18.88 ? 12  DT  T OP1   1 
ATOM   3673 O  OP2   . DT  B 2 12  ? 34.247 -21.975 -5.681  1.00 16.82 ? 12  DT  T OP2   1 
ATOM   3674 O  "O5'" . DT  B 2 12  ? 32.126 -20.678 -5.614  1.00 18.83 ? 12  DT  T "O5'" 1 
ATOM   3675 C  "C5'" . DT  B 2 12  ? 31.060 -20.079 -4.938  1.00 19.25 ? 12  DT  T "C5'" 1 
ATOM   3676 C  "C4'" . DT  B 2 12  ? 30.045 -19.607 -5.935  1.00 22.82 ? 12  DT  T "C4'" 1 
ATOM   3677 O  "O4'" . DT  B 2 12  ? 30.614 -18.504 -6.683  1.00 21.87 ? 12  DT  T "O4'" 1 
ATOM   3678 C  "C3'" . DT  B 2 12  ? 29.652 -20.662 -6.981  1.00 21.48 ? 12  DT  T "C3'" 1 
ATOM   3679 O  "O3'" . DT  B 2 12  ? 28.251 -20.591 -7.233  1.00 26.56 ? 12  DT  T "O3'" 1 
ATOM   3680 C  "C2'" . DT  B 2 12  ? 30.459 -20.236 -8.207  1.00 19.59 ? 12  DT  T "C2'" 1 
ATOM   3681 C  "C1'" . DT  B 2 12  ? 30.359 -18.734 -8.046  1.00 26.24 ? 12  DT  T "C1'" 1 
ATOM   3682 N  N1    . DT  B 2 12  ? 31.304 -17.945 -8.864  1.00 26.26 ? 12  DT  T N1    1 
ATOM   3683 C  C2    . DT  B 2 12  ? 30.907 -16.706 -9.291  1.00 20.03 ? 12  DT  T C2    1 
ATOM   3684 O  O2    . DT  B 2 12  ? 29.823 -16.234 -9.022  1.00 25.01 ? 12  DT  T O2    1 
ATOM   3685 N  N3    . DT  B 2 12  ? 31.814 -16.042 -10.047 1.00 21.00 ? 12  DT  T N3    1 
ATOM   3686 C  C4    . DT  B 2 12  ? 33.063 -16.479 -10.428 1.00 16.59 ? 12  DT  T C4    1 
ATOM   3687 O  O4    . DT  B 2 12  ? 33.804 -15.791 -11.120 1.00 23.59 ? 12  DT  T O4    1 
ATOM   3688 C  C5    . DT  B 2 12  ? 33.434 -17.791 -9.945  1.00 18.28 ? 12  DT  T C5    1 
ATOM   3689 C  C7    . DT  B 2 12  ? 34.773 -18.374 -10.291 1.00 24.91 ? 12  DT  T C7    1 
ATOM   3690 C  C6    . DT  B 2 12  ? 32.541 -18.459 -9.192  1.00 19.50 ? 12  DT  T C6    1 
ATOM   3691 O  "O5'" . DA  C 3 1   ? 29.248 -7.791  -15.210 1.00 40.27 ? 1   DA  P "O5'" 1 
ATOM   3692 C  "C5'" . DA  C 3 1   ? 27.952 -8.090  -15.703 1.00 33.07 ? 1   DA  P "C5'" 1 
ATOM   3693 C  "C4'" . DA  C 3 1   ? 27.036 -8.579  -14.590 1.00 30.34 ? 1   DA  P "C4'" 1 
ATOM   3694 O  "O4'" . DA  C 3 1   ? 27.383 -9.932  -14.225 1.00 34.66 ? 1   DA  P "O4'" 1 
ATOM   3695 C  "C3'" . DA  C 3 1   ? 27.061 -7.761  -13.303 1.00 29.76 ? 1   DA  P "C3'" 1 
ATOM   3696 O  "O3'" . DA  C 3 1   ? 25.760 -7.667  -12.774 1.00 27.77 ? 1   DA  P "O3'" 1 
ATOM   3697 C  "C2'" . DA  C 3 1   ? 27.977 -8.549  -12.373 1.00 31.11 ? 1   DA  P "C2'" 1 
ATOM   3698 C  "C1'" . DA  C 3 1   ? 27.922 -9.980  -12.920 1.00 32.26 ? 1   DA  P "C1'" 1 
ATOM   3699 N  N9    . DA  C 3 1   ? 29.240 -10.595 -13.001 1.00 27.31 ? 1   DA  P N9    1 
ATOM   3700 C  C8    . DA  C 3 1   ? 30.280 -10.212 -13.802 1.00 29.39 ? 1   DA  P C8    1 
ATOM   3701 N  N7    . DA  C 3 1   ? 31.359 -10.944 -13.651 1.00 28.11 ? 1   DA  P N7    1 
ATOM   3702 C  C5    . DA  C 3 1   ? 31.001 -11.868 -12.682 1.00 23.16 ? 1   DA  P C5    1 
ATOM   3703 C  C6    . DA  C 3 1   ? 31.700 -12.929 -12.075 1.00 23.29 ? 1   DA  P C6    1 
ATOM   3704 N  N6    . DA  C 3 1   ? 32.958 -13.251 -12.380 1.00 23.19 ? 1   DA  P N6    1 
ATOM   3705 N  N1    . DA  C 3 1   ? 31.046 -13.658 -11.146 1.00 23.40 ? 1   DA  P N1    1 
ATOM   3706 C  C2    . DA  C 3 1   ? 29.780 -13.344 -10.847 1.00 17.09 ? 1   DA  P C2    1 
ATOM   3707 N  N3    . DA  C 3 1   ? 29.020 -12.372 -11.350 1.00 22.18 ? 1   DA  P N3    1 
ATOM   3708 C  C4    . DA  C 3 1   ? 29.699 -11.664 -12.269 1.00 22.77 ? 1   DA  P C4    1 
ATOM   3709 P  P     . DG  C 3 2   ? 25.404 -6.505  -11.721 1.00 38.18 ? 2   DG  P P     1 
ATOM   3710 O  OP1   . DG  C 3 2   ? 23.940 -6.348  -11.744 1.00 28.45 ? 2   DG  P OP1   1 
ATOM   3711 O  OP2   . DG  C 3 2   ? 26.331 -5.365  -11.916 1.00 36.93 ? 2   DG  P OP2   1 
ATOM   3712 O  "O5'" . DG  C 3 2   ? 25.773 -7.148  -10.316 1.00 28.33 ? 2   DG  P "O5'" 1 
ATOM   3713 C  "C5'" . DG  C 3 2   ? 24.843 -7.983  -9.697  1.00 27.76 ? 2   DG  P "C5'" 1 
ATOM   3714 C  "C4'" . DG  C 3 2   ? 25.486 -8.668  -8.533  1.00 20.72 ? 2   DG  P "C4'" 1 
ATOM   3715 O  "O4'" . DG  C 3 2   ? 26.705 -9.307  -8.977  1.00 23.47 ? 2   DG  P "O4'" 1 
ATOM   3716 C  "C3'" . DG  C 3 2   ? 25.883 -7.729  -7.392  1.00 22.92 ? 2   DG  P "C3'" 1 
ATOM   3717 O  "O3'" . DG  C 3 2   ? 25.340 -8.233  -6.196  1.00 24.15 ? 2   DG  P "O3'" 1 
ATOM   3718 C  "C2'" . DG  C 3 2   ? 27.417 -7.776  -7.397  1.00 23.25 ? 2   DG  P "C2'" 1 
ATOM   3719 C  "C1'" . DG  C 3 2   ? 27.674 -9.149  -7.987  1.00 22.84 ? 2   DG  P "C1'" 1 
ATOM   3720 N  N9    . DG  C 3 2   ? 28.998 -9.308  -8.582  1.00 23.74 ? 2   DG  P N9    1 
ATOM   3721 C  C8    . DG  C 3 2   ? 29.648 -8.443  -9.434  1.00 23.95 ? 2   DG  P C8    1 
ATOM   3722 N  N7    . DG  C 3 2   ? 30.836 -8.862  -9.790  1.00 24.09 ? 2   DG  P N7    1 
ATOM   3723 C  C5    . DG  C 3 2   ? 30.973 -10.086 -9.133  1.00 23.02 ? 2   DG  P C5    1 
ATOM   3724 C  C6    . DG  C 3 2   ? 32.049 -11.007 -9.123  1.00 19.12 ? 2   DG  P C6    1 
ATOM   3725 O  O6    . DG  C 3 2   ? 33.129 -10.938 -9.727  1.00 20.70 ? 2   DG  P O6    1 
ATOM   3726 N  N1    . DG  C 3 2   ? 31.771 -12.112 -8.319  1.00 22.35 ? 2   DG  P N1    1 
ATOM   3727 C  C2    . DG  C 3 2   ? 30.605 -12.300 -7.617  1.00 22.32 ? 2   DG  P C2    1 
ATOM   3728 N  N2    . DG  C 3 2   ? 30.512 -13.431 -6.898  1.00 22.28 ? 2   DG  P N2    1 
ATOM   3729 N  N3    . DG  C 3 2   ? 29.596 -11.447 -7.622  1.00 25.99 ? 2   DG  P N3    1 
ATOM   3730 C  C4    . DG  C 3 2   ? 29.850 -10.365 -8.391  1.00 23.52 ? 2   DG  P C4    1 
ATOM   3731 P  P     . DC  C 3 3   ? 25.547 -7.480  -4.793  1.00 30.02 ? 3   DC  P P     1 
ATOM   3732 O  OP1   . DC  C 3 3   ? 24.228 -7.493  -4.127  1.00 37.55 ? 3   DC  P OP1   1 
ATOM   3733 O  OP2   . DC  C 3 3   ? 26.280 -6.208  -4.962  1.00 31.87 ? 3   DC  P OP2   1 
ATOM   3734 O  "O5'" . DC  C 3 3   ? 26.551 -8.444  -4.005  1.00 33.72 ? 3   DC  P "O5'" 1 
ATOM   3735 C  "C5'" . DC  C 3 3   ? 26.284 -9.836  -3.910  1.00 34.29 ? 3   DC  P "C5'" 1 
ATOM   3736 C  "C4'" . DC  C 3 3   ? 27.479 -10.564 -3.322  1.00 37.16 ? 3   DC  P "C4'" 1 
ATOM   3737 O  "O4'" . DC  C 3 3   ? 28.530 -10.625 -4.311  1.00 30.73 ? 3   DC  P "O4'" 1 
ATOM   3738 C  "C3'" . DC  C 3 3   ? 28.085 -9.901  -2.079  1.00 34.05 ? 3   DC  P "C3'" 1 
ATOM   3739 O  "O3'" . DC  C 3 3   ? 27.943 -10.751 -0.952  1.00 38.31 ? 3   DC  P "O3'" 1 
ATOM   3740 C  "C2'" . DC  C 3 3   ? 29.562 -9.669  -2.425  1.00 34.18 ? 3   DC  P "C2'" 1 
ATOM   3741 C  "C1'" . DC  C 3 3   ? 29.779 -10.513 -3.677  1.00 38.58 ? 3   DC  P "C1'" 1 
ATOM   3742 N  N1    . DC  C 3 3   ? 30.734 -9.880  -4.626  1.00 33.13 ? 3   DC  P N1    1 
ATOM   3743 C  C2    . DC  C 3 3   ? 31.934 -10.526 -4.930  1.00 27.13 ? 3   DC  P C2    1 
ATOM   3744 O  O2    . DC  C 3 3   ? 32.170 -11.625 -4.421  1.00 34.37 ? 3   DC  P O2    1 
ATOM   3745 N  N3    . DC  C 3 3   ? 32.804 -9.927  -5.779  1.00 31.17 ? 3   DC  P N3    1 
ATOM   3746 C  C4    . DC  C 3 3   ? 32.513 -8.740  -6.307  1.00 28.28 ? 3   DC  P C4    1 
ATOM   3747 N  N4    . DC  C 3 3   ? 33.403 -8.194  -7.142  1.00 30.55 ? 3   DC  P N4    1 
ATOM   3748 C  C5    . DC  C 3 3   ? 31.294 -8.061  -6.005  1.00 35.21 ? 3   DC  P C5    1 
ATOM   3749 C  C6    . DC  C 3 3   ? 30.446 -8.658  -5.162  1.00 28.50 ? 3   DC  P C6    1 
ATOM   3750 P  P     . DG  C 3 4   ? 28.517 -10.298 0.482   1.00 35.46 ? 4   DG  P P     1 
ATOM   3751 O  OP1   . DG  C 3 4   ? 27.714 -11.015 1.496   1.00 43.79 ? 4   DG  P OP1   1 
ATOM   3752 O  OP2   . DG  C 3 4   ? 28.648 -8.822  0.537   1.00 35.84 ? 4   DG  P OP2   1 
ATOM   3753 O  "O5'" . DG  C 3 4   ? 29.997 -10.889 0.497   1.00 32.58 ? 4   DG  P "O5'" 1 
ATOM   3754 C  "C5'" . DG  C 3 4   ? 30.202 -12.261 0.222   1.00 31.87 ? 4   DG  P "C5'" 1 
ATOM   3755 C  "C4'" . DG  C 3 4   ? 31.677 -12.592 0.286   1.00 38.29 ? 4   DG  P "C4'" 1 
ATOM   3756 O  "O4'" . DG  C 3 4   ? 32.346 -12.013 -0.863  1.00 38.36 ? 4   DG  P "O4'" 1 
ATOM   3757 C  "C3'" . DG  C 3 4   ? 32.387 -12.044 1.526   1.00 34.76 ? 4   DG  P "C3'" 1 
ATOM   3758 O  "O3'" . DG  C 3 4   ? 33.126 -13.072 2.150   1.00 36.90 ? 4   DG  P "O3'" 1 
ATOM   3759 C  "C2'" . DG  C 3 4   ? 33.291 -10.936 0.987   1.00 32.17 ? 4   DG  P "C2'" 1 
ATOM   3760 C  "C1'" . DG  C 3 4   ? 33.524 -11.368 -0.451  1.00 30.55 ? 4   DG  P "C1'" 1 
ATOM   3761 N  N9    . DG  C 3 4   ? 33.763 -10.247 -1.349  1.00 29.24 ? 4   DG  P N9    1 
ATOM   3762 C  C8    . DG  C 3 4   ? 32.931 -9.179  -1.585  1.00 25.94 ? 4   DG  P C8    1 
ATOM   3763 N  N7    . DG  C 3 4   ? 33.409 -8.327  -2.448  1.00 24.21 ? 4   DG  P N7    1 
ATOM   3764 C  C5    . DG  C 3 4   ? 34.642 -8.865  -2.802  1.00 23.85 ? 4   DG  P C5    1 
ATOM   3765 C  C6    . DG  C 3 4   ? 35.615 -8.388  -3.699  1.00 22.99 ? 4   DG  P C6    1 
ATOM   3766 O  O6    . DG  C 3 4   ? 35.591 -7.352  -4.377  1.00 29.12 ? 4   DG  P O6    1 
ATOM   3767 N  N1    . DG  C 3 4   ? 36.719 -9.244  -3.768  1.00 21.48 ? 4   DG  P N1    1 
ATOM   3768 C  C2    . DG  C 3 4   ? 36.850 -10.411 -3.054  1.00 16.88 ? 4   DG  P C2    1 
ATOM   3769 N  N2    . DG  C 3 4   ? 37.985 -11.104 -3.244  1.00 20.73 ? 4   DG  P N2    1 
ATOM   3770 N  N3    . DG  C 3 4   ? 35.936 -10.872 -2.212  1.00 18.32 ? 4   DG  P N3    1 
ATOM   3771 C  C4    . DG  C 3 4   ? 34.867 -10.049 -2.136  1.00 23.69 ? 4   DG  P C4    1 
ATOM   3772 P  P     . DT  C 3 5   ? 33.811 -12.820 3.584   1.00 36.04 ? 5   DT  P P     1 
ATOM   3773 O  OP1   . DT  C 3 5   ? 33.643 -14.061 4.368   1.00 38.84 ? 5   DT  P OP1   1 
ATOM   3774 O  OP2   . DT  C 3 5   ? 33.384 -11.514 4.118   1.00 29.47 ? 5   DT  P OP2   1 
ATOM   3775 O  "O5'" . DT  C 3 5   ? 35.356 -12.666 3.213   1.00 31.02 ? 5   DT  P "O5'" 1 
ATOM   3776 C  "C5'" . DT  C 3 5   ? 35.933 -13.582 2.324   1.00 22.47 ? 5   DT  P "C5'" 1 
ATOM   3777 C  "C4'" . DT  C 3 5   ? 37.346 -13.166 1.981   1.00 19.60 ? 5   DT  P "C4'" 1 
ATOM   3778 O  "O4'" . DT  C 3 5   ? 37.326 -12.138 0.977   1.00 19.85 ? 5   DT  P "O4'" 1 
ATOM   3779 C  "C3'" . DT  C 3 5   ? 38.164 -12.619 3.150   1.00 20.23 ? 5   DT  P "C3'" 1 
ATOM   3780 O  "O3'" . DT  C 3 5   ? 39.361 -13.362 3.223   1.00 20.13 ? 5   DT  P "O3'" 1 
ATOM   3781 C  "C2'" . DT  C 3 5   ? 38.422 -11.148 2.775   1.00 15.95 ? 5   DT  P "C2'" 1 
ATOM   3782 C  "C1'" . DT  C 3 5   ? 38.336 -11.195 1.263   1.00 17.41 ? 5   DT  P "C1'" 1 
ATOM   3783 N  N1    . DT  C 3 5   ? 37.934 -9.921  0.633   1.00 18.13 ? 5   DT  P N1    1 
ATOM   3784 C  C2    . DT  C 3 5   ? 38.767 -9.343  -0.293  1.00 15.69 ? 5   DT  P C2    1 
ATOM   3785 O  O2    . DT  C 3 5   ? 39.846 -9.809  -0.604  1.00 17.65 ? 5   DT  P O2    1 
ATOM   3786 N  N3    . DT  C 3 5   ? 38.294 -8.189  -0.846  1.00 18.93 ? 5   DT  P N3    1 
ATOM   3787 C  C4    . DT  C 3 5   ? 37.097 -7.569  -0.583  1.00 17.14 ? 5   DT  P C4    1 
ATOM   3788 O  O4    . DT  C 3 5   ? 36.772 -6.520  -1.145  1.00 17.86 ? 5   DT  P O4    1 
ATOM   3789 C  C5    . DT  C 3 5   ? 36.261 -8.223  0.402   1.00 18.88 ? 5   DT  P C5    1 
ATOM   3790 C  C7    . DT  C 3 5   ? 34.933 -7.641  0.781   1.00 24.97 ? 5   DT  P C7    1 
ATOM   3791 C  C6    . DT  C 3 5   ? 36.713 -9.363  0.955   1.00 19.39 ? 5   DT  P C6    1 
ATOM   3792 P  P     . DC  C 3 6   ? 40.354 -13.230 4.476   1.00 16.27 ? 6   DC  P P     1 
ATOM   3793 O  OP1   . DC  C 3 6   ? 41.064 -14.538 4.538   1.00 16.44 ? 6   DC  P OP1   1 
ATOM   3794 O  OP2   . DC  C 3 6   ? 39.647 -12.678 5.652   1.00 16.39 ? 6   DC  P OP2   1 
ATOM   3795 O  "O5'" . DC  C 3 6   ? 41.389 -12.117 4.001   1.00 15.84 ? 6   DC  P "O5'" 1 
ATOM   3796 C  "C5'" . DC  C 3 6   ? 42.256 -12.374 2.922   1.00 13.28 ? 6   DC  P "C5'" 1 
ATOM   3797 C  "C4'" . DC  C 3 6   ? 43.007 -11.115 2.576   1.00 18.94 ? 6   DC  P "C4'" 1 
ATOM   3798 O  "O4'" . DC  C 3 6   ? 42.109 -10.188 1.933   1.00 17.37 ? 6   DC  P "O4'" 1 
ATOM   3799 C  "C3'" . DC  C 3 6   ? 43.587 -10.370 3.782   1.00 14.25 ? 6   DC  P "C3'" 1 
ATOM   3800 O  "O3'" . DC  C 3 6   ? 45.015 -10.490 3.756   1.00 12.65 ? 6   DC  P "O3'" 1 
ATOM   3801 C  "C2'" . DC  C 3 6   ? 43.123 -8.908  3.590   1.00 17.36 ? 6   DC  P "C2'" 1 
ATOM   3802 C  "C1'" . DC  C 3 6   ? 42.578 -8.899  2.165   1.00 15.24 ? 6   DC  P "C1'" 1 
ATOM   3803 N  N1    . DC  C 3 6   ? 41.457 -7.950  1.966   1.00 13.66 ? 6   DC  P N1    1 
ATOM   3804 C  C2    . DC  C 3 6   ? 41.527 -7.013  0.932   1.00 16.20 ? 6   DC  P C2    1 
ATOM   3805 O  O2    . DC  C 3 6   ? 42.513 -7.018  0.190   1.00 16.38 ? 6   DC  P O2    1 
ATOM   3806 N  N3    . DC  C 3 6   ? 40.500 -6.136  0.770   1.00 16.79 ? 6   DC  P N3    1 
ATOM   3807 C  C4    . DC  C 3 6   ? 39.451 -6.180  1.593   1.00 17.46 ? 6   DC  P C4    1 
ATOM   3808 N  N4    . DC  C 3 6   ? 38.464 -5.296  1.401   1.00 20.13 ? 6   DC  P N4    1 
ATOM   3809 C  C5    . DC  C 3 6   ? 39.362 -7.122  2.656   1.00 16.19 ? 6   DC  P C5    1 
ATOM   3810 C  C6    . DC  C 3 6   ? 40.379 -7.985  2.803   1.00 15.56 ? 6   DC  P C6    1 
ATOM   3811 P  P     . DA  C 3 7   ? 45.935 -9.751  4.849   1.00 13.95 ? 7   DA  P P     1 
ATOM   3812 O  OP1   . DA  C 3 7   ? 47.160 -10.583 4.980   1.00 15.99 ? 7   DA  P OP1   1 
ATOM   3813 O  OP2   . DA  C 3 7   ? 45.140 -9.435  6.049   1.00 16.46 ? 7   DA  P OP2   1 
ATOM   3814 O  "O5'" . DA  C 3 7   ? 46.271 -8.340  4.174   1.00 15.26 ? 7   DA  P "O5'" 1 
ATOM   3815 C  "C5'" . DA  C 3 7   ? 46.873 -8.292  2.898   1.00 17.54 ? 7   DA  P "C5'" 1 
ATOM   3816 C  "C4'" . DA  C 3 7   ? 46.745 -6.901  2.298   1.00 18.56 ? 7   DA  P "C4'" 1 
ATOM   3817 O  "O4'" . DA  C 3 7   ? 45.388 -6.646  1.905   1.00 18.79 ? 7   DA  P "O4'" 1 
ATOM   3818 C  "C3'" . DA  C 3 7   ? 46.994 -5.750  3.242   1.00 20.54 ? 7   DA  P "C3'" 1 
ATOM   3819 O  "O3'" . DA  C 3 7   ? 48.382 -5.670  3.627   1.00 25.29 ? 7   DA  P "O3'" 1 
ATOM   3820 C  "C2'" . DA  C 3 7   ? 46.477 -4.592  2.404   1.00 20.63 ? 7   DA  P "C2'" 1 
ATOM   3821 C  "C1'" . DA  C 3 7   ? 45.268 -5.236  1.735   1.00 20.65 ? 7   DA  P "C1'" 1 
ATOM   3822 N  N9    . DA  C 3 7   ? 43.992 -4.782  2.259   1.00 16.40 ? 7   DA  P N9    1 
ATOM   3823 C  C8    . DA  C 3 7   ? 43.208 -5.373  3.217   1.00 18.34 ? 7   DA  P C8    1 
ATOM   3824 N  N7    . DA  C 3 7   ? 42.081 -4.724  3.444   1.00 19.12 ? 7   DA  P N7    1 
ATOM   3825 C  C5    . DA  C 3 7   ? 42.148 -3.637  2.577   1.00 16.03 ? 7   DA  P C5    1 
ATOM   3826 C  C6    . DA  C 3 7   ? 41.279 -2.554  2.337   1.00 20.49 ? 7   DA  P C6    1 
ATOM   3827 N  N6    . DA  C 3 7   ? 40.116 -2.400  2.963   1.00 23.80 ? 7   DA  P N6    1 
ATOM   3828 N  N1    . DA  C 3 7   ? 41.654 -1.640  1.415   1.00 16.04 ? 7   DA  P N1    1 
ATOM   3829 C  C2    . DA  C 3 7   ? 42.823 -1.804  0.787   1.00 17.61 ? 7   DA  P C2    1 
ATOM   3830 N  N3    . DA  C 3 7   ? 43.727 -2.773  0.944   1.00 17.90 ? 7   DA  P N3    1 
ATOM   3831 C  C4    . DA  C 3 7   ? 43.321 -3.658  1.858   1.00 17.05 ? 7   DA  P C4    1 
ATOM   3832 P  P     A DT  C 3 8   ? 49.555 -5.065  2.725   0.30 27.82 ? 8   DT  P P     1 
ATOM   3833 P  P     B DT  C 3 8   ? 48.997 -4.369  4.358   0.70 19.19 ? 8   DT  P P     1 
ATOM   3834 O  OP1   A DT  C 3 8   ? 49.515 -5.602  1.350   0.30 25.23 ? 8   DT  P OP1   1 
ATOM   3835 O  OP1   B DT  C 3 8   ? 50.454 -4.603  4.447   0.70 21.92 ? 8   DT  P OP1   1 
ATOM   3836 O  OP2   A DT  C 3 8   ? 50.766 -5.257  3.550   0.30 22.98 ? 8   DT  P OP2   1 
ATOM   3837 O  OP2   B DT  C 3 8   ? 48.192 -4.169  5.589   0.70 19.36 ? 8   DT  P OP2   1 
ATOM   3838 O  "O5'" A DT  C 3 8   ? 49.273 -3.511  2.749   0.30 21.83 ? 8   DT  P "O5'" 1 
ATOM   3839 O  "O5'" B DT  C 3 8   ? 48.720 -3.084  3.409   0.70 20.48 ? 8   DT  P "O5'" 1 
ATOM   3840 C  "C5'" A DT  C 3 8   ? 49.669 -2.781  1.683   0.30 20.07 ? 8   DT  P "C5'" 1 
ATOM   3841 C  "C5'" B DT  C 3 8   ? 49.443 -2.811  2.145   0.70 20.78 ? 8   DT  P "C5'" 1 
ATOM   3842 C  "C4'" . DT  C 3 8   ? 49.158 -1.364  1.748   1.00 18.15 ? 8   DT  P "C4'" 1 
ATOM   3843 O  "O4'" . DT  C 3 8   ? 47.719 -1.251  1.765   1.00 16.05 ? 8   DT  P "O4'" 1 
ATOM   3844 C  "C3'" . DT  C 3 8   ? 49.698 -0.428  2.823   1.00 17.04 ? 8   DT  P "C3'" 1 
ATOM   3845 O  "O3'" . DT  C 3 8   ? 50.448 0.601   2.227   1.00 15.71 ? 8   DT  P "O3'" 1 
ATOM   3846 C  "C2'" . DT  C 3 8   ? 48.443 0.109   3.527   1.00 18.27 ? 8   DT  P "C2'" 1 
ATOM   3847 C  "C1'" . DT  C 3 8   ? 47.351 -0.097  2.489   1.00 18.59 ? 8   DT  P "C1'" 1 
ATOM   3848 N  N1    . DT  C 3 8   ? 46.022 -0.316  3.117   1.00 15.20 ? 8   DT  P N1    1 
ATOM   3849 C  C2    . DT  C 3 8   ? 45.011 0.590   2.891   1.00 17.11 ? 8   DT  P C2    1 
ATOM   3850 O  O2    . DT  C 3 8   ? 45.133 1.568   2.179   1.00 21.60 ? 8   DT  P O2    1 
ATOM   3851 N  N3    . DT  C 3 8   ? 43.838 0.307   3.536   1.00 18.94 ? 8   DT  P N3    1 
ATOM   3852 C  C4    . DT  C 3 8   ? 43.581 -0.759  4.366   1.00 17.74 ? 8   DT  P C4    1 
ATOM   3853 O  O4    . DT  C 3 8   ? 42.493 -0.928  4.900   1.00 19.70 ? 8   DT  P O4    1 
ATOM   3854 C  C5    . DT  C 3 8   ? 44.686 -1.663  4.571   1.00 16.08 ? 8   DT  P C5    1 
ATOM   3855 C  C7    . DT  C 3 8   ? 44.518 -2.864  5.458   1.00 20.01 ? 8   DT  P C7    1 
ATOM   3856 C  C6    . DT  C 3 8   ? 45.841 -1.397  3.946   1.00 18.04 ? 8   DT  P C6    1 
HETATM 3857 MN MN    . MN  D 4 .   ? 52.761 0.375   2.084   0.80 12.32 ? 501 MN  A MN    1 
HETATM 3858 CA CA    A CA  E 5 .   ? 54.823 2.627   3.936   0.70 12.58 ? 502 CA  A CA    1 
HETATM 3859 MN MN    B MN  F 4 .   ? 54.822 2.627   3.937   0.30 12.52 ? 503 MN  A MN    1 
HETATM 3860 C  C1    . GOL G 6 .   ? 60.213 -24.851 12.225  1.00 14.63 ? 504 GOL A C1    1 
HETATM 3861 O  O1    . GOL G 6 .   ? 58.837 -24.933 12.388  1.00 16.43 ? 504 GOL A O1    1 
HETATM 3862 C  C2    . GOL G 6 .   ? 60.368 -24.498 10.748  1.00 22.34 ? 504 GOL A C2    1 
HETATM 3863 O  O2    . GOL G 6 .   ? 60.509 -23.111 10.618  1.00 14.90 ? 504 GOL A O2    1 
HETATM 3864 C  C3    . GOL G 6 .   ? 61.310 -25.366 9.915   1.00 28.97 ? 504 GOL A C3    1 
HETATM 3865 O  O3    . GOL G 6 .   ? 61.420 -24.882 8.588   1.00 16.54 ? 504 GOL A O3    1 
HETATM 3866 C  C1    . GOL H 6 .   ? 54.305 28.049  4.691   1.00 28.47 ? 505 GOL A C1    1 
HETATM 3867 O  O1    . GOL H 6 .   ? 52.967 27.784  4.304   1.00 27.60 ? 505 GOL A O1    1 
HETATM 3868 C  C2    . GOL H 6 .   ? 54.784 27.056  5.747   1.00 35.92 ? 505 GOL A C2    1 
HETATM 3869 O  O2    . GOL H 6 .   ? 54.102 25.825  5.617   1.00 37.61 ? 505 GOL A O2    1 
HETATM 3870 C  C3    . GOL H 6 .   ? 56.276 26.819  5.562   1.00 31.57 ? 505 GOL A C3    1 
HETATM 3871 O  O3    . GOL H 6 .   ? 56.822 25.992  6.577   1.00 21.73 ? 505 GOL A O3    1 
HETATM 3872 P  PG    . DTP I 7 .   ? 55.147 2.651   7.449   1.00 11.79 ? 506 DTP A PG    1 
HETATM 3873 O  O1G   . DTP I 7 .   ? 55.023 1.882   6.155   1.00 11.93 ? 506 DTP A O1G   1 
HETATM 3874 O  O2G   . DTP I 7 .   ? 56.463 3.370   7.586   1.00 12.61 ? 506 DTP A O2G   1 
HETATM 3875 O  O3G   . DTP I 7 .   ? 54.910 1.751   8.661   1.00 12.75 ? 506 DTP A O3G   1 
HETATM 3876 P  PB    . DTP I 7 .   ? 52.957 4.144   6.345   1.00 10.43 ? 506 DTP A PB    1 
HETATM 3877 O  O1B   . DTP I 7 .   ? 53.706 4.386   5.047   1.00 10.61 ? 506 DTP A O1B   1 
HETATM 3878 O  O2B   . DTP I 7 .   ? 52.172 5.362   6.793   1.00 10.88 ? 506 DTP A O2B   1 
HETATM 3879 O  O3B   . DTP I 7 .   ? 53.997 3.773   7.521   1.00 9.79  ? 506 DTP A O3B   1 
HETATM 3880 P  PA    . DTP I 7 .   ? 51.468 2.077   4.964   1.00 12.68 ? 506 DTP A PA    1 
HETATM 3881 O  O1A   . DTP I 7 .   ? 52.607 1.612   4.098   1.00 12.25 ? 506 DTP A O1A   1 
HETATM 3882 O  O2A   . DTP I 7 .   ? 50.644 0.950   5.552   1.00 14.39 ? 506 DTP A O2A   1 
HETATM 3883 O  O3A   . DTP I 7 .   ? 51.974 2.898   6.247   1.00 10.96 ? 506 DTP A O3A   1 
HETATM 3884 O  "O5'" . DTP I 7 .   ? 50.472 3.021   4.185   1.00 11.49 ? 506 DTP A "O5'" 1 
HETATM 3885 C  "C5'" . DTP I 7 .   ? 50.937 3.997   3.288   1.00 13.49 ? 506 DTP A "C5'" 1 
HETATM 3886 C  "C4'" . DTP I 7 .   ? 49.989 5.195   3.291   1.00 10.14 ? 506 DTP A "C4'" 1 
HETATM 3887 O  "O4'" . DTP I 7 .   ? 48.710 4.770   2.874   1.00 11.87 ? 506 DTP A "O4'" 1 
HETATM 3888 C  "C3'" . DTP I 7 .   ? 49.855 5.781   4.612   1.00 9.90  ? 506 DTP A "C3'" 1 
HETATM 3889 O  "O3'" . DTP I 7 .   ? 50.856 6.790   4.828   1.00 10.46 ? 506 DTP A "O3'" 1 
HETATM 3890 C  "C2'" . DTP I 7 .   ? 48.496 6.349   4.610   1.00 11.01 ? 506 DTP A "C2'" 1 
HETATM 3891 C  "C1'" . DTP I 7 .   ? 47.742 5.430   3.701   1.00 11.81 ? 506 DTP A "C1'" 1 
HETATM 3892 N  N9    . DTP I 7 .   ? 46.992 4.444   4.411   1.00 10.37 ? 506 DTP A N9    1 
HETATM 3893 C  C8    . DTP I 7 .   ? 47.434 3.259   4.900   1.00 11.92 ? 506 DTP A C8    1 
HETATM 3894 N  N7    . DTP I 7 .   ? 46.451 2.606   5.516   1.00 13.63 ? 506 DTP A N7    1 
HETATM 3895 C  C5    . DTP I 7 .   ? 45.331 3.342   5.416   1.00 12.09 ? 506 DTP A C5    1 
HETATM 3896 C  C6    . DTP I 7 .   ? 44.017 3.190   5.847   1.00 15.52 ? 506 DTP A C6    1 
HETATM 3897 N  N6    . DTP I 7 .   ? 43.639 2.016   6.563   1.00 17.16 ? 506 DTP A N6    1 
HETATM 3898 N  N1    . DTP I 7 .   ? 43.129 4.147   5.589   1.00 14.32 ? 506 DTP A N1    1 
HETATM 3899 C  C2    . DTP I 7 .   ? 43.452 5.270   4.904   1.00 13.22 ? 506 DTP A C2    1 
HETATM 3900 N  N3    . DTP I 7 .   ? 44.728 5.459   4.466   1.00 13.32 ? 506 DTP A N3    1 
HETATM 3901 C  C4    . DTP I 7 .   ? 45.660 4.518   4.719   1.00 10.31 ? 506 DTP A C4    1 
HETATM 3902 C  C1    A EDO J 8 .   ? 56.329 -4.289  4.443   0.53 13.17 ? 507 EDO A C1    1 
HETATM 3903 O  O1    A EDO J 8 .   ? 55.900 -3.121  3.855   0.53 25.48 ? 507 EDO A O1    1 
HETATM 3904 C  C2    A EDO J 8 .   ? 57.086 -3.702  5.585   0.53 25.34 ? 507 EDO A C2    1 
HETATM 3905 O  O2    A EDO J 8 .   ? 56.586 -2.389  5.671   0.53 18.50 ? 507 EDO A O2    1 
HETATM 3906 O  O     . HOH K 9 .   ? 65.968 -2.464  12.761  1.00 29.86 ? 601 HOH A O     1 
HETATM 3907 O  O     . HOH K 9 .   ? 68.335 -15.806 -7.751  1.00 24.88 ? 602 HOH A O     1 
HETATM 3908 O  O     . HOH K 9 .   ? 57.677 12.038  -12.290 1.00 34.64 ? 603 HOH A O     1 
HETATM 3909 O  O     . HOH K 9 .   ? 70.177 0.459   11.497  1.00 28.91 ? 604 HOH A O     1 
HETATM 3910 O  O     . HOH K 9 .   ? 38.713 -19.795 12.335  1.00 29.60 ? 605 HOH A O     1 
HETATM 3911 O  O     A HOH K 9 .   ? 58.905 1.908   6.291   0.48 20.22 ? 606 HOH A O     1 
HETATM 3912 O  O     . HOH K 9 .   ? 43.758 -33.145 5.670   1.00 32.74 ? 607 HOH A O     1 
HETATM 3913 O  O     . HOH K 9 .   ? 34.898 5.501   2.009   1.00 17.96 ? 608 HOH A O     1 
HETATM 3914 O  O     . HOH K 9 .   ? 48.292 -6.119  -11.726 1.00 40.86 ? 609 HOH A O     1 
HETATM 3915 O  O     . HOH K 9 .   ? 50.577 17.425  -5.804  1.00 28.73 ? 610 HOH A O     1 
HETATM 3916 O  O     . HOH K 9 .   ? 31.915 -1.154  -2.897  1.00 40.71 ? 611 HOH A O     1 
HETATM 3917 O  O     . HOH K 9 .   ? 80.536 -15.846 7.540   1.00 34.33 ? 612 HOH A O     1 
HETATM 3918 O  O     . HOH K 9 .   ? 60.881 -15.975 13.736  1.00 26.00 ? 613 HOH A O     1 
HETATM 3919 O  O     . HOH K 9 .   ? 30.666 1.218   3.408   1.00 41.18 ? 614 HOH A O     1 
HETATM 3920 O  O     . HOH K 9 .   ? 53.037 24.134  4.097   1.00 28.98 ? 615 HOH A O     1 
HETATM 3921 O  O     . HOH K 9 .   ? 65.545 -25.564 0.063   1.00 33.93 ? 616 HOH A O     1 
HETATM 3922 O  O     . HOH K 9 .   ? 58.375 -12.130 -11.456 1.00 14.33 ? 617 HOH A O     1 
HETATM 3923 O  O     . HOH K 9 .   ? 65.425 -6.655  -13.836 1.00 18.83 ? 618 HOH A O     1 
HETATM 3924 O  O     . HOH K 9 .   ? 45.494 1.961   18.240  1.00 33.75 ? 619 HOH A O     1 
HETATM 3925 O  O     . HOH K 9 .   ? 48.280 -36.783 2.619   1.00 21.46 ? 620 HOH A O     1 
HETATM 3926 O  O     . HOH K 9 .   ? 50.012 -27.584 18.485  1.00 29.30 ? 621 HOH A O     1 
HETATM 3927 O  O     . HOH K 9 .   ? 34.169 5.932   -21.679 1.00 29.84 ? 622 HOH A O     1 
HETATM 3928 O  O     . HOH K 9 .   ? 33.014 10.582  5.504   1.00 22.01 ? 623 HOH A O     1 
HETATM 3929 O  O     . HOH K 9 .   ? 60.524 -0.203  -16.147 1.00 38.26 ? 624 HOH A O     1 
HETATM 3930 O  O     . HOH K 9 .   ? 37.224 14.996  -20.278 1.00 32.59 ? 625 HOH A O     1 
HETATM 3931 O  O     . HOH K 9 .   ? 56.261 -14.003 -5.836  1.00 11.80 ? 626 HOH A O     1 
HETATM 3932 O  O     . HOH K 9 .   ? 48.543 0.083   9.716   1.00 40.30 ? 627 HOH A O     1 
HETATM 3933 O  O     . HOH K 9 .   ? 57.127 -16.403 -11.297 1.00 20.85 ? 628 HOH A O     1 
HETATM 3934 O  O     . HOH K 9 .   ? 27.644 6.777   -16.973 1.00 24.82 ? 629 HOH A O     1 
HETATM 3935 O  O     . HOH K 9 .   ? 64.195 -24.338 -7.857  1.00 39.23 ? 630 HOH A O     1 
HETATM 3936 O  O     . HOH K 9 .   ? 48.108 -33.321 -3.599  1.00 28.14 ? 631 HOH A O     1 
HETATM 3937 O  O     . HOH K 9 .   ? 72.933 2.094   7.864   1.00 30.69 ? 632 HOH A O     1 
HETATM 3938 O  O     . HOH K 9 .   ? 57.752 -23.433 14.206  1.00 9.66  ? 633 HOH A O     1 
HETATM 3939 O  O     . HOH K 9 .   ? 40.796 13.984  -6.356  1.00 32.08 ? 634 HOH A O     1 
HETATM 3940 O  O     . HOH K 9 .   ? 67.166 -8.370  10.045  1.00 23.27 ? 635 HOH A O     1 
HETATM 3941 O  O     . HOH K 9 .   ? 62.644 -17.062 -7.254  1.00 23.47 ? 636 HOH A O     1 
HETATM 3942 O  O     . HOH K 9 .   ? 53.822 15.220  -6.741  1.00 16.94 ? 637 HOH A O     1 
HETATM 3943 O  O     . HOH K 9 .   ? 41.221 16.929  -14.719 1.00 20.80 ? 638 HOH A O     1 
HETATM 3944 O  O     . HOH K 9 .   ? 52.151 20.102  5.061   1.00 18.12 ? 639 HOH A O     1 
HETATM 3945 O  O     . HOH K 9 .   ? 52.439 3.713   17.905  1.00 27.96 ? 640 HOH A O     1 
HETATM 3946 O  O     . HOH K 9 .   ? 60.248 6.231   -15.662 1.00 26.46 ? 641 HOH A O     1 
HETATM 3947 O  O     . HOH K 9 .   ? 62.586 9.438   -13.397 1.00 31.78 ? 642 HOH A O     1 
HETATM 3948 O  O     . HOH K 9 .   ? 54.216 -0.614  6.080   1.00 20.35 ? 643 HOH A O     1 
HETATM 3949 O  O     . HOH K 9 .   ? 40.948 7.666   -18.485 1.00 16.22 ? 644 HOH A O     1 
HETATM 3950 O  O     . HOH K 9 .   ? 77.852 -1.005  5.423   1.00 19.95 ? 645 HOH A O     1 
HETATM 3951 O  O     . HOH K 9 .   ? 40.511 11.384  -3.500  1.00 13.73 ? 646 HOH A O     1 
HETATM 3952 O  O     . HOH K 9 .   ? 48.758 13.584  28.350  1.00 31.12 ? 647 HOH A O     1 
HETATM 3953 O  O     . HOH K 9 .   ? 51.843 5.754   9.376   1.00 13.10 ? 648 HOH A O     1 
HETATM 3954 O  O     . HOH K 9 .   ? 71.921 -3.903  -13.922 1.00 24.80 ? 649 HOH A O     1 
HETATM 3955 O  O     . HOH K 9 .   ? 62.288 7.493   7.102   1.00 14.86 ? 650 HOH A O     1 
HETATM 3956 O  O     . HOH K 9 .   ? 42.474 13.106  -23.783 1.00 28.65 ? 651 HOH A O     1 
HETATM 3957 O  O     . HOH K 9 .   ? 69.413 9.908   -8.592  1.00 26.60 ? 652 HOH A O     1 
HETATM 3958 O  O     . HOH K 9 .   ? 52.524 1.273   9.682   1.00 16.35 ? 653 HOH A O     1 
HETATM 3959 O  O     . HOH K 9 .   ? 61.348 -17.694 -13.018 1.00 42.26 ? 654 HOH A O     1 
HETATM 3960 O  O     . HOH K 9 .   ? 52.659 -19.712 22.233  1.00 25.81 ? 655 HOH A O     1 
HETATM 3961 O  O     . HOH K 9 .   ? 40.219 9.007   27.018  1.00 24.90 ? 656 HOH A O     1 
HETATM 3962 O  O     . HOH K 9 .   ? 40.604 16.750  6.217   1.00 25.34 ? 657 HOH A O     1 
HETATM 3963 O  O     . HOH K 9 .   ? 77.676 3.237   -1.201  1.00 45.11 ? 658 HOH A O     1 
HETATM 3964 O  O     . HOH K 9 .   ? 48.871 2.774   21.243  1.00 22.64 ? 659 HOH A O     1 
HETATM 3965 O  O     . HOH K 9 .   ? 53.203 -28.178 15.285  1.00 18.55 ? 660 HOH A O     1 
HETATM 3966 O  O     . HOH K 9 .   ? 47.036 -22.668 17.366  1.00 23.54 ? 661 HOH A O     1 
HETATM 3967 O  O     . HOH K 9 .   ? 59.038 27.038  7.604   1.00 23.82 ? 662 HOH A O     1 
HETATM 3968 O  O     . HOH K 9 .   ? 45.792 7.529   -12.934 1.00 31.75 ? 663 HOH A O     1 
HETATM 3969 O  O     . HOH K 9 .   ? 76.212 2.658   6.721   1.00 26.25 ? 664 HOH A O     1 
HETATM 3970 O  O     . HOH K 9 .   ? 24.511 -8.160  -0.924  1.00 47.08 ? 665 HOH A O     1 
HETATM 3971 O  O     . HOH K 9 .   ? 64.990 -9.236  12.321  1.00 36.47 ? 666 HOH A O     1 
HETATM 3972 O  O     . HOH K 9 .   ? 45.399 17.960  -3.494  1.00 27.47 ? 667 HOH A O     1 
HETATM 3973 O  O     . HOH K 9 .   ? 67.250 -20.722 8.744   1.00 11.65 ? 668 HOH A O     1 
HETATM 3974 O  O     . HOH K 9 .   ? 59.720 14.000  -8.683  1.00 17.58 ? 669 HOH A O     1 
HETATM 3975 O  O     . HOH K 9 .   ? 57.604 -7.432  8.028   1.00 19.19 ? 670 HOH A O     1 
HETATM 3976 O  O     . HOH K 9 .   ? 53.586 6.044   -12.351 1.00 20.32 ? 671 HOH A O     1 
HETATM 3977 O  O     . HOH K 9 .   ? 60.529 -28.327 8.516   1.00 28.34 ? 672 HOH A O     1 
HETATM 3978 O  O     . HOH K 9 .   ? 72.072 -7.750  11.639  1.00 18.58 ? 673 HOH A O     1 
HETATM 3979 O  O     . HOH K 9 .   ? 50.325 -13.192 -0.952  1.00 30.30 ? 674 HOH A O     1 
HETATM 3980 O  O     . HOH K 9 .   ? 69.568 -12.991 -11.488 1.00 26.43 ? 675 HOH A O     1 
HETATM 3981 O  O     . HOH K 9 .   ? 34.616 17.450  -12.708 1.00 34.49 ? 676 HOH A O     1 
HETATM 3982 O  O     . HOH K 9 .   ? 36.880 16.040  -4.226  1.00 21.48 ? 677 HOH A O     1 
HETATM 3983 O  O     . HOH K 9 .   ? 62.369 14.711  -9.128  1.00 14.23 ? 678 HOH A O     1 
HETATM 3984 O  O     . HOH K 9 .   ? 78.820 3.432   1.836   1.00 36.21 ? 679 HOH A O     1 
HETATM 3985 O  O     . HOH K 9 .   ? 47.791 10.931  -13.716 1.00 29.59 ? 680 HOH A O     1 
HETATM 3986 O  O     . HOH K 9 .   ? 67.298 -6.503  12.816  1.00 23.14 ? 681 HOH A O     1 
HETATM 3987 O  O     . HOH K 9 .   ? 47.501 15.973  -17.898 1.00 33.59 ? 682 HOH A O     1 
HETATM 3988 O  O     . HOH K 9 .   ? 36.131 -0.701  -24.740 1.00 41.18 ? 683 HOH A O     1 
HETATM 3989 O  O     . HOH K 9 .   ? 72.082 2.049   12.103  1.00 36.03 ? 684 HOH A O     1 
HETATM 3990 O  O     . HOH K 9 .   ? 53.653 -28.445 4.194   1.00 13.24 ? 685 HOH A O     1 
HETATM 3991 O  O     . HOH K 9 .   ? 53.265 19.260  -1.451  1.00 20.35 ? 686 HOH A O     1 
HETATM 3992 O  O     . HOH K 9 .   ? 28.717 10.021  -26.533 1.00 47.87 ? 687 HOH A O     1 
HETATM 3993 O  O     . HOH K 9 .   ? 30.855 1.687   -22.097 1.00 25.47 ? 688 HOH A O     1 
HETATM 3994 O  O     . HOH K 9 .   ? 65.468 5.704   2.169   1.00 19.91 ? 689 HOH A O     1 
HETATM 3995 O  O     . HOH K 9 .   ? 39.801 7.141   13.519  1.00 28.69 ? 690 HOH A O     1 
HETATM 3996 O  O     . HOH K 9 .   ? 70.409 -17.229 12.408  1.00 26.16 ? 691 HOH A O     1 
HETATM 3997 O  O     . HOH K 9 .   ? 47.744 -27.078 -7.219  1.00 28.78 ? 692 HOH A O     1 
HETATM 3998 O  O     . HOH K 9 .   ? 45.391 15.811  -1.509  1.00 13.83 ? 693 HOH A O     1 
HETATM 3999 O  O     . HOH K 9 .   ? 63.907 -3.448  6.061   1.00 12.24 ? 694 HOH A O     1 
HETATM 4000 O  O     . HOH K 9 .   ? 68.611 16.202  -4.036  1.00 15.28 ? 695 HOH A O     1 
HETATM 4001 O  O     . HOH K 9 .   ? 70.923 3.521   -0.343  1.00 16.57 ? 696 HOH A O     1 
HETATM 4002 O  O     . HOH K 9 .   ? 51.338 5.133   -10.865 1.00 18.01 ? 697 HOH A O     1 
HETATM 4003 O  O     . HOH K 9 .   ? 68.968 -17.595 -1.288  1.00 12.40 ? 698 HOH A O     1 
HETATM 4004 O  O     . HOH K 9 .   ? 70.547 -18.982 1.430   1.00 15.68 ? 699 HOH A O     1 
HETATM 4005 O  O     . HOH K 9 .   ? 63.023 12.740  -10.791 1.00 24.03 ? 700 HOH A O     1 
HETATM 4006 O  O     . HOH K 9 .   ? 49.555 -9.413  -8.307  1.00 24.61 ? 701 HOH A O     1 
HETATM 4007 O  O     . HOH K 9 .   ? 42.135 -18.986 14.876  1.00 22.77 ? 702 HOH A O     1 
HETATM 4008 O  O     . HOH K 9 .   ? 60.637 -23.501 6.381   1.00 17.39 ? 703 HOH A O     1 
HETATM 4009 O  O     . HOH K 9 .   ? 33.323 7.700   17.354  1.00 38.04 ? 704 HOH A O     1 
HETATM 4010 O  O     . HOH K 9 .   ? 70.484 -15.973 7.731   1.00 16.21 ? 705 HOH A O     1 
HETATM 4011 O  O     . HOH K 9 .   ? 50.028 -17.202 15.517  1.00 17.46 ? 706 HOH A O     1 
HETATM 4012 O  O     . HOH K 9 .   ? 41.580 -30.399 -6.336  1.00 22.65 ? 707 HOH A O     1 
HETATM 4013 O  O     . HOH K 9 .   ? 42.991 -25.400 17.449  1.00 33.89 ? 708 HOH A O     1 
HETATM 4014 O  O     . HOH K 9 .   ? 43.873 11.025  -12.291 1.00 19.40 ? 709 HOH A O     1 
HETATM 4015 O  O     . HOH K 9 .   ? 54.115 -9.505  5.374   1.00 17.12 ? 710 HOH A O     1 
HETATM 4016 O  O     . HOH K 9 .   ? 35.769 10.904  0.803   1.00 20.58 ? 711 HOH A O     1 
HETATM 4017 O  O     . HOH K 9 .   ? 52.146 15.698  -4.712  1.00 14.30 ? 712 HOH A O     1 
HETATM 4018 O  O     . HOH K 9 .   ? 49.767 -8.923  12.987  1.00 27.07 ? 713 HOH A O     1 
HETATM 4019 O  O     . HOH K 9 .   ? 43.300 -33.169 -0.548  1.00 17.39 ? 714 HOH A O     1 
HETATM 4020 O  O     . HOH K 9 .   ? 53.436 7.394   -14.721 1.00 24.98 ? 715 HOH A O     1 
HETATM 4021 O  O     . HOH K 9 .   ? 64.950 -34.592 -6.069  1.00 32.87 ? 716 HOH A O     1 
HETATM 4022 O  O     . HOH K 9 .   ? 55.296 17.342  -0.608  1.00 12.54 ? 717 HOH A O     1 
HETATM 4023 O  O     . HOH K 9 .   ? 55.825 -3.395  8.103   1.00 29.23 ? 718 HOH A O     1 
HETATM 4024 O  O     . HOH K 9 .   ? 33.777 3.038   2.865   1.00 32.03 ? 719 HOH A O     1 
HETATM 4025 O  O     . HOH K 9 .   ? 66.904 -16.633 9.710   1.00 13.60 ? 720 HOH A O     1 
HETATM 4026 O  O     . HOH K 9 .   ? 41.041 6.732   19.208  1.00 19.18 ? 721 HOH A O     1 
HETATM 4027 O  O     . HOH K 9 .   ? 61.119 20.894  11.945  1.00 25.78 ? 722 HOH A O     1 
HETATM 4028 O  O     . HOH K 9 .   ? 43.671 -14.435 5.675   1.00 13.60 ? 723 HOH A O     1 
HETATM 4029 O  O     . HOH K 9 .   ? 52.868 -26.332 -3.952  1.00 23.42 ? 724 HOH A O     1 
HETATM 4030 O  O     . HOH K 9 .   ? 58.198 -17.960 19.756  1.00 20.56 ? 725 HOH A O     1 
HETATM 4031 O  O     . HOH K 9 .   ? 56.176 1.191   13.249  1.00 24.49 ? 726 HOH A O     1 
HETATM 4032 O  O     . HOH K 9 .   ? 53.569 -32.487 -2.891  1.00 33.44 ? 727 HOH A O     1 
HETATM 4033 O  O     . HOH K 9 .   ? 52.877 -1.143  3.611   1.00 17.58 ? 728 HOH A O     1 
HETATM 4034 O  O     . HOH K 9 .   ? 42.561 15.620  23.673  1.00 20.51 ? 729 HOH A O     1 
HETATM 4035 O  O     . HOH K 9 .   ? 41.384 15.725  -22.900 1.00 25.06 ? 730 HOH A O     1 
HETATM 4036 O  O     . HOH K 9 .   ? 52.471 8.556   25.693  1.00 32.35 ? 731 HOH A O     1 
HETATM 4037 O  O     . HOH K 9 .   ? 50.984 -8.820  -5.257  1.00 26.03 ? 732 HOH A O     1 
HETATM 4038 O  O     . HOH K 9 .   ? 49.787 -15.806 -8.914  1.00 31.33 ? 733 HOH A O     1 
HETATM 4039 O  O     . HOH K 9 .   ? 56.014 18.660  18.287  1.00 19.76 ? 734 HOH A O     1 
HETATM 4040 O  O     . HOH K 9 .   ? 59.690 13.012  11.400  1.00 21.88 ? 735 HOH A O     1 
HETATM 4041 O  O     . HOH K 9 .   ? 37.034 18.565  16.886  1.00 37.98 ? 736 HOH A O     1 
HETATM 4042 O  O     . HOH K 9 .   ? 63.118 -7.415  12.886  1.00 27.73 ? 737 HOH A O     1 
HETATM 4043 O  O     . HOH K 9 .   ? 39.380 -2.114  -14.261 1.00 25.37 ? 738 HOH A O     1 
HETATM 4044 O  O     . HOH K 9 .   ? 49.788 -3.084  -17.189 1.00 20.38 ? 739 HOH A O     1 
HETATM 4045 O  O     . HOH K 9 .   ? 53.449 13.518  -9.910  1.00 17.70 ? 740 HOH A O     1 
HETATM 4046 O  O     . HOH K 9 .   ? 65.664 -15.190 11.638  1.00 17.34 ? 741 HOH A O     1 
HETATM 4047 O  O     . HOH K 9 .   ? 47.166 -0.410  -8.266  1.00 28.42 ? 742 HOH A O     1 
HETATM 4048 O  O     . HOH K 9 .   ? 62.887 -23.692 3.308   1.00 27.24 ? 743 HOH A O     1 
HETATM 4049 O  O     . HOH K 9 .   ? 62.879 -26.596 6.984   1.00 19.97 ? 744 HOH A O     1 
HETATM 4050 O  O     . HOH K 9 .   ? 22.041 -4.388  3.275   1.00 47.24 ? 745 HOH A O     1 
HETATM 4051 O  O     . HOH K 9 .   ? 48.827 -9.521  10.536  1.00 24.79 ? 746 HOH A O     1 
HETATM 4052 O  O     . HOH K 9 .   ? 20.369 17.689  -5.251  1.00 36.83 ? 747 HOH A O     1 
HETATM 4053 O  O     . HOH K 9 .   ? 71.344 5.974   -7.243  1.00 20.36 ? 748 HOH A O     1 
HETATM 4054 O  O     . HOH K 9 .   ? 49.782 2.983   12.862  1.00 24.42 ? 749 HOH A O     1 
HETATM 4055 O  O     . HOH K 9 .   ? 75.034 0.314   -3.823  1.00 27.38 ? 750 HOH A O     1 
HETATM 4056 O  O     . HOH K 9 .   ? 81.319 -10.973 -8.195  1.00 41.76 ? 751 HOH A O     1 
HETATM 4057 O  O     . HOH K 9 .   ? 48.864 -34.567 10.117  1.00 32.54 ? 752 HOH A O     1 
HETATM 4058 O  O     . HOH K 9 .   ? 77.706 -16.696 10.699  1.00 39.22 ? 753 HOH A O     1 
HETATM 4059 O  O     . HOH K 9 .   ? 59.768 11.448  -10.350 1.00 19.19 ? 754 HOH A O     1 
HETATM 4060 O  O     . HOH K 9 .   ? 61.365 -31.605 -10.479 1.00 37.97 ? 755 HOH A O     1 
HETATM 4061 O  O     . HOH K 9 .   ? 83.457 -7.930  0.865   1.00 37.35 ? 756 HOH A O     1 
HETATM 4062 O  O     . HOH K 9 .   ? 60.545 13.934  6.368   1.00 26.73 ? 757 HOH A O     1 
HETATM 4063 O  O     . HOH K 9 .   ? 54.071 15.563  23.325  1.00 30.22 ? 758 HOH A O     1 
HETATM 4064 O  O     . HOH K 9 .   ? 59.164 4.834   16.714  1.00 20.28 ? 759 HOH A O     1 
HETATM 4065 O  O     . HOH K 9 .   ? 66.403 4.003   10.692  1.00 30.23 ? 760 HOH A O     1 
HETATM 4066 O  O     . HOH K 9 .   ? 55.277 -1.424  -14.820 1.00 27.73 ? 761 HOH A O     1 
HETATM 4067 O  O     . HOH K 9 .   ? 51.397 -35.311 7.761   1.00 32.50 ? 762 HOH A O     1 
HETATM 4068 O  O     . HOH K 9 .   ? 63.261 -17.168 15.047  1.00 28.69 ? 763 HOH A O     1 
HETATM 4069 O  O     . HOH K 9 .   ? 65.433 -22.884 3.234   1.00 12.60 ? 764 HOH A O     1 
HETATM 4070 O  O     . HOH K 9 .   ? 52.405 -5.393  -0.810  1.00 22.20 ? 765 HOH A O     1 
HETATM 4071 O  O     . HOH K 9 .   ? 23.142 14.238  -9.152  1.00 27.00 ? 766 HOH A O     1 
HETATM 4072 O  O     . HOH K 9 .   ? 51.213 8.715   -15.467 1.00 27.62 ? 767 HOH A O     1 
HETATM 4073 O  O     . HOH K 9 .   ? 44.342 7.255   2.355   1.00 16.25 ? 768 HOH A O     1 
HETATM 4074 O  O     . HOH K 9 .   ? 64.402 6.527   -0.468  1.00 18.01 ? 769 HOH A O     1 
HETATM 4075 O  O     . HOH K 9 .   ? 49.293 17.516  -11.339 1.00 36.08 ? 770 HOH A O     1 
HETATM 4076 O  O     . HOH K 9 .   ? 21.508 13.597  6.734   1.00 39.78 ? 771 HOH A O     1 
HETATM 4077 O  O     . HOH K 9 .   ? 76.445 1.282   -5.598  1.00 32.18 ? 772 HOH A O     1 
HETATM 4078 O  O     . HOH K 9 .   ? 44.806 -14.272 10.473  1.00 15.33 ? 773 HOH A O     1 
HETATM 4079 O  O     . HOH K 9 .   ? 46.676 16.421  25.636  1.00 23.99 ? 774 HOH A O     1 
HETATM 4080 O  O     . HOH K 9 .   ? 59.209 11.055  8.539   1.00 17.90 ? 775 HOH A O     1 
HETATM 4081 O  O     . HOH K 9 .   ? 51.054 5.476   -8.284  1.00 17.21 ? 776 HOH A O     1 
HETATM 4082 O  O     . HOH K 9 .   ? 83.672 -5.173  2.411   1.00 26.87 ? 777 HOH A O     1 
HETATM 4083 O  O     . HOH K 9 .   ? 59.664 10.508  19.931  1.00 21.01 ? 778 HOH A O     1 
HETATM 4084 O  O     . HOH K 9 .   ? 51.278 6.270   -19.025 1.00 28.08 ? 779 HOH A O     1 
HETATM 4085 O  O     . HOH K 9 .   ? 51.292 -33.605 10.665  1.00 35.14 ? 780 HOH A O     1 
HETATM 4086 O  O     . HOH K 9 .   ? 51.042 0.652   -16.022 1.00 28.27 ? 781 HOH A O     1 
HETATM 4087 O  O     . HOH K 9 .   ? 68.958 -10.864 11.956  1.00 27.31 ? 782 HOH A O     1 
HETATM 4088 O  O     . HOH K 9 .   ? 37.283 13.731  21.756  1.00 28.91 ? 783 HOH A O     1 
HETATM 4089 O  O     . HOH K 9 .   ? 42.869 -1.494  -24.938 1.00 21.61 ? 784 HOH A O     1 
HETATM 4090 O  O     . HOH K 9 .   ? 34.504 14.947  11.406  1.00 22.44 ? 785 HOH A O     1 
HETATM 4091 O  O     . HOH K 9 .   ? 57.443 23.299  14.097  1.00 28.81 ? 786 HOH A O     1 
HETATM 4092 O  O     . HOH K 9 .   ? 19.907 10.107  8.791   1.00 38.07 ? 787 HOH A O     1 
HETATM 4093 O  O     . HOH K 9 .   ? 80.301 -3.884  13.881  1.00 38.45 ? 788 HOH A O     1 
HETATM 4094 O  O     . HOH K 9 .   ? 52.576 -12.548 -3.917  1.00 22.25 ? 789 HOH A O     1 
HETATM 4095 O  O     . HOH K 9 .   ? 43.491 12.065  -7.309  1.00 17.35 ? 790 HOH A O     1 
HETATM 4096 O  O     . HOH K 9 .   ? 48.093 19.719  4.442   1.00 25.96 ? 791 HOH A O     1 
HETATM 4097 O  O     . HOH K 9 .   ? 29.422 3.718   6.548   1.00 33.39 ? 792 HOH A O     1 
HETATM 4098 O  O     . HOH K 9 .   ? 53.542 -20.496 -2.609  1.00 16.44 ? 793 HOH A O     1 
HETATM 4099 O  O     . HOH K 9 .   ? 58.765 4.553   23.070  1.00 24.07 ? 794 HOH A O     1 
HETATM 4100 O  O     . HOH K 9 .   ? 38.466 -17.977 10.298  1.00 22.36 ? 795 HOH A O     1 
HETATM 4101 O  O     . HOH K 9 .   ? 67.353 6.377   1.066   1.00 30.85 ? 796 HOH A O     1 
HETATM 4102 O  O     . HOH K 9 .   ? 48.471 -22.216 -5.688  1.00 19.70 ? 797 HOH A O     1 
HETATM 4103 O  O     . HOH K 9 .   ? 63.156 -18.953 -1.712  1.00 19.28 ? 798 HOH A O     1 
HETATM 4104 O  O     . HOH K 9 .   ? 39.360 18.572  18.197  1.00 27.38 ? 799 HOH A O     1 
HETATM 4105 O  O     . HOH K 9 .   ? 40.823 -29.798 13.117  1.00 33.18 ? 800 HOH A O     1 
HETATM 4106 O  O     . HOH K 9 .   ? 55.379 2.761   20.925  1.00 27.11 ? 801 HOH A O     1 
HETATM 4107 O  O     . HOH K 9 .   ? 65.457 -21.555 14.575  1.00 32.78 ? 802 HOH A O     1 
HETATM 4108 O  O     . HOH K 9 .   ? 69.523 -18.776 -9.539  1.00 32.57 ? 803 HOH A O     1 
HETATM 4109 O  O     . HOH K 9 .   ? 40.217 -28.426 -9.901  1.00 32.32 ? 804 HOH A O     1 
HETATM 4110 O  O     . HOH K 9 .   ? 41.139 21.565  2.274   1.00 24.08 ? 805 HOH A O     1 
HETATM 4111 O  O     . HOH K 9 .   ? 65.691 8.522   8.984   1.00 29.12 ? 806 HOH A O     1 
HETATM 4112 O  O     . HOH K 9 .   ? 46.248 0.205   7.048   1.00 25.50 ? 807 HOH A O     1 
HETATM 4113 O  O     . HOH K 9 .   ? 63.289 -11.677 12.788  1.00 43.27 ? 808 HOH A O     1 
HETATM 4114 O  O     . HOH K 9 .   ? 62.318 11.845  5.505   1.00 30.14 ? 809 HOH A O     1 
HETATM 4115 O  O     . HOH K 9 .   ? 46.622 -0.317  -15.179 1.00 18.92 ? 810 HOH A O     1 
HETATM 4116 O  O     . HOH K 9 .   ? 68.306 -16.919 -11.855 1.00 37.49 ? 811 HOH A O     1 
HETATM 4117 O  O     . HOH K 9 .   ? 46.525 19.281  1.483   1.00 23.26 ? 812 HOH A O     1 
HETATM 4118 O  O     . HOH K 9 .   ? 69.025 -13.538 5.022   1.00 11.06 ? 813 HOH A O     1 
HETATM 4119 O  O     . HOH K 9 .   ? 61.954 -2.233  12.293  1.00 30.84 ? 814 HOH A O     1 
HETATM 4120 O  O     . HOH K 9 .   ? 58.632 -30.604 -0.916  1.00 38.31 ? 815 HOH A O     1 
HETATM 4121 O  O     . HOH K 9 .   ? 57.330 -34.852 8.455   1.00 31.17 ? 816 HOH A O     1 
HETATM 4122 O  O     . HOH K 9 .   ? 65.203 12.946  2.990   1.00 28.60 ? 817 HOH A O     1 
HETATM 4123 O  O     . HOH K 9 .   ? 50.314 -34.657 -0.713  1.00 19.41 ? 818 HOH A O     1 
HETATM 4124 O  O     . HOH K 9 .   ? 52.935 -33.390 -0.208  1.00 20.56 ? 819 HOH A O     1 
HETATM 4125 O  O     . HOH K 9 .   ? 46.225 -9.533  10.944  1.00 30.96 ? 820 HOH A O     1 
HETATM 4126 O  O     . HOH K 9 .   ? 11.767 0.575   -4.373  1.00 47.64 ? 821 HOH A O     1 
HETATM 4127 O  O     . HOH K 9 .   ? 45.068 -32.612 8.657   1.00 39.57 ? 822 HOH A O     1 
HETATM 4128 O  O     . HOH K 9 .   ? 49.037 -29.595 15.643  1.00 37.47 ? 823 HOH A O     1 
HETATM 4129 O  O     . HOH K 9 .   ? 41.405 20.156  4.831   1.00 24.04 ? 824 HOH A O     1 
HETATM 4130 O  O     . HOH K 9 .   ? 63.901 -9.377  -14.447 1.00 18.33 ? 825 HOH A O     1 
HETATM 4131 O  O     . HOH K 9 .   ? 60.243 -18.463 -4.611  1.00 12.54 ? 826 HOH A O     1 
HETATM 4132 O  O     . HOH K 9 .   ? 43.931 -15.114 1.390   1.00 18.64 ? 827 HOH A O     1 
HETATM 4133 O  O     . HOH K 9 .   ? 57.906 -27.532 11.393  1.00 17.18 ? 828 HOH A O     1 
HETATM 4134 O  O     . HOH K 9 .   ? 72.969 -7.366  9.002   1.00 13.51 ? 829 HOH A O     1 
HETATM 4135 O  O     . HOH K 9 .   ? 37.769 10.785  21.479  1.00 36.70 ? 830 HOH A O     1 
HETATM 4136 O  O     . HOH K 9 .   ? 50.024 -14.794 -3.380  1.00 41.23 ? 831 HOH A O     1 
HETATM 4137 O  O     . HOH K 9 .   ? 24.131 16.388  3.218   1.00 25.43 ? 832 HOH A O     1 
HETATM 4138 O  O     . HOH K 9 .   ? 44.140 9.992   -24.597 1.00 28.30 ? 833 HOH A O     1 
HETATM 4139 O  O     . HOH K 9 .   ? 45.086 16.998  -18.097 1.00 26.09 ? 834 HOH A O     1 
HETATM 4140 O  O     . HOH K 9 .   ? 40.818 -1.727  -16.415 1.00 27.79 ? 835 HOH A O     1 
HETATM 4141 O  O     . HOH K 9 .   ? 62.038 -6.750  -14.781 1.00 38.96 ? 836 HOH A O     1 
HETATM 4142 O  O     . HOH K 9 .   ? 60.033 -18.045 -7.761  1.00 24.13 ? 837 HOH A O     1 
HETATM 4143 O  O     . HOH K 9 .   ? 42.233 -9.040  9.584   1.00 33.44 ? 838 HOH A O     1 
HETATM 4144 O  O     . HOH K 9 .   ? 33.096 2.482   -0.352  1.00 28.51 ? 839 HOH A O     1 
HETATM 4145 O  O     . HOH K 9 .   ? 69.130 4.385   3.948   1.00 23.04 ? 840 HOH A O     1 
HETATM 4146 O  O     . HOH K 9 .   ? 47.155 2.326   -1.102  1.00 20.56 ? 841 HOH A O     1 
HETATM 4147 O  O     . HOH K 9 .   ? 63.096 -4.764  -15.707 1.00 37.95 ? 842 HOH A O     1 
HETATM 4148 O  O     . HOH K 9 .   ? 74.835 -22.366 -6.408  1.00 36.88 ? 843 HOH A O     1 
HETATM 4149 O  O     . HOH K 9 .   ? 46.052 16.622  1.220   1.00 12.63 ? 844 HOH A O     1 
HETATM 4150 O  O     . HOH K 9 .   ? 65.094 19.874  6.670   1.00 29.26 ? 845 HOH A O     1 
HETATM 4151 O  O     . HOH K 9 .   ? 69.594 -9.047  10.750  1.00 30.74 ? 846 HOH A O     1 
HETATM 4152 O  O     . HOH K 9 .   ? 54.480 -11.375 3.424   1.00 12.95 ? 847 HOH A O     1 
HETATM 4153 O  O     . HOH K 9 .   ? 65.605 -4.202  -15.254 1.00 29.08 ? 848 HOH A O     1 
HETATM 4154 O  O     . HOH K 9 .   ? 41.995 -22.454 -2.639  1.00 19.21 ? 849 HOH A O     1 
HETATM 4155 O  O     . HOH K 9 .   ? 46.505 -18.696 -2.529  1.00 33.30 ? 850 HOH A O     1 
HETATM 4156 O  O     . HOH K 9 .   ? 57.532 -0.090  -14.674 1.00 25.60 ? 851 HOH A O     1 
HETATM 4157 O  O     . HOH K 9 .   ? 61.979 -13.158 -13.519 1.00 30.06 ? 852 HOH A O     1 
HETATM 4158 O  O     . HOH K 9 .   ? 50.608 -6.494  -5.384  1.00 29.65 ? 853 HOH A O     1 
HETATM 4159 O  O     . HOH K 9 .   ? 36.508 12.883  12.073  1.00 22.82 ? 854 HOH A O     1 
HETATM 4160 O  O     . HOH K 9 .   ? 45.006 0.512   -18.436 1.00 22.86 ? 855 HOH A O     1 
HETATM 4161 O  O     . HOH K 9 .   ? 61.448 14.570  8.840   1.00 26.11 ? 856 HOH A O     1 
HETATM 4162 O  O     . HOH K 9 .   ? 55.246 1.491   -17.341 1.00 48.46 ? 857 HOH A O     1 
HETATM 4163 O  O     . HOH K 9 .   ? 38.670 4.481   15.950  1.00 46.62 ? 858 HOH A O     1 
HETATM 4164 O  O     . HOH K 9 .   ? 48.984 -15.603 13.604  1.00 17.22 ? 859 HOH A O     1 
HETATM 4165 O  O     . HOH K 9 .   ? 42.279 15.382  -8.839  1.00 32.42 ? 860 HOH A O     1 
HETATM 4166 O  O     . HOH K 9 .   ? 41.073 -2.996  -23.036 1.00 23.87 ? 861 HOH A O     1 
HETATM 4167 O  O     . HOH K 9 .   ? 71.475 1.359   18.796  1.00 37.39 ? 862 HOH A O     1 
HETATM 4168 O  O     . HOH K 9 .   ? 47.284 -16.648 -0.817  1.00 26.36 ? 863 HOH A O     1 
HETATM 4169 O  O     . HOH K 9 .   ? 49.361 -14.774 18.546  1.00 29.07 ? 864 HOH A O     1 
HETATM 4170 O  O     . HOH K 9 .   ? 53.507 -8.498  8.700   1.00 27.31 ? 865 HOH A O     1 
HETATM 4171 O  O     . HOH K 9 .   ? 47.269 13.781  -11.230 1.00 34.17 ? 866 HOH A O     1 
HETATM 4172 O  O     . HOH K 9 .   ? 40.692 -29.352 -2.238  1.00 26.46 ? 867 HOH A O     1 
HETATM 4173 O  O     . HOH K 9 .   ? 59.340 9.615   10.858  1.00 12.00 ? 868 HOH A O     1 
HETATM 4174 O  O     . HOH K 9 .   ? 59.491 -31.486 4.012   1.00 28.99 ? 869 HOH A O     1 
HETATM 4175 O  O     . HOH K 9 .   ? 40.533 7.645   24.349  1.00 34.57 ? 870 HOH A O     1 
HETATM 4176 O  O     . HOH K 9 .   ? 44.534 -16.798 -0.422  1.00 27.10 ? 871 HOH A O     1 
HETATM 4177 O  O     . HOH K 9 .   ? 43.361 9.643   -9.904  1.00 18.70 ? 872 HOH A O     1 
HETATM 4178 O  O     . HOH K 9 .   ? 35.196 20.743  0.643   1.00 26.94 ? 873 HOH A O     1 
HETATM 4179 O  O     . HOH K 9 .   ? 12.200 3.171   -5.381  1.00 53.15 ? 874 HOH A O     1 
HETATM 4180 O  O     . HOH K 9 .   ? 53.730 17.232  -3.138  1.00 16.67 ? 875 HOH A O     1 
HETATM 4181 O  O     . HOH K 9 .   ? 43.120 -30.769 -10.528 1.00 36.82 ? 876 HOH A O     1 
HETATM 4182 O  O     . HOH K 9 .   ? 41.147 -23.858 -4.923  1.00 21.24 ? 877 HOH A O     1 
HETATM 4183 O  O     . HOH K 9 .   ? 65.483 -22.387 -7.818  1.00 32.34 ? 878 HOH A O     1 
HETATM 4184 O  O     . HOH K 9 .   ? 61.721 1.743   13.959  1.00 32.90 ? 879 HOH A O     1 
HETATM 4185 O  O     . HOH K 9 .   ? 49.036 7.235   -7.645  1.00 20.68 ? 880 HOH A O     1 
HETATM 4186 O  O     . HOH K 9 .   ? 38.254 -22.681 10.886  1.00 30.21 ? 881 HOH A O     1 
HETATM 4187 O  O     . HOH K 9 .   ? 51.055 21.583  7.310   1.00 28.83 ? 882 HOH A O     1 
HETATM 4188 O  O     . HOH K 9 .   ? 35.328 22.418  -3.357  1.00 34.85 ? 883 HOH A O     1 
HETATM 4189 O  O     . HOH K 9 .   ? 31.392 -5.721  1.630   1.00 46.55 ? 884 HOH A O     1 
HETATM 4190 O  O     . HOH K 9 .   ? 59.954 14.351  3.318   1.00 27.69 ? 885 HOH A O     1 
HETATM 4191 O  O     . HOH K 9 .   ? 34.544 19.821  -16.172 1.00 28.21 ? 886 HOH A O     1 
HETATM 4192 O  O     . HOH K 9 .   ? 67.588 -25.878 -6.446  1.00 47.00 ? 887 HOH A O     1 
HETATM 4193 O  O     . HOH K 9 .   ? 73.061 -19.655 -2.769  1.00 23.03 ? 888 HOH A O     1 
HETATM 4194 O  O     . HOH K 9 .   ? 61.763 -18.836 21.958  1.00 36.05 ? 889 HOH A O     1 
HETATM 4195 O  O     . HOH K 9 .   ? 68.728 -15.121 -14.889 1.00 50.63 ? 890 HOH A O     1 
HETATM 4196 O  O     . HOH K 9 .   ? 55.392 -32.890 4.854   1.00 30.95 ? 891 HOH A O     1 
HETATM 4197 O  O     . HOH K 9 .   ? 38.172 10.416  9.627   1.00 25.13 ? 892 HOH A O     1 
HETATM 4198 O  O     . HOH K 9 .   ? 70.949 6.415   7.631   1.00 34.86 ? 893 HOH A O     1 
HETATM 4199 O  O     . HOH K 9 .   ? 64.869 19.465  1.893   1.00 22.84 ? 894 HOH A O     1 
HETATM 4200 O  O     . HOH K 9 .   ? 67.910 -14.486 -10.101 1.00 23.52 ? 895 HOH A O     1 
HETATM 4201 O  O     . HOH K 9 .   ? 28.934 8.074   -18.789 1.00 22.70 ? 896 HOH A O     1 
HETATM 4202 O  O     . HOH K 9 .   ? 46.649 -14.604 14.845  1.00 28.66 ? 897 HOH A O     1 
HETATM 4203 O  O     . HOH K 9 .   ? 43.670 -28.805 15.768  1.00 37.05 ? 898 HOH A O     1 
HETATM 4204 O  O     . HOH K 9 .   ? 18.929 14.287  6.529   1.00 39.70 ? 899 HOH A O     1 
HETATM 4205 O  O     . HOH K 9 .   ? 35.737 21.988  12.463  1.00 39.26 ? 900 HOH A O     1 
HETATM 4206 O  O     . HOH K 9 .   ? 61.643 15.764  2.239   1.00 27.47 ? 901 HOH A O     1 
HETATM 4207 O  O     . HOH K 9 .   ? 49.262 8.396   -13.669 1.00 23.46 ? 902 HOH A O     1 
HETATM 4208 O  O     . HOH K 9 .   ? 25.526 14.454  5.132   1.00 32.73 ? 903 HOH A O     1 
HETATM 4209 O  O     . HOH K 9 .   ? 38.733 -3.590  -20.141 1.00 25.17 ? 904 HOH A O     1 
HETATM 4210 O  O     . HOH K 9 .   ? 47.338 21.670  9.717   1.00 30.51 ? 905 HOH A O     1 
HETATM 4211 O  O     . HOH K 9 .   ? 48.899 -23.879 19.236  1.00 36.17 ? 906 HOH A O     1 
HETATM 4212 O  O     . HOH K 9 .   ? 50.832 15.851  -12.483 1.00 41.68 ? 907 HOH A O     1 
HETATM 4213 O  O     . HOH K 9 .   ? 51.066 4.616   24.772  1.00 25.61 ? 908 HOH A O     1 
HETATM 4214 O  O     . HOH K 9 .   ? 38.365 13.567  24.656  1.00 35.53 ? 909 HOH A O     1 
HETATM 4215 O  O     . HOH K 9 .   ? 61.820 24.042  9.883   1.00 29.18 ? 910 HOH A O     1 
HETATM 4216 O  O     . HOH K 9 .   ? 67.569 -5.184  -17.304 1.00 37.30 ? 911 HOH A O     1 
HETATM 4217 O  O     . HOH K 9 .   ? 38.750 21.314  5.648   1.00 32.82 ? 912 HOH A O     1 
HETATM 4218 O  O     . HOH K 9 .   ? 50.442 10.944  -13.724 1.00 38.76 ? 913 HOH A O     1 
HETATM 4219 O  O     . HOH K 9 .   ? 53.009 -20.184 -5.058  1.00 23.14 ? 914 HOH A O     1 
HETATM 4220 O  O     . HOH K 9 .   ? 37.114 -7.489  -18.466 1.00 45.00 ? 915 HOH A O     1 
HETATM 4221 O  O     . HOH K 9 .   ? 36.779 21.825  4.314   1.00 38.32 ? 916 HOH A O     1 
HETATM 4222 O  O     . HOH K 9 .   ? 51.098 3.368   10.518  1.00 20.92 ? 917 HOH A O     1 
HETATM 4223 O  O     . HOH K 9 .   ? 60.956 10.000  7.126   1.00 24.76 ? 918 HOH A O     1 
HETATM 4224 O  O     . HOH K 9 .   ? 68.247 -21.630 -8.156  1.00 36.55 ? 919 HOH A O     1 
HETATM 4225 O  O     . HOH K 9 .   ? 57.195 -18.897 22.200  1.00 27.41 ? 920 HOH A O     1 
HETATM 4226 O  O     . HOH K 9 .   ? 46.944 15.837  -23.611 1.00 27.34 ? 921 HOH A O     1 
HETATM 4227 O  O     . HOH K 9 .   ? 61.728 7.931   16.207  1.00 34.69 ? 922 HOH A O     1 
HETATM 4228 O  O     . HOH K 9 .   ? 70.206 -21.618 0.809   1.00 26.79 ? 923 HOH A O     1 
HETATM 4229 O  O     . HOH K 9 .   ? 51.488 -8.754  4.866   1.00 26.72 ? 924 HOH A O     1 
HETATM 4230 O  O     . HOH K 9 .   ? 47.895 10.656  -9.490  1.00 21.81 ? 925 HOH A O     1 
HETATM 4231 O  O     . HOH K 9 .   ? 42.790 17.228  -17.194 1.00 29.27 ? 926 HOH A O     1 
HETATM 4232 O  O     . HOH K 9 .   ? 48.935 12.114  -11.541 1.00 28.43 ? 927 HOH A O     1 
HETATM 4233 O  O     . HOH K 9 .   ? 55.285 -7.392  6.600   1.00 26.26 ? 928 HOH A O     1 
HETATM 4234 O  O     . HOH K 9 .   ? 50.846 -22.793 -5.748  1.00 30.43 ? 929 HOH A O     1 
HETATM 4235 O  O     . HOH K 9 .   ? 67.995 -27.734 -7.707  1.00 45.93 ? 930 HOH A O     1 
HETATM 4236 O  O     . HOH K 9 .   ? 64.130 -15.437 13.784  1.00 33.81 ? 931 HOH A O     1 
HETATM 4237 O  O     . HOH K 9 .   ? 33.699 22.360  -0.560  1.00 40.00 ? 932 HOH A O     1 
HETATM 4238 O  O     . HOH K 9 .   ? 59.742 -29.193 -8.565  1.00 40.32 ? 933 HOH A O     1 
HETATM 4239 O  O     . HOH K 9 .   ? 55.085 -17.418 -13.198 1.00 29.37 ? 934 HOH A O     1 
HETATM 4240 O  O     . HOH K 9 .   ? 61.936 -25.328 4.960   1.00 29.64 ? 935 HOH A O     1 
HETATM 4241 O  O     . HOH K 9 .   ? 40.025 -18.296 -1.444  1.00 31.32 ? 936 HOH A O     1 
HETATM 4242 O  O     . HOH K 9 .   ? 67.636 1.808   12.093  1.00 31.96 ? 937 HOH A O     1 
HETATM 4243 O  O     . HOH K 9 .   ? 43.988 0.431   -21.028 1.00 30.48 ? 938 HOH A O     1 
HETATM 4244 O  O     . HOH K 9 .   ? 71.058 8.987   -6.732  1.00 34.17 ? 939 HOH A O     1 
HETATM 4245 O  O     . HOH K 9 .   ? 52.886 0.210   12.227  1.00 25.18 ? 940 HOH A O     1 
HETATM 4246 O  O     . HOH K 9 .   ? 73.183 4.491   -1.204  1.00 32.22 ? 941 HOH A O     1 
HETATM 4247 O  O     . HOH K 9 .   ? 44.035 -1.269  -16.403 1.00 39.38 ? 942 HOH A O     1 
HETATM 4248 O  O     . HOH K 9 .   ? 43.084 19.964  -11.923 1.00 32.41 ? 943 HOH A O     1 
HETATM 4249 O  O     . HOH K 9 .   ? 39.513 4.763   18.270  1.00 37.48 ? 944 HOH A O     1 
HETATM 4250 O  O     . HOH K 9 .   ? 69.424 5.279   1.238   1.00 31.01 ? 945 HOH A O     1 
HETATM 4251 O  O     . HOH K 9 .   ? 49.189 -0.260  -16.491 1.00 29.65 ? 946 HOH A O     1 
HETATM 4252 O  O     . HOH K 9 .   ? 42.411 5.455   20.834  1.00 42.16 ? 947 HOH A O     1 
HETATM 4253 O  O     . HOH K 9 .   ? 46.233 1.943   20.494  1.00 40.77 ? 948 HOH A O     1 
HETATM 4254 O  O     . HOH K 9 .   ? 61.785 12.068  9.493   1.00 31.29 ? 949 HOH A O     1 
HETATM 4255 O  O     . HOH K 9 .   ? 54.381 -34.852 1.230   1.00 31.33 ? 950 HOH A O     1 
HETATM 4256 O  O     . HOH K 9 .   ? 77.562 -17.262 8.407   1.00 42.89 ? 951 HOH A O     1 
HETATM 4257 O  O     . HOH K 9 .   ? 34.687 14.113  21.851  1.00 34.54 ? 952 HOH A O     1 
HETATM 4258 O  O     . HOH K 9 .   ? 44.756 -14.891 13.192  1.00 34.62 ? 953 HOH A O     1 
HETATM 4259 O  O     . HOH K 9 .   ? 47.876 -19.074 -5.472  1.00 35.35 ? 954 HOH A O     1 
HETATM 4260 O  O     . HOH K 9 .   ? 55.700 13.559  -11.574 1.00 26.91 ? 955 HOH A O     1 
HETATM 4261 O  O     . HOH K 9 .   ? 47.762 0.870   -18.833 1.00 31.25 ? 956 HOH A O     1 
HETATM 4262 O  O     . HOH K 9 .   ? 51.482 -29.253 16.512  1.00 26.62 ? 957 HOH A O     1 
HETATM 4263 O  O     . HOH K 9 .   ? 59.294 -28.192 -2.206  1.00 37.21 ? 958 HOH A O     1 
HETATM 4264 O  O     . HOH K 9 .   ? 47.267 -20.137 18.510  1.00 29.05 ? 959 HOH A O     1 
HETATM 4265 O  O     . HOH K 9 .   ? 61.537 11.512  -12.263 1.00 27.63 ? 960 HOH A O     1 
HETATM 4266 O  O     . HOH K 9 .   ? 51.265 13.384  -11.490 1.00 28.29 ? 961 HOH A O     1 
HETATM 4267 O  O     . HOH K 9 .   ? 57.847 -14.356 -12.964 1.00 21.94 ? 962 HOH A O     1 
HETATM 4268 O  O     . HOH K 9 .   ? 49.954 0.790   20.254  1.00 34.49 ? 963 HOH A O     1 
HETATM 4269 O  O     . HOH K 9 .   ? 44.119 15.674  26.115  1.00 24.11 ? 964 HOH A O     1 
HETATM 4270 O  O     . HOH K 9 .   ? 52.366 2.485   -17.447 1.00 43.61 ? 965 HOH A O     1 
HETATM 4271 O  O     . HOH K 9 .   ? 58.298 15.206  -10.674 1.00 23.45 ? 966 HOH A O     1 
HETATM 4272 O  O     . HOH K 9 .   ? 61.555 8.926   18.831  1.00 30.98 ? 967 HOH A O     1 
HETATM 4273 O  O     . HOH K 9 .   ? 60.389 13.146  -14.276 1.00 33.76 ? 968 HOH A O     1 
HETATM 4274 O  O     . HOH K 9 .   ? 47.579 7.806   -9.693  1.00 19.37 ? 969 HOH A O     1 
HETATM 4275 O  O     . HOH K 9 .   ? 43.339 16.094  -10.763 1.00 42.97 ? 970 HOH A O     1 
HETATM 4276 O  O     . HOH K 9 .   ? 36.021 10.878  10.453  1.00 26.53 ? 971 HOH A O     1 
HETATM 4277 O  O     . HOH K 9 .   ? 43.573 -16.563 14.965  1.00 31.61 ? 972 HOH A O     1 
HETATM 4278 O  O     . HOH K 9 .   ? 53.698 16.176  -9.338  1.00 25.29 ? 973 HOH A O     1 
HETATM 4279 O  O     . HOH K 9 .   ? 38.790 18.628  -15.217 1.00 35.48 ? 974 HOH A O     1 
HETATM 4280 O  O     . HOH K 9 .   ? 37.308 -28.615 9.134   1.00 44.24 ? 975 HOH A O     1 
HETATM 4281 O  O     . HOH K 9 .   ? 44.355 13.244  -10.509 1.00 36.92 ? 976 HOH A O     1 
HETATM 4282 O  O     . HOH K 9 .   ? 56.456 21.500  18.178  1.00 24.29 ? 977 HOH A O     1 
HETATM 4283 O  O     . HOH K 9 .   ? 57.966 17.743  19.806  1.00 31.46 ? 978 HOH A O     1 
HETATM 4284 O  O     . HOH K 9 .   ? 48.825 6.666   -11.768 1.00 20.27 ? 979 HOH A O     1 
HETATM 4285 O  O     . HOH K 9 .   ? 59.887 9.669   22.418  1.00 35.89 ? 980 HOH A O     1 
HETATM 4286 O  O     . HOH K 9 .   ? 38.039 -15.669 12.028  1.00 34.65 ? 981 HOH A O     1 
HETATM 4287 O  O     . HOH K 9 .   ? 48.105 -17.883 17.278  1.00 28.44 ? 982 HOH A O     1 
HETATM 4288 O  O     . HOH K 9 .   ? 61.363 8.031   9.885   1.00 22.82 ? 983 HOH A O     1 
HETATM 4289 O  O     . HOH L 9 .   ? 34.855 5.891   18.049  1.00 39.78 ? 101 HOH T O     1 
HETATM 4290 O  O     . HOH L 9 .   ? 33.735 8.989   11.580  1.00 38.81 ? 102 HOH T O     1 
HETATM 4291 O  O     . HOH L 9 .   ? 41.448 -19.904 -3.304  1.00 27.81 ? 103 HOH T O     1 
HETATM 4292 O  O     . HOH L 9 .   ? 37.727 -18.448 -8.816  1.00 36.60 ? 104 HOH T O     1 
HETATM 4293 O  O     . HOH L 9 .   ? 37.252 0.017   -3.061  1.00 36.84 ? 105 HOH T O     1 
HETATM 4294 O  O     . HOH L 9 .   ? 43.176 5.395   -8.934  1.00 19.51 ? 106 HOH T O     1 
HETATM 4295 O  O     . HOH L 9 .   ? 36.117 2.511   4.531   1.00 27.06 ? 107 HOH T O     1 
HETATM 4296 O  O     . HOH L 9 .   ? 36.533 -2.066  -1.091  1.00 30.69 ? 108 HOH T O     1 
HETATM 4297 O  O     . HOH L 9 .   ? 38.729 -10.239 -9.988  1.00 33.49 ? 109 HOH T O     1 
HETATM 4298 O  O     . HOH L 9 .   ? 41.950 -7.406  -10.567 1.00 32.50 ? 110 HOH T O     1 
HETATM 4299 O  O     . HOH L 9 .   ? 32.106 14.027  10.666  1.00 35.48 ? 111 HOH T O     1 
HETATM 4300 O  O     . HOH L 9 .   ? 40.712 -3.571  -9.306  1.00 28.81 ? 112 HOH T O     1 
HETATM 4301 O  O     . HOH L 9 .   ? 44.220 -8.579  -3.644  1.00 29.12 ? 113 HOH T O     1 
HETATM 4302 O  O     . HOH L 9 .   ? 30.618 5.104   8.597   1.00 42.16 ? 114 HOH T O     1 
HETATM 4303 O  O     . HOH L 9 .   ? 41.938 8.118   3.265   1.00 16.96 ? 115 HOH T O     1 
HETATM 4304 O  O     . HOH L 9 .   ? 45.392 -4.986  -3.108  1.00 32.99 ? 116 HOH T O     1 
HETATM 4305 O  O     . HOH L 9 .   ? 40.015 -0.643  7.754   1.00 41.13 ? 117 HOH T O     1 
HETATM 4306 O  O     . HOH L 9 .   ? 45.552 5.257   -4.911  1.00 25.28 ? 118 HOH T O     1 
HETATM 4307 O  O     . HOH L 9 .   ? 36.834 -23.147 -5.229  1.00 25.93 ? 119 HOH T O     1 
HETATM 4308 O  O     . HOH L 9 .   ? 38.396 -2.325  -6.451  1.00 31.51 ? 120 HOH T O     1 
HETATM 4309 O  O     . HOH L 9 .   ? 43.672 5.512   0.502   1.00 22.20 ? 121 HOH T O     1 
HETATM 4310 O  O     . HOH L 9 .   ? 36.669 -3.020  -4.286  1.00 32.62 ? 122 HOH T O     1 
HETATM 4311 O  O     . HOH L 9 .   ? 37.480 -12.877 -11.238 1.00 33.42 ? 123 HOH T O     1 
HETATM 4312 O  O     . HOH L 9 .   ? 37.390 -0.183  4.651   1.00 32.73 ? 124 HOH T O     1 
HETATM 4313 O  O     . HOH L 9 .   ? 42.570 -11.447 -11.703 1.00 44.12 ? 125 HOH T O     1 
HETATM 4314 O  O     . HOH L 9 .   ? 37.976 -21.626 -3.430  1.00 31.18 ? 126 HOH T O     1 
HETATM 4315 O  O     . HOH L 9 .   ? 38.719 -1.001  10.408  1.00 46.01 ? 127 HOH T O     1 
HETATM 4316 O  O     . HOH L 9 .   ? 34.362 -15.816 -14.221 1.00 40.18 ? 128 HOH T O     1 
HETATM 4317 O  O     . HOH L 9 .   ? 37.762 -4.386  -8.563  1.00 47.71 ? 129 HOH T O     1 
HETATM 4318 O  O     . HOH L 9 .   ? 33.205 10.667  8.505   1.00 39.63 ? 130 HOH T O     1 
HETATM 4319 O  O     . HOH L 9 .   ? 46.710 -8.773  -4.542  1.00 30.02 ? 131 HOH T O     1 
HETATM 4320 O  O     . HOH L 9 .   ? 40.818 -9.915  -11.294 1.00 39.87 ? 132 HOH T O     1 
HETATM 4321 O  O     . HOH L 9 .   ? 44.890 7.391   -10.279 1.00 15.49 ? 133 HOH T O     1 
HETATM 4322 O  O     . HOH M 9 .   ? 27.923 -5.111  -10.254 1.00 37.48 ? 101 HOH P O     1 
HETATM 4323 O  O     . HOH M 9 .   ? 47.870 -2.072  6.889   1.00 28.75 ? 102 HOH P O     1 
HETATM 4324 O  O     . HOH M 9 .   ? 48.934 2.280   1.114   0.67 13.76 ? 103 HOH P O     1 
HETATM 4325 O  O     . HOH M 9 .   ? 38.168 -10.768 6.409   1.00 30.33 ? 104 HOH P O     1 
HETATM 4326 O  O     . HOH M 9 .   ? 32.219 -7.409  -11.357 1.00 43.92 ? 105 HOH P O     1 
HETATM 4327 O  O     . HOH M 9 .   ? 41.558 -11.706 -0.879  1.00 21.31 ? 106 HOH P O     1 
HETATM 4328 O  O     . HOH M 9 .   ? 45.984 3.782   1.097   1.00 21.51 ? 107 HOH P O     1 
HETATM 4329 O  O     . HOH M 9 .   ? 49.254 -10.143 6.646   1.00 20.54 ? 108 HOH P O     1 
HETATM 4330 O  O     . HOH M 9 .   ? 42.696 -8.965  7.140   1.00 21.31 ? 109 HOH P O     1 
HETATM 4331 O  O     . HOH M 9 .   ? 44.610 -8.396  -1.030  1.00 23.59 ? 110 HOH P O     1 
HETATM 4332 O  O     . HOH M 9 .   ? 46.069 -2.543  -0.569  1.00 24.49 ? 111 HOH P O     1 
HETATM 4333 O  O     . HOH M 9 .   ? 30.482 -6.325  -13.160 1.00 39.23 ? 112 HOH P O     1 
HETATM 4334 O  O     . HOH M 9 .   ? 35.099 -9.241  -10.943 1.00 47.21 ? 113 HOH P O     1 
HETATM 4335 O  O     . HOH M 9 .   ? 40.185 -5.294  5.524   1.00 31.36 ? 114 HOH P O     1 
HETATM 4336 O  O     . HOH M 9 .   ? 31.111 -13.913 -2.989  1.00 38.27 ? 115 HOH P O     1 
HETATM 4337 O  O     . HOH M 9 .   ? 41.358 -15.699 1.897   1.00 20.35 ? 116 HOH P O     1 
HETATM 4338 O  O     . HOH M 9 .   ? 50.517 -7.270  6.648   1.00 37.43 ? 117 HOH P O     1 
HETATM 4339 O  O     . HOH M 9 .   ? 38.239 -1.964  6.082   1.00 39.69 ? 118 HOH P O     1 
HETATM 4340 O  O     . HOH M 9 .   ? 40.312 -9.020  5.858   1.00 26.92 ? 119 HOH P O     1 
HETATM 4341 O  O     . HOH M 9 .   ? 30.815 -5.041  -9.666  1.00 41.21 ? 120 HOH P O     1 
HETATM 4342 O  O     . HOH M 9 .   ? 45.743 -10.798 -0.038  1.00 22.80 ? 121 HOH P O     1 
HETATM 4343 O  O     . HOH M 9 .   ? 43.955 -12.844 -0.258  1.00 22.55 ? 122 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1   501 501 MN  MN  A . 
E 5 CA  1   502 502 CA  CA  A . 
F 4 MN  1   503 503 MN  MN  A . 
G 6 GOL 1   504 505 GOL GOL A . 
H 6 GOL 1   505 506 GOL GOL A . 
I 7 DTP 1   506 504 DTP DTP A . 
J 8 EDO 1   507 1   EDO EDO A . 
K 9 HOH 1   601 7   HOH HOH A . 
K 9 HOH 2   602 658 HOH HOH A . 
K 9 HOH 3   603 847 HOH HOH A . 
K 9 HOH 4   604 758 HOH HOH A . 
K 9 HOH 5   605 771 HOH HOH A . 
K 9 HOH 6   606 5   HOH HOH A . 
K 9 HOH 7   607 796 HOH HOH A . 
K 9 HOH 8   608 642 HOH HOH A . 
K 9 HOH 9   609 939 HOH HOH A . 
K 9 HOH 10  610 764 HOH HOH A . 
K 9 HOH 11  611 791 HOH HOH A . 
K 9 HOH 12  612 746 HOH HOH A . 
K 9 HOH 13  613 831 HOH HOH A . 
K 9 HOH 14  614 942 HOH HOH A . 
K 9 HOH 15  615 915 HOH HOH A . 
K 9 HOH 16  616 852 HOH HOH A . 
K 9 HOH 17  617 656 HOH HOH A . 
K 9 HOH 18  618 626 HOH HOH A . 
K 9 HOH 19  619 732 HOH HOH A . 
K 9 HOH 20  620 686 HOH HOH A . 
K 9 HOH 21  621 825 HOH HOH A . 
K 9 HOH 22  622 735 HOH HOH A . 
K 9 HOH 23  623 645 HOH HOH A . 
K 9 HOH 24  624 960 HOH HOH A . 
K 9 HOH 25  625 781 HOH HOH A . 
K 9 HOH 26  626 602 HOH HOH A . 
K 9 HOH 27  627 4   HOH HOH A . 
K 9 HOH 28  628 811 HOH HOH A . 
K 9 HOH 29  629 808 HOH HOH A . 
K 9 HOH 30  630 727 HOH HOH A . 
K 9 HOH 31  631 828 HOH HOH A . 
K 9 HOH 32  632 923 HOH HOH A . 
K 9 HOH 33  633 606 HOH HOH A . 
K 9 HOH 34  634 761 HOH HOH A . 
K 9 HOH 35  635 877 HOH HOH A . 
K 9 HOH 36  636 803 HOH HOH A . 
K 9 HOH 37  637 706 HOH HOH A . 
K 9 HOH 38  638 639 HOH HOH A . 
K 9 HOH 39  639 646 HOH HOH A . 
K 9 HOH 40  640 775 HOH HOH A . 
K 9 HOH 41  641 854 HOH HOH A . 
K 9 HOH 42  642 726 HOH HOH A . 
K 9 HOH 43  643 722 HOH HOH A . 
K 9 HOH 44  644 671 HOH HOH A . 
K 9 HOH 45  645 717 HOH HOH A . 
K 9 HOH 46  646 624 HOH HOH A . 
K 9 HOH 47  647 2   HOH HOH A . 
K 9 HOH 48  648 609 HOH HOH A . 
K 9 HOH 49  649 760 HOH HOH A . 
K 9 HOH 50  650 617 HOH HOH A . 
K 9 HOH 51  651 895 HOH HOH A . 
K 9 HOH 52  652 827 HOH HOH A . 
K 9 HOH 53  653 643 HOH HOH A . 
K 9 HOH 54  654 842 HOH HOH A . 
K 9 HOH 55  655 865 HOH HOH A . 
K 9 HOH 56  656 691 HOH HOH A . 
K 9 HOH 57  657 633 HOH HOH A . 
K 9 HOH 58  658 953 HOH HOH A . 
K 9 HOH 59  659 663 HOH HOH A . 
K 9 HOH 60  660 623 HOH HOH A . 
K 9 HOH 61  661 814 HOH HOH A . 
K 9 HOH 62  662 802 HOH HOH A . 
K 9 HOH 63  663 754 HOH HOH A . 
K 9 HOH 64  664 738 HOH HOH A . 
K 9 HOH 65  665 798 HOH HOH A . 
K 9 HOH 66  666 938 HOH HOH A . 
K 9 HOH 67  667 774 HOH HOH A . 
K 9 HOH 68  668 605 HOH HOH A . 
K 9 HOH 69  669 640 HOH HOH A . 
K 9 HOH 70  670 662 HOH HOH A . 
K 9 HOH 71  671 762 HOH HOH A . 
K 9 HOH 72  672 715 HOH HOH A . 
K 9 HOH 73  673 787 HOH HOH A . 
K 9 HOH 74  674 835 HOH HOH A . 
K 9 HOH 75  675 898 HOH HOH A . 
K 9 HOH 76  676 883 HOH HOH A . 
K 9 HOH 77  677 690 HOH HOH A . 
K 9 HOH 78  678 620 HOH HOH A . 
K 9 HOH 79  679 801 HOH HOH A . 
K 9 HOH 80  680 894 HOH HOH A . 
K 9 HOH 81  681 793 HOH HOH A . 
K 9 HOH 82  682 772 HOH HOH A . 
K 9 HOH 83  683 963 HOH HOH A . 
K 9 HOH 84  684 744 HOH HOH A . 
K 9 HOH 85  685 614 HOH HOH A . 
K 9 HOH 86  686 848 HOH HOH A . 
K 9 HOH 87  687 919 HOH HOH A . 
K 9 HOH 88  688 912 HOH HOH A . 
K 9 HOH 89  689 725 HOH HOH A . 
K 9 HOH 90  690 765 HOH HOH A . 
K 9 HOH 91  691 767 HOH HOH A . 
K 9 HOH 92  692 709 HOH HOH A . 
K 9 HOH 93  693 621 HOH HOH A . 
K 9 HOH 94  694 603 HOH HOH A . 
K 9 HOH 95  695 610 HOH HOH A . 
K 9 HOH 96  696 634 HOH HOH A . 
K 9 HOH 97  697 652 HOH HOH A . 
K 9 HOH 98  698 612 HOH HOH A . 
K 9 HOH 99  699 689 HOH HOH A . 
K 9 HOH 100 700 678 HOH HOH A . 
K 9 HOH 101 701 730 HOH HOH A . 
K 9 HOH 102 702 664 HOH HOH A . 
K 9 HOH 103 703 651 HOH HOH A . 
K 9 HOH 104 704 899 HOH HOH A . 
K 9 HOH 105 705 655 HOH HOH A . 
K 9 HOH 106 706 647 HOH HOH A . 
K 9 HOH 107 707 721 HOH HOH A . 
K 9 HOH 108 708 887 HOH HOH A . 
K 9 HOH 109 709 673 HOH HOH A . 
K 9 HOH 110 710 644 HOH HOH A . 
K 9 HOH 111 711 101 HOH HOH A . 
K 9 HOH 112 712 638 HOH HOH A . 
K 9 HOH 113 713 807 HOH HOH A . 
K 9 HOH 114 714 630 HOH HOH A . 
K 9 HOH 115 715 718 HOH HOH A . 
K 9 HOH 116 716 806 HOH HOH A . 
K 9 HOH 117 717 632 HOH HOH A . 
K 9 HOH 118 718 975 HOH HOH A . 
K 9 HOH 119 719 870 HOH HOH A . 
K 9 HOH 120 720 611 HOH HOH A . 
K 9 HOH 121 721 661 HOH HOH A . 
K 9 HOH 122 722 756 HOH HOH A . 
K 9 HOH 123 723 604 HOH HOH A . 
K 9 HOH 124 724 855 HOH HOH A . 
K 9 HOH 125 725 737 HOH HOH A . 
K 9 HOH 126 726 888 HOH HOH A . 
K 9 HOH 127 727 927 HOH HOH A . 
K 9 HOH 128 728 601 HOH HOH A . 
K 9 HOH 129 729 659 HOH HOH A . 
K 9 HOH 130 730 713 HOH HOH A . 
K 9 HOH 131 731 789 HOH HOH A . 
K 9 HOH 132 732 705 HOH HOH A . 
K 9 HOH 133 733 910 HOH HOH A . 
K 9 HOH 134 734 748 HOH HOH A . 
K 9 HOH 135 735 701 HOH HOH A . 
K 9 HOH 136 736 922 HOH HOH A . 
K 9 HOH 137 737 736 HOH HOH A . 
K 9 HOH 138 738 879 HOH HOH A . 
K 9 HOH 139 739 674 HOH HOH A . 
K 9 HOH 140 740 649 HOH HOH A . 
K 9 HOH 141 741 672 HOH HOH A . 
K 9 HOH 142 742 973 HOH HOH A . 
K 9 HOH 143 743 782 HOH HOH A . 
K 9 HOH 144 744 660 HOH HOH A . 
K 9 HOH 145 745 889 HOH HOH A . 
K 9 HOH 146 746 679 HOH HOH A . 
K 9 HOH 147 747 903 HOH HOH A . 
K 9 HOH 148 748 669 HOH HOH A . 
K 9 HOH 149 749 666 HOH HOH A . 
K 9 HOH 150 750 729 HOH HOH A . 
K 9 HOH 151 751 896 HOH HOH A . 
K 9 HOH 152 752 851 HOH HOH A . 
K 9 HOH 153 753 792 HOH HOH A . 
K 9 HOH 154 754 627 HOH HOH A . 
K 9 HOH 155 755 739 HOH HOH A . 
K 9 HOH 156 756 974 HOH HOH A . 
K 9 HOH 157 757 784 HOH HOH A . 
K 9 HOH 158 758 972 HOH HOH A . 
K 9 HOH 159 759 675 HOH HOH A . 
K 9 HOH 160 760 891 HOH HOH A . 
K 9 HOH 161 761 779 HOH HOH A . 
K 9 HOH 162 762 780 HOH HOH A . 
K 9 HOH 163 763 873 HOH HOH A . 
K 9 HOH 164 764 665 HOH HOH A . 
K 9 HOH 165 765 838 HOH HOH A . 
K 9 HOH 166 766 703 HOH HOH A . 
K 9 HOH 167 767 711 HOH HOH A . 
K 9 HOH 168 768 682 HOH HOH A . 
K 9 HOH 169 769 692 HOH HOH A . 
K 9 HOH 170 770 948 HOH HOH A . 
K 9 HOH 171 771 857 HOH HOH A . 
K 9 HOH 172 772 872 HOH HOH A . 
K 9 HOH 173 773 667 HOH HOH A . 
K 9 HOH 174 774 790 HOH HOH A . 
K 9 HOH 175 775 619 HOH HOH A . 
K 9 HOH 176 776 629 HOH HOH A . 
K 9 HOH 177 777 702 HOH HOH A . 
K 9 HOH 178 778 680 HOH HOH A . 
K 9 HOH 179 779 885 HOH HOH A . 
K 9 HOH 180 780 819 HOH HOH A . 
K 9 HOH 181 781 696 HOH HOH A . 
K 9 HOH 182 782 862 HOH HOH A . 
K 9 HOH 183 783 926 HOH HOH A . 
K 9 HOH 184 784 740 HOH HOH A . 
K 9 HOH 185 785 684 HOH HOH A . 
K 9 HOH 186 786 818 HOH HOH A . 
K 9 HOH 187 787 952 HOH HOH A . 
K 9 HOH 188 788 804 HOH HOH A . 
K 9 HOH 189 789 741 HOH HOH A . 
K 9 HOH 190 790 615 HOH HOH A . 
K 9 HOH 191 791 693 HOH HOH A . 
K 9 HOH 192 792 742 HOH HOH A . 
K 9 HOH 193 793 622 HOH HOH A . 
K 9 HOH 194 794 751 HOH HOH A . 
K 9 HOH 195 795 777 HOH HOH A . 
K 9 HOH 196 796 866 HOH HOH A . 
K 9 HOH 197 797 654 HOH HOH A . 
K 9 HOH 198 798 685 HOH HOH A . 
K 9 HOH 199 799 878 HOH HOH A . 
K 9 HOH 200 800 886 HOH HOH A . 
K 9 HOH 201 801 800 HOH HOH A . 
K 9 HOH 202 802 788 HOH HOH A . 
K 9 HOH 203 803 921 HOH HOH A . 
K 9 HOH 204 804 823 HOH HOH A . 
K 9 HOH 205 805 853 HOH HOH A . 
K 9 HOH 206 806 816 HOH HOH A . 
K 9 HOH 207 807 817 HOH HOH A . 
K 9 HOH 208 808 925 HOH HOH A . 
K 9 HOH 209 809 918 HOH HOH A . 
K 9 HOH 210 810 657 HOH HOH A . 
K 9 HOH 211 811 957 HOH HOH A . 
K 9 HOH 212 812 723 HOH HOH A . 
K 9 HOH 213 813 618 HOH HOH A . 
K 9 HOH 214 814 924 HOH HOH A . 
K 9 HOH 215 815 941 HOH HOH A . 
K 9 HOH 216 816 743 HOH HOH A . 
K 9 HOH 217 817 768 HOH HOH A . 
K 9 HOH 218 818 668 HOH HOH A . 
K 9 HOH 219 819 688 HOH HOH A . 
K 9 HOH 220 820 778 HOH HOH A . 
K 9 HOH 221 821 940 HOH HOH A . 
K 9 HOH 222 822 967 HOH HOH A . 
K 9 HOH 223 823 843 HOH HOH A . 
K 9 HOH 224 824 704 HOH HOH A . 
K 9 HOH 225 825 650 HOH HOH A . 
K 9 HOH 226 826 613 HOH HOH A . 
K 9 HOH 227 827 681 HOH HOH A . 
K 9 HOH 228 828 841 HOH HOH A . 
K 9 HOH 229 829 608 HOH HOH A . 
K 9 HOH 230 830 769 HOH HOH A . 
K 9 HOH 231 831 849 HOH HOH A . 
K 9 HOH 232 832 110 HOH HOH A . 
K 9 HOH 233 833 837 HOH HOH A . 
K 9 HOH 234 834 695 HOH HOH A . 
K 9 HOH 235 835 820 HOH HOH A . 
K 9 HOH 236 836 839 HOH HOH A . 
K 9 HOH 237 837 648 HOH HOH A . 
K 9 HOH 238 838 752 HOH HOH A . 
K 9 HOH 239 839 755 HOH HOH A . 
K 9 HOH 240 840 694 HOH HOH A . 
K 9 HOH 241 841 677 HOH HOH A . 
K 9 HOH 242 842 901 HOH HOH A . 
K 9 HOH 243 843 902 HOH HOH A . 
K 9 HOH 244 844 628 HOH HOH A . 
K 9 HOH 245 845 913 HOH HOH A . 
K 9 HOH 246 846 861 HOH HOH A . 
K 9 HOH 247 847 616 HOH HOH A . 
K 9 HOH 248 848 773 HOH HOH A . 
K 9 HOH 249 849 637 HOH HOH A . 
K 9 HOH 250 850 880 HOH HOH A . 
K 9 HOH 251 851 750 HOH HOH A . 
K 9 HOH 252 852 753 HOH HOH A . 
K 9 HOH 253 853 867 HOH HOH A . 
K 9 HOH 254 854 733 HOH HOH A . 
K 9 HOH 255 855 805 HOH HOH A . 
K 9 HOH 256 856 687 HOH HOH A . 
K 9 HOH 257 857 949 HOH HOH A . 
K 9 HOH 258 858 134 HOH HOH A . 
K 9 HOH 259 859 636 HOH HOH A . 
K 9 HOH 260 860 914 HOH HOH A . 
K 9 HOH 261 861 908 HOH HOH A . 
K 9 HOH 262 862 783 HOH HOH A . 
K 9 HOH 263 863 720 HOH HOH A . 
K 9 HOH 264 864 858 HOH HOH A . 
K 9 HOH 265 865 797 HOH HOH A . 
K 9 HOH 266 866 893 HOH HOH A . 
K 9 HOH 267 867 961 HOH HOH A . 
K 9 HOH 268 868 607 HOH HOH A . 
K 9 HOH 269 869 826 HOH HOH A . 
K 9 HOH 270 870 935 HOH HOH A . 
K 9 HOH 271 871 3   HOH HOH A . 
K 9 HOH 272 872 653 HOH HOH A . 
K 9 HOH 273 873 763 HOH HOH A . 
K 9 HOH 274 874 932 HOH HOH A . 
K 9 HOH 275 875 635 HOH HOH A . 
K 9 HOH 276 876 945 HOH HOH A . 
K 9 HOH 277 877 707 HOH HOH A . 
K 9 HOH 278 878 757 HOH HOH A . 
K 9 HOH 279 879 795 HOH HOH A . 
K 9 HOH 280 880 631 HOH HOH A . 
K 9 HOH 281 881 962 HOH HOH A . 
K 9 HOH 282 882 776 HOH HOH A . 
K 9 HOH 283 883 846 HOH HOH A . 
K 9 HOH 284 884 955 HOH HOH A . 
K 9 HOH 285 885 809 HOH HOH A . 
K 9 HOH 286 886 815 HOH HOH A . 
K 9 HOH 287 887 917 HOH HOH A . 
K 9 HOH 288 888 976 HOH HOH A . 
K 9 HOH 289 889 904 HOH HOH A . 
K 9 HOH 290 890 920 HOH HOH A . 
K 9 HOH 291 891 810 HOH HOH A . 
K 9 HOH 292 892 868 HOH HOH A . 
K 9 HOH 293 893 931 HOH HOH A . 
K 9 HOH 294 894 830 HOH HOH A . 
K 9 HOH 295 895 833 HOH HOH A . 
K 9 HOH 296 896 759 HOH HOH A . 
K 9 HOH 297 897 714 HOH HOH A . 
K 9 HOH 298 898 821 HOH HOH A . 
K 9 HOH 299 899 799 HOH HOH A . 
K 9 HOH 300 900 958 HOH HOH A . 
K 9 HOH 301 901 969 HOH HOH A . 
K 9 HOH 302 902 731 HOH HOH A . 
K 9 HOH 303 903 114 HOH HOH A . 
K 9 HOH 304 904 812 HOH HOH A . 
K 9 HOH 305 905 875 HOH HOH A . 
K 9 HOH 306 906 863 HOH HOH A . 
K 9 HOH 307 907 929 HOH HOH A . 
K 9 HOH 308 908 890 HOH HOH A . 
K 9 HOH 309 909 892 HOH HOH A . 
K 9 HOH 310 910 859 HOH HOH A . 
K 9 HOH 311 911 840 HOH HOH A . 
K 9 HOH 312 912 876 HOH HOH A . 
K 9 HOH 313 913 900 HOH HOH A . 
K 9 HOH 314 914 699 HOH HOH A . 
K 9 HOH 315 915 954 HOH HOH A . 
K 9 HOH 316 916 137 HOH HOH A . 
K 9 HOH 317 917 670 HOH HOH A . 
K 9 HOH 318 918 970 HOH HOH A . 
K 9 HOH 319 919 936 HOH HOH A . 
K 9 HOH 320 920 786 HOH HOH A . 
K 9 HOH 321 921 824 HOH HOH A . 
K 9 HOH 322 922 864 HOH HOH A . 
K 9 HOH 323 923 829 HOH HOH A . 
K 9 HOH 324 924 719 HOH HOH A . 
K 9 HOH 325 925 676 HOH HOH A . 
K 9 HOH 326 926 834 HOH HOH A . 
K 9 HOH 327 927 844 HOH HOH A . 
K 9 HOH 328 928 785 HOH HOH A . 
K 9 HOH 329 929 909 HOH HOH A . 
K 9 HOH 330 930 947 HOH HOH A . 
K 9 HOH 331 931 964 HOH HOH A . 
K 9 HOH 332 932 934 HOH HOH A . 
K 9 HOH 333 933 959 HOH HOH A . 
K 9 HOH 334 934 943 HOH HOH A . 
K 9 HOH 335 935 728 HOH HOH A . 
K 9 HOH 336 936 126 HOH HOH A . 
K 9 HOH 337 937 869 HOH HOH A . 
K 9 HOH 338 938 766 HOH HOH A . 
K 9 HOH 339 939 874 HOH HOH A . 
K 9 HOH 340 940 971 HOH HOH A . 
K 9 HOH 341 941 710 HOH HOH A . 
K 9 HOH 342 942 928 HOH HOH A . 
K 9 HOH 343 943 968 HOH HOH A . 
K 9 HOH 344 944 111 HOH HOH A . 
K 9 HOH 345 945 822 HOH HOH A . 
K 9 HOH 346 946 884 HOH HOH A . 
K 9 HOH 347 947 950 HOH HOH A . 
K 9 HOH 348 948 882 HOH HOH A . 
K 9 HOH 349 949 907 HOH HOH A . 
K 9 HOH 350 950 944 HOH HOH A . 
K 9 HOH 351 951 836 HOH HOH A . 
K 9 HOH 352 952 916 HOH HOH A . 
K 9 HOH 353 953 965 HOH HOH A . 
K 9 HOH 354 954 871 HOH HOH A . 
K 9 HOH 355 955 698 HOH HOH A . 
K 9 HOH 356 956 881 HOH HOH A . 
K 9 HOH 357 957 716 HOH HOH A . 
K 9 HOH 358 958 930 HOH HOH A . 
K 9 HOH 359 959 724 HOH HOH A . 
K 9 HOH 360 960 906 HOH HOH A . 
K 9 HOH 361 961 832 HOH HOH A . 
K 9 HOH 362 962 708 HOH HOH A . 
K 9 HOH 363 963 860 HOH HOH A . 
K 9 HOH 364 964 905 HOH HOH A . 
K 9 HOH 365 965 856 HOH HOH A . 
K 9 HOH 366 966 745 HOH HOH A . 
K 9 HOH 367 967 937 HOH HOH A . 
K 9 HOH 368 968 911 HOH HOH A . 
K 9 HOH 369 969 697 HOH HOH A . 
K 9 HOH 370 970 951 HOH HOH A . 
K 9 HOH 371 971 897 HOH HOH A . 
K 9 HOH 372 972 956 HOH HOH A . 
K 9 HOH 373 973 712 HOH HOH A . 
K 9 HOH 374 974 933 HOH HOH A . 
K 9 HOH 375 975 966 HOH HOH A . 
K 9 HOH 376 976 734 HOH HOH A . 
K 9 HOH 377 977 747 HOH HOH A . 
K 9 HOH 378 978 845 HOH HOH A . 
K 9 HOH 379 979 625 HOH HOH A . 
K 9 HOH 380 980 770 HOH HOH A . 
K 9 HOH 381 981 946 HOH HOH A . 
K 9 HOH 382 982 749 HOH HOH A . 
K 9 HOH 383 983 813 HOH HOH A . 
L 9 HOH 1   101 113 HOH HOH T . 
L 9 HOH 2   102 105 HOH HOH T . 
L 9 HOH 3   103 121 HOH HOH T . 
L 9 HOH 4   104 118 HOH HOH T . 
L 9 HOH 5   105 132 HOH HOH T . 
L 9 HOH 6   106 102 HOH HOH T . 
L 9 HOH 7   107 110 HOH HOH T . 
L 9 HOH 8   108 128 HOH HOH T . 
L 9 HOH 9   109 115 HOH HOH T . 
L 9 HOH 10  110 103 HOH HOH T . 
L 9 HOH 11  111 112 HOH HOH T . 
L 9 HOH 12  112 106 HOH HOH T . 
L 9 HOH 13  113 107 HOH HOH T . 
L 9 HOH 14  114 125 HOH HOH T . 
L 9 HOH 15  115 683 HOH HOH T . 
L 9 HOH 16  116 123 HOH HOH T . 
L 9 HOH 17  117 122 HOH HOH T . 
L 9 HOH 18  118 129 HOH HOH T . 
L 9 HOH 19  119 104 HOH HOH T . 
L 9 HOH 20  120 117 HOH HOH T . 
L 9 HOH 21  121 116 HOH HOH T . 
L 9 HOH 22  122 120 HOH HOH T . 
L 9 HOH 23  123 114 HOH HOH T . 
L 9 HOH 24  124 127 HOH HOH T . 
L 9 HOH 25  125 119 HOH HOH T . 
L 9 HOH 26  126 136 HOH HOH T . 
L 9 HOH 27  127 131 HOH HOH T . 
L 9 HOH 28  128 135 HOH HOH T . 
L 9 HOH 29  129 133 HOH HOH T . 
L 9 HOH 30  130 109 HOH HOH T . 
L 9 HOH 31  131 108 HOH HOH T . 
L 9 HOH 32  132 130 HOH HOH T . 
L 9 HOH 33  133 641 HOH HOH T . 
M 9 HOH 1   101 109 HOH HOH P . 
M 9 HOH 2   102 794 HOH HOH P . 
M 9 HOH 3   103 1   HOH HOH P . 
M 9 HOH 4   104 112 HOH HOH P . 
M 9 HOH 5   105 119 HOH HOH P . 
M 9 HOH 6   106 103 HOH HOH P . 
M 9 HOH 7   107 106 HOH HOH P . 
M 9 HOH 8   108 700 HOH HOH P . 
M 9 HOH 9   109 101 HOH HOH P . 
M 9 HOH 10  110 102 HOH HOH P . 
M 9 HOH 11  111 108 HOH HOH P . 
M 9 HOH 12  112 117 HOH HOH P . 
M 9 HOH 13  113 118 HOH HOH P . 
M 9 HOH 14  114 116 HOH HOH P . 
M 9 HOH 15  115 113 HOH HOH P . 
M 9 HOH 16  116 104 HOH HOH P . 
M 9 HOH 17  117 850 HOH HOH P . 
M 9 HOH 18  118 124 HOH HOH P . 
M 9 HOH 19  119 107 HOH HOH P . 
M 9 HOH 20  120 115 HOH HOH P . 
M 9 HOH 21  121 111 HOH HOH P . 
M 9 HOH 22  122 105 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5950  ? 
1 MORE         -52   ? 
1 'SSA (A^2)'  21870 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 96.2  ? 
2  OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.8  ? 
3  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 85.7  ? 
4  OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 169.0 ? 
5  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 91.6  ? 
6  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 89.1  ? 
7  OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 89.7  ? 
8  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 168.6 ? 
9  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 85.3  ? 
10 O1B   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 81.3  ? 
11 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 105.1 ? 
12 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 104.4 ? 
13 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 165.5 ? 
14 O1B   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 80.3  ? 
15 O1A   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 83.3  ? 
16 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 84.8  ? 
17 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 109.0 ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 85.7  ? 
19 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 161.1 ? 
20 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 91.6  ? 
21 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 89.1  ? 
22 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 104.7 ? 
23 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 168.6 ? 
24 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 85.3  ? 
25 O1B   ? I DTP .   ? A DTP 506 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 81.4  ? 
26 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 82.6  ? 
27 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 104.4 ? 
28 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 165.6 ? 
29 O1B   ? I DTP .   ? A DTP 506 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 80.4  ? 
30 O1A   ? I DTP .   ? A DTP 506 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 83.3  ? 
31 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 29.6  ? 
32 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 115.6 ? 
33 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 91.6  ? 
34 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 75.3  ? 
35 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 94.4  ? 
36 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 95.9  ? 
37 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 153.3 ? 
38 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 177.1 ? 
39 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 85.8  ? 
40 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 87.1  ? 
41 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? K HOH .   ? A HOH 728 ? 1_555 67.5  ? 
42 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? K HOH .   ? A HOH 728 ? 1_555 87.9  ? 
43 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? K HOH .   ? A HOH 728 ? 1_555 169.9 ? 
44 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? K HOH .   ? A HOH 728 ? 1_555 94.2  ? 
45 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? K HOH .   ? A HOH 728 ? 1_555 94.5  ? 
46 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 112.3 ? 
47 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 98.6  ? 
48 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 93.4  ? 
49 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 163.7 ? 
50 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 80.4  ? 
51 O     ? K HOH .   ? A HOH 728 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 76.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-29 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Derived calculations'       
3 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support    
2 2 'Structure model' pdbx_struct_oper_list 
3 3 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization'  
2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 3 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .        2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    781 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    946 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_1             232 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_2             232 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.560 
_pdbx_validate_rmsd_bond.bond_target_value         1.474 
_pdbx_validate_rmsd_bond.bond_deviation            0.086 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.014 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE    A ARG 61  ? ? CZ    A ARG 61  ? ? NH1   A ARG 61  ? ? 123.49 120.30 3.19  0.50 N 
2 1 NE    A ARG 61  ? ? CZ    A ARG 61  ? ? NH2   A ARG 61  ? ? 115.47 120.30 -4.83 0.50 N 
3 1 C     A LYS 231 ? A N     A PRO 232 ? ? CD    A PRO 232 ? ? 135.49 120.60 14.89 2.20 Y 
4 1 "O4'" P DA  7   ? ? "C4'" P DA  7   ? ? "C3'" P DA  7   ? ? 101.05 104.50 -3.45 0.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 31.55   63.31   
2 1 TYR A 39  ? ? 65.79   -178.80 
3 1 LYS A 40  ? ? -155.39 -35.38  
4 1 SER A 62  ? ? 78.82   -7.81   
5 1 SER A 217 ? ? -154.61 -157.43 
6 1 SER A 257 ? ? 92.71   -10.80  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KFG 'double helix'        
5KFG 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.025  -0.111 -0.029 0.463  -3.684  5.029  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.034  -0.044 0.238  1.227  -16.724 4.314  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.223 -0.150 -0.354 -7.603 -2.842  -0.289 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.209  -0.164 0.044  4.765  -1.645  -1.015 4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.225  -0.135 -0.303 11.727 -6.137  1.899  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.518 -0.306 -0.072 -2.085 -6.823  4.743  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 -0.022 -0.137 0.132  -5.240 -3.909  -1.171 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.177 -0.168 -0.115 14.277 -0.365  3.018  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.850  -1.103 3.338 -2.324 2.122 26.484 -2.944 -2.448 3.156 4.612  5.051   
26.667 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.428 -1.151 3.497 6.433  8.536 29.011 -3.835 2.064  2.891 16.355 -12.326 
30.878 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.603 -0.462 3.113 -2.687 1.375 35.086 -0.958 0.615  3.129 2.276  4.446   
35.211 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.447  -0.697 3.214 3.261  1.409 30.182 -1.608 -0.209 3.209 2.695  -6.235  
30.386 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.336 -0.545 3.727 -4.719 4.524 33.691 -1.730 -0.272 3.638 7.714  8.047   
34.301 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.561 -0.651 3.480 -2.482 1.152 37.142 -1.183 0.528  3.488 1.806  3.890   
37.239 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.288  0.158  3.015 -0.659 2.132 27.600 -0.146 -0.749 3.011 4.459  1.378   
27.688 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Intramural DK036146-08' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION'                MN  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 1,2-ETHANEDIOL                      EDO 
9 water                               HOH 
#