data_5KFI
# 
_entry.id   5KFI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KFI         
WWPDB D_1000222124 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KFI 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gao, Y.'  1 ? 
primary 'Yang, W.' 2 ? 
# 
_cell.length_a           98.530 
_cell.length_b           98.530 
_cell.length_c           81.840 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           5KFI 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.entry_id                         5KFI 
_symmetry.Int_Tables_number                169 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                 54.938    3   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ? ? 
8 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
9 water       nat water                                                18.015    463 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' ? 9606 ? 
3 1 sample 1 9  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5KFI       5KFI   ? 2 ? 1 
3 PDB 5KFI       5KFI   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KFI A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5KFI T 1 ? 12  ? 5KFI   1 ? 12  ? 1 12  
3 3 5KFI P 1 ? 9   ? 5KFI   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KFI GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5KFI PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5KFI HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ?                               'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ?                               'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KFI 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.09 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.01 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.d_resolution_high            1.650 
_reflns.pdbx_number_measured_all     355355 
_reflns.number_obs                   53596 
_reflns.pdbx_Rmerge_I_obs            0.070 
_reflns.pdbx_netI_over_sigmaI        19.960 
_reflns.pdbx_chi_squared             0.994 
_reflns.percent_possible_obs         98.700 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.pdbx_Rrim_I_all              0.076 
_reflns.pdbx_CC_half                 0.999 
_reflns.B_iso_Wilson_estimate        24.847 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5KFI 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.8960 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  1.650 1.690 27558 ? 4020 0 0.702 2.650  ? ? ? ? ? 4020 ? ? ? ? ? 100.000 0.759 ? 0.807 
1 2  1.690 1.740 26123 ? 3896 0 0.620 3.150  ? ? ? ? ? 3897 ? ? ? ? ? 100.000 0.672 ? 0.849 
1 3  1.740 1.790 26102 ? 3794 0 0.491 3.800  ? ? ? ? ? 3794 ? ? ? ? ? 100.000 0.531 ? 0.907 
1 4  1.790 1.840 25283 ? 3663 0 0.404 4.630  ? ? ? ? ? 3663 ? ? ? ? ? 100.000 0.438 ? 0.928 
1 5  1.840 1.910 22732 ? 3461 0 0.380 5.380  ? ? ? ? ? 3584 ? ? ? ? ? 96.600  0.413 ? 0.945 
1 6  1.910 1.970 18870 ? 3257 0 0.261 8.460  ? ? ? ? ? 3478 ? ? ? ? ? 93.600  0.289 ? 0.968 
1 7  1.970 2.050 22823 ? 3307 0 0.198 9.440  ? ? ? ? ? 3309 ? ? ? ? ? 99.900  0.214 ? 0.980 
1 8  2.050 2.130 18698 ? 3140 0 0.171 11.960 ? ? ? ? ? 3217 ? ? ? ? ? 97.600  0.189 ? 0.979 
1 9  2.130 2.220 21358 ? 3069 0 0.119 15.050 ? ? ? ? ? 3083 ? ? ? ? ? 99.500  0.129 ? 0.993 
1 10 2.220 2.330 16144 ? 2767 0 0.116 17.800 ? ? ? ? ? 2950 ? ? ? ? ? 93.800  0.128 ? 0.989 
1 11 2.330 2.460 19644 ? 2810 0 0.078 21.910 ? ? ? ? ? 2810 ? ? ? ? ? 100.000 0.084 ? 0.997 
1 12 2.460 2.610 18041 ? 2639 0 0.074 23.650 ? ? ? ? ? 2639 ? ? ? ? ? 100.000 0.080 ? 0.997 
1 13 2.610 2.790 16022 ? 2490 0 0.062 28.440 ? ? ? ? ? 2500 ? ? ? ? ? 99.600  0.068 ? 0.997 
1 14 2.790 3.010 16150 ? 2316 0 0.046 35.440 ? ? ? ? ? 2316 ? ? ? ? ? 100.000 0.050 ? 0.999 
1 15 3.010 3.300 14737 ? 2148 0 0.035 44.720 ? ? ? ? ? 2148 ? ? ? ? ? 100.000 0.038 ? 0.999 
1 16 3.300 3.690 11972 ? 1919 0 0.031 53.590 ? ? ? ? ? 1943 ? ? ? ? ? 98.800  0.034 ? 0.999 
1 17 3.690 4.260 11084 ? 1711 0 0.024 61.810 ? ? ? ? ? 1722 ? ? ? ? ? 99.400  0.026 ? 0.999 
1 18 4.260 5.220 10140 ? 1456 0 0.019 69.740 ? ? ? ? ? 1456 ? ? ? ? ? 100.000 0.021 ? 1.000 
1 19 5.220 7.380 7856  ? 1129 0 0.021 66.610 ? ? ? ? ? 1129 ? ? ? ? ? 100.000 0.023 ? 1.000 
1 20 7.380 ?     4018  ? 604  0 0.019 77.180 ? ? ? ? ? 638  ? ? ? ? ? 94.700  0.021 ? 0.999 
# 
_refine.entry_id                                 5KFI 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            1.6500 
_refine.ls_d_res_low                             19.8960 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.7400 
_refine.ls_number_reflns_obs                     53576 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1914 
_refine.ls_R_factor_R_work                       0.1898 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2208 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0100 
_refine.ls_number_reflns_R_free                  2685 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               23.7877 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1900 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4ECQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                86.910 
_refine.B_iso_min                                6.750 
_refine.pdbx_overall_phase_error                 22.9100 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.6500 
_refine_hist.d_res_low                        19.8960 
_refine_hist.pdbx_number_atoms_ligand         61 
_refine_hist.number_atoms_solvent             464 
_refine_hist.number_atoms_total               4299 
_refine_hist.pdbx_number_residues_total       451 
_refine_hist.pdbx_B_iso_mean_ligand           19.01 
_refine_hist.pdbx_B_iso_mean_solvent          29.38 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
# 
_refine_ls_shell.R_factor_R_free                  0.2597 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2199 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.d_res_high                       1.6500 
_refine_ls_shell.d_res_low                        1.6800 
_refine_ls_shell.number_reflns_R_free             136 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
# 
_struct.entry_id                     5KFI 
_struct.title                        'Human DNA polymerase eta-DNA ternary complex: reaction with 10 mM Mn2+ for 120s' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KFI 
_struct_keywords.text            
'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, replication, transferase-DNA complex' 
_struct_keywords.pdbx_keywords   'replication, transferase/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 4 ? 
M N N 9 ? 
N N N 9 ? 
O N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 AB2 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P12 AB3 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P13 AB4 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P14 AB5 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P15 AB6 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P16 AB7 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P17 AB8 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 AB9 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 AC1 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 AC2 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.243 ? 
metalc2  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 F MN  . MN  B ? A ASP 13  A MN  503 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc3  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 D MN  . MN  ? ? A ASP 13  A MN  501 1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc4  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc5  metalc ? ? A MET 17  O     ? ? ? 1_555 F MN  . MN  B ? A MET 14  A MN  503 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc6  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 D MN  . MN  ? ? A ASP 115 A MN  501 1_555 ? ? ? ? ? ? ?            2.145 ? 
metalc7  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.283 ? 
metalc8  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 F MN  . MN  B ? A ASP 115 A MN  503 1_555 ? ? ? ? ? ? ?            2.246 ? 
metalc9  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MN  . MN  ? ? A GLU 116 A MN  501 1_555 ? ? ? ? ? ? ?            2.182 ? 
metalc10 metalc ? ? C DT  8   "O3'" A ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc11 metalc ? ? C DT  8   "O3'" B ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.469 ? 
metalc12 metalc ? ? C DA  9   OP1   B ? ? 1_555 D MN  . MN  ? ? P DA  9   A MN  501 1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc13 metalc ? ? C DA  9   OP1   B ? ? 1_555 F MN  . MN  B ? P DA  9   A MN  503 1_555 ? ? ? ? ? ? ?            2.523 ? 
metalc14 metalc ? ? C DA  9   OP2   B ? ? 1_555 L MN  . MN  B ? P DA  9   P MN  101 1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc15 metalc ? ? D MN  .   MN    ? ? ? 1_555 M HOH . O   ? ? A MN  501 A HOH 780 1_555 ? ? ? ? ? ? ?            2.209 ? 
metalc16 metalc ? ? D MN  .   MN    ? ? ? 1_555 J DTP . O1A A ? A MN  501 A DTP 507 1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc17 metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O1B A ? A CA  502 A DTP 507 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc18 metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O1A A ? A CA  502 A DTP 507 1_555 ? ? ? ? ? ? ?            2.230 ? 
metalc19 metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O1G A ? A CA  502 A DTP 507 1_555 ? ? ? ? ? ? ?            2.304 ? 
metalc20 metalc ? ? F MN  .   MN    B ? ? 1_555 K DPO . O1  B ? A MN  503 A DPO 508 1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc21 metalc ? ? F MN  .   MN    B ? ? 1_555 K DPO . O5  B ? A MN  503 A DPO 508 1_555 ? ? ? ? ? ? ?            2.084 ? 
metalc22 metalc ? ? K DPO .   O2    B ? ? 1_555 L MN  . MN  B ? A DPO 508 P MN  101 1_555 ? ? ? ? ? ? ?            2.264 ? 
metalc23 metalc ? ? L MN  .   MN    B ? ? 1_555 M HOH . O   ? ? P MN  101 A HOH 650 1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc24 metalc ? ? L MN  .   MN    B ? ? 1_555 M HOH . O   B ? P MN  101 A HOH 796 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc25 metalc ? ? L MN  .   MN    B ? ? 1_555 O HOH . O   B ? P MN  101 P HOH 222 1_555 ? ? ? ? ? ? ?            2.105 ? 
metalc26 metalc ? ? L MN  .   MN    B ? ? 1_555 M HOH . O   ? ? P MN  101 A HOH 618 1_555 ? ? ? ? ? ? ?            2.727 ? 
hydrog1  hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  9 N1  B ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  9 N6  B ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -1.46 
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -2.75 
3 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -0.53 
4 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -7.37 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  501 ? 9  'binding site for residue MN A 501'  
AC2 Software A CA  502 ? 7  'binding site for residue CA A 502'  
AC3 Software A MN  503 ? 7  'binding site for residue MN A 503'  
AC4 Software A GOL 504 ? 10 'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 9  'binding site for residue GOL A 505' 
AC6 Software A GOL 506 ? 8  'binding site for residue GOL A 506' 
AC7 Software A DTP 507 ? 32 'binding site for residue DTP A 507' 
AC8 Software A DPO 508 ? 18 'binding site for residue DPO A 508' 
AC9 Software P MN  101 ? 8  'binding site for residue MN P 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 9  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2   AC1 9  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3   AC1 9  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4   AC1 9  CA  E .   ? CA  A 502 . ? 1_555 ? 
5   AC1 9  MN  F .   ? MN  A 503 . ? 1_555 ? 
6   AC1 9  DTP J .   ? DTP A 507 . ? 1_555 ? 
7   AC1 9  HOH M .   ? HOH A 780 . ? 1_555 ? 
8   AC1 9  DT  C 8   ? DT  P 8   . ? 1_555 ? 
9   AC1 9  DA  C 9   ? DA  P 9   . ? 1_555 ? 
10  AC2 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
11  AC2 7  MET A 17  ? MET A 14  . ? 1_555 ? 
12  AC2 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
13  AC2 7  MN  D .   ? MN  A 501 . ? 1_555 ? 
14  AC2 7  DTP J .   ? DTP A 507 . ? 1_555 ? 
15  AC2 7  DPO K .   ? DPO A 508 . ? 1_555 ? 
16  AC2 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
17  AC3 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
18  AC3 7  MET A 17  ? MET A 14  . ? 1_555 ? 
19  AC3 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
20  AC3 7  MN  D .   ? MN  A 501 . ? 1_555 ? 
21  AC3 7  DTP J .   ? DTP A 507 . ? 1_555 ? 
22  AC3 7  DPO K .   ? DPO A 508 . ? 1_555 ? 
23  AC3 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
24  AC4 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
25  AC4 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
26  AC4 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
27  AC4 10 SER A 251 ? SER A 248 . ? 1_555 ? 
28  AC4 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
29  AC4 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
30  AC4 10 HOH M .   ? HOH A 647 . ? 1_555 ? 
31  AC4 10 HOH M .   ? HOH A 715 . ? 1_555 ? 
32  AC4 10 HOH M .   ? HOH A 721 . ? 1_555 ? 
33  AC4 10 HOH M .   ? HOH A 793 . ? 1_555 ? 
34  AC5 9  GLU A 97  ? GLU A 94  . ? 1_555 ? 
35  AC5 9  ALA A 98  ? ALA A 95  . ? 1_555 ? 
36  AC5 9  GLU A 101 ? GLU A 98  . ? 1_555 ? 
37  AC5 9  ARG A 306 ? ARG A 303 . ? 5_664 ? 
38  AC5 9  HOH M .   ? HOH A 645 . ? 5_664 ? 
39  AC5 9  HOH M .   ? HOH A 661 . ? 1_555 ? 
40  AC5 9  HOH M .   ? HOH A 673 . ? 1_555 ? 
41  AC5 9  HOH M .   ? HOH A 685 . ? 1_555 ? 
42  AC5 9  HOH M .   ? HOH A 834 . ? 1_555 ? 
43  AC6 8  ASN A 29  ? ASN A 26  . ? 1_555 ? 
44  AC6 8  PRO A 30  ? PRO A 27  . ? 1_555 ? 
45  AC6 8  GLY A 274 ? GLY A 271 . ? 5_664 ? 
46  AC6 8  GLU A 276 ? GLU A 273 . ? 5_664 ? 
47  AC6 8  TYR A 277 ? TYR A 274 . ? 5_664 ? 
48  AC6 8  GLU A 280 ? GLU A 277 . ? 5_664 ? 
49  AC6 8  HOH M .   ? HOH A 614 . ? 1_555 ? 
50  AC6 8  HOH M .   ? HOH A 691 . ? 1_555 ? 
51  AC7 32 ASP A 16  ? ASP A 13  . ? 1_555 ? 
52  AC7 32 MET A 17  ? MET A 14  . ? 1_555 ? 
53  AC7 32 ASP A 18  ? ASP A 15  . ? 1_555 ? 
54  AC7 32 CYS A 19  ? CYS A 16  . ? 1_555 ? 
55  AC7 32 PHE A 20  ? PHE A 17  . ? 1_555 ? 
56  AC7 32 PHE A 21  ? PHE A 18  . ? 1_555 ? 
57  AC7 32 ILE A 51  ? ILE A 48  . ? 1_555 ? 
58  AC7 32 ALA A 52  ? ALA A 49  . ? 1_555 ? 
59  AC7 32 TYR A 55  ? TYR A 52  . ? 1_555 ? 
60  AC7 32 ARG A 58  ? ARG A 55  . ? 1_555 ? 
61  AC7 32 ARG A 64  ? ARG A 61  . ? 1_555 ? 
62  AC7 32 ASP A 118 ? ASP A 115 . ? 1_555 ? 
63  AC7 32 LYS A 234 ? LYS A 231 . ? 1_555 ? 
64  AC7 32 MN  D .   ? MN  A 501 . ? 1_555 ? 
65  AC7 32 CA  E .   ? CA  A 502 . ? 1_555 ? 
66  AC7 32 MN  F .   ? MN  A 503 . ? 1_555 ? 
67  AC7 32 DPO K .   ? DPO A 508 . ? 1_555 ? 
68  AC7 32 HOH M .   ? HOH A 618 . ? 1_555 ? 
69  AC7 32 HOH M .   ? HOH A 650 . ? 1_555 ? 
70  AC7 32 HOH M .   ? HOH A 653 . ? 1_555 ? 
71  AC7 32 HOH M .   ? HOH A 780 . ? 1_555 ? 
72  AC7 32 HOH M .   ? HOH A 791 . ? 1_555 ? 
73  AC7 32 HOH M .   ? HOH A 796 . ? 1_555 ? 
74  AC7 32 DT  C 8   ? DT  P 8   . ? 1_555 ? 
75  AC7 32 DA  C 9   ? DA  P 9   . ? 1_555 ? 
76  AC7 32 MN  L .   ? MN  P 101 . ? 1_555 ? 
77  AC7 32 HOH O .   ? HOH P 203 . ? 1_555 ? 
78  AC7 32 HOH O .   ? HOH P 207 . ? 1_555 ? 
79  AC7 32 HOH O .   ? HOH P 222 . ? 1_555 ? 
80  AC7 32 DT  B 3   ? DT  T 3   . ? 1_555 ? 
81  AC7 32 DT  B 4   ? DT  T 4   . ? 1_555 ? 
82  AC7 32 DA  B 5   ? DA  T 5   . ? 1_555 ? 
83  AC8 18 ASP A 16  ? ASP A 13  . ? 1_555 ? 
84  AC8 18 MET A 17  ? MET A 14  . ? 1_555 ? 
85  AC8 18 ASP A 18  ? ASP A 15  . ? 1_555 ? 
86  AC8 18 CYS A 19  ? CYS A 16  . ? 1_555 ? 
87  AC8 18 PHE A 20  ? PHE A 17  . ? 1_555 ? 
88  AC8 18 TYR A 55  ? TYR A 52  . ? 1_555 ? 
89  AC8 18 ARG A 58  ? ARG A 55  . ? 1_555 ? 
90  AC8 18 ARG A 64  ? ARG A 61  . ? 1_555 ? 
91  AC8 18 ASP A 118 ? ASP A 115 . ? 1_555 ? 
92  AC8 18 LYS A 234 ? LYS A 231 . ? 1_555 ? 
93  AC8 18 CA  E .   ? CA  A 502 . ? 1_555 ? 
94  AC8 18 MN  F .   ? MN  A 503 . ? 1_555 ? 
95  AC8 18 DTP J .   ? DTP A 507 . ? 1_555 ? 
96  AC8 18 HOH M .   ? HOH A 618 . ? 1_555 ? 
97  AC8 18 HOH M .   ? HOH A 653 . ? 1_555 ? 
98  AC8 18 HOH M .   ? HOH A 796 . ? 1_555 ? 
99  AC8 18 DA  C 9   ? DA  P 9   . ? 1_555 ? 
100 AC8 18 MN  L .   ? MN  P 101 . ? 1_555 ? 
101 AC9 8  ARG A 64  ? ARG A 61  . ? 1_555 ? 
102 AC9 8  DTP J .   ? DTP A 507 . ? 1_555 ? 
103 AC9 8  DPO K .   ? DPO A 508 . ? 1_555 ? 
104 AC9 8  HOH M .   ? HOH A 618 . ? 1_555 ? 
105 AC9 8  HOH M .   ? HOH A 650 . ? 1_555 ? 
106 AC9 8  HOH M .   ? HOH A 796 . ? 1_555 ? 
107 AC9 8  DA  C 9   ? DA  P 9   . ? 1_555 ? 
108 AC9 8  HOH O .   ? HOH P 222 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KFI 
_atom_sites.fract_transf_matrix[1][1]   0.010149 
_atom_sites.fract_transf_matrix[1][2]   0.005860 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011719 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012219 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.833 -34.410 -3.851  1.00 44.07 ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.201 -33.924 -3.857  1.00 53.37 ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.520 -33.009 -5.029  1.00 52.47 ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.256 -31.807 -4.969  1.00 55.65 ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.086 -33.581 -6.106  1.00 53.54 ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.527 -32.858 -7.309  1.00 55.89 ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.381 -32.255 -8.126  1.00 54.13 ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.611 -31.359 -8.943  1.00 56.74 ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.252 -33.940 -8.121  1.00 48.38 ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.638 -35.224 -7.671  1.00 46.17 ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.330 -35.030 -6.213  1.00 47.43 ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.165 -32.742 -7.904  1.00 51.57 ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.003 -32.285 -8.661  1.00 54.38 ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.097 -31.413 -7.795  1.00 59.07 ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.045 -30.949 -8.242  1.00 52.76 ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.235 -33.488 -9.215  1.00 46.45 ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.126 -34.563 -9.758  1.00 42.51 ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.744 -34.467 -10.986 1.00 40.55 ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.522 -35.745 -9.228  1.00 39.41 ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.474 -35.548 -11.196 1.00 39.83 ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.358 -36.339 -10.145 1.00 42.06 ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.520 -31.194 -6.552  1.00 61.86 ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.791 -30.334 -5.627  1.00 61.69 ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.914 -28.866 -6.015  1.00 62.49 ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.980 -28.263 -5.867  1.00 62.32 ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 64.291 -30.535 -4.194  1.00 61.18 ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 63.753 -31.784 -3.516  1.00 68.07 ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.945 -31.817 -3.476  1.00 86.91 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.656 -33.335 -2.564  1.00 64.90 ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.822 -28.299 -6.519  1.00 61.79 ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.773 -26.873 -6.821  1.00 58.41 ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 62.902 -26.077 -5.528  1.00 51.21 ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.239 -26.383 -4.535  1.00 47.84 ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.485 -26.518 -7.549  1.00 52.80 ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.766 -25.065 -5.528  1.00 48.43 ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.025 -24.322 -4.299  1.00 40.30 ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.534 -22.882 -4.364  1.00 31.13 ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.712 -22.125 -3.405  1.00 34.88 ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.522 -24.315 -3.948  1.00 34.94 ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.263 -23.676 -4.999  1.00 39.74 ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.027 -25.739 -3.747  1.00 42.14 ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.913 -22.510 -5.483  1.00 28.76 ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.352 -21.178 -5.629  1.00 26.25 ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.400 -20.102 -5.424  1.00 22.44 ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.193 -19.152 -4.666  1.00 22.68 ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.539 -20.271 -6.088  1.00 20.06 ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.644 -19.329 -5.980  1.00 14.62 ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.029 -18.760 -7.342  1.00 16.52 ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.139 -18.251 -7.508  1.00 18.45 ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.868 -20.002 -5.346  1.00 18.23 ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.704 -20.362 -3.877  1.00 21.22 ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 67.900 -21.126 -3.348  1.00 22.25 ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 67.999 -22.335 -3.533  1.00 29.66 ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.818 -20.422 -2.690  1.00 24.05 ? 5    GLN A NE2   1 
ATOM   55   N  N     A ASP A 1 9   ? 65.081 -18.843 -8.278  0.50 20.91 ? 6    ASP A N     1 
ATOM   56   N  N     B ASP A 1 9   ? 65.127 -18.827 -8.317  0.50 20.92 ? 6    ASP A N     1 
ATOM   57   C  CA    A ASP A 1 9   ? 65.279 -18.473 -9.676  0.50 18.33 ? 6    ASP A CA    1 
ATOM   58   C  CA    B ASP A 1 9   ? 65.472 -18.420 -9.680  0.50 18.23 ? 6    ASP A CA    1 
ATOM   59   C  C     A ASP A 1 9   ? 65.283 -16.957 -9.906  0.50 17.52 ? 6    ASP A C     1 
ATOM   60   C  C     B ASP A 1 9   ? 65.224 -16.936 -9.977  0.50 17.50 ? 6    ASP A C     1 
ATOM   61   O  O     A ASP A 1 9   ? 65.969 -16.459 -10.795 0.50 19.91 ? 6    ASP A O     1 
ATOM   62   O  O     B ASP A 1 9   ? 65.652 -16.440 -11.012 0.50 20.48 ? 6    ASP A O     1 
ATOM   63   C  CB    A ASP A 1 9   ? 64.198 -19.133 -10.559 0.50 20.75 ? 6    ASP A CB    1 
ATOM   64   C  CB    B ASP A 1 9   ? 64.709 -19.271 -10.698 0.50 21.05 ? 6    ASP A CB    1 
ATOM   65   C  CG    A ASP A 1 9   ? 62.773 -18.984 -9.996  0.50 21.69 ? 6    ASP A CG    1 
ATOM   66   C  CG    B ASP A 1 9   ? 65.267 -20.679 -10.817 0.50 26.71 ? 6    ASP A CG    1 
ATOM   67   O  OD1   A ASP A 1 9   ? 62.527 -19.331 -8.817  0.50 17.12 ? 6    ASP A OD1   1 
ATOM   68   O  OD1   B ASP A 1 9   ? 66.486 -20.862 -10.602 0.50 24.75 ? 6    ASP A OD1   1 
ATOM   69   O  OD2   A ASP A 1 9   ? 61.879 -18.533 -10.749 0.50 28.27 ? 6    ASP A OD2   1 
ATOM   70   O  OD2   B ASP A 1 9   ? 64.484 -21.603 -11.126 0.50 31.70 ? 6    ASP A OD2   1 
ATOM   71   N  N     . ARG A 1 10  ? 64.529 -16.235 -9.087  1.00 15.98 ? 7    ARG A N     1 
ATOM   72   C  CA    . ARG A 1 10  ? 64.316 -14.790 -9.256  1.00 14.99 ? 7    ARG A CA    1 
ATOM   73   C  C     . ARG A 1 10  ? 64.946 -13.951 -8.145  1.00 14.20 ? 7    ARG A C     1 
ATOM   74   O  O     . ARG A 1 10  ? 65.141 -14.428 -7.035  1.00 13.91 ? 7    ARG A O     1 
ATOM   75   C  CB    . ARG A 1 10  ? 62.824 -14.457 -9.283  1.00 13.59 ? 7    ARG A CB    1 
ATOM   76   C  CG    . ARG A 1 10  ? 62.016 -15.075 -10.404 1.00 15.66 ? 7    ARG A CG    1 
ATOM   77   C  CD    . ARG A 1 10  ? 60.543 -14.692 -10.253 1.00 17.61 ? 7    ARG A CD    1 
ATOM   78   N  NE    . ARG A 1 10  ? 59.914 -15.344 -9.106  1.00 16.79 ? 7    ARG A NE    1 
ATOM   79   C  CZ    . ARG A 1 10  ? 58.851 -14.873 -8.456  1.00 18.13 ? 7    ARG A CZ    1 
ATOM   80   N  NH1   . ARG A 1 10  ? 58.344 -15.554 -7.430  1.00 13.02 ? 7    ARG A NH1   1 
ATOM   81   N  NH2   . ARG A 1 10  ? 58.293 -13.722 -8.824  1.00 15.24 ? 7    ARG A NH2   1 
ATOM   82   N  N     . VAL A 1 11  ? 65.239 -12.689 -8.447  1.00 10.25 ? 8    VAL A N     1 
ATOM   83   C  CA    . VAL A 1 11  ? 65.525 -11.705 -7.401  1.00 8.21  ? 8    VAL A CA    1 
ATOM   84   C  C     . VAL A 1 11  ? 64.389 -10.695 -7.417  1.00 13.18 ? 8    VAL A C     1 
ATOM   85   O  O     . VAL A 1 11  ? 64.135 -10.064 -8.448  1.00 13.68 ? 8    VAL A O     1 
ATOM   86   C  CB    . VAL A 1 11  ? 66.869 -10.980 -7.603  1.00 12.44 ? 8    VAL A CB    1 
ATOM   87   C  CG1   . VAL A 1 11  ? 67.124 -9.961  -6.454  1.00 10.68 ? 8    VAL A CG1   1 
ATOM   88   C  CG2   . VAL A 1 11  ? 67.991 -11.974 -7.704  1.00 14.46 ? 8    VAL A CG2   1 
ATOM   89   N  N     . VAL A 1 12  ? 63.718 -10.535 -6.279  1.00 9.80  ? 9    VAL A N     1 
ATOM   90   C  CA    . VAL A 1 12  ? 62.541 -9.672  -6.214  1.00 9.89  ? 9    VAL A CA    1 
ATOM   91   C  C     . VAL A 1 12  ? 62.699 -8.700  -5.062  1.00 8.10  ? 9    VAL A C     1 
ATOM   92   O  O     . VAL A 1 12  ? 63.120 -9.081  -3.968  1.00 10.21 ? 9    VAL A O     1 
ATOM   93   C  CB    . VAL A 1 12  ? 61.240 -10.491 -6.038  1.00 9.63  ? 9    VAL A CB    1 
ATOM   94   C  CG1   . VAL A 1 12  ? 60.022 -9.578  -5.816  1.00 11.53 ? 9    VAL A CG1   1 
ATOM   95   C  CG2   . VAL A 1 12  ? 61.016 -11.394 -7.249  1.00 11.50 ? 9    VAL A CG2   1 
ATOM   96   N  N     . ALA A 1 13  ? 62.365 -7.435  -5.291  1.00 11.46 ? 10   ALA A N     1 
ATOM   97   C  CA    . ALA A 1 13  ? 62.385 -6.499  -4.178  1.00 9.54  ? 10   ALA A CA    1 
ATOM   98   C  C     . ALA A 1 13  ? 61.022 -5.883  -3.952  1.00 11.14 ? 10   ALA A C     1 
ATOM   99   O  O     . ALA A 1 13  ? 60.218 -5.796  -4.864  1.00 13.77 ? 10   ALA A O     1 
ATOM   100  C  CB    . ALA A 1 13  ? 63.411 -5.411  -4.413  1.00 10.33 ? 10   ALA A CB    1 
ATOM   101  N  N     . LEU A 1 14  ? 60.787 -5.446  -2.723  1.00 7.52  ? 11   LEU A N     1 
ATOM   102  C  CA    . LEU A 1 14  ? 59.611 -4.634  -2.418  1.00 6.75  ? 11   LEU A CA    1 
ATOM   103  C  C     . LEU A 1 14  ? 60.130 -3.338  -1.804  1.00 12.47 ? 11   LEU A C     1 
ATOM   104  O  O     . LEU A 1 14  ? 60.884 -3.368  -0.824  1.00 10.77 ? 11   LEU A O     1 
ATOM   105  C  CB    . LEU A 1 14  ? 58.663 -5.364  -1.468  1.00 10.68 ? 11   LEU A CB    1 
ATOM   106  C  CG    . LEU A 1 14  ? 57.310 -4.767  -1.040  1.00 16.15 ? 11   LEU A CG    1 
ATOM   107  C  CD1   . LEU A 1 14  ? 57.453 -3.853  0.163   1.00 15.46 ? 11   LEU A CD1   1 
ATOM   108  C  CD2   . LEU A 1 14  ? 56.573 -4.055  -2.197  1.00 10.71 ? 11   LEU A CD2   1 
ATOM   109  N  N     . VAL A 1 15  ? 59.764 -2.206  -2.397  1.00 10.64 ? 12   VAL A N     1 
ATOM   110  C  CA    . VAL A 1 15  ? 60.180 -0.924  -1.865  1.00 10.99 ? 12   VAL A CA    1 
ATOM   111  C  C     . VAL A 1 15  ? 58.937 -0.243  -1.330  1.00 8.79  ? 12   VAL A C     1 
ATOM   112  O  O     . VAL A 1 15  ? 57.948 -0.116  -2.056  1.00 9.93  ? 12   VAL A O     1 
ATOM   113  C  CB    . VAL A 1 15  ? 60.855 -0.046  -2.932  1.00 10.77 ? 12   VAL A CB    1 
ATOM   114  C  CG1   . VAL A 1 15  ? 61.216 1.333   -2.357  1.00 10.30 ? 12   VAL A CG1   1 
ATOM   115  C  CG2   . VAL A 1 15  ? 62.104 -0.743  -3.454  1.00 13.32 ? 12   VAL A CG2   1 
ATOM   116  N  N     . ASP A 1 16  ? 58.993 0.177   -0.069  1.00 10.23 ? 13   ASP A N     1 
ATOM   117  C  CA    . ASP A 1 16  ? 57.861 0.770   0.624   1.00 9.35  ? 13   ASP A CA    1 
ATOM   118  C  C     . ASP A 1 16  ? 58.239 2.080   1.306   1.00 9.17  ? 13   ASP A C     1 
ATOM   119  O  O     . ASP A 1 16  ? 59.179 2.122   2.093   1.00 9.59  ? 13   ASP A O     1 
ATOM   120  C  CB    . ASP A 1 16  ? 57.316 -0.208  1.658   1.00 11.34 ? 13   ASP A CB    1 
ATOM   121  C  CG    . ASP A 1 16  ? 56.083 0.319   2.348   1.00 13.55 ? 13   ASP A CG    1 
ATOM   122  O  OD1   . ASP A 1 16  ? 56.219 0.930   3.420   1.00 12.33 ? 13   ASP A OD1   1 
ATOM   123  O  OD2   . ASP A 1 16  ? 54.984 0.109   1.818   1.00 14.75 ? 13   ASP A OD2   1 
ATOM   124  N  N     . MET A 1 17  ? 57.555 3.165   0.996   1.00 8.66  ? 14   MET A N     1 
ATOM   125  C  CA    . MET A 1 17  ? 57.931 4.402   1.611   1.00 10.69 ? 14   MET A CA    1 
ATOM   126  C  C     . MET A 1 17  ? 57.719 4.455   3.126   1.00 9.61  ? 14   MET A C     1 
ATOM   127  O  O     . MET A 1 17  ? 56.815 3.928   3.592   1.00 11.69 ? 14   MET A O     1 
ATOM   128  C  CB    . MET A 1 17  ? 57.273 5.636   0.978   1.00 13.94 ? 14   MET A CB    1 
ATOM   129  C  CG    . MET A 1 17  ? 57.112 5.564   -0.507  1.00 11.09 ? 14   MET A CG    1 
ATOM   130  S  SD    . MET A 1 17  ? 58.748 5.634   -1.238  1.00 13.84 ? 14   MET A SD    1 
ATOM   131  C  CE    . MET A 1 17  ? 59.278 7.248   -0.839  1.00 18.88 ? 14   MET A CE    1 
ATOM   132  N  N     . ASP A 1 18  ? 58.574 5.156   3.824   1.00 8.36  ? 15   ASP A N     1 
ATOM   133  C  CA    . ASP A 1 18  ? 58.387 5.327   5.242   1.00 7.69  ? 15   ASP A CA    1 
ATOM   134  C  C     . ASP A 1 18  ? 57.371 6.459   5.476   1.00 10.26 ? 15   ASP A C     1 
ATOM   135  O  O     . ASP A 1 18  ? 57.391 7.472   4.882   1.00 9.93  ? 15   ASP A O     1 
ATOM   136  C  CB    . ASP A 1 18  ? 59.670 5.722   5.918   1.00 12.97 ? 15   ASP A CB    1 
ATOM   137  C  CG    . ASP A 1 18  ? 60.776 4.705   5.773   1.00 11.34 ? 15   ASP A CG    1 
ATOM   138  O  OD1   . ASP A 1 18  ? 60.480 3.538   5.683   1.00 12.56 ? 15   ASP A OD1   1 
ATOM   139  O  OD2   . ASP A 1 18  ? 61.903 5.131   5.824   1.00 17.23 ? 15   ASP A OD2   1 
ATOM   140  N  N     . CYS A 1 19  ? 56.467 6.123   6.368   1.00 9.00  ? 16   CYS A N     1 
ATOM   141  C  CA    . CYS A 1 19  ? 55.419 7.011   6.860   1.00 9.34  ? 16   CYS A CA    1 
ATOM   142  C  C     . CYS A 1 19  ? 54.901 7.964   5.774   1.00 9.84  ? 16   CYS A C     1 
ATOM   143  O  O     . CYS A 1 19  ? 54.989 9.082   5.898   1.00 9.82  ? 16   CYS A O     1 
ATOM   144  C  CB    . CYS A 1 19  ? 55.659 7.644   8.202   1.00 13.46 ? 16   CYS A CB    1 
ATOM   145  S  SG    . CYS A 1 19  ? 57.182 8.552   8.296   1.00 12.32 ? 16   CYS A SG    1 
ATOM   146  N  N     . PHE A 1 20  ? 54.420 7.393   4.696   1.00 11.53 ? 17   PHE A N     1 
ATOM   147  C  CA    . PHE A 1 20  ? 54.429 8.109   3.440   1.00 9.68  ? 17   PHE A CA    1 
ATOM   148  C  C     . PHE A 1 20  ? 53.669 9.432   3.408   1.00 13.24 ? 17   PHE A C     1 
ATOM   149  O  O     . PHE A 1 20  ? 54.250 10.414  3.094   1.00 8.72  ? 17   PHE A O     1 
ATOM   150  C  CB    . PHE A 1 20  ? 53.873 7.210   2.340   1.00 9.25  ? 17   PHE A CB    1 
ATOM   151  C  CG    . PHE A 1 20  ? 53.911 7.823   0.972   1.00 10.35 ? 17   PHE A CG    1 
ATOM   152  C  CD1   . PHE A 1 20  ? 54.995 8.498   0.529   1.00 9.53  ? 17   PHE A CD1   1 
ATOM   153  C  CD2   . PHE A 1 20  ? 52.831 7.720   0.150   1.00 12.42 ? 17   PHE A CD2   1 
ATOM   154  C  CE1   . PHE A 1 20  ? 55.021 9.039   -0.727  1.00 11.71 ? 17   PHE A CE1   1 
ATOM   155  C  CE2   . PHE A 1 20  ? 52.850 8.272   -1.099  1.00 14.78 ? 17   PHE A CE2   1 
ATOM   156  C  CZ    . PHE A 1 20  ? 53.949 8.937   -1.522  1.00 13.21 ? 17   PHE A CZ    1 
ATOM   157  N  N     . PHE A 1 21  ? 52.427 9.457   3.837   1.00 8.34  ? 18   PHE A N     1 
ATOM   158  C  CA    . PHE A 1 21  ? 51.686 10.736  3.781   1.00 8.49  ? 18   PHE A CA    1 
ATOM   159  C  C     . PHE A 1 21  ? 52.350 11.771  4.696   1.00 12.18 ? 18   PHE A C     1 
ATOM   160  O  O     . PHE A 1 21  ? 52.336 12.969  4.411   1.00 10.72 ? 18   PHE A O     1 
ATOM   161  C  CB    . PHE A 1 21  ? 50.198 10.585  4.170   1.00 8.85  ? 18   PHE A CB    1 
ATOM   162  C  CG    . PHE A 1 21  ? 49.349 9.861   3.147   1.00 11.62 ? 18   PHE A CG    1 
ATOM   163  C  CD1   . PHE A 1 21  ? 49.916 9.131   2.117   1.00 9.28  ? 18   PHE A CD1   1 
ATOM   164  C  CD2   . PHE A 1 21  ? 47.968 9.892   3.244   1.00 12.37 ? 18   PHE A CD2   1 
ATOM   165  C  CE1   . PHE A 1 21  ? 49.112 8.458   1.196   1.00 13.08 ? 18   PHE A CE1   1 
ATOM   166  C  CE2   . PHE A 1 21  ? 47.164 9.230   2.325   1.00 16.03 ? 18   PHE A CE2   1 
ATOM   167  C  CZ    . PHE A 1 21  ? 47.742 8.513   1.300   1.00 11.98 ? 18   PHE A CZ    1 
ATOM   168  N  N     . VAL A 1 22  ? 52.925 11.314  5.804   1.00 11.00 ? 19   VAL A N     1 
ATOM   169  C  CA    . VAL A 1 22  ? 53.645 12.218  6.701   1.00 10.30 ? 19   VAL A CA    1 
ATOM   170  C  C     . VAL A 1 22  ? 54.861 12.815  5.967   1.00 10.68 ? 19   VAL A C     1 
ATOM   171  O  O     . VAL A 1 22  ? 55.105 14.023  6.032   1.00 11.32 ? 19   VAL A O     1 
ATOM   172  C  CB    . VAL A 1 22  ? 54.084 11.499  7.998   1.00 7.81  ? 19   VAL A CB    1 
ATOM   173  C  CG1   . VAL A 1 22  ? 55.205 12.274  8.710   1.00 9.79  ? 19   VAL A CG1   1 
ATOM   174  C  CG2   . VAL A 1 22  ? 52.888 11.287  8.906   1.00 9.62  ? 19   VAL A CG2   1 
ATOM   175  N  N     . GLN A 1 23  ? 55.612 11.987  5.242   1.00 9.79  ? 20   GLN A N     1 
ATOM   176  C  CA    . GLN A 1 23  ? 56.771 12.547  4.526   1.00 7.03  ? 20   GLN A CA    1 
ATOM   177  C  C     . GLN A 1 23  ? 56.348 13.541  3.445   1.00 8.65  ? 20   GLN A C     1 
ATOM   178  O  O     . GLN A 1 23  ? 57.048 14.524  3.221   1.00 10.25 ? 20   GLN A O     1 
ATOM   179  C  CB    . GLN A 1 23  ? 57.635 11.464  3.897   1.00 9.02  ? 20   GLN A CB    1 
ATOM   180  C  CG    . GLN A 1 23  ? 58.503 10.687  4.863   1.00 11.45 ? 20   GLN A CG    1 
ATOM   181  C  CD    . GLN A 1 23  ? 59.590 9.974   4.090   1.00 12.46 ? 20   GLN A CD    1 
ATOM   182  O  OE1   . GLN A 1 23  ? 60.675 10.524  3.874   1.00 13.08 ? 20   GLN A OE1   1 
ATOM   183  N  NE2   . GLN A 1 23  ? 59.288 8.768   3.617   1.00 14.73 ? 20   GLN A NE2   1 
ATOM   184  N  N     . VAL A 1 24  ? 55.226 13.285  2.780   1.00 10.19 ? 21   VAL A N     1 
ATOM   185  C  CA    . VAL A 1 24  ? 54.723 14.215  1.763   1.00 8.04  ? 21   VAL A CA    1 
ATOM   186  C  C     . VAL A 1 24  ? 54.431 15.566  2.423   1.00 9.02  ? 21   VAL A C     1 
ATOM   187  O  O     . VAL A 1 24  ? 54.808 16.612  1.896   1.00 11.96 ? 21   VAL A O     1 
ATOM   188  C  CB    . VAL A 1 24  ? 53.456 13.669  1.051   1.00 9.66  ? 21   VAL A CB    1 
ATOM   189  C  CG1   . VAL A 1 24  ? 52.878 14.684  0.058   1.00 8.98  ? 21   VAL A CG1   1 
ATOM   190  C  CG2   . VAL A 1 24  ? 53.775 12.360  0.313   1.00 7.17  ? 21   VAL A CG2   1 
ATOM   191  N  N     . GLU A 1 25  ? 53.793 15.543  3.595   1.00 9.55  ? 22   GLU A N     1 
ATOM   192  C  CA    . GLU A 1 25  ? 53.508 16.799  4.292   1.00 9.79  ? 22   GLU A CA    1 
ATOM   193  C  C     . GLU A 1 25  ? 54.765 17.431  4.895   1.00 11.09 ? 22   GLU A C     1 
ATOM   194  O  O     . GLU A 1 25  ? 54.871 18.652  4.930   1.00 11.02 ? 22   GLU A O     1 
ATOM   195  C  CB    . GLU A 1 25  ? 52.441 16.589  5.386   1.00 8.08  ? 22   GLU A CB    1 
ATOM   196  C  CG    . GLU A 1 25  ? 51.115 16.102  4.856   1.00 8.08  ? 22   GLU A CG    1 
ATOM   197  C  CD    . GLU A 1 25  ? 50.381 17.144  3.997   1.00 14.70 ? 22   GLU A CD    1 
ATOM   198  O  OE1   . GLU A 1 25  ? 50.640 18.360  4.164   1.00 13.64 ? 22   GLU A OE1   1 
ATOM   199  O  OE2   . GLU A 1 25  ? 49.532 16.752  3.167   1.00 14.23 ? 22   GLU A OE2   1 
ATOM   200  N  N     . GLN A 1 26  ? 55.726 16.618  5.331   1.00 10.82 ? 23   GLN A N     1 
ATOM   201  C  CA    . GLN A 1 26  ? 56.958 17.177  5.904   1.00 9.00  ? 23   GLN A CA    1 
ATOM   202  C  C     . GLN A 1 26  ? 57.854 17.821  4.845   1.00 11.39 ? 23   GLN A C     1 
ATOM   203  O  O     . GLN A 1 26  ? 58.535 18.811  5.120   1.00 10.68 ? 23   GLN A O     1 
ATOM   204  C  CB    . GLN A 1 26  ? 57.742 16.100  6.641   1.00 9.81  ? 23   GLN A CB    1 
ATOM   205  C  CG    . GLN A 1 26  ? 57.128 15.673  7.958   1.00 11.44 ? 23   GLN A CG    1 
ATOM   206  C  CD    . GLN A 1 26  ? 57.875 14.486  8.548   1.00 10.97 ? 23   GLN A CD    1 
ATOM   207  O  OE1   . GLN A 1 26  ? 58.334 13.604  7.814   1.00 13.53 ? 23   GLN A OE1   1 
ATOM   208  N  NE2   . GLN A 1 26  ? 58.041 14.482  9.871   1.00 13.48 ? 23   GLN A NE2   1 
ATOM   209  N  N     . ARG A 1 27  ? 57.854 17.262  3.638   1.00 8.82  ? 24   ARG A N     1 
ATOM   210  C  CA    . ARG A 1 27  ? 58.559 17.893  2.532   1.00 10.16 ? 24   ARG A CA    1 
ATOM   211  C  C     . ARG A 1 27  ? 57.977 19.283  2.254   1.00 13.62 ? 24   ARG A C     1 
ATOM   212  O  O     . ARG A 1 27  ? 58.712 20.244  2.067   1.00 11.07 ? 24   ARG A O     1 
ATOM   213  C  CB    . ARG A 1 27  ? 58.486 17.048  1.259   1.00 10.56 ? 24   ARG A CB    1 
ATOM   214  C  CG    . ARG A 1 27  ? 59.301 17.672  0.118   1.00 12.03 ? 24   ARG A CG    1 
ATOM   215  C  CD    . ARG A 1 27  ? 59.326 16.734  -1.094  1.00 11.84 ? 24   ARG A CD    1 
ATOM   216  N  NE    . ARG A 1 27  ? 58.032 16.707  -1.768  1.00 10.11 ? 24   ARG A NE    1 
ATOM   217  C  CZ    . ARG A 1 27  ? 57.815 16.101  -2.930  1.00 9.76  ? 24   ARG A CZ    1 
ATOM   218  N  NH1   . ARG A 1 27  ? 58.818 15.469  -3.545  1.00 9.49  ? 24   ARG A NH1   1 
ATOM   219  N  NH2   . ARG A 1 27  ? 56.618 16.149  -3.491  1.00 12.87 ? 24   ARG A NH2   1 
ATOM   220  N  N     . GLN A 1 28  ? 56.650 19.361  2.234   1.00 9.41  ? 25   GLN A N     1 
ATOM   221  C  CA    . GLN A 1 28  ? 55.938 20.598  1.953   1.00 10.37 ? 25   GLN A CA    1 
ATOM   222  C  C     . GLN A 1 28  ? 56.123 21.647  3.027   1.00 11.56 ? 25   GLN A C     1 
ATOM   223  O  O     . GLN A 1 28  ? 56.212 22.849  2.733   1.00 14.65 ? 25   GLN A O     1 
ATOM   224  C  CB    . GLN A 1 28  ? 54.440 20.329  1.792   1.00 11.89 ? 25   GLN A CB    1 
ATOM   225  C  CG    . GLN A 1 28  ? 53.672 21.516  1.189   1.00 10.88 ? 25   GLN A CG    1 
ATOM   226  C  CD    . GLN A 1 28  ? 52.179 21.227  1.049   1.00 17.76 ? 25   GLN A CD    1 
ATOM   227  O  OE1   . GLN A 1 28  ? 51.792 20.159  0.601   1.00 16.87 ? 25   GLN A OE1   1 
ATOM   228  N  NE2   . GLN A 1 28  ? 51.344 22.180  1.452   1.00 21.78 ? 25   GLN A NE2   1 
ATOM   229  N  N     . ASN A 1 29  ? 56.102 21.197  4.276   1.00 10.05 ? 26   ASN A N     1 
ATOM   230  C  CA    . ASN A 1 29  ? 56.174 22.073  5.432   1.00 11.00 ? 26   ASN A CA    1 
ATOM   231  C  C     . ASN A 1 29  ? 57.336 21.671  6.331   1.00 13.11 ? 26   ASN A C     1 
ATOM   232  O  O     . ASN A 1 29  ? 57.220 20.777  7.180   1.00 11.30 ? 26   ASN A O     1 
ATOM   233  C  CB    . ASN A 1 29  ? 54.841 22.056  6.213   1.00 12.30 ? 26   ASN A CB    1 
ATOM   234  C  CG    . ASN A 1 29  ? 54.836 23.028  7.415   1.00 14.83 ? 26   ASN A CG    1 
ATOM   235  O  OD1   . ASN A 1 29  ? 55.825 23.696  7.702   1.00 13.86 ? 26   ASN A OD1   1 
ATOM   236  N  ND2   . ASN A 1 29  ? 53.704 23.099  8.110   1.00 17.70 ? 26   ASN A ND2   1 
ATOM   237  N  N     . PRO A 1 30  ? 58.478 22.346  6.146   1.00 10.30 ? 27   PRO A N     1 
ATOM   238  C  CA    . PRO A 1 30  ? 59.706 22.103  6.907   1.00 13.72 ? 27   PRO A CA    1 
ATOM   239  C  C     . PRO A 1 30  ? 59.490 22.133  8.425   1.00 12.44 ? 27   PRO A C     1 
ATOM   240  O  O     . PRO A 1 30  ? 60.203 21.433  9.126   1.00 14.10 ? 27   PRO A O     1 
ATOM   241  C  CB    . PRO A 1 30  ? 60.619 23.247  6.459   1.00 16.49 ? 27   PRO A CB    1 
ATOM   242  C  CG    . PRO A 1 30  ? 60.170 23.513  5.040   1.00 13.32 ? 27   PRO A CG    1 
ATOM   243  C  CD    . PRO A 1 30  ? 58.676 23.330  5.066   1.00 10.68 ? 27   PRO A CD    1 
ATOM   244  N  N     . HIS A 1 31  ? 58.502 22.880  8.909   1.00 15.04 ? 28   HIS A N     1 
ATOM   245  C  CA    . HIS A 1 31  ? 58.220 22.928  10.349  1.00 21.49 ? 28   HIS A CA    1 
ATOM   246  C  C     . HIS A 1 31  ? 57.809 21.576  10.924  1.00 18.08 ? 28   HIS A C     1 
ATOM   247  O  O     . HIS A 1 31  ? 57.878 21.380  12.136  1.00 18.32 ? 28   HIS A O     1 
ATOM   248  C  CB    . HIS A 1 31  ? 57.118 23.943  10.659  1.00 20.98 ? 28   HIS A CB    1 
ATOM   249  C  CG    . HIS A 1 31  ? 57.575 25.366  10.609  1.00 25.79 ? 28   HIS A CG    1 
ATOM   250  N  ND1   . HIS A 1 31  ? 56.781 26.385  10.130  1.00 28.96 ? 28   HIS A ND1   1 
ATOM   251  C  CD2   . HIS A 1 31  ? 58.739 25.940  10.988  1.00 25.66 ? 28   HIS A CD2   1 
ATOM   252  C  CE1   . HIS A 1 31  ? 57.439 27.528  10.213  1.00 29.71 ? 28   HIS A CE1   1 
ATOM   253  N  NE2   . HIS A 1 31  ? 58.632 27.286  10.729  1.00 35.68 ? 28   HIS A NE2   1 
ATOM   254  N  N     . LEU A 1 32  ? 57.381 20.649  10.071  1.00 13.34 ? 29   LEU A N     1 
ATOM   255  C  CA    . LEU A 1 32  ? 56.918 19.339  10.551  1.00 12.95 ? 29   LEU A CA    1 
ATOM   256  C  C     . LEU A 1 32  ? 58.043 18.310  10.581  1.00 16.76 ? 29   LEU A C     1 
ATOM   257  O  O     . LEU A 1 32  ? 57.876 17.209  11.135  1.00 13.66 ? 29   LEU A O     1 
ATOM   258  C  CB    . LEU A 1 32  ? 55.770 18.815  9.681   1.00 10.27 ? 29   LEU A CB    1 
ATOM   259  C  CG    . LEU A 1 32  ? 54.540 19.710  9.547   1.00 13.21 ? 29   LEU A CG    1 
ATOM   260  C  CD1   . LEU A 1 32  ? 53.470 19.039  8.688   1.00 12.95 ? 29   LEU A CD1   1 
ATOM   261  C  CD2   . LEU A 1 32  ? 54.001 20.069  10.945  1.00 17.29 ? 29   LEU A CD2   1 
ATOM   262  N  N     . ARG A 1 33  ? 59.192 18.657  9.996   1.00 11.70 ? 30   ARG A N     1 
ATOM   263  C  CA    . ARG A 1 33  ? 60.282 17.697  9.861   1.00 13.50 ? 30   ARG A CA    1 
ATOM   264  C  C     . ARG A 1 33  ? 60.888 17.341  11.211  1.00 12.82 ? 30   ARG A C     1 
ATOM   265  O  O     . ARG A 1 33  ? 61.041 18.198  12.074  1.00 16.71 ? 30   ARG A O     1 
ATOM   266  C  CB    . ARG A 1 33  ? 61.372 18.229  8.929   1.00 14.47 ? 30   ARG A CB    1 
ATOM   267  C  CG    . ARG A 1 33  ? 60.890 18.457  7.507   1.00 11.79 ? 30   ARG A CG    1 
ATOM   268  C  CD    . ARG A 1 33  ? 61.934 19.108  6.611   1.00 13.03 ? 30   ARG A CD    1 
ATOM   269  N  NE    . ARG A 1 33  ? 61.386 19.396  5.280   1.00 17.74 ? 30   ARG A NE    1 
ATOM   270  C  CZ    . ARG A 1 33  ? 62.092 19.902  4.269   1.00 18.33 ? 30   ARG A CZ    1 
ATOM   271  N  NH1   . ARG A 1 33  ? 63.374 20.180  4.432   1.00 18.19 ? 30   ARG A NH1   1 
ATOM   272  N  NH2   . ARG A 1 33  ? 61.518 20.127  3.091   1.00 14.34 ? 30   ARG A NH2   1 
ATOM   273  N  N     . ASN A 1 34  ? 61.205 16.059  11.376  1.00 17.29 ? 31   ASN A N     1 
ATOM   274  C  CA    . ASN A 1 34  ? 61.856 15.559  12.586  1.00 18.74 ? 31   ASN A CA    1 
ATOM   275  C  C     . ASN A 1 34  ? 61.062 15.867  13.843  1.00 17.78 ? 31   ASN A C     1 
ATOM   276  O  O     . ASN A 1 34  ? 61.632 16.213  14.872  1.00 19.53 ? 31   ASN A O     1 
ATOM   277  C  CB    . ASN A 1 34  ? 63.264 16.145  12.712  1.00 16.91 ? 31   ASN A CB    1 
ATOM   278  C  CG    . ASN A 1 34  ? 64.113 15.887  11.484  1.00 23.46 ? 31   ASN A CG    1 
ATOM   279  O  OD1   . ASN A 1 34  ? 64.340 14.738  11.102  1.00 33.56 ? 31   ASN A OD1   1 
ATOM   280  N  ND2   . ASN A 1 34  ? 64.570 16.956  10.849  1.00 24.71 ? 31   ASN A ND2   1 
ATOM   281  N  N     . LYS A 1 35  ? 59.740 15.758  13.735  1.00 13.77 ? 32   LYS A N     1 
ATOM   282  C  CA    . LYS A 1 35  ? 58.820 16.021  14.841  1.00 13.39 ? 32   LYS A CA    1 
ATOM   283  C  C     . LYS A 1 35  ? 57.816 14.887  14.969  1.00 14.23 ? 32   LYS A C     1 
ATOM   284  O  O     . LYS A 1 35  ? 57.545 14.196  13.992  1.00 15.28 ? 32   LYS A O     1 
ATOM   285  C  CB    . LYS A 1 35  ? 58.066 17.339  14.613  1.00 15.54 ? 32   LYS A CB    1 
ATOM   286  C  CG    . LYS A 1 35  ? 58.940 18.581  14.614  1.00 21.92 ? 32   LYS A CG    1 
ATOM   287  C  CD    . LYS A 1 35  ? 58.975 19.231  15.990  1.00 28.56 ? 32   LYS A CD    1 
ATOM   288  C  CE    . LYS A 1 35  ? 60.054 20.311  16.067  1.00 34.53 ? 32   LYS A CE    1 
ATOM   289  N  NZ    . LYS A 1 35  ? 60.271 20.967  14.746  1.00 34.24 ? 32   LYS A NZ    1 
ATOM   290  N  N     . PRO A 1 36  ? 57.252 14.693  16.177  1.00 13.46 ? 33   PRO A N     1 
ATOM   291  C  CA    . PRO A 1 36  ? 56.075 13.830  16.259  1.00 11.26 ? 33   PRO A CA    1 
ATOM   292  C  C     . PRO A 1 36  ? 54.949 14.483  15.459  1.00 13.88 ? 33   PRO A C     1 
ATOM   293  O  O     . PRO A 1 36  ? 54.505 15.585  15.773  1.00 13.96 ? 33   PRO A O     1 
ATOM   294  C  CB    . PRO A 1 36  ? 55.768 13.773  17.761  1.00 15.35 ? 33   PRO A CB    1 
ATOM   295  C  CG    . PRO A 1 36  ? 56.421 14.992  18.346  1.00 17.12 ? 33   PRO A CG    1 
ATOM   296  C  CD    . PRO A 1 36  ? 57.620 15.290  17.477  1.00 11.92 ? 33   PRO A CD    1 
ATOM   297  N  N     A CYS A 1 37  ? 54.520 13.825  14.393  0.62 11.32 ? 34   CYS A N     1 
ATOM   298  N  N     B CYS A 1 37  ? 54.494 13.798  14.416  0.38 11.34 ? 34   CYS A N     1 
ATOM   299  C  CA    A CYS A 1 37  ? 53.419 14.378  13.634  0.62 11.15 ? 34   CYS A CA    1 
ATOM   300  C  CA    B CYS A 1 37  ? 53.555 14.379  13.461  0.38 11.38 ? 34   CYS A CA    1 
ATOM   301  C  C     . CYS A 1 37  ? 52.623 13.293  12.940  1.00 11.07 ? 34   CYS A C     1 
ATOM   302  O  O     . CYS A 1 37  ? 53.041 12.139  12.856  1.00 14.64 ? 34   CYS A O     1 
ATOM   303  C  CB    A CYS A 1 37  ? 53.922 15.415  12.627  0.62 12.99 ? 34   CYS A CB    1 
ATOM   304  C  CB    B CYS A 1 37  ? 54.336 15.042  12.308  0.38 12.75 ? 34   CYS A CB    1 
ATOM   305  S  SG    A CYS A 1 37  ? 54.957 14.751  11.346  0.62 13.91 ? 34   CYS A SG    1 
ATOM   306  S  SG    B CYS A 1 37  ? 53.388 15.759  10.916  0.38 13.92 ? 34   CYS A SG    1 
ATOM   307  N  N     . ALA A 1 38  ? 51.409 13.660  12.546  1.00 10.83 ? 35   ALA A N     1 
ATOM   308  C  CA    . ALA A 1 38  ? 50.516 12.705  11.905  1.00 10.16 ? 35   ALA A CA    1 
ATOM   309  C  C     . ALA A 1 38  ? 49.680 13.402  10.864  1.00 9.96  ? 35   ALA A C     1 
ATOM   310  O  O     . ALA A 1 38  ? 49.542 14.632  10.897  1.00 11.88 ? 35   ALA A O     1 
ATOM   311  C  CB    . ALA A 1 38  ? 49.611 12.019  12.925  1.00 11.94 ? 35   ALA A CB    1 
ATOM   312  N  N     . VAL A 1 39  ? 49.111 12.607  9.959   1.00 10.14 ? 36   VAL A N     1 
ATOM   313  C  CA    . VAL A 1 39  ? 48.186 13.107  8.946   1.00 7.63  ? 36   VAL A CA    1 
ATOM   314  C  C     . VAL A 1 39  ? 46.769 12.660  9.286   1.00 12.06 ? 36   VAL A C     1 
ATOM   315  O  O     . VAL A 1 39  ? 46.528 11.495  9.600   1.00 11.11 ? 36   VAL A O     1 
ATOM   316  C  CB    . VAL A 1 39  ? 48.568 12.629  7.536   1.00 10.51 ? 36   VAL A CB    1 
ATOM   317  C  CG1   . VAL A 1 39  ? 47.483 13.014  6.496   1.00 11.50 ? 36   VAL A CG1   1 
ATOM   318  C  CG2   . VAL A 1 39  ? 49.933 13.212  7.152   1.00 12.68 ? 36   VAL A CG2   1 
ATOM   319  N  N     . VAL A 1 40  ? 45.839 13.611  9.220   1.00 11.93 ? 37   VAL A N     1 
ATOM   320  C  CA    . VAL A 1 40  ? 44.484 13.420  9.699   1.00 11.73 ? 37   VAL A CA    1 
ATOM   321  C  C     . VAL A 1 40  ? 43.491 13.772  8.599   1.00 15.30 ? 37   VAL A C     1 
ATOM   322  O  O     . VAL A 1 40  ? 43.772 14.640  7.762   1.00 16.33 ? 37   VAL A O     1 
ATOM   323  C  CB    . VAL A 1 40  ? 44.218 14.293  10.974  1.00 15.55 ? 37   VAL A CB    1 
ATOM   324  C  CG1   A VAL A 1 40  ? 45.006 13.763  12.153  0.44 13.48 ? 37   VAL A CG1   1 
ATOM   325  C  CG1   B VAL A 1 40  ? 43.998 15.759  10.622  0.56 17.01 ? 37   VAL A CG1   1 
ATOM   326  C  CG2   A VAL A 1 40  ? 44.554 15.760  10.717  0.44 15.89 ? 37   VAL A CG2   1 
ATOM   327  C  CG2   B VAL A 1 40  ? 43.064 13.765  11.737  0.56 15.66 ? 37   VAL A CG2   1 
ATOM   328  N  N     . GLN A 1 41  ? 42.347 13.096  8.570   1.00 13.91 ? 38   GLN A N     1 
ATOM   329  C  CA    . GLN A 1 41  ? 41.296 13.510  7.649   1.00 15.49 ? 38   GLN A CA    1 
ATOM   330  C  C     . GLN A 1 41  ? 40.062 13.861  8.445   1.00 13.81 ? 38   GLN A C     1 
ATOM   331  O  O     . GLN A 1 41  ? 39.698 13.155  9.395   1.00 14.61 ? 38   GLN A O     1 
ATOM   332  C  CB    . GLN A 1 41  ? 40.997 12.450  6.581   1.00 19.36 ? 38   GLN A CB    1 
ATOM   333  C  CG    . GLN A 1 41  ? 40.540 11.095  7.054   1.00 21.58 ? 38   GLN A CG    1 
ATOM   334  C  CD    . GLN A 1 41  ? 40.682 10.041  5.958   1.00 20.26 ? 38   GLN A CD    1 
ATOM   335  O  OE1   . GLN A 1 41  ? 41.099 10.339  4.828   1.00 23.64 ? 38   GLN A OE1   1 
ATOM   336  N  NE2   . GLN A 1 41  ? 40.335 8.812   6.286   1.00 22.83 ? 38   GLN A NE2   1 
ATOM   337  N  N     . TYR A 1 42  ? 39.474 14.992  8.049   1.00 16.73 ? 39   TYR A N     1 
ATOM   338  C  CA    . TYR A 1 42  ? 38.339 15.620  8.712   1.00 15.89 ? 39   TYR A CA    1 
ATOM   339  C  C     . TYR A 1 42  ? 38.845 16.125  10.070  1.00 21.25 ? 39   TYR A C     1 
ATOM   340  O  O     . TYR A 1 42  ? 40.041 16.014  10.373  1.00 23.81 ? 39   TYR A O     1 
ATOM   341  C  CB    . TYR A 1 42  ? 37.149 14.661  8.794   1.00 16.37 ? 39   TYR A CB    1 
ATOM   342  C  CG    . TYR A 1 42  ? 36.756 14.117  7.419   1.00 15.00 ? 39   TYR A CG    1 
ATOM   343  C  CD1   . TYR A 1 42  ? 36.380 14.976  6.394   1.00 22.11 ? 39   TYR A CD1   1 
ATOM   344  C  CD2   . TYR A 1 42  ? 36.785 12.742  7.141   1.00 14.79 ? 39   TYR A CD2   1 
ATOM   345  C  CE1   . TYR A 1 42  ? 36.033 14.499  5.137   1.00 18.67 ? 39   TYR A CE1   1 
ATOM   346  C  CE2   . TYR A 1 42  ? 36.421 12.254  5.876   1.00 15.67 ? 39   TYR A CE2   1 
ATOM   347  C  CZ    . TYR A 1 42  ? 36.057 13.140  4.887   1.00 11.95 ? 39   TYR A CZ    1 
ATOM   348  O  OH    . TYR A 1 42  ? 35.690 12.689  3.638   1.00 14.09 ? 39   TYR A OH    1 
ATOM   349  N  N     . LYS A 1 43  ? 37.983 16.736  10.861  1.00 21.55 ? 40   LYS A N     1 
ATOM   350  C  CA    . LYS A 1 43  ? 38.471 17.456  12.038  1.00 24.16 ? 40   LYS A CA    1 
ATOM   351  C  C     . LYS A 1 43  ? 37.396 17.608  13.092  1.00 30.26 ? 40   LYS A C     1 
ATOM   352  O  O     . LYS A 1 43  ? 37.685 17.625  14.289  1.00 29.75 ? 40   LYS A O     1 
ATOM   353  C  CB    . LYS A 1 43  ? 39.000 18.840  11.636  1.00 20.50 ? 40   LYS A CB    1 
ATOM   354  C  CG    . LYS A 1 43  ? 40.118 19.405  12.538  1.00 41.05 ? 40   LYS A CG    1 
ATOM   355  C  CD    . LYS A 1 43  ? 41.504 18.895  12.109  1.00 33.53 ? 40   LYS A CD    1 
ATOM   356  C  CE    . LYS A 1 43  ? 42.625 19.428  13.004  1.00 33.58 ? 40   LYS A CE    1 
ATOM   357  N  NZ    . LYS A 1 43  ? 42.688 18.738  14.330  1.00 29.82 ? 40   LYS A NZ    1 
ATOM   358  N  N     . SER A 1 44  ? 36.152 17.721  12.639  1.00 24.76 ? 41   SER A N     1 
ATOM   359  C  CA    . SER A 1 44  ? 35.029 17.959  13.529  1.00 27.13 ? 41   SER A CA    1 
ATOM   360  C  C     . SER A 1 44  ? 34.788 16.808  14.496  1.00 28.51 ? 41   SER A C     1 
ATOM   361  O  O     . SER A 1 44  ? 34.488 17.034  15.667  1.00 32.80 ? 41   SER A O     1 
ATOM   362  C  CB    . SER A 1 44  ? 33.766 18.221  12.709  1.00 26.75 ? 41   SER A CB    1 
ATOM   363  O  OG    . SER A 1 44  ? 34.027 19.208  11.728  1.00 39.73 ? 41   SER A OG    1 
ATOM   364  N  N     . TRP A 1 45  ? 34.913 15.576  14.012  1.00 31.19 ? 42   TRP A N     1 
ATOM   365  C  CA    . TRP A 1 45  ? 34.657 14.419  14.869  1.00 30.03 ? 42   TRP A CA    1 
ATOM   366  C  C     . TRP A 1 45  ? 35.953 13.973  15.547  1.00 25.82 ? 42   TRP A C     1 
ATOM   367  O  O     . TRP A 1 45  ? 36.819 13.353  14.923  1.00 24.60 ? 42   TRP A O     1 
ATOM   368  C  CB    . TRP A 1 45  ? 34.027 13.269  14.068  1.00 28.59 ? 42   TRP A CB    1 
ATOM   369  C  CG    . TRP A 1 45  ? 33.550 12.103  14.918  1.00 31.60 ? 42   TRP A CG    1 
ATOM   370  C  CD1   . TRP A 1 45  ? 34.252 10.971  15.226  1.00 22.83 ? 42   TRP A CD1   1 
ATOM   371  C  CD2   . TRP A 1 45  ? 32.272 11.963  15.547  1.00 29.06 ? 42   TRP A CD2   1 
ATOM   372  N  NE1   . TRP A 1 45  ? 33.494 10.139  16.013  1.00 36.16 ? 42   TRP A NE1   1 
ATOM   373  C  CE2   . TRP A 1 45  ? 32.273 10.723  16.227  1.00 38.14 ? 42   TRP A CE2   1 
ATOM   374  C  CE3   . TRP A 1 45  ? 31.126 12.763  15.607  1.00 32.80 ? 42   TRP A CE3   1 
ATOM   375  C  CZ2   . TRP A 1 45  ? 31.173 10.266  16.954  1.00 40.53 ? 42   TRP A CZ2   1 
ATOM   376  C  CZ3   . TRP A 1 45  ? 30.032 12.307  16.333  1.00 39.89 ? 42   TRP A CZ3   1 
ATOM   377  C  CH2   . TRP A 1 45  ? 30.064 11.069  16.994  1.00 36.15 ? 42   TRP A CH2   1 
ATOM   378  N  N     . LYS A 1 46  ? 36.079 14.337  16.821  1.00 27.28 ? 43   LYS A N     1 
ATOM   379  C  CA    . LYS A 1 46  ? 37.192 13.923  17.679  1.00 28.14 ? 43   LYS A CA    1 
ATOM   380  C  C     . LYS A 1 46  ? 38.564 14.314  17.135  1.00 23.10 ? 43   LYS A C     1 
ATOM   381  O  O     . LYS A 1 46  ? 39.570 13.642  17.406  1.00 23.33 ? 43   LYS A O     1 
ATOM   382  C  CB    . LYS A 1 46  ? 37.128 12.415  17.909  1.00 23.61 ? 43   LYS A CB    1 
ATOM   383  C  CG    . LYS A 1 46  ? 35.859 11.958  18.614  1.00 31.56 ? 43   LYS A CG    1 
ATOM   384  C  CD    . LYS A 1 46  ? 35.776 10.445  18.697  1.00 36.04 ? 43   LYS A CD    1 
ATOM   385  C  CE    . LYS A 1 46  ? 34.607 10.014  19.569  1.00 42.79 ? 43   LYS A CE    1 
ATOM   386  N  NZ    . LYS A 1 46  ? 34.523 8.534   19.672  1.00 50.36 ? 43   LYS A NZ    1 
ATOM   387  N  N     . GLY A 1 47  ? 38.604 15.405  16.380  1.00 21.18 ? 44   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 47  ? 39.848 15.998  15.932  1.00 19.50 ? 44   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 47  ? 40.312 15.427  14.612  1.00 18.20 ? 44   GLY A C     1 
ATOM   390  O  O     . GLY A 1 47  ? 41.333 15.845  14.072  1.00 17.16 ? 44   GLY A O     1 
ATOM   391  N  N     . GLY A 1 48  ? 39.552 14.459  14.104  1.00 20.26 ? 45   GLY A N     1 
ATOM   392  C  CA    . GLY A 1 48  ? 39.841 13.839  12.830  1.00 18.13 ? 45   GLY A CA    1 
ATOM   393  C  C     . GLY A 1 48  ? 40.480 12.473  12.991  1.00 21.18 ? 45   GLY A C     1 
ATOM   394  O  O     . GLY A 1 48  ? 41.026 12.141  14.048  1.00 17.53 ? 45   GLY A O     1 
ATOM   395  N  N     . GLY A 1 49  ? 40.453 11.691  11.921  1.00 15.90 ? 46   GLY A N     1 
ATOM   396  C  CA    . GLY A 1 49  ? 40.983 10.339  11.962  1.00 15.15 ? 46   GLY A CA    1 
ATOM   397  C  C     . GLY A 1 49  ? 42.406 10.299  11.448  1.00 14.84 ? 46   GLY A C     1 
ATOM   398  O  O     . GLY A 1 49  ? 42.684 10.787  10.360  1.00 15.38 ? 46   GLY A O     1 
ATOM   399  N  N     . ILE A 1 50  ? 43.301 9.700   12.223  1.00 12.31 ? 47   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 50  ? 44.705 9.612   11.827  1.00 13.61 ? 47   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 50  ? 44.907 8.538   10.757  1.00 12.61 ? 47   ILE A C     1 
ATOM   402  O  O     . ILE A 1 50  ? 44.445 7.415   10.918  1.00 14.23 ? 47   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 50  ? 45.599 9.316   13.053  1.00 12.84 ? 47   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 50  ? 45.684 10.559  13.940  1.00 18.61 ? 47   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 50  ? 46.996 8.844   12.626  1.00 10.19 ? 47   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 50  ? 46.531 10.350  15.157  1.00 20.54 ? 47   ILE A CD1   1 
ATOM   407  N  N     . ILE A 1 51  ? 45.587 8.876   9.662   1.00 9.75  ? 48   ILE A N     1 
ATOM   408  C  CA    . ILE A 1 51  ? 45.845 7.861   8.654   1.00 13.68 ? 48   ILE A CA    1 
ATOM   409  C  C     . ILE A 1 51  ? 47.343 7.626   8.408   1.00 11.88 ? 48   ILE A C     1 
ATOM   410  O  O     . ILE A 1 51  ? 47.697 6.692   7.684   1.00 12.65 ? 48   ILE A O     1 
ATOM   411  C  CB    . ILE A 1 51  ? 45.143 8.172   7.312   1.00 15.66 ? 48   ILE A CB    1 
ATOM   412  C  CG1   . ILE A 1 51  ? 45.544 9.527   6.722   1.00 10.39 ? 48   ILE A CG1   1 
ATOM   413  C  CG2   . ILE A 1 51  ? 43.613 8.106   7.487   1.00 19.62 ? 48   ILE A CG2   1 
ATOM   414  C  CD1   . ILE A 1 51  ? 45.001 9.694   5.263   1.00 15.11 ? 48   ILE A CD1   1 
ATOM   415  N  N     . ALA A 1 52  ? 48.213 8.436   9.023   1.00 10.67 ? 49   ALA A N     1 
ATOM   416  C  CA    . ALA A 1 52  ? 49.673 8.229   8.923   1.00 7.50  ? 49   ALA A CA    1 
ATOM   417  C  C     . ALA A 1 52  ? 50.382 8.889   10.105  1.00 9.02  ? 49   ALA A C     1 
ATOM   418  O  O     . ALA A 1 52  ? 49.954 9.941   10.574  1.00 10.82 ? 49   ALA A O     1 
ATOM   419  C  CB    . ALA A 1 52  ? 50.235 8.771   7.575   1.00 9.05  ? 49   ALA A CB    1 
ATOM   420  N  N     . VAL A 1 53  ? 51.461 8.260   10.582  1.00 8.68  ? 50   VAL A N     1 
ATOM   421  C  CA    . VAL A 1 53  ? 52.118 8.650   11.829  1.00 7.31  ? 50   VAL A CA    1 
ATOM   422  C  C     . VAL A 1 53  ? 53.635 8.633   11.694  1.00 9.19  ? 50   VAL A C     1 
ATOM   423  O  O     . VAL A 1 53  ? 54.205 7.610   11.297  1.00 9.76  ? 50   VAL A O     1 
ATOM   424  C  CB    . VAL A 1 53  ? 51.728 7.679   12.979  1.00 9.48  ? 50   VAL A CB    1 
ATOM   425  C  CG1   . VAL A 1 53  ? 52.277 8.171   14.314  1.00 12.97 ? 50   VAL A CG1   1 
ATOM   426  C  CG2   . VAL A 1 53  ? 50.213 7.482   13.032  1.00 15.42 ? 50   VAL A CG2   1 
ATOM   427  N  N     . SER A 1 54  ? 54.304 9.720   12.066  1.00 9.59  ? 51   SER A N     1 
ATOM   428  C  CA    . SER A 1 54  ? 55.767 9.753   11.985  1.00 8.28  ? 51   SER A CA    1 
ATOM   429  C  C     . SER A 1 54  ? 56.361 8.846   13.049  1.00 10.62 ? 51   SER A C     1 
ATOM   430  O  O     . SER A 1 54  ? 55.712 8.562   14.058  1.00 10.72 ? 51   SER A O     1 
ATOM   431  C  CB    . SER A 1 54  ? 56.305 11.177  12.150  1.00 11.14 ? 51   SER A CB    1 
ATOM   432  O  OG    . SER A 1 54  ? 56.319 11.572  13.517  1.00 11.23 ? 51   SER A OG    1 
ATOM   433  N  N     . TYR A 1 55  ? 57.592 8.391   12.826  1.00 12.10 ? 52   TYR A N     1 
ATOM   434  C  CA    . TYR A 1 55  ? 58.221 7.473   13.775  1.00 14.19 ? 52   TYR A CA    1 
ATOM   435  C  C     . TYR A 1 55  ? 58.446 8.130   15.140  1.00 12.84 ? 52   TYR A C     1 
ATOM   436  O  O     . TYR A 1 55  ? 58.366 7.455   16.162  1.00 13.29 ? 52   TYR A O     1 
ATOM   437  C  CB    . TYR A 1 55  ? 59.526 6.912   13.189  1.00 11.32 ? 52   TYR A CB    1 
ATOM   438  C  CG    . TYR A 1 55  ? 59.211 5.811   12.204  1.00 13.47 ? 52   TYR A CG    1 
ATOM   439  C  CD1   . TYR A 1 55  ? 58.830 6.110   10.906  1.00 9.47  ? 52   TYR A CD1   1 
ATOM   440  C  CD2   . TYR A 1 55  ? 59.218 4.480   12.590  1.00 15.44 ? 52   TYR A CD2   1 
ATOM   441  C  CE1   . TYR A 1 55  ? 58.469 5.114   10.012  1.00 10.63 ? 52   TYR A CE1   1 
ATOM   442  C  CE2   . TYR A 1 55  ? 58.870 3.469   11.701  1.00 11.42 ? 52   TYR A CE2   1 
ATOM   443  C  CZ    . TYR A 1 55  ? 58.502 3.783   10.410  1.00 12.17 ? 52   TYR A CZ    1 
ATOM   444  O  OH    . TYR A 1 55  ? 58.152 2.782   9.508   1.00 16.48 ? 52   TYR A OH    1 
ATOM   445  N  N     . GLU A 1 56  ? 58.678 9.438   15.155  1.00 14.96 ? 53   GLU A N     1 
ATOM   446  C  CA    . GLU A 1 56  ? 58.767 10.153  16.428  1.00 13.84 ? 53   GLU A CA    1 
ATOM   447  C  C     . GLU A 1 56  ? 57.455 10.057  17.200  1.00 14.61 ? 53   GLU A C     1 
ATOM   448  O  O     . GLU A 1 56  ? 57.466 9.933   18.417  1.00 14.40 ? 53   GLU A O     1 
ATOM   449  C  CB    . GLU A 1 56  ? 59.130 11.620  16.217  1.00 14.31 ? 53   GLU A CB    1 
ATOM   450  C  CG    . GLU A 1 56  ? 60.500 11.859  15.613  1.00 17.02 ? 53   GLU A CG    1 
ATOM   451  C  CD    . GLU A 1 56  ? 60.556 11.776  14.080  1.00 19.97 ? 53   GLU A CD    1 
ATOM   452  O  OE1   . GLU A 1 56  ? 59.596 11.301  13.426  1.00 19.34 ? 53   GLU A OE1   1 
ATOM   453  O  OE2   . GLU A 1 56  ? 61.591 12.195  13.523  1.00 27.66 ? 53   GLU A OE2   1 
ATOM   454  N  N     . ALA A 1 57  ? 56.323 10.145  16.504  1.00 9.91  ? 54   ALA A N     1 
ATOM   455  C  CA    . ALA A 1 57  ? 55.027 10.046  17.175  1.00 9.62  ? 54   ALA A CA    1 
ATOM   456  C  C     . ALA A 1 57  ? 54.699 8.595   17.571  1.00 13.44 ? 54   ALA A C     1 
ATOM   457  O  O     . ALA A 1 57  ? 53.995 8.358   18.548  1.00 13.92 ? 54   ALA A O     1 
ATOM   458  C  CB    . ALA A 1 57  ? 53.914 10.627  16.282  1.00 13.31 ? 54   ALA A CB    1 
ATOM   459  N  N     . ARG A 1 58  ? 55.197 7.626   16.813  1.00 12.17 ? 55   ARG A N     1 
ATOM   460  C  CA    . ARG A 1 58  ? 54.905 6.224   17.152  1.00 12.66 ? 55   ARG A CA    1 
ATOM   461  C  C     . ARG A 1 58  ? 55.511 5.884   18.509  1.00 15.27 ? 55   ARG A C     1 
ATOM   462  O  O     . ARG A 1 58  ? 54.998 5.022   19.220  1.00 16.05 ? 55   ARG A O     1 
ATOM   463  C  CB    . ARG A 1 58  ? 55.441 5.270   16.082  1.00 10.07 ? 55   ARG A CB    1 
ATOM   464  C  CG    . ARG A 1 58  ? 54.857 5.537   14.722  1.00 14.16 ? 55   ARG A CG    1 
ATOM   465  C  CD    . ARG A 1 58  ? 55.309 4.544   13.701  1.00 12.58 ? 55   ARG A CD    1 
ATOM   466  N  NE    . ARG A 1 58  ? 54.870 4.985   12.376  1.00 14.45 ? 55   ARG A NE    1 
ATOM   467  C  CZ    . ARG A 1 58  ? 54.933 4.259   11.274  1.00 15.79 ? 55   ARG A CZ    1 
ATOM   468  N  NH1   . ARG A 1 58  ? 55.426 3.026   11.310  1.00 14.44 ? 55   ARG A NH1   1 
ATOM   469  N  NH2   . ARG A 1 58  ? 54.500 4.780   10.126  1.00 14.49 ? 55   ARG A NH2   1 
ATOM   470  N  N     . ALA A 1 59  ? 56.604 6.561   18.852  1.00 13.76 ? 56   ALA A N     1 
ATOM   471  C  CA    . ALA A 1 59  ? 57.287 6.309   20.120  1.00 13.82 ? 56   ALA A CA    1 
ATOM   472  C  C     . ALA A 1 59  ? 56.390 6.650   21.309  1.00 16.72 ? 56   ALA A C     1 
ATOM   473  O  O     . ALA A 1 59  ? 56.565 6.102   22.399  1.00 18.56 ? 56   ALA A O     1 
ATOM   474  C  CB    . ALA A 1 59  ? 58.609 7.102   20.193  1.00 14.10 ? 56   ALA A CB    1 
ATOM   475  N  N     . PHE A 1 60  ? 55.423 7.539   21.099  1.00 14.69 ? 57   PHE A N     1 
ATOM   476  C  CA    . PHE A 1 60  ? 54.473 7.907   22.148  1.00 14.29 ? 57   PHE A CA    1 
ATOM   477  C  C     . PHE A 1 60  ? 53.271 6.972   22.176  1.00 14.17 ? 57   PHE A C     1 
ATOM   478  O  O     . PHE A 1 60  ? 52.402 7.093   23.044  1.00 17.90 ? 57   PHE A O     1 
ATOM   479  C  CB    . PHE A 1 60  ? 53.965 9.350   21.958  1.00 14.16 ? 57   PHE A CB    1 
ATOM   480  C  CG    . PHE A 1 60  ? 54.971 10.416  22.281  1.00 14.31 ? 57   PHE A CG    1 
ATOM   481  C  CD1   . PHE A 1 60  ? 54.910 11.110  23.489  1.00 19.26 ? 57   PHE A CD1   1 
ATOM   482  C  CD2   . PHE A 1 60  ? 55.968 10.751  21.378  1.00 13.62 ? 57   PHE A CD2   1 
ATOM   483  C  CE1   . PHE A 1 60  ? 55.831 12.116  23.786  1.00 22.12 ? 57   PHE A CE1   1 
ATOM   484  C  CE2   . PHE A 1 60  ? 56.883 11.752  21.666  1.00 20.55 ? 57   PHE A CE2   1 
ATOM   485  C  CZ    . PHE A 1 60  ? 56.818 12.433  22.875  1.00 22.73 ? 57   PHE A CZ    1 
ATOM   486  N  N     . GLY A 1 61  ? 53.187 6.074   21.195  1.00 13.37 ? 58   GLY A N     1 
ATOM   487  C  CA    . GLY A 1 61  ? 52.075 5.141   21.085  1.00 15.60 ? 58   GLY A CA    1 
ATOM   488  C  C     . GLY A 1 61  ? 50.977 5.576   20.125  1.00 17.40 ? 58   GLY A C     1 
ATOM   489  O  O     . GLY A 1 61  ? 49.894 4.981   20.094  1.00 15.53 ? 58   GLY A O     1 
ATOM   490  N  N     . VAL A 1 62  ? 51.243 6.622   19.344  1.00 12.54 ? 59   VAL A N     1 
ATOM   491  C  CA    . VAL A 1 62  ? 50.272 7.101   18.354  1.00 14.92 ? 59   VAL A CA    1 
ATOM   492  C  C     . VAL A 1 62  ? 50.185 6.102   17.195  1.00 15.68 ? 59   VAL A C     1 
ATOM   493  O  O     . VAL A 1 62  ? 51.210 5.642   16.682  1.00 14.10 ? 59   VAL A O     1 
ATOM   494  C  CB    . VAL A 1 62  ? 50.644 8.523   17.844  1.00 11.73 ? 59   VAL A CB    1 
ATOM   495  C  CG1   . VAL A 1 62  ? 49.610 9.018   16.818  1.00 14.67 ? 59   VAL A CG1   1 
ATOM   496  C  CG2   . VAL A 1 62  ? 50.699 9.503   19.017  1.00 13.60 ? 59   VAL A CG2   1 
ATOM   497  N  N     . THR A 1 63  ? 48.963 5.744   16.796  1.00 16.49 ? 60   THR A N     1 
ATOM   498  C  CA    . THR A 1 63  ? 48.781 4.796   15.705  1.00 16.86 ? 60   THR A CA    1 
ATOM   499  C  C     . THR A 1 63  ? 47.751 5.259   14.694  1.00 20.39 ? 60   THR A C     1 
ATOM   500  O  O     . THR A 1 63  ? 46.915 6.109   14.986  1.00 17.77 ? 60   THR A O     1 
ATOM   501  C  CB    . THR A 1 63  ? 48.335 3.414   16.209  1.00 19.05 ? 60   THR A CB    1 
ATOM   502  O  OG1   . THR A 1 63  ? 47.016 3.514   16.765  1.00 21.24 ? 60   THR A OG1   1 
ATOM   503  C  CG2   . THR A 1 63  ? 49.305 2.880   17.261  1.00 18.40 ? 60   THR A CG2   1 
ATOM   504  N  N     . ARG A 1 64  ? 47.802 4.670   13.504  1.00 13.27 ? 61   ARG A N     1 
ATOM   505  C  CA    . ARG A 1 64  ? 46.739 4.839   12.522  1.00 22.54 ? 61   ARG A CA    1 
ATOM   506  C  C     . ARG A 1 64  ? 45.383 4.388   13.096  1.00 19.46 ? 61   ARG A C     1 
ATOM   507  O  O     . ARG A 1 64  ? 45.332 3.446   13.889  1.00 19.56 ? 61   ARG A O     1 
ATOM   508  C  CB    . ARG A 1 64  ? 47.093 4.057   11.247  1.00 20.54 ? 61   ARG A CB    1 
ATOM   509  C  CG    A ARG A 1 64  ? 45.959 3.784   10.285  0.60 25.71 ? 61   ARG A CG    1 
ATOM   510  C  CG    B ARG A 1 64  ? 46.071 4.214   10.123  0.40 23.26 ? 61   ARG A CG    1 
ATOM   511  C  CD    A ARG A 1 64  ? 46.506 3.070   9.055   0.60 24.47 ? 61   ARG A CD    1 
ATOM   512  C  CD    B ARG A 1 64  ? 46.388 3.279   8.971   0.40 24.13 ? 61   ARG A CD    1 
ATOM   513  N  NE    A ARG A 1 64  ? 47.555 3.874   8.440   0.60 17.51 ? 61   ARG A NE    1 
ATOM   514  N  NE    B ARG A 1 64  ? 46.900 2.004   9.463   0.40 25.47 ? 61   ARG A NE    1 
ATOM   515  C  CZ    A ARG A 1 64  ? 48.755 3.432   8.073   0.60 17.08 ? 61   ARG A CZ    1 
ATOM   516  C  CZ    B ARG A 1 64  ? 46.149 0.940   9.729   0.40 26.06 ? 61   ARG A CZ    1 
ATOM   517  N  NH1   A ARG A 1 64  ? 49.092 2.155   8.225   0.60 21.43 ? 61   ARG A NH1   1 
ATOM   518  N  NH1   B ARG A 1 64  ? 44.836 0.978   9.538   0.40 25.08 ? 61   ARG A NH1   1 
ATOM   519  N  NH2   A ARG A 1 64  ? 49.619 4.277   7.526   0.60 13.77 ? 61   ARG A NH2   1 
ATOM   520  N  NH2   B ARG A 1 64  ? 46.718 -0.169  10.177  0.40 27.76 ? 61   ARG A NH2   1 
ATOM   521  N  N     . SER A 1 65  ? 44.313 5.082   12.695  1.00 19.49 ? 62   SER A N     1 
ATOM   522  C  CA    . SER A 1 65  ? 42.907 4.838   13.094  1.00 25.30 ? 62   SER A CA    1 
ATOM   523  C  C     . SER A 1 65  ? 42.528 5.516   14.410  1.00 24.69 ? 62   SER A C     1 
ATOM   524  O  O     . SER A 1 65  ? 41.354 5.589   14.766  1.00 30.75 ? 62   SER A O     1 
ATOM   525  C  CB    . SER A 1 65  ? 42.588 3.349   13.206  1.00 29.61 ? 62   SER A CB    1 
ATOM   526  O  OG    . SER A 1 65  ? 42.938 2.862   14.489  1.00 39.00 ? 62   SER A OG    1 
ATOM   527  N  N     . MET A 1 66  ? 43.530 6.004   15.126  1.00 23.99 ? 63   MET A N     1 
ATOM   528  C  CA    . MET A 1 66  ? 43.312 6.762   16.342  1.00 19.94 ? 63   MET A CA    1 
ATOM   529  C  C     . MET A 1 66  ? 42.684 8.104   15.984  1.00 22.89 ? 63   MET A C     1 
ATOM   530  O  O     . MET A 1 66  ? 43.042 8.707   14.967  1.00 17.42 ? 63   MET A O     1 
ATOM   531  C  CB    . MET A 1 66  ? 44.643 6.953   17.058  1.00 17.73 ? 63   MET A CB    1 
ATOM   532  C  CG    . MET A 1 66  ? 44.629 7.196   18.523  1.00 28.69 ? 63   MET A CG    1 
ATOM   533  S  SD    . MET A 1 66  ? 46.343 6.988   19.052  1.00 22.57 ? 63   MET A SD    1 
ATOM   534  C  CE    . MET A 1 66  ? 46.406 5.259   19.476  1.00 23.88 ? 63   MET A CE    1 
ATOM   535  N  N     . TRP A 1 67  ? 41.738 8.558   16.801  1.00 16.51 ? 64   TRP A N     1 
ATOM   536  C  CA    . TRP A 1 67  ? 41.232 9.927   16.686  1.00 16.82 ? 64   TRP A CA    1 
ATOM   537  C  C     . TRP A 1 67  ? 42.323 10.887  17.134  1.00 14.98 ? 64   TRP A C     1 
ATOM   538  O  O     . TRP A 1 67  ? 43.019 10.603  18.106  1.00 16.64 ? 64   TRP A O     1 
ATOM   539  C  CB    . TRP A 1 67  ? 39.961 10.122  17.526  1.00 19.22 ? 64   TRP A CB    1 
ATOM   540  C  CG    . TRP A 1 67  ? 38.844 9.256   17.072  1.00 19.96 ? 64   TRP A CG    1 
ATOM   541  C  CD1   . TRP A 1 67  ? 38.247 8.248   17.769  1.00 23.50 ? 64   TRP A CD1   1 
ATOM   542  C  CD2   . TRP A 1 67  ? 38.211 9.290   15.789  1.00 23.13 ? 64   TRP A CD2   1 
ATOM   543  N  NE1   . TRP A 1 67  ? 37.268 7.660   17.000  1.00 25.70 ? 64   TRP A NE1   1 
ATOM   544  C  CE2   . TRP A 1 67  ? 37.230 8.282   15.779  1.00 27.09 ? 64   TRP A CE2   1 
ATOM   545  C  CE3   . TRP A 1 67  ? 38.379 10.083  14.648  1.00 15.60 ? 64   TRP A CE3   1 
ATOM   546  C  CZ2   . TRP A 1 67  ? 36.414 8.044   14.672  1.00 27.44 ? 64   TRP A CZ2   1 
ATOM   547  C  CZ3   . TRP A 1 67  ? 37.565 9.842   13.545  1.00 21.55 ? 64   TRP A CZ3   1 
ATOM   548  C  CH2   . TRP A 1 67  ? 36.601 8.832   13.569  1.00 23.17 ? 64   TRP A CH2   1 
ATOM   549  N  N     . ALA A 1 68  ? 42.492 12.013  16.436  1.00 13.15 ? 65   ALA A N     1 
ATOM   550  C  CA    . ALA A 1 68  ? 43.540 12.954  16.823  1.00 17.45 ? 65   ALA A CA    1 
ATOM   551  C  C     . ALA A 1 68  ? 43.378 13.432  18.275  1.00 17.47 ? 65   ALA A C     1 
ATOM   552  O  O     . ALA A 1 68  ? 44.371 13.661  18.950  1.00 15.26 ? 65   ALA A O     1 
ATOM   553  C  CB    . ALA A 1 68  ? 43.575 14.155  15.878  1.00 12.43 ? 65   ALA A CB    1 
ATOM   554  N  N     . ASP A 1 69  ? 42.146 13.580  18.758  1.00 15.48 ? 66   ASP A N     1 
ATOM   555  C  CA    . ASP A 1 69  ? 41.965 14.037  20.142  1.00 16.34 ? 66   ASP A CA    1 
ATOM   556  C  C     . ASP A 1 69  ? 42.575 13.023  21.106  1.00 17.05 ? 66   ASP A C     1 
ATOM   557  O  O     . ASP A 1 69  ? 43.125 13.377  22.160  1.00 15.84 ? 66   ASP A O     1 
ATOM   558  C  CB    . ASP A 1 69  ? 40.484 14.251  20.484  1.00 22.86 ? 66   ASP A CB    1 
ATOM   559  C  CG    . ASP A 1 69  ? 39.894 15.486  19.828  1.00 25.98 ? 66   ASP A CG    1 
ATOM   560  O  OD1   . ASP A 1 69  ? 40.645 16.286  19.225  1.00 23.54 ? 66   ASP A OD1   1 
ATOM   561  O  OD2   . ASP A 1 69  ? 38.663 15.650  19.925  1.00 26.56 ? 66   ASP A OD2   1 
ATOM   562  N  N     . ASP A 1 70  ? 42.470 11.754  20.742  1.00 13.94 ? 67   ASP A N     1 
ATOM   563  C  CA    . ASP A 1 70  ? 42.961 10.682  21.597  1.00 14.87 ? 67   ASP A CA    1 
ATOM   564  C  C     . ASP A 1 70  ? 44.473 10.576  21.461  1.00 14.54 ? 67   ASP A C     1 
ATOM   565  O  O     . ASP A 1 70  ? 45.186 10.368  22.444  1.00 14.14 ? 67   ASP A O     1 
ATOM   566  C  CB    . ASP A 1 70  ? 42.283 9.363   21.241  1.00 17.55 ? 67   ASP A CB    1 
ATOM   567  C  CG    . ASP A 1 70  ? 40.796 9.381   21.548  1.00 22.29 ? 67   ASP A CG    1 
ATOM   568  O  OD1   . ASP A 1 70  ? 40.381 10.132  22.463  1.00 19.20 ? 67   ASP A OD1   1 
ATOM   569  O  OD2   . ASP A 1 70  ? 40.044 8.658   20.866  1.00 23.55 ? 67   ASP A OD2   1 
ATOM   570  N  N     . ALA A 1 71  ? 44.965 10.748  20.237  1.00 12.93 ? 68   ALA A N     1 
ATOM   571  C  CA    . ALA A 1 71  ? 46.405 10.767  20.009  1.00 15.89 ? 68   ALA A CA    1 
ATOM   572  C  C     . ALA A 1 71  ? 47.072 11.859  20.841  1.00 12.41 ? 68   ALA A C     1 
ATOM   573  O  O     . ALA A 1 71  ? 48.177 11.668  21.343  1.00 16.71 ? 68   ALA A O     1 
ATOM   574  C  CB    . ALA A 1 71  ? 46.718 10.975  18.526  1.00 11.66 ? 68   ALA A CB    1 
ATOM   575  N  N     . LYS A 1 72  ? 46.398 13.002  20.962  1.00 13.23 ? 69   LYS A N     1 
ATOM   576  C  CA    . LYS A 1 72  ? 46.928 14.135  21.710  1.00 13.37 ? 69   LYS A CA    1 
ATOM   577  C  C     . LYS A 1 72  ? 47.047 13.823  23.196  1.00 17.52 ? 69   LYS A C     1 
ATOM   578  O  O     . LYS A 1 72  ? 47.851 14.425  23.906  1.00 14.54 ? 69   LYS A O     1 
ATOM   579  C  CB    . LYS A 1 72  ? 46.047 15.372  21.504  1.00 18.37 ? 69   LYS A CB    1 
ATOM   580  C  CG    . LYS A 1 72  ? 46.369 16.147  20.231  1.00 17.80 ? 69   LYS A CG    1 
ATOM   581  C  CD    . LYS A 1 72  ? 47.621 16.998  20.448  1.00 22.92 ? 69   LYS A CD    1 
ATOM   582  C  CE    . LYS A 1 72  ? 47.774 18.085  19.405  1.00 24.65 ? 69   LYS A CE    1 
ATOM   583  N  NZ    . LYS A 1 72  ? 49.030 18.879  19.654  1.00 17.49 ? 69   LYS A NZ    1 
ATOM   584  N  N     . LYS A 1 73  ? 46.237 12.881  23.668  1.00 16.29 ? 70   LYS A N     1 
ATOM   585  C  CA    . LYS A 1 73  ? 46.328 12.464  25.062  1.00 16.03 ? 70   LYS A CA    1 
ATOM   586  C  C     . LYS A 1 73  ? 47.656 11.734  25.295  1.00 17.56 ? 70   LYS A C     1 
ATOM   587  O  O     . LYS A 1 73  ? 48.262 11.863  26.355  1.00 17.57 ? 70   LYS A O     1 
ATOM   588  C  CB    . LYS A 1 73  ? 45.127 11.589  25.420  1.00 10.54 ? 70   LYS A CB    1 
ATOM   589  C  CG    . LYS A 1 73  ? 43.798 12.281  25.191  1.00 11.88 ? 70   LYS A CG    1 
ATOM   590  C  CD    . LYS A 1 73  ? 42.635 11.314  25.396  1.00 10.97 ? 70   LYS A CD    1 
ATOM   591  C  CE    . LYS A 1 73  ? 41.306 12.009  25.130  1.00 20.60 ? 70   LYS A CE    1 
ATOM   592  N  NZ    . LYS A 1 73  ? 40.216 11.012  25.063  1.00 21.36 ? 70   LYS A NZ    1 
ATOM   593  N  N     . LEU A 1 74  ? 48.119 10.992  24.289  1.00 14.16 ? 71   LEU A N     1 
ATOM   594  C  CA    . LEU A 1 74  ? 49.405 10.279  24.388  1.00 16.00 ? 71   LEU A CA    1 
ATOM   595  C  C     . LEU A 1 74  ? 50.591 11.185  24.082  1.00 16.96 ? 71   LEU A C     1 
ATOM   596  O  O     . LEU A 1 74  ? 51.697 11.006  24.606  1.00 17.30 ? 71   LEU A O     1 
ATOM   597  C  CB    . LEU A 1 74  ? 49.447 9.090   23.423  1.00 12.15 ? 71   LEU A CB    1 
ATOM   598  C  CG    . LEU A 1 74  ? 48.389 7.998   23.539  1.00 17.90 ? 71   LEU A CG    1 
ATOM   599  C  CD1   . LEU A 1 74  ? 48.622 6.954   22.450  1.00 14.52 ? 71   LEU A CD1   1 
ATOM   600  C  CD2   . LEU A 1 74  ? 48.467 7.366   24.914  1.00 15.64 ? 71   LEU A CD2   1 
ATOM   601  N  N     . CYS A 1 75  ? 50.354 12.139  23.193  1.00 14.59 ? 72   CYS A N     1 
ATOM   602  C  CA    . CYS A 1 75  ? 51.408 12.984  22.661  1.00 14.51 ? 72   CYS A CA    1 
ATOM   603  C  C     . CYS A 1 75  ? 50.896 14.420  22.550  1.00 16.92 ? 72   CYS A C     1 
ATOM   604  O  O     . CYS A 1 75  ? 50.409 14.836  21.503  1.00 15.95 ? 72   CYS A O     1 
ATOM   605  C  CB    . CYS A 1 75  ? 51.860 12.447  21.310  1.00 15.10 ? 72   CYS A CB    1 
ATOM   606  S  SG    . CYS A 1 75  ? 53.214 13.369  20.554  1.00 17.53 ? 72   CYS A SG    1 
ATOM   607  N  N     . PRO A 1 76  ? 50.991 15.184  23.645  1.00 16.62 ? 73   PRO A N     1 
ATOM   608  C  CA    . PRO A 1 76  ? 50.380 16.518  23.678  1.00 18.95 ? 73   PRO A CA    1 
ATOM   609  C  C     . PRO A 1 76  ? 50.983 17.478  22.651  1.00 14.24 ? 73   PRO A C     1 
ATOM   610  O  O     . PRO A 1 76  ? 50.298 18.411  22.218  1.00 21.82 ? 73   PRO A O     1 
ATOM   611  C  CB    . PRO A 1 76  ? 50.662 16.993  25.109  1.00 22.50 ? 73   PRO A CB    1 
ATOM   612  C  CG    . PRO A 1 76  ? 50.821 15.727  25.892  1.00 27.69 ? 73   PRO A CG    1 
ATOM   613  C  CD    . PRO A 1 76  ? 51.520 14.781  24.959  1.00 19.40 ? 73   PRO A CD    1 
ATOM   614  N  N     . ASP A 1 77  ? 52.233 17.253  22.269  1.00 16.40 ? 74   ASP A N     1 
ATOM   615  C  CA    . ASP A 1 77  ? 52.880 18.131  21.286  1.00 19.65 ? 74   ASP A CA    1 
ATOM   616  C  C     . ASP A 1 77  ? 52.795 17.619  19.851  1.00 19.23 ? 74   ASP A C     1 
ATOM   617  O  O     . ASP A 1 77  ? 53.446 18.178  18.965  1.00 17.58 ? 74   ASP A O     1 
ATOM   618  C  CB    . ASP A 1 77  ? 54.348 18.343  21.645  1.00 20.37 ? 74   ASP A CB    1 
ATOM   619  C  CG    . ASP A 1 77  ? 54.527 19.118  22.930  1.00 35.32 ? 74   ASP A CG    1 
ATOM   620  O  OD1   . ASP A 1 77  ? 55.313 18.664  23.789  1.00 35.77 ? 74   ASP A OD1   1 
ATOM   621  O  OD2   . ASP A 1 77  ? 53.885 20.179  23.078  1.00 35.60 ? 74   ASP A OD2   1 
ATOM   622  N  N     . LEU A 1 78  ? 52.002 16.570  19.623  1.00 13.58 ? 75   LEU A N     1 
ATOM   623  C  CA    . LEU A 1 78  ? 51.781 16.033  18.269  1.00 13.16 ? 75   LEU A CA    1 
ATOM   624  C  C     . LEU A 1 78  ? 51.401 17.113  17.273  1.00 16.46 ? 75   LEU A C     1 
ATOM   625  O  O     . LEU A 1 78  ? 50.447 17.855  17.498  1.00 14.57 ? 75   LEU A O     1 
ATOM   626  C  CB    . LEU A 1 78  ? 50.672 14.974  18.293  1.00 14.56 ? 75   LEU A CB    1 
ATOM   627  C  CG    . LEU A 1 78  ? 50.338 14.245  16.989  1.00 11.03 ? 75   LEU A CG    1 
ATOM   628  C  CD1   . LEU A 1 78  ? 51.513 13.354  16.542  1.00 13.70 ? 75   LEU A CD1   1 
ATOM   629  C  CD2   . LEU A 1 78  ? 49.090 13.418  17.208  1.00 14.66 ? 75   LEU A CD2   1 
ATOM   630  N  N     . LEU A 1 79  ? 52.131 17.188  16.163  1.00 13.05 ? 76   LEU A N     1 
ATOM   631  C  CA    . LEU A 1 79  ? 51.759 18.114  15.099  1.00 9.89  ? 76   LEU A CA    1 
ATOM   632  C  C     . LEU A 1 79  ? 50.878 17.400  14.083  1.00 16.11 ? 76   LEU A C     1 
ATOM   633  O  O     . LEU A 1 79  ? 51.023 16.208  13.856  1.00 15.45 ? 76   LEU A O     1 
ATOM   634  C  CB    . LEU A 1 79  ? 53.003 18.686  14.422  1.00 8.52  ? 76   LEU A CB    1 
ATOM   635  C  CG    . LEU A 1 79  ? 53.957 19.436  15.353  1.00 13.35 ? 76   LEU A CG    1 
ATOM   636  C  CD1   . LEU A 1 79  ? 55.141 19.987  14.589  1.00 11.33 ? 76   LEU A CD1   1 
ATOM   637  C  CD2   . LEU A 1 79  ? 53.213 20.565  16.095  1.00 14.70 ? 76   LEU A CD2   1 
ATOM   638  N  N     . LEU A 1 80  ? 49.970 18.137  13.459  1.00 12.31 ? 77   LEU A N     1 
ATOM   639  C  CA    . LEU A 1 80  ? 49.022 17.531  12.542  1.00 15.12 ? 77   LEU A CA    1 
ATOM   640  C  C     . LEU A 1 80  ? 49.027 18.235  11.197  1.00 16.32 ? 77   LEU A C     1 
ATOM   641  O  O     . LEU A 1 80  ? 49.191 19.457  11.113  1.00 20.60 ? 77   LEU A O     1 
ATOM   642  C  CB    . LEU A 1 80  ? 47.620 17.561  13.135  1.00 12.56 ? 77   LEU A CB    1 
ATOM   643  C  CG    . LEU A 1 80  ? 47.402 16.762  14.414  1.00 13.23 ? 77   LEU A CG    1 
ATOM   644  C  CD1   . LEU A 1 80  ? 45.975 16.935  14.937  1.00 17.00 ? 77   LEU A CD1   1 
ATOM   645  C  CD2   . LEU A 1 80  ? 47.704 15.271  14.179  1.00 15.49 ? 77   LEU A CD2   1 
ATOM   646  N  N     . ALA A 1 81  ? 48.860 17.449  10.145  1.00 12.23 ? 78   ALA A N     1 
ATOM   647  C  CA    . ALA A 1 81  ? 48.601 17.968  8.809   1.00 11.54 ? 78   ALA A CA    1 
ATOM   648  C  C     . ALA A 1 81  ? 47.295 17.357  8.318   1.00 14.23 ? 78   ALA A C     1 
ATOM   649  O  O     . ALA A 1 81  ? 47.060 16.161  8.473   1.00 13.67 ? 78   ALA A O     1 
ATOM   650  C  CB    . ALA A 1 81  ? 49.748 17.644  7.853   1.00 16.84 ? 78   ALA A CB    1 
ATOM   651  N  N     . GLN A 1 82  ? 46.448 18.189  7.721   1.00 15.41 ? 79   GLN A N     1 
ATOM   652  C  CA    . GLN A 1 82  ? 45.124 17.756  7.288   1.00 17.80 ? 79   GLN A CA    1 
ATOM   653  C  C     . GLN A 1 82  ? 45.092 17.394  5.823   1.00 11.27 ? 79   GLN A C     1 
ATOM   654  O  O     . GLN A 1 82  ? 45.678 18.099  4.994   1.00 14.13 ? 79   GLN A O     1 
ATOM   655  C  CB    . GLN A 1 82  ? 44.098 18.857  7.535   1.00 18.10 ? 79   GLN A CB    1 
ATOM   656  C  CG    . GLN A 1 82  ? 43.768 19.115  8.971   1.00 32.68 ? 79   GLN A CG    1 
ATOM   657  C  CD    . GLN A 1 82  ? 42.639 20.105  9.084   1.00 35.63 ? 79   GLN A CD    1 
ATOM   658  O  OE1   . GLN A 1 82  ? 42.864 21.299  9.281   1.00 34.53 ? 79   GLN A OE1   1 
ATOM   659  N  NE2   . GLN A 1 82  ? 41.410 19.619  8.921   1.00 31.70 ? 79   GLN A NE2   1 
ATOM   660  N  N     . VAL A 1 83  ? 44.403 16.298  5.514   1.00 13.15 ? 80   VAL A N     1 
ATOM   661  C  CA    . VAL A 1 83  ? 44.089 15.951  4.144   1.00 12.63 ? 80   VAL A CA    1 
ATOM   662  C  C     . VAL A 1 83  ? 43.189 17.019  3.556   1.00 13.89 ? 80   VAL A C     1 
ATOM   663  O  O     . VAL A 1 83  ? 42.265 17.502  4.206   1.00 14.47 ? 80   VAL A O     1 
ATOM   664  C  CB    . VAL A 1 83  ? 43.402 14.573  4.052   1.00 13.73 ? 80   VAL A CB    1 
ATOM   665  C  CG1   . VAL A 1 83  ? 42.956 14.275  2.634   1.00 13.38 ? 80   VAL A CG1   1 
ATOM   666  C  CG2   . VAL A 1 83  ? 44.352 13.484  4.551   1.00 12.46 ? 80   VAL A CG2   1 
ATOM   667  N  N     . ARG A 1 84  ? 43.477 17.375  2.315   1.00 14.08 ? 81   ARG A N     1 
ATOM   668  C  CA    . ARG A 1 84  ? 42.721 18.392  1.610   1.00 12.07 ? 81   ARG A CA    1 
ATOM   669  C  C     . ARG A 1 84  ? 41.256 18.019  1.504   1.00 14.45 ? 81   ARG A C     1 
ATOM   670  O  O     . ARG A 1 84  ? 40.924 16.855  1.359   1.00 13.44 ? 81   ARG A O     1 
ATOM   671  C  CB    . ARG A 1 84  ? 43.319 18.576  0.223   1.00 19.37 ? 81   ARG A CB    1 
ATOM   672  C  CG    . ARG A 1 84  ? 42.538 19.508  -0.660  1.00 23.38 ? 81   ARG A CG    1 
ATOM   673  C  CD    . ARG A 1 84  ? 43.122 19.483  -2.041  1.00 31.29 ? 81   ARG A CD    1 
ATOM   674  N  NE    . ARG A 1 84  ? 42.555 20.521  -2.888  1.00 45.82 ? 81   ARG A NE    1 
ATOM   675  C  CZ    . ARG A 1 84  ? 43.170 21.012  -3.955  1.00 50.21 ? 81   ARG A CZ    1 
ATOM   676  N  NH1   . ARG A 1 84  ? 44.375 20.561  -4.284  1.00 44.57 ? 81   ARG A NH1   1 
ATOM   677  N  NH2   . ARG A 1 84  ? 42.589 21.957  -4.682  1.00 50.06 ? 81   ARG A NH2   1 
ATOM   678  N  N     . GLU A 1 85  ? 40.372 19.006  1.575   1.00 15.22 ? 82   GLU A N     1 
ATOM   679  C  CA    . GLU A 1 85  ? 38.982 18.736  1.298   1.00 16.39 ? 82   GLU A CA    1 
ATOM   680  C  C     . GLU A 1 85  ? 38.519 19.497  0.069   1.00 17.66 ? 82   GLU A C     1 
ATOM   681  O  O     . GLU A 1 85  ? 38.746 20.703  -0.053  1.00 21.96 ? 82   GLU A O     1 
ATOM   682  C  CB    . GLU A 1 85  ? 38.126 19.069  2.520   1.00 18.11 ? 82   GLU A CB    1 
ATOM   683  C  CG    . GLU A 1 85  ? 38.284 17.988  3.587   1.00 25.06 ? 82   GLU A CG    1 
ATOM   684  C  CD    . GLU A 1 85  ? 37.525 18.280  4.867   1.00 29.25 ? 82   GLU A CD    1 
ATOM   685  O  OE1   . GLU A 1 85  ? 36.299 18.559  4.816   1.00 30.33 ? 82   GLU A OE1   1 
ATOM   686  O  OE2   . GLU A 1 85  ? 38.176 18.215  5.932   1.00 32.33 ? 82   GLU A OE2   1 
ATOM   687  N  N     . SER A 1 86  ? 37.905 18.762  -0.858  1.00 17.14 ? 83   SER A N     1 
ATOM   688  C  CA    . SER A 1 86  ? 37.315 19.338  -2.055  1.00 16.65 ? 83   SER A CA    1 
ATOM   689  C  C     . SER A 1 86  ? 35.954 18.715  -2.294  1.00 15.94 ? 83   SER A C     1 
ATOM   690  O  O     . SER A 1 86  ? 35.795 17.502  -2.175  1.00 17.81 ? 83   SER A O     1 
ATOM   691  C  CB    . SER A 1 86  ? 38.202 19.118  -3.277  1.00 18.73 ? 83   SER A CB    1 
ATOM   692  O  OG    . SER A 1 86  ? 39.518 19.568  -3.025  1.00 34.98 ? 83   SER A OG    1 
ATOM   693  N  N     . ARG A 1 87  ? 34.987 19.560  -2.647  1.00 19.07 ? 84   ARG A N     1 
ATOM   694  C  CA    . ARG A 1 87  ? 33.625 19.125  -2.915  1.00 15.76 ? 84   ARG A CA    1 
ATOM   695  C  C     . ARG A 1 87  ? 33.029 18.334  -1.764  1.00 18.49 ? 84   ARG A C     1 
ATOM   696  O  O     . ARG A 1 87  ? 32.262 17.393  -1.973  1.00 21.15 ? 84   ARG A O     1 
ATOM   697  C  CB    . ARG A 1 87  ? 33.576 18.303  -4.207  1.00 18.78 ? 84   ARG A CB    1 
ATOM   698  C  CG    . ARG A 1 87  ? 33.810 19.123  -5.459  1.00 25.15 ? 84   ARG A CG    1 
ATOM   699  C  CD    . ARG A 1 87  ? 33.765 18.241  -6.694  1.00 31.89 ? 84   ARG A CD    1 
ATOM   700  N  NE    . ARG A 1 87  ? 35.068 18.177  -7.348  1.00 35.30 ? 84   ARG A NE    1 
ATOM   701  C  CZ    . ARG A 1 87  ? 35.407 18.906  -8.407  1.00 38.41 ? 84   ARG A CZ    1 
ATOM   702  N  NH1   . ARG A 1 87  ? 34.528 19.746  -8.947  1.00 44.09 ? 84   ARG A NH1   1 
ATOM   703  N  NH2   . ARG A 1 87  ? 36.622 18.789  -8.928  1.00 40.14 ? 84   ARG A NH2   1 
ATOM   704  N  N     . GLY A 1 88  ? 33.373 18.725  -0.543  1.00 17.12 ? 85   GLY A N     1 
ATOM   705  C  CA    . GLY A 1 88  ? 32.783 18.123  0.638   1.00 19.83 ? 85   GLY A CA    1 
ATOM   706  C  C     . GLY A 1 88  ? 33.441 16.842  1.125   1.00 18.32 ? 85   GLY A C     1 
ATOM   707  O  O     . GLY A 1 88  ? 32.967 16.223  2.083   1.00 18.44 ? 85   GLY A O     1 
ATOM   708  N  N     . LYS A 1 89  ? 34.530 16.432  0.477   1.00 15.45 ? 86   LYS A N     1 
ATOM   709  C  CA    . LYS A 1 89  ? 35.155 15.153  0.820   1.00 13.15 ? 86   LYS A CA    1 
ATOM   710  C  C     . LYS A 1 89  ? 36.674 15.221  0.841   1.00 11.88 ? 86   LYS A C     1 
ATOM   711  O  O     . LYS A 1 89  ? 37.279 16.123  0.260   1.00 14.60 ? 86   LYS A O     1 
ATOM   712  C  CB    . LYS A 1 89  ? 34.727 14.060  -0.160  1.00 15.57 ? 86   LYS A CB    1 
ATOM   713  C  CG    . LYS A 1 89  ? 35.247 14.268  -1.570  1.00 18.69 ? 86   LYS A CG    1 
ATOM   714  C  CD    . LYS A 1 89  ? 34.736 13.182  -2.519  1.00 20.93 ? 86   LYS A CD    1 
ATOM   715  C  CE    . LYS A 1 89  ? 35.319 11.826  -2.151  1.00 14.64 ? 86   LYS A CE    1 
ATOM   716  N  NZ    . LYS A 1 89  ? 36.808 11.802  -2.269  1.00 15.04 ? 86   LYS A NZ    1 
ATOM   717  N  N     . ALA A 1 90  ? 37.276 14.243  1.506   1.00 15.46 ? 87   ALA A N     1 
ATOM   718  C  CA    . ALA A 1 90  ? 38.720 14.120  1.511   1.00 14.88 ? 87   ALA A CA    1 
ATOM   719  C  C     . ALA A 1 90  ? 39.205 13.893  0.094   1.00 15.66 ? 87   ALA A C     1 
ATOM   720  O  O     . ALA A 1 90  ? 38.611 13.125  -0.657  1.00 17.34 ? 87   ALA A O     1 
ATOM   721  C  CB    . ALA A 1 90  ? 39.162 12.988  2.420   1.00 15.32 ? 87   ALA A CB    1 
ATOM   722  N  N     . ASN A 1 91  ? 40.287 14.573  -0.266  1.00 11.67 ? 88   ASN A N     1 
ATOM   723  C  CA    . ASN A 1 91  ? 40.834 14.450  -1.614  1.00 13.09 ? 88   ASN A CA    1 
ATOM   724  C  C     . ASN A 1 91  ? 42.299 14.056  -1.527  1.00 19.58 ? 88   ASN A C     1 
ATOM   725  O  O     . ASN A 1 91  ? 43.094 14.790  -0.957  1.00 16.35 ? 88   ASN A O     1 
ATOM   726  C  CB    . ASN A 1 91  ? 40.672 15.764  -2.378  1.00 15.91 ? 88   ASN A CB    1 
ATOM   727  C  CG    . ASN A 1 91  ? 41.004 15.624  -3.846  1.00 18.60 ? 88   ASN A CG    1 
ATOM   728  O  OD1   . ASN A 1 91  ? 42.137 15.345  -4.206  1.00 16.37 ? 88   ASN A OD1   1 
ATOM   729  N  ND2   . ASN A 1 91  ? 40.002 15.817  -4.708  1.00 24.44 ? 88   ASN A ND2   1 
ATOM   730  N  N     . LEU A 1 92  ? 42.645 12.899  -2.079  1.00 16.56 ? 89   LEU A N     1 
ATOM   731  C  CA    . LEU A 1 92  ? 43.983 12.322  -1.896  1.00 13.59 ? 89   LEU A CA    1 
ATOM   732  C  C     . LEU A 1 92  ? 44.952 12.629  -3.034  1.00 13.06 ? 89   LEU A C     1 
ATOM   733  O  O     . LEU A 1 92  ? 45.984 11.969  -3.158  1.00 13.20 ? 89   LEU A O     1 
ATOM   734  C  CB    . LEU A 1 92  ? 43.870 10.802  -1.723  1.00 11.96 ? 89   LEU A CB    1 
ATOM   735  C  CG    . LEU A 1 92  ? 42.946 10.359  -0.587  1.00 14.27 ? 89   LEU A CG    1 
ATOM   736  C  CD1   . LEU A 1 92  ? 42.826 8.846   -0.554  1.00 15.77 ? 89   LEU A CD1   1 
ATOM   737  C  CD2   . LEU A 1 92  ? 43.476 10.892  0.721   1.00 16.69 ? 89   LEU A CD2   1 
ATOM   738  N  N     . THR A 1 93  ? 44.633 13.624  -3.854  1.00 13.59 ? 90   THR A N     1 
ATOM   739  C  CA    . THR A 1 93  ? 45.443 13.906  -5.043  1.00 12.39 ? 90   THR A CA    1 
ATOM   740  C  C     . THR A 1 93  ? 46.922 14.154  -4.759  1.00 14.63 ? 90   THR A C     1 
ATOM   741  O  O     . THR A 1 93  ? 47.787 13.619  -5.469  1.00 15.96 ? 90   THR A O     1 
ATOM   742  C  CB    . THR A 1 93  ? 44.862 15.107  -5.825  1.00 15.96 ? 90   THR A CB    1 
ATOM   743  O  OG1   . THR A 1 93  ? 43.555 14.748  -6.296  1.00 18.19 ? 90   THR A OG1   1 
ATOM   744  C  CG2   . THR A 1 93  ? 45.738 15.455  -7.031  1.00 15.46 ? 90   THR A CG2   1 
ATOM   745  N  N     . LYS A 1 94  ? 47.225 14.938  -3.730  1.00 12.05 ? 91   LYS A N     1 
ATOM   746  C  CA    . LYS A 1 94  ? 48.617 15.240  -3.408  1.00 11.51 ? 91   LYS A CA    1 
ATOM   747  C  C     . LYS A 1 94  ? 49.445 13.963  -3.191  1.00 11.00 ? 91   LYS A C     1 
ATOM   748  O  O     . LYS A 1 94  ? 50.587 13.869  -3.646  1.00 14.28 ? 91   LYS A O     1 
ATOM   749  C  CB    . LYS A 1 94  ? 48.700 16.146  -2.168  1.00 11.52 ? 91   LYS A CB    1 
ATOM   750  C  CG    . LYS A 1 94  ? 50.129 16.575  -1.826  1.00 13.78 ? 91   LYS A CG    1 
ATOM   751  C  CD    . LYS A 1 94  ? 50.236 17.108  -0.390  1.00 14.10 ? 91   LYS A CD    1 
ATOM   752  C  CE    . LYS A 1 94  ? 49.304 18.285  -0.173  1.00 17.72 ? 91   LYS A CE    1 
ATOM   753  N  NZ    . LYS A 1 94  ? 49.442 18.820  1.219   1.00 12.46 ? 91   LYS A NZ    1 
ATOM   754  N  N     . TYR A 1 95  ? 48.850 12.961  -2.547  1.00 11.89 ? 92   TYR A N     1 
ATOM   755  C  CA    . TYR A 1 95  ? 49.577 11.737  -2.238  1.00 8.40  ? 92   TYR A CA    1 
ATOM   756  C  C     . TYR A 1 95  ? 49.658 10.842  -3.466  1.00 11.84 ? 92   TYR A C     1 
ATOM   757  O  O     . TYR A 1 95  ? 50.662 10.164  -3.656  1.00 12.19 ? 92   TYR A O     1 
ATOM   758  C  CB    . TYR A 1 95  ? 48.930 11.000  -1.045  1.00 13.43 ? 92   TYR A CB    1 
ATOM   759  C  CG    . TYR A 1 95  ? 48.613 11.990  0.047   1.00 9.42  ? 92   TYR A CG    1 
ATOM   760  C  CD1   . TYR A 1 95  ? 47.305 12.379  0.295   1.00 10.49 ? 92   TYR A CD1   1 
ATOM   761  C  CD2   . TYR A 1 95  ? 49.632 12.613  0.771   1.00 11.61 ? 92   TYR A CD2   1 
ATOM   762  C  CE1   . TYR A 1 95  ? 47.011 13.334  1.254   1.00 12.76 ? 92   TYR A CE1   1 
ATOM   763  C  CE2   . TYR A 1 95  ? 49.355 13.564  1.716   1.00 10.20 ? 92   TYR A CE2   1 
ATOM   764  C  CZ    . TYR A 1 95  ? 48.029 13.926  1.951   1.00 10.88 ? 92   TYR A CZ    1 
ATOM   765  O  OH    . TYR A 1 95  ? 47.722 14.879  2.890   1.00 12.52 ? 92   TYR A OH    1 
ATOM   766  N  N     . ARG A 1 96  ? 48.633 10.871  -4.320  1.00 11.37 ? 93   ARG A N     1 
ATOM   767  C  CA    . ARG A 1 96  ? 48.690 10.127  -5.584  1.00 12.14 ? 93   ARG A CA    1 
ATOM   768  C  C     . ARG A 1 96  ? 49.787 10.685  -6.494  1.00 15.81 ? 93   ARG A C     1 
ATOM   769  O  O     . ARG A 1 96  ? 50.530 9.928   -7.140  1.00 13.86 ? 93   ARG A O     1 
ATOM   770  C  CB    . ARG A 1 96  ? 47.337 10.152  -6.307  1.00 11.82 ? 93   ARG A CB    1 
ATOM   771  C  CG    . ARG A 1 96  ? 46.255 9.362   -5.606  1.00 11.38 ? 93   ARG A CG    1 
ATOM   772  C  CD    . ARG A 1 96  ? 45.070 9.040   -6.514  1.00 15.34 ? 93   ARG A CD    1 
ATOM   773  N  NE    . ARG A 1 96  ? 44.050 8.299   -5.773  1.00 16.45 ? 93   ARG A NE    1 
ATOM   774  C  CZ    . ARG A 1 96  ? 43.017 8.875   -5.162  1.00 17.84 ? 93   ARG A CZ    1 
ATOM   775  N  NH1   . ARG A 1 96  ? 42.148 8.137   -4.469  1.00 13.25 ? 93   ARG A NH1   1 
ATOM   776  N  NH2   . ARG A 1 96  ? 42.859 10.189  -5.245  1.00 14.01 ? 93   ARG A NH2   1 
ATOM   777  N  N     . GLU A 1 97  ? 49.916 12.009  -6.527  1.00 13.41 ? 94   GLU A N     1 
ATOM   778  C  CA    . GLU A 1 97  ? 50.942 12.628  -7.364  1.00 12.27 ? 94   GLU A CA    1 
ATOM   779  C  C     . GLU A 1 97  ? 52.350 12.360  -6.810  1.00 12.03 ? 94   GLU A C     1 
ATOM   780  O  O     . GLU A 1 97  ? 53.276 12.109  -7.574  1.00 11.49 ? 94   GLU A O     1 
ATOM   781  C  CB    . GLU A 1 97  ? 50.658 14.120  -7.520  1.00 15.35 ? 94   GLU A CB    1 
ATOM   782  C  CG    . GLU A 1 97  ? 49.367 14.341  -8.309  1.00 19.01 ? 94   GLU A CG    1 
ATOM   783  C  CD    . GLU A 1 97  ? 48.997 15.793  -8.512  1.00 28.30 ? 94   GLU A CD    1 
ATOM   784  O  OE1   . GLU A 1 97  ? 49.580 16.670  -7.839  1.00 34.05 ? 94   GLU A OE1   1 
ATOM   785  O  OE2   . GLU A 1 97  ? 48.103 16.050  -9.356  1.00 24.61 ? 94   GLU A OE2   1 
ATOM   786  N  N     . ALA A 1 98  ? 52.496 12.364  -5.490  1.00 12.26 ? 95   ALA A N     1 
ATOM   787  C  CA    . ALA A 1 98  ? 53.783 12.033  -4.876  1.00 10.94 ? 95   ALA A CA    1 
ATOM   788  C  C     . ALA A 1 98  ? 54.159 10.584  -5.163  1.00 10.79 ? 95   ALA A C     1 
ATOM   789  O  O     . ALA A 1 98  ? 55.318 10.278  -5.371  1.00 13.40 ? 95   ALA A O     1 
ATOM   790  C  CB    . ALA A 1 98  ? 53.750 12.285  -3.382  1.00 11.15 ? 95   ALA A CB    1 
ATOM   791  N  N     . SER A 1 99  ? 53.162 9.712   -5.176  1.00 11.52 ? 96   SER A N     1 
ATOM   792  C  CA    . SER A 1 99  ? 53.364 8.305   -5.497  1.00 12.68 ? 96   SER A CA    1 
ATOM   793  C  C     . SER A 1 99  ? 53.934 8.159   -6.911  1.00 11.49 ? 96   SER A C     1 
ATOM   794  O  O     . SER A 1 99  ? 54.897 7.405   -7.146  1.00 11.71 ? 96   SER A O     1 
ATOM   795  C  CB    . SER A 1 99  ? 52.043 7.550   -5.370  1.00 11.69 ? 96   SER A CB    1 
ATOM   796  O  OG    . SER A 1 99  ? 52.184 6.228   -5.813  1.00 13.14 ? 96   SER A OG    1 
ATOM   797  N  N     . VAL A 1 100 ? 53.335 8.877   -7.852  1.00 12.24 ? 97   VAL A N     1 
ATOM   798  C  CA    . VAL A 1 100 ? 53.833 8.864   -9.234  1.00 12.81 ? 97   VAL A CA    1 
ATOM   799  C  C     . VAL A 1 100 ? 55.303 9.281   -9.313  1.00 13.39 ? 97   VAL A C     1 
ATOM   800  O  O     . VAL A 1 100 ? 56.079 8.697   -10.080 1.00 14.25 ? 97   VAL A O     1 
ATOM   801  C  CB    . VAL A 1 100 ? 52.977 9.779   -10.134 1.00 16.66 ? 97   VAL A CB    1 
ATOM   802  C  CG1   . VAL A 1 100 ? 53.681 10.061  -11.486 1.00 15.59 ? 97   VAL A CG1   1 
ATOM   803  C  CG2   . VAL A 1 100 ? 51.597 9.164   -10.336 1.00 18.29 ? 97   VAL A CG2   1 
ATOM   804  N  N     . GLU A 1 101 ? 55.708 10.267  -8.512  1.00 10.38 ? 98   GLU A N     1 
ATOM   805  C  CA    . GLU A 1 101 ? 57.119 10.681  -8.477  1.00 10.99 ? 98   GLU A CA    1 
ATOM   806  C  C     . GLU A 1 101 ? 58.033 9.504   -8.193  1.00 11.92 ? 98   GLU A C     1 
ATOM   807  O  O     . GLU A 1 101 ? 59.072 9.330   -8.835  1.00 16.13 ? 98   GLU A O     1 
ATOM   808  C  CB    . GLU A 1 101 ? 57.375 11.744  -7.407  1.00 12.09 ? 98   GLU A CB    1 
ATOM   809  C  CG    . GLU A 1 101 ? 56.868 13.156  -7.689  1.00 15.58 ? 98   GLU A CG    1 
ATOM   810  C  CD    . GLU A 1 101 ? 57.236 14.108  -6.560  1.00 14.95 ? 98   GLU A CD    1 
ATOM   811  O  OE1   . GLU A 1 101 ? 58.439 14.444  -6.421  1.00 15.98 ? 98   GLU A OE1   1 
ATOM   812  O  OE2   . GLU A 1 101 ? 56.316 14.516  -5.804  1.00 15.90 ? 98   GLU A OE2   1 
ATOM   813  N  N     . VAL A 1 102 ? 57.633 8.701   -7.214  1.00 11.56 ? 99   VAL A N     1 
ATOM   814  C  CA    . VAL A 1 102 ? 58.450 7.584   -6.772  1.00 11.28 ? 99   VAL A CA    1 
ATOM   815  C  C     . VAL A 1 102 ? 58.405 6.450   -7.773  1.00 11.52 ? 99   VAL A C     1 
ATOM   816  O  O     . VAL A 1 102 ? 59.439 5.856   -8.085  1.00 13.67 ? 99   VAL A O     1 
ATOM   817  C  CB    . VAL A 1 102 ? 58.003 7.055   -5.395  1.00 8.67  ? 99   VAL A CB    1 
ATOM   818  C  CG1   . VAL A 1 102 ? 58.766 5.764   -5.058  1.00 15.24 ? 99   VAL A CG1   1 
ATOM   819  C  CG2   . VAL A 1 102 ? 58.210 8.129   -4.332  1.00 13.77 ? 99   VAL A CG2   1 
ATOM   820  N  N     . MET A 1 103 ? 57.208 6.134   -8.265  1.00 9.93  ? 100  MET A N     1 
ATOM   821  C  CA    . MET A 1 103 ? 57.059 5.027   -9.205  1.00 11.89 ? 100  MET A CA    1 
ATOM   822  C  C     . MET A 1 103 ? 57.827 5.297   -10.494 1.00 14.32 ? 100  MET A C     1 
ATOM   823  O  O     . MET A 1 103 ? 58.377 4.379   -11.079 1.00 14.20 ? 100  MET A O     1 
ATOM   824  C  CB    . MET A 1 103 ? 55.591 4.773   -9.525  1.00 13.20 ? 100  MET A CB    1 
ATOM   825  C  CG    A MET A 1 103 ? 54.688 4.600   -8.300  0.41 14.86 ? 100  MET A CG    1 
ATOM   826  C  CG    B MET A 1 103 ? 54.747 4.452   -8.321  0.59 14.89 ? 100  MET A CG    1 
ATOM   827  S  SD    A MET A 1 103 ? 54.537 2.909   -7.681  0.41 14.00 ? 100  MET A SD    1 
ATOM   828  S  SD    B MET A 1 103 ? 55.432 3.057   -7.421  0.59 14.63 ? 100  MET A SD    1 
ATOM   829  C  CE    A MET A 1 103 ? 53.816 3.175   -6.052  0.41 13.53 ? 100  MET A CE    1 
ATOM   830  C  CE    B MET A 1 103 ? 54.478 3.144   -5.898  0.59 15.15 ? 100  MET A CE    1 
ATOM   831  N  N     . GLU A 1 104 ? 57.864 6.553   -10.939 1.00 13.04 ? 101  GLU A N     1 
ATOM   832  C  CA    . GLU A 1 104 ? 58.578 6.854   -12.178 1.00 14.64 ? 101  GLU A CA    1 
ATOM   833  C  C     . GLU A 1 104 ? 60.094 6.666   -12.017 1.00 13.89 ? 101  GLU A C     1 
ATOM   834  O  O     . GLU A 1 104 ? 60.764 6.170   -12.934 1.00 15.00 ? 101  GLU A O     1 
ATOM   835  C  CB    . GLU A 1 104 ? 58.230 8.272   -12.676 1.00 16.55 ? 101  GLU A CB    1 
ATOM   836  C  CG    . GLU A 1 104 ? 56.828 8.333   -13.287 1.00 16.55 ? 101  GLU A CG    1 
ATOM   837  C  CD    . GLU A 1 104 ? 56.476 9.700   -13.865 1.00 34.94 ? 101  GLU A CD    1 
ATOM   838  O  OE1   . GLU A 1 104 ? 57.266 10.656  -13.690 1.00 31.08 ? 101  GLU A OE1   1 
ATOM   839  O  OE2   . GLU A 1 104 ? 55.401 9.815   -14.495 1.00 32.53 ? 101  GLU A OE2   1 
ATOM   840  N  N     . ILE A 1 105 ? 60.623 7.004   -10.850 1.00 13.18 ? 102  ILE A N     1 
ATOM   841  C  CA    . ILE A 1 105 ? 62.039 6.754   -10.556 1.00 11.45 ? 102  ILE A CA    1 
ATOM   842  C  C     . ILE A 1 105 ? 62.325 5.254   -10.501 1.00 11.48 ? 102  ILE A C     1 
ATOM   843  O  O     . ILE A 1 105 ? 63.281 4.767   -11.115 1.00 15.48 ? 102  ILE A O     1 
ATOM   844  C  CB    . ILE A 1 105 ? 62.465 7.431   -9.229  1.00 12.88 ? 102  ILE A CB    1 
ATOM   845  C  CG1   . ILE A 1 105 ? 62.376 8.951   -9.368  1.00 14.15 ? 102  ILE A CG1   1 
ATOM   846  C  CG2   . ILE A 1 105 ? 63.885 7.043   -8.836  1.00 14.21 ? 102  ILE A CG2   1 
ATOM   847  C  CD1   . ILE A 1 105 ? 62.314 9.663   -8.034  1.00 14.30 ? 102  ILE A CD1   1 
ATOM   848  N  N     . MET A 1 106 ? 61.485 4.501   -9.806  1.00 11.74 ? 103  MET A N     1 
ATOM   849  C  CA    . MET A 1 106 ? 61.733 3.055   -9.713  1.00 12.26 ? 103  MET A CA    1 
ATOM   850  C  C     . MET A 1 106 ? 61.715 2.396   -11.091 1.00 15.40 ? 103  MET A C     1 
ATOM   851  O  O     . MET A 1 106 ? 62.498 1.487   -11.360 1.00 14.50 ? 103  MET A O     1 
ATOM   852  C  CB    . MET A 1 106 ? 60.700 2.387   -8.787  1.00 11.99 ? 103  MET A CB    1 
ATOM   853  C  CG    A MET A 1 106 ? 61.055 2.595   -7.318  0.43 11.42 ? 103  MET A CG    1 
ATOM   854  C  CG    B MET A 1 106 ? 60.810 2.732   -7.309  0.57 11.34 ? 103  MET A CG    1 
ATOM   855  S  SD    A MET A 1 106 ? 60.035 1.643   -6.179  0.43 18.11 ? 103  MET A SD    1 
ATOM   856  S  SD    B MET A 1 106 ? 59.517 1.866   -6.362  0.57 15.47 ? 103  MET A SD    1 
ATOM   857  C  CE    A MET A 1 106 ? 58.466 2.474   -6.403  0.43 19.87 ? 103  MET A CE    1 
ATOM   858  C  CE    B MET A 1 106 ? 59.931 0.149   -6.648  0.57 10.06 ? 103  MET A CE    1 
ATOM   859  N  N     . SER A 1 107 ? 60.829 2.872   -11.964 1.00 11.71 ? 104  SER A N     1 
ATOM   860  C  CA    . SER A 1 107 ? 60.667 2.295   -13.292 1.00 13.74 ? 104  SER A CA    1 
ATOM   861  C  C     . SER A 1 107 ? 61.927 2.416   -14.142 1.00 17.44 ? 104  SER A C     1 
ATOM   862  O  O     . SER A 1 107 ? 62.050 1.714   -15.149 1.00 16.10 ? 104  SER A O     1 
ATOM   863  C  CB    . SER A 1 107 ? 59.497 2.956   -14.029 1.00 21.21 ? 104  SER A CB    1 
ATOM   864  O  OG    . SER A 1 107 ? 58.266 2.613   -13.428 1.00 25.73 ? 104  SER A OG    1 
ATOM   865  N  N     . ARG A 1 108 ? 62.841 3.314   -13.760 1.00 14.74 ? 105  ARG A N     1 
ATOM   866  C  CA    . ARG A 1 108 ? 64.098 3.505   -14.496 1.00 13.08 ? 105  ARG A CA    1 
ATOM   867  C  C     . ARG A 1 108 ? 65.025 2.313   -14.311 1.00 14.22 ? 105  ARG A C     1 
ATOM   868  O  O     . ARG A 1 108 ? 65.875 2.044   -15.159 1.00 21.02 ? 105  ARG A O     1 
ATOM   869  C  CB    . ARG A 1 108 ? 64.838 4.765   -14.048 1.00 20.17 ? 105  ARG A CB    1 
ATOM   870  C  CG    . ARG A 1 108 ? 64.077 6.048   -14.236 1.00 16.68 ? 105  ARG A CG    1 
ATOM   871  C  CD    . ARG A 1 108 ? 65.043 7.208   -14.409 1.00 20.24 ? 105  ARG A CD    1 
ATOM   872  N  NE    . ARG A 1 108 ? 66.087 7.275   -13.390 1.00 24.00 ? 105  ARG A NE    1 
ATOM   873  C  CZ    . ARG A 1 108 ? 66.103 8.165   -12.399 1.00 15.78 ? 105  ARG A CZ    1 
ATOM   874  N  NH1   . ARG A 1 108 ? 67.096 8.167   -11.521 1.00 22.82 ? 105  ARG A NH1   1 
ATOM   875  N  NH2   . ARG A 1 108 ? 65.125 9.048   -12.290 1.00 20.68 ? 105  ARG A NH2   1 
ATOM   876  N  N     . PHE A 1 109 ? 64.857 1.611   -13.195 1.00 17.28 ? 106  PHE A N     1 
ATOM   877  C  CA    . PHE A 1 109 ? 65.724 0.475   -12.876 1.00 18.59 ? 106  PHE A CA    1 
ATOM   878  C  C     . PHE A 1 109 ? 65.165 -0.841  -13.382 1.00 21.01 ? 106  PHE A C     1 
ATOM   879  O  O     . PHE A 1 109 ? 65.915 -1.723  -13.813 1.00 25.87 ? 106  PHE A O     1 
ATOM   880  C  CB    . PHE A 1 109 ? 65.953 0.391   -11.370 1.00 15.19 ? 106  PHE A CB    1 
ATOM   881  C  CG    . PHE A 1 109 ? 66.714 1.555   -10.817 1.00 23.11 ? 106  PHE A CG    1 
ATOM   882  C  CD1   . PHE A 1 109 ? 66.067 2.754   -10.547 1.00 15.23 ? 106  PHE A CD1   1 
ATOM   883  C  CD2   . PHE A 1 109 ? 68.075 1.459   -10.572 1.00 13.95 ? 106  PHE A CD2   1 
ATOM   884  C  CE1   . PHE A 1 109 ? 66.753 3.833   -10.042 1.00 14.84 ? 106  PHE A CE1   1 
ATOM   885  C  CE2   . PHE A 1 109 ? 68.770 2.532   -10.061 1.00 15.60 ? 106  PHE A CE2   1 
ATOM   886  C  CZ    . PHE A 1 109 ? 68.110 3.729   -9.796  1.00 17.83 ? 106  PHE A CZ    1 
ATOM   887  N  N     . ALA A 1 110 ? 63.846 -0.974  -13.333 1.00 20.44 ? 107  ALA A N     1 
ATOM   888  C  CA    . ALA A 1 110 ? 63.196 -2.190  -13.775 1.00 16.10 ? 107  ALA A CA    1 
ATOM   889  C  C     . ALA A 1 110 ? 61.692 -2.033  -13.871 1.00 24.94 ? 107  ALA A C     1 
ATOM   890  O  O     . ALA A 1 110 ? 61.108 -1.040  -13.421 1.00 25.90 ? 107  ALA A O     1 
ATOM   891  C  CB    . ALA A 1 110 ? 63.530 -3.348  -12.838 1.00 23.88 ? 107  ALA A CB    1 
ATOM   892  N  N     . VAL A 1 111 ? 61.085 -3.040  -14.482 1.00 25.51 ? 108  VAL A N     1 
ATOM   893  C  CA    . VAL A 1 111 ? 59.646 -3.212  -14.522 1.00 33.11 ? 108  VAL A CA    1 
ATOM   894  C  C     . VAL A 1 111 ? 59.097 -3.293  -13.103 1.00 20.99 ? 108  VAL A C     1 
ATOM   895  O  O     . VAL A 1 111 ? 59.626 -4.047  -12.276 1.00 24.48 ? 108  VAL A O     1 
ATOM   896  C  CB    . VAL A 1 111 ? 59.287 -4.484  -15.296 1.00 29.51 ? 108  VAL A CB    1 
ATOM   897  C  CG1   . VAL A 1 111 ? 57.867 -4.947  -14.972 1.00 33.58 ? 108  VAL A CG1   1 
ATOM   898  C  CG2   . VAL A 1 111 ? 59.478 -4.254  -16.788 1.00 41.66 ? 108  VAL A CG2   1 
ATOM   899  N  N     . ILE A 1 112 ? 58.076 -2.497  -12.802 1.00 23.74 ? 109  ILE A N     1 
ATOM   900  C  CA    . ILE A 1 112 ? 57.517 -2.545  -11.453 1.00 18.69 ? 109  ILE A CA    1 
ATOM   901  C  C     . ILE A 1 112 ? 56.052 -2.933  -11.443 1.00 15.84 ? 109  ILE A C     1 
ATOM   902  O  O     . ILE A 1 112 ? 55.336 -2.760  -12.433 1.00 17.40 ? 109  ILE A O     1 
ATOM   903  C  CB    . ILE A 1 112 ? 57.683 -1.194  -10.696 1.00 24.60 ? 109  ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 112 ? 56.738 -0.126  -11.250 1.00 25.85 ? 109  ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 112 ? 59.152 -0.746  -10.707 1.00 22.25 ? 109  ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 112 ? 56.641 1.135   -10.368 1.00 22.85 ? 109  ILE A CD1   1 
ATOM   907  N  N     . GLU A 1 113 ? 55.638 -3.515  -10.324 1.00 11.64 ? 110  GLU A N     1 
ATOM   908  C  CA    . GLU A 1 113 ? 54.232 -3.732  -10.015 1.00 12.54 ? 110  GLU A CA    1 
ATOM   909  C  C     . GLU A 1 113 ? 53.814 -2.795  -8.896  1.00 14.44 ? 110  GLU A C     1 
ATOM   910  O  O     . GLU A 1 113 ? 54.236 -2.967  -7.760  1.00 15.02 ? 110  GLU A O     1 
ATOM   911  C  CB    . GLU A 1 113 ? 53.962 -5.190  -9.602  1.00 13.19 ? 110  GLU A CB    1 
ATOM   912  C  CG    . GLU A 1 113 ? 52.515 -5.446  -9.212  1.00 14.76 ? 110  GLU A CG    1 
ATOM   913  C  CD    . GLU A 1 113 ? 52.263 -6.879  -8.734  1.00 19.61 ? 110  GLU A CD    1 
ATOM   914  O  OE1   . GLU A 1 113 ? 51.226 -7.114  -8.078  1.00 24.49 ? 110  GLU A OE1   1 
ATOM   915  O  OE2   . GLU A 1 113 ? 53.084 -7.768  -9.018  1.00 18.56 ? 110  GLU A OE2   1 
ATOM   916  N  N     . ARG A 1 114 ? 53.003 -1.799  -9.223  1.00 14.24 ? 111  ARG A N     1 
ATOM   917  C  CA    . ARG A 1 114 ? 52.443 -0.909  -8.199  1.00 13.27 ? 111  ARG A CA    1 
ATOM   918  C  C     . ARG A 1 114 ? 51.512 -1.732  -7.322  1.00 16.15 ? 111  ARG A C     1 
ATOM   919  O  O     . ARG A 1 114 ? 50.540 -2.304  -7.818  1.00 23.24 ? 111  ARG A O     1 
ATOM   920  C  CB    . ARG A 1 114 ? 51.689 0.266   -8.850  1.00 16.17 ? 111  ARG A CB    1 
ATOM   921  C  CG    . ARG A 1 114 ? 51.067 1.270   -7.869  1.00 17.79 ? 111  ARG A CG    1 
ATOM   922  C  CD    . ARG A 1 114 ? 49.934 2.048   -8.543  1.00 19.04 ? 111  ARG A CD    1 
ATOM   923  N  NE    . ARG A 1 114 ? 49.561 3.273   -7.835  1.00 22.48 ? 111  ARG A NE    1 
ATOM   924  C  CZ    . ARG A 1 114 ? 48.617 3.350   -6.905  1.00 27.52 ? 111  ARG A CZ    1 
ATOM   925  N  NH1   . ARG A 1 114 ? 47.950 2.262   -6.537  1.00 27.37 ? 111  ARG A NH1   1 
ATOM   926  N  NH2   . ARG A 1 114 ? 48.348 4.519   -6.333  1.00 22.73 ? 111  ARG A NH2   1 
ATOM   927  N  N     . ALA A 1 115 ? 51.804 -1.799  -6.025  1.00 10.86 ? 112  ALA A N     1 
ATOM   928  C  CA    . ALA A 1 115 ? 51.072 -2.682  -5.130  1.00 8.47  ? 112  ALA A CA    1 
ATOM   929  C  C     . ALA A 1 115 ? 50.196 -1.902  -4.157  1.00 11.87 ? 112  ALA A C     1 
ATOM   930  O  O     . ALA A 1 115 ? 49.285 -2.462  -3.566  1.00 13.81 ? 112  ALA A O     1 
ATOM   931  C  CB    . ALA A 1 115 ? 52.036 -3.569  -4.361  1.00 11.84 ? 112  ALA A CB    1 
ATOM   932  N  N     . SER A 1 116 ? 50.522 -0.625  -3.977  1.00 14.31 ? 113  SER A N     1 
ATOM   933  C  CA    . SER A 1 116 ? 49.712 0.319   -3.206  1.00 12.05 ? 113  SER A CA    1 
ATOM   934  C  C     . SER A 1 116 ? 50.129 1.734   -3.579  1.00 13.66 ? 113  SER A C     1 
ATOM   935  O  O     . SER A 1 116 ? 51.041 1.932   -4.386  1.00 13.57 ? 113  SER A O     1 
ATOM   936  C  CB    . SER A 1 116 ? 49.879 0.136   -1.691  1.00 14.22 ? 113  SER A CB    1 
ATOM   937  O  OG    . SER A 1 116 ? 51.118 0.678   -1.248  1.00 12.50 ? 113  SER A OG    1 
ATOM   938  N  N     . ILE A 1 117 ? 49.505 2.720   -2.952  1.00 12.10 ? 114  ILE A N     1 
ATOM   939  C  CA    . ILE A 1 117 ? 49.912 4.095   -3.189  1.00 11.60 ? 114  ILE A CA    1 
ATOM   940  C  C     . ILE A 1 117 ? 51.395 4.330   -2.815  1.00 11.84 ? 114  ILE A C     1 
ATOM   941  O  O     . ILE A 1 117 ? 52.041 5.220   -3.365  1.00 14.64 ? 114  ILE A O     1 
ATOM   942  C  CB    . ILE A 1 117 ? 49.016 5.083   -2.408  1.00 7.89  ? 114  ILE A CB    1 
ATOM   943  C  CG1   . ILE A 1 117 ? 49.186 6.496   -2.962  1.00 11.86 ? 114  ILE A CG1   1 
ATOM   944  C  CG2   . ILE A 1 117 ? 49.328 5.036   -0.916  1.00 12.20 ? 114  ILE A CG2   1 
ATOM   945  C  CD1   . ILE A 1 117 ? 48.074 7.430   -2.559  1.00 13.96 ? 114  ILE A CD1   1 
ATOM   946  N  N     . ASP A 1 118 ? 51.963 3.515   -1.921  1.00 11.04 ? 115  ASP A N     1 
ATOM   947  C  CA    . ASP A 1 118 ? 53.342 3.806   -1.519  1.00 10.88 ? 115  ASP A CA    1 
ATOM   948  C  C     . ASP A 1 118 ? 54.343 2.657   -1.660  1.00 12.47 ? 115  ASP A C     1 
ATOM   949  O  O     . ASP A 1 118 ? 55.421 2.703   -1.064  1.00 11.71 ? 115  ASP A O     1 
ATOM   950  C  CB    . ASP A 1 118 ? 53.358 4.312   -0.073  1.00 9.96  ? 115  ASP A CB    1 
ATOM   951  C  CG    . ASP A 1 118 ? 53.512 3.186   0.944   1.00 12.11 ? 115  ASP A CG    1 
ATOM   952  O  OD1   . ASP A 1 118 ? 52.911 2.093   0.770   1.00 12.95 ? 115  ASP A OD1   1 
ATOM   953  O  OD2   . ASP A 1 118 ? 54.270 3.405   1.913   1.00 10.84 ? 115  ASP A OD2   1 
ATOM   954  N  N     . GLU A 1 119 ? 54.019 1.636   -2.444  1.00 7.48  ? 116  GLU A N     1 
ATOM   955  C  CA    . GLU A 1 119 ? 54.989 0.550   -2.606  1.00 9.74  ? 116  GLU A CA    1 
ATOM   956  C  C     . GLU A 1 119 ? 54.853 -0.141  -3.948  1.00 11.81 ? 116  GLU A C     1 
ATOM   957  O  O     . GLU A 1 119 ? 53.772 -0.147  -4.554  1.00 11.24 ? 116  GLU A O     1 
ATOM   958  C  CB    . GLU A 1 119 ? 54.851 -0.479  -1.484  1.00 12.41 ? 116  GLU A CB    1 
ATOM   959  C  CG    . GLU A 1 119 ? 53.616 -1.380  -1.580  1.00 10.06 ? 116  GLU A CG    1 
ATOM   960  C  CD    . GLU A 1 119 ? 53.124 -1.808  -0.207  1.00 15.44 ? 116  GLU A CD    1 
ATOM   961  O  OE1   . GLU A 1 119 ? 53.460 -2.927  0.235   1.00 16.51 ? 116  GLU A OE1   1 
ATOM   962  O  OE2   . GLU A 1 119 ? 52.423 -1.012  0.451   1.00 13.24 ? 116  GLU A OE2   1 
ATOM   963  N  N     . ALA A 1 120 ? 55.973 -0.699  -4.405  1.00 11.05 ? 117  ALA A N     1 
ATOM   964  C  CA    . ALA A 1 120 ? 56.021 -1.438  -5.658  1.00 10.71 ? 117  ALA A CA    1 
ATOM   965  C  C     . ALA A 1 120 ? 56.983 -2.606  -5.558  1.00 12.84 ? 117  ALA A C     1 
ATOM   966  O  O     . ALA A 1 120 ? 58.014 -2.513  -4.883  1.00 14.58 ? 117  ALA A O     1 
ATOM   967  C  CB    . ALA A 1 120 ? 56.428 -0.515  -6.800  1.00 13.30 ? 117  ALA A CB    1 
ATOM   968  N  N     . TYR A 1 121 ? 56.647 -3.702  -6.231  1.00 10.57 ? 118  TYR A N     1 
ATOM   969  C  CA    . TYR A 1 121 ? 57.590 -4.802  -6.380  1.00 11.18 ? 118  TYR A CA    1 
ATOM   970  C  C     . TYR A 1 121 ? 58.436 -4.574  -7.608  1.00 12.07 ? 118  TYR A C     1 
ATOM   971  O  O     . TYR A 1 121 ? 57.985 -3.943  -8.571  1.00 13.61 ? 118  TYR A O     1 
ATOM   972  C  CB    . TYR A 1 121 ? 56.872 -6.142  -6.480  1.00 10.65 ? 118  TYR A CB    1 
ATOM   973  C  CG    . TYR A 1 121 ? 56.139 -6.505  -5.216  1.00 9.04  ? 118  TYR A CG    1 
ATOM   974  C  CD1   . TYR A 1 121 ? 54.820 -6.126  -5.028  1.00 10.93 ? 118  TYR A CD1   1 
ATOM   975  C  CD2   . TYR A 1 121 ? 56.777 -7.206  -4.204  1.00 9.01  ? 118  TYR A CD2   1 
ATOM   976  C  CE1   . TYR A 1 121 ? 54.142 -6.451  -3.858  1.00 14.20 ? 118  TYR A CE1   1 
ATOM   977  C  CE2   . TYR A 1 121 ? 56.120 -7.540  -3.035  1.00 10.97 ? 118  TYR A CE2   1 
ATOM   978  C  CZ    . TYR A 1 121 ? 54.805 -7.148  -2.866  1.00 15.07 ? 118  TYR A CZ    1 
ATOM   979  O  OH    . TYR A 1 121 ? 54.143 -7.476  -1.712  1.00 17.59 ? 118  TYR A OH    1 
ATOM   980  N  N     . VAL A 1 122 ? 59.661 -5.094  -7.556  1.00 10.33 ? 119  VAL A N     1 
ATOM   981  C  CA    . VAL A 1 122 ? 60.640 -4.997  -8.629  1.00 13.89 ? 119  VAL A CA    1 
ATOM   982  C  C     . VAL A 1 122 ? 61.155 -6.394  -8.926  1.00 16.29 ? 119  VAL A C     1 
ATOM   983  O  O     . VAL A 1 122 ? 61.566 -7.092  -8.005  1.00 15.99 ? 119  VAL A O     1 
ATOM   984  C  CB    . VAL A 1 122 ? 61.858 -4.109  -8.231  1.00 19.95 ? 119  VAL A CB    1 
ATOM   985  C  CG1   . VAL A 1 122 ? 62.432 -3.423  -9.449  1.00 31.57 ? 119  VAL A CG1   1 
ATOM   986  C  CG2   . VAL A 1 122 ? 61.471 -3.093  -7.165  1.00 26.86 ? 119  VAL A CG2   1 
ATOM   987  N  N     . ASP A 1 123 ? 61.125 -6.824  -10.185 1.00 16.89 ? 120  ASP A N     1 
ATOM   988  C  CA    . ASP A 1 123 ? 61.828 -8.051  -10.558 1.00 17.39 ? 120  ASP A CA    1 
ATOM   989  C  C     . ASP A 1 123 ? 63.206 -7.660  -11.086 1.00 19.48 ? 120  ASP A C     1 
ATOM   990  O  O     . ASP A 1 123 ? 63.339 -7.114  -12.185 1.00 20.09 ? 120  ASP A O     1 
ATOM   991  C  CB    . ASP A 1 123 ? 61.049 -8.866  -11.596 1.00 22.06 ? 120  ASP A CB    1 
ATOM   992  C  CG    . ASP A 1 123 ? 61.661 -10.242 -11.838 1.00 27.47 ? 120  ASP A CG    1 
ATOM   993  O  OD1   . ASP A 1 123 ? 62.900 -10.341 -11.956 1.00 20.64 ? 120  ASP A OD1   1 
ATOM   994  O  OD2   . ASP A 1 123 ? 60.906 -11.237 -11.896 1.00 34.60 ? 120  ASP A OD2   1 
ATOM   995  N  N     . LEU A 1 124 ? 64.226 -7.941  -10.288 1.00 14.59 ? 121  LEU A N     1 
ATOM   996  C  CA    . LEU A 1 124 ? 65.595 -7.529  -10.577 1.00 12.90 ? 121  LEU A CA    1 
ATOM   997  C  C     . LEU A 1 124 ? 66.486 -8.610  -11.180 1.00 11.56 ? 121  LEU A C     1 
ATOM   998  O  O     . LEU A 1 124 ? 67.696 -8.393  -11.316 1.00 12.62 ? 121  LEU A O     1 
ATOM   999  C  CB    . LEU A 1 124 ? 66.251 -7.025  -9.296  1.00 11.85 ? 121  LEU A CB    1 
ATOM   1000 C  CG    . LEU A 1 124 ? 65.610 -5.771  -8.713  1.00 15.23 ? 121  LEU A CG    1 
ATOM   1001 C  CD1   . LEU A 1 124 ? 66.130 -5.498  -7.318  1.00 15.33 ? 121  LEU A CD1   1 
ATOM   1002 C  CD2   . LEU A 1 124 ? 65.865 -4.584  -9.646  1.00 15.84 ? 121  LEU A CD2   1 
ATOM   1003 N  N     . THR A 1 125 ? 65.892 -9.753  -11.508 1.00 12.40 ? 122  THR A N     1 
ATOM   1004 C  CA    . THR A 1 125 ? 66.645 -10.895 -12.019 1.00 14.15 ? 122  THR A CA    1 
ATOM   1005 C  C     . THR A 1 125 ? 67.583 -10.483 -13.152 1.00 15.81 ? 122  THR A C     1 
ATOM   1006 O  O     . THR A 1 125 ? 68.783 -10.732 -13.076 1.00 16.09 ? 122  THR A O     1 
ATOM   1007 C  CB    . THR A 1 125 ? 65.711 -11.982 -12.491 1.00 17.78 ? 122  THR A CB    1 
ATOM   1008 O  OG1   . THR A 1 125 ? 64.776 -12.252 -11.445 1.00 14.82 ? 122  THR A OG1   1 
ATOM   1009 C  CG2   . THR A 1 125 ? 66.487 -13.259 -12.831 1.00 16.71 ? 122  THR A CG2   1 
ATOM   1010 N  N     . SER A 1 126 ? 67.043 -9.800  -14.160 1.00 14.49 ? 123  SER A N     1 
ATOM   1011 C  CA    . SER A 1 126 ? 67.850 -9.427  -15.326 1.00 18.05 ? 123  SER A CA    1 
ATOM   1012 C  C     A SER A 1 126 ? 68.880 -8.357  -14.988 0.43 19.97 ? 123  SER A C     1 
ATOM   1013 C  C     B SER A 1 126 ? 68.880 -8.357  -14.988 0.57 20.13 ? 123  SER A C     1 
ATOM   1014 O  O     . SER A 1 126 ? 70.031 -8.446  -15.411 1.00 21.93 ? 123  SER A O     1 
ATOM   1015 C  CB    . SER A 1 126 ? 66.959 -8.942  -16.466 1.00 20.10 ? 123  SER A CB    1 
ATOM   1016 O  OG    A SER A 1 126 ? 66.057 -9.947  -16.883 0.43 25.07 ? 123  SER A OG    1 
ATOM   1017 O  OG    B SER A 1 126 ? 66.114 -7.887  -16.044 0.57 24.11 ? 123  SER A OG    1 
ATOM   1018 N  N     . ALA A 1 127 ? 68.467 -7.346  -14.228 1.00 18.29 ? 124  ALA A N     1 
ATOM   1019 C  CA    . ALA A 1 127 ? 69.382 -6.290  -13.800 1.00 20.99 ? 124  ALA A CA    1 
ATOM   1020 C  C     . ALA A 1 127 ? 70.579 -6.877  -13.033 1.00 19.80 ? 124  ALA A C     1 
ATOM   1021 O  O     . ALA A 1 127 ? 71.714 -6.424  -13.186 1.00 21.82 ? 124  ALA A O     1 
ATOM   1022 C  CB    . ALA A 1 127 ? 68.646 -5.253  -12.941 1.00 14.06 ? 124  ALA A CB    1 
ATOM   1023 N  N     . VAL A 1 128 ? 70.317 -7.900  -12.223 1.00 16.25 ? 125  VAL A N     1 
ATOM   1024 C  CA    . VAL A 1 128 ? 71.366 -8.558  -11.457 1.00 19.76 ? 125  VAL A CA    1 
ATOM   1025 C  C     . VAL A 1 128 ? 72.351 -9.283  -12.374 1.00 15.40 ? 125  VAL A C     1 
ATOM   1026 O  O     . VAL A 1 128 ? 73.562 -9.177  -12.186 1.00 18.93 ? 125  VAL A O     1 
ATOM   1027 C  CB    . VAL A 1 128 ? 70.776 -9.547  -10.431 1.00 16.46 ? 125  VAL A CB    1 
ATOM   1028 C  CG1   . VAL A 1 128 ? 71.835 -10.540 -9.971  1.00 17.10 ? 125  VAL A CG1   1 
ATOM   1029 C  CG2   . VAL A 1 128 ? 70.213 -8.765  -9.241  1.00 13.27 ? 125  VAL A CG2   1 
ATOM   1030 N  N     . GLN A 1 129 ? 71.826 -9.982  -13.372 1.00 17.97 ? 126  GLN A N     1 
ATOM   1031 C  CA    . GLN A 1 129 ? 72.671 -10.681 -14.335 1.00 27.77 ? 126  GLN A CA    1 
ATOM   1032 C  C     . GLN A 1 129 ? 73.570 -9.689  -15.058 1.00 23.73 ? 126  GLN A C     1 
ATOM   1033 O  O     . GLN A 1 129 ? 74.762 -9.930  -15.239 1.00 30.37 ? 126  GLN A O     1 
ATOM   1034 C  CB    . GLN A 1 129 ? 71.822 -11.461 -15.340 1.00 24.56 ? 126  GLN A CB    1 
ATOM   1035 C  CG    . GLN A 1 129 ? 71.065 -12.625 -14.722 1.00 34.03 ? 126  GLN A CG    1 
ATOM   1036 C  CD    . GLN A 1 129 ? 71.986 -13.607 -14.015 1.00 43.45 ? 126  GLN A CD    1 
ATOM   1037 O  OE1   . GLN A 1 129 ? 71.984 -13.706 -12.787 1.00 44.27 ? 126  GLN A OE1   1 
ATOM   1038 N  NE2   . GLN A 1 129 ? 72.781 -14.338 -14.791 1.00 48.53 ? 126  GLN A NE2   1 
ATOM   1039 N  N     . GLU A 1 130 ? 72.995 -8.561  -15.454 1.00 27.83 ? 127  GLU A N     1 
ATOM   1040 C  CA    . GLU A 1 130 ? 73.777 -7.535  -16.128 1.00 30.81 ? 127  GLU A CA    1 
ATOM   1041 C  C     . GLU A 1 130 ? 74.898 -7.019  -15.213 1.00 32.40 ? 127  GLU A C     1 
ATOM   1042 O  O     . GLU A 1 130 ? 76.064 -6.990  -15.609 1.00 32.65 ? 127  GLU A O     1 
ATOM   1043 C  CB    . GLU A 1 130 ? 72.871 -6.386  -16.593 1.00 29.25 ? 127  GLU A CB    1 
ATOM   1044 C  CG    . GLU A 1 130 ? 73.353 -5.707  -17.876 1.00 42.19 ? 127  GLU A CG    1 
ATOM   1045 C  CD    . GLU A 1 130 ? 72.506 -4.511  -18.277 1.00 59.24 ? 127  GLU A CD    1 
ATOM   1046 O  OE1   . GLU A 1 130 ? 71.524 -4.201  -17.567 1.00 53.26 ? 127  GLU A OE1   1 
ATOM   1047 O  OE2   . GLU A 1 130 ? 72.826 -3.876  -19.307 1.00 67.68 ? 127  GLU A OE2   1 
ATOM   1048 N  N     . ARG A 1 131 ? 74.552 -6.644  -13.985 1.00 24.77 ? 128  ARG A N     1 
ATOM   1049 C  CA    . ARG A 1 131 ? 75.530 -6.092  -13.050 1.00 22.70 ? 128  ARG A CA    1 
ATOM   1050 C  C     . ARG A 1 131 ? 76.635 -7.096  -12.711 1.00 26.30 ? 128  ARG A C     1 
ATOM   1051 O  O     . ARG A 1 131 ? 77.795 -6.713  -12.559 1.00 25.77 ? 128  ARG A O     1 
ATOM   1052 C  CB    . ARG A 1 131 ? 74.832 -5.628  -11.768 1.00 20.30 ? 128  ARG A CB    1 
ATOM   1053 C  CG    A ARG A 1 131 ? 75.726 -4.910  -10.772 0.48 22.07 ? 128  ARG A CG    1 
ATOM   1054 C  CG    B ARG A 1 131 ? 75.779 -5.010  -10.747 0.52 22.07 ? 128  ARG A CG    1 
ATOM   1055 C  CD    A ARG A 1 131 ? 76.274 -3.611  -11.347 0.48 22.82 ? 128  ARG A CD    1 
ATOM   1056 C  CD    B ARG A 1 131 ? 76.396 -3.726  -11.285 0.52 22.96 ? 128  ARG A CD    1 
ATOM   1057 N  NE    A ARG A 1 131 ? 76.896 -2.799  -10.312 0.48 28.16 ? 128  ARG A NE    1 
ATOM   1058 N  NE    B ARG A 1 131 ? 75.357 -2.741  -11.540 0.52 21.57 ? 128  ARG A NE    1 
ATOM   1059 C  CZ    A ARG A 1 131 ? 76.229 -1.945  -9.545  0.48 20.52 ? 128  ARG A CZ    1 
ATOM   1060 C  CZ    B ARG A 1 131 ? 74.899 -1.907  -10.615 0.52 20.16 ? 128  ARG A CZ    1 
ATOM   1061 N  NH1   A ARG A 1 131 ? 76.865 -1.241  -8.618  0.48 18.31 ? 128  ARG A NH1   1 
ATOM   1062 N  NH1   B ARG A 1 131 ? 73.937 -1.043  -10.910 0.52 28.18 ? 128  ARG A NH1   1 
ATOM   1063 N  NH2   A ARG A 1 131 ? 74.922 -1.796  -9.713  0.48 19.50 ? 128  ARG A NH2   1 
ATOM   1064 N  NH2   B ARG A 1 131 ? 75.409 -1.943  -9.392  0.52 18.72 ? 128  ARG A NH2   1 
ATOM   1065 N  N     . LEU A 1 132 ? 76.273 -8.373  -12.597 1.00 21.46 ? 129  LEU A N     1 
ATOM   1066 C  CA    . LEU A 1 132 ? 77.244 -9.443  -12.340 1.00 24.56 ? 129  LEU A CA    1 
ATOM   1067 C  C     . LEU A 1 132 ? 78.303 -9.536  -13.447 1.00 35.32 ? 129  LEU A C     1 
ATOM   1068 O  O     . LEU A 1 132 ? 79.475 -9.783  -13.168 1.00 35.29 ? 129  LEU A O     1 
ATOM   1069 C  CB    . LEU A 1 132 ? 76.528 -10.789 -12.181 1.00 31.48 ? 129  LEU A CB    1 
ATOM   1070 C  CG    . LEU A 1 132 ? 76.002 -11.136 -10.780 1.00 22.21 ? 129  LEU A CG    1 
ATOM   1071 C  CD1   . LEU A 1 132 ? 75.074 -12.352 -10.800 1.00 24.30 ? 129  LEU A CD1   1 
ATOM   1072 C  CD2   . LEU A 1 132 ? 77.173 -11.367 -9.826  1.00 29.36 ? 129  LEU A CD2   1 
ATOM   1073 N  N     . GLN A 1 133 ? 77.887 -9.341  -14.697 1.00 36.98 ? 130  GLN A N     1 
ATOM   1074 C  CA    . GLN A 1 133 ? 78.823 -9.340  -15.823 1.00 37.32 ? 130  GLN A CA    1 
ATOM   1075 C  C     . GLN A 1 133 ? 79.763 -8.136  -15.766 1.00 41.09 ? 130  GLN A C     1 
ATOM   1076 O  O     . GLN A 1 133 ? 80.940 -8.242  -16.107 1.00 50.80 ? 130  GLN A O     1 
ATOM   1077 C  CB    . GLN A 1 133 ? 78.067 -9.354  -17.151 1.00 37.93 ? 130  GLN A CB    1 
ATOM   1078 C  CG    . GLN A 1 133 ? 77.240 -10.616 -17.373 1.00 53.48 ? 130  GLN A CG    1 
ATOM   1079 C  CD    . GLN A 1 133 ? 76.495 -10.612 -18.700 1.00 65.78 ? 130  GLN A CD    1 
ATOM   1080 O  OE1   . GLN A 1 133 ? 77.063 -10.286 -19.744 1.00 75.26 ? 130  GLN A OE1   1 
ATOM   1081 N  NE2   . GLN A 1 133 ? 75.215 -10.973 -18.664 1.00 61.23 ? 130  GLN A NE2   1 
ATOM   1082 N  N     . LYS A 1 134 ? 79.242 -6.995  -15.329 1.00 37.50 ? 131  LYS A N     1 
ATOM   1083 C  CA    . LYS A 1 134 ? 80.062 -5.797  -15.160 1.00 42.64 ? 131  LYS A CA    1 
ATOM   1084 C  C     . LYS A 1 134 ? 81.078 -5.962  -14.028 1.00 52.84 ? 131  LYS A C     1 
ATOM   1085 O  O     . LYS A 1 134 ? 82.203 -5.469  -14.114 1.00 55.13 ? 131  LYS A O     1 
ATOM   1086 C  CB    . LYS A 1 134 ? 79.171 -4.576  -14.903 1.00 38.88 ? 131  LYS A CB    1 
ATOM   1087 C  CG    . LYS A 1 134 ? 79.834 -3.443  -14.125 1.00 46.55 ? 131  LYS A CG    1 
ATOM   1088 C  CD    . LYS A 1 134 ? 79.131 -2.111  -14.370 1.00 48.00 ? 131  LYS A CD    1 
ATOM   1089 C  CE    . LYS A 1 134 ? 77.619 -2.282  -14.396 1.00 40.45 ? 131  LYS A CE    1 
ATOM   1090 N  NZ    . LYS A 1 134 ? 76.893 -1.015  -14.692 1.00 48.06 ? 131  LYS A NZ    1 
ATOM   1091 N  N     . LEU A 1 135 ? 80.683 -6.672  -12.976 1.00 47.34 ? 132  LEU A N     1 
ATOM   1092 C  CA    . LEU A 1 135 ? 81.533 -6.823  -11.801 1.00 51.06 ? 132  LEU A CA    1 
ATOM   1093 C  C     . LEU A 1 135 ? 82.764 -7.688  -12.070 1.00 58.44 ? 132  LEU A C     1 
ATOM   1094 O  O     . LEU A 1 135 ? 83.803 -7.503  -11.435 1.00 63.94 ? 132  LEU A O     1 
ATOM   1095 C  CB    . LEU A 1 135 ? 80.728 -7.404  -10.638 1.00 49.74 ? 132  LEU A CB    1 
ATOM   1096 C  CG    . LEU A 1 135 ? 79.825 -6.397  -9.920  1.00 45.29 ? 132  LEU A CG    1 
ATOM   1097 C  CD1   . LEU A 1 135 ? 79.126 -7.053  -8.742  1.00 40.76 ? 132  LEU A CD1   1 
ATOM   1098 C  CD2   . LEU A 1 135 ? 80.634 -5.193  -9.464  1.00 38.63 ? 132  LEU A CD2   1 
ATOM   1099 N  N     . GLN A 1 136 ? 82.637 -8.627  -13.005 1.00 51.21 ? 133  GLN A N     1 
ATOM   1100 C  CA    . GLN A 1 136 ? 83.749 -9.488  -13.414 1.00 58.94 ? 133  GLN A CA    1 
ATOM   1101 C  C     . GLN A 1 136 ? 84.378 -10.281 -12.267 1.00 59.74 ? 133  GLN A C     1 
ATOM   1102 O  O     . GLN A 1 136 ? 85.592 -10.228 -12.065 1.00 57.69 ? 133  GLN A O     1 
ATOM   1103 C  CB    . GLN A 1 136 ? 84.836 -8.656  -14.101 1.00 56.42 ? 133  GLN A CB    1 
ATOM   1104 C  CG    . GLN A 1 136 ? 84.315 -7.742  -15.193 1.00 65.06 ? 133  GLN A CG    1 
ATOM   1105 C  CD    . GLN A 1 136 ? 85.374 -7.395  -16.219 1.00 73.83 ? 133  GLN A CD    1 
ATOM   1106 O  OE1   . GLN A 1 136 ? 86.561 -7.296  -15.901 1.00 78.55 ? 133  GLN A OE1   1 
ATOM   1107 N  NE2   . GLN A 1 136 ? 84.950 -7.220  -17.465 1.00 75.35 ? 133  GLN A NE2   1 
ATOM   1108 N  N     . GLY A 1 137 ? 83.556 -11.012 -11.519 1.00 56.50 ? 134  GLY A N     1 
ATOM   1109 C  CA    . GLY A 1 137 ? 84.042 -11.854 -10.437 1.00 51.13 ? 134  GLY A CA    1 
ATOM   1110 C  C     . GLY A 1 137 ? 84.710 -11.108 -9.293  1.00 54.32 ? 134  GLY A C     1 
ATOM   1111 O  O     . GLY A 1 137 ? 85.329 -11.718 -8.423  1.00 59.03 ? 134  GLY A O     1 
ATOM   1112 N  N     . GLN A 1 138 ? 84.589 -9.785  -9.296  1.00 49.91 ? 135  GLN A N     1 
ATOM   1113 C  CA    . GLN A 1 138 ? 85.147 -8.952  -8.234  1.00 54.83 ? 135  GLN A CA    1 
ATOM   1114 C  C     . GLN A 1 138 ? 84.207 -8.885  -7.030  1.00 53.03 ? 135  GLN A C     1 
ATOM   1115 O  O     . GLN A 1 138 ? 83.000 -8.701  -7.193  1.00 49.10 ? 135  GLN A O     1 
ATOM   1116 C  CB    . GLN A 1 138 ? 85.433 -7.549  -8.767  1.00 55.70 ? 135  GLN A CB    1 
ATOM   1117 C  CG    . GLN A 1 138 ? 85.485 -6.466  -7.711  1.00 57.65 ? 135  GLN A CG    1 
ATOM   1118 C  CD    . GLN A 1 138 ? 85.786 -5.106  -8.301  1.00 67.25 ? 135  GLN A CD    1 
ATOM   1119 O  OE1   . GLN A 1 138 ? 85.927 -4.961  -9.517  1.00 67.18 ? 135  GLN A OE1   1 
ATOM   1120 N  NE2   . GLN A 1 138 ? 85.889 -4.098  -7.442  1.00 60.76 ? 135  GLN A NE2   1 
ATOM   1121 N  N     . PRO A 1 139 ? 84.763 -9.036  -5.817  1.00 51.32 ? 136  PRO A N     1 
ATOM   1122 C  CA    . PRO A 1 139 ? 83.999 -9.074  -4.563  1.00 45.94 ? 136  PRO A CA    1 
ATOM   1123 C  C     . PRO A 1 139 ? 83.119 -7.848  -4.335  1.00 41.01 ? 136  PRO A C     1 
ATOM   1124 O  O     . PRO A 1 139 ? 83.373 -6.773  -4.877  1.00 41.26 ? 136  PRO A O     1 
ATOM   1125 C  CB    . PRO A 1 139 ? 85.093 -9.153  -3.488  1.00 48.00 ? 136  PRO A CB    1 
ATOM   1126 C  CG    . PRO A 1 139 ? 86.342 -8.689  -4.167  1.00 48.23 ? 136  PRO A CG    1 
ATOM   1127 C  CD    . PRO A 1 139 ? 86.208 -9.165  -5.574  1.00 53.33 ? 136  PRO A CD    1 
ATOM   1128 N  N     . ILE A 1 140 ? 82.081 -8.022  -3.531  1.00 37.23 ? 137  ILE A N     1 
ATOM   1129 C  CA    . ILE A 1 140 ? 81.200 -6.918  -3.198  1.00 30.93 ? 137  ILE A CA    1 
ATOM   1130 C  C     . ILE A 1 140 ? 81.606 -6.320  -1.861  1.00 22.96 ? 137  ILE A C     1 
ATOM   1131 O  O     . ILE A 1 140 ? 81.641 -7.010  -0.837  1.00 30.82 ? 137  ILE A O     1 
ATOM   1132 C  CB    . ILE A 1 140 ? 79.731 -7.371  -3.174  1.00 30.48 ? 137  ILE A CB    1 
ATOM   1133 C  CG1   . ILE A 1 140 ? 79.345 -7.894  -4.563  1.00 30.61 ? 137  ILE A CG1   1 
ATOM   1134 C  CG2   . ILE A 1 140 ? 78.818 -6.228  -2.749  1.00 22.60 ? 137  ILE A CG2   1 
ATOM   1135 C  CD1   . ILE A 1 140 ? 77.903 -8.314  -4.698  1.00 31.71 ? 137  ILE A CD1   1 
ATOM   1136 N  N     . SER A 1 141 ? 81.934 -5.034  -1.891  1.00 21.71 ? 138  SER A N     1 
ATOM   1137 C  CA    . SER A 1 141 ? 82.385 -4.302  -0.709  1.00 26.32 ? 138  SER A CA    1 
ATOM   1138 C  C     . SER A 1 141 ? 81.213 -3.973  0.212   1.00 20.13 ? 138  SER A C     1 
ATOM   1139 O  O     . SER A 1 141 ? 80.115 -3.678  -0.267  1.00 21.85 ? 138  SER A O     1 
ATOM   1140 C  CB    . SER A 1 141 ? 83.105 -3.012  -1.143  1.00 24.68 ? 138  SER A CB    1 
ATOM   1141 O  OG    . SER A 1 141 ? 83.422 -2.174  -0.048  1.00 36.46 ? 138  SER A OG    1 
ATOM   1142 N  N     . ALA A 1 142 ? 81.437 -3.995  1.524   1.00 16.99 ? 139  ALA A N     1 
ATOM   1143 C  CA    . ALA A 1 142 ? 80.403 -3.567  2.463   1.00 19.35 ? 139  ALA A CA    1 
ATOM   1144 C  C     . ALA A 1 142 ? 79.964 -2.121  2.208   1.00 21.07 ? 139  ALA A C     1 
ATOM   1145 O  O     . ALA A 1 142 ? 78.854 -1.731  2.565   1.00 19.62 ? 139  ALA A O     1 
ATOM   1146 C  CB    . ALA A 1 142 ? 80.885 -3.719  3.897   1.00 21.24 ? 139  ALA A CB    1 
ATOM   1147 N  N     . ASP A 1 143 ? 80.845 -1.337  1.596   1.00 22.30 ? 140  ASP A N     1 
ATOM   1148 C  CA    . ASP A 1 143 ? 80.566 0.062   1.297   1.00 24.14 ? 140  ASP A CA    1 
ATOM   1149 C  C     . ASP A 1 143 ? 79.425 0.221   0.301   1.00 22.45 ? 140  ASP A C     1 
ATOM   1150 O  O     . ASP A 1 143 ? 78.770 1.263   0.268   1.00 18.79 ? 140  ASP A O     1 
ATOM   1151 C  CB    . ASP A 1 143 ? 81.821 0.755   0.750   1.00 22.95 ? 140  ASP A CB    1 
ATOM   1152 C  CG    . ASP A 1 143 ? 82.933 0.863   1.784   1.00 39.92 ? 140  ASP A CG    1 
ATOM   1153 O  OD1   . ASP A 1 143 ? 82.636 0.869   2.999   1.00 36.03 ? 140  ASP A OD1   1 
ATOM   1154 O  OD2   . ASP A 1 143 ? 84.110 0.956   1.375   1.00 46.75 ? 140  ASP A OD2   1 
ATOM   1155 N  N     . LEU A 1 144 ? 79.193 -0.807  -0.512  1.00 15.34 ? 141  LEU A N     1 
ATOM   1156 C  CA    . LEU A 1 144 ? 78.107 -0.786  -1.481  1.00 21.05 ? 141  LEU A CA    1 
ATOM   1157 C  C     . LEU A 1 144 ? 76.760 -1.136  -0.840  1.00 19.51 ? 141  LEU A C     1 
ATOM   1158 O  O     . LEU A 1 144 ? 75.727 -1.069  -1.497  1.00 16.18 ? 141  LEU A O     1 
ATOM   1159 C  CB    . LEU A 1 144 ? 78.394 -1.750  -2.628  1.00 17.74 ? 141  LEU A CB    1 
ATOM   1160 C  CG    . LEU A 1 144 ? 79.586 -1.448  -3.541  1.00 20.81 ? 141  LEU A CG    1 
ATOM   1161 C  CD1   . LEU A 1 144 ? 79.677 -2.472  -4.653  1.00 25.62 ? 141  LEU A CD1   1 
ATOM   1162 C  CD2   . LEU A 1 144 ? 79.446 -0.065  -4.132  1.00 21.63 ? 141  LEU A CD2   1 
ATOM   1163 N  N     . LEU A 1 145 ? 76.780 -1.510  0.436   1.00 13.01 ? 142  LEU A N     1 
ATOM   1164 C  CA    . LEU A 1 145 ? 75.562 -1.935  1.141   1.00 15.20 ? 142  LEU A CA    1 
ATOM   1165 C  C     . LEU A 1 145 ? 75.401 -1.199  2.480   1.00 12.52 ? 142  LEU A C     1 
ATOM   1166 O  O     . LEU A 1 145 ? 75.302 -1.812  3.551   1.00 13.52 ? 142  LEU A O     1 
ATOM   1167 C  CB    . LEU A 1 145 ? 75.593 -3.459  1.349   1.00 14.87 ? 142  LEU A CB    1 
ATOM   1168 C  CG    . LEU A 1 145 ? 75.461 -4.327  0.088   1.00 14.68 ? 142  LEU A CG    1 
ATOM   1169 C  CD1   . LEU A 1 145 ? 75.836 -5.803  0.357   1.00 10.43 ? 142  LEU A CD1   1 
ATOM   1170 C  CD2   . LEU A 1 145 ? 74.064 -4.274  -0.509  1.00 15.25 ? 142  LEU A CD2   1 
ATOM   1171 N  N     . PRO A 1 146 ? 75.386 0.146   2.438   1.00 17.80 ? 143  PRO A N     1 
ATOM   1172 C  CA    . PRO A 1 146 ? 75.487 0.924   3.679   1.00 18.79 ? 143  PRO A CA    1 
ATOM   1173 C  C     . PRO A 1 146 ? 74.236 0.936   4.552   1.00 14.39 ? 143  PRO A C     1 
ATOM   1174 O  O     . PRO A 1 146 ? 74.318 1.407   5.681   1.00 18.28 ? 143  PRO A O     1 
ATOM   1175 C  CB    . PRO A 1 146 ? 75.776 2.339   3.167   1.00 19.78 ? 143  PRO A CB    1 
ATOM   1176 C  CG    . PRO A 1 146 ? 75.079 2.389   1.828   1.00 19.68 ? 143  PRO A CG    1 
ATOM   1177 C  CD    . PRO A 1 146 ? 75.309 1.013   1.246   1.00 15.94 ? 143  PRO A CD    1 
ATOM   1178 N  N     . SER A 1 147 ? 73.103 0.436   4.058   1.00 15.81 ? 144  SER A N     1 
ATOM   1179 C  CA    . SER A 1 147 ? 71.882 0.451   4.868   1.00 14.02 ? 144  SER A CA    1 
ATOM   1180 C  C     . SER A 1 147 ? 71.193 -0.922  4.879   1.00 11.45 ? 144  SER A C     1 
ATOM   1181 O  O     . SER A 1 147 ? 70.015 -1.041  5.239   1.00 11.47 ? 144  SER A O     1 
ATOM   1182 C  CB    . SER A 1 147 ? 70.918 1.535   4.364   1.00 17.46 ? 144  SER A CB    1 
ATOM   1183 O  OG    . SER A 1 147 ? 70.423 1.236   3.070   1.00 17.10 ? 144  SER A OG    1 
ATOM   1184 N  N     . THR A 1 148 ? 71.957 -1.948  4.505   1.00 11.02 ? 145  THR A N     1 
ATOM   1185 C  CA    . THR A 1 148 ? 71.450 -3.318  4.361   1.00 10.24 ? 145  THR A CA    1 
ATOM   1186 C  C     . THR A 1 148 ? 71.649 -4.184  5.609   1.00 14.77 ? 145  THR A C     1 
ATOM   1187 O  O     . THR A 1 148 ? 72.728 -4.203  6.207   1.00 15.07 ? 145  THR A O     1 
ATOM   1188 C  CB    . THR A 1 148 ? 72.125 -4.019  3.160   1.00 8.61  ? 145  THR A CB    1 
ATOM   1189 O  OG1   . THR A 1 148 ? 71.746 -3.351  1.958   1.00 10.62 ? 145  THR A OG1   1 
ATOM   1190 C  CG2   . THR A 1 148 ? 71.690 -5.489  3.060   1.00 13.18 ? 145  THR A CG2   1 
ATOM   1191 N  N     . TYR A 1 149 ? 70.589 -4.888  5.977   1.00 10.32 ? 146  TYR A N     1 
ATOM   1192 C  CA    . TYR A 1 149 ? 70.594 -5.909  7.029   1.00 12.91 ? 146  TYR A CA    1 
ATOM   1193 C  C     . TYR A 1 149 ? 70.507 -7.254  6.361   1.00 14.42 ? 146  TYR A C     1 
ATOM   1194 O  O     . TYR A 1 149 ? 69.759 -7.408  5.385   1.00 15.08 ? 146  TYR A O     1 
ATOM   1195 C  CB    . TYR A 1 149 ? 69.402 -5.752  7.976   1.00 13.35 ? 146  TYR A CB    1 
ATOM   1196 C  CG    . TYR A 1 149 ? 69.589 -4.687  9.016   1.00 16.38 ? 146  TYR A CG    1 
ATOM   1197 C  CD1   . TYR A 1 149 ? 70.012 -5.010  10.296  1.00 15.04 ? 146  TYR A CD1   1 
ATOM   1198 C  CD2   . TYR A 1 149 ? 69.332 -3.347  8.715   1.00 13.07 ? 146  TYR A CD2   1 
ATOM   1199 C  CE1   . TYR A 1 149 ? 70.182 -4.026  11.254  1.00 17.57 ? 146  TYR A CE1   1 
ATOM   1200 C  CE2   . TYR A 1 149 ? 69.505 -2.359  9.661   1.00 14.83 ? 146  TYR A CE2   1 
ATOM   1201 C  CZ    . TYR A 1 149 ? 69.928 -2.705  10.929  1.00 18.01 ? 146  TYR A CZ    1 
ATOM   1202 O  OH    . TYR A 1 149 ? 70.104 -1.733  11.878  1.00 27.51 ? 146  TYR A OH    1 
ATOM   1203 N  N     . ILE A 1 150 ? 71.264 -8.220  6.874   1.00 11.70 ? 147  ILE A N     1 
ATOM   1204 C  CA    . ILE A 1 150 ? 71.161 -9.605  6.422   1.00 9.53  ? 147  ILE A CA    1 
ATOM   1205 C  C     . ILE A 1 150 ? 70.394 -10.375 7.484   1.00 10.18 ? 147  ILE A C     1 
ATOM   1206 O  O     . ILE A 1 150 ? 70.899 -10.566 8.595   1.00 14.57 ? 147  ILE A O     1 
ATOM   1207 C  CB    . ILE A 1 150 ? 72.534 -10.249 6.229   1.00 11.11 ? 147  ILE A CB    1 
ATOM   1208 C  CG1   . ILE A 1 150 ? 73.419 -9.379  5.324   1.00 12.14 ? 147  ILE A CG1   1 
ATOM   1209 C  CG2   . ILE A 1 150 ? 72.377 -11.682 5.663   1.00 12.63 ? 147  ILE A CG2   1 
ATOM   1210 C  CD1   . ILE A 1 150 ? 72.853 -9.173  3.906   1.00 12.09 ? 147  ILE A CD1   1 
ATOM   1211 N  N     . GLU A 1 151 ? 69.170 -10.786 7.173   1.00 9.19  ? 148  GLU A N     1 
ATOM   1212 C  CA    . GLU A 1 151 ? 68.336 -11.409 8.195   1.00 9.98  ? 148  GLU A CA    1 
ATOM   1213 C  C     . GLU A 1 151 ? 68.944 -12.725 8.677   1.00 11.44 ? 148  GLU A C     1 
ATOM   1214 O  O     . GLU A 1 151 ? 69.315 -13.573 7.857   1.00 14.18 ? 148  GLU A O     1 
ATOM   1215 C  CB    . GLU A 1 151 ? 66.919 -11.661 7.664   1.00 10.87 ? 148  GLU A CB    1 
ATOM   1216 C  CG    . GLU A 1 151 ? 66.016 -12.455 8.639   1.00 13.21 ? 148  GLU A CG    1 
ATOM   1217 C  CD    . GLU A 1 151 ? 65.780 -11.760 9.978   1.00 18.04 ? 148  GLU A CD    1 
ATOM   1218 O  OE1   . GLU A 1 151 ? 65.494 -12.467 10.966  1.00 18.04 ? 148  GLU A OE1   1 
ATOM   1219 O  OE2   . GLU A 1 151 ? 65.878 -10.516 10.051  1.00 17.66 ? 148  GLU A OE2   1 
ATOM   1220 N  N     . GLY A 1 152 ? 69.026 -12.867 10.007  1.00 11.56 ? 149  GLY A N     1 
ATOM   1221 C  CA    . GLY A 1 152 ? 69.567 -14.049 10.665  1.00 16.03 ? 149  GLY A CA    1 
ATOM   1222 C  C     . GLY A 1 152 ? 71.027 -13.914 11.071  1.00 17.45 ? 149  GLY A C     1 
ATOM   1223 O  O     . GLY A 1 152 ? 71.573 -14.767 11.781  1.00 19.25 ? 149  GLY A O     1 
ATOM   1224 N  N     . LEU A 1 153 ? 71.674 -12.850 10.614  1.00 14.89 ? 150  LEU A N     1 
ATOM   1225 C  CA    . LEU A 1 153 ? 73.065 -12.598 10.988  1.00 17.49 ? 150  LEU A CA    1 
ATOM   1226 C  C     . LEU A 1 153 ? 73.181 -11.307 11.797  1.00 21.06 ? 150  LEU A C     1 
ATOM   1227 O  O     . LEU A 1 153 ? 72.316 -10.439 11.709  1.00 16.52 ? 150  LEU A O     1 
ATOM   1228 C  CB    . LEU A 1 153 ? 73.949 -12.540 9.745   1.00 15.14 ? 150  LEU A CB    1 
ATOM   1229 C  CG    . LEU A 1 153 ? 73.970 -13.825 8.923   1.00 16.40 ? 150  LEU A CG    1 
ATOM   1230 C  CD1   . LEU A 1 153 ? 74.838 -13.651 7.696   1.00 12.49 ? 150  LEU A CD1   1 
ATOM   1231 C  CD2   . LEU A 1 153 ? 74.456 -14.995 9.780   1.00 19.56 ? 150  LEU A CD2   1 
ATOM   1232 N  N     . PRO A 1 154 ? 74.238 -11.180 12.625  1.00 16.51 ? 151  PRO A N     1 
ATOM   1233 C  CA    . PRO A 1 154 ? 75.306 -12.159 12.879  1.00 19.32 ? 151  PRO A CA    1 
ATOM   1234 C  C     . PRO A 1 154 ? 74.856 -13.319 13.753  1.00 17.73 ? 151  PRO A C     1 
ATOM   1235 O  O     . PRO A 1 154 ? 73.852 -13.235 14.456  1.00 20.20 ? 151  PRO A O     1 
ATOM   1236 C  CB    . PRO A 1 154 ? 76.370 -11.332 13.609  1.00 18.83 ? 151  PRO A CB    1 
ATOM   1237 C  CG    . PRO A 1 154 ? 75.581 -10.277 14.318  1.00 20.81 ? 151  PRO A CG    1 
ATOM   1238 C  CD    . PRO A 1 154 ? 74.443 -9.932  13.380  1.00 17.62 ? 151  PRO A CD    1 
ATOM   1239 N  N     . GLN A 1 155 ? 75.624 -14.398 13.724  1.00 19.98 ? 152  GLN A N     1 
ATOM   1240 C  CA    . GLN A 1 155 ? 75.307 -15.569 14.530  1.00 22.96 ? 152  GLN A CA    1 
ATOM   1241 C  C     . GLN A 1 155 ? 76.597 -16.212 14.990  1.00 35.99 ? 152  GLN A C     1 
ATOM   1242 O  O     . GLN A 1 155 ? 77.680 -15.818 14.549  1.00 33.83 ? 152  GLN A O     1 
ATOM   1243 C  CB    . GLN A 1 155 ? 74.493 -16.588 13.737  1.00 27.88 ? 152  GLN A CB    1 
ATOM   1244 C  CG    . GLN A 1 155 ? 75.363 -17.375 12.778  1.00 39.40 ? 152  GLN A CG    1 
ATOM   1245 C  CD    . GLN A 1 155 ? 74.738 -18.673 12.317  1.00 42.12 ? 152  GLN A CD    1 
ATOM   1246 O  OE1   . GLN A 1 155 ? 73.572 -18.967 12.609  1.00 37.25 ? 152  GLN A OE1   1 
ATOM   1247 N  NE2   . GLN A 1 155 ? 75.518 -19.466 11.582  1.00 36.74 ? 152  GLN A NE2   1 
ATOM   1248 N  N     . GLY A 1 156 ? 76.471 -17.206 15.866  1.00 37.48 ? 153  GLY A N     1 
ATOM   1249 C  CA    . GLY A 1 156 ? 77.588 -18.058 16.236  1.00 42.77 ? 153  GLY A CA    1 
ATOM   1250 C  C     . GLY A 1 156 ? 78.644 -17.414 17.115  1.00 46.67 ? 153  GLY A C     1 
ATOM   1251 O  O     . GLY A 1 156 ? 78.444 -16.316 17.638  1.00 48.13 ? 153  GLY A O     1 
ATOM   1252 N  N     . PRO A 1 157 ? 79.782 -18.109 17.279  1.00 52.57 ? 154  PRO A N     1 
ATOM   1253 C  CA    . PRO A 1 157 ? 80.933 -17.700 18.094  1.00 50.89 ? 154  PRO A CA    1 
ATOM   1254 C  C     . PRO A 1 157 ? 81.763 -16.587 17.452  1.00 40.21 ? 154  PRO A C     1 
ATOM   1255 O  O     . PRO A 1 157 ? 81.972 -16.612 16.237  1.00 55.41 ? 154  PRO A O     1 
ATOM   1256 C  CB    . PRO A 1 157 ? 81.751 -18.990 18.203  1.00 36.63 ? 154  PRO A CB    1 
ATOM   1257 C  CG    . PRO A 1 157 ? 81.427 -19.731 16.953  1.00 34.00 ? 154  PRO A CG    1 
ATOM   1258 C  CD    . PRO A 1 157 ? 79.981 -19.440 16.675  1.00 40.75 ? 154  PRO A CD    1 
ATOM   1259 N  N     . THR A 1 163 ? 79.858 -6.039  20.384  1.00 55.75 ? 160  THR A N     1 
ATOM   1260 C  CA    . THR A 1 163 ? 79.313 -4.686  20.326  1.00 55.65 ? 160  THR A CA    1 
ATOM   1261 C  C     . THR A 1 163 ? 77.835 -4.673  20.713  1.00 54.69 ? 160  THR A C     1 
ATOM   1262 O  O     . THR A 1 163 ? 77.128 -5.672  20.555  1.00 56.25 ? 160  THR A O     1 
ATOM   1263 C  CB    . THR A 1 163 ? 79.484 -4.062  18.925  1.00 58.40 ? 160  THR A CB    1 
ATOM   1264 O  OG1   . THR A 1 163 ? 78.849 -2.778  18.889  1.00 58.10 ? 160  THR A OG1   1 
ATOM   1265 C  CG2   . THR A 1 163 ? 78.868 -4.956  17.859  1.00 51.88 ? 160  THR A CG2   1 
ATOM   1266 N  N     . VAL A 1 164 ? 77.368 -3.534  21.212  1.00 44.66 ? 161  VAL A N     1 
ATOM   1267 C  CA    . VAL A 1 164 ? 76.041 -3.469  21.807  1.00 49.21 ? 161  VAL A CA    1 
ATOM   1268 C  C     . VAL A 1 164 ? 75.091 -2.476  21.133  1.00 43.90 ? 161  VAL A C     1 
ATOM   1269 O  O     . VAL A 1 164 ? 73.965 -2.292  21.599  1.00 44.61 ? 161  VAL A O     1 
ATOM   1270 C  CB    . VAL A 1 164 ? 76.133 -3.106  23.308  1.00 48.18 ? 161  VAL A CB    1 
ATOM   1271 C  CG1   . VAL A 1 164 ? 76.906 -4.175  24.075  1.00 36.99 ? 161  VAL A CG1   1 
ATOM   1272 C  CG2   . VAL A 1 164 ? 76.776 -1.737  23.487  1.00 45.11 ? 161  VAL A CG2   1 
ATOM   1273 N  N     . GLN A 1 165 ? 75.527 -1.841  20.046  1.00 37.80 ? 162  GLN A N     1 
ATOM   1274 C  CA    . GLN A 1 165 ? 74.685 -0.844  19.379  1.00 38.57 ? 162  GLN A CA    1 
ATOM   1275 C  C     . GLN A 1 165 ? 74.215 -1.324  18.003  1.00 38.78 ? 162  GLN A C     1 
ATOM   1276 O  O     . GLN A 1 165 ? 74.877 -2.137  17.356  1.00 36.70 ? 162  GLN A O     1 
ATOM   1277 C  CB    . GLN A 1 165 ? 75.415 0.498   19.255  1.00 44.97 ? 162  GLN A CB    1 
ATOM   1278 C  CG    . GLN A 1 165 ? 76.162 0.719   17.945  1.00 49.88 ? 162  GLN A CG    1 
ATOM   1279 C  CD    . GLN A 1 165 ? 77.593 0.207   17.977  1.00 58.31 ? 162  GLN A CD    1 
ATOM   1280 O  OE1   . GLN A 1 165 ? 77.924 -0.704  18.739  1.00 59.64 ? 162  GLN A OE1   1 
ATOM   1281 N  NE2   . GLN A 1 165 ? 78.453 0.797   17.149  1.00 50.11 ? 162  GLN A NE2   1 
ATOM   1282 N  N     . LYS A 1 166 ? 73.069 -0.804  17.571  1.00 32.05 ? 163  LYS A N     1 
ATOM   1283 C  CA    . LYS A 1 166 ? 72.355 -1.321  16.404  1.00 33.06 ? 163  LYS A CA    1 
ATOM   1284 C  C     . LYS A 1 166 ? 73.174 -1.348  15.112  1.00 25.80 ? 163  LYS A C     1 
ATOM   1285 O  O     . LYS A 1 166 ? 73.181 -2.355  14.397  1.00 23.70 ? 163  LYS A O     1 
ATOM   1286 C  CB    . LYS A 1 166 ? 71.078 -0.507  16.168  1.00 37.50 ? 163  LYS A CB    1 
ATOM   1287 C  CG    . LYS A 1 166 ? 70.371 -0.876  14.874  1.00 41.00 ? 163  LYS A CG    1 
ATOM   1288 C  CD    . LYS A 1 166 ? 68.973 -0.284  14.777  1.00 49.40 ? 163  LYS A CD    1 
ATOM   1289 C  CE    . LYS A 1 166 ? 68.997 1.150   14.268  1.00 51.84 ? 163  LYS A CE    1 
ATOM   1290 N  NZ    . LYS A 1 166 ? 67.661 1.549   13.723  1.00 50.14 ? 163  LYS A NZ    1 
ATOM   1291 N  N     . GLU A 1 167 ? 73.836 -0.242  14.798  1.00 28.76 ? 164  GLU A N     1 
ATOM   1292 C  CA    . GLU A 1 167 ? 74.608 -0.156  13.564  1.00 29.42 ? 164  GLU A CA    1 
ATOM   1293 C  C     . GLU A 1 167 ? 75.781 -1.130  13.610  1.00 27.34 ? 164  GLU A C     1 
ATOM   1294 O  O     . GLU A 1 167 ? 76.194 -1.681  12.587  1.00 24.02 ? 164  GLU A O     1 
ATOM   1295 C  CB    . GLU A 1 167 ? 75.094 1.284   13.330  1.00 30.24 ? 164  GLU A CB    1 
ATOM   1296 C  CG    . GLU A 1 167 ? 76.110 1.471   12.192  1.00 25.81 ? 164  GLU A CG    1 
ATOM   1297 C  CD    . GLU A 1 167 ? 75.564 1.134   10.806  1.00 34.35 ? 164  GLU A CD    1 
ATOM   1298 O  OE1   . GLU A 1 167 ? 76.388 1.044   9.861   1.00 29.22 ? 164  GLU A OE1   1 
ATOM   1299 O  OE2   . GLU A 1 167 ? 74.326 0.973   10.652  1.00 32.12 ? 164  GLU A OE2   1 
ATOM   1300 N  N     . GLY A 1 168 ? 76.308 -1.342  14.811  1.00 31.48 ? 165  GLY A N     1 
ATOM   1301 C  CA    . GLY A 1 168 ? 77.410 -2.262  15.001  1.00 29.25 ? 165  GLY A CA    1 
ATOM   1302 C  C     . GLY A 1 168 ? 76.977 -3.667  14.646  1.00 20.93 ? 165  GLY A C     1 
ATOM   1303 O  O     . GLY A 1 168 ? 77.683 -4.375  13.927  1.00 24.76 ? 165  GLY A O     1 
ATOM   1304 N  N     . MET A 1 169 ? 75.808 -4.060  15.152  1.00 25.57 ? 166  MET A N     1 
ATOM   1305 C  CA    . MET A 1 169 ? 75.213 -5.356  14.837  1.00 19.74 ? 166  MET A CA    1 
ATOM   1306 C  C     . MET A 1 169 ? 74.979 -5.494  13.340  1.00 21.98 ? 166  MET A C     1 
ATOM   1307 O  O     . MET A 1 169 ? 75.292 -6.530  12.752  1.00 19.70 ? 166  MET A O     1 
ATOM   1308 C  CB    . MET A 1 169 ? 73.893 -5.543  15.592  1.00 31.20 ? 166  MET A CB    1 
ATOM   1309 C  CG    . MET A 1 169 ? 74.037 -5.588  17.110  1.00 43.91 ? 166  MET A CG    1 
ATOM   1310 S  SD    . MET A 1 169 ? 74.758 -7.140  17.689  1.00 59.53 ? 166  MET A SD    1 
ATOM   1311 C  CE    . MET A 1 169 ? 73.586 -8.318  17.009  1.00 33.80 ? 166  MET A CE    1 
ATOM   1312 N  N     . ARG A 1 170 ? 74.442 -4.448  12.716  1.00 20.95 ? 167  ARG A N     1 
ATOM   1313 C  CA    . ARG A 1 170 ? 74.186 -4.500  11.274  1.00 17.64 ? 167  ARG A CA    1 
ATOM   1314 C  C     . ARG A 1 170 ? 75.460 -4.853  10.519  1.00 18.19 ? 167  ARG A C     1 
ATOM   1315 O  O     . ARG A 1 170 ? 75.450 -5.737  9.666   1.00 16.11 ? 167  ARG A O     1 
ATOM   1316 C  CB    . ARG A 1 170 ? 73.626 -3.172  10.747  1.00 19.27 ? 167  ARG A CB    1 
ATOM   1317 C  CG    . ARG A 1 170 ? 73.185 -3.248  9.280   1.00 17.78 ? 167  ARG A CG    1 
ATOM   1318 C  CD    . ARG A 1 170 ? 73.029 -1.859  8.637   1.00 17.29 ? 167  ARG A CD    1 
ATOM   1319 N  NE    . ARG A 1 170 ? 74.310 -1.178  8.439   1.00 16.86 ? 167  ARG A NE    1 
ATOM   1320 C  CZ    . ARG A 1 170 ? 75.100 -1.349  7.380   1.00 17.11 ? 167  ARG A CZ    1 
ATOM   1321 N  NH1   . ARG A 1 170 ? 74.766 -2.198  6.417   1.00 15.55 ? 167  ARG A NH1   1 
ATOM   1322 N  NH2   . ARG A 1 170 ? 76.239 -0.681  7.284   1.00 22.10 ? 167  ARG A NH2   1 
ATOM   1323 N  N     . LYS A 1 171 ? 76.558 -4.165  10.833  1.00 15.34 ? 168  LYS A N     1 
ATOM   1324 C  CA    . LYS A 1 171 ? 77.802 -4.397  10.107  1.00 17.17 ? 168  LYS A CA    1 
ATOM   1325 C  C     . LYS A 1 171 ? 78.357 -5.785  10.386  1.00 19.23 ? 168  LYS A C     1 
ATOM   1326 O  O     . LYS A 1 171 ? 78.909 -6.423  9.485   1.00 18.22 ? 168  LYS A O     1 
ATOM   1327 C  CB    . LYS A 1 171 ? 78.851 -3.339  10.456  1.00 22.75 ? 168  LYS A CB    1 
ATOM   1328 C  CG    . LYS A 1 171 ? 78.567 -1.954  9.894   1.00 28.03 ? 168  LYS A CG    1 
ATOM   1329 C  CD    . LYS A 1 171 ? 79.826 -1.080  10.002  1.00 40.98 ? 168  LYS A CD    1 
ATOM   1330 C  CE    . LYS A 1 171 ? 79.660 0.260   9.298   1.00 42.63 ? 168  LYS A CE    1 
ATOM   1331 N  NZ    . LYS A 1 171 ? 78.821 1.206   10.088  1.00 48.15 ? 168  LYS A NZ    1 
ATOM   1332 N  N     . GLN A 1 172 ? 78.220 -6.254  11.623  1.00 19.86 ? 169  GLN A N     1 
ATOM   1333 C  CA    . GLN A 1 172 ? 78.722 -7.584  11.967  1.00 21.37 ? 169  GLN A CA    1 
ATOM   1334 C  C     . GLN A 1 172 ? 78.045 -8.627  11.082  1.00 17.04 ? 169  GLN A C     1 
ATOM   1335 O  O     . GLN A 1 172 ? 78.698 -9.483  10.499  1.00 16.30 ? 169  GLN A O     1 
ATOM   1336 C  CB    . GLN A 1 172 ? 78.481 -7.909  13.443  1.00 22.76 ? 169  GLN A CB    1 
ATOM   1337 C  CG    . GLN A 1 172 ? 79.341 -7.115  14.413  1.00 34.81 ? 169  GLN A CG    1 
ATOM   1338 C  CD    . GLN A 1 172 ? 80.437 -7.961  15.038  1.00 58.60 ? 169  GLN A CD    1 
ATOM   1339 O  OE1   . GLN A 1 172 ? 81.599 -7.883  14.639  1.00 60.54 ? 169  GLN A OE1   1 
ATOM   1340 N  NE2   . GLN A 1 172 ? 80.070 -8.778  16.021  1.00 61.46 ? 169  GLN A NE2   1 
ATOM   1341 N  N     . GLY A 1 173 ? 76.727 -8.525  10.959  1.00 19.77 ? 170  GLY A N     1 
ATOM   1342 C  CA    . GLY A 1 173 ? 75.986 -9.474  10.150  1.00 16.87 ? 170  GLY A CA    1 
ATOM   1343 C  C     . GLY A 1 173 ? 76.367 -9.382  8.687   1.00 16.87 ? 170  GLY A C     1 
ATOM   1344 O  O     . GLY A 1 173 ? 76.539 -10.401 8.013   1.00 16.98 ? 170  GLY A O     1 
ATOM   1345 N  N     . LEU A 1 174 ? 76.507 -8.153  8.197   1.00 14.01 ? 171  LEU A N     1 
ATOM   1346 C  CA    . LEU A 1 174 ? 76.863 -7.918  6.808   1.00 13.93 ? 171  LEU A CA    1 
ATOM   1347 C  C     . LEU A 1 174 ? 78.250 -8.493  6.519   1.00 14.53 ? 171  LEU A C     1 
ATOM   1348 O  O     . LEU A 1 174 ? 78.478 -9.128  5.485   1.00 16.15 ? 171  LEU A O     1 
ATOM   1349 C  CB    . LEU A 1 174 ? 76.817 -6.414  6.479   1.00 15.44 ? 171  LEU A CB    1 
ATOM   1350 C  CG    . LEU A 1 174 ? 77.175 -6.105  5.023   1.00 16.30 ? 171  LEU A CG    1 
ATOM   1351 C  CD1   . LEU A 1 174 ? 76.231 -6.794  4.035   1.00 17.71 ? 171  LEU A CD1   1 
ATOM   1352 C  CD2   . LEU A 1 174 ? 77.210 -4.603  4.774   1.00 17.99 ? 171  LEU A CD2   1 
ATOM   1353 N  N     . PHE A 1 175 ? 79.172 -8.291  7.453   1.00 15.45 ? 172  PHE A N     1 
ATOM   1354 C  CA    . PHE A 1 175 ? 80.522 -8.807  7.272   1.00 19.27 ? 172  PHE A CA    1 
ATOM   1355 C  C     . PHE A 1 175 ? 80.515 -10.337 7.173   1.00 18.36 ? 172  PHE A C     1 
ATOM   1356 O  O     . PHE A 1 175 ? 81.151 -10.898 6.283   1.00 20.15 ? 172  PHE A O     1 
ATOM   1357 C  CB    . PHE A 1 175 ? 81.432 -8.355  8.405   1.00 18.07 ? 172  PHE A CB    1 
ATOM   1358 C  CG    . PHE A 1 175 ? 81.824 -6.907  8.327   1.00 31.80 ? 172  PHE A CG    1 
ATOM   1359 C  CD1   . PHE A 1 175 ? 81.969 -6.280  7.100   1.00 36.05 ? 172  PHE A CD1   1 
ATOM   1360 C  CD2   . PHE A 1 175 ? 82.045 -6.173  9.483   1.00 32.20 ? 172  PHE A CD2   1 
ATOM   1361 C  CE1   . PHE A 1 175 ? 82.332 -4.945  7.025   1.00 42.89 ? 172  PHE A CE1   1 
ATOM   1362 C  CE2   . PHE A 1 175 ? 82.411 -4.837  9.418   1.00 44.33 ? 172  PHE A CE2   1 
ATOM   1363 C  CZ    . PHE A 1 175 ? 82.551 -4.221  8.186   1.00 43.74 ? 172  PHE A CZ    1 
ATOM   1364 N  N     . GLN A 1 176 ? 79.803 -11.005 8.079   1.00 18.16 ? 173  GLN A N     1 
ATOM   1365 C  CA    . GLN A 1 176 ? 79.736 -12.469 8.051   1.00 18.26 ? 173  GLN A CA    1 
ATOM   1366 C  C     . GLN A 1 176 ? 79.194 -12.938 6.711   1.00 18.02 ? 173  GLN A C     1 
ATOM   1367 O  O     . GLN A 1 176 ? 79.693 -13.895 6.113   1.00 22.88 ? 173  GLN A O     1 
ATOM   1368 C  CB    . GLN A 1 176 ? 78.859 -13.017 9.187   1.00 17.59 ? 173  GLN A CB    1 
ATOM   1369 C  CG    . GLN A 1 176 ? 79.450 -12.855 10.584  1.00 17.88 ? 173  GLN A CG    1 
ATOM   1370 C  CD    . GLN A 1 176 ? 78.636 -13.563 11.651  1.00 24.12 ? 173  GLN A CD    1 
ATOM   1371 O  OE1   . GLN A 1 176 ? 77.537 -14.051 11.393  1.00 22.68 ? 173  GLN A OE1   1 
ATOM   1372 N  NE2   . GLN A 1 176 ? 79.182 -13.632 12.861  1.00 30.96 ? 173  GLN A NE2   1 
ATOM   1373 N  N     . TRP A 1 177 ? 78.165 -12.237 6.240   1.00 16.51 ? 174  TRP A N     1 
ATOM   1374 C  CA    . TRP A 1 177 ? 77.523 -12.566 4.983   1.00 13.39 ? 174  TRP A CA    1 
ATOM   1375 C  C     . TRP A 1 177 ? 78.490 -12.419 3.815   1.00 16.05 ? 174  TRP A C     1 
ATOM   1376 O  O     . TRP A 1 177 ? 78.630 -13.326 3.001   1.00 19.03 ? 174  TRP A O     1 
ATOM   1377 C  CB    . TRP A 1 177 ? 76.296 -11.666 4.758   1.00 12.68 ? 174  TRP A CB    1 
ATOM   1378 C  CG    . TRP A 1 177 ? 75.616 -11.856 3.419   1.00 14.01 ? 174  TRP A CG    1 
ATOM   1379 C  CD1   . TRP A 1 177 ? 75.707 -11.030 2.330   1.00 12.62 ? 174  TRP A CD1   1 
ATOM   1380 C  CD2   . TRP A 1 177 ? 74.737 -12.931 3.034   1.00 14.28 ? 174  TRP A CD2   1 
ATOM   1381 N  NE1   . TRP A 1 177 ? 74.941 -11.517 1.303   1.00 15.09 ? 174  TRP A NE1   1 
ATOM   1382 C  CE2   . TRP A 1 177 ? 74.334 -12.681 1.702   1.00 16.30 ? 174  TRP A CE2   1 
ATOM   1383 C  CE3   . TRP A 1 177 ? 74.247 -14.069 3.687   1.00 14.41 ? 174  TRP A CE3   1 
ATOM   1384 C  CZ2   . TRP A 1 177 ? 73.467 -13.533 1.004   1.00 12.92 ? 174  TRP A CZ2   1 
ATOM   1385 C  CZ3   . TRP A 1 177 ? 73.386 -14.923 2.996   1.00 14.58 ? 174  TRP A CZ3   1 
ATOM   1386 C  CH2   . TRP A 1 177 ? 73.002 -14.646 1.665   1.00 15.73 ? 174  TRP A CH2   1 
ATOM   1387 N  N     . LEU A 1 178 ? 79.147 -11.269 3.736   1.00 17.62 ? 175  LEU A N     1 
ATOM   1388 C  CA    . LEU A 1 178 ? 80.059 -11.009 2.629   1.00 16.59 ? 175  LEU A CA    1 
ATOM   1389 C  C     . LEU A 1 178 ? 81.287 -11.914 2.690   1.00 22.02 ? 175  LEU A C     1 
ATOM   1390 O  O     . LEU A 1 178 ? 81.776 -12.374 1.662   1.00 26.87 ? 175  LEU A O     1 
ATOM   1391 C  CB    . LEU A 1 178 ? 80.488 -9.550  2.619   1.00 17.17 ? 175  LEU A CB    1 
ATOM   1392 C  CG    . LEU A 1 178 ? 79.367 -8.570  2.279   1.00 18.92 ? 175  LEU A CG    1 
ATOM   1393 C  CD1   . LEU A 1 178 ? 79.917 -7.152  2.256   1.00 16.09 ? 175  LEU A CD1   1 
ATOM   1394 C  CD2   . LEU A 1 178 ? 78.743 -8.917  0.928   1.00 13.68 ? 175  LEU A CD2   1 
ATOM   1395 N  N     . ASP A 1 179 ? 81.766 -12.170 3.902   1.00 24.02 ? 176  ASP A N     1 
ATOM   1396 C  CA    . ASP A 1 179 ? 82.909 -13.061 4.103   1.00 31.67 ? 176  ASP A CA    1 
ATOM   1397 C  C     . ASP A 1 179 ? 82.627 -14.459 3.581   1.00 27.96 ? 176  ASP A C     1 
ATOM   1398 O  O     . ASP A 1 179 ? 83.532 -15.137 3.101   1.00 31.50 ? 176  ASP A O     1 
ATOM   1399 C  CB    . ASP A 1 179 ? 83.289 -13.131 5.582   1.00 20.88 ? 176  ASP A CB    1 
ATOM   1400 C  CG    . ASP A 1 179 ? 84.154 -11.969 6.011   1.00 37.32 ? 176  ASP A CG    1 
ATOM   1401 O  OD1   . ASP A 1 179 ? 84.863 -11.415 5.145   1.00 47.24 ? 176  ASP A OD1   1 
ATOM   1402 O  OD2   . ASP A 1 179 ? 84.130 -11.609 7.209   1.00 50.59 ? 176  ASP A OD2   1 
ATOM   1403 N  N     . SER A 1 180 ? 81.368 -14.877 3.661   1.00 20.57 ? 177  SER A N     1 
ATOM   1404 C  CA    . SER A 1 180 ? 80.960 -16.204 3.199   1.00 26.11 ? 177  SER A CA    1 
ATOM   1405 C  C     . SER A 1 180 ? 80.680 -16.314 1.697   1.00 29.82 ? 177  SER A C     1 
ATOM   1406 O  O     . SER A 1 180 ? 80.680 -17.416 1.149   1.00 39.49 ? 177  SER A O     1 
ATOM   1407 C  CB    . SER A 1 180 ? 79.709 -16.653 3.959   1.00 27.19 ? 177  SER A CB    1 
ATOM   1408 O  OG    . SER A 1 180 ? 79.921 -16.597 5.357   1.00 37.34 ? 177  SER A OG    1 
ATOM   1409 N  N     . LEU A 1 181 ? 80.417 -15.188 1.038   1.00 22.43 ? 178  LEU A N     1 
ATOM   1410 C  CA    . LEU A 1 181 ? 79.933 -15.204 -0.347  1.00 21.56 ? 178  LEU A CA    1 
ATOM   1411 C  C     . LEU A 1 181 ? 80.846 -15.880 -1.370  1.00 34.48 ? 178  LEU A C     1 
ATOM   1412 O  O     . LEU A 1 181 ? 82.047 -15.622 -1.409  1.00 37.34 ? 178  LEU A O     1 
ATOM   1413 C  CB    . LEU A 1 181 ? 79.666 -13.769 -0.821  1.00 29.27 ? 178  LEU A CB    1 
ATOM   1414 C  CG    . LEU A 1 181 ? 78.243 -13.212 -0.730  1.00 32.40 ? 178  LEU A CG    1 
ATOM   1415 C  CD1   . LEU A 1 181 ? 78.124 -11.910 -1.541  1.00 18.08 ? 178  LEU A CD1   1 
ATOM   1416 C  CD2   . LEU A 1 181 ? 77.216 -14.239 -1.194  1.00 27.48 ? 178  LEU A CD2   1 
ATOM   1417 N  N     . GLN A 1 182 ? 80.256 -16.722 -2.218  1.00 36.99 ? 179  GLN A N     1 
ATOM   1418 C  CA    . GLN A 1 182 ? 80.984 -17.336 -3.327  1.00 50.54 ? 179  GLN A CA    1 
ATOM   1419 C  C     . GLN A 1 182 ? 80.810 -16.530 -4.622  1.00 52.36 ? 179  GLN A C     1 
ATOM   1420 O  O     . GLN A 1 182 ? 79.922 -16.822 -5.427  1.00 52.91 ? 179  GLN A O     1 
ATOM   1421 C  CB    . GLN A 1 182 ? 80.515 -18.779 -3.534  1.00 57.54 ? 179  GLN A CB    1 
ATOM   1422 C  CG    . GLN A 1 182 ? 81.632 -19.772 -3.847  1.00 66.14 ? 179  GLN A CG    1 
ATOM   1423 C  CD    . GLN A 1 182 ? 82.589 -19.985 -2.678  1.00 67.38 ? 179  GLN A CD    1 
ATOM   1424 O  OE1   . GLN A 1 182 ? 83.798 -19.782 -2.807  1.00 67.82 ? 179  GLN A OE1   1 
ATOM   1425 N  NE2   . GLN A 1 182 ? 82.051 -20.406 -1.534  1.00 58.05 ? 179  GLN A NE2   1 
ATOM   1426 N  N     . ILE A 1 183 ? 81.667 -15.529 -4.826  1.00 51.00 ? 180  ILE A N     1 
ATOM   1427 C  CA    . ILE A 1 183 ? 81.496 -14.587 -5.936  1.00 54.86 ? 180  ILE A CA    1 
ATOM   1428 C  C     . ILE A 1 183 ? 81.981 -15.113 -7.290  1.00 56.14 ? 180  ILE A C     1 
ATOM   1429 O  O     . ILE A 1 183 ? 81.806 -14.455 -8.319  1.00 57.26 ? 180  ILE A O     1 
ATOM   1430 C  CB    . ILE A 1 183 ? 82.207 -13.242 -5.646  1.00 46.92 ? 180  ILE A CB    1 
ATOM   1431 C  CG1   . ILE A 1 183 ? 83.558 -13.467 -4.963  1.00 56.78 ? 180  ILE A CG1   1 
ATOM   1432 C  CG2   . ILE A 1 183 ? 81.330 -12.357 -4.779  1.00 47.72 ? 180  ILE A CG2   1 
ATOM   1433 C  CD1   . ILE A 1 183 ? 84.703 -13.725 -5.916  1.00 57.23 ? 180  ILE A CD1   1 
ATOM   1434 N  N     . ASP A 1 184 ? 82.586 -16.296 -7.289  1.00 58.16 ? 181  ASP A N     1 
ATOM   1435 C  CA    . ASP A 1 184 ? 83.036 -16.919 -8.529  1.00 55.39 ? 181  ASP A CA    1 
ATOM   1436 C  C     . ASP A 1 184 ? 81.865 -17.535 -9.296  1.00 61.34 ? 181  ASP A C     1 
ATOM   1437 O  O     . ASP A 1 184 ? 81.969 -17.802 -10.494 1.00 63.01 ? 181  ASP A O     1 
ATOM   1438 C  CB    . ASP A 1 184 ? 84.091 -17.987 -8.236  1.00 52.91 ? 181  ASP A CB    1 
ATOM   1439 C  CG    . ASP A 1 184 ? 83.604 -19.026 -7.243  1.00 65.71 ? 181  ASP A CG    1 
ATOM   1440 O  OD1   . ASP A 1 184 ? 83.673 -18.756 -6.024  1.00 65.96 ? 181  ASP A OD1   1 
ATOM   1441 O  OD2   . ASP A 1 184 ? 83.149 -20.107 -7.678  1.00 66.13 ? 181  ASP A OD2   1 
ATOM   1442 N  N     . ASN A 1 185 ? 80.751 -17.758 -8.604  1.00 53.38 ? 182  ASN A N     1 
ATOM   1443 C  CA    . ASN A 1 185 ? 79.603 -18.426 -9.214  1.00 55.85 ? 182  ASN A CA    1 
ATOM   1444 C  C     . ASN A 1 185 ? 78.485 -17.458 -9.598  1.00 50.29 ? 182  ASN A C     1 
ATOM   1445 O  O     . ASN A 1 185 ? 77.715 -17.017 -8.745  1.00 41.54 ? 182  ASN A O     1 
ATOM   1446 C  CB    . ASN A 1 185 ? 79.056 -19.502 -8.272  1.00 46.43 ? 182  ASN A CB    1 
ATOM   1447 C  CG    . ASN A 1 185 ? 77.941 -20.319 -8.902  1.00 46.21 ? 182  ASN A CG    1 
ATOM   1448 O  OD1   . ASN A 1 185 ? 77.732 -20.281 -10.118 1.00 44.07 ? 182  ASN A OD1   1 
ATOM   1449 N  ND2   . ASN A 1 185 ? 77.218 -21.071 -8.074  1.00 48.29 ? 182  ASN A ND2   1 
ATOM   1450 N  N     . LEU A 1 186 ? 78.389 -17.158 -10.891 1.00 48.77 ? 183  LEU A N     1 
ATOM   1451 C  CA    . LEU A 1 186 ? 77.378 -16.238 -11.414 1.00 43.15 ? 183  LEU A CA    1 
ATOM   1452 C  C     . LEU A 1 186 ? 75.945 -16.719 -11.173 1.00 37.41 ? 183  LEU A C     1 
ATOM   1453 O  O     . LEU A 1 186 ? 74.996 -15.945 -11.313 1.00 49.08 ? 183  LEU A O     1 
ATOM   1454 C  CB    . LEU A 1 186 ? 77.598 -16.016 -12.915 1.00 41.45 ? 183  LEU A CB    1 
ATOM   1455 C  CG    . LEU A 1 186 ? 78.360 -14.763 -13.360 1.00 48.45 ? 183  LEU A CG    1 
ATOM   1456 C  CD1   . LEU A 1 186 ? 79.465 -14.399 -12.374 1.00 51.20 ? 183  LEU A CD1   1 
ATOM   1457 C  CD2   . LEU A 1 186 ? 78.933 -14.970 -14.760 1.00 50.98 ? 183  LEU A CD2   1 
ATOM   1458 N  N     . THR A 1 187 ? 75.789 -17.990 -10.813 1.00 41.06 ? 184  THR A N     1 
ATOM   1459 C  CA    . THR A 1 187 ? 74.461 -18.569 -10.634 1.00 40.93 ? 184  THR A CA    1 
ATOM   1460 C  C     . THR A 1 187 ? 74.101 -18.860 -9.173  1.00 35.12 ? 184  THR A C     1 
ATOM   1461 O  O     . THR A 1 187 ? 73.034 -19.416 -8.908  1.00 38.90 ? 184  THR A O     1 
ATOM   1462 C  CB    . THR A 1 187 ? 74.308 -19.883 -11.443 1.00 48.35 ? 184  THR A CB    1 
ATOM   1463 O  OG1   . THR A 1 187 ? 75.221 -20.872 -10.945 1.00 49.97 ? 184  THR A OG1   1 
ATOM   1464 C  CG2   . THR A 1 187 ? 74.581 -19.639 -12.925 1.00 50.03 ? 184  THR A CG2   1 
ATOM   1465 N  N     . SER A 1 188 ? 74.973 -18.505 -8.230  1.00 30.46 ? 185  SER A N     1 
ATOM   1466 C  CA    . SER A 1 188 ? 74.630 -18.664 -6.807  1.00 21.47 ? 185  SER A CA    1 
ATOM   1467 C  C     . SER A 1 188 ? 73.510 -17.712 -6.402  1.00 17.93 ? 185  SER A C     1 
ATOM   1468 O  O     . SER A 1 188 ? 73.654 -16.498 -6.502  1.00 15.21 ? 185  SER A O     1 
ATOM   1469 C  CB    . SER A 1 188 ? 75.830 -18.423 -5.896  1.00 30.84 ? 185  SER A CB    1 
ATOM   1470 O  OG    . SER A 1 188 ? 75.397 -18.272 -4.544  1.00 22.24 ? 185  SER A OG    1 
ATOM   1471 N  N     . PRO A 1 189 ? 72.390 -18.264 -5.936  1.00 17.51 ? 186  PRO A N     1 
ATOM   1472 C  CA    . PRO A 1 189 ? 71.277 -17.413 -5.498  1.00 13.38 ? 186  PRO A CA    1 
ATOM   1473 C  C     . PRO A 1 189 ? 71.681 -16.388 -4.443  1.00 15.44 ? 186  PRO A C     1 
ATOM   1474 O  O     . PRO A 1 189 ? 71.201 -15.259 -4.515  1.00 13.58 ? 186  PRO A O     1 
ATOM   1475 C  CB    . PRO A 1 189 ? 70.275 -18.420 -4.935  1.00 16.87 ? 186  PRO A CB    1 
ATOM   1476 C  CG    . PRO A 1 189 ? 70.557 -19.673 -5.728  1.00 20.24 ? 186  PRO A CG    1 
ATOM   1477 C  CD    . PRO A 1 189 ? 72.040 -19.692 -5.888  1.00 16.72 ? 186  PRO A CD    1 
ATOM   1478 N  N     . ASP A 1 190 ? 72.522 -16.756 -3.477  1.00 12.67 ? 187  ASP A N     1 
ATOM   1479 C  CA    . ASP A 1 190 ? 72.924 -15.785 -2.460  1.00 11.58 ? 187  ASP A CA    1 
ATOM   1480 C  C     . ASP A 1 190 ? 73.674 -14.607 -3.071  1.00 13.16 ? 187  ASP A C     1 
ATOM   1481 O  O     . ASP A 1 190 ? 73.489 -13.468 -2.644  1.00 14.19 ? 187  ASP A O     1 
ATOM   1482 C  CB    . ASP A 1 190 ? 73.802 -16.437 -1.391  1.00 10.30 ? 187  ASP A CB    1 
ATOM   1483 C  CG    . ASP A 1 190 ? 73.028 -17.417 -0.527  1.00 19.15 ? 187  ASP A CG    1 
ATOM   1484 O  OD1   . ASP A 1 190 ? 71.794 -17.300 -0.461  1.00 12.41 ? 187  ASP A OD1   1 
ATOM   1485 O  OD2   . ASP A 1 190 ? 73.645 -18.310 0.082   1.00 18.61 ? 187  ASP A OD2   1 
ATOM   1486 N  N     . LEU A 1 191 ? 74.525 -14.892 -4.053  1.00 12.09 ? 188  LEU A N     1 
ATOM   1487 C  CA    . LEU A 1 191 ? 75.257 -13.824 -4.731  1.00 12.40 ? 188  LEU A CA    1 
ATOM   1488 C  C     . LEU A 1 191 ? 74.293 -12.932 -5.487  1.00 12.58 ? 188  LEU A C     1 
ATOM   1489 O  O     . LEU A 1 191 ? 74.401 -11.702 -5.432  1.00 11.73 ? 188  LEU A O     1 
ATOM   1490 C  CB    . LEU A 1 191 ? 76.307 -14.383 -5.695  1.00 17.03 ? 188  LEU A CB    1 
ATOM   1491 C  CG    . LEU A 1 191 ? 77.102 -13.337 -6.487  1.00 23.99 ? 188  LEU A CG    1 
ATOM   1492 C  CD1   . LEU A 1 191 ? 77.774 -12.340 -5.566  1.00 18.11 ? 188  LEU A CD1   1 
ATOM   1493 C  CD2   . LEU A 1 191 ? 78.148 -14.018 -7.370  1.00 21.63 ? 188  LEU A CD2   1 
ATOM   1494 N  N     . GLN A 1 192 ? 73.341 -13.551 -6.176  1.00 12.30 ? 189  GLN A N     1 
ATOM   1495 C  CA    . GLN A 1 192 ? 72.340 -12.804 -6.934  1.00 14.06 ? 189  GLN A CA    1 
ATOM   1496 C  C     . GLN A 1 192 ? 71.503 -11.896 -6.022  1.00 12.25 ? 189  GLN A C     1 
ATOM   1497 O  O     . GLN A 1 192 ? 71.260 -10.742 -6.362  1.00 11.17 ? 189  GLN A O     1 
ATOM   1498 C  CB    . GLN A 1 192 ? 71.443 -13.751 -7.721  1.00 16.45 ? 189  GLN A CB    1 
ATOM   1499 C  CG    . GLN A 1 192 ? 72.212 -14.529 -8.783  1.00 18.56 ? 189  GLN A CG    1 
ATOM   1500 C  CD    . GLN A 1 192 ? 71.397 -15.637 -9.419  1.00 30.47 ? 189  GLN A CD    1 
ATOM   1501 O  OE1   . GLN A 1 192 ? 70.310 -15.973 -8.952  1.00 35.99 ? 189  GLN A OE1   1 
ATOM   1502 N  NE2   . GLN A 1 192 ? 71.926 -16.216 -10.493 1.00 40.54 ? 189  GLN A NE2   1 
ATOM   1503 N  N     . LEU A 1 193 ? 71.103 -12.393 -4.854  1.00 12.94 ? 190  LEU A N     1 
ATOM   1504 C  CA    . LEU A 1 193 ? 70.400 -11.538 -3.887  1.00 8.75  ? 190  LEU A CA    1 
ATOM   1505 C  C     . LEU A 1 193 ? 71.235 -10.343 -3.454  1.00 11.29 ? 190  LEU A C     1 
ATOM   1506 O  O     . LEU A 1 193 ? 70.714 -9.242  -3.264  1.00 12.12 ? 190  LEU A O     1 
ATOM   1507 C  CB    . LEU A 1 193 ? 69.995 -12.335 -2.638  1.00 10.83 ? 190  LEU A CB    1 
ATOM   1508 C  CG    . LEU A 1 193 ? 68.902 -13.394 -2.800  1.00 7.20  ? 190  LEU A CG    1 
ATOM   1509 C  CD1   . LEU A 1 193 ? 68.521 -14.018 -1.442  1.00 11.39 ? 190  LEU A CD1   1 
ATOM   1510 C  CD2   . LEU A 1 193 ? 67.682 -12.783 -3.485  1.00 9.78  ? 190  LEU A CD2   1 
ATOM   1511 N  N     . THR A 1 194 ? 72.522 -10.594 -3.234  1.00 10.17 ? 191  THR A N     1 
ATOM   1512 C  CA    . THR A 1 194 ? 73.454 -9.580  -2.768  1.00 12.93 ? 191  THR A CA    1 
ATOM   1513 C  C     . THR A 1 194 ? 73.581 -8.466  -3.793  1.00 12.53 ? 191  THR A C     1 
ATOM   1514 O  O     . THR A 1 194 ? 73.558 -7.293  -3.442  1.00 11.99 ? 191  THR A O     1 
ATOM   1515 C  CB    . THR A 1 194 ? 74.833 -10.173 -2.502  1.00 13.53 ? 191  THR A CB    1 
ATOM   1516 O  OG1   . THR A 1 194 ? 74.715 -11.198 -1.517  1.00 13.23 ? 191  THR A OG1   1 
ATOM   1517 C  CG2   . THR A 1 194 ? 75.780 -9.111  -1.968  1.00 11.30 ? 191  THR A CG2   1 
ATOM   1518 N  N     . VAL A 1 195 ? 73.721 -8.849  -5.054  1.00 11.97 ? 192  VAL A N     1 
ATOM   1519 C  CA    . VAL A 1 195 ? 73.812 -7.855  -6.124  1.00 12.82 ? 192  VAL A CA    1 
ATOM   1520 C  C     . VAL A 1 195 ? 72.468 -7.147  -6.227  1.00 11.16 ? 192  VAL A C     1 
ATOM   1521 O  O     . VAL A 1 195 ? 72.413 -5.932  -6.459  1.00 12.05 ? 192  VAL A O     1 
ATOM   1522 C  CB    . VAL A 1 195 ? 74.210 -8.497  -7.470  1.00 13.72 ? 192  VAL A CB    1 
ATOM   1523 C  CG1   . VAL A 1 195 ? 74.103 -7.472  -8.610  1.00 17.41 ? 192  VAL A CG1   1 
ATOM   1524 C  CG2   . VAL A 1 195 ? 75.633 -9.046  -7.392  1.00 12.81 ? 192  VAL A CG2   1 
ATOM   1525 N  N     . GLY A 1 196 ? 71.384 -7.888  -6.004  1.00 10.77 ? 193  GLY A N     1 
ATOM   1526 C  CA    . GLY A 1 196 ? 70.056 -7.286  -5.963  1.00 12.11 ? 193  GLY A CA    1 
ATOM   1527 C  C     . GLY A 1 196 ? 70.017 -6.187  -4.907  1.00 11.83 ? 193  GLY A C     1 
ATOM   1528 O  O     . GLY A 1 196 ? 69.516 -5.091  -5.155  1.00 14.48 ? 193  GLY A O     1 
ATOM   1529 N  N     . ALA A 1 197 ? 70.576 -6.468  -3.736  1.00 11.94 ? 194  ALA A N     1 
ATOM   1530 C  CA    . ALA A 1 197 ? 70.608 -5.507  -2.643  1.00 10.10 ? 194  ALA A CA    1 
ATOM   1531 C  C     . ALA A 1 197 ? 71.437 -4.264  -2.999  1.00 11.20 ? 194  ALA A C     1 
ATOM   1532 O  O     . ALA A 1 197 ? 71.100 -3.142  -2.604  1.00 12.48 ? 194  ALA A O     1 
ATOM   1533 C  CB    . ALA A 1 197 ? 71.138 -6.165  -1.380  1.00 13.44 ? 194  ALA A CB    1 
ATOM   1534 N  N     . VAL A 1 198 ? 72.509 -4.464  -3.752  1.00 11.53 ? 195  VAL A N     1 
ATOM   1535 C  CA    . VAL A 1 198 ? 73.321 -3.341  -4.231  1.00 9.30  ? 195  VAL A CA    1 
ATOM   1536 C  C     . VAL A 1 198 ? 72.493 -2.405  -5.114  1.00 14.59 ? 195  VAL A C     1 
ATOM   1537 O  O     . VAL A 1 198 ? 72.513 -1.177  -4.926  1.00 13.79 ? 195  VAL A O     1 
ATOM   1538 C  CB    . VAL A 1 198 ? 74.565 -3.835  -5.004  1.00 15.17 ? 195  VAL A CB    1 
ATOM   1539 C  CG1   . VAL A 1 198 ? 75.296 -2.650  -5.639  1.00 18.00 ? 195  VAL A CG1   1 
ATOM   1540 C  CG2   . VAL A 1 198 ? 75.506 -4.565  -4.052  1.00 17.77 ? 195  VAL A CG2   1 
ATOM   1541 N  N     . ILE A 1 199 ? 71.715 -2.985  -6.028  1.00 11.06 ? 196  ILE A N     1 
ATOM   1542 C  CA    . ILE A 1 199 ? 70.878 -2.196  -6.926  1.00 13.99 ? 196  ILE A CA    1 
ATOM   1543 C  C     . ILE A 1 199 ? 69.797 -1.444  -6.142  1.00 15.03 ? 196  ILE A C     1 
ATOM   1544 O  O     . ILE A 1 199 ? 69.523 -0.285  -6.418  1.00 14.26 ? 196  ILE A O     1 
ATOM   1545 C  CB    . ILE A 1 199 ? 70.248 -3.098  -8.012  1.00 11.99 ? 196  ILE A CB    1 
ATOM   1546 C  CG1   . ILE A 1 199 ? 71.362 -3.637  -8.915  1.00 12.81 ? 196  ILE A CG1   1 
ATOM   1547 C  CG2   . ILE A 1 199 ? 69.185 -2.353  -8.824  1.00 14.37 ? 196  ILE A CG2   1 
ATOM   1548 C  CD1   . ILE A 1 199 ? 70.936 -4.734  -9.849  1.00 13.43 ? 196  ILE A CD1   1 
ATOM   1549 N  N     . VAL A 1 200 ? 69.206 -2.100  -5.148  1.00 14.17 ? 197  VAL A N     1 
ATOM   1550 C  CA    . VAL A 1 200 ? 68.154 -1.475  -4.357  1.00 10.03 ? 197  VAL A CA    1 
ATOM   1551 C  C     . VAL A 1 200 ? 68.711 -0.334  -3.490  1.00 13.39 ? 197  VAL A C     1 
ATOM   1552 O  O     . VAL A 1 200 ? 68.023 0.681   -3.271  1.00 13.14 ? 197  VAL A O     1 
ATOM   1553 C  CB    . VAL A 1 200 ? 67.426 -2.537  -3.498  1.00 8.19  ? 197  VAL A CB    1 
ATOM   1554 C  CG1   . VAL A 1 200 ? 66.379 -1.886  -2.588  1.00 13.99 ? 197  VAL A CG1   1 
ATOM   1555 C  CG2   . VAL A 1 200 ? 66.779 -3.565  -4.406  1.00 11.31 ? 197  VAL A CG2   1 
ATOM   1556 N  N     . GLU A 1 201 ? 69.957 -0.459  -3.032  1.00 10.96 ? 198  GLU A N     1 
ATOM   1557 C  CA    . GLU A 1 201 ? 70.609 0.673   -2.379  1.00 9.48  ? 198  GLU A CA    1 
ATOM   1558 C  C     . GLU A 1 201 ? 70.637 1.856   -3.351  1.00 15.29 ? 198  GLU A C     1 
ATOM   1559 O  O     . GLU A 1 201 ? 70.356 2.997   -2.960  1.00 13.99 ? 198  GLU A O     1 
ATOM   1560 C  CB    . GLU A 1 201 ? 72.046 0.331   -1.924  1.00 12.71 ? 198  GLU A CB    1 
ATOM   1561 C  CG    . GLU A 1 201 ? 72.150 -0.662  -0.768  1.00 14.82 ? 198  GLU A CG    1 
ATOM   1562 C  CD    . GLU A 1 201 ? 72.081 -0.033  0.605   1.00 13.02 ? 198  GLU A CD    1 
ATOM   1563 O  OE1   . GLU A 1 201 ? 71.727 1.163   0.733   1.00 17.65 ? 198  GLU A OE1   1 
ATOM   1564 O  OE2   . GLU A 1 201 ? 72.383 -0.746  1.585   1.00 14.14 ? 198  GLU A OE2   1 
ATOM   1565 N  N     . GLU A 1 202 ? 70.950 1.569   -4.616  1.00 11.63 ? 199  GLU A N     1 
ATOM   1566 C  CA    . GLU A 1 202 ? 71.068 2.616   -5.638  1.00 12.04 ? 199  GLU A CA    1 
ATOM   1567 C  C     . GLU A 1 202 ? 69.677 3.216   -5.915  1.00 15.29 ? 199  GLU A C     1 
ATOM   1568 O  O     . GLU A 1 202 ? 69.518 4.439   -5.983  1.00 15.53 ? 199  GLU A O     1 
ATOM   1569 C  CB    . GLU A 1 202 ? 71.709 2.047   -6.916  1.00 16.44 ? 199  GLU A CB    1 
ATOM   1570 C  CG    . GLU A 1 202 ? 73.171 1.608   -6.706  1.00 15.59 ? 199  GLU A CG    1 
ATOM   1571 C  CD    . GLU A 1 202 ? 73.743 0.776   -7.844  1.00 22.68 ? 199  GLU A CD    1 
ATOM   1572 O  OE1   . GLU A 1 202 ? 74.934 0.399   -7.748  1.00 28.68 ? 199  GLU A OE1   1 
ATOM   1573 O  OE2   . GLU A 1 202 ? 73.022 0.499   -8.827  1.00 21.81 ? 199  GLU A OE2   1 
ATOM   1574 N  N     . MET A 1 203 ? 68.678 2.344   -6.047  1.00 14.86 ? 200  MET A N     1 
ATOM   1575 C  CA    . MET A 1 203 ? 67.287 2.765   -6.246  1.00 11.47 ? 200  MET A CA    1 
ATOM   1576 C  C     . MET A 1 203 ? 66.812 3.661   -5.122  1.00 12.65 ? 200  MET A C     1 
ATOM   1577 O  O     . MET A 1 203 ? 66.212 4.717   -5.365  1.00 12.59 ? 200  MET A O     1 
ATOM   1578 C  CB    . MET A 1 203 ? 66.358 1.556   -6.346  1.00 15.33 ? 200  MET A CB    1 
ATOM   1579 C  CG    A MET A 1 203 ? 64.933 1.902   -6.669  0.38 12.36 ? 200  MET A CG    1 
ATOM   1580 C  CG    B MET A 1 203 ? 66.629 0.631   -7.500  0.62 11.74 ? 200  MET A CG    1 
ATOM   1581 S  SD    A MET A 1 203 ? 63.878 0.443   -6.642  0.38 18.37 ? 200  MET A SD    1 
ATOM   1582 S  SD    B MET A 1 203 ? 65.382 -0.680  -7.578  0.62 15.20 ? 200  MET A SD    1 
ATOM   1583 C  CE    A MET A 1 203 ? 64.285 -0.334  -8.202  0.38 18.16 ? 200  MET A CE    1 
ATOM   1584 C  CE    B MET A 1 203 ? 63.894 0.285   -7.816  0.62 13.74 ? 200  MET A CE    1 
ATOM   1585 N  N     . ARG A 1 204 ? 67.082 3.244   -3.886  1.00 10.76 ? 201  ARG A N     1 
ATOM   1586 C  CA    . ARG A 1 204 ? 66.615 3.977   -2.712  1.00 10.41 ? 201  ARG A CA    1 
ATOM   1587 C  C     . ARG A 1 204 ? 67.336 5.316   -2.577  1.00 14.50 ? 201  ARG A C     1 
ATOM   1588 O  O     . ARG A 1 204 ? 66.729 6.285   -2.144  1.00 13.03 ? 201  ARG A O     1 
ATOM   1589 C  CB    . ARG A 1 204 ? 66.781 3.135   -1.451  1.00 12.82 ? 201  ARG A CB    1 
ATOM   1590 C  CG    . ARG A 1 204 ? 65.808 1.960   -1.440  1.00 13.13 ? 201  ARG A CG    1 
ATOM   1591 C  CD    . ARG A 1 204 ? 65.913 1.137   -0.175  1.00 11.86 ? 201  ARG A CD    1 
ATOM   1592 N  NE    . ARG A 1 204 ? 65.940 1.988   1.006   1.00 12.68 ? 201  ARG A NE    1 
ATOM   1593 C  CZ    . ARG A 1 204 ? 66.989 2.102   1.814   1.00 12.62 ? 201  ARG A CZ    1 
ATOM   1594 N  NH1   . ARG A 1 204 ? 66.930 2.916   2.858   1.00 13.40 ? 201  ARG A NH1   1 
ATOM   1595 N  NH2   . ARG A 1 204 ? 68.100 1.407   1.578   1.00 13.05 ? 201  ARG A NH2   1 
ATOM   1596 N  N     . ALA A 1 205 ? 68.614 5.365   -2.961  1.00 13.27 ? 202  ALA A N     1 
ATOM   1597 C  CA    . ALA A 1 205 ? 69.375 6.623   -2.954  1.00 14.25 ? 202  ALA A CA    1 
ATOM   1598 C  C     . ALA A 1 205 ? 68.780 7.584   -3.992  1.00 15.33 ? 202  ALA A C     1 
ATOM   1599 O  O     . ALA A 1 205 ? 68.653 8.795   -3.750  1.00 13.49 ? 202  ALA A O     1 
ATOM   1600 C  CB    . ALA A 1 205 ? 70.868 6.363   -3.244  1.00 12.96 ? 202  ALA A CB    1 
ATOM   1601 N  N     . ALA A 1 206 ? 68.387 7.023   -5.130  1.00 11.85 ? 203  ALA A N     1 
ATOM   1602 C  CA    . ALA A 1 206 ? 67.798 7.811   -6.204  1.00 12.11 ? 203  ALA A CA    1 
ATOM   1603 C  C     . ALA A 1 206 ? 66.470 8.399   -5.748  1.00 10.94 ? 203  ALA A C     1 
ATOM   1604 O  O     . ALA A 1 206 ? 66.190 9.583   -5.979  1.00 13.53 ? 203  ALA A O     1 
ATOM   1605 C  CB    . ALA A 1 206 ? 67.619 6.968   -7.451  1.00 13.70 ? 203  ALA A CB    1 
ATOM   1606 N  N     . ILE A 1 207 ? 65.643 7.574   -5.102  1.00 10.13 ? 204  ILE A N     1 
ATOM   1607 C  CA    . ILE A 1 207 ? 64.351 8.067   -4.654  1.00 12.46 ? 204  ILE A CA    1 
ATOM   1608 C  C     . ILE A 1 207 ? 64.563 9.200   -3.669  1.00 13.84 ? 204  ILE A C     1 
ATOM   1609 O  O     . ILE A 1 207 ? 63.902 10.245  -3.777  1.00 11.61 ? 204  ILE A O     1 
ATOM   1610 C  CB    . ILE A 1 207 ? 63.497 6.962   -4.023  1.00 10.06 ? 204  ILE A CB    1 
ATOM   1611 C  CG1   . ILE A 1 207 ? 63.052 5.986   -5.103  1.00 7.99  ? 204  ILE A CG1   1 
ATOM   1612 C  CG2   . ILE A 1 207 ? 62.271 7.556   -3.309  1.00 10.27 ? 204  ILE A CG2   1 
ATOM   1613 C  CD1   . ILE A 1 207 ? 62.422 4.671   -4.531  1.00 13.51 ? 204  ILE A CD1   1 
ATOM   1614 N  N     . GLU A 1 208 ? 65.505 9.031   -2.736  1.00 12.71 ? 205  GLU A N     1 
ATOM   1615 C  CA    . GLU A 1 208 ? 65.691 10.067  -1.721  1.00 9.70  ? 205  GLU A CA    1 
ATOM   1616 C  C     . GLU A 1 208 ? 66.286 11.335  -2.332  1.00 11.72 ? 205  GLU A C     1 
ATOM   1617 O  O     . GLU A 1 208 ? 65.836 12.432  -2.028  1.00 13.65 ? 205  GLU A O     1 
ATOM   1618 C  CB    . GLU A 1 208 ? 66.574 9.597   -0.569  1.00 12.13 ? 205  GLU A CB    1 
ATOM   1619 C  CG    . GLU A 1 208 ? 66.717 10.686  0.502   1.00 12.58 ? 205  GLU A CG    1 
ATOM   1620 C  CD    . GLU A 1 208 ? 67.402 10.198  1.749   1.00 16.89 ? 205  GLU A CD    1 
ATOM   1621 O  OE1   . GLU A 1 208 ? 67.394 10.941  2.747   1.00 21.66 ? 205  GLU A OE1   1 
ATOM   1622 O  OE2   . GLU A 1 208 ? 67.947 9.075   1.718   1.00 20.29 ? 205  GLU A OE2   1 
ATOM   1623 N  N     . ARG A 1 209 ? 67.268 11.180  -3.219  1.00 13.69 ? 206  ARG A N     1 
ATOM   1624 C  CA    . ARG A 1 209 ? 67.883 12.349  -3.858  1.00 14.74 ? 206  ARG A CA    1 
ATOM   1625 C  C     . ARG A 1 209 ? 66.841 13.164  -4.628  1.00 11.17 ? 206  ARG A C     1 
ATOM   1626 O  O     . ARG A 1 209 ? 66.812 14.387  -4.521  1.00 14.93 ? 206  ARG A O     1 
ATOM   1627 C  CB    . ARG A 1 209 ? 69.024 11.949  -4.816  1.00 13.11 ? 206  ARG A CB    1 
ATOM   1628 C  CG    . ARG A 1 209 ? 69.764 13.188  -5.378  1.00 18.79 ? 206  ARG A CG    1 
ATOM   1629 C  CD    . ARG A 1 209 ? 70.811 12.850  -6.439  1.00 17.78 ? 206  ARG A CD    1 
ATOM   1630 N  NE    . ARG A 1 209 ? 70.246 12.545  -7.760  1.00 20.92 ? 206  ARG A NE    1 
ATOM   1631 C  CZ    . ARG A 1 209 ? 69.857 13.457  -8.651  1.00 24.00 ? 206  ARG A CZ    1 
ATOM   1632 N  NH1   . ARG A 1 209 ? 69.375 13.067  -9.828  1.00 21.06 ? 206  ARG A NH1   1 
ATOM   1633 N  NH2   . ARG A 1 209 ? 69.937 14.757  -8.368  1.00 17.40 ? 206  ARG A NH2   1 
ATOM   1634 N  N     . GLU A 1 210 ? 66.002 12.484  -5.403  1.00 10.69 ? 207  GLU A N     1 
ATOM   1635 C  CA    . GLU A 1 210 ? 65.151 13.149  -6.391  1.00 10.86 ? 207  GLU A CA    1 
ATOM   1636 C  C     . GLU A 1 210 ? 63.769 13.522  -5.859  1.00 13.28 ? 207  GLU A C     1 
ATOM   1637 O  O     . GLU A 1 210 ? 63.048 14.286  -6.511  1.00 11.00 ? 207  GLU A O     1 
ATOM   1638 C  CB    . GLU A 1 210 ? 65.021 12.268  -7.641  1.00 11.50 ? 207  GLU A CB    1 
ATOM   1639 C  CG    . GLU A 1 210 ? 66.372 11.892  -8.239  1.00 10.59 ? 207  GLU A CG    1 
ATOM   1640 C  CD    . GLU A 1 210 ? 66.274 11.093  -9.507  1.00 18.63 ? 207  GLU A CD    1 
ATOM   1641 O  OE1   . GLU A 1 210 ? 65.224 11.153  -10.196 1.00 18.29 ? 207  GLU A OE1   1 
ATOM   1642 O  OE2   . GLU A 1 210 ? 67.270 10.408  -9.827  1.00 24.92 ? 207  GLU A OE2   1 
ATOM   1643 N  N     . THR A 1 211 ? 63.394 13.008  -4.683  1.00 11.68 ? 208  THR A N     1 
ATOM   1644 C  CA    . THR A 1 211 ? 62.096 13.378  -4.096  1.00 9.90  ? 208  THR A CA    1 
ATOM   1645 C  C     . THR A 1 211 ? 62.167 13.912  -2.682  1.00 12.22 ? 208  THR A C     1 
ATOM   1646 O  O     . THR A 1 211 ? 61.237 14.566  -2.238  1.00 13.56 ? 208  THR A O     1 
ATOM   1647 C  CB    . THR A 1 211 ? 61.110 12.184  -4.060  1.00 11.96 ? 208  THR A CB    1 
ATOM   1648 O  OG1   . THR A 1 211 ? 61.560 11.220  -3.098  1.00 12.82 ? 208  THR A OG1   1 
ATOM   1649 C  CG2   . THR A 1 211 ? 60.971 11.549  -5.435  1.00 12.56 ? 208  THR A CG2   1 
ATOM   1650 N  N     . GLY A 1 212 ? 63.237 13.594  -1.959  1.00 10.35 ? 209  GLY A N     1 
ATOM   1651 C  CA    . GLY A 1 212 ? 63.337 13.894  -0.538  1.00 11.18 ? 209  GLY A CA    1 
ATOM   1652 C  C     . GLY A 1 212 ? 62.776 12.814  0.385   1.00 14.89 ? 209  GLY A C     1 
ATOM   1653 O  O     . GLY A 1 212 ? 62.902 12.918  1.604   1.00 17.35 ? 209  GLY A O     1 
ATOM   1654 N  N     . PHE A 1 213 ? 62.142 11.801  -0.194  1.00 12.16 ? 210  PHE A N     1 
ATOM   1655 C  CA    . PHE A 1 213 ? 61.438 10.775  0.575   1.00 8.46  ? 210  PHE A CA    1 
ATOM   1656 C  C     . PHE A 1 213 ? 62.365 9.592   0.883   1.00 11.32 ? 210  PHE A C     1 
ATOM   1657 O  O     . PHE A 1 213 ? 63.048 9.097   -0.000  1.00 13.12 ? 210  PHE A O     1 
ATOM   1658 C  CB    . PHE A 1 213 ? 60.214 10.251  -0.174  1.00 11.38 ? 210  PHE A CB    1 
ATOM   1659 C  CG    . PHE A 1 213 ? 59.196 11.302  -0.552  1.00 10.03 ? 210  PHE A CG    1 
ATOM   1660 C  CD1   . PHE A 1 213 ? 58.524 11.209  -1.767  1.00 12.41 ? 210  PHE A CD1   1 
ATOM   1661 C  CD2   . PHE A 1 213 ? 58.886 12.350  0.305   1.00 10.50 ? 210  PHE A CD2   1 
ATOM   1662 C  CE1   . PHE A 1 213 ? 57.572 12.149  -2.139  1.00 10.37 ? 210  PHE A CE1   1 
ATOM   1663 C  CE2   . PHE A 1 213 ? 57.928 13.299  -0.060  1.00 14.68 ? 210  PHE A CE2   1 
ATOM   1664 C  CZ    . PHE A 1 213 ? 57.273 13.193  -1.282  1.00 8.03  ? 210  PHE A CZ    1 
ATOM   1665 N  N     . GLN A 1 214 ? 62.334 9.137   2.126   1.00 9.86  ? 211  GLN A N     1 
ATOM   1666 C  CA    . GLN A 1 214 ? 63.013 7.914   2.540   1.00 9.01  ? 211  GLN A CA    1 
ATOM   1667 C  C     . GLN A 1 214 ? 62.088 6.697   2.444   1.00 10.15 ? 211  GLN A C     1 
ATOM   1668 O  O     . GLN A 1 214 ? 60.860 6.818   2.515   1.00 12.13 ? 211  GLN A O     1 
ATOM   1669 C  CB    . GLN A 1 214 ? 63.547 8.086   3.960   1.00 12.04 ? 211  GLN A CB    1 
ATOM   1670 C  CG    . GLN A 1 214 ? 64.771 8.997   3.970   1.00 11.26 ? 211  GLN A CG    1 
ATOM   1671 C  CD    . GLN A 1 214 ? 65.333 9.200   5.358   1.00 19.52 ? 211  GLN A CD    1 
ATOM   1672 O  OE1   . GLN A 1 214 ? 64.752 8.757   6.350   1.00 17.09 ? 211  GLN A OE1   1 
ATOM   1673 N  NE2   . GLN A 1 214 ? 66.473 9.878   5.435   1.00 19.90 ? 211  GLN A NE2   1 
ATOM   1674 N  N     . CYS A 1 215 ? 62.691 5.519   2.289   1.00 9.16  ? 212  CYS A N     1 
ATOM   1675 C  CA    . CYS A 1 215 ? 61.918 4.299   2.139   1.00 9.56  ? 212  CYS A CA    1 
ATOM   1676 C  C     . CYS A 1 215 ? 62.722 3.122   2.673   1.00 10.43 ? 212  CYS A C     1 
ATOM   1677 O  O     . CYS A 1 215 ? 63.940 3.220   2.894   1.00 12.40 ? 212  CYS A O     1 
ATOM   1678 C  CB    . CYS A 1 215 ? 61.543 4.057   0.669   1.00 11.88 ? 212  CYS A CB    1 
ATOM   1679 S  SG    . CYS A 1 215 ? 62.985 3.894   -0.419  1.00 17.29 ? 212  CYS A SG    1 
ATOM   1680 N  N     . SER A 1 216 ? 62.022 2.024   2.896   1.00 9.64  ? 213  SER A N     1 
ATOM   1681 C  CA    . SER A 1 216 ? 62.659 0.772   3.248   1.00 10.70 ? 213  SER A CA    1 
ATOM   1682 C  C     . SER A 1 216 ? 62.466 -0.202  2.103   1.00 12.44 ? 213  SER A C     1 
ATOM   1683 O  O     . SER A 1 216 ? 61.677 0.052   1.187   1.00 9.82  ? 213  SER A O     1 
ATOM   1684 C  CB    . SER A 1 216 ? 62.077 0.239   4.543   1.00 13.89 ? 213  SER A CB    1 
ATOM   1685 O  OG    . SER A 1 216 ? 62.299 1.188   5.577   1.00 14.36 ? 213  SER A OG    1 
ATOM   1686 N  N     . ALA A 1 217 ? 63.193 -1.316  2.135   1.00 10.85 ? 214  ALA A N     1 
ATOM   1687 C  CA    . ALA A 1 217 ? 63.000 -2.327  1.107   1.00 8.35  ? 214  ALA A CA    1 
ATOM   1688 C  C     . ALA A 1 217 ? 63.325 -3.717  1.602   1.00 9.11  ? 214  ALA A C     1 
ATOM   1689 O  O     . ALA A 1 217 ? 64.140 -3.872  2.505   1.00 8.79  ? 214  ALA A O     1 
ATOM   1690 C  CB    . ALA A 1 217 ? 63.860 -2.027  -0.108  1.00 8.95  ? 214  ALA A CB    1 
ATOM   1691 N  N     . GLY A 1 218 ? 62.689 -4.708  0.995   1.00 9.62  ? 215  GLY A N     1 
ATOM   1692 C  CA    . GLY A 1 218 ? 63.070 -6.103  1.190   1.00 10.93 ? 215  GLY A CA    1 
ATOM   1693 C  C     . GLY A 1 218 ? 63.596 -6.689  -0.110  1.00 11.33 ? 215  GLY A C     1 
ATOM   1694 O  O     . GLY A 1 218 ? 63.093 -6.387  -1.195  1.00 9.39  ? 215  GLY A O     1 
ATOM   1695 N  N     . ILE A 1 219 ? 64.623 -7.527  -0.012  1.00 7.66  ? 216  ILE A N     1 
ATOM   1696 C  CA    . ILE A 1 219 ? 65.171 -8.223  -1.178  1.00 8.82  ? 216  ILE A CA    1 
ATOM   1697 C  C     . ILE A 1 219 ? 65.153 -9.716  -0.891  1.00 10.41 ? 216  ILE A C     1 
ATOM   1698 O  O     . ILE A 1 219 ? 65.767 -10.167 0.084   1.00 10.08 ? 216  ILE A O     1 
ATOM   1699 C  CB    . ILE A 1 219 ? 66.622 -7.778  -1.493  1.00 9.44  ? 216  ILE A CB    1 
ATOM   1700 C  CG1   . ILE A 1 219 ? 66.716 -6.250  -1.641  1.00 12.29 ? 216  ILE A CG1   1 
ATOM   1701 C  CG2   . ILE A 1 219 ? 67.146 -8.493  -2.766  1.00 11.12 ? 216  ILE A CG2   1 
ATOM   1702 C  CD1   . ILE A 1 219 ? 67.142 -5.517  -0.366  1.00 12.39 ? 216  ILE A CD1   1 
ATOM   1703 N  N     . SER A 1 220 ? 64.448 -10.479 -1.718  1.00 9.27  ? 217  SER A N     1 
ATOM   1704 C  CA    . SER A 1 220 ? 64.425 -11.926 -1.577  1.00 8.60  ? 217  SER A CA    1 
ATOM   1705 C  C     . SER A 1 220 ? 64.172 -12.587 -2.926  1.00 9.63  ? 217  SER A C     1 
ATOM   1706 O  O     . SER A 1 220 ? 64.400 -11.974 -3.970  1.00 10.41 ? 217  SER A O     1 
ATOM   1707 C  CB    . SER A 1 220 ? 63.360 -12.350 -0.560  1.00 12.44 ? 217  SER A CB    1 
ATOM   1708 O  OG    . SER A 1 220 ? 63.605 -13.687 -0.118  1.00 12.07 ? 217  SER A OG    1 
ATOM   1709 N  N     . HIS A 1 221 ? 63.693 -13.832 -2.911  1.00 10.07 ? 218  HIS A N     1 
ATOM   1710 C  CA    . HIS A 1 221 ? 63.463 -14.565 -4.152  1.00 10.52 ? 218  HIS A CA    1 
ATOM   1711 C  C     . HIS A 1 221 ? 62.018 -14.514 -4.633  1.00 11.75 ? 218  HIS A C     1 
ATOM   1712 O  O     . HIS A 1 221 ? 61.705 -15.045 -5.693  1.00 11.84 ? 218  HIS A O     1 
ATOM   1713 C  CB    . HIS A 1 221 ? 63.900 -16.035 -3.995  1.00 10.20 ? 218  HIS A CB    1 
ATOM   1714 C  CG    . HIS A 1 221 ? 65.380 -16.213 -3.865  1.00 17.78 ? 218  HIS A CG    1 
ATOM   1715 N  ND1   . HIS A 1 221 ? 66.257 -15.853 -4.863  1.00 13.87 ? 218  HIS A ND1   1 
ATOM   1716 C  CD2   . HIS A 1 221 ? 66.136 -16.706 -2.854  1.00 12.59 ? 218  HIS A CD2   1 
ATOM   1717 C  CE1   . HIS A 1 221 ? 67.489 -16.126 -4.480  1.00 12.50 ? 218  HIS A CE1   1 
ATOM   1718 N  NE2   . HIS A 1 221 ? 67.447 -16.637 -3.259  1.00 15.47 ? 218  HIS A NE2   1 
ATOM   1719 N  N     . ASN A 1 222 ? 61.138 -13.883 -3.863  1.00 10.02 ? 219  ASN A N     1 
ATOM   1720 C  CA    . ASN A 1 222 ? 59.744 -13.782 -4.259  1.00 11.29 ? 219  ASN A CA    1 
ATOM   1721 C  C     . ASN A 1 222 ? 59.051 -12.633 -3.539  1.00 9.34  ? 219  ASN A C     1 
ATOM   1722 O  O     . ASN A 1 222 ? 59.625 -11.984 -2.649  1.00 11.42 ? 219  ASN A O     1 
ATOM   1723 C  CB    . ASN A 1 222 ? 59.006 -15.103 -4.002  1.00 9.72  ? 219  ASN A CB    1 
ATOM   1724 C  CG    . ASN A 1 222 ? 59.125 -15.567 -2.553  1.00 14.35 ? 219  ASN A CG    1 
ATOM   1725 O  OD1   . ASN A 1 222 ? 58.651 -14.895 -1.648  1.00 8.86  ? 219  ASN A OD1   1 
ATOM   1726 N  ND2   . ASN A 1 222 ? 59.741 -16.734 -2.335  1.00 11.21 ? 219  ASN A ND2   1 
ATOM   1727 N  N     . LYS A 1 223 ? 57.819 -12.366 -3.942  1.00 10.69 ? 220  LYS A N     1 
ATOM   1728 C  CA    . LYS A 1 223 ? 57.113 -11.199 -3.430  1.00 10.57 ? 220  LYS A CA    1 
ATOM   1729 C  C     . LYS A 1 223 ? 56.780 -11.303 -1.941  1.00 8.82  ? 220  LYS A C     1 
ATOM   1730 O  O     . LYS A 1 223 ? 56.904 -10.308 -1.207  1.00 10.32 ? 220  LYS A O     1 
ATOM   1731 C  CB    . LYS A 1 223 ? 55.846 -10.968 -4.258  1.00 10.62 ? 220  LYS A CB    1 
ATOM   1732 C  CG    . LYS A 1 223 ? 56.120 -10.343 -5.630  1.00 12.14 ? 220  LYS A CG    1 
ATOM   1733 C  CD    . LYS A 1 223 ? 54.941 -10.502 -6.604  1.00 21.77 ? 220  LYS A CD    1 
ATOM   1734 C  CE    . LYS A 1 223 ? 53.743 -9.696  -6.207  1.00 27.96 ? 220  LYS A CE    1 
ATOM   1735 N  NZ    . LYS A 1 223 ? 52.632 -9.872  -7.214  1.00 17.14 ? 220  LYS A NZ    1 
ATOM   1736 N  N     . VAL A 1 224 ? 56.327 -12.477 -1.492  1.00 9.75  ? 221  VAL A N     1 
ATOM   1737 C  CA    . VAL A 1 224 ? 55.929 -12.618 -0.086  1.00 10.91 ? 221  VAL A CA    1 
ATOM   1738 C  C     . VAL A 1 224 ? 57.129 -12.394 0.839   1.00 10.78 ? 221  VAL A C     1 
ATOM   1739 O  O     . VAL A 1 224 ? 57.017 -11.669 1.847   1.00 11.11 ? 221  VAL A O     1 
ATOM   1740 C  CB    . VAL A 1 224 ? 55.297 -14.010 0.203   1.00 12.75 ? 221  VAL A CB    1 
ATOM   1741 C  CG1   . VAL A 1 224 ? 55.361 -14.344 1.693   1.00 15.47 ? 221  VAL A CG1   1 
ATOM   1742 C  CG2   . VAL A 1 224 ? 53.849 -14.043 -0.301  1.00 13.18 ? 221  VAL A CG2   1 
ATOM   1743 N  N     . LEU A 1 225 ? 58.277 -12.983 0.498   1.00 9.56  ? 222  LEU A N     1 
ATOM   1744 C  CA    . LEU A 1 225 ? 59.448 -12.821 1.362   1.00 9.73  ? 222  LEU A CA    1 
ATOM   1745 C  C     . LEU A 1 225 ? 59.998 -11.403 1.271   1.00 11.03 ? 222  LEU A C     1 
ATOM   1746 O  O     . LEU A 1 225 ? 60.485 -10.856 2.258   1.00 9.77  ? 222  LEU A O     1 
ATOM   1747 C  CB    . LEU A 1 225 ? 60.562 -13.824 1.023   1.00 8.61  ? 222  LEU A CB    1 
ATOM   1748 C  CG    . LEU A 1 225 ? 60.268 -15.291 1.393   1.00 8.51  ? 222  LEU A CG    1 
ATOM   1749 C  CD1   . LEU A 1 225 ? 61.444 -16.175 0.981   1.00 13.29 ? 222  LEU A CD1   1 
ATOM   1750 C  CD2   . LEU A 1 225 ? 60.008 -15.416 2.877   1.00 11.67 ? 222  LEU A CD2   1 
ATOM   1751 N  N     . ALA A 1 226 ? 59.950 -10.821 0.073   1.00 10.77 ? 223  ALA A N     1 
ATOM   1752 C  CA    . ALA A 1 226 ? 60.407 -9.454  -0.093  1.00 9.51  ? 223  ALA A CA    1 
ATOM   1753 C  C     . ALA A 1 226 ? 59.591 -8.499  0.763   1.00 10.02 ? 223  ALA A C     1 
ATOM   1754 O  O     . ALA A 1 226 ? 60.163 -7.613  1.400   1.00 10.32 ? 223  ALA A O     1 
ATOM   1755 C  CB    . ALA A 1 226 ? 60.342 -9.038  -1.559  1.00 9.91  ? 223  ALA A CB    1 
ATOM   1756 N  N     . LYS A 1 227 ? 58.263 -8.656  0.756   1.00 10.39 ? 224  LYS A N     1 
ATOM   1757 C  CA    . LYS A 1 227 ? 57.382 -7.831  1.597   1.00 7.96  ? 224  LYS A CA    1 
ATOM   1758 C  C     . LYS A 1 227 ? 57.677 -8.023  3.088   1.00 9.91  ? 224  LYS A C     1 
ATOM   1759 O  O     . LYS A 1 227 ? 57.775 -7.045  3.844   1.00 11.07 ? 224  LYS A O     1 
ATOM   1760 C  CB    . LYS A 1 227 ? 55.906 -8.148  1.317   1.00 10.96 ? 224  LYS A CB    1 
ATOM   1761 C  CG    A LYS A 1 227 ? 54.912 -7.419  2.200   0.42 13.05 ? 224  LYS A CG    1 
ATOM   1762 C  CG    B LYS A 1 227 ? 54.929 -7.364  2.210   0.58 13.03 ? 224  LYS A CG    1 
ATOM   1763 C  CD    A LYS A 1 227 ? 53.506 -7.632  1.658   0.42 9.42  ? 224  LYS A CD    1 
ATOM   1764 C  CD    B LYS A 1 227 ? 54.988 -5.848  1.990   0.58 16.92 ? 224  LYS A CD    1 
ATOM   1765 C  CE    A LYS A 1 227 ? 52.433 -7.221  2.637   0.42 20.04 ? 224  LYS A CE    1 
ATOM   1766 C  CE    B LYS A 1 227 ? 53.974 -5.118  2.874   0.58 15.86 ? 224  LYS A CE    1 
ATOM   1767 N  NZ    A LYS A 1 227 ? 52.673 -5.907  3.256   0.42 14.52 ? 224  LYS A NZ    1 
ATOM   1768 N  NZ    B LYS A 1 227 ? 54.026 -3.620  2.810   0.58 8.79  ? 224  LYS A NZ    1 
ATOM   1769 N  N     . LEU A 1 228 ? 57.837 -9.276  3.497   1.00 10.01 ? 225  LEU A N     1 
ATOM   1770 C  CA    . LEU A 1 228 ? 58.125 -9.583  4.882   1.00 10.61 ? 225  LEU A CA    1 
ATOM   1771 C  C     . LEU A 1 228 ? 59.466 -8.952  5.290   1.00 9.25  ? 225  LEU A C     1 
ATOM   1772 O  O     . LEU A 1 228 ? 59.568 -8.297  6.350   1.00 11.99 ? 225  LEU A O     1 
ATOM   1773 C  CB    . LEU A 1 228 ? 58.141 -11.098 5.084   1.00 13.69 ? 225  LEU A CB    1 
ATOM   1774 C  CG    . LEU A 1 228 ? 58.336 -11.527 6.539   1.00 14.76 ? 225  LEU A CG    1 
ATOM   1775 C  CD1   . LEU A 1 228 ? 57.147 -11.054 7.393   1.00 13.96 ? 225  LEU A CD1   1 
ATOM   1776 C  CD2   . LEU A 1 228 ? 58.495 -13.027 6.625   1.00 12.07 ? 225  LEU A CD2   1 
ATOM   1777 N  N     . ALA A 1 229 ? 60.470 -9.122  4.432   1.00 10.01 ? 226  ALA A N     1 
ATOM   1778 C  CA    . ALA A 1 229 ? 61.805 -8.566  4.662   1.00 10.99 ? 226  ALA A CA    1 
ATOM   1779 C  C     . ALA A 1 229 ? 61.769 -7.057  4.853   1.00 9.86  ? 226  ALA A C     1 
ATOM   1780 O  O     . ALA A 1 229 ? 62.431 -6.529  5.734   1.00 13.31 ? 226  ALA A O     1 
ATOM   1781 C  CB    . ALA A 1 229 ? 62.759 -8.914  3.498   1.00 10.62 ? 226  ALA A CB    1 
ATOM   1782 N  N     . CYS A 1 230 ? 61.016 -6.376  3.993   1.00 10.84 ? 227  CYS A N     1 
ATOM   1783 C  CA    . CYS A 1 230 ? 60.928 -4.923  4.028   1.00 12.45 ? 227  CYS A CA    1 
ATOM   1784 C  C     . CYS A 1 230 ? 60.564 -4.391  5.427   1.00 12.60 ? 227  CYS A C     1 
ATOM   1785 O  O     . CYS A 1 230 ? 61.164 -3.426  5.928   1.00 12.20 ? 227  CYS A O     1 
ATOM   1786 C  CB    . CYS A 1 230 ? 59.905 -4.450  2.991   1.00 8.97  ? 227  CYS A CB    1 
ATOM   1787 S  SG    . CYS A 1 230 ? 59.832 -2.647  2.852   1.00 11.54 ? 227  CYS A SG    1 
ATOM   1788 N  N     . GLY A 1 231 ? 59.613 -5.050  6.078   1.00 11.86 ? 228  GLY A N     1 
ATOM   1789 C  CA    . GLY A 1 231 ? 59.179 -4.618  7.392   1.00 12.18 ? 228  GLY A CA    1 
ATOM   1790 C  C     . GLY A 1 231 ? 60.112 -4.937  8.552   1.00 13.54 ? 228  GLY A C     1 
ATOM   1791 O  O     . GLY A 1 231 ? 59.892 -4.456  9.660   1.00 18.00 ? 228  GLY A O     1 
ATOM   1792 N  N     . LEU A 1 232 ? 61.159 -5.724  8.326   1.00 12.24 ? 229  LEU A N     1 
ATOM   1793 C  CA    . LEU A 1 232 ? 61.962 -6.202  9.454   1.00 11.50 ? 229  LEU A CA    1 
ATOM   1794 C  C     . LEU A 1 232 ? 62.860 -5.126  10.046  1.00 12.96 ? 229  LEU A C     1 
ATOM   1795 O  O     . LEU A 1 232 ? 63.183 -5.175  11.235  1.00 14.25 ? 229  LEU A O     1 
ATOM   1796 C  CB    . LEU A 1 232 ? 62.826 -7.403  9.037   1.00 12.93 ? 229  LEU A CB    1 
ATOM   1797 C  CG    . LEU A 1 232 ? 62.048 -8.692  8.745   1.00 15.18 ? 229  LEU A CG    1 
ATOM   1798 C  CD1   . LEU A 1 232 ? 62.979 -9.822  8.286   1.00 13.26 ? 229  LEU A CD1   1 
ATOM   1799 C  CD2   . LEU A 1 232 ? 61.202 -9.107  9.959   1.00 17.73 ? 229  LEU A CD2   1 
ATOM   1800 N  N     A ASN A 1 233 ? 63.304 -4.213  9.195   0.50 12.37 ? 230  ASN A N     1 
ATOM   1801 N  N     B ASN A 1 233 ? 63.242 -4.121  9.253   0.50 12.42 ? 230  ASN A N     1 
ATOM   1802 C  CA    A ASN A 1 233 ? 64.104 -3.087  9.640   0.50 12.39 ? 230  ASN A CA    1 
ATOM   1803 C  CA    B ASN A 1 233 ? 64.171 -3.092  9.759   0.50 12.35 ? 230  ASN A CA    1 
ATOM   1804 C  C     A ASN A 1 233 ? 63.572 -1.831  8.975   0.50 12.85 ? 230  ASN A C     1 
ATOM   1805 C  C     B ASN A 1 233 ? 63.872 -1.627  9.387   0.50 12.79 ? 230  ASN A C     1 
ATOM   1806 O  O     A ASN A 1 233 ? 64.022 -1.439  7.906   0.50 14.03 ? 230  ASN A O     1 
ATOM   1807 O  O     B ASN A 1 233 ? 64.788 -0.802  9.327   0.50 12.88 ? 230  ASN A O     1 
ATOM   1808 C  CB    A ASN A 1 233 ? 65.584 -3.303  9.321   0.50 13.70 ? 230  ASN A CB    1 
ATOM   1809 C  CB    B ASN A 1 233 ? 65.595 -3.426  9.307   0.50 13.70 ? 230  ASN A CB    1 
ATOM   1810 C  CG    A ASN A 1 233 ? 66.161 -4.519  10.031  0.50 12.84 ? 230  ASN A CG    1 
ATOM   1811 C  CG    B ASN A 1 233 ? 66.166 -4.632  10.025  0.50 12.79 ? 230  ASN A CG    1 
ATOM   1812 O  OD1   A ASN A 1 233 ? 66.492 -4.456  11.216  0.50 15.11 ? 230  ASN A OD1   1 
ATOM   1813 O  OD1   B ASN A 1 233 ? 66.509 -4.555  11.205  0.50 15.11 ? 230  ASN A OD1   1 
ATOM   1814 N  ND2   A ASN A 1 233 ? 66.296 -5.626  9.307   0.50 13.43 ? 230  ASN A ND2   1 
ATOM   1815 N  ND2   B ASN A 1 233 ? 66.288 -5.749  9.313   0.50 13.44 ? 230  ASN A ND2   1 
ATOM   1816 N  N     A LYS A 1 234 ? 62.562 -1.242  9.598   0.50 19.29 ? 231  LYS A N     1 
ATOM   1817 N  N     B LYS A 1 234 ? 62.604 -1.305  9.161   0.50 18.65 ? 231  LYS A N     1 
ATOM   1818 C  CA    A LYS A 1 234 ? 62.037 0.046   9.177   0.50 16.49 ? 231  LYS A CA    1 
ATOM   1819 C  CA    B LYS A 1 234 ? 62.171 0.075   8.916   0.50 16.15 ? 231  LYS A CA    1 
ATOM   1820 C  C     A LYS A 1 234 ? 62.334 1.018   10.298  0.50 16.67 ? 231  LYS A C     1 
ATOM   1821 C  C     B LYS A 1 234 ? 62.358 0.967   10.157  0.50 16.41 ? 231  LYS A C     1 
ATOM   1822 O  O     A LYS A 1 234 ? 62.410 0.623   11.462  0.50 21.09 ? 231  LYS A O     1 
ATOM   1823 O  O     B LYS A 1 234 ? 62.350 0.459   11.278  0.50 21.27 ? 231  LYS A O     1 
ATOM   1824 C  CB    A LYS A 1 234 ? 60.528 -0.019  8.885   0.50 15.18 ? 231  LYS A CB    1 
ATOM   1825 C  CB    B LYS A 1 234 ? 60.702 0.074   8.476   0.50 15.51 ? 231  LYS A CB    1 
ATOM   1826 C  CG    A LYS A 1 234 ? 60.157 -0.417  7.448   0.50 16.46 ? 231  LYS A CG    1 
ATOM   1827 C  CG    B LYS A 1 234 ? 59.781 -0.697  9.408   0.50 16.09 ? 231  LYS A CG    1 
ATOM   1828 C  CD    A LYS A 1 234 ? 58.660 -0.192  7.160   0.50 17.13 ? 231  LYS A CD    1 
ATOM   1829 C  CD    B LYS A 1 234 ? 58.345 -0.681  8.917   0.50 18.30 ? 231  LYS A CD    1 
ATOM   1830 C  CE    A LYS A 1 234 ? 58.351 -0.066  5.656   0.50 14.79 ? 231  LYS A CE    1 
ATOM   1831 C  CE    B LYS A 1 234 ? 57.362 -0.465  10.071  0.50 14.26 ? 231  LYS A CE    1 
ATOM   1832 N  NZ    A LYS A 1 234 ? 58.515 1.356   5.182   0.50 12.63 ? 231  LYS A NZ    1 
ATOM   1833 N  NZ    B LYS A 1 234 ? 55.956 -0.632  9.601   0.50 14.17 ? 231  LYS A NZ    1 
ATOM   1834 N  N     . PRO A 1 235 ? 62.512 2.299   9.974   1.00 14.29 ? 232  PRO A N     1 
ATOM   1835 C  CA    . PRO A 1 235 ? 62.531 3.002   8.684   1.00 14.65 ? 232  PRO A CA    1 
ATOM   1836 C  C     . PRO A 1 235 ? 63.915 3.151   8.077   1.00 11.77 ? 232  PRO A C     1 
ATOM   1837 O  O     . PRO A 1 235 ? 64.925 2.923   8.752   1.00 14.45 ? 232  PRO A O     1 
ATOM   1838 C  CB    . PRO A 1 235 ? 61.991 4.383   9.050   1.00 17.30 ? 232  PRO A CB    1 
ATOM   1839 C  CG    . PRO A 1 235 ? 62.570 4.617   10.430  1.00 16.98 ? 232  PRO A CG    1 
ATOM   1840 C  CD    . PRO A 1 235 ? 62.515 3.253   11.100  1.00 19.83 ? 232  PRO A CD    1 
ATOM   1841 N  N     . ASN A 1 236 ? 63.931 3.550   6.812   1.00 12.68 ? 233  ASN A N     1 
ATOM   1842 C  CA    . ASN A 1 236 ? 65.148 3.948   6.115   1.00 10.04 ? 233  ASN A CA    1 
ATOM   1843 C  C     . ASN A 1 236 ? 66.242 2.872   6.080   1.00 8.76  ? 233  ASN A C     1 
ATOM   1844 O  O     . ASN A 1 236 ? 67.418 3.199   6.138   1.00 12.66 ? 233  ASN A O     1 
ATOM   1845 C  CB    . ASN A 1 236 ? 65.693 5.236   6.751   1.00 11.66 ? 233  ASN A CB    1 
ATOM   1846 C  CG    . ASN A 1 236 ? 66.717 5.947   5.869   1.00 12.20 ? 233  ASN A CG    1 
ATOM   1847 O  OD1   . ASN A 1 236 ? 66.655 5.883   4.643   1.00 18.25 ? 233  ASN A OD1   1 
ATOM   1848 N  ND2   . ASN A 1 236 ? 67.668 6.626   6.503   1.00 18.84 ? 233  ASN A ND2   1 
ATOM   1849 N  N     . ARG A 1 237 ? 65.848 1.602   5.980   1.00 10.38 ? 234  ARG A N     1 
ATOM   1850 C  CA    . ARG A 1 237 ? 66.825 0.512   5.884   1.00 13.10 ? 234  ARG A CA    1 
ATOM   1851 C  C     . ARG A 1 237 ? 66.292 -0.546  4.947   1.00 11.88 ? 234  ARG A C     1 
ATOM   1852 O  O     . ARG A 1 237 ? 65.102 -0.552  4.627   1.00 11.50 ? 234  ARG A O     1 
ATOM   1853 C  CB    . ARG A 1 237 ? 67.122 -0.120  7.254   1.00 13.44 ? 234  ARG A CB    1 
ATOM   1854 C  CG    . ARG A 1 237 ? 67.753 0.792   8.279   1.00 13.82 ? 234  ARG A CG    1 
ATOM   1855 C  CD    . ARG A 1 237 ? 69.219 1.052   7.950   1.00 18.16 ? 234  ARG A CD    1 
ATOM   1856 N  NE    . ARG A 1 237 ? 69.891 1.856   8.973   1.00 23.69 ? 234  ARG A NE    1 
ATOM   1857 C  CZ    . ARG A 1 237 ? 69.908 3.187   8.986   1.00 25.33 ? 234  ARG A CZ    1 
ATOM   1858 N  NH1   . ARG A 1 237 ? 69.287 3.871   8.032   1.00 22.21 ? 234  ARG A NH1   1 
ATOM   1859 N  NH2   . ARG A 1 237 ? 70.554 3.836   9.949   1.00 26.64 ? 234  ARG A NH2   1 
ATOM   1860 N  N     . GLN A 1 238 ? 67.154 -1.446  4.493   1.00 11.11 ? 235  GLN A N     1 
ATOM   1861 C  CA    . GLN A 1 238 ? 66.668 -2.532  3.643   1.00 8.83  ? 235  GLN A CA    1 
ATOM   1862 C  C     . GLN A 1 238 ? 67.178 -3.845  4.186   1.00 10.10 ? 235  GLN A C     1 
ATOM   1863 O  O     . GLN A 1 238 ? 68.205 -3.883  4.852   1.00 10.82 ? 235  GLN A O     1 
ATOM   1864 C  CB    . GLN A 1 238 ? 67.099 -2.343  2.188   1.00 10.52 ? 235  GLN A CB    1 
ATOM   1865 C  CG    . GLN A 1 238 ? 68.592 -2.108  2.016   1.00 10.48 ? 235  GLN A CG    1 
ATOM   1866 C  CD    . GLN A 1 238 ? 68.977 -1.893  0.561   1.00 12.37 ? 235  GLN A CD    1 
ATOM   1867 O  OE1   . GLN A 1 238 ? 68.576 -0.896  -0.061  1.00 13.50 ? 235  GLN A OE1   1 
ATOM   1868 N  NE2   . GLN A 1 238 ? 69.750 -2.821  0.005   1.00 12.38 ? 235  GLN A NE2   1 
ATOM   1869 N  N     . THR A 1 239 ? 66.430 -4.913  3.921   1.00 9.50  ? 236  THR A N     1 
ATOM   1870 C  CA    . THR A 1 239 ? 66.719 -6.209  4.508   1.00 10.81 ? 236  THR A CA    1 
ATOM   1871 C  C     . THR A 1 239 ? 66.735 -7.281  3.421   1.00 9.20  ? 236  THR A C     1 
ATOM   1872 O  O     . THR A 1 239 ? 65.808 -7.365  2.611   1.00 10.84 ? 236  THR A O     1 
ATOM   1873 C  CB    . THR A 1 239 ? 65.679 -6.578  5.575   1.00 12.08 ? 236  THR A CB    1 
ATOM   1874 O  OG1   . THR A 1 239 ? 65.595 -5.538  6.550   1.00 11.38 ? 236  THR A OG1   1 
ATOM   1875 C  CG2   . THR A 1 239 ? 66.055 -7.882  6.295   1.00 10.68 ? 236  THR A CG2   1 
ATOM   1876 N  N     . LEU A 1 240 ? 67.799 -8.084  3.429   1.00 7.87  ? 237  LEU A N     1 
ATOM   1877 C  CA    . LEU A 1 240 ? 67.953 -9.249  2.563   1.00 10.16 ? 237  LEU A CA    1 
ATOM   1878 C  C     . LEU A 1 240 ? 67.529 -10.511 3.342   1.00 10.86 ? 237  LEU A C     1 
ATOM   1879 O  O     . LEU A 1 240 ? 68.073 -10.818 4.404   1.00 10.88 ? 237  LEU A O     1 
ATOM   1880 C  CB    . LEU A 1 240 ? 69.407 -9.362  2.071   1.00 11.89 ? 237  LEU A CB    1 
ATOM   1881 C  CG    . LEU A 1 240 ? 69.801 -10.348 0.960   1.00 12.08 ? 237  LEU A CG    1 
ATOM   1882 C  CD1   . LEU A 1 240 ? 71.147 -9.970  0.365   1.00 12.46 ? 237  LEU A CD1   1 
ATOM   1883 C  CD2   . LEU A 1 240 ? 69.845 -11.809 1.432   1.00 12.33 ? 237  LEU A CD2   1 
ATOM   1884 N  N     . VAL A 1 241 ? 66.542 -11.222 2.807   1.00 8.37  ? 238  VAL A N     1 
ATOM   1885 C  CA    . VAL A 1 241 ? 66.111 -12.500 3.363   1.00 10.93 ? 238  VAL A CA    1 
ATOM   1886 C  C     . VAL A 1 241 ? 66.513 -13.567 2.365   1.00 9.72  ? 238  VAL A C     1 
ATOM   1887 O  O     . VAL A 1 241 ? 65.942 -13.667 1.275   1.00 12.00 ? 238  VAL A O     1 
ATOM   1888 C  CB    . VAL A 1 241 ? 64.605 -12.528 3.645   1.00 9.64  ? 238  VAL A CB    1 
ATOM   1889 C  CG1   . VAL A 1 241 ? 64.091 -13.964 3.836   1.00 10.00 ? 238  VAL A CG1   1 
ATOM   1890 C  CG2   . VAL A 1 241 ? 64.307 -11.724 4.899   1.00 10.19 ? 238  VAL A CG2   1 
ATOM   1891 N  N     . SER A 1 242 ? 67.533 -14.337 2.729   1.00 9.75  ? 239  SER A N     1 
ATOM   1892 C  CA    . SER A 1 242 ? 68.006 -15.411 1.864   1.00 11.04 ? 239  SER A CA    1 
ATOM   1893 C  C     . SER A 1 242 ? 67.125 -16.665 1.986   1.00 8.73  ? 239  SER A C     1 
ATOM   1894 O  O     . SER A 1 242 ? 66.331 -16.807 2.925   1.00 11.46 ? 239  SER A O     1 
ATOM   1895 C  CB    . SER A 1 242 ? 69.461 -15.751 2.196   1.00 12.27 ? 239  SER A CB    1 
ATOM   1896 O  OG    . SER A 1 242 ? 69.588 -16.162 3.551   1.00 15.01 ? 239  SER A OG    1 
ATOM   1897 N  N     . HIS A 1 243 ? 67.292 -17.587 1.044   1.00 11.23 ? 240  HIS A N     1 
ATOM   1898 C  CA    . HIS A 1 243 ? 66.545 -18.834 1.090   1.00 10.55 ? 240  HIS A CA    1 
ATOM   1899 C  C     . HIS A 1 243 ? 66.922 -19.586 2.364   1.00 12.17 ? 240  HIS A C     1 
ATOM   1900 O  O     . HIS A 1 243 ? 66.064 -20.185 3.034   1.00 9.90  ? 240  HIS A O     1 
ATOM   1901 C  CB    . HIS A 1 243 ? 66.831 -19.700 -0.139  1.00 13.60 ? 240  HIS A CB    1 
ATOM   1902 C  CG    . HIS A 1 243 ? 66.074 -20.995 -0.155  1.00 15.64 ? 240  HIS A CG    1 
ATOM   1903 N  ND1   . HIS A 1 243 ? 64.728 -21.061 -0.434  1.00 16.49 ? 240  HIS A ND1   1 
ATOM   1904 C  CD2   . HIS A 1 243 ? 66.474 -22.268 0.071   1.00 19.87 ? 240  HIS A CD2   1 
ATOM   1905 C  CE1   . HIS A 1 243 ? 64.326 -22.319 -0.384  1.00 20.02 ? 240  HIS A CE1   1 
ATOM   1906 N  NE2   . HIS A 1 243 ? 65.368 -23.075 -0.076  1.00 18.86 ? 240  HIS A NE2   1 
ATOM   1907 N  N     . GLY A 1 244 ? 68.209 -19.521 2.702   1.00 12.69 ? 241  GLY A N     1 
ATOM   1908 C  CA    . GLY A 1 244 ? 68.738 -20.238 3.851   1.00 12.06 ? 241  GLY A CA    1 
ATOM   1909 C  C     . GLY A 1 244 ? 68.217 -19.698 5.167   1.00 11.16 ? 241  GLY A C     1 
ATOM   1910 O  O     . GLY A 1 244 ? 68.099 -20.437 6.144   1.00 12.70 ? 241  GLY A O     1 
ATOM   1911 N  N     . SER A 1 245 ? 67.859 -18.412 5.186   1.00 12.25 ? 242  SER A N     1 
ATOM   1912 C  CA    . SER A 1 245 ? 67.337 -17.799 6.406   1.00 11.16 ? 242  SER A CA    1 
ATOM   1913 C  C     . SER A 1 245 ? 65.912 -18.223 6.744   1.00 10.73 ? 242  SER A C     1 
ATOM   1914 O  O     . SER A 1 245 ? 65.452 -17.987 7.860   1.00 12.69 ? 242  SER A O     1 
ATOM   1915 C  CB    . SER A 1 245 ? 67.385 -16.268 6.306   1.00 10.85 ? 242  SER A CB    1 
ATOM   1916 O  OG    . SER A 1 245 ? 66.321 -15.756 5.509   1.00 12.11 ? 242  SER A OG    1 
ATOM   1917 N  N     . VAL A 1 246 ? 65.211 -18.838 5.799   1.00 10.87 ? 243  VAL A N     1 
ATOM   1918 C  CA    . VAL A 1 246 ? 63.783 -19.080 5.996   1.00 9.46  ? 243  VAL A CA    1 
ATOM   1919 C  C     . VAL A 1 246 ? 63.415 -20.027 7.173   1.00 10.84 ? 243  VAL A C     1 
ATOM   1920 O  O     . VAL A 1 246 ? 62.517 -19.696 7.958   1.00 9.86  ? 243  VAL A O     1 
ATOM   1921 C  CB    . VAL A 1 246 ? 63.139 -19.575 4.688   1.00 11.42 ? 243  VAL A CB    1 
ATOM   1922 C  CG1   . VAL A 1 246 ? 61.710 -20.041 4.940   1.00 9.40  ? 243  VAL A CG1   1 
ATOM   1923 C  CG2   . VAL A 1 246 ? 63.151 -18.451 3.663   1.00 14.02 ? 243  VAL A CG2   1 
ATOM   1924 N  N     . PRO A 1 247 ? 64.095 -21.180 7.331   1.00 12.00 ? 244  PRO A N     1 
ATOM   1925 C  CA    . PRO A 1 247 ? 63.667 -22.028 8.465   1.00 9.71  ? 244  PRO A CA    1 
ATOM   1926 C  C     . PRO A 1 247 ? 63.704 -21.335 9.840   1.00 8.43  ? 244  PRO A C     1 
ATOM   1927 O  O     . PRO A 1 247 ? 62.752 -21.497 10.612  1.00 10.59 ? 244  PRO A O     1 
ATOM   1928 C  CB    . PRO A 1 247 ? 64.666 -23.207 8.418   1.00 8.37  ? 244  PRO A CB    1 
ATOM   1929 C  CG    . PRO A 1 247 ? 65.057 -23.285 6.943   1.00 16.73 ? 244  PRO A CG    1 
ATOM   1930 C  CD    . PRO A 1 247 ? 65.161 -21.822 6.535   1.00 11.05 ? 244  PRO A CD    1 
ATOM   1931 N  N     . GLN A 1 248 ? 64.775 -20.615 10.159  1.00 12.84 ? 245  GLN A N     1 
ATOM   1932 C  CA    . GLN A 1 248 ? 64.845 -19.959 11.453  1.00 10.83 ? 245  GLN A CA    1 
ATOM   1933 C  C     . GLN A 1 248 ? 63.840 -18.807 11.539  1.00 13.04 ? 245  GLN A C     1 
ATOM   1934 O  O     . GLN A 1 248 ? 63.144 -18.644 12.545  1.00 11.95 ? 245  GLN A O     1 
ATOM   1935 C  CB    . GLN A 1 248 ? 66.269 -19.459 11.736  1.00 16.66 ? 245  GLN A CB    1 
ATOM   1936 C  CG    . GLN A 1 248 ? 67.289 -20.584 11.920  1.00 22.63 ? 245  GLN A CG    1 
ATOM   1937 C  CD    . GLN A 1 248 ? 68.436 -20.221 12.868  1.00 30.51 ? 245  GLN A CD    1 
ATOM   1938 O  OE1   . GLN A 1 248 ? 69.607 -20.109 12.458  1.00 24.07 ? 245  GLN A OE1   1 
ATOM   1939 N  NE2   . GLN A 1 248 ? 68.107 -20.063 14.147  1.00 30.98 ? 245  GLN A NE2   1 
ATOM   1940 N  N     . LEU A 1 249 ? 63.768 -18.019 10.469  1.00 9.96  ? 246  LEU A N     1 
ATOM   1941 C  CA    . LEU A 1 249 ? 62.837 -16.896 10.404  1.00 11.42 ? 246  LEU A CA    1 
ATOM   1942 C  C     . LEU A 1 249 ? 61.400 -17.362 10.599  1.00 9.27  ? 246  LEU A C     1 
ATOM   1943 O  O     . LEU A 1 249 ? 60.637 -16.782 11.375  1.00 11.65 ? 246  LEU A O     1 
ATOM   1944 C  CB    . LEU A 1 249 ? 62.984 -16.185 9.058   1.00 12.03 ? 246  LEU A CB    1 
ATOM   1945 C  CG    . LEU A 1 249 ? 62.057 -14.980 8.889   1.00 12.14 ? 246  LEU A CG    1 
ATOM   1946 C  CD1   . LEU A 1 249 ? 62.372 -13.915 9.930   1.00 12.38 ? 246  LEU A CD1   1 
ATOM   1947 C  CD2   . LEU A 1 249 ? 62.158 -14.427 7.470   1.00 17.05 ? 246  LEU A CD2   1 
ATOM   1948 N  N     . PHE A 1 250 ? 61.048 -18.450 9.930   1.00 8.02  ? 247  PHE A N     1 
ATOM   1949 C  CA    . PHE A 1 250 ? 59.663 -18.910 9.954   1.00 9.75  ? 247  PHE A CA    1 
ATOM   1950 C  C     . PHE A 1 250 ? 59.323 -19.680 11.227  1.00 8.58  ? 247  PHE A C     1 
ATOM   1951 O  O     . PHE A 1 250 ? 58.149 -19.853 11.547  1.00 10.59 ? 247  PHE A O     1 
ATOM   1952 C  CB    . PHE A 1 250 ? 59.360 -19.769 8.721   1.00 11.37 ? 247  PHE A CB    1 
ATOM   1953 C  CG    . PHE A 1 250 ? 58.929 -18.978 7.511   1.00 10.77 ? 247  PHE A CG    1 
ATOM   1954 C  CD1   . PHE A 1 250 ? 58.411 -19.624 6.402   1.00 12.94 ? 247  PHE A CD1   1 
ATOM   1955 C  CD2   . PHE A 1 250 ? 59.060 -17.583 7.486   1.00 11.57 ? 247  PHE A CD2   1 
ATOM   1956 C  CE1   . PHE A 1 250 ? 58.010 -18.906 5.278   1.00 12.39 ? 247  PHE A CE1   1 
ATOM   1957 C  CE2   . PHE A 1 250 ? 58.678 -16.849 6.377   1.00 12.39 ? 247  PHE A CE2   1 
ATOM   1958 C  CZ    . PHE A 1 250 ? 58.141 -17.513 5.263   1.00 12.61 ? 247  PHE A CZ    1 
ATOM   1959 N  N     . SER A 1 251 ? 60.340 -20.123 11.971  1.00 8.02  ? 248  SER A N     1 
ATOM   1960 C  CA    . SER A 1 251 ? 60.102 -20.988 13.128  1.00 7.97  ? 248  SER A CA    1 
ATOM   1961 C  C     . SER A 1 251 ? 59.368 -20.256 14.252  1.00 9.08  ? 248  SER A C     1 
ATOM   1962 O  O     . SER A 1 251 ? 58.719 -20.885 15.075  1.00 9.13  ? 248  SER A O     1 
ATOM   1963 C  CB    . SER A 1 251 ? 61.419 -21.559 13.655  1.00 8.35  ? 248  SER A CB    1 
ATOM   1964 O  OG    . SER A 1 251 ? 62.201 -20.574 14.318  1.00 10.50 ? 248  SER A OG    1 
ATOM   1965 N  N     . GLN A 1 252 ? 59.458 -18.925 14.277  1.00 9.27  ? 249  GLN A N     1 
ATOM   1966 C  CA    . GLN A 1 252 ? 58.726 -18.153 15.264  1.00 10.66 ? 249  GLN A CA    1 
ATOM   1967 C  C     . GLN A 1 252 ? 57.880 -17.056 14.638  1.00 13.48 ? 249  GLN A C     1 
ATOM   1968 O  O     . GLN A 1 252 ? 57.549 -16.080 15.302  1.00 14.81 ? 249  GLN A O     1 
ATOM   1969 C  CB    . GLN A 1 252 ? 59.680 -17.517 16.260  1.00 14.82 ? 249  GLN A CB    1 
ATOM   1970 C  CG    . GLN A 1 252 ? 60.449 -18.497 17.096  1.00 15.05 ? 249  GLN A CG    1 
ATOM   1971 C  CD    . GLN A 1 252 ? 61.282 -17.771 18.117  1.00 17.48 ? 249  GLN A CD    1 
ATOM   1972 O  OE1   . GLN A 1 252 ? 60.828 -17.515 19.234  1.00 25.19 ? 249  GLN A OE1   1 
ATOM   1973 N  NE2   . GLN A 1 252 ? 62.492 -17.388 17.726  1.00 21.02 ? 249  GLN A NE2   1 
ATOM   1974 N  N     . MET A 1 253 ? 57.569 -17.205 13.361  1.00 9.98  ? 250  MET A N     1 
ATOM   1975 C  CA    . MET A 1 253 ? 56.858 -16.163 12.640  1.00 12.28 ? 250  MET A CA    1 
ATOM   1976 C  C     . MET A 1 253 ? 55.373 -16.449 12.689  1.00 10.88 ? 250  MET A C     1 
ATOM   1977 O  O     . MET A 1 253 ? 54.928 -17.429 12.116  1.00 12.57 ? 250  MET A O     1 
ATOM   1978 C  CB    . MET A 1 253 ? 57.356 -16.080 11.183  1.00 13.14 ? 250  MET A CB    1 
ATOM   1979 C  CG    . MET A 1 253 ? 56.680 -15.009 10.325  1.00 16.36 ? 250  MET A CG    1 
ATOM   1980 S  SD    . MET A 1 253 ? 56.995 -13.344 10.910  1.00 17.07 ? 250  MET A SD    1 
ATOM   1981 C  CE    . MET A 1 253 ? 58.786 -13.190 10.787  1.00 14.50 ? 250  MET A CE    1 
ATOM   1982 N  N     . PRO A 1 254 ? 54.585 -15.583 13.364  1.00 12.37 ? 251  PRO A N     1 
ATOM   1983 C  CA    . PRO A 1 254 ? 53.135 -15.824 13.355  1.00 14.25 ? 251  PRO A CA    1 
ATOM   1984 C  C     . PRO A 1 254 ? 52.573 -15.889 11.946  1.00 11.08 ? 251  PRO A C     1 
ATOM   1985 O  O     . PRO A 1 254 ? 52.951 -15.105 11.072  1.00 12.91 ? 251  PRO A O     1 
ATOM   1986 C  CB    . PRO A 1 254 ? 52.562 -14.612 14.114  1.00 13.46 ? 251  PRO A CB    1 
ATOM   1987 C  CG    . PRO A 1 254 ? 53.679 -14.192 15.009  1.00 14.94 ? 251  PRO A CG    1 
ATOM   1988 C  CD    . PRO A 1 254 ? 54.929 -14.388 14.147  1.00 16.80 ? 251  PRO A CD    1 
ATOM   1989 N  N     . ILE A 1 255 ? 51.652 -16.818 11.749  1.00 13.89 ? 252  ILE A N     1 
ATOM   1990 C  CA    . ILE A 1 255 ? 51.080 -17.059 10.444  1.00 13.34 ? 252  ILE A CA    1 
ATOM   1991 C  C     . ILE A 1 255 ? 50.476 -15.782 9.866   1.00 12.76 ? 252  ILE A C     1 
ATOM   1992 O  O     . ILE A 1 255 ? 50.610 -15.540 8.675   1.00 12.81 ? 252  ILE A O     1 
ATOM   1993 C  CB    . ILE A 1 255 ? 50.055 -18.210 10.524  1.00 12.93 ? 252  ILE A CB    1 
ATOM   1994 C  CG1   . ILE A 1 255 ? 50.820 -19.541 10.613  1.00 18.19 ? 252  ILE A CG1   1 
ATOM   1995 C  CG2   . ILE A 1 255 ? 49.115 -18.222 9.324   1.00 15.37 ? 252  ILE A CG2   1 
ATOM   1996 C  CD1   . ILE A 1 255 ? 50.013 -20.686 11.174  1.00 17.92 ? 252  ILE A CD1   1 
ATOM   1997 N  N     . ARG A 1 256 ? 49.877 -14.933 10.712  1.00 11.17 ? 253  ARG A N     1 
ATOM   1998 C  CA    . ARG A 1 256 ? 49.141 -13.775 10.218  1.00 9.99  ? 253  ARG A CA    1 
ATOM   1999 C  C     . ARG A 1 256 ? 50.066 -12.723 9.604   1.00 13.67 ? 253  ARG A C     1 
ATOM   2000 O  O     . ARG A 1 256 ? 49.607 -11.802 8.930   1.00 14.63 ? 253  ARG A O     1 
ATOM   2001 C  CB    . ARG A 1 256 ? 48.327 -13.138 11.342  1.00 13.74 ? 253  ARG A CB    1 
ATOM   2002 C  CG    . ARG A 1 256 ? 49.195 -12.470 12.386  1.00 16.45 ? 253  ARG A CG    1 
ATOM   2003 C  CD    . ARG A 1 256 ? 48.388 -11.940 13.564  1.00 18.18 ? 253  ARG A CD    1 
ATOM   2004 N  NE    . ARG A 1 256 ? 49.274 -11.443 14.625  1.00 25.68 ? 253  ARG A NE    1 
ATOM   2005 C  CZ    . ARG A 1 256 ? 49.724 -12.184 15.633  1.00 27.61 ? 253  ARG A CZ    1 
ATOM   2006 N  NH1   . ARG A 1 256 ? 49.363 -13.457 15.737  1.00 25.72 ? 253  ARG A NH1   1 
ATOM   2007 N  NH2   . ARG A 1 256 ? 50.531 -11.649 16.547  1.00 28.59 ? 253  ARG A NH2   1 
ATOM   2008 N  N     . LYS A 1 257 ? 51.369 -12.843 9.841   1.00 11.68 ? 254  LYS A N     1 
ATOM   2009 C  CA    . LYS A 1 257 ? 52.297 -11.845 9.317   1.00 16.17 ? 254  LYS A CA    1 
ATOM   2010 C  C     . LYS A 1 257 ? 52.590 -12.012 7.844   1.00 14.70 ? 254  LYS A C     1 
ATOM   2011 O  O     . LYS A 1 257 ? 53.184 -11.127 7.237   1.00 14.40 ? 254  LYS A O     1 
ATOM   2012 C  CB    . LYS A 1 257 ? 53.627 -11.873 10.071  1.00 12.58 ? 254  LYS A CB    1 
ATOM   2013 C  CG    . LYS A 1 257 ? 53.492 -11.642 11.558  1.00 17.72 ? 254  LYS A CG    1 
ATOM   2014 C  CD    . LYS A 1 257 ? 52.803 -10.336 11.885  1.00 20.72 ? 254  LYS A CD    1 
ATOM   2015 C  CE    . LYS A 1 257 ? 52.871 -10.073 13.390  1.00 32.15 ? 254  LYS A CE    1 
ATOM   2016 N  NZ    . LYS A 1 257 ? 52.278 -8.758  13.781  1.00 36.86 ? 254  LYS A NZ    1 
ATOM   2017 N  N     . ILE A 1 258 ? 52.227 -13.157 7.275   1.00 11.78 ? 255  ILE A N     1 
ATOM   2018 C  CA    . ILE A 1 258 ? 52.533 -13.412 5.874   1.00 11.38 ? 255  ILE A CA    1 
ATOM   2019 C  C     . ILE A 1 258 ? 51.397 -12.864 5.009   1.00 15.76 ? 255  ILE A C     1 
ATOM   2020 O  O     . ILE A 1 258 ? 50.228 -13.068 5.331   1.00 15.30 ? 255  ILE A O     1 
ATOM   2021 C  CB    . ILE A 1 258 ? 52.734 -14.928 5.606   1.00 14.63 ? 255  ILE A CB    1 
ATOM   2022 C  CG1   . ILE A 1 258 ? 54.162 -15.347 5.972   1.00 24.78 ? 255  ILE A CG1   1 
ATOM   2023 C  CG2   . ILE A 1 258 ? 52.486 -15.272 4.145   1.00 17.36 ? 255  ILE A CG2   1 
ATOM   2024 C  CD1   . ILE A 1 258 ? 54.505 -15.212 7.422   1.00 25.98 ? 255  ILE A CD1   1 
ATOM   2025 N  N     . ARG A 1 259 ? 51.731 -12.209 3.917   1.00 13.56 ? 256  ARG A N     1 
ATOM   2026 C  CA    . ARG A 1 259 ? 50.729 -11.595 3.105   1.00 16.40 ? 256  ARG A CA    1 
ATOM   2027 C  C     . ARG A 1 259 ? 49.684 -12.585 2.573   1.00 17.74 ? 256  ARG A C     1 
ATOM   2028 O  O     . ARG A 1 259 ? 50.028 -13.555 2.041   1.00 14.77 ? 256  ARG A O     1 
ATOM   2029 C  CB    . ARG A 1 259 ? 51.362 -10.903 1.928   1.00 16.83 ? 256  ARG A CB    1 
ATOM   2030 C  CG    . ARG A 1 259 ? 50.435 -9.937  1.261   1.00 23.91 ? 256  ARG A CG    1 
ATOM   2031 C  CD    . ARG A 1 259 ? 50.840 -9.447  -0.109  1.00 34.55 ? 256  ARG A CD    1 
ATOM   2032 N  NE    . ARG A 1 259 ? 49.828 -8.430  -0.480  1.00 42.74 ? 256  ARG A NE    1 
ATOM   2033 C  CZ    . ARG A 1 259 ? 49.770 -7.795  -1.628  1.00 49.07 ? 256  ARG A CZ    1 
ATOM   2034 N  NH1   . ARG A 1 259 ? 48.784 -6.952  -1.861  1.00 48.97 ? 256  ARG A NH1   1 
ATOM   2035 N  NH2   . ARG A 1 259 ? 50.701 -7.995  -2.533  1.00 42.02 ? 256  ARG A NH2   1 
ATOM   2036 N  N     . SER A 1 260 ? 48.414 -12.226 2.768   1.00 14.53 ? 257  SER A N     1 
ATOM   2037 C  CA    . SER A 1 260 ? 47.198 -12.992 2.416   1.00 15.37 ? 257  SER A CA    1 
ATOM   2038 C  C     . SER A 1 260 ? 46.705 -13.868 3.571   1.00 18.13 ? 257  SER A C     1 
ATOM   2039 O  O     . SER A 1 260 ? 45.594 -14.399 3.506   1.00 14.48 ? 257  SER A O     1 
ATOM   2040 C  CB    . SER A 1 260 ? 47.378 -13.853 1.153   1.00 14.44 ? 257  SER A CB    1 
ATOM   2041 O  OG    . SER A 1 260 ? 48.041 -15.081 1.421   1.00 18.58 ? 257  SER A OG    1 
ATOM   2042 N  N     . LEU A 1 261 ? 47.507 -14.004 4.628   1.00 12.46 ? 258  LEU A N     1 
ATOM   2043 C  CA    . LEU A 1 261 ? 47.103 -14.796 5.788   1.00 12.15 ? 258  LEU A CA    1 
ATOM   2044 C  C     . LEU A 1 261 ? 46.722 -13.953 7.015   1.00 12.02 ? 258  LEU A C     1 
ATOM   2045 O  O     . LEU A 1 261 ? 46.561 -14.473 8.131   1.00 14.54 ? 258  LEU A O     1 
ATOM   2046 C  CB    . LEU A 1 261 ? 48.227 -15.789 6.162   1.00 11.56 ? 258  LEU A CB    1 
ATOM   2047 C  CG    . LEU A 1 261 ? 48.645 -16.771 5.051   1.00 12.13 ? 258  LEU A CG    1 
ATOM   2048 C  CD1   . LEU A 1 261 ? 49.719 -17.731 5.556   1.00 12.92 ? 258  LEU A CD1   1 
ATOM   2049 C  CD2   . LEU A 1 261 ? 47.447 -17.563 4.480   1.00 13.78 ? 258  LEU A CD2   1 
ATOM   2050 N  N     . GLY A 1 262 ? 46.553 -12.648 6.821   1.00 13.76 ? 259  GLY A N     1 
ATOM   2051 C  CA    . GLY A 1 262 ? 46.219 -11.780 7.932   1.00 16.04 ? 259  GLY A CA    1 
ATOM   2052 C  C     . GLY A 1 262 ? 44.749 -11.759 8.338   1.00 15.01 ? 259  GLY A C     1 
ATOM   2053 O  O     . GLY A 1 262 ? 44.387 -11.071 9.294   1.00 17.51 ? 259  GLY A O     1 
ATOM   2054 N  N     . GLY A 1 263 ? 43.909 -12.500 7.615   1.00 14.05 ? 260  GLY A N     1 
ATOM   2055 C  CA    . GLY A 1 263 ? 42.474 -12.483 7.837   1.00 18.25 ? 260  GLY A CA    1 
ATOM   2056 C  C     . GLY A 1 263 ? 41.900 -13.845 8.182   1.00 20.49 ? 260  GLY A C     1 
ATOM   2057 O  O     . GLY A 1 263 ? 42.502 -14.613 8.949   1.00 16.19 ? 260  GLY A O     1 
ATOM   2058 N  N     . LYS A 1 264 ? 40.727 -14.145 7.628   1.00 15.54 ? 261  LYS A N     1 
ATOM   2059 C  CA    . LYS A 1 264 ? 39.998 -15.361 7.976   1.00 19.44 ? 261  LYS A CA    1 
ATOM   2060 C  C     . LYS A 1 264 ? 40.750 -16.650 7.599   1.00 19.17 ? 261  LYS A C     1 
ATOM   2061 O  O     . LYS A 1 264 ? 40.744 -17.615 8.369   1.00 19.30 ? 261  LYS A O     1 
ATOM   2062 C  CB    . LYS A 1 264 ? 38.613 -15.354 7.308   1.00 18.23 ? 261  LYS A CB    1 
ATOM   2063 C  CG    . LYS A 1 264 ? 37.688 -14.246 7.818   1.00 21.86 ? 261  LYS A CG    1 
ATOM   2064 C  CD    . LYS A 1 264 ? 36.318 -14.321 7.141   1.00 25.18 ? 261  LYS A CD    1 
ATOM   2065 C  CE    . LYS A 1 264 ? 35.383 -13.216 7.617   1.00 36.43 ? 261  LYS A CE    1 
ATOM   2066 N  NZ    . LYS A 1 264 ? 34.013 -13.394 7.041   1.00 30.94 ? 261  LYS A NZ    1 
ATOM   2067 N  N     . LEU A 1 265 ? 41.387 -16.681 6.429   1.00 15.18 ? 262  LEU A N     1 
ATOM   2068 C  CA    . LEU A 1 265 ? 42.112 -17.889 6.018   1.00 14.28 ? 262  LEU A CA    1 
ATOM   2069 C  C     . LEU A 1 265 ? 43.224 -18.191 7.022   1.00 16.64 ? 262  LEU A C     1 
ATOM   2070 O  O     . LEU A 1 265 ? 43.362 -19.317 7.485   1.00 17.37 ? 262  LEU A O     1 
ATOM   2071 C  CB    . LEU A 1 265 ? 42.699 -17.749 4.616   1.00 14.93 ? 262  LEU A CB    1 
ATOM   2072 C  CG    . LEU A 1 265 ? 43.606 -18.870 4.086   1.00 21.15 ? 262  LEU A CG    1 
ATOM   2073 C  CD1   . LEU A 1 265 ? 42.875 -20.219 4.020   1.00 19.23 ? 262  LEU A CD1   1 
ATOM   2074 C  CD2   . LEU A 1 265 ? 44.150 -18.485 2.713   1.00 21.83 ? 262  LEU A CD2   1 
ATOM   2075 N  N     . GLY A 1 266 ? 43.994 -17.167 7.369   1.00 16.90 ? 263  GLY A N     1 
ATOM   2076 C  CA    . GLY A 1 266 ? 45.048 -17.322 8.351   1.00 12.98 ? 263  GLY A CA    1 
ATOM   2077 C  C     . GLY A 1 266 ? 44.525 -17.805 9.691   1.00 17.63 ? 263  GLY A C     1 
ATOM   2078 O  O     . GLY A 1 266 ? 45.120 -18.683 10.310  1.00 14.94 ? 263  GLY A O     1 
ATOM   2079 N  N     . ALA A 1 267 ? 43.408 -17.239 10.145  1.00 15.70 ? 264  ALA A N     1 
ATOM   2080 C  CA    . ALA A 1 267 ? 42.797 -17.704 11.383  1.00 15.03 ? 264  ALA A CA    1 
ATOM   2081 C  C     . ALA A 1 267 ? 42.393 -19.162 11.275  1.00 17.20 ? 264  ALA A C     1 
ATOM   2082 O  O     . ALA A 1 267 ? 42.500 -19.898 12.244  1.00 19.54 ? 264  ALA A O     1 
ATOM   2083 C  CB    . ALA A 1 267 ? 41.577 -16.832 11.751  1.00 17.82 ? 264  ALA A CB    1 
ATOM   2084 N  N     . SER A 1 268 ? 41.931 -19.583 10.093  1.00 16.48 ? 265  SER A N     1 
ATOM   2085 C  CA    . SER A 1 268 ? 41.488 -20.960 9.923   1.00 16.26 ? 265  SER A CA    1 
ATOM   2086 C  C     . SER A 1 268 ? 42.692 -21.912 9.891   1.00 14.02 ? 265  SER A C     1 
ATOM   2087 O  O     . SER A 1 268 ? 42.592 -23.017 10.396  1.00 17.53 ? 265  SER A O     1 
ATOM   2088 C  CB    . SER A 1 268 ? 40.619 -21.122 8.669   1.00 19.18 ? 265  SER A CB    1 
ATOM   2089 O  OG    . SER A 1 268 ? 41.365 -21.005 7.476   1.00 25.01 ? 265  SER A OG    1 
ATOM   2090 N  N     . VAL A 1 269 ? 43.819 -21.480 9.317   1.00 14.21 ? 266  VAL A N     1 
ATOM   2091 C  CA    . VAL A 1 269 ? 45.048 -22.295 9.327   1.00 13.55 ? 266  VAL A CA    1 
ATOM   2092 C  C     . VAL A 1 269 ? 45.433 -22.601 10.776  1.00 15.11 ? 266  VAL A C     1 
ATOM   2093 O  O     . VAL A 1 269 ? 45.726 -23.743 11.146  1.00 15.32 ? 266  VAL A O     1 
ATOM   2094 C  CB    . VAL A 1 269 ? 46.220 -21.592 8.602   1.00 13.35 ? 266  VAL A CB    1 
ATOM   2095 C  CG1   . VAL A 1 269 ? 47.527 -22.367 8.804   1.00 16.03 ? 266  VAL A CG1   1 
ATOM   2096 C  CG2   . VAL A 1 269 ? 45.914 -21.448 7.102   1.00 13.21 ? 266  VAL A CG2   1 
ATOM   2097 N  N     . ILE A 1 270 ? 45.392 -21.561 11.598  1.00 13.64 ? 267  ILE A N     1 
ATOM   2098 C  CA    . ILE A 1 270 ? 45.757 -21.638 13.003  1.00 16.65 ? 267  ILE A CA    1 
ATOM   2099 C  C     . ILE A 1 270 ? 44.824 -22.555 13.782  1.00 17.07 ? 267  ILE A C     1 
ATOM   2100 O  O     . ILE A 1 270 ? 45.282 -23.436 14.516  1.00 19.85 ? 267  ILE A O     1 
ATOM   2101 C  CB    . ILE A 1 270 ? 45.742 -20.223 13.634  1.00 16.85 ? 267  ILE A CB    1 
ATOM   2102 C  CG1   . ILE A 1 270 ? 46.935 -19.397 13.127  1.00 16.32 ? 267  ILE A CG1   1 
ATOM   2103 C  CG2   . ILE A 1 270 ? 45.737 -20.292 15.153  1.00 20.90 ? 267  ILE A CG2   1 
ATOM   2104 C  CD1   . ILE A 1 270 ? 46.819 -17.893 13.439  1.00 18.73 ? 267  ILE A CD1   1 
ATOM   2105 N  N     . GLU A 1 271 ? 43.517 -22.345 13.624  1.00 19.30 ? 268  GLU A N     1 
ATOM   2106 C  CA    . GLU A 1 271 ? 42.525 -23.102 14.386  1.00 20.23 ? 268  GLU A CA    1 
ATOM   2107 C  C     . GLU A 1 271 ? 42.418 -24.556 13.955  1.00 17.88 ? 268  GLU A C     1 
ATOM   2108 O  O     . GLU A 1 271 ? 42.405 -25.458 14.790  1.00 19.88 ? 268  GLU A O     1 
ATOM   2109 C  CB    . GLU A 1 271 ? 41.149 -22.444 14.276  1.00 28.07 ? 268  GLU A CB    1 
ATOM   2110 C  CG    . GLU A 1 271 ? 40.013 -23.306 14.819  1.00 40.51 ? 268  GLU A CG    1 
ATOM   2111 C  CD    . GLU A 1 271 ? 38.897 -22.483 15.427  1.00 47.68 ? 268  GLU A CD    1 
ATOM   2112 O  OE1   . GLU A 1 271 ? 37.716 -22.763 15.125  1.00 51.88 ? 268  GLU A OE1   1 
ATOM   2113 O  OE2   . GLU A 1 271 ? 39.204 -21.558 16.212  1.00 52.02 ? 268  GLU A OE2   1 
ATOM   2114 N  N     . ILE A 1 272 ? 42.339 -24.782 12.649  1.00 17.32 ? 269  ILE A N     1 
ATOM   2115 C  CA    . ILE A 1 272 ? 42.155 -26.131 12.137  1.00 13.87 ? 269  ILE A CA    1 
ATOM   2116 C  C     . ILE A 1 272 ? 43.379 -26.997 12.416  1.00 15.38 ? 269  ILE A C     1 
ATOM   2117 O  O     . ILE A 1 272 ? 43.255 -28.144 12.842  1.00 18.94 ? 269  ILE A O     1 
ATOM   2118 C  CB    . ILE A 1 272 ? 41.859 -26.124 10.631  1.00 13.92 ? 269  ILE A CB    1 
ATOM   2119 C  CG1   . ILE A 1 272 ? 40.449 -25.592 10.381  1.00 22.36 ? 269  ILE A CG1   1 
ATOM   2120 C  CG2   . ILE A 1 272 ? 41.985 -27.534 10.058  1.00 14.62 ? 269  ILE A CG2   1 
ATOM   2121 C  CD1   . ILE A 1 272 ? 40.092 -25.455 8.915   1.00 27.04 ? 269  ILE A CD1   1 
ATOM   2122 N  N     . LEU A 1 273 ? 44.569 -26.453 12.199  1.00 19.06 ? 270  LEU A N     1 
ATOM   2123 C  CA    . LEU A 1 273 ? 45.771 -27.273 12.335  1.00 16.27 ? 270  LEU A CA    1 
ATOM   2124 C  C     . LEU A 1 273 ? 46.353 -27.214 13.742  1.00 17.06 ? 270  LEU A C     1 
ATOM   2125 O  O     . LEU A 1 273 ? 47.217 -28.014 14.107  1.00 21.12 ? 270  LEU A O     1 
ATOM   2126 C  CB    . LEU A 1 273 ? 46.819 -26.847 11.311  1.00 18.14 ? 270  LEU A CB    1 
ATOM   2127 C  CG    . LEU A 1 273 ? 46.374 -26.971 9.856   1.00 17.76 ? 270  LEU A CG    1 
ATOM   2128 C  CD1   . LEU A 1 273 ? 47.483 -26.476 8.935   1.00 17.28 ? 270  LEU A CD1   1 
ATOM   2129 C  CD2   . LEU A 1 273 ? 46.038 -28.422 9.539   1.00 18.79 ? 270  LEU A CD2   1 
ATOM   2130 N  N     . GLY A 1 274 ? 45.896 -26.255 14.533  1.00 15.44 ? 271  GLY A N     1 
ATOM   2131 C  CA    . GLY A 1 274 ? 46.378 -26.132 15.897  1.00 15.57 ? 271  GLY A CA    1 
ATOM   2132 C  C     . GLY A 1 274 ? 47.826 -25.686 15.968  1.00 19.33 ? 271  GLY A C     1 
ATOM   2133 O  O     . GLY A 1 274 ? 48.585 -26.145 16.826  1.00 21.91 ? 271  GLY A O     1 
ATOM   2134 N  N     . ILE A 1 275 ? 48.217 -24.787 15.068  1.00 14.68 ? 272  ILE A N     1 
ATOM   2135 C  CA    . ILE A 1 275 ? 49.593 -24.269 15.037  1.00 14.91 ? 272  ILE A CA    1 
ATOM   2136 C  C     . ILE A 1 275 ? 49.610 -22.755 15.167  1.00 15.68 ? 272  ILE A C     1 
ATOM   2137 O  O     . ILE A 1 275 ? 48.562 -22.125 15.120  1.00 15.70 ? 272  ILE A O     1 
ATOM   2138 C  CB    . ILE A 1 275 ? 50.311 -24.665 13.734  1.00 14.16 ? 272  ILE A CB    1 
ATOM   2139 C  CG1   . ILE A 1 275 ? 49.601 -24.048 12.519  1.00 14.45 ? 272  ILE A CG1   1 
ATOM   2140 C  CG2   . ILE A 1 275 ? 50.408 -26.187 13.630  1.00 13.21 ? 272  ILE A CG2   1 
ATOM   2141 C  CD1   . ILE A 1 275 ? 50.295 -24.379 11.193  1.00 16.46 ? 272  ILE A CD1   1 
ATOM   2142 N  N     . GLU A 1 276 ? 50.800 -22.172 15.321  1.00 14.70 ? 273  GLU A N     1 
ATOM   2143 C  CA    . GLU A 1 276 ? 50.946 -20.718 15.472  1.00 14.49 ? 273  GLU A CA    1 
ATOM   2144 C  C     . GLU A 1 276 ? 51.905 -20.088 14.452  1.00 15.62 ? 273  GLU A C     1 
ATOM   2145 O  O     . GLU A 1 276 ? 51.742 -18.930 14.054  1.00 14.53 ? 273  GLU A O     1 
ATOM   2146 C  CB    . GLU A 1 276 ? 51.457 -20.382 16.873  1.00 14.09 ? 273  GLU A CB    1 
ATOM   2147 C  CG    . GLU A 1 276 ? 50.524 -20.771 18.012  1.00 26.11 ? 273  GLU A CG    1 
ATOM   2148 C  CD    . GLU A 1 276 ? 51.151 -20.536 19.382  1.00 35.65 ? 273  GLU A CD    1 
ATOM   2149 O  OE1   . GLU A 1 276 ? 51.172 -21.479 20.203  1.00 44.17 ? 273  GLU A OE1   1 
ATOM   2150 O  OE2   . GLU A 1 276 ? 51.627 -19.405 19.637  1.00 41.91 ? 273  GLU A OE2   1 
ATOM   2151 N  N     . TYR A 1 277 ? 52.931 -20.834 14.063  1.00 14.66 ? 274  TYR A N     1 
ATOM   2152 C  CA    . TYR A 1 277 ? 54.024 -20.247 13.291  1.00 11.40 ? 274  TYR A CA    1 
ATOM   2153 C  C     . TYR A 1 277 ? 54.081 -20.826 11.896  1.00 12.20 ? 274  TYR A C     1 
ATOM   2154 O  O     . TYR A 1 277 ? 53.760 -21.997 11.678  1.00 12.32 ? 274  TYR A O     1 
ATOM   2155 C  CB    . TYR A 1 277 ? 55.370 -20.465 14.001  1.00 13.33 ? 274  TYR A CB    1 
ATOM   2156 C  CG    . TYR A 1 277 ? 55.368 -19.948 15.414  1.00 11.64 ? 274  TYR A CG    1 
ATOM   2157 C  CD1   . TYR A 1 277 ? 55.595 -20.800 16.487  1.00 14.73 ? 274  TYR A CD1   1 
ATOM   2158 C  CD2   . TYR A 1 277 ? 55.103 -18.610 15.679  1.00 13.15 ? 274  TYR A CD2   1 
ATOM   2159 C  CE1   . TYR A 1 277 ? 55.584 -20.331 17.791  1.00 14.36 ? 274  TYR A CE1   1 
ATOM   2160 C  CE2   . TYR A 1 277 ? 55.077 -18.129 16.974  1.00 14.13 ? 274  TYR A CE2   1 
ATOM   2161 C  CZ    . TYR A 1 277 ? 55.319 -18.995 18.034  1.00 21.70 ? 274  TYR A CZ    1 
ATOM   2162 O  OH    . TYR A 1 277 ? 55.296 -18.533 19.334  1.00 19.41 ? 274  TYR A OH    1 
ATOM   2163 N  N     . MET A 1 278 ? 54.530 -20.001 10.958  1.00 11.36 ? 275  MET A N     1 
ATOM   2164 C  CA    . MET A 1 278 ? 54.646 -20.413 9.566   1.00 11.03 ? 275  MET A CA    1 
ATOM   2165 C  C     . MET A 1 278 ? 55.442 -21.710 9.388   1.00 11.68 ? 275  MET A C     1 
ATOM   2166 O  O     . MET A 1 278 ? 55.090 -22.558 8.566   1.00 10.52 ? 275  MET A O     1 
ATOM   2167 C  CB    . MET A 1 278 ? 55.287 -19.281 8.751   1.00 17.03 ? 275  MET A CB    1 
ATOM   2168 C  CG    . MET A 1 278 ? 54.939 -19.309 7.287   1.00 15.64 ? 275  MET A CG    1 
ATOM   2169 S  SD    . MET A 1 278 ? 53.171 -19.008 6.975   1.00 18.93 ? 275  MET A SD    1 
ATOM   2170 C  CE    . MET A 1 278 ? 53.147 -19.405 5.231   1.00 26.81 ? 275  MET A CE    1 
ATOM   2171 N  N     . GLY A 1 279 ? 56.521 -21.865 10.148  1.00 11.91 ? 276  GLY A N     1 
ATOM   2172 C  CA    . GLY A 1 279 ? 57.378 -23.019 9.960   1.00 12.77 ? 276  GLY A CA    1 
ATOM   2173 C  C     . GLY A 1 279 ? 56.671 -24.327 10.263  1.00 15.91 ? 276  GLY A C     1 
ATOM   2174 O  O     . GLY A 1 279 ? 56.977 -25.368 9.666   1.00 14.10 ? 276  GLY A O     1 
ATOM   2175 N  N     . GLU A 1 280 ? 55.721 -24.281 11.190  1.00 10.92 ? 277  GLU A N     1 
ATOM   2176 C  CA    . GLU A 1 280 ? 54.982 -25.480 11.575  1.00 11.01 ? 277  GLU A CA    1 
ATOM   2177 C  C     . GLU A 1 280 ? 54.174 -26.074 10.412  1.00 11.94 ? 277  GLU A C     1 
ATOM   2178 O  O     . GLU A 1 280 ? 53.783 -27.236 10.462  1.00 11.84 ? 277  GLU A O     1 
ATOM   2179 C  CB    . GLU A 1 280 ? 54.042 -25.184 12.748  1.00 12.81 ? 277  GLU A CB    1 
ATOM   2180 C  CG    . GLU A 1 280 ? 54.738 -24.844 14.048  1.00 11.87 ? 277  GLU A CG    1 
ATOM   2181 C  CD    . GLU A 1 280 ? 53.741 -24.617 15.165  1.00 18.02 ? 277  GLU A CD    1 
ATOM   2182 O  OE1   . GLU A 1 280 ? 53.350 -23.463 15.374  1.00 17.47 ? 277  GLU A OE1   1 
ATOM   2183 O  OE2   . GLU A 1 280 ? 53.343 -25.590 15.829  1.00 17.56 ? 277  GLU A OE2   1 
ATOM   2184 N  N     . LEU A 1 281 ? 53.929 -25.295 9.365   1.00 13.41 ? 278  LEU A N     1 
ATOM   2185 C  CA    . LEU A 1 281 ? 53.193 -25.817 8.204   1.00 10.73 ? 278  LEU A CA    1 
ATOM   2186 C  C     . LEU A 1 281 ? 53.932 -26.943 7.459   1.00 10.42 ? 278  LEU A C     1 
ATOM   2187 O  O     . LEU A 1 281 ? 53.297 -27.732 6.744   1.00 12.58 ? 278  LEU A O     1 
ATOM   2188 C  CB    . LEU A 1 281 ? 52.877 -24.680 7.226   1.00 11.11 ? 278  LEU A CB    1 
ATOM   2189 C  CG    . LEU A 1 281 ? 51.708 -23.791 7.661   1.00 15.52 ? 278  LEU A CG    1 
ATOM   2190 C  CD1   . LEU A 1 281 ? 51.698 -22.478 6.859   1.00 14.97 ? 278  LEU A CD1   1 
ATOM   2191 C  CD2   . LEU A 1 281 ? 50.386 -24.553 7.491   1.00 12.98 ? 278  LEU A CD2   1 
ATOM   2192 N  N     . THR A 1 282 ? 55.258 -27.008 7.601   1.00 13.36 ? 279  THR A N     1 
ATOM   2193 C  CA    . THR A 1 282 ? 56.053 -27.964 6.815   1.00 12.92 ? 279  THR A CA    1 
ATOM   2194 C  C     . THR A 1 282 ? 55.694 -29.414 7.132   1.00 9.38  ? 279  THR A C     1 
ATOM   2195 O  O     . THR A 1 282 ? 56.002 -30.305 6.340   1.00 16.18 ? 279  THR A O     1 
ATOM   2196 C  CB    . THR A 1 282 ? 57.593 -27.797 7.023   1.00 14.75 ? 279  THR A CB    1 
ATOM   2197 O  OG1   . THR A 1 282 ? 57.947 -28.076 8.388   1.00 17.53 ? 279  THR A OG1   1 
ATOM   2198 C  CG2   . THR A 1 282 ? 58.068 -26.384 6.644   1.00 11.47 ? 279  THR A CG2   1 
ATOM   2199 N  N     . GLN A 1 283 ? 55.089 -29.654 8.292   1.00 13.52 ? 280  GLN A N     1 
ATOM   2200 C  CA    . GLN A 1 283 ? 54.791 -31.023 8.713   1.00 16.61 ? 280  GLN A CA    1 
ATOM   2201 C  C     . GLN A 1 283 ? 53.506 -31.595 8.130   1.00 16.84 ? 280  GLN A C     1 
ATOM   2202 O  O     . GLN A 1 283 ? 53.089 -32.688 8.497   1.00 23.40 ? 280  GLN A O     1 
ATOM   2203 C  CB    . GLN A 1 283 ? 54.723 -31.086 10.238  1.00 15.42 ? 280  GLN A CB    1 
ATOM   2204 C  CG    A GLN A 1 283 ? 56.075 -30.836 10.843  0.57 11.82 ? 280  GLN A CG    1 
ATOM   2205 C  CG    B GLN A 1 283 ? 53.573 -30.332 10.817  0.43 16.15 ? 280  GLN A CG    1 
ATOM   2206 C  CD    A GLN A 1 283 ? 57.143 -31.640 10.130  0.57 16.47 ? 280  GLN A CD    1 
ATOM   2207 C  CD    B GLN A 1 283 ? 53.804 -29.976 12.263  0.43 21.47 ? 280  GLN A CD    1 
ATOM   2208 O  OE1   A GLN A 1 283 ? 57.158 -32.871 10.207  0.57 20.71 ? 280  GLN A OE1   1 
ATOM   2209 O  OE1   B GLN A 1 283 ? 54.493 -30.697 12.988  0.43 25.79 ? 280  GLN A OE1   1 
ATOM   2210 N  NE2   A GLN A 1 283 ? 58.023 -30.951 9.395   0.57 15.53 ? 280  GLN A NE2   1 
ATOM   2211 N  NE2   B GLN A 1 283 ? 53.231 -28.860 12.693  0.43 11.36 ? 280  GLN A NE2   1 
ATOM   2212 N  N     . PHE A 1 284 ? 52.870 -30.859 7.237   1.00 12.90 ? 281  PHE A N     1 
ATOM   2213 C  CA    . PHE A 1 284 ? 51.662 -31.350 6.601   1.00 15.35 ? 281  PHE A CA    1 
ATOM   2214 C  C     . PHE A 1 284 ? 51.941 -31.638 5.130   1.00 17.63 ? 281  PHE A C     1 
ATOM   2215 O  O     . PHE A 1 284 ? 52.742 -30.957 4.507   1.00 16.23 ? 281  PHE A O     1 
ATOM   2216 C  CB    . PHE A 1 284 ? 50.545 -30.335 6.760   1.00 12.73 ? 281  PHE A CB    1 
ATOM   2217 C  CG    . PHE A 1 284 ? 50.197 -30.061 8.193   1.00 12.83 ? 281  PHE A CG    1 
ATOM   2218 C  CD1   . PHE A 1 284 ? 49.344 -30.909 8.881   1.00 19.80 ? 281  PHE A CD1   1 
ATOM   2219 C  CD2   . PHE A 1 284 ? 50.743 -28.980 8.862   1.00 13.48 ? 281  PHE A CD2   1 
ATOM   2220 C  CE1   . PHE A 1 284 ? 49.023 -30.666 10.209  1.00 18.28 ? 281  PHE A CE1   1 
ATOM   2221 C  CE2   . PHE A 1 284 ? 50.425 -28.731 10.183  1.00 14.41 ? 281  PHE A CE2   1 
ATOM   2222 C  CZ    . PHE A 1 284 ? 49.566 -29.578 10.862  1.00 22.91 ? 281  PHE A CZ    1 
ATOM   2223 N  N     . THR A 1 285 ? 51.301 -32.662 4.585   1.00 13.14 ? 282  THR A N     1 
ATOM   2224 C  CA    . THR A 1 285 ? 51.473 -32.958 3.173   1.00 16.32 ? 282  THR A CA    1 
ATOM   2225 C  C     . THR A 1 285 ? 50.726 -31.923 2.362   1.00 14.07 ? 282  THR A C     1 
ATOM   2226 O  O     . THR A 1 285 ? 49.838 -31.253 2.876   1.00 13.48 ? 282  THR A O     1 
ATOM   2227 C  CB    . THR A 1 285 ? 50.948 -34.346 2.791   1.00 16.56 ? 282  THR A CB    1 
ATOM   2228 O  OG1   . THR A 1 285 ? 49.534 -34.371 2.986   1.00 13.64 ? 282  THR A OG1   1 
ATOM   2229 C  CG2   . THR A 1 285 ? 51.609 -35.416 3.633   1.00 20.26 ? 282  THR A CG2   1 
ATOM   2230 N  N     . GLU A 1 286 ? 51.101 -31.794 1.097   1.00 14.99 ? 283  GLU A N     1 
ATOM   2231 C  CA    . GLU A 1 286 ? 50.402 -30.889 0.200   1.00 13.87 ? 283  GLU A CA    1 
ATOM   2232 C  C     . GLU A 1 286 ? 48.909 -31.247 0.136   1.00 12.92 ? 283  GLU A C     1 
ATOM   2233 O  O     . GLU A 1 286 ? 48.049 -30.363 0.235   1.00 13.88 ? 283  GLU A O     1 
ATOM   2234 C  CB    . GLU A 1 286 ? 51.040 -30.913 -1.188  1.00 13.37 ? 283  GLU A CB    1 
ATOM   2235 C  CG    . GLU A 1 286 ? 50.423 -29.896 -2.114  1.00 13.43 ? 283  GLU A CG    1 
ATOM   2236 C  CD    . GLU A 1 286 ? 51.168 -29.757 -3.429  1.00 23.72 ? 283  GLU A CD    1 
ATOM   2237 O  OE1   . GLU A 1 286 ? 52.229 -30.390 -3.589  1.00 28.52 ? 283  GLU A OE1   1 
ATOM   2238 O  OE2   . GLU A 1 286 ? 50.687 -29.002 -4.300  1.00 21.71 ? 283  GLU A OE2   1 
ATOM   2239 N  N     A SER A 1 287 ? 48.604 -32.537 0.006   0.74 14.97 ? 284  SER A N     1 
ATOM   2240 N  N     B SER A 1 287 ? 48.603 -32.535 0.008   0.26 14.99 ? 284  SER A N     1 
ATOM   2241 C  CA    . SER A 1 287 ? 47.211 -32.975 -0.029  1.00 14.30 ? 284  SER A CA    1 
ATOM   2242 C  C     . SER A 1 287 ? 46.476 -32.638 1.263   1.00 18.25 ? 284  SER A C     1 
ATOM   2243 O  O     . SER A 1 287 ? 45.284 -32.309 1.224   1.00 13.49 ? 284  SER A O     1 
ATOM   2244 C  CB    . SER A 1 287 ? 47.122 -34.481 -0.291  1.00 15.80 ? 284  SER A CB    1 
ATOM   2245 O  OG    A SER A 1 287 ? 47.551 -34.801 -1.593  0.74 20.28 ? 284  SER A OG    1 
ATOM   2246 O  OG    B SER A 1 287 ? 47.636 -35.229 0.798   0.26 12.62 ? 284  SER A OG    1 
ATOM   2247 N  N     . GLN A 1 288 ? 47.167 -32.703 2.404   1.00 14.89 ? 285  GLN A N     1 
ATOM   2248 C  CA    . GLN A 1 288 ? 46.521 -32.355 3.660   1.00 11.96 ? 285  GLN A CA    1 
ATOM   2249 C  C     . GLN A 1 288 ? 46.114 -30.878 3.651   1.00 16.52 ? 285  GLN A C     1 
ATOM   2250 O  O     . GLN A 1 288 ? 44.996 -30.520 4.022   1.00 14.68 ? 285  GLN A O     1 
ATOM   2251 C  CB    . GLN A 1 288 ? 47.430 -32.636 4.860   1.00 12.00 ? 285  GLN A CB    1 
ATOM   2252 C  CG    . GLN A 1 288 ? 47.470 -34.082 5.305   1.00 15.71 ? 285  GLN A CG    1 
ATOM   2253 C  CD    . GLN A 1 288 ? 48.358 -34.278 6.511   1.00 18.03 ? 285  GLN A CD    1 
ATOM   2254 O  OE1   . GLN A 1 288 ? 49.494 -33.822 6.533   1.00 14.75 ? 285  GLN A OE1   1 
ATOM   2255 N  NE2   . GLN A 1 288 ? 47.837 -34.954 7.531   1.00 25.03 ? 285  GLN A NE2   1 
ATOM   2256 N  N     . LEU A 1 289 ? 47.028 -30.020 3.225   1.00 12.71 ? 286  LEU A N     1 
ATOM   2257 C  CA    . LEU A 1 289 ? 46.734 -28.600 3.178   1.00 12.55 ? 286  LEU A CA    1 
ATOM   2258 C  C     . LEU A 1 289 ? 45.631 -28.296 2.169   1.00 13.76 ? 286  LEU A C     1 
ATOM   2259 O  O     . LEU A 1 289 ? 44.732 -27.497 2.451   1.00 16.29 ? 286  LEU A O     1 
ATOM   2260 C  CB    . LEU A 1 289 ? 48.008 -27.815 2.858   1.00 13.98 ? 286  LEU A CB    1 
ATOM   2261 C  CG    . LEU A 1 289 ? 49.113 -27.953 3.911   1.00 12.61 ? 286  LEU A CG    1 
ATOM   2262 C  CD1   . LEU A 1 289 ? 50.352 -27.171 3.503   1.00 13.76 ? 286  LEU A CD1   1 
ATOM   2263 C  CD2   . LEU A 1 289 ? 48.614 -27.494 5.266   1.00 16.64 ? 286  LEU A CD2   1 
ATOM   2264 N  N     . GLN A 1 290 ? 45.695 -28.925 0.998   1.00 13.84 ? 287  GLN A N     1 
ATOM   2265 C  CA    . GLN A 1 290 ? 44.636 -28.772 0.000   1.00 14.70 ? 287  GLN A CA    1 
ATOM   2266 C  C     . GLN A 1 290 ? 43.270 -29.233 0.511   1.00 16.42 ? 287  GLN A C     1 
ATOM   2267 O  O     . GLN A 1 290 ? 42.245 -28.629 0.188   1.00 17.01 ? 287  GLN A O     1 
ATOM   2268 C  CB    . GLN A 1 290 ? 44.990 -29.543 -1.269  1.00 16.04 ? 287  GLN A CB    1 
ATOM   2269 C  CG    . GLN A 1 290 ? 46.153 -28.955 -2.042  1.00 17.69 ? 287  GLN A CG    1 
ATOM   2270 C  CD    . GLN A 1 290 ? 46.531 -29.815 -3.219  1.00 22.05 ? 287  GLN A CD    1 
ATOM   2271 O  OE1   . GLN A 1 290 ? 46.502 -31.041 -3.131  1.00 21.19 ? 287  GLN A OE1   1 
ATOM   2272 N  NE2   . GLN A 1 290 ? 46.899 -29.181 -4.330  1.00 25.74 ? 287  GLN A NE2   1 
ATOM   2273 N  N     . SER A 1 291 ? 43.251 -30.287 1.325   1.00 13.38 ? 288  SER A N     1 
ATOM   2274 C  CA    . SER A 1 291 ? 41.980 -30.794 1.864   1.00 14.40 ? 288  SER A CA    1 
ATOM   2275 C  C     . SER A 1 291 ? 41.303 -29.772 2.790   1.00 19.37 ? 288  SER A C     1 
ATOM   2276 O  O     . SER A 1 291 ? 40.073 -29.678 2.832   1.00 21.44 ? 288  SER A O     1 
ATOM   2277 C  CB    . SER A 1 291 ? 42.192 -32.117 2.614   1.00 15.55 ? 288  SER A CB    1 
ATOM   2278 O  OG    A SER A 1 291 ? 42.696 -31.921 3.931   0.59 15.93 ? 288  SER A OG    1 
ATOM   2279 O  OG    B SER A 1 291 ? 40.954 -32.735 2.905   0.41 17.06 ? 288  SER A OG    1 
ATOM   2280 N  N     . HIS A 1 292 ? 42.093 -29.002 3.532   1.00 16.59 ? 289  HIS A N     1 
ATOM   2281 C  CA    . HIS A 1 292 ? 41.517 -28.007 4.426   1.00 19.10 ? 289  HIS A CA    1 
ATOM   2282 C  C     . HIS A 1 292 ? 41.252 -26.663 3.749   1.00 19.99 ? 289  HIS A C     1 
ATOM   2283 O  O     . HIS A 1 292 ? 40.234 -26.019 4.007   1.00 23.51 ? 289  HIS A O     1 
ATOM   2284 C  CB    . HIS A 1 292 ? 42.426 -27.772 5.626   1.00 18.41 ? 289  HIS A CB    1 
ATOM   2285 C  CG    . HIS A 1 292 ? 42.613 -28.969 6.502   1.00 15.68 ? 289  HIS A CG    1 
ATOM   2286 N  ND1   . HIS A 1 292 ? 41.569 -29.584 7.160   1.00 26.47 ? 289  HIS A ND1   1 
ATOM   2287 C  CD2   . HIS A 1 292 ? 43.733 -29.637 6.864   1.00 21.17 ? 289  HIS A CD2   1 
ATOM   2288 C  CE1   . HIS A 1 292 ? 42.039 -30.590 7.878   1.00 21.11 ? 289  HIS A CE1   1 
ATOM   2289 N  NE2   . HIS A 1 292 ? 43.348 -30.642 7.719   1.00 22.95 ? 289  HIS A NE2   1 
ATOM   2290 N  N     . PHE A 1 293 ? 42.167 -26.229 2.891   1.00 14.99 ? 290  PHE A N     1 
ATOM   2291 C  CA    . PHE A 1 293 ? 42.139 -24.837 2.443   1.00 14.75 ? 290  PHE A CA    1 
ATOM   2292 C  C     . PHE A 1 293 ? 41.906 -24.668 0.941   1.00 21.03 ? 290  PHE A C     1 
ATOM   2293 O  O     . PHE A 1 293 ? 41.942 -23.551 0.418   1.00 18.42 ? 290  PHE A O     1 
ATOM   2294 C  CB    . PHE A 1 293 ? 43.444 -24.163 2.889   1.00 11.94 ? 290  PHE A CB    1 
ATOM   2295 C  CG    . PHE A 1 293 ? 43.762 -24.420 4.339   1.00 12.60 ? 290  PHE A CG    1 
ATOM   2296 C  CD1   . PHE A 1 293 ? 42.931 -23.934 5.337   1.00 13.93 ? 290  PHE A CD1   1 
ATOM   2297 C  CD2   . PHE A 1 293 ? 44.860 -25.190 4.703   1.00 11.59 ? 290  PHE A CD2   1 
ATOM   2298 C  CE1   . PHE A 1 293 ? 43.196 -24.190 6.673   1.00 16.32 ? 290  PHE A CE1   1 
ATOM   2299 C  CE2   . PHE A 1 293 ? 45.135 -25.458 6.031   1.00 15.04 ? 290  PHE A CE2   1 
ATOM   2300 C  CZ    . PHE A 1 293 ? 44.304 -24.954 7.020   1.00 12.73 ? 290  PHE A CZ    1 
ATOM   2301 N  N     . GLY A 1 294 ? 41.632 -25.771 0.252   1.00 17.00 ? 291  GLY A N     1 
ATOM   2302 C  CA    . GLY A 1 294 ? 41.389 -25.718 -1.177  1.00 17.19 ? 291  GLY A CA    1 
ATOM   2303 C  C     . GLY A 1 294 ? 42.643 -26.011 -1.964  1.00 18.75 ? 291  GLY A C     1 
ATOM   2304 O  O     . GLY A 1 294 ? 43.755 -25.922 -1.439  1.00 18.07 ? 291  GLY A O     1 
ATOM   2305 N  N     . GLU A 1 295 ? 42.463 -26.347 -3.235  1.00 16.89 ? 292  GLU A N     1 
ATOM   2306 C  CA    . GLU A 1 295 ? 43.556 -26.752 -4.102  1.00 18.13 ? 292  GLU A CA    1 
ATOM   2307 C  C     . GLU A 1 295 ? 44.629 -25.664 -4.241  1.00 19.10 ? 292  GLU A C     1 
ATOM   2308 O  O     . GLU A 1 295 ? 45.822 -25.927 -4.086  1.00 17.56 ? 292  GLU A O     1 
ATOM   2309 C  CB    . GLU A 1 295 ? 43.006 -27.125 -5.479  1.00 23.59 ? 292  GLU A CB    1 
ATOM   2310 C  CG    . GLU A 1 295 ? 44.063 -27.587 -6.458  1.00 23.98 ? 292  GLU A CG    1 
ATOM   2311 C  CD    . GLU A 1 295 ? 43.495 -27.880 -7.832  1.00 44.51 ? 292  GLU A CD    1 
ATOM   2312 O  OE1   . GLU A 1 295 ? 44.150 -27.518 -8.834  1.00 46.03 ? 292  GLU A OE1   1 
ATOM   2313 O  OE2   . GLU A 1 295 ? 42.395 -28.475 -7.907  1.00 38.36 ? 292  GLU A OE2   1 
ATOM   2314 N  N     . LYS A 1 296 ? 44.189 -24.442 -4.527  1.00 17.18 ? 293  LYS A N     1 
ATOM   2315 C  CA    . LYS A 1 296 ? 45.109 -23.350 -4.806  1.00 15.44 ? 293  LYS A CA    1 
ATOM   2316 C  C     . LYS A 1 296 ? 45.801 -22.928 -3.511  1.00 19.10 ? 293  LYS A C     1 
ATOM   2317 O  O     . LYS A 1 296 ? 47.033 -22.878 -3.454  1.00 13.07 ? 293  LYS A O     1 
ATOM   2318 C  CB    . LYS A 1 296 ? 44.371 -22.165 -5.456  1.00 17.21 ? 293  LYS A CB    1 
ATOM   2319 C  CG    . LYS A 1 296 ? 45.260 -21.321 -6.350  1.00 38.34 ? 293  LYS A CG    1 
ATOM   2320 C  CD    . LYS A 1 296 ? 44.538 -20.076 -6.847  1.00 37.10 ? 293  LYS A CD    1 
ATOM   2321 C  CE    . LYS A 1 296 ? 45.492 -19.151 -7.593  1.00 49.82 ? 293  LYS A CE    1 
ATOM   2322 N  NZ    . LYS A 1 296 ? 44.915 -17.783 -7.757  1.00 48.52 ? 293  LYS A NZ    1 
ATOM   2323 N  N     . ASN A 1 297 ? 45.024 -22.651 -2.466  1.00 16.43 ? 294  ASN A N     1 
ATOM   2324 C  CA    . ASN A 1 297 ? 45.625 -22.251 -1.180  1.00 13.18 ? 294  ASN A CA    1 
ATOM   2325 C  C     . ASN A 1 297 ? 46.549 -23.328 -0.602  1.00 14.42 ? 294  ASN A C     1 
ATOM   2326 O  O     . ASN A 1 297 ? 47.599 -23.018 -0.016  1.00 15.09 ? 294  ASN A O     1 
ATOM   2327 C  CB    . ASN A 1 297 ? 44.554 -21.936 -0.137  1.00 19.09 ? 294  ASN A CB    1 
ATOM   2328 C  CG    . ASN A 1 297 ? 43.815 -20.643 -0.415  1.00 20.60 ? 294  ASN A CG    1 
ATOM   2329 O  OD1   . ASN A 1 297 ? 44.353 -19.725 -1.038  1.00 20.75 ? 294  ASN A OD1   1 
ATOM   2330 N  ND2   . ASN A 1 297 ? 42.574 -20.558 0.067   1.00 23.43 ? 294  ASN A ND2   1 
ATOM   2331 N  N     . GLY A 1 298 ? 46.128 -24.585 -0.694  1.00 14.64 ? 295  GLY A N     1 
ATOM   2332 C  CA    . GLY A 1 298 ? 46.934 -25.683 -0.173  1.00 15.71 ? 295  GLY A CA    1 
ATOM   2333 C  C     . GLY A 1 298 ? 48.301 -25.801 -0.828  1.00 13.69 ? 295  GLY A C     1 
ATOM   2334 O  O     . GLY A 1 298 ? 49.315 -25.975 -0.137  1.00 14.11 ? 295  GLY A O     1 
ATOM   2335 N  N     . SER A 1 299 ? 48.338 -25.736 -2.159  1.00 12.24 ? 296  SER A N     1 
ATOM   2336 C  CA    . SER A 1 299 ? 49.596 -25.817 -2.885  1.00 9.87  ? 296  SER A CA    1 
ATOM   2337 C  C     . SER A 1 299 ? 50.450 -24.601 -2.554  1.00 12.00 ? 296  SER A C     1 
ATOM   2338 O  O     . SER A 1 299 ? 51.661 -24.726 -2.368  1.00 13.44 ? 296  SER A O     1 
ATOM   2339 C  CB    . SER A 1 299 ? 49.358 -25.899 -4.398  1.00 14.01 ? 296  SER A CB    1 
ATOM   2340 O  OG    . SER A 1 299 ? 48.841 -27.166 -4.754  1.00 18.45 ? 296  SER A OG    1 
ATOM   2341 N  N     . TRP A 1 300 ? 49.808 -23.437 -2.461  1.00 13.86 ? 297  TRP A N     1 
ATOM   2342 C  CA    . TRP A 1 300 ? 50.518 -22.204 -2.139  1.00 12.12 ? 297  TRP A CA    1 
ATOM   2343 C  C     . TRP A 1 300 ? 51.131 -22.296 -0.744  1.00 13.19 ? 297  TRP A C     1 
ATOM   2344 O  O     . TRP A 1 300 ? 52.314 -22.009 -0.579  1.00 13.02 ? 297  TRP A O     1 
ATOM   2345 C  CB    . TRP A 1 300 ? 49.584 -20.998 -2.242  1.00 10.95 ? 297  TRP A CB    1 
ATOM   2346 C  CG    . TRP A 1 300 ? 50.269 -19.705 -1.934  1.00 12.27 ? 297  TRP A CG    1 
ATOM   2347 C  CD1   . TRP A 1 300 ? 51.007 -18.946 -2.798  1.00 19.00 ? 297  TRP A CD1   1 
ATOM   2348 C  CD2   . TRP A 1 300 ? 50.262 -18.999 -0.680  1.00 11.89 ? 297  TRP A CD2   1 
ATOM   2349 N  NE1   . TRP A 1 300 ? 51.479 -17.825 -2.153  1.00 16.82 ? 297  TRP A NE1   1 
ATOM   2350 C  CE2   . TRP A 1 300 ? 51.026 -17.828 -0.859  1.00 14.13 ? 297  TRP A CE2   1 
ATOM   2351 C  CE3   . TRP A 1 300 ? 49.693 -19.246 0.573   1.00 18.41 ? 297  TRP A CE3   1 
ATOM   2352 C  CZ2   . TRP A 1 300 ? 51.232 -16.904 0.170   1.00 13.85 ? 297  TRP A CZ2   1 
ATOM   2353 C  CZ3   . TRP A 1 300 ? 49.901 -18.329 1.589   1.00 20.51 ? 297  TRP A CZ3   1 
ATOM   2354 C  CH2   . TRP A 1 300 ? 50.669 -17.181 1.383   1.00 15.83 ? 297  TRP A CH2   1 
ATOM   2355 N  N     . LEU A 1 301 ? 50.348 -22.753 0.238   1.00 12.33 ? 298  LEU A N     1 
ATOM   2356 C  CA    . LEU A 1 301 ? 50.870 -22.896 1.603   1.00 14.83 ? 298  LEU A CA    1 
ATOM   2357 C  C     . LEU A 1 301 ? 52.018 -23.897 1.698   1.00 12.57 ? 298  LEU A C     1 
ATOM   2358 O  O     . LEU A 1 301 ? 53.001 -23.661 2.421   1.00 11.77 ? 298  LEU A O     1 
ATOM   2359 C  CB    . LEU A 1 301 ? 49.761 -23.318 2.576   1.00 15.21 ? 298  LEU A CB    1 
ATOM   2360 C  CG    . LEU A 1 301 ? 48.748 -22.216 2.919   1.00 12.97 ? 298  LEU A CG    1 
ATOM   2361 C  CD1   . LEU A 1 301 ? 47.501 -22.785 3.566   1.00 14.39 ? 298  LEU A CD1   1 
ATOM   2362 C  CD2   . LEU A 1 301 ? 49.401 -21.175 3.834   1.00 17.12 ? 298  LEU A CD2   1 
ATOM   2363 N  N     . TYR A 1 302 ? 51.898 -25.001 0.969   1.00 11.17 ? 299  TYR A N     1 
ATOM   2364 C  CA    . TYR A 1 302 ? 52.927 -26.049 1.016   1.00 13.30 ? 299  TYR A CA    1 
ATOM   2365 C  C     . TYR A 1 302 ? 54.281 -25.517 0.552   1.00 14.15 ? 299  TYR A C     1 
ATOM   2366 O  O     . TYR A 1 302 ? 55.327 -25.793 1.152   1.00 10.65 ? 299  TYR A O     1 
ATOM   2367 C  CB    . TYR A 1 302 ? 52.507 -27.252 0.157   1.00 11.62 ? 299  TYR A CB    1 
ATOM   2368 C  CG    . TYR A 1 302 ? 53.518 -28.388 0.161   1.00 14.72 ? 299  TYR A CG    1 
ATOM   2369 C  CD1   . TYR A 1 302 ? 53.496 -29.350 1.165   1.00 12.95 ? 299  TYR A CD1   1 
ATOM   2370 C  CD2   . TYR A 1 302 ? 54.493 -28.487 -0.826  1.00 16.57 ? 299  TYR A CD2   1 
ATOM   2371 C  CE1   . TYR A 1 302 ? 54.422 -30.386 1.192   1.00 17.51 ? 299  TYR A CE1   1 
ATOM   2372 C  CE2   . TYR A 1 302 ? 55.427 -29.512 -0.806  1.00 19.48 ? 299  TYR A CE2   1 
ATOM   2373 C  CZ    . TYR A 1 302 ? 55.377 -30.462 0.205   1.00 23.41 ? 299  TYR A CZ    1 
ATOM   2374 O  OH    . TYR A 1 302 ? 56.297 -31.489 0.231   1.00 23.82 ? 299  TYR A OH    1 
ATOM   2375 N  N     . ALA A 1 303 ? 54.267 -24.750 -0.526  1.00 12.52 ? 300  ALA A N     1 
ATOM   2376 C  CA    . ALA A 1 303 ? 55.494 -24.144 -1.026  1.00 11.55 ? 300  ALA A CA    1 
ATOM   2377 C  C     . ALA A 1 303 ? 55.926 -22.929 -0.186  1.00 13.13 ? 300  ALA A C     1 
ATOM   2378 O  O     . ALA A 1 303 ? 57.124 -22.758 0.093   1.00 12.51 ? 300  ALA A O     1 
ATOM   2379 C  CB    . ALA A 1 303 ? 55.317 -23.742 -2.504  1.00 12.52 ? 300  ALA A CB    1 
ATOM   2380 N  N     . MET A 1 304 ? 54.970 -22.105 0.238   1.00 12.34 ? 301  MET A N     1 
ATOM   2381 C  CA    . MET A 1 304 ? 55.314 -20.859 0.935   1.00 13.76 ? 301  MET A CA    1 
ATOM   2382 C  C     . MET A 1 304 ? 55.994 -21.092 2.277   1.00 11.18 ? 301  MET A C     1 
ATOM   2383 O  O     . MET A 1 304 ? 56.909 -20.337 2.663   1.00 10.71 ? 301  MET A O     1 
ATOM   2384 C  CB    . MET A 1 304 ? 54.074 -19.995 1.152   1.00 14.68 ? 301  MET A CB    1 
ATOM   2385 C  CG    . MET A 1 304 ? 54.394 -18.576 1.603   1.00 16.00 ? 301  MET A CG    1 
ATOM   2386 S  SD    . MET A 1 304 ? 55.182 -17.661 0.259   1.00 16.24 ? 301  MET A SD    1 
ATOM   2387 C  CE    . MET A 1 304 ? 56.894 -17.576 0.830   1.00 13.03 ? 301  MET A CE    1 
ATOM   2388 N  N     . CYS A 1 305 ? 55.570 -22.123 3.001   1.00 10.56 ? 302  CYS A N     1 
ATOM   2389 C  CA    . CYS A 1 305 ? 56.189 -22.381 4.304   1.00 12.63 ? 302  CYS A CA    1 
ATOM   2390 C  C     . CYS A 1 305 ? 57.634 -22.879 4.144   1.00 11.83 ? 302  CYS A C     1 
ATOM   2391 O  O     . CYS A 1 305 ? 58.385 -22.899 5.120   1.00 12.00 ? 302  CYS A O     1 
ATOM   2392 C  CB    . CYS A 1 305 ? 55.361 -23.377 5.130   1.00 11.18 ? 302  CYS A CB    1 
ATOM   2393 S  SG    . CYS A 1 305 ? 55.382 -25.095 4.535   1.00 11.71 ? 302  CYS A SG    1 
ATOM   2394 N  N     . ARG A 1 306 ? 58.015 -23.242 2.921   1.00 10.41 ? 303  ARG A N     1 
ATOM   2395 C  CA    . ARG A 1 306 ? 59.393 -23.615 2.588   1.00 9.50  ? 303  ARG A CA    1 
ATOM   2396 C  C     . ARG A 1 306 ? 60.136 -22.435 1.920   1.00 13.17 ? 303  ARG A C     1 
ATOM   2397 O  O     . ARG A 1 306 ? 61.272 -22.578 1.482   1.00 15.98 ? 303  ARG A O     1 
ATOM   2398 C  CB    . ARG A 1 306 ? 59.412 -24.865 1.683   1.00 11.09 ? 303  ARG A CB    1 
ATOM   2399 C  CG    . ARG A 1 306 ? 58.827 -26.092 2.385   1.00 11.10 ? 303  ARG A CG    1 
ATOM   2400 C  CD    . ARG A 1 306 ? 58.581 -27.286 1.459   1.00 15.36 ? 303  ARG A CD    1 
ATOM   2401 N  NE    . ARG A 1 306 ? 58.356 -28.489 2.261   1.00 20.72 ? 303  ARG A NE    1 
ATOM   2402 C  CZ    . ARG A 1 306 ? 57.236 -28.760 2.929   1.00 15.63 ? 303  ARG A CZ    1 
ATOM   2403 N  NH1   . ARG A 1 306 ? 57.148 -29.891 3.634   1.00 13.71 ? 303  ARG A NH1   1 
ATOM   2404 N  NH2   . ARG A 1 306 ? 56.190 -27.932 2.880   1.00 12.37 ? 303  ARG A NH2   1 
ATOM   2405 N  N     . GLY A 1 307 ? 59.482 -21.275 1.872   1.00 9.83  ? 304  GLY A N     1 
ATOM   2406 C  CA    . GLY A 1 307 ? 60.072 -20.052 1.343   1.00 10.82 ? 304  GLY A CA    1 
ATOM   2407 C  C     . GLY A 1 307 ? 59.918 -19.905 -0.155  1.00 12.00 ? 304  GLY A C     1 
ATOM   2408 O  O     . GLY A 1 307 ? 60.611 -19.109 -0.785  1.00 12.95 ? 304  GLY A O     1 
ATOM   2409 N  N     . ILE A 1 308 ? 59.000 -20.672 -0.726  1.00 12.34 ? 305  ILE A N     1 
ATOM   2410 C  CA    . ILE A 1 308 ? 58.878 -20.747 -2.179  1.00 12.60 ? 305  ILE A CA    1 
ATOM   2411 C  C     . ILE A 1 308 ? 57.535 -20.226 -2.626  1.00 14.61 ? 305  ILE A C     1 
ATOM   2412 O  O     . ILE A 1 308 ? 56.505 -20.650 -2.104  1.00 12.76 ? 305  ILE A O     1 
ATOM   2413 C  CB    . ILE A 1 308 ? 59.066 -22.194 -2.654  1.00 13.55 ? 305  ILE A CB    1 
ATOM   2414 C  CG1   . ILE A 1 308 ? 60.482 -22.652 -2.290  1.00 14.36 ? 305  ILE A CG1   1 
ATOM   2415 C  CG2   . ILE A 1 308 ? 58.812 -22.299 -4.150  1.00 16.22 ? 305  ILE A CG2   1 
ATOM   2416 C  CD1   . ILE A 1 308 ? 60.776 -24.097 -2.634  1.00 15.96 ? 305  ILE A CD1   1 
ATOM   2417 N  N     . GLU A 1 309 ? 57.548 -19.318 -3.600  1.00 10.47 ? 306  GLU A N     1 
ATOM   2418 C  CA    . GLU A 1 309 ? 56.309 -18.769 -4.160  1.00 16.10 ? 306  GLU A CA    1 
ATOM   2419 C  C     . GLU A 1 309 ? 56.581 -18.306 -5.591  1.00 17.75 ? 306  GLU A C     1 
ATOM   2420 O  O     . GLU A 1 309 ? 57.676 -17.815 -5.881  1.00 17.27 ? 306  GLU A O     1 
ATOM   2421 C  CB    . GLU A 1 309 ? 55.805 -17.609 -3.309  1.00 22.31 ? 306  GLU A CB    1 
ATOM   2422 C  CG    . GLU A 1 309 ? 54.411 -17.218 -3.642  1.00 31.68 ? 306  GLU A CG    1 
ATOM   2423 C  CD    . GLU A 1 309 ? 54.134 -15.751 -3.419  1.00 22.30 ? 306  GLU A CD    1 
ATOM   2424 O  OE1   . GLU A 1 309 ? 55.064 -14.908 -3.524  1.00 17.36 ? 306  GLU A OE1   1 
ATOM   2425 O  OE2   . GLU A 1 309 ? 52.962 -15.443 -3.155  1.00 25.38 ? 306  GLU A OE2   1 
ATOM   2426 N  N     . HIS A 1 310 ? 55.608 -18.450 -6.489  1.00 21.02 ? 307  HIS A N     1 
ATOM   2427 C  CA    . HIS A 1 310 ? 55.911 -18.167 -7.889  1.00 19.35 ? 307  HIS A CA    1 
ATOM   2428 C  C     . HIS A 1 310 ? 55.156 -16.972 -8.467  1.00 19.79 ? 307  HIS A C     1 
ATOM   2429 O  O     . HIS A 1 310 ? 55.380 -16.619 -9.622  1.00 22.45 ? 307  HIS A O     1 
ATOM   2430 C  CB    . HIS A 1 310 ? 55.653 -19.416 -8.739  1.00 26.40 ? 307  HIS A CB    1 
ATOM   2431 C  CG    . HIS A 1 310 ? 56.554 -20.563 -8.391  1.00 37.22 ? 307  HIS A CG    1 
ATOM   2432 N  ND1   . HIS A 1 310 ? 57.920 -20.419 -8.253  1.00 34.79 ? 307  HIS A ND1   1 
ATOM   2433 C  CD2   . HIS A 1 310 ? 56.286 -21.864 -8.129  1.00 37.28 ? 307  HIS A CD2   1 
ATOM   2434 C  CE1   . HIS A 1 310 ? 58.454 -21.584 -7.934  1.00 36.40 ? 307  HIS A CE1   1 
ATOM   2435 N  NE2   . HIS A 1 310 ? 57.485 -22.477 -7.851  1.00 33.26 ? 307  HIS A NE2   1 
ATOM   2436 N  N     . ASP A 1 311 ? 54.282 -16.364 -7.666  1.00 15.27 ? 308  ASP A N     1 
ATOM   2437 C  CA    . ASP A 1 311 ? 53.517 -15.180 -8.088  1.00 14.16 ? 308  ASP A CA    1 
ATOM   2438 C  C     . ASP A 1 311 ? 54.425 -14.159 -8.781  1.00 21.26 ? 308  ASP A C     1 
ATOM   2439 O  O     . ASP A 1 311 ? 55.376 -13.679 -8.183  1.00 15.50 ? 308  ASP A O     1 
ATOM   2440 C  CB    . ASP A 1 311 ? 52.844 -14.544 -6.872  1.00 16.22 ? 308  ASP A CB    1 
ATOM   2441 C  CG    . ASP A 1 311 ? 51.933 -13.406 -7.246  1.00 23.82 ? 308  ASP A CG    1 
ATOM   2442 O  OD1   . ASP A 1 311 ? 51.794 -12.466 -6.443  1.00 27.83 ? 308  ASP A OD1   1 
ATOM   2443 O  OD2   . ASP A 1 311 ? 51.354 -13.460 -8.348  1.00 27.60 ? 308  ASP A OD2   1 
ATOM   2444 N  N     . PRO A 1 312 ? 54.150 -13.837 -10.057 1.00 16.97 ? 309  PRO A N     1 
ATOM   2445 C  CA    . PRO A 1 312 ? 55.082 -12.939 -10.744 1.00 15.46 ? 309  PRO A CA    1 
ATOM   2446 C  C     . PRO A 1 312 ? 54.898 -11.467 -10.388 1.00 14.42 ? 309  PRO A C     1 
ATOM   2447 O  O     . PRO A 1 312 ? 53.816 -11.037 -9.971  1.00 14.04 ? 309  PRO A O     1 
ATOM   2448 C  CB    . PRO A 1 312 ? 54.761 -13.172 -12.226 1.00 19.76 ? 309  PRO A CB    1 
ATOM   2449 C  CG    . PRO A 1 312 ? 53.313 -13.572 -12.221 1.00 15.35 ? 309  PRO A CG    1 
ATOM   2450 C  CD    . PRO A 1 312 ? 53.137 -14.400 -10.968 1.00 14.58 ? 309  PRO A CD    1 
ATOM   2451 N  N     . VAL A 1 313 ? 55.979 -10.709 -10.539 1.00 12.75 ? 310  VAL A N     1 
ATOM   2452 C  CA    . VAL A 1 313 ? 55.908 -9.255  -10.514 1.00 11.77 ? 310  VAL A CA    1 
ATOM   2453 C  C     . VAL A 1 313 ? 55.180 -8.829  -11.778 1.00 15.85 ? 310  VAL A C     1 
ATOM   2454 O  O     . VAL A 1 313 ? 55.733 -8.953  -12.863 1.00 17.54 ? 310  VAL A O     1 
ATOM   2455 C  CB    . VAL A 1 313 ? 57.309 -8.628  -10.465 1.00 14.54 ? 310  VAL A CB    1 
ATOM   2456 C  CG1   . VAL A 1 313 ? 57.228 -7.080  -10.468 1.00 14.19 ? 310  VAL A CG1   1 
ATOM   2457 C  CG2   . VAL A 1 313 ? 58.049 -9.136  -9.231  1.00 13.98 ? 310  VAL A CG2   1 
ATOM   2458 N  N     . LYS A 1 314 ? 53.940 -8.371  -11.647 1.00 17.90 ? 311  LYS A N     1 
ATOM   2459 C  CA    . LYS A 1 314 ? 53.170 -7.983  -12.829 1.00 15.77 ? 311  LYS A CA    1 
ATOM   2460 C  C     . LYS A 1 314 ? 53.647 -6.645  -13.388 1.00 14.20 ? 311  LYS A C     1 
ATOM   2461 O  O     . LYS A 1 314 ? 53.841 -5.691  -12.643 1.00 16.92 ? 311  LYS A O     1 
ATOM   2462 C  CB    . LYS A 1 314 ? 51.680 -7.893  -12.503 1.00 16.93 ? 311  LYS A CB    1 
ATOM   2463 C  CG    . LYS A 1 314 ? 51.060 -9.194  -11.993 1.00 20.79 ? 311  LYS A CG    1 
ATOM   2464 C  CD    . LYS A 1 314 ? 49.564 -9.051  -11.758 1.00 29.12 ? 311  LYS A CD    1 
ATOM   2465 C  CE    . LYS A 1 314 ? 48.928 -10.397 -11.402 1.00 26.87 ? 311  LYS A CE    1 
ATOM   2466 N  NZ    . LYS A 1 314 ? 47.432 -10.362 -11.402 1.00 44.58 ? 311  LYS A NZ    1 
ATOM   2467 N  N     . PRO A 1 315 ? 53.828 -6.564  -14.710 1.00 14.81 ? 312  PRO A N     1 
ATOM   2468 C  CA    . PRO A 1 315 ? 54.177 -5.274  -15.308 1.00 14.26 ? 312  PRO A CA    1 
ATOM   2469 C  C     . PRO A 1 315 ? 52.976 -4.333  -15.301 1.00 17.73 ? 312  PRO A C     1 
ATOM   2470 O  O     . PRO A 1 315 ? 52.234 -4.262  -16.292 1.00 21.52 ? 312  PRO A O     1 
ATOM   2471 C  CB    . PRO A 1 315 ? 54.586 -5.651  -16.733 1.00 16.42 ? 312  PRO A CB    1 
ATOM   2472 C  CG    . PRO A 1 315 ? 53.751 -6.895  -17.024 1.00 17.50 ? 312  PRO A CG    1 
ATOM   2473 C  CD    . PRO A 1 315 ? 53.706 -7.642  -15.715 1.00 14.99 ? 312  PRO A CD    1 
ATOM   2474 N  N     . ARG A 1 316 ? 52.776 -3.626  -14.192 1.00 16.91 ? 313  ARG A N     1 
ATOM   2475 C  CA    . ARG A 1 316 ? 51.645 -2.687  -14.064 1.00 13.88 ? 313  ARG A CA    1 
ATOM   2476 C  C     . ARG A 1 316 ? 52.003 -1.551  -13.116 1.00 20.19 ? 313  ARG A C     1 
ATOM   2477 O  O     . ARG A 1 316 ? 52.136 -1.755  -11.909 1.00 17.64 ? 313  ARG A O     1 
ATOM   2478 C  CB    . ARG A 1 316 ? 50.386 -3.402  -13.565 1.00 19.10 ? 313  ARG A CB    1 
ATOM   2479 C  CG    A ARG A 1 316 ? 49.130 -2.534  -13.552 0.61 21.24 ? 313  ARG A CG    1 
ATOM   2480 C  CG    B ARG A 1 316 ? 49.156 -2.496  -13.581 0.39 21.22 ? 313  ARG A CG    1 
ATOM   2481 C  CD    A ARG A 1 316 ? 47.993 -3.206  -12.782 0.61 18.96 ? 313  ARG A CD    1 
ATOM   2482 C  CD    B ARG A 1 316 ? 47.952 -3.138  -12.908 0.39 18.94 ? 313  ARG A CD    1 
ATOM   2483 N  NE    A ARG A 1 316 ? 48.332 -3.397  -11.372 0.61 20.93 ? 313  ARG A NE    1 
ATOM   2484 N  NE    B ARG A 1 316 ? 48.258 -3.585  -11.552 0.39 20.96 ? 313  ARG A NE    1 
ATOM   2485 C  CZ    A ARG A 1 316 ? 48.470 -4.581  -10.779 0.61 25.82 ? 313  ARG A CZ    1 
ATOM   2486 C  CZ    B ARG A 1 316 ? 48.324 -2.786  -10.490 0.39 21.68 ? 313  ARG A CZ    1 
ATOM   2487 N  NH1   A ARG A 1 316 ? 48.786 -4.641  -9.491  0.61 22.92 ? 313  ARG A NH1   1 
ATOM   2488 N  NH1   B ARG A 1 316 ? 48.612 -3.293  -9.296  0.39 19.71 ? 313  ARG A NH1   1 
ATOM   2489 N  NH2   A ARG A 1 316 ? 48.284 -5.702  -11.464 0.61 25.15 ? 313  ARG A NH2   1 
ATOM   2490 N  NH2   B ARG A 1 316 ? 48.111 -1.481  -10.616 0.39 18.13 ? 313  ARG A NH2   1 
ATOM   2491 N  N     . GLN A 1 317 ? 52.162 -0.355  -13.674 1.00 19.55 ? 314  GLN A N     1 
ATOM   2492 C  CA    . GLN A 1 317 ? 52.625 0.806   -12.920 1.00 22.28 ? 314  GLN A CA    1 
ATOM   2493 C  C     . GLN A 1 317 ? 51.463 1.713   -12.519 1.00 21.49 ? 314  GLN A C     1 
ATOM   2494 O  O     . GLN A 1 317 ? 51.570 2.524   -11.595 1.00 23.26 ? 314  GLN A O     1 
ATOM   2495 C  CB    . GLN A 1 317 ? 53.638 1.586   -13.755 1.00 28.37 ? 314  GLN A CB    1 
ATOM   2496 C  CG    . GLN A 1 317 ? 54.358 2.675   -13.010 1.00 30.89 ? 314  GLN A CG    1 
ATOM   2497 C  CD    . GLN A 1 317 ? 55.283 3.453   -13.910 1.00 33.46 ? 314  GLN A CD    1 
ATOM   2498 O  OE1   . GLN A 1 317 ? 55.612 3.006   -15.009 1.00 41.50 ? 314  GLN A OE1   1 
ATOM   2499 N  NE2   . GLN A 1 317 ? 55.713 4.624   -13.452 1.00 29.94 ? 314  GLN A NE2   1 
ATOM   2500 N  N     . LEU A 1 318 ? 50.352 1.555   -13.226 1.00 16.67 ? 315  LEU A N     1 
ATOM   2501 C  CA    . LEU A 1 318 ? 49.176 2.396   -13.056 1.00 21.26 ? 315  LEU A CA    1 
ATOM   2502 C  C     . LEU A 1 318 ? 48.047 1.624   -12.397 1.00 18.28 ? 315  LEU A C     1 
ATOM   2503 O  O     . LEU A 1 318 ? 47.874 0.443   -12.677 1.00 20.81 ? 315  LEU A O     1 
ATOM   2504 C  CB    . LEU A 1 318 ? 48.690 2.908   -14.412 1.00 19.48 ? 315  LEU A CB    1 
ATOM   2505 C  CG    . LEU A 1 318 ? 49.689 3.679   -15.274 1.00 21.22 ? 315  LEU A CG    1 
ATOM   2506 C  CD1   . LEU A 1 318 ? 49.092 3.898   -16.660 1.00 15.60 ? 315  LEU A CD1   1 
ATOM   2507 C  CD2   . LEU A 1 318 ? 50.054 5.004   -14.619 1.00 19.28 ? 315  LEU A CD2   1 
ATOM   2508 N  N     . PRO A 1 319 ? 47.241 2.297   -11.556 1.00 16.98 ? 316  PRO A N     1 
ATOM   2509 C  CA    . PRO A 1 319 ? 46.071 1.589   -11.013 1.00 21.54 ? 316  PRO A CA    1 
ATOM   2510 C  C     . PRO A 1 319 ? 45.098 1.148   -12.112 1.00 18.15 ? 316  PRO A C     1 
ATOM   2511 O  O     . PRO A 1 319 ? 45.059 1.784   -13.162 1.00 21.59 ? 316  PRO A O     1 
ATOM   2512 C  CB    . PRO A 1 319 ? 45.426 2.623   -10.080 1.00 25.02 ? 316  PRO A CB    1 
ATOM   2513 C  CG    . PRO A 1 319 ? 45.991 3.949   -10.504 1.00 33.39 ? 316  PRO A CG    1 
ATOM   2514 C  CD    . PRO A 1 319 ? 47.352 3.683   -11.062 1.00 20.33 ? 316  PRO A CD    1 
ATOM   2515 N  N     . LYS A 1 320 ? 44.359 0.061   -11.859 1.00 20.05 ? 317  LYS A N     1 
ATOM   2516 C  CA    . LYS A 1 320 ? 43.411 -0.547  -12.801 1.00 21.27 ? 317  LYS A CA    1 
ATOM   2517 C  C     . LYS A 1 320 ? 42.019 0.067   -12.737 1.00 20.62 ? 317  LYS A C     1 
ATOM   2518 O  O     . LYS A 1 320 ? 41.183 -0.176  -13.601 1.00 19.82 ? 317  LYS A O     1 
ATOM   2519 C  CB    . LYS A 1 320 ? 43.254 -2.043  -12.510 1.00 30.32 ? 317  LYS A CB    1 
ATOM   2520 C  CG    . LYS A 1 320 ? 44.350 -2.942  -12.983 1.00 29.53 ? 317  LYS A CG    1 
ATOM   2521 C  CD    . LYS A 1 320 ? 43.877 -4.398  -12.889 1.00 29.48 ? 317  LYS A CD    1 
ATOM   2522 C  CE    . LYS A 1 320 ? 44.834 -5.328  -13.596 1.00 32.32 ? 317  LYS A CE    1 
ATOM   2523 N  NZ    . LYS A 1 320 ? 44.348 -6.733  -13.591 1.00 41.75 ? 317  LYS A NZ    1 
ATOM   2524 N  N     . THR A 1 321 ? 41.756 0.798   -11.663 1.00 20.19 ? 318  THR A N     1 
ATOM   2525 C  CA    . THR A 1 321 ? 40.453 1.410   -11.447 1.00 21.13 ? 318  THR A CA    1 
ATOM   2526 C  C     . THR A 1 321 ? 40.679 2.807   -10.888 1.00 21.43 ? 318  THR A C     1 
ATOM   2527 O  O     . THR A 1 321 ? 41.743 3.093   -10.334 1.00 23.88 ? 318  THR A O     1 
ATOM   2528 C  CB    . THR A 1 321 ? 39.572 0.587   -10.464 1.00 17.44 ? 318  THR A CB    1 
ATOM   2529 O  OG1   . THR A 1 321 ? 40.256 0.459   -9.208  1.00 19.70 ? 318  THR A OG1   1 
ATOM   2530 C  CG2   . THR A 1 321 ? 39.257 -0.806  -11.008 1.00 18.63 ? 318  THR A CG2   1 
ATOM   2531 N  N     . ILE A 1 322 ? 39.694 3.684   -11.063 1.00 16.57 ? 319  ILE A N     1 
ATOM   2532 C  CA    . ILE A 1 322 ? 39.734 5.011   -10.475 1.00 20.12 ? 319  ILE A CA    1 
ATOM   2533 C  C     . ILE A 1 322 ? 38.427 5.214   -9.728  1.00 20.52 ? 319  ILE A C     1 
ATOM   2534 O  O     . ILE A 1 322 ? 37.358 5.189   -10.332 1.00 19.93 ? 319  ILE A O     1 
ATOM   2535 C  CB    . ILE A 1 322 ? 39.940 6.098   -11.546 1.00 16.61 ? 319  ILE A CB    1 
ATOM   2536 C  CG1   . ILE A 1 322 ? 41.301 5.902   -12.235 1.00 18.94 ? 319  ILE A CG1   1 
ATOM   2537 C  CG2   . ILE A 1 322 ? 39.860 7.498   -10.934 1.00 17.43 ? 319  ILE A CG2   1 
ATOM   2538 C  CD1   . ILE A 1 322 ? 41.650 7.020   -13.211 1.00 17.79 ? 319  ILE A CD1   1 
ATOM   2539 N  N     . GLY A 1 323 ? 38.508 5.378   -8.413  1.00 18.87 ? 320  GLY A N     1 
ATOM   2540 C  CA    . GLY A 1 323 ? 37.307 5.410   -7.595  1.00 18.83 ? 320  GLY A CA    1 
ATOM   2541 C  C     . GLY A 1 323 ? 37.205 6.594   -6.654  1.00 15.75 ? 320  GLY A C     1 
ATOM   2542 O  O     . GLY A 1 323 ? 38.205 7.206   -6.290  1.00 16.33 ? 320  GLY A O     1 
ATOM   2543 N  N     . CYS A 1 324 ? 35.966 6.900   -6.267  1.00 16.52 ? 321  CYS A N     1 
ATOM   2544 C  CA    . CYS A 1 324 ? 35.629 8.004   -5.370  1.00 20.02 ? 321  CYS A CA    1 
ATOM   2545 C  C     . CYS A 1 324 ? 34.626 7.462   -4.360  1.00 18.98 ? 321  CYS A C     1 
ATOM   2546 O  O     . CYS A 1 324 ? 33.580 6.936   -4.753  1.00 17.00 ? 321  CYS A O     1 
ATOM   2547 C  CB    . CYS A 1 324 ? 35.036 9.200   -6.147  1.00 16.71 ? 321  CYS A CB    1 
ATOM   2548 S  SG    A CYS A 1 324 ? 35.386 10.821  -5.490  0.34 23.27 ? 321  CYS A SG    1 
ATOM   2549 S  SG    B CYS A 1 324 ? 36.200 10.014  -7.262  0.66 19.18 ? 321  CYS A SG    1 
ATOM   2550 N  N     . SER A 1 325 ? 34.925 7.559   -3.070  1.00 15.81 ? 322  SER A N     1 
ATOM   2551 C  CA    A SER A 1 325 ? 33.978 7.048   -2.091  0.53 18.68 ? 322  SER A CA    1 
ATOM   2552 C  CA    B SER A 1 325 ? 34.073 6.979   -2.038  0.47 18.73 ? 322  SER A CA    1 
ATOM   2553 C  C     . SER A 1 325 ? 33.888 7.929   -0.855  1.00 19.39 ? 322  SER A C     1 
ATOM   2554 O  O     . SER A 1 325 ? 34.842 8.609   -0.462  1.00 17.73 ? 322  SER A O     1 
ATOM   2555 C  CB    A SER A 1 325 ? 34.325 5.605   -1.692  0.53 20.10 ? 322  SER A CB    1 
ATOM   2556 C  CB    B SER A 1 325 ? 34.677 5.652   -1.561  0.47 18.72 ? 322  SER A CB    1 
ATOM   2557 O  OG    A SER A 1 325 ? 35.505 5.517   -0.919  0.53 16.59 ? 322  SER A OG    1 
ATOM   2558 O  OG    B SER A 1 325 ? 34.064 5.187   -0.372  0.47 18.20 ? 322  SER A OG    1 
ATOM   2559 N  N     . LYS A 1 326 ? 32.692 7.948   -0.275  1.00 16.57 ? 323  LYS A N     1 
ATOM   2560 C  CA    . LYS A 1 326 ? 32.461 8.698   0.953   1.00 15.43 ? 323  LYS A CA    1 
ATOM   2561 C  C     . LYS A 1 326 ? 31.493 7.971   1.879   1.00 20.98 ? 323  LYS A C     1 
ATOM   2562 O  O     . LYS A 1 326 ? 30.440 7.506   1.436   1.00 15.66 ? 323  LYS A O     1 
ATOM   2563 C  CB    . LYS A 1 326 ? 31.930 10.103  0.650   1.00 16.58 ? 323  LYS A CB    1 
ATOM   2564 C  CG    . LYS A 1 326 ? 31.776 10.916  1.936   1.00 17.08 ? 323  LYS A CG    1 
ATOM   2565 C  CD    . LYS A 1 326 ? 31.571 12.402  1.688   1.00 22.36 ? 323  LYS A CD    1 
ATOM   2566 C  CE    . LYS A 1 326 ? 31.305 13.108  3.008   1.00 24.60 ? 323  LYS A CE    1 
ATOM   2567 N  NZ    . LYS A 1 326 ? 32.258 12.649  4.047   1.00 30.79 ? 323  LYS A NZ    1 
ATOM   2568 N  N     . ASN A 1 327 ? 31.874 7.843   3.150   1.00 17.38 ? 324  ASN A N     1 
ATOM   2569 C  CA    . ASN A 1 327 ? 30.963 7.389   4.202   1.00 18.64 ? 324  ASN A CA    1 
ATOM   2570 C  C     . ASN A 1 327 ? 30.109 8.527   4.761   1.00 17.96 ? 324  ASN A C     1 
ATOM   2571 O  O     . ASN A 1 327 ? 30.518 9.685   4.792   1.00 18.43 ? 324  ASN A O     1 
ATOM   2572 C  CB    . ASN A 1 327 ? 31.718 6.747   5.372   1.00 18.55 ? 324  ASN A CB    1 
ATOM   2573 C  CG    . ASN A 1 327 ? 32.417 5.454   5.001   1.00 23.74 ? 324  ASN A CG    1 
ATOM   2574 O  OD1   . ASN A 1 327 ? 32.156 4.851   3.957   1.00 26.93 ? 324  ASN A OD1   1 
ATOM   2575 N  ND2   . ASN A 1 327 ? 33.317 5.012   5.878   1.00 27.51 ? 324  ASN A ND2   1 
ATOM   2576 N  N     . PHE A 1 328 ? 28.916 8.179   5.225   1.00 16.62 ? 325  PHE A N     1 
ATOM   2577 C  CA    . PHE A 1 328 ? 28.052 9.138   5.892   1.00 20.30 ? 325  PHE A CA    1 
ATOM   2578 C  C     . PHE A 1 328 ? 27.586 8.505   7.194   1.00 23.75 ? 325  PHE A C     1 
ATOM   2579 O  O     . PHE A 1 328 ? 26.489 7.938   7.263   1.00 22.06 ? 325  PHE A O     1 
ATOM   2580 C  CB    . PHE A 1 328 ? 26.888 9.514   4.981   1.00 20.49 ? 325  PHE A CB    1 
ATOM   2581 C  CG    . PHE A 1 328 ? 27.324 10.052  3.653   1.00 15.79 ? 325  PHE A CG    1 
ATOM   2582 C  CD1   . PHE A 1 328 ? 27.522 9.199   2.576   1.00 19.76 ? 325  PHE A CD1   1 
ATOM   2583 C  CD2   . PHE A 1 328 ? 27.564 11.403  3.482   1.00 17.63 ? 325  PHE A CD2   1 
ATOM   2584 C  CE1   . PHE A 1 328 ? 27.940 9.693   1.351   1.00 11.40 ? 325  PHE A CE1   1 
ATOM   2585 C  CE2   . PHE A 1 328 ? 27.973 11.901  2.262   1.00 17.55 ? 325  PHE A CE2   1 
ATOM   2586 C  CZ    . PHE A 1 328 ? 28.163 11.044  1.192   1.00 18.48 ? 325  PHE A CZ    1 
ATOM   2587 N  N     . PRO A 1 329 ? 28.440 8.575   8.228   1.00 21.60 ? 326  PRO A N     1 
ATOM   2588 C  CA    . PRO A 1 329 ? 28.242 7.790   9.451   1.00 22.80 ? 326  PRO A CA    1 
ATOM   2589 C  C     . PRO A 1 329 ? 27.189 8.372   10.375  1.00 28.33 ? 326  PRO A C     1 
ATOM   2590 O  O     . PRO A 1 329 ? 26.874 9.559   10.281  1.00 27.18 ? 326  PRO A O     1 
ATOM   2591 C  CB    . PRO A 1 329 ? 29.618 7.827   10.118  1.00 29.82 ? 326  PRO A CB    1 
ATOM   2592 C  CG    . PRO A 1 329 ? 30.213 9.104   9.659   1.00 32.89 ? 326  PRO A CG    1 
ATOM   2593 C  CD    . PRO A 1 329 ? 29.709 9.325   8.255   1.00 24.04 ? 326  PRO A CD    1 
ATOM   2594 N  N     . GLY A 1 330 ? 26.665 7.521   11.253  1.00 41.17 ? 327  GLY A N     1 
ATOM   2595 C  CA    . GLY A 1 330 ? 25.701 7.915   12.263  1.00 38.53 ? 327  GLY A CA    1 
ATOM   2596 C  C     . GLY A 1 330 ? 24.554 8.738   11.720  1.00 36.31 ? 327  GLY A C     1 
ATOM   2597 O  O     . GLY A 1 330 ? 23.771 8.276   10.887  1.00 40.24 ? 327  GLY A O     1 
ATOM   2598 N  N     . LYS A 1 331 ? 24.477 9.981   12.177  1.00 34.66 ? 328  LYS A N     1 
ATOM   2599 C  CA    . LYS A 1 331 ? 23.336 10.826  11.870  1.00 32.20 ? 328  LYS A CA    1 
ATOM   2600 C  C     . LYS A 1 331 ? 23.511 11.590  10.558  1.00 33.27 ? 328  LYS A C     1 
ATOM   2601 O  O     . LYS A 1 331 ? 22.573 12.213  10.074  1.00 33.28 ? 328  LYS A O     1 
ATOM   2602 C  CB    . LYS A 1 331 ? 23.078 11.794  13.032  1.00 41.76 ? 328  LYS A CB    1 
ATOM   2603 C  CG    . LYS A 1 331 ? 23.251 11.163  14.424  1.00 45.29 ? 328  LYS A CG    1 
ATOM   2604 C  CD    . LYS A 1 331 ? 22.450 9.869   14.589  1.00 54.62 ? 328  LYS A CD    1 
ATOM   2605 C  CE    . LYS A 1 331 ? 23.161 8.865   15.504  1.00 56.81 ? 328  LYS A CE    1 
ATOM   2606 N  NZ    . LYS A 1 331 ? 23.007 9.171   16.959  1.00 64.31 ? 328  LYS A NZ    1 
ATOM   2607 N  N     . THR A 1 332 ? 24.699 11.532  9.961   1.00 28.67 ? 329  THR A N     1 
ATOM   2608 C  CA    . THR A 1 332 ? 24.913 12.231  8.691   1.00 26.90 ? 329  THR A CA    1 
ATOM   2609 C  C     . THR A 1 332 ? 24.430 11.397  7.504   1.00 25.43 ? 329  THR A C     1 
ATOM   2610 O  O     . THR A 1 332 ? 24.542 11.825  6.352   1.00 28.71 ? 329  THR A O     1 
ATOM   2611 C  CB    . THR A 1 332 ? 26.395 12.590  8.473   1.00 28.51 ? 329  THR A CB    1 
ATOM   2612 O  OG1   . THR A 1 332 ? 27.150 11.392  8.255   1.00 30.23 ? 329  THR A OG1   1 
ATOM   2613 C  CG2   . THR A 1 332 ? 26.953 13.334  9.682   1.00 29.68 ? 329  THR A CG2   1 
ATOM   2614 N  N     . ALA A 1 333 ? 23.905 10.210  7.793   1.00 24.51 ? 330  ALA A N     1 
ATOM   2615 C  CA    . ALA A 1 333 ? 23.378 9.324   6.756   1.00 25.99 ? 330  ALA A CA    1 
ATOM   2616 C  C     . ALA A 1 333 ? 22.352 10.026  5.869   1.00 27.68 ? 330  ALA A C     1 
ATOM   2617 O  O     . ALA A 1 333 ? 21.527 10.805  6.344   1.00 28.48 ? 330  ALA A O     1 
ATOM   2618 C  CB    . ALA A 1 333 ? 22.774 8.090   7.386   1.00 25.39 ? 330  ALA A CB    1 
ATOM   2619 N  N     . LEU A 1 334 ? 22.407 9.741   4.573   1.00 23.99 ? 331  LEU A N     1 
ATOM   2620 C  CA    . LEU A 1 334 ? 21.596 10.450  3.594   1.00 25.39 ? 331  LEU A CA    1 
ATOM   2621 C  C     . LEU A 1 334 ? 20.156 9.929   3.584   1.00 27.70 ? 331  LEU A C     1 
ATOM   2622 O  O     . LEU A 1 334 ? 19.927 8.742   3.377   1.00 31.87 ? 331  LEU A O     1 
ATOM   2623 C  CB    . LEU A 1 334 ? 22.228 10.315  2.209   1.00 22.88 ? 331  LEU A CB    1 
ATOM   2624 C  CG    . LEU A 1 334 ? 23.724 10.643  2.143   1.00 20.86 ? 331  LEU A CG    1 
ATOM   2625 C  CD1   . LEU A 1 334 ? 24.167 10.547  0.696   1.00 19.82 ? 331  LEU A CD1   1 
ATOM   2626 C  CD2   . LEU A 1 334 ? 24.012 12.034  2.732   1.00 20.26 ? 331  LEU A CD2   1 
ATOM   2627 N  N     . ALA A 1 335 ? 19.193 10.821  3.806   1.00 34.88 ? 332  ALA A N     1 
ATOM   2628 C  CA    . ALA A 1 335 ? 17.803 10.400  4.011   1.00 29.25 ? 332  ALA A CA    1 
ATOM   2629 C  C     . ALA A 1 335 ? 16.823 11.073  3.050   1.00 36.21 ? 332  ALA A C     1 
ATOM   2630 O  O     . ALA A 1 335 ? 15.619 10.826  3.109   1.00 42.06 ? 332  ALA A O     1 
ATOM   2631 C  CB    . ALA A 1 335 ? 17.388 10.669  5.450   1.00 37.05 ? 332  ALA A CB    1 
ATOM   2632 N  N     . THR A 1 336 ? 17.340 11.928  2.177   1.00 27.68 ? 333  THR A N     1 
ATOM   2633 C  CA    . THR A 1 336 ? 16.516 12.601  1.190   1.00 35.22 ? 333  THR A CA    1 
ATOM   2634 C  C     . THR A 1 336 ? 17.087 12.371  -0.201  1.00 42.25 ? 333  THR A C     1 
ATOM   2635 O  O     . THR A 1 336 ? 18.294 12.178  -0.357  1.00 38.31 ? 333  THR A O     1 
ATOM   2636 C  CB    . THR A 1 336 ? 16.408 14.112  1.461   1.00 36.13 ? 333  THR A CB    1 
ATOM   2637 O  OG1   . THR A 1 336 ? 17.577 14.783  0.979   1.00 34.50 ? 333  THR A OG1   1 
ATOM   2638 C  CG2   . THR A 1 336 ? 16.233 14.386  2.952   1.00 37.32 ? 333  THR A CG2   1 
ATOM   2639 N  N     . ARG A 1 337 ? 16.223 12.389  -1.212  1.00 43.55 ? 334  ARG A N     1 
ATOM   2640 C  CA    . ARG A 1 337 ? 16.664 12.114  -2.572  1.00 41.31 ? 334  ARG A CA    1 
ATOM   2641 C  C     . ARG A 1 337 ? 17.654 13.175  -3.044  1.00 40.38 ? 334  ARG A C     1 
ATOM   2642 O  O     . ARG A 1 337 ? 18.610 12.857  -3.747  1.00 39.53 ? 334  ARG A O     1 
ATOM   2643 C  CB    . ARG A 1 337 ? 15.470 12.025  -3.539  1.00 51.25 ? 334  ARG A CB    1 
ATOM   2644 C  CG    . ARG A 1 337 ? 14.925 13.367  -4.022  1.00 56.76 ? 334  ARG A CG    1 
ATOM   2645 C  CD    . ARG A 1 337 ? 14.186 13.252  -5.348  1.00 62.54 ? 334  ARG A CD    1 
ATOM   2646 N  NE    . ARG A 1 337 ? 13.996 14.560  -5.975  1.00 63.27 ? 334  ARG A NE    1 
ATOM   2647 C  CZ    . ARG A 1 337 ? 12.939 15.343  -5.776  1.00 71.95 ? 334  ARG A CZ    1 
ATOM   2648 N  NH1   . ARG A 1 337 ? 11.964 14.952  -4.966  1.00 66.64 ? 334  ARG A NH1   1 
ATOM   2649 N  NH2   . ARG A 1 337 ? 12.853 16.518  -6.391  1.00 71.24 ? 334  ARG A NH2   1 
ATOM   2650 N  N     . GLU A 1 338 ? 17.444 14.428  -2.645  1.00 45.46 ? 335  GLU A N     1 
ATOM   2651 C  CA    . GLU A 1 338 ? 18.307 15.510  -3.101  1.00 40.51 ? 335  GLU A CA    1 
ATOM   2652 C  C     . GLU A 1 338 ? 19.648 15.488  -2.378  1.00 31.89 ? 335  GLU A C     1 
ATOM   2653 O  O     . GLU A 1 338 ? 20.641 16.000  -2.886  1.00 32.29 ? 335  GLU A O     1 
ATOM   2654 C  CB    . GLU A 1 338 ? 17.623 16.865  -2.923  1.00 42.67 ? 335  GLU A CB    1 
ATOM   2655 C  CG    . GLU A 1 338 ? 16.881 17.314  -4.174  1.00 51.31 ? 335  GLU A CG    1 
ATOM   2656 C  CD    . GLU A 1 338 ? 16.035 18.553  -3.954  1.00 65.14 ? 335  GLU A CD    1 
ATOM   2657 O  OE1   . GLU A 1 338 ? 16.230 19.238  -2.925  1.00 62.28 ? 335  GLU A OE1   1 
ATOM   2658 O  OE2   . GLU A 1 338 ? 15.171 18.837  -4.812  1.00 65.47 ? 335  GLU A OE2   1 
ATOM   2659 N  N     . GLN A 1 339 ? 19.669 14.899  -1.190  1.00 35.83 ? 336  GLN A N     1 
ATOM   2660 C  CA    . GLN A 1 339 ? 20.928 14.628  -0.515  1.00 31.97 ? 336  GLN A CA    1 
ATOM   2661 C  C     . GLN A 1 339 ? 21.718 13.630  -1.350  1.00 34.64 ? 336  GLN A C     1 
ATOM   2662 O  O     . GLN A 1 339 ? 22.848 13.898  -1.769  1.00 28.79 ? 336  GLN A O     1 
ATOM   2663 C  CB    . GLN A 1 339 ? 20.685 14.070  0.885   1.00 30.59 ? 336  GLN A CB    1 
ATOM   2664 C  CG    . GLN A 1 339 ? 21.121 14.971  2.019   1.00 29.34 ? 336  GLN A CG    1 
ATOM   2665 C  CD    . GLN A 1 339 ? 20.984 14.281  3.354   1.00 30.99 ? 336  GLN A CD    1 
ATOM   2666 O  OE1   . GLN A 1 339 ? 20.062 13.490  3.562   1.00 29.66 ? 336  GLN A OE1   1 
ATOM   2667 N  NE2   . GLN A 1 339 ? 21.907 14.561  4.266   1.00 26.13 ? 336  GLN A NE2   1 
ATOM   2668 N  N     . VAL A 1 340 ? 21.092 12.483  -1.598  1.00 31.18 ? 337  VAL A N     1 
ATOM   2669 C  CA    . VAL A 1 340 ? 21.689 11.414  -2.379  1.00 30.30 ? 337  VAL A CA    1 
ATOM   2670 C  C     . VAL A 1 340 ? 22.193 11.933  -3.722  1.00 31.02 ? 337  VAL A C     1 
ATOM   2671 O  O     . VAL A 1 340 ? 23.302 11.612  -4.139  1.00 30.01 ? 337  VAL A O     1 
ATOM   2672 C  CB    . VAL A 1 340 ? 20.685 10.264  -2.610  1.00 35.42 ? 337  VAL A CB    1 
ATOM   2673 C  CG1   . VAL A 1 340 ? 21.235 9.256   -3.601  1.00 23.35 ? 337  VAL A CG1   1 
ATOM   2674 C  CG2   . VAL A 1 340 ? 20.353 9.581   -1.300  1.00 23.10 ? 337  VAL A CG2   1 
ATOM   2675 N  N     . GLN A 1 341 ? 21.387 12.760  -4.381  1.00 28.16 ? 338  GLN A N     1 
ATOM   2676 C  CA    . GLN A 1 341 ? 21.736 13.266  -5.708  1.00 29.26 ? 338  GLN A CA    1 
ATOM   2677 C  C     . GLN A 1 341 ? 22.874 14.278  -5.665  1.00 33.03 ? 338  GLN A C     1 
ATOM   2678 O  O     . GLN A 1 341 ? 23.727 14.303  -6.554  1.00 27.72 ? 338  GLN A O     1 
ATOM   2679 C  CB    . GLN A 1 341 ? 20.509 13.883  -6.383  1.00 34.34 ? 338  GLN A CB    1 
ATOM   2680 C  CG    . GLN A 1 341 ? 19.479 12.840  -6.796  1.00 35.78 ? 338  GLN A CG    1 
ATOM   2681 C  CD    . GLN A 1 341 ? 18.220 13.447  -7.389  1.00 41.62 ? 338  GLN A CD    1 
ATOM   2682 O  OE1   . GLN A 1 341 ? 17.994 14.652  -7.302  1.00 42.26 ? 338  GLN A OE1   1 
ATOM   2683 N  NE2   . GLN A 1 341 ? 17.393 12.605  -8.002  1.00 48.08 ? 338  GLN A NE2   1 
ATOM   2684 N  N     . TRP A 1 342 ? 22.885 15.112  -4.634  1.00 25.72 ? 339  TRP A N     1 
ATOM   2685 C  CA    . TRP A 1 342 ? 23.915 16.132  -4.503  1.00 27.35 ? 339  TRP A CA    1 
ATOM   2686 C  C     . TRP A 1 342 ? 25.285 15.501  -4.271  1.00 21.39 ? 339  TRP A C     1 
ATOM   2687 O  O     . TRP A 1 342 ? 26.266 15.910  -4.871  1.00 22.45 ? 339  TRP A O     1 
ATOM   2688 C  CB    . TRP A 1 342 ? 23.587 17.099  -3.363  1.00 22.07 ? 339  TRP A CB    1 
ATOM   2689 C  CG    . TRP A 1 342 ? 24.558 18.236  -3.294  1.00 27.36 ? 339  TRP A CG    1 
ATOM   2690 C  CD1   . TRP A 1 342 ? 24.559 19.365  -4.059  1.00 21.78 ? 339  TRP A CD1   1 
ATOM   2691 C  CD2   . TRP A 1 342 ? 25.684 18.339  -2.425  1.00 22.03 ? 339  TRP A CD2   1 
ATOM   2692 N  NE1   . TRP A 1 342 ? 25.610 20.172  -3.713  1.00 29.37 ? 339  TRP A NE1   1 
ATOM   2693 C  CE2   . TRP A 1 342 ? 26.319 19.567  -2.709  1.00 21.14 ? 339  TRP A CE2   1 
ATOM   2694 C  CE3   . TRP A 1 342 ? 26.214 17.519  -1.426  1.00 20.87 ? 339  TRP A CE3   1 
ATOM   2695 C  CZ2   . TRP A 1 342 ? 27.458 19.993  -2.036  1.00 27.74 ? 339  TRP A CZ2   1 
ATOM   2696 C  CZ3   . TRP A 1 342 ? 27.345 17.946  -0.754  1.00 21.52 ? 339  TRP A CZ3   1 
ATOM   2697 C  CH2   . TRP A 1 342 ? 27.959 19.169  -1.067  1.00 24.18 ? 339  TRP A CH2   1 
ATOM   2698 N  N     . TRP A 1 343 ? 25.336 14.500  -3.404  1.00 21.35 ? 340  TRP A N     1 
ATOM   2699 C  CA    . TRP A 1 343 ? 26.596 13.822  -3.118  1.00 18.54 ? 340  TRP A CA    1 
ATOM   2700 C  C     . TRP A 1 343 ? 27.041 12.929  -4.277  1.00 25.76 ? 340  TRP A C     1 
ATOM   2701 O  O     . TRP A 1 343 ? 28.238 12.791  -4.516  1.00 18.86 ? 340  TRP A O     1 
ATOM   2702 C  CB    . TRP A 1 343 ? 26.488 13.011  -1.826  1.00 22.12 ? 340  TRP A CB    1 
ATOM   2703 C  CG    . TRP A 1 343 ? 26.620 13.862  -0.573  1.00 17.44 ? 340  TRP A CG    1 
ATOM   2704 C  CD1   . TRP A 1 343 ? 25.630 14.182  0.318   1.00 26.74 ? 340  TRP A CD1   1 
ATOM   2705 C  CD2   . TRP A 1 343 ? 27.813 14.497  -0.092  1.00 17.00 ? 340  TRP A CD2   1 
ATOM   2706 N  NE1   . TRP A 1 343 ? 26.140 14.975  1.326   1.00 20.52 ? 340  TRP A NE1   1 
ATOM   2707 C  CE2   . TRP A 1 343 ? 27.477 15.179  1.096   1.00 22.27 ? 340  TRP A CE2   1 
ATOM   2708 C  CE3   . TRP A 1 343 ? 29.135 14.545  -0.548  1.00 18.26 ? 340  TRP A CE3   1 
ATOM   2709 C  CZ2   . TRP A 1 343 ? 28.416 15.905  1.835   1.00 19.84 ? 340  TRP A CZ2   1 
ATOM   2710 C  CZ3   . TRP A 1 343 ? 30.067 15.273  0.184   1.00 15.90 ? 340  TRP A CZ3   1 
ATOM   2711 C  CH2   . TRP A 1 343 ? 29.704 15.939  1.365   1.00 21.87 ? 340  TRP A CH2   1 
ATOM   2712 N  N     . LEU A 1 344 ? 26.103 12.326  -5.007  1.00 21.47 ? 341  LEU A N     1 
ATOM   2713 C  CA    . LEU A 1 344 ? 26.512 11.559  -6.193  1.00 23.21 ? 341  LEU A CA    1 
ATOM   2714 C  C     . LEU A 1 344 ? 27.193 12.491  -7.176  1.00 17.61 ? 341  LEU A C     1 
ATOM   2715 O  O     . LEU A 1 344 ? 28.169 12.122  -7.845  1.00 19.46 ? 341  LEU A O     1 
ATOM   2716 C  CB    . LEU A 1 344 ? 25.327 10.863  -6.873  1.00 16.25 ? 341  LEU A CB    1 
ATOM   2717 C  CG    . LEU A 1 344 ? 24.789 9.606   -6.184  1.00 19.75 ? 341  LEU A CG    1 
ATOM   2718 C  CD1   . LEU A 1 344 ? 23.419 9.261   -6.748  1.00 26.39 ? 341  LEU A CD1   1 
ATOM   2719 C  CD2   . LEU A 1 344 ? 25.750 8.442   -6.347  1.00 19.76 ? 341  LEU A CD2   1 
ATOM   2720 N  N     . LEU A 1 345 ? 26.680 13.711  -7.257  1.00 16.55 ? 342  LEU A N     1 
ATOM   2721 C  CA    . LEU A 1 345 ? 27.257 14.720  -8.117  1.00 17.41 ? 342  LEU A CA    1 
ATOM   2722 C  C     . LEU A 1 345 ? 28.654 15.122  -7.627  1.00 17.24 ? 342  LEU A C     1 
ATOM   2723 O  O     . LEU A 1 345 ? 29.567 15.303  -8.425  1.00 21.82 ? 342  LEU A O     1 
ATOM   2724 C  CB    . LEU A 1 345 ? 26.348 15.949  -8.194  1.00 23.15 ? 342  LEU A CB    1 
ATOM   2725 C  CG    . LEU A 1 345 ? 26.924 17.064  -9.069  1.00 19.42 ? 342  LEU A CG    1 
ATOM   2726 C  CD1   . LEU A 1 345 ? 27.145 16.568  -10.504 1.00 29.80 ? 342  LEU A CD1   1 
ATOM   2727 C  CD2   . LEU A 1 345 ? 26.016 18.292  -9.059  1.00 28.88 ? 342  LEU A CD2   1 
ATOM   2728 N  N     . GLN A 1 346 ? 28.821 15.256  -6.316  1.00 15.84 ? 343  GLN A N     1 
ATOM   2729 C  CA    . GLN A 1 346 ? 30.126 15.651  -5.781  1.00 18.49 ? 343  GLN A CA    1 
ATOM   2730 C  C     . GLN A 1 346 ? 31.162 14.584  -6.119  1.00 14.24 ? 343  GLN A C     1 
ATOM   2731 O  O     . GLN A 1 346 ? 32.251 14.896  -6.608  1.00 16.75 ? 343  GLN A O     1 
ATOM   2732 C  CB    . GLN A 1 346 ? 30.082 15.861  -4.264  1.00 20.87 ? 343  GLN A CB    1 
ATOM   2733 C  CG    . GLN A 1 346 ? 29.148 16.971  -3.790  1.00 17.27 ? 343  GLN A CG    1 
ATOM   2734 C  CD    . GLN A 1 346 ? 29.168 18.208  -4.666  1.00 18.94 ? 343  GLN A CD    1 
ATOM   2735 O  OE1   . GLN A 1 346 ? 30.154 18.944  -4.715  1.00 22.17 ? 343  GLN A OE1   1 
ATOM   2736 N  NE2   . GLN A 1 346 ? 28.060 18.451  -5.362  1.00 25.82 ? 343  GLN A NE2   1 
ATOM   2737 N  N     . LEU A 1 347 ? 30.813 13.335  -5.847  1.00 20.81 ? 344  LEU A N     1 
ATOM   2738 C  CA    . LEU A 1 347 ? 31.692 12.213  -6.174  1.00 18.70 ? 344  LEU A CA    1 
ATOM   2739 C  C     . LEU A 1 347 ? 31.983 12.178  -7.676  1.00 19.48 ? 344  LEU A C     1 
ATOM   2740 O  O     . LEU A 1 347 ? 33.139 12.037  -8.096  1.00 14.29 ? 344  LEU A O     1 
ATOM   2741 C  CB    . LEU A 1 347 ? 31.073 10.893  -5.725  1.00 16.97 ? 344  LEU A CB    1 
ATOM   2742 C  CG    . LEU A 1 347 ? 31.094 10.555  -4.237  1.00 24.33 ? 344  LEU A CG    1 
ATOM   2743 C  CD1   . LEU A 1 347 ? 30.445 9.198   -3.977  1.00 26.57 ? 344  LEU A CD1   1 
ATOM   2744 C  CD2   . LEU A 1 347 ? 32.486 10.543  -3.725  1.00 24.72 ? 344  LEU A CD2   1 
ATOM   2745 N  N     . ALA A 1 348 ? 30.931 12.315  -8.480  1.00 15.40 ? 345  ALA A N     1 
ATOM   2746 C  CA    . ALA A 1 348 ? 31.077 12.261  -9.927  1.00 19.09 ? 345  ALA A CA    1 
ATOM   2747 C  C     . ALA A 1 348 ? 31.955 13.386  -10.466 1.00 18.10 ? 345  ALA A C     1 
ATOM   2748 O  O     . ALA A 1 348 ? 32.623 13.222  -11.490 1.00 17.66 ? 345  ALA A O     1 
ATOM   2749 C  CB    . ALA A 1 348 ? 29.705 12.296  -10.599 1.00 15.63 ? 345  ALA A CB    1 
ATOM   2750 N  N     . GLN A 1 349 ? 31.952 14.531  -9.792  1.00 15.04 ? 346  GLN A N     1 
ATOM   2751 C  CA    . GLN A 1 349 ? 32.773 15.651  -10.228 1.00 14.39 ? 346  GLN A CA    1 
ATOM   2752 C  C     . GLN A 1 349 ? 34.258 15.408  -9.946  1.00 16.08 ? 346  GLN A C     1 
ATOM   2753 O  O     . GLN A 1 349 ? 35.106 15.731  -10.778 1.00 19.03 ? 346  GLN A O     1 
ATOM   2754 C  CB    . GLN A 1 349 ? 32.301 16.949  -9.579  1.00 22.19 ? 346  GLN A CB    1 
ATOM   2755 C  CG    . GLN A 1 349 ? 30.999 17.464  -10.198 1.00 24.76 ? 346  GLN A CG    1 
ATOM   2756 C  CD    . GLN A 1 349 ? 30.508 18.758  -9.563  1.00 34.88 ? 346  GLN A CD    1 
ATOM   2757 O  OE1   . GLN A 1 349 ? 31.134 19.295  -8.653  1.00 38.02 ? 346  GLN A OE1   1 
ATOM   2758 N  NE2   . GLN A 1 349 ? 29.378 19.258  -10.045 1.00 41.80 ? 346  GLN A NE2   1 
ATOM   2759 N  N     . GLU A 1 350 ? 34.578 14.827  -8.791  1.00 16.38 ? 347  GLU A N     1 
ATOM   2760 C  CA    . GLU A 1 350 ? 35.968 14.442  -8.544  1.00 17.67 ? 347  GLU A CA    1 
ATOM   2761 C  C     . GLU A 1 350 ? 36.385 13.331  -9.506  1.00 15.95 ? 347  GLU A C     1 
ATOM   2762 O  O     . GLU A 1 350 ? 37.511 13.330  -9.996  1.00 16.80 ? 347  GLU A O     1 
ATOM   2763 C  CB    . GLU A 1 350 ? 36.201 13.989  -7.100  1.00 17.00 ? 347  GLU A CB    1 
ATOM   2764 C  CG    . GLU A 1 350 ? 37.651 13.495  -6.881  1.00 17.97 ? 347  GLU A CG    1 
ATOM   2765 C  CD    . GLU A 1 350 ? 37.923 12.938  -5.491  1.00 24.81 ? 347  GLU A CD    1 
ATOM   2766 O  OE1   . GLU A 1 350 ? 37.276 13.371  -4.515  1.00 22.69 ? 347  GLU A OE1   1 
ATOM   2767 O  OE2   . GLU A 1 350 ? 38.797 12.051  -5.371  1.00 18.69 ? 347  GLU A OE2   1 
ATOM   2768 N  N     . LEU A 1 351 ? 35.484 12.388  -9.763  1.00 13.32 ? 348  LEU A N     1 
ATOM   2769 C  CA    . LEU A 1 351 ? 35.792 11.267  -10.646 1.00 15.94 ? 348  LEU A CA    1 
ATOM   2770 C  C     . LEU A 1 351 ? 36.080 11.762  -12.059 1.00 18.33 ? 348  LEU A C     1 
ATOM   2771 O  O     . LEU A 1 351 ? 37.063 11.346  -12.684 1.00 19.77 ? 348  LEU A O     1 
ATOM   2772 C  CB    . LEU A 1 351 ? 34.648 10.252  -10.645 1.00 16.35 ? 348  LEU A CB    1 
ATOM   2773 C  CG    . LEU A 1 351 ? 34.925 8.893   -11.306 1.00 22.02 ? 348  LEU A CG    1 
ATOM   2774 C  CD1   . LEU A 1 351 ? 36.175 8.237   -10.706 1.00 24.83 ? 348  LEU A CD1   1 
ATOM   2775 C  CD2   . LEU A 1 351 ? 33.721 7.951   -11.198 1.00 19.76 ? 348  LEU A CD2   1 
ATOM   2776 N  N     . GLU A 1 352 ? 35.247 12.673  -12.559 1.00 16.91 ? 349  GLU A N     1 
ATOM   2777 C  CA    . GLU A 1 352 ? 35.494 13.252  -13.878 1.00 16.00 ? 349  GLU A CA    1 
ATOM   2778 C  C     . GLU A 1 352 ? 36.863 13.924  -13.960 1.00 17.28 ? 349  GLU A C     1 
ATOM   2779 O  O     . GLU A 1 352 ? 37.587 13.779  -14.952 1.00 18.82 ? 349  GLU A O     1 
ATOM   2780 C  CB    . GLU A 1 352 ? 34.411 14.276  -14.248 1.00 19.04 ? 349  GLU A CB    1 
ATOM   2781 C  CG    . GLU A 1 352 ? 34.649 14.881  -15.634 1.00 24.80 ? 349  GLU A CG    1 
ATOM   2782 C  CD    . GLU A 1 352 ? 33.667 15.986  -15.981 1.00 43.51 ? 349  GLU A CD    1 
ATOM   2783 O  OE1   . GLU A 1 352 ? 34.018 16.838  -16.828 1.00 40.54 ? 349  GLU A OE1   1 
ATOM   2784 O  OE2   . GLU A 1 352 ? 32.547 16.000  -15.417 1.00 30.31 ? 349  GLU A OE2   1 
ATOM   2785 N  N     . GLU A 1 353 ? 37.217 14.660  -12.912 1.00 18.11 ? 350  GLU A N     1 
ATOM   2786 C  CA    . GLU A 1 353 ? 38.476 15.377  -12.896 1.00 14.77 ? 350  GLU A CA    1 
ATOM   2787 C  C     . GLU A 1 353 ? 39.635 14.379  -12.953 1.00 16.76 ? 350  GLU A C     1 
ATOM   2788 O  O     . GLU A 1 353 ? 40.593 14.569  -13.699 1.00 18.67 ? 350  GLU A O     1 
ATOM   2789 C  CB    . GLU A 1 353 ? 38.586 16.264  -11.652 1.00 21.55 ? 350  GLU A CB    1 
ATOM   2790 C  CG    . GLU A 1 353 ? 39.839 17.124  -11.624 1.00 28.49 ? 350  GLU A CG    1 
ATOM   2791 C  CD    . GLU A 1 353 ? 39.918 18.000  -10.383 1.00 40.82 ? 350  GLU A CD    1 
ATOM   2792 O  OE1   . GLU A 1 353 ? 38.898 18.110  -9.669  1.00 44.79 ? 350  GLU A OE1   1 
ATOM   2793 O  OE2   . GLU A 1 353 ? 40.998 18.573  -10.122 1.00 50.67 ? 350  GLU A OE2   1 
ATOM   2794 N  N     . ARG A 1 354 ? 39.522 13.292  -12.201 1.00 18.72 ? 351  ARG A N     1 
ATOM   2795 C  CA    . ARG A 1 354 ? 40.605 12.319  -12.191 1.00 19.91 ? 351  ARG A CA    1 
ATOM   2796 C  C     . ARG A 1 354 ? 40.648 11.537  -13.491 1.00 19.67 ? 351  ARG A C     1 
ATOM   2797 O  O     . ARG A 1 354 ? 41.732 11.243  -13.999 1.00 20.17 ? 351  ARG A O     1 
ATOM   2798 C  CB    . ARG A 1 354 ? 40.468 11.380  -10.995 1.00 18.31 ? 351  ARG A CB    1 
ATOM   2799 C  CG    A ARG A 1 354 ? 40.905 12.079  -9.703  0.69 20.19 ? 351  ARG A CG    1 
ATOM   2800 C  CG    B ARG A 1 354 ? 40.738 12.008  -9.639  0.31 20.20 ? 351  ARG A CG    1 
ATOM   2801 C  CD    A ARG A 1 354 ? 40.383 11.385  -8.469  0.69 18.53 ? 351  ARG A CD    1 
ATOM   2802 C  CD    B ARG A 1 354 ? 40.669 10.940  -8.558  0.31 17.66 ? 351  ARG A CD    1 
ATOM   2803 N  NE    A ARG A 1 354 ? 40.960 10.059  -8.336  0.69 14.54 ? 351  ARG A NE    1 
ATOM   2804 N  NE    B ARG A 1 354 ? 41.671 9.902   -8.777  0.31 15.38 ? 351  ARG A NE    1 
ATOM   2805 C  CZ    A ARG A 1 354 ? 40.549 9.143   -7.468  0.69 17.58 ? 351  ARG A CZ    1 
ATOM   2806 C  CZ    B ARG A 1 354 ? 41.575 8.655   -8.328  0.31 16.28 ? 351  ARG A CZ    1 
ATOM   2807 N  NH1   A ARG A 1 354 ? 39.556 9.408   -6.614  0.69 14.60 ? 351  ARG A NH1   1 
ATOM   2808 N  NH1   B ARG A 1 354 ? 40.506 8.269   -7.648  0.31 16.42 ? 351  ARG A NH1   1 
ATOM   2809 N  NH2   A ARG A 1 354 ? 41.155 7.961   -7.448  0.69 12.47 ? 351  ARG A NH2   1 
ATOM   2810 N  NH2   B ARG A 1 354 ? 42.545 7.789   -8.583  0.31 18.70 ? 351  ARG A NH2   1 
ATOM   2811 N  N     . LEU A 1 355 ? 39.475 11.223  -14.042 1.00 16.89 ? 352  LEU A N     1 
ATOM   2812 C  CA    . LEU A 1 355 ? 39.407 10.480  -15.290 1.00 17.15 ? 352  LEU A CA    1 
ATOM   2813 C  C     . LEU A 1 355 ? 39.984 11.272  -16.469 1.00 19.35 ? 352  LEU A C     1 
ATOM   2814 O  O     . LEU A 1 355 ? 40.706 10.721  -17.314 1.00 19.00 ? 352  LEU A O     1 
ATOM   2815 C  CB    . LEU A 1 355 ? 37.965 10.074  -15.586 1.00 17.74 ? 352  LEU A CB    1 
ATOM   2816 C  CG    . LEU A 1 355 ? 37.403 8.885   -14.811 1.00 20.02 ? 352  LEU A CG    1 
ATOM   2817 C  CD1   . LEU A 1 355 ? 35.926 8.709   -15.138 1.00 22.10 ? 352  LEU A CD1   1 
ATOM   2818 C  CD2   . LEU A 1 355 ? 38.178 7.613   -15.162 1.00 18.19 ? 352  LEU A CD2   1 
ATOM   2819 N  N     . THR A 1 356 ? 39.662 12.561  -16.533 1.00 17.88 ? 353  THR A N     1 
ATOM   2820 C  CA    . THR A 1 356 ? 40.142 13.392  -17.625 1.00 18.06 ? 353  THR A CA    1 
ATOM   2821 C  C     . THR A 1 356 ? 41.665 13.511  -17.583 1.00 21.85 ? 353  THR A C     1 
ATOM   2822 O  O     . THR A 1 356 ? 42.332 13.410  -18.614 1.00 23.03 ? 353  THR A O     1 
ATOM   2823 C  CB    . THR A 1 356 ? 39.480 14.787  -17.595 1.00 17.92 ? 353  THR A CB    1 
ATOM   2824 O  OG1   . THR A 1 356 ? 38.063 14.618  -17.723 1.00 20.94 ? 353  THR A OG1   1 
ATOM   2825 C  CG2   . THR A 1 356 ? 39.981 15.640  -18.732 1.00 23.23 ? 353  THR A CG2   1 
ATOM   2826 N  N     . LYS A 1 357 ? 42.216 13.706  -16.388 1.00 18.99 ? 354  LYS A N     1 
ATOM   2827 C  CA    . LYS A 1 357 ? 43.664 13.725  -16.222 1.00 17.24 ? 354  LYS A CA    1 
ATOM   2828 C  C     . LYS A 1 357 ? 44.266 12.385  -16.646 1.00 19.97 ? 354  LYS A C     1 
ATOM   2829 O  O     . LYS A 1 357 ? 45.276 12.330  -17.360 1.00 21.92 ? 354  LYS A O     1 
ATOM   2830 C  CB    . LYS A 1 357 ? 44.036 14.036  -14.770 1.00 19.03 ? 354  LYS A CB    1 
ATOM   2831 C  CG    . LYS A 1 357 ? 45.537 14.045  -14.489 1.00 30.19 ? 354  LYS A CG    1 
ATOM   2832 C  CD    . LYS A 1 357 ? 46.239 15.209  -15.185 1.00 35.84 ? 354  LYS A CD    1 
ATOM   2833 C  CE    . LYS A 1 357 ? 47.415 15.727  -14.360 1.00 40.15 ? 354  LYS A CE    1 
ATOM   2834 N  NZ    . LYS A 1 357 ? 48.277 14.620  -13.871 1.00 39.29 ? 354  LYS A NZ    1 
ATOM   2835 N  N     . ASP A 1 358 ? 43.630 11.302  -16.222 1.00 18.70 ? 355  ASP A N     1 
ATOM   2836 C  CA    . ASP A 1 358 ? 44.133 9.966   -16.529 1.00 19.26 ? 355  ASP A CA    1 
ATOM   2837 C  C     . ASP A 1 358 ? 44.191 9.758   -18.033 1.00 18.27 ? 355  ASP A C     1 
ATOM   2838 O  O     . ASP A 1 358 ? 45.182 9.245   -18.557 1.00 22.12 ? 355  ASP A O     1 
ATOM   2839 C  CB    . ASP A 1 358 ? 43.253 8.894   -15.877 1.00 19.45 ? 355  ASP A CB    1 
ATOM   2840 C  CG    . ASP A 1 358 ? 43.781 7.496   -16.107 1.00 23.51 ? 355  ASP A CG    1 
ATOM   2841 O  OD1   . ASP A 1 358 ? 44.770 7.121   -15.429 1.00 19.51 ? 355  ASP A OD1   1 
ATOM   2842 O  OD2   . ASP A 1 358 ? 43.220 6.785   -16.973 1.00 21.68 ? 355  ASP A OD2   1 
ATOM   2843 N  N     . ARG A 1 359 ? 43.141 10.191  -18.726 1.00 17.75 ? 356  ARG A N     1 
ATOM   2844 C  CA    . ARG A 1 359 ? 43.065 10.018  -20.171 1.00 19.70 ? 356  ARG A CA    1 
ATOM   2845 C  C     . ARG A 1 359 ? 44.188 10.767  -20.892 1.00 21.63 ? 356  ARG A C     1 
ATOM   2846 O  O     . ARG A 1 359 ? 44.779 10.245  -21.835 1.00 22.46 ? 356  ARG A O     1 
ATOM   2847 C  CB    . ARG A 1 359 ? 41.703 10.484  -20.689 1.00 21.35 ? 356  ARG A CB    1 
ATOM   2848 C  CG    . ARG A 1 359 ? 41.418 10.086  -22.137 1.00 26.07 ? 356  ARG A CG    1 
ATOM   2849 C  CD    . ARG A 1 359 ? 40.035 10.558  -22.564 1.00 17.89 ? 356  ARG A CD    1 
ATOM   2850 N  NE    . ARG A 1 359 ? 39.914 12.011  -22.476 1.00 30.15 ? 356  ARG A NE    1 
ATOM   2851 C  CZ    . ARG A 1 359 ? 38.768 12.663  -22.295 1.00 30.84 ? 356  ARG A CZ    1 
ATOM   2852 N  NH1   . ARG A 1 359 ? 37.626 11.994  -22.179 1.00 31.95 ? 356  ARG A NH1   1 
ATOM   2853 N  NH2   . ARG A 1 359 ? 38.767 13.990  -22.227 1.00 29.62 ? 356  ARG A NH2   1 
ATOM   2854 N  N     . ASN A 1 360 ? 44.496 11.982  -20.435 1.00 18.01 ? 357  ASN A N     1 
ATOM   2855 C  CA    . ASN A 1 360 ? 45.563 12.776  -21.041 1.00 17.76 ? 357  ASN A CA    1 
ATOM   2856 C  C     . ASN A 1 360 ? 46.944 12.198  -20.743 1.00 25.51 ? 357  ASN A C     1 
ATOM   2857 O  O     . ASN A 1 360 ? 47.816 12.149  -21.613 1.00 27.95 ? 357  ASN A O     1 
ATOM   2858 C  CB    . ASN A 1 360 ? 45.518 14.215  -20.539 1.00 23.18 ? 357  ASN A CB    1 
ATOM   2859 C  CG    . ASN A 1 360 ? 44.333 14.985  -21.068 1.00 24.51 ? 357  ASN A CG    1 
ATOM   2860 O  OD1   . ASN A 1 360 ? 43.747 14.635  -22.090 1.00 32.33 ? 357  ASN A OD1   1 
ATOM   2861 N  ND2   . ASN A 1 360 ? 43.982 16.058  -20.374 1.00 20.03 ? 357  ASN A ND2   1 
ATOM   2862 N  N     . ASP A 1 361 ? 47.132 11.776  -19.494 1.00 21.80 ? 358  ASP A N     1 
ATOM   2863 C  CA    . ASP A 1 361 ? 48.419 11.281  -19.023 1.00 28.33 ? 358  ASP A CA    1 
ATOM   2864 C  C     . ASP A 1 361 ? 48.754 9.891   -19.545 1.00 25.09 ? 358  ASP A C     1 
ATOM   2865 O  O     . ASP A 1 361 ? 49.910 9.604   -19.859 1.00 20.69 ? 358  ASP A O     1 
ATOM   2866 C  CB    . ASP A 1 361 ? 48.453 11.248  -17.486 1.00 22.74 ? 358  ASP A CB    1 
ATOM   2867 C  CG    . ASP A 1 361 ? 48.650 12.622  -16.875 1.00 35.42 ? 358  ASP A CG    1 
ATOM   2868 O  OD1   . ASP A 1 361 ? 48.870 13.592  -17.637 1.00 29.72 ? 358  ASP A OD1   1 
ATOM   2869 O  OD2   . ASP A 1 361 ? 48.594 12.723  -15.628 1.00 31.73 ? 358  ASP A OD2   1 
ATOM   2870 N  N     . ASN A 1 362 ? 47.750 9.029   -19.627 1.00 20.95 ? 359  ASN A N     1 
ATOM   2871 C  CA    . ASN A 1 362 ? 48.009 7.598   -19.777 1.00 17.49 ? 359  ASN A CA    1 
ATOM   2872 C  C     . ASN A 1 362 ? 47.355 6.953   -20.988 1.00 22.30 ? 359  ASN A C     1 
ATOM   2873 O  O     . ASN A 1 362 ? 47.374 5.735   -21.104 1.00 23.50 ? 359  ASN A O     1 
ATOM   2874 C  CB    . ASN A 1 362 ? 47.570 6.857   -18.507 1.00 19.31 ? 359  ASN A CB    1 
ATOM   2875 C  CG    . ASN A 1 362 ? 48.338 7.319   -17.268 1.00 25.03 ? 359  ASN A CG    1 
ATOM   2876 O  OD1   . ASN A 1 362 ? 49.553 7.517   -17.315 1.00 19.69 ? 359  ASN A OD1   1 
ATOM   2877 N  ND2   . ASN A 1 362 ? 47.629 7.484   -16.155 1.00 22.45 ? 359  ASN A ND2   1 
ATOM   2878 N  N     . ASP A 1 363 ? 46.781 7.759   -21.881 1.00 21.88 ? 360  ASP A N     1 
ATOM   2879 C  CA    . ASP A 1 363 ? 46.259 7.250   -23.156 1.00 23.41 ? 360  ASP A CA    1 
ATOM   2880 C  C     . ASP A 1 363 ? 45.330 6.070   -22.989 1.00 23.71 ? 360  ASP A C     1 
ATOM   2881 O  O     . ASP A 1 363 ? 45.546 5.012   -23.581 1.00 24.06 ? 360  ASP A O     1 
ATOM   2882 C  CB    . ASP A 1 363 ? 47.403 6.838   -24.085 1.00 30.74 ? 360  ASP A CB    1 
ATOM   2883 C  CG    . ASP A 1 363 ? 48.330 7.983   -24.404 1.00 35.74 ? 360  ASP A CG    1 
ATOM   2884 O  OD1   . ASP A 1 363 ? 47.828 9.078   -24.752 1.00 30.24 ? 360  ASP A OD1   1 
ATOM   2885 O  OD2   . ASP A 1 363 ? 49.561 7.787   -24.291 1.00 30.70 ? 360  ASP A OD2   1 
ATOM   2886 N  N     . ARG A 1 364 ? 44.308 6.238   -22.162 1.00 22.47 ? 361  ARG A N     1 
ATOM   2887 C  CA    . ARG A 1 364 ? 43.321 5.189   -21.963 1.00 24.76 ? 361  ARG A CA    1 
ATOM   2888 C  C     . ARG A 1 364 ? 41.994 5.813   -21.562 1.00 27.04 ? 361  ARG A C     1 
ATOM   2889 O  O     . ARG A 1 364 ? 41.948 6.970   -21.136 1.00 22.79 ? 361  ARG A O     1 
ATOM   2890 C  CB    . ARG A 1 364 ? 43.793 4.187   -20.905 1.00 26.95 ? 361  ARG A CB    1 
ATOM   2891 C  CG    . ARG A 1 364 ? 44.169 4.831   -19.565 1.00 23.36 ? 361  ARG A CG    1 
ATOM   2892 C  CD    . ARG A 1 364 ? 44.560 3.774   -18.534 1.00 19.18 ? 361  ARG A CD    1 
ATOM   2893 N  NE    . ARG A 1 364 ? 44.599 4.321   -17.182 1.00 21.07 ? 361  ARG A NE    1 
ATOM   2894 C  CZ    . ARG A 1 364 ? 44.905 3.619   -16.095 1.00 23.84 ? 361  ARG A CZ    1 
ATOM   2895 N  NH1   . ARG A 1 364 ? 44.915 4.210   -14.902 1.00 20.18 ? 361  ARG A NH1   1 
ATOM   2896 N  NH2   . ARG A 1 364 ? 45.224 2.340   -16.200 1.00 17.21 ? 361  ARG A NH2   1 
ATOM   2897 N  N     . VAL A 1 365 ? 40.921 5.049   -21.721 1.00 26.88 ? 362  VAL A N     1 
ATOM   2898 C  CA    . VAL A 1 365 ? 39.581 5.489   -21.350 1.00 26.03 ? 362  VAL A CA    1 
ATOM   2899 C  C     . VAL A 1 365 ? 38.843 4.401   -20.590 1.00 24.13 ? 362  VAL A C     1 
ATOM   2900 O  O     . VAL A 1 365 ? 38.849 3.240   -20.989 1.00 23.50 ? 362  VAL A O     1 
ATOM   2901 C  CB    . VAL A 1 365 ? 38.752 5.878   -22.589 1.00 28.95 ? 362  VAL A CB    1 
ATOM   2902 C  CG1   . VAL A 1 365 ? 39.227 7.200   -23.145 1.00 33.21 ? 362  VAL A CG1   1 
ATOM   2903 C  CG2   . VAL A 1 365 ? 38.845 4.793   -23.656 1.00 32.40 ? 362  VAL A CG2   1 
ATOM   2904 N  N     . ALA A 1 366 ? 38.214 4.775   -19.483 1.00 19.22 ? 363  ALA A N     1 
ATOM   2905 C  CA    . ALA A 1 366 ? 37.405 3.841   -18.721 1.00 24.26 ? 363  ALA A CA    1 
ATOM   2906 C  C     . ALA A 1 366 ? 36.075 3.608   -19.446 1.00 25.92 ? 363  ALA A C     1 
ATOM   2907 O  O     . ALA A 1 366 ? 35.532 4.522   -20.068 1.00 27.59 ? 363  ALA A O     1 
ATOM   2908 C  CB    . ALA A 1 366 ? 37.179 4.373   -17.311 1.00 16.08 ? 363  ALA A CB    1 
ATOM   2909 N  N     . THR A 1 367 ? 35.553 2.389   -19.380 1.00 23.08 ? 364  THR A N     1 
ATOM   2910 C  CA    . THR A 1 367 ? 34.337 2.060   -20.117 1.00 21.95 ? 364  THR A CA    1 
ATOM   2911 C  C     . THR A 1 367 ? 33.171 1.573   -19.252 1.00 24.84 ? 364  THR A C     1 
ATOM   2912 O  O     . THR A 1 367 ? 32.055 1.392   -19.744 1.00 23.81 ? 364  THR A O     1 
ATOM   2913 C  CB    . THR A 1 367 ? 34.625 0.981   -21.188 1.00 22.29 ? 364  THR A CB    1 
ATOM   2914 O  OG1   . THR A 1 367 ? 34.983 -0.250  -20.550 1.00 24.80 ? 364  THR A OG1   1 
ATOM   2915 C  CG2   . THR A 1 367 ? 35.758 1.433   -22.091 1.00 27.06 ? 364  THR A CG2   1 
ATOM   2916 N  N     . GLN A 1 368 ? 33.422 1.334   -17.971 1.00 22.91 ? 365  GLN A N     1 
ATOM   2917 C  CA    . GLN A 1 368 ? 32.361 0.864   -17.087 1.00 23.11 ? 365  GLN A CA    1 
ATOM   2918 C  C     . GLN A 1 368 ? 32.335 1.699   -15.818 1.00 26.11 ? 365  GLN A C     1 
ATOM   2919 O  O     . GLN A 1 368 ? 33.381 2.056   -15.284 1.00 24.68 ? 365  GLN A O     1 
ATOM   2920 C  CB    . GLN A 1 368 ? 32.548 -0.613  -16.736 1.00 25.75 ? 365  GLN A CB    1 
ATOM   2921 C  CG    . GLN A 1 368 ? 31.377 -1.214  -15.967 1.00 24.41 ? 365  GLN A CG    1 
ATOM   2922 C  CD    . GLN A 1 368 ? 31.585 -2.679  -15.617 1.00 27.27 ? 365  GLN A CD    1 
ATOM   2923 O  OE1   . GLN A 1 368 ? 32.403 -3.011  -14.761 1.00 41.59 ? 365  GLN A OE1   1 
ATOM   2924 N  NE2   . GLN A 1 368 ? 30.846 -3.561  -16.277 1.00 31.20 ? 365  GLN A NE2   1 
ATOM   2925 N  N     . LEU A 1 369 ? 31.132 2.025   -15.355 1.00 21.12 ? 366  LEU A N     1 
ATOM   2926 C  CA    . LEU A 1 369 ? 30.965 2.754   -14.098 1.00 20.80 ? 366  LEU A CA    1 
ATOM   2927 C  C     . LEU A 1 369 ? 30.305 1.835   -13.085 1.00 23.05 ? 366  LEU A C     1 
ATOM   2928 O  O     . LEU A 1 369 ? 29.229 1.293   -13.332 1.00 25.01 ? 366  LEU A O     1 
ATOM   2929 C  CB    . LEU A 1 369 ? 30.126 4.021   -14.296 1.00 20.73 ? 366  LEU A CB    1 
ATOM   2930 C  CG    . LEU A 1 369 ? 29.924 4.895   -13.053 1.00 23.20 ? 366  LEU A CG    1 
ATOM   2931 C  CD1   . LEU A 1 369 ? 31.210 5.636   -12.697 1.00 26.83 ? 366  LEU A CD1   1 
ATOM   2932 C  CD2   . LEU A 1 369 ? 28.772 5.869   -13.262 1.00 29.82 ? 366  LEU A CD2   1 
ATOM   2933 N  N     . VAL A 1 370 ? 30.969 1.650   -11.950 1.00 19.37 ? 367  VAL A N     1 
ATOM   2934 C  CA    . VAL A 1 370 ? 30.467 0.788   -10.909 1.00 20.45 ? 367  VAL A CA    1 
ATOM   2935 C  C     . VAL A 1 370 ? 29.921 1.640   -9.767  1.00 21.77 ? 367  VAL A C     1 
ATOM   2936 O  O     . VAL A 1 370 ? 30.615 2.542   -9.283  1.00 27.21 ? 367  VAL A O     1 
ATOM   2937 C  CB    . VAL A 1 370 ? 31.577 -0.139  -10.399 1.00 26.79 ? 367  VAL A CB    1 
ATOM   2938 C  CG1   . VAL A 1 370 ? 31.120 -0.873  -9.162  1.00 26.80 ? 367  VAL A CG1   1 
ATOM   2939 C  CG2   . VAL A 1 370 ? 31.997 -1.101  -11.506 1.00 26.97 ? 367  VAL A CG2   1 
ATOM   2940 N  N     . VAL A 1 371 ? 28.681 1.381   -9.357  1.00 18.99 ? 368  VAL A N     1 
ATOM   2941 C  CA    . VAL A 1 371 ? 28.064 2.158   -8.284  1.00 18.57 ? 368  VAL A CA    1 
ATOM   2942 C  C     . VAL A 1 371 ? 27.775 1.276   -7.087  1.00 25.87 ? 368  VAL A C     1 
ATOM   2943 O  O     . VAL A 1 371 ? 27.171 0.214   -7.217  1.00 24.06 ? 368  VAL A O     1 
ATOM   2944 C  CB    . VAL A 1 371 ? 26.765 2.848   -8.757  1.00 25.93 ? 368  VAL A CB    1 
ATOM   2945 C  CG1   . VAL A 1 371 ? 26.227 3.792   -7.676  1.00 25.04 ? 368  VAL A CG1   1 
ATOM   2946 C  CG2   . VAL A 1 371 ? 27.023 3.607   -10.050 1.00 20.42 ? 368  VAL A CG2   1 
ATOM   2947 N  N     . SER A 1 372 ? 28.234 1.709   -5.916  1.00 20.65 ? 369  SER A N     1 
ATOM   2948 C  CA    . SER A 1 372 ? 28.069 0.928   -4.707  1.00 25.22 ? 369  SER A CA    1 
ATOM   2949 C  C     . SER A 1 372 ? 27.512 1.788   -3.587  1.00 19.48 ? 369  SER A C     1 
ATOM   2950 O  O     . SER A 1 372 ? 27.836 2.975   -3.486  1.00 25.94 ? 369  SER A O     1 
ATOM   2951 C  CB    . SER A 1 372 ? 29.403 0.312   -4.286  1.00 28.10 ? 369  SER A CB    1 
ATOM   2952 O  OG    . SER A 1 372 ? 29.256 -0.480  -3.123  1.00 35.64 ? 369  SER A OG    1 
ATOM   2953 N  N     . ILE A 1 373 ? 26.658 1.198   -2.760  1.00 24.07 ? 370  ILE A N     1 
ATOM   2954 C  CA    . ILE A 1 373 ? 26.128 1.905   -1.603  1.00 22.04 ? 370  ILE A CA    1 
ATOM   2955 C  C     . ILE A 1 373 ? 26.122 0.993   -0.375  1.00 26.75 ? 370  ILE A C     1 
ATOM   2956 O  O     . ILE A 1 373 ? 26.259 -0.228  -0.479  1.00 25.43 ? 370  ILE A O     1 
ATOM   2957 C  CB    . ILE A 1 373 ? 24.687 2.457   -1.846  1.00 26.87 ? 370  ILE A CB    1 
ATOM   2958 C  CG1   . ILE A 1 373 ? 23.668 1.324   -1.997  1.00 28.40 ? 370  ILE A CG1   1 
ATOM   2959 C  CG2   . ILE A 1 373 ? 24.638 3.449   -3.032  1.00 20.12 ? 370  ILE A CG2   1 
ATOM   2960 C  CD1   . ILE A 1 373 ? 22.261 1.836   -2.258  1.00 28.83 ? 370  ILE A CD1   1 
ATOM   2961 N  N     . ARG A 1 374 ? 25.992 1.603   0.797   1.00 27.01 ? 371  ARG A N     1 
ATOM   2962 C  CA    . ARG A 1 374 ? 25.779 0.851   2.021   1.00 30.75 ? 371  ARG A CA    1 
ATOM   2963 C  C     . ARG A 1 374 ? 24.532 1.411   2.682   1.00 34.68 ? 371  ARG A C     1 
ATOM   2964 O  O     . ARG A 1 374 ? 24.282 2.613   2.616   1.00 24.41 ? 371  ARG A O     1 
ATOM   2965 C  CB    . ARG A 1 374 ? 26.985 0.942   2.950   1.00 32.83 ? 371  ARG A CB    1 
ATOM   2966 C  CG    . ARG A 1 374 ? 26.926 -0.008  4.128   1.00 36.65 ? 371  ARG A CG    1 
ATOM   2967 C  CD    . ARG A 1 374 ? 28.089 0.216   5.062   1.00 39.40 ? 371  ARG A CD    1 
ATOM   2968 N  NE    . ARG A 1 374 ? 28.033 -0.657  6.229   1.00 51.19 ? 371  ARG A NE    1 
ATOM   2969 C  CZ    . ARG A 1 374 ? 28.763 -0.479  7.325   1.00 53.94 ? 371  ARG A CZ    1 
ATOM   2970 N  NH1   . ARG A 1 374 ? 29.601 0.546   7.404   1.00 53.90 ? 371  ARG A NH1   1 
ATOM   2971 N  NH2   . ARG A 1 374 ? 28.650 -1.322  8.343   1.00 62.62 ? 371  ARG A NH2   1 
ATOM   2972 N  N     . VAL A 1 375 ? 23.732 0.535   3.283   1.00 29.54 ? 372  VAL A N     1 
ATOM   2973 C  CA    . VAL A 1 375 ? 22.507 0.964   3.946   1.00 36.96 ? 372  VAL A CA    1 
ATOM   2974 C  C     . VAL A 1 375 ? 22.683 0.895   5.452   1.00 29.10 ? 372  VAL A C     1 
ATOM   2975 O  O     . VAL A 1 375 ? 23.411 0.041   5.962   1.00 31.41 ? 372  VAL A O     1 
ATOM   2976 C  CB    . VAL A 1 375 ? 21.300 0.106   3.527   1.00 42.29 ? 372  VAL A CB    1 
ATOM   2977 C  CG1   . VAL A 1 375 ? 20.906 0.412   2.089   1.00 41.33 ? 372  VAL A CG1   1 
ATOM   2978 C  CG2   . VAL A 1 375 ? 21.614 -1.367  3.706   1.00 44.69 ? 372  VAL A CG2   1 
ATOM   2979 N  N     . GLN A 1 376 ? 22.028 1.808   6.161   1.00 39.49 ? 373  GLN A N     1 
ATOM   2980 C  CA    . GLN A 1 376 ? 22.133 1.852   7.612   1.00 38.89 ? 373  GLN A CA    1 
ATOM   2981 C  C     . GLN A 1 376 ? 21.685 0.532   8.222   1.00 42.89 ? 373  GLN A C     1 
ATOM   2982 O  O     . GLN A 1 376 ? 20.564 0.088   8.000   1.00 52.22 ? 373  GLN A O     1 
ATOM   2983 C  CB    . GLN A 1 376 ? 21.306 3.008   8.169   1.00 42.61 ? 373  GLN A CB    1 
ATOM   2984 C  CG    . GLN A 1 376 ? 21.755 3.489   9.539   1.00 49.34 ? 373  GLN A CG    1 
ATOM   2985 C  CD    . GLN A 1 376 ? 21.239 4.879   9.854   1.00 41.55 ? 373  GLN A CD    1 
ATOM   2986 O  OE1   . GLN A 1 376 ? 20.044 5.149   9.736   1.00 43.93 ? 373  GLN A OE1   1 
ATOM   2987 N  NE2   . GLN A 1 376 ? 22.146 5.778   10.233  1.00 50.74 ? 373  GLN A NE2   1 
ATOM   2988 N  N     . GLY A 1 377 ? 22.573 -0.101  8.977   1.00 46.26 ? 374  GLY A N     1 
ATOM   2989 C  CA    . GLY A 1 377 ? 22.245 -1.358  9.624   1.00 54.90 ? 374  GLY A CA    1 
ATOM   2990 C  C     . GLY A 1 377 ? 23.079 -2.529  9.135   1.00 60.66 ? 374  GLY A C     1 
ATOM   2991 O  O     . GLY A 1 377 ? 23.346 -3.467  9.890   1.00 55.57 ? 374  GLY A O     1 
ATOM   2992 N  N     . ASP A 1 378 ? 23.494 -2.472  7.872   1.00 50.74 ? 375  ASP A N     1 
ATOM   2993 C  CA    . ASP A 1 378 ? 24.251 -3.558  7.261   1.00 49.92 ? 375  ASP A CA    1 
ATOM   2994 C  C     . ASP A 1 378 ? 25.654 -3.677  7.858   1.00 60.48 ? 375  ASP A C     1 
ATOM   2995 O  O     . ASP A 1 378 ? 26.399 -2.697  7.925   1.00 59.06 ? 375  ASP A O     1 
ATOM   2996 C  CB    . ASP A 1 378 ? 24.335 -3.355  5.746   1.00 49.26 ? 375  ASP A CB    1 
ATOM   2997 C  CG    . ASP A 1 378 ? 24.738 -4.619  5.006   1.00 51.89 ? 375  ASP A CG    1 
ATOM   2998 O  OD1   . ASP A 1 378 ? 25.581 -5.383  5.524   1.00 49.38 ? 375  ASP A OD1   1 
ATOM   2999 O  OD2   . ASP A 1 378 ? 24.200 -4.847  3.901   1.00 49.46 ? 375  ASP A OD2   1 
ATOM   3000 N  N     . LYS A 1 379 ? 26.007 -4.887  8.283   1.00 64.16 ? 376  LYS A N     1 
ATOM   3001 C  CA    . LYS A 1 379 ? 27.330 -5.150  8.838   1.00 71.30 ? 376  LYS A CA    1 
ATOM   3002 C  C     . LYS A 1 379 ? 28.403 -5.002  7.766   1.00 69.65 ? 376  LYS A C     1 
ATOM   3003 O  O     . LYS A 1 379 ? 29.522 -4.566  8.044   1.00 71.53 ? 376  LYS A O     1 
ATOM   3004 C  CB    . LYS A 1 379 ? 27.390 -6.553  9.448   1.00 70.67 ? 376  LYS A CB    1 
ATOM   3005 C  CG    . LYS A 1 379 ? 28.715 -6.886  10.123  1.00 75.73 ? 376  LYS A CG    1 
ATOM   3006 C  CD    . LYS A 1 379 ? 28.737 -6.435  11.578  1.00 78.92 ? 376  LYS A CD    1 
ATOM   3007 C  CE    . LYS A 1 379 ? 30.091 -6.710  12.220  1.00 74.79 ? 376  LYS A CE    1 
ATOM   3008 N  NZ    . LYS A 1 379 ? 30.552 -8.112  11.993  1.00 64.69 ? 376  LYS A NZ    1 
ATOM   3009 N  N     . ARG A 1 380 ? 28.047 -5.365  6.538   1.00 62.31 ? 377  ARG A N     1 
ATOM   3010 C  CA    . ARG A 1 380 ? 28.981 -5.336  5.418   1.00 63.43 ? 377  ARG A CA    1 
ATOM   3011 C  C     . ARG A 1 380 ? 29.342 -3.917  5.004   1.00 59.83 ? 377  ARG A C     1 
ATOM   3012 O  O     . ARG A 1 380 ? 28.548 -2.988  5.167   1.00 60.80 ? 377  ARG A O     1 
ATOM   3013 C  CB    . ARG A 1 380 ? 28.393 -6.084  4.225   1.00 59.82 ? 377  ARG A CB    1 
ATOM   3014 C  CG    . ARG A 1 380 ? 27.897 -7.470  4.570   1.00 59.09 ? 377  ARG A CG    1 
ATOM   3015 C  CD    . ARG A 1 380 ? 27.123 -8.055  3.420   1.00 50.99 ? 377  ARG A CD    1 
ATOM   3016 N  NE    . ARG A 1 380 ? 25.884 -7.330  3.163   1.00 41.51 ? 377  ARG A NE    1 
ATOM   3017 C  CZ    . ARG A 1 380 ? 25.100 -7.581  2.121   1.00 45.45 ? 377  ARG A CZ    1 
ATOM   3018 N  NH1   . ARG A 1 380 ? 25.445 -8.526  1.258   1.00 40.87 ? 377  ARG A NH1   1 
ATOM   3019 N  NH2   . ARG A 1 380 ? 23.982 -6.896  1.934   1.00 40.54 ? 377  ARG A NH2   1 
ATOM   3020 N  N     . LEU A 1 381 ? 30.541 -3.759  4.460   1.00 55.34 ? 378  LEU A N     1 
ATOM   3021 C  CA    . LEU A 1 381 ? 31.016 -2.450  4.042   1.00 55.55 ? 378  LEU A CA    1 
ATOM   3022 C  C     . LEU A 1 381 ? 30.290 -2.003  2.776   1.00 53.84 ? 378  LEU A C     1 
ATOM   3023 O  O     . LEU A 1 381 ? 29.985 -0.822  2.608   1.00 52.92 ? 378  LEU A O     1 
ATOM   3024 C  CB    . LEU A 1 381 ? 32.533 -2.469  3.830   1.00 57.57 ? 378  LEU A CB    1 
ATOM   3025 C  CG    . LEU A 1 381 ? 33.376 -2.554  5.112   1.00 61.69 ? 378  LEU A CG    1 
ATOM   3026 C  CD1   . LEU A 1 381 ? 33.451 -3.980  5.660   1.00 66.55 ? 378  LEU A CD1   1 
ATOM   3027 C  CD2   . LEU A 1 381 ? 34.774 -1.984  4.897   1.00 56.15 ? 378  LEU A CD2   1 
ATOM   3028 N  N     . SER A 1 382 ? 30.005 -2.950  1.891   1.00 52.47 ? 379  SER A N     1 
ATOM   3029 C  CA    . SER A 1 382 ? 29.153 -2.668  0.744   1.00 43.61 ? 379  SER A CA    1 
ATOM   3030 C  C     . SER A 1 382 ? 27.869 -3.465  0.831   1.00 41.35 ? 379  SER A C     1 
ATOM   3031 O  O     . SER A 1 382 ? 27.889 -4.664  1.119   1.00 42.99 ? 379  SER A O     1 
ATOM   3032 C  CB    . SER A 1 382 ? 29.856 -2.982  -0.571  1.00 39.95 ? 379  SER A CB    1 
ATOM   3033 O  OG    . SER A 1 382 ? 28.924 -2.928  -1.642  1.00 33.59 ? 379  SER A OG    1 
ATOM   3034 N  N     . SER A 1 383 ? 26.753 -2.793  0.571   1.00 38.00 ? 380  SER A N     1 
ATOM   3035 C  CA    . SER A 1 383 ? 25.440 -3.423  0.621   1.00 40.84 ? 380  SER A CA    1 
ATOM   3036 C  C     . SER A 1 383 ? 24.980 -3.858  -0.760  1.00 44.93 ? 380  SER A C     1 
ATOM   3037 O  O     . SER A 1 383 ? 24.331 -4.892  -0.908  1.00 44.29 ? 380  SER A O     1 
ATOM   3038 C  CB    . SER A 1 383 ? 24.407 -2.468  1.230   1.00 44.67 ? 380  SER A CB    1 
ATOM   3039 O  OG    . SER A 1 383 ? 24.702 -2.191  2.590   1.00 46.35 ? 380  SER A OG    1 
ATOM   3040 N  N     . LEU A 1 384 ? 25.319 -3.059  -1.767  1.00 44.24 ? 381  LEU A N     1 
ATOM   3041 C  CA    . LEU A 1 384 ? 24.831 -3.276  -3.123  1.00 35.36 ? 381  LEU A CA    1 
ATOM   3042 C  C     . LEU A 1 384 ? 25.750 -2.653  -4.161  1.00 38.35 ? 381  LEU A C     1 
ATOM   3043 O  O     . LEU A 1 384 ? 26.181 -1.508  -4.008  1.00 27.65 ? 381  LEU A O     1 
ATOM   3044 C  CB    . LEU A 1 384 ? 23.427 -2.701  -3.283  1.00 28.57 ? 381  LEU A CB    1 
ATOM   3045 C  CG    . LEU A 1 384 ? 22.845 -2.739  -4.697  1.00 37.99 ? 381  LEU A CG    1 
ATOM   3046 C  CD1   . LEU A 1 384 ? 21.520 -3.482  -4.703  1.00 39.88 ? 381  LEU A CD1   1 
ATOM   3047 C  CD2   . LEU A 1 384 ? 22.667 -1.337  -5.242  1.00 38.84 ? 381  LEU A CD2   1 
ATOM   3048 N  N     . ARG A 1 385 ? 26.022 -3.409  -5.223  1.00 33.65 ? 382  ARG A N     1 
ATOM   3049 C  CA    . ARG A 1 385 ? 26.925 -2.971  -6.277  1.00 25.24 ? 382  ARG A CA    1 
ATOM   3050 C  C     . ARG A 1 385 ? 26.306 -3.198  -7.650  1.00 30.01 ? 382  ARG A C     1 
ATOM   3051 O  O     . ARG A 1 385 ? 25.932 -4.319  -7.995  1.00 35.38 ? 382  ARG A O     1 
ATOM   3052 C  CB    . ARG A 1 385 ? 28.257 -3.711  -6.178  1.00 29.51 ? 382  ARG A CB    1 
ATOM   3053 C  CG    . ARG A 1 385 ? 29.434 -2.935  -6.723  1.00 37.10 ? 382  ARG A CG    1 
ATOM   3054 C  CD    . ARG A 1 385 ? 30.457 -3.860  -7.361  1.00 42.67 ? 382  ARG A CD    1 
ATOM   3055 N  NE    . ARG A 1 385 ? 29.964 -4.426  -8.614  1.00 42.37 ? 382  ARG A NE    1 
ATOM   3056 C  CZ    . ARG A 1 385 ? 30.747 -4.833  -9.608  1.00 41.47 ? 382  ARG A CZ    1 
ATOM   3057 N  NH1   . ARG A 1 385 ? 30.212 -5.334  -10.714 1.00 42.27 ? 382  ARG A NH1   1 
ATOM   3058 N  NH2   . ARG A 1 385 ? 32.062 -4.730  -9.500  1.00 39.81 ? 382  ARG A NH2   1 
ATOM   3059 N  N     . ARG A 1 386 ? 26.192 -2.131  -8.430  1.00 22.18 ? 383  ARG A N     1 
ATOM   3060 C  CA    . ARG A 1 386 ? 25.591 -2.209  -9.761  1.00 27.35 ? 383  ARG A CA    1 
ATOM   3061 C  C     . ARG A 1 386 ? 26.447 -1.476  -10.784 1.00 30.84 ? 383  ARG A C     1 
ATOM   3062 O  O     . ARG A 1 386 ? 27.019 -0.431  -10.491 1.00 27.44 ? 383  ARG A O     1 
ATOM   3063 C  CB    . ARG A 1 386 ? 24.180 -1.618  -9.752  1.00 26.43 ? 383  ARG A CB    1 
ATOM   3064 C  CG    . ARG A 1 386 ? 23.208 -2.331  -8.845  1.00 31.79 ? 383  ARG A CG    1 
ATOM   3065 C  CD    . ARG A 1 386 ? 22.787 -3.654  -9.440  1.00 26.36 ? 383  ARG A CD    1 
ATOM   3066 N  NE    . ARG A 1 386 ? 21.577 -4.172  -8.815  1.00 31.51 ? 383  ARG A NE    1 
ATOM   3067 C  CZ    . ARG A 1 386 ? 21.566 -5.106  -7.871  1.00 35.79 ? 383  ARG A CZ    1 
ATOM   3068 N  NH1   . ARG A 1 386 ? 22.707 -5.630  -7.438  1.00 36.11 ? 383  ARG A NH1   1 
ATOM   3069 N  NH2   . ARG A 1 386 ? 20.410 -5.524  -7.369  1.00 44.00 ? 383  ARG A NH2   1 
ATOM   3070 N  N     A CYS A 1 387 ? 26.530 -2.026  -11.991 0.65 32.55 ? 384  CYS A N     1 
ATOM   3071 N  N     B CYS A 1 387 ? 26.530 -2.026  -11.990 0.35 32.49 ? 384  CYS A N     1 
ATOM   3072 C  CA    . CYS A 1 387 ? 27.323 -1.408  -13.046 1.00 29.66 ? 384  CYS A CA    1 
ATOM   3073 C  C     . CYS A 1 387 ? 26.449 -0.850  -14.148 1.00 30.64 ? 384  CYS A C     1 
ATOM   3074 O  O     . CYS A 1 387 ? 25.363 -1.355  -14.414 1.00 28.89 ? 384  CYS A O     1 
ATOM   3075 C  CB    . CYS A 1 387 ? 28.314 -2.416  -13.642 1.00 28.78 ? 384  CYS A CB    1 
ATOM   3076 S  SG    A CYS A 1 387 ? 27.561 -3.765  -14.593 0.65 36.09 ? 384  CYS A SG    1 
ATOM   3077 S  SG    B CYS A 1 387 ? 29.384 -3.195  -12.442 0.35 35.87 ? 384  CYS A SG    1 
ATOM   3078 N  N     . CYS A 1 388 ? 26.939 0.192   -14.800 1.00 28.86 ? 385  CYS A N     1 
ATOM   3079 C  CA    . CYS A 1 388 ? 26.334 0.649   -16.035 1.00 33.94 ? 385  CYS A CA    1 
ATOM   3080 C  C     . CYS A 1 388 ? 27.439 1.102   -16.977 1.00 32.66 ? 385  CYS A C     1 
ATOM   3081 O  O     . CYS A 1 388 ? 28.617 1.116   -16.611 1.00 27.37 ? 385  CYS A O     1 
ATOM   3082 C  CB    . CYS A 1 388 ? 25.332 1.772   -15.774 1.00 26.01 ? 385  CYS A CB    1 
ATOM   3083 S  SG    . CYS A 1 388 ? 26.029 3.218   -14.967 1.00 33.28 ? 385  CYS A SG    1 
ATOM   3084 N  N     . ALA A 1 389 ? 27.070 1.470   -18.194 1.00 27.65 ? 386  ALA A N     1 
ATOM   3085 C  CA    . ALA A 1 389 ? 28.072 1.902   -19.155 1.00 23.47 ? 386  ALA A CA    1 
ATOM   3086 C  C     . ALA A 1 389 ? 28.650 3.252   -18.758 1.00 28.79 ? 386  ALA A C     1 
ATOM   3087 O  O     . ALA A 1 389 ? 27.953 4.096   -18.209 1.00 33.19 ? 386  ALA A O     1 
ATOM   3088 C  CB    . ALA A 1 389 ? 27.479 1.969   -20.556 1.00 27.25 ? 386  ALA A CB    1 
ATOM   3089 N  N     . LEU A 1 390 ? 29.937 3.437   -19.017 1.00 22.80 ? 387  LEU A N     1 
ATOM   3090 C  CA    . LEU A 1 390 ? 30.572 4.739   -18.898 1.00 27.93 ? 387  LEU A CA    1 
ATOM   3091 C  C     . LEU A 1 390 ? 31.002 5.174   -20.293 1.00 32.73 ? 387  LEU A C     1 
ATOM   3092 O  O     . LEU A 1 390 ? 32.042 4.746   -20.795 1.00 29.46 ? 387  LEU A O     1 
ATOM   3093 C  CB    . LEU A 1 390 ? 31.771 4.679   -17.950 1.00 30.53 ? 387  LEU A CB    1 
ATOM   3094 C  CG    . LEU A 1 390 ? 32.183 5.941   -17.180 1.00 25.58 ? 387  LEU A CG    1 
ATOM   3095 C  CD1   . LEU A 1 390 ? 33.298 5.584   -16.206 1.00 24.35 ? 387  LEU A CD1   1 
ATOM   3096 C  CD2   . LEU A 1 390 ? 32.611 7.080   -18.093 1.00 24.77 ? 387  LEU A CD2   1 
ATOM   3097 N  N     . THR A 1 391 ? 30.204 6.025   -20.923 1.00 30.60 ? 388  THR A N     1 
ATOM   3098 C  CA    . THR A 1 391 ? 30.442 6.375   -22.319 1.00 29.21 ? 388  THR A CA    1 
ATOM   3099 C  C     . THR A 1 391 ? 31.008 7.777   -22.500 1.00 35.10 ? 388  THR A C     1 
ATOM   3100 O  O     . THR A 1 391 ? 31.646 8.070   -23.511 1.00 36.72 ? 388  THR A O     1 
ATOM   3101 C  CB    . THR A 1 391 ? 29.147 6.248   -23.142 1.00 37.25 ? 388  THR A CB    1 
ATOM   3102 O  OG1   . THR A 1 391 ? 28.157 7.138   -22.614 1.00 41.67 ? 388  THR A OG1   1 
ATOM   3103 C  CG2   . THR A 1 391 ? 28.618 4.831   -23.065 1.00 33.05 ? 388  THR A CG2   1 
ATOM   3104 N  N     . ARG A 1 392 ? 30.777 8.641   -21.518 1.00 32.44 ? 389  ARG A N     1 
ATOM   3105 C  CA    . ARG A 1 392 ? 31.276 10.007  -21.573 1.00 27.56 ? 389  ARG A CA    1 
ATOM   3106 C  C     . ARG A 1 392 ? 31.791 10.474  -20.221 1.00 31.37 ? 389  ARG A C     1 
ATOM   3107 O  O     . ARG A 1 392 ? 31.158 10.255  -19.192 1.00 28.97 ? 389  ARG A O     1 
ATOM   3108 C  CB    . ARG A 1 392 ? 30.185 10.963  -22.057 1.00 38.05 ? 389  ARG A CB    1 
ATOM   3109 C  CG    . ARG A 1 392 ? 29.889 10.871  -23.537 1.00 39.25 ? 389  ARG A CG    1 
ATOM   3110 C  CD    . ARG A 1 392 ? 28.669 11.696  -23.891 1.00 49.21 ? 389  ARG A CD    1 
ATOM   3111 N  NE    . ARG A 1 392 ? 28.728 13.030  -23.303 1.00 55.39 ? 389  ARG A NE    1 
ATOM   3112 C  CZ    . ARG A 1 392 ? 27.731 13.583  -22.619 1.00 54.07 ? 389  ARG A CZ    1 
ATOM   3113 N  NH1   . ARG A 1 392 ? 27.865 14.801  -22.114 1.00 56.18 ? 389  ARG A NH1   1 
ATOM   3114 N  NH2   . ARG A 1 392 ? 26.598 12.917  -22.442 1.00 53.60 ? 389  ARG A NH2   1 
ATOM   3115 N  N     . TYR A 1 393 ? 32.945 11.124  -20.238 1.00 23.94 ? 390  TYR A N     1 
ATOM   3116 C  CA    . TYR A 1 393 ? 33.516 11.726  -19.042 1.00 23.89 ? 390  TYR A CA    1 
ATOM   3117 C  C     . TYR A 1 393 ? 32.759 13.004  -18.698 1.00 30.21 ? 390  TYR A C     1 
ATOM   3118 O  O     . TYR A 1 393 ? 33.260 14.113  -18.908 1.00 26.61 ? 390  TYR A O     1 
ATOM   3119 C  CB    . TYR A 1 393 ? 35.003 12.018  -19.241 1.00 25.19 ? 390  TYR A CB    1 
ATOM   3120 C  CG    . TYR A 1 393 ? 35.907 10.797  -19.162 1.00 20.55 ? 390  TYR A CG    1 
ATOM   3121 C  CD1   . TYR A 1 393 ? 37.285 10.940  -19.127 1.00 21.98 ? 390  TYR A CD1   1 
ATOM   3122 C  CD2   . TYR A 1 393 ? 35.380 9.511   -19.110 1.00 27.99 ? 390  TYR A CD2   1 
ATOM   3123 C  CE1   . TYR A 1 393 ? 38.121 9.830   -19.047 1.00 21.23 ? 390  TYR A CE1   1 
ATOM   3124 C  CE2   . TYR A 1 393 ? 36.209 8.397   -19.028 1.00 25.92 ? 390  TYR A CE2   1 
ATOM   3125 C  CZ    . TYR A 1 393 ? 37.576 8.564   -18.998 1.00 25.20 ? 390  TYR A CZ    1 
ATOM   3126 O  OH    . TYR A 1 393 ? 38.411 7.459   -18.915 1.00 25.48 ? 390  TYR A OH    1 
ATOM   3127 N  N     . ASP A 1 394 ? 31.539 12.839  -18.199 1.00 25.05 ? 391  ASP A N     1 
ATOM   3128 C  CA    . ASP A 1 394 ? 30.715 13.970  -17.799 1.00 28.43 ? 391  ASP A CA    1 
ATOM   3129 C  C     . ASP A 1 394 ? 30.078 13.664  -16.454 1.00 24.51 ? 391  ASP A C     1 
ATOM   3130 O  O     . ASP A 1 394 ? 29.356 12.673  -16.321 1.00 28.18 ? 391  ASP A O     1 
ATOM   3131 C  CB    . ASP A 1 394 ? 29.644 14.266  -18.850 1.00 30.93 ? 391  ASP A CB    1 
ATOM   3132 C  CG    . ASP A 1 394 ? 28.823 15.497  -18.505 1.00 34.67 ? 391  ASP A CG    1 
ATOM   3133 O  OD1   . ASP A 1 394 ? 27.950 15.390  -17.621 1.00 28.65 ? 391  ASP A OD1   1 
ATOM   3134 O  OD2   . ASP A 1 394 ? 29.060 16.571  -19.102 1.00 46.58 ? 391  ASP A OD2   1 
ATOM   3135 N  N     . ALA A 1 395 ? 30.358 14.505  -15.459 1.00 22.74 ? 392  ALA A N     1 
ATOM   3136 C  CA    . ALA A 1 395 ? 29.927 14.228  -14.091 1.00 20.29 ? 392  ALA A CA    1 
ATOM   3137 C  C     . ALA A 1 395 ? 28.406 14.229  -13.939 1.00 20.14 ? 392  ALA A C     1 
ATOM   3138 O  O     . ALA A 1 395 ? 27.859 13.459  -13.157 1.00 24.23 ? 392  ALA A O     1 
ATOM   3139 C  CB    . ALA A 1 395 ? 30.557 15.232  -13.113 1.00 18.77 ? 392  ALA A CB    1 
ATOM   3140 N  N     . HIS A 1 396 ? 27.719 15.082  -14.688 1.00 29.84 ? 393  HIS A N     1 
ATOM   3141 C  CA    . HIS A 1 396 ? 26.274 15.160  -14.544 1.00 24.90 ? 393  HIS A CA    1 
ATOM   3142 C  C     . HIS A 1 396 ? 25.596 13.908  -15.071 1.00 19.32 ? 393  HIS A C     1 
ATOM   3143 O  O     . HIS A 1 396 ? 24.630 13.423  -14.475 1.00 25.12 ? 393  HIS A O     1 
ATOM   3144 C  CB    . HIS A 1 396 ? 25.739 16.419  -15.228 1.00 24.08 ? 393  HIS A CB    1 
ATOM   3145 C  CG    . HIS A 1 396 ? 25.848 17.641  -14.368 1.00 34.11 ? 393  HIS A CG    1 
ATOM   3146 N  ND1   . HIS A 1 396 ? 26.846 18.580  -14.523 1.00 39.18 ? 393  HIS A ND1   1 
ATOM   3147 C  CD2   . HIS A 1 396 ? 25.107 18.052  -13.311 1.00 36.78 ? 393  HIS A CD2   1 
ATOM   3148 C  CE1   . HIS A 1 396 ? 26.701 19.529  -13.614 1.00 36.61 ? 393  HIS A CE1   1 
ATOM   3149 N  NE2   . HIS A 1 396 ? 25.653 19.232  -12.866 1.00 44.90 ? 393  HIS A NE2   1 
ATOM   3150 N  N     . LYS A 1 397 ? 26.125 13.362  -16.161 1.00 24.54 ? 394  LYS A N     1 
ATOM   3151 C  CA    . LYS A 1 397 ? 25.633 12.093  -16.689 1.00 26.12 ? 394  LYS A CA    1 
ATOM   3152 C  C     . LYS A 1 397 ? 25.959 10.906  -15.781 1.00 21.34 ? 394  LYS A C     1 
ATOM   3153 O  O     . LYS A 1 397 ? 25.114 10.039  -15.547 1.00 24.93 ? 394  LYS A O     1 
ATOM   3154 C  CB    . LYS A 1 397 ? 26.199 11.829  -18.084 1.00 32.76 ? 394  LYS A CB    1 
ATOM   3155 C  CG    . LYS A 1 397 ? 25.818 10.450  -18.616 1.00 36.65 ? 394  LYS A CG    1 
ATOM   3156 C  CD    . LYS A 1 397 ? 26.166 10.272  -20.082 1.00 41.49 ? 394  LYS A CD    1 
ATOM   3157 C  CE    . LYS A 1 397 ? 25.880 8.844   -20.523 1.00 43.86 ? 394  LYS A CE    1 
ATOM   3158 N  NZ    . LYS A 1 397 ? 24.477 8.413   -20.220 1.00 42.68 ? 394  LYS A NZ    1 
ATOM   3159 N  N     . MET A 1 398 ? 27.189 10.858  -15.286 1.00 23.75 ? 395  MET A N     1 
ATOM   3160 C  CA    . MET A 1 398 ? 27.601 9.745   -14.447 1.00 22.78 ? 395  MET A CA    1 
ATOM   3161 C  C     . MET A 1 398 ? 26.775 9.703   -13.162 1.00 21.37 ? 395  MET A C     1 
ATOM   3162 O  O     . MET A 1 398 ? 26.351 8.633   -12.727 1.00 23.15 ? 395  MET A O     1 
ATOM   3163 C  CB    . MET A 1 398 ? 29.100 9.832   -14.135 1.00 22.04 ? 395  MET A CB    1 
ATOM   3164 C  CG    . MET A 1 398 ? 29.986 9.529   -15.338 1.00 20.75 ? 395  MET A CG    1 
ATOM   3165 S  SD    . MET A 1 398 ? 31.691 9.218   -14.838 1.00 24.87 ? 395  MET A SD    1 
ATOM   3166 C  CE    . MET A 1 398 ? 32.267 10.878  -14.489 1.00 29.53 ? 395  MET A CE    1 
ATOM   3167 N  N     . SER A 1 399 ? 26.517 10.870  -12.579 1.00 24.83 ? 396  SER A N     1 
ATOM   3168 C  CA    . SER A 1 399 ? 25.758 10.927  -11.335 1.00 24.57 ? 396  SER A CA    1 
ATOM   3169 C  C     . SER A 1 399 ? 24.270 10.649  -11.594 1.00 21.50 ? 396  SER A C     1 
ATOM   3170 O  O     . SER A 1 399 ? 23.587 10.041  -10.764 1.00 21.95 ? 396  SER A O     1 
ATOM   3171 C  CB    . SER A 1 399 ? 25.951 12.280  -10.640 1.00 24.91 ? 396  SER A CB    1 
ATOM   3172 O  OG    . SER A 1 399 ? 25.480 13.365  -11.423 1.00 26.61 ? 396  SER A OG    1 
ATOM   3173 N  N     . HIS A 1 400 ? 23.773 11.070  -12.752 1.00 24.25 ? 397  HIS A N     1 
ATOM   3174 C  CA    . HIS A 1 400 ? 22.398 10.723  -13.124 1.00 32.46 ? 397  HIS A CA    1 
ATOM   3175 C  C     . HIS A 1 400 ? 22.261 9.211   -13.368 1.00 27.36 ? 397  HIS A C     1 
ATOM   3176 O  O     . HIS A 1 400 ? 21.291 8.579   -12.940 1.00 26.44 ? 397  HIS A O     1 
ATOM   3177 C  CB    . HIS A 1 400 ? 21.962 11.511  -14.362 1.00 35.74 ? 397  HIS A CB    1 
ATOM   3178 C  CG    . HIS A 1 400 ? 20.527 11.300  -14.734 1.00 48.73 ? 397  HIS A CG    1 
ATOM   3179 N  ND1   . HIS A 1 400 ? 20.131 10.374  -15.675 1.00 45.52 ? 397  HIS A ND1   1 
ATOM   3180 C  CD2   . HIS A 1 400 ? 19.393 11.889  -14.285 1.00 45.48 ? 397  HIS A CD2   1 
ATOM   3181 C  CE1   . HIS A 1 400 ? 18.815 10.403  -15.792 1.00 48.14 ? 397  HIS A CE1   1 
ATOM   3182 N  NE2   . HIS A 1 400 ? 18.343 11.313  -14.959 1.00 50.93 ? 397  HIS A NE2   1 
ATOM   3183 N  N     . ASP A 1 401 ? 23.250 8.633   -14.044 1.00 26.12 ? 398  ASP A N     1 
ATOM   3184 C  CA    . ASP A 1 401 ? 23.277 7.198   -14.298 1.00 26.98 ? 398  ASP A CA    1 
ATOM   3185 C  C     . ASP A 1 401 ? 23.402 6.402   -13.009 1.00 26.47 ? 398  ASP A C     1 
ATOM   3186 O  O     . ASP A 1 401 ? 22.757 5.371   -12.847 1.00 29.75 ? 398  ASP A O     1 
ATOM   3187 C  CB    . ASP A 1 401 ? 24.427 6.837   -15.237 1.00 28.92 ? 398  ASP A CB    1 
ATOM   3188 C  CG    . ASP A 1 401 ? 24.158 7.254   -16.666 1.00 39.10 ? 398  ASP A CG    1 
ATOM   3189 O  OD1   . ASP A 1 401 ? 23.000 7.611   -16.967 1.00 34.13 ? 398  ASP A OD1   1 
ATOM   3190 O  OD2   . ASP A 1 401 ? 25.097 7.214   -17.487 1.00 34.92 ? 398  ASP A OD2   1 
ATOM   3191 N  N     . ALA A 1 402 ? 24.242 6.882   -12.096 1.00 23.29 ? 399  ALA A N     1 
ATOM   3192 C  CA    . ALA A 1 402 ? 24.428 6.222   -10.813 1.00 25.49 ? 399  ALA A CA    1 
ATOM   3193 C  C     . ALA A 1 402 ? 23.127 6.185   -10.033 1.00 18.71 ? 399  ALA A C     1 
ATOM   3194 O  O     . ALA A 1 402 ? 22.770 5.164   -9.437  1.00 24.53 ? 399  ALA A O     1 
ATOM   3195 C  CB    . ALA A 1 402 ? 25.509 6.936   -10.002 1.00 23.17 ? 399  ALA A CB    1 
ATOM   3196 N  N     . PHE A 1 403 ? 22.417 7.308   -10.036 1.00 27.63 ? 400  PHE A N     1 
ATOM   3197 C  CA    . PHE A 1 403 ? 21.141 7.382   -9.341  1.00 26.64 ? 400  PHE A CA    1 
ATOM   3198 C  C     . PHE A 1 403 ? 20.146 6.402   -9.944  1.00 29.81 ? 400  PHE A C     1 
ATOM   3199 O  O     . PHE A 1 403 ? 19.470 5.674   -9.224  1.00 31.41 ? 400  PHE A O     1 
ATOM   3200 C  CB    . PHE A 1 403 ? 20.579 8.799   -9.390  1.00 28.76 ? 400  PHE A CB    1 
ATOM   3201 C  CG    . PHE A 1 403 ? 19.300 8.963   -8.628  1.00 39.03 ? 400  PHE A CG    1 
ATOM   3202 C  CD1   . PHE A 1 403 ? 18.116 9.263   -9.284  1.00 39.22 ? 400  PHE A CD1   1 
ATOM   3203 C  CD2   . PHE A 1 403 ? 19.276 8.795   -7.255  1.00 32.08 ? 400  PHE A CD2   1 
ATOM   3204 C  CE1   . PHE A 1 403 ? 16.932 9.404   -8.580  1.00 43.05 ? 400  PHE A CE1   1 
ATOM   3205 C  CE2   . PHE A 1 403 ? 18.097 8.936   -6.545  1.00 41.86 ? 400  PHE A CE2   1 
ATOM   3206 C  CZ    . PHE A 1 403 ? 16.924 9.242   -7.208  1.00 42.68 ? 400  PHE A CZ    1 
ATOM   3207 N  N     . THR A 1 404 ? 20.078 6.380   -11.269 1.00 29.04 ? 401  THR A N     1 
ATOM   3208 C  CA    . THR A 1 404 ? 19.186 5.465   -11.969 1.00 34.45 ? 401  THR A CA    1 
ATOM   3209 C  C     . THR A 1 404 ? 19.378 4.012   -11.532 1.00 28.61 ? 401  THR A C     1 
ATOM   3210 O  O     . THR A 1 404 ? 18.405 3.292   -11.318 1.00 33.68 ? 401  THR A O     1 
ATOM   3211 C  CB    . THR A 1 404 ? 19.375 5.556   -13.501 1.00 30.19 ? 401  THR A CB    1 
ATOM   3212 O  OG1   . THR A 1 404 ? 18.948 6.844   -13.961 1.00 29.83 ? 401  THR A OG1   1 
ATOM   3213 C  CG2   . THR A 1 404 ? 18.562 4.477   -14.206 1.00 35.12 ? 401  THR A CG2   1 
ATOM   3214 N  N     . VAL A 1 405 ? 20.625 3.576   -11.380 1.00 24.95 ? 402  VAL A N     1 
ATOM   3215 C  CA    . VAL A 1 405 ? 20.862 2.168   -11.090 1.00 26.15 ? 402  VAL A CA    1 
ATOM   3216 C  C     . VAL A 1 405 ? 20.679 1.825   -9.615  1.00 30.10 ? 402  VAL A C     1 
ATOM   3217 O  O     . VAL A 1 405 ? 20.575 0.648   -9.277  1.00 32.73 ? 402  VAL A O     1 
ATOM   3218 C  CB    . VAL A 1 405 ? 22.269 1.716   -11.545 1.00 32.86 ? 402  VAL A CB    1 
ATOM   3219 C  CG1   . VAL A 1 405 ? 22.475 2.044   -13.015 1.00 32.26 ? 402  VAL A CG1   1 
ATOM   3220 C  CG2   . VAL A 1 405 ? 23.346 2.354   -10.696 1.00 35.37 ? 402  VAL A CG2   1 
ATOM   3221 N  N     . ILE A 1 406 ? 20.621 2.840   -8.747  1.00 29.68 ? 403  ILE A N     1 
ATOM   3222 C  CA    . ILE A 1 406 ? 20.413 2.610   -7.312  1.00 34.98 ? 403  ILE A CA    1 
ATOM   3223 C  C     . ILE A 1 406 ? 19.043 3.057   -6.779  1.00 31.08 ? 403  ILE A C     1 
ATOM   3224 O  O     . ILE A 1 406 ? 18.650 2.657   -5.681  1.00 39.51 ? 403  ILE A O     1 
ATOM   3225 C  CB    . ILE A 1 406 ? 21.479 3.334   -6.440  1.00 31.44 ? 403  ILE A CB    1 
ATOM   3226 C  CG1   . ILE A 1 406 ? 21.249 4.852   -6.464  1.00 27.95 ? 403  ILE A CG1   1 
ATOM   3227 C  CG2   . ILE A 1 406 ? 22.880 2.954   -6.866  1.00 32.00 ? 403  ILE A CG2   1 
ATOM   3228 C  CD1   . ILE A 1 406 ? 21.919 5.592   -5.318  1.00 33.87 ? 403  ILE A CD1   1 
ATOM   3229 N  N     . LYS A 1 407 ? 18.321 3.876   -7.539  1.00 33.43 ? 404  LYS A N     1 
ATOM   3230 C  CA    . LYS A 1 407 ? 17.118 4.536   -7.017  1.00 39.25 ? 404  LYS A CA    1 
ATOM   3231 C  C     . LYS A 1 407 ? 16.032 3.554   -6.561  1.00 41.56 ? 404  LYS A C     1 
ATOM   3232 O  O     . LYS A 1 407 ? 15.119 3.927   -5.819  1.00 42.11 ? 404  LYS A O     1 
ATOM   3233 C  CB    . LYS A 1 407 ? 16.540 5.500   -8.062  1.00 37.09 ? 404  LYS A CB    1 
ATOM   3234 C  CG    . LYS A 1 407 ? 15.997 4.828   -9.311  1.00 33.73 ? 404  LYS A CG    1 
ATOM   3235 C  CD    . LYS A 1 407 ? 15.582 5.872   -10.343 1.00 41.58 ? 404  LYS A CD    1 
ATOM   3236 C  CE    . LYS A 1 407 ? 14.939 5.228   -11.567 1.00 42.61 ? 404  LYS A CE    1 
ATOM   3237 N  NZ    . LYS A 1 407 ? 15.851 4.257   -12.242 1.00 52.66 ? 404  LYS A NZ    1 
ATOM   3238 N  N     . ASN A 1 408 ? 16.146 2.303   -6.989  1.00 37.46 ? 405  ASN A N     1 
ATOM   3239 C  CA    . ASN A 1 408 ? 15.194 1.268   -6.607  1.00 46.68 ? 405  ASN A CA    1 
ATOM   3240 C  C     . ASN A 1 408 ? 15.452 0.700   -5.213  1.00 46.27 ? 405  ASN A C     1 
ATOM   3241 O  O     . ASN A 1 408 ? 14.670 -0.109  -4.713  1.00 38.40 ? 405  ASN A O     1 
ATOM   3242 C  CB    . ASN A 1 408 ? 15.221 0.139   -7.636  1.00 47.68 ? 405  ASN A CB    1 
ATOM   3243 C  CG    . ASN A 1 408 ? 16.629 -0.367  -7.904  1.00 51.18 ? 405  ASN A CG    1 
ATOM   3244 O  OD1   . ASN A 1 408 ? 17.607 0.372   -7.769  1.00 48.18 ? 405  ASN A OD1   1 
ATOM   3245 N  ND2   . ASN A 1 408 ? 16.737 -1.631  -8.288  1.00 54.73 ? 405  ASN A ND2   1 
ATOM   3246 N  N     . CYS A 1 409 ? 16.557 1.110   -4.595  1.00 44.23 ? 406  CYS A N     1 
ATOM   3247 C  CA    . CYS A 1 409 ? 16.899 0.630   -3.260  1.00 45.74 ? 406  CYS A CA    1 
ATOM   3248 C  C     . CYS A 1 409 ? 16.129 1.411   -2.214  1.00 39.64 ? 406  CYS A C     1 
ATOM   3249 O  O     . CYS A 1 409 ? 16.111 1.050   -1.040  1.00 49.94 ? 406  CYS A O     1 
ATOM   3250 C  CB    . CYS A 1 409 ? 18.400 0.753   -3.000  1.00 46.01 ? 406  CYS A CB    1 
ATOM   3251 S  SG    . CYS A 1 409 ? 19.416 -0.168  -4.151  1.00 60.34 ? 406  CYS A SG    1 
ATOM   3252 N  N     . ASN A 1 410 ? 15.505 2.494   -2.655  1.00 40.88 ? 407  ASN A N     1 
ATOM   3253 C  CA    . ASN A 1 410 ? 14.714 3.336   -1.777  1.00 46.60 ? 407  ASN A CA    1 
ATOM   3254 C  C     . ASN A 1 410 ? 13.372 2.689   -1.421  1.00 51.86 ? 407  ASN A C     1 
ATOM   3255 O  O     . ASN A 1 410 ? 12.423 2.745   -2.201  1.00 48.87 ? 407  ASN A O     1 
ATOM   3256 C  CB    . ASN A 1 410 ? 14.493 4.695   -2.436  1.00 41.14 ? 407  ASN A CB    1 
ATOM   3257 C  CG    . ASN A 1 410 ? 13.865 5.689   -1.502  1.00 42.41 ? 407  ASN A CG    1 
ATOM   3258 O  OD1   . ASN A 1 410 ? 13.683 5.405   -0.319  1.00 48.42 ? 407  ASN A OD1   1 
ATOM   3259 N  ND2   . ASN A 1 410 ? 13.538 6.871   -2.019  1.00 36.83 ? 407  ASN A ND2   1 
ATOM   3260 N  N     . THR A 1 411 ? 13.298 2.081   -0.241  1.00 52.61 ? 408  THR A N     1 
ATOM   3261 C  CA    . THR A 1 411 ? 12.077 1.408   0.192   1.00 52.86 ? 408  THR A CA    1 
ATOM   3262 C  C     . THR A 1 411 ? 10.988 2.401   0.574   1.00 55.48 ? 408  THR A C     1 
ATOM   3263 O  O     . THR A 1 411 ? 9.815  2.038   0.647   1.00 62.78 ? 408  THR A O     1 
ATOM   3264 C  CB    . THR A 1 411 ? 12.323 0.480   1.399   1.00 50.96 ? 408  THR A CB    1 
ATOM   3265 O  OG1   . THR A 1 411 ? 12.602 1.268   2.563   1.00 49.89 ? 408  THR A OG1   1 
ATOM   3266 C  CG2   . THR A 1 411 ? 13.482 -0.469  1.126   1.00 52.80 ? 408  THR A CG2   1 
ATOM   3267 N  N     . SER A 1 412 ? 11.380 3.647   0.823   1.00 52.50 ? 409  SER A N     1 
ATOM   3268 C  CA    . SER A 1 412 ? 10.438 4.683   1.239   1.00 52.29 ? 409  SER A CA    1 
ATOM   3269 C  C     . SER A 1 412 ? 9.287  4.853   0.252   1.00 60.39 ? 409  SER A C     1 
ATOM   3270 O  O     . SER A 1 412 ? 9.502  4.961   -0.954  1.00 65.43 ? 409  SER A O     1 
ATOM   3271 C  CB    . SER A 1 412 ? 11.161 6.018   1.419   1.00 55.43 ? 409  SER A CB    1 
ATOM   3272 O  OG    . SER A 1 412 ? 10.241 7.091   1.503   1.00 58.30 ? 409  SER A OG    1 
ATOM   3273 N  N     . GLY A 1 413 ? 8.066  4.870   0.776   1.00 65.16 ? 410  GLY A N     1 
ATOM   3274 C  CA    . GLY A 1 413 ? 6.887  5.089   -0.041  1.00 66.50 ? 410  GLY A CA    1 
ATOM   3275 C  C     . GLY A 1 413 ? 6.873  6.495   -0.605  1.00 67.76 ? 410  GLY A C     1 
ATOM   3276 O  O     . GLY A 1 413 ? 6.347  6.738   -1.691  1.00 67.17 ? 410  GLY A O     1 
ATOM   3277 N  N     . ILE A 1 414 ? 7.453  7.425   0.146   1.00 63.79 ? 411  ILE A N     1 
ATOM   3278 C  CA    . ILE A 1 414 ? 7.626  8.795   -0.316  1.00 66.09 ? 411  ILE A CA    1 
ATOM   3279 C  C     . ILE A 1 414 ? 8.861  8.877   -1.208  1.00 69.30 ? 411  ILE A C     1 
ATOM   3280 O  O     . ILE A 1 414 ? 9.939  8.416   -0.825  1.00 65.62 ? 411  ILE A O     1 
ATOM   3281 C  CB    . ILE A 1 414 ? 7.776  9.777   0.863   1.00 58.57 ? 411  ILE A CB    1 
ATOM   3282 C  CG1   . ILE A 1 414 ? 6.939  9.309   2.056   1.00 60.78 ? 411  ILE A CG1   1 
ATOM   3283 C  CG2   . ILE A 1 414 ? 7.407  11.190  0.433   1.00 55.01 ? 411  ILE A CG2   1 
ATOM   3284 C  CD1   . ILE A 1 414 ? 7.063  10.193  3.275   1.00 55.17 ? 411  ILE A CD1   1 
ATOM   3285 N  N     . GLN A 1 415 ? 8.702  9.457   -2.395  1.00 73.83 ? 412  GLN A N     1 
ATOM   3286 C  CA    . GLN A 1 415 ? 9.807  9.589   -3.342  1.00 68.91 ? 412  GLN A CA    1 
ATOM   3287 C  C     . GLN A 1 415 ? 10.901 10.494  -2.784  1.00 69.20 ? 412  GLN A C     1 
ATOM   3288 O  O     . GLN A 1 415 ? 12.092 10.198  -2.907  1.00 68.72 ? 412  GLN A O     1 
ATOM   3289 C  CB    . GLN A 1 415 ? 9.301  10.136  -4.683  1.00 72.67 ? 412  GLN A CB    1 
ATOM   3290 C  CG    . GLN A 1 415 ? 10.304 10.054  -5.834  1.00 83.11 ? 412  GLN A CG    1 
ATOM   3291 C  CD    . GLN A 1 415 ? 11.216 11.271  -5.934  1.00 85.58 ? 412  GLN A CD    1 
ATOM   3292 O  OE1   . GLN A 1 415 ? 11.063 12.244  -5.193  1.00 84.33 ? 412  GLN A OE1   1 
ATOM   3293 N  NE2   . GLN A 1 415 ? 12.167 11.221  -6.863  1.00 77.81 ? 412  GLN A NE2   1 
ATOM   3294 N  N     . THR A 1 416 ? 10.479 11.595  -2.167  1.00 62.12 ? 413  THR A N     1 
ATOM   3295 C  CA    . THR A 1 416 ? 11.383 12.620  -1.653  1.00 58.54 ? 413  THR A CA    1 
ATOM   3296 C  C     . THR A 1 416 ? 12.288 12.106  -0.533  1.00 57.08 ? 413  THR A C     1 
ATOM   3297 O  O     . THR A 1 416 ? 13.422 12.561  -0.375  1.00 51.22 ? 413  THR A O     1 
ATOM   3298 C  CB    . THR A 1 416 ? 10.582 13.832  -1.143  1.00 56.42 ? 413  THR A CB    1 
ATOM   3299 O  OG1   . THR A 1 416 ? 9.708  14.288  -2.180  1.00 63.47 ? 413  THR A OG1   1 
ATOM   3300 C  CG2   . THR A 1 416 ? 11.504 14.968  -0.733  1.00 58.71 ? 413  THR A CG2   1 
ATOM   3301 N  N     . GLU A 1 417 ? 11.783 11.154  0.241   1.00 54.27 ? 414  GLU A N     1 
ATOM   3302 C  CA    . GLU A 1 417 ? 12.544 10.584  1.342   1.00 47.06 ? 414  GLU A CA    1 
ATOM   3303 C  C     . GLU A 1 417 ? 13.306 9.344   0.900   1.00 53.01 ? 414  GLU A C     1 
ATOM   3304 O  O     . GLU A 1 417 ? 12.837 8.592   0.044   1.00 54.87 ? 414  GLU A O     1 
ATOM   3305 C  CB    . GLU A 1 417 ? 11.617 10.243  2.508   1.00 53.40 ? 414  GLU A CB    1 
ATOM   3306 C  CG    . GLU A 1 417 ? 10.866 11.441  3.049   1.00 54.31 ? 414  GLU A CG    1 
ATOM   3307 C  CD    . GLU A 1 417 ? 11.795 12.565  3.458   1.00 53.22 ? 414  GLU A CD    1 
ATOM   3308 O  OE1   . GLU A 1 417 ? 12.721 12.315  4.260   1.00 53.37 ? 414  GLU A OE1   1 
ATOM   3309 O  OE2   . GLU A 1 417 ? 11.596 13.702  2.978   1.00 56.30 ? 414  GLU A OE2   1 
ATOM   3310 N  N     . TRP A 1 418 ? 14.484 9.132   1.479   1.00 43.14 ? 415  TRP A N     1 
ATOM   3311 C  CA    . TRP A 1 418 ? 15.260 7.940   1.175   1.00 37.50 ? 415  TRP A CA    1 
ATOM   3312 C  C     . TRP A 1 418 ? 15.346 7.013   2.378   1.00 38.54 ? 415  TRP A C     1 
ATOM   3313 O  O     . TRP A 1 418 ? 15.848 7.399   3.433   1.00 39.95 ? 415  TRP A O     1 
ATOM   3314 C  CB    . TRP A 1 418 ? 16.670 8.302   0.710   1.00 37.08 ? 415  TRP A CB    1 
ATOM   3315 C  CG    . TRP A 1 418 ? 17.334 7.145   0.048   1.00 27.30 ? 415  TRP A CG    1 
ATOM   3316 C  CD1   . TRP A 1 418 ? 17.845 6.036   0.650   1.00 26.48 ? 415  TRP A CD1   1 
ATOM   3317 C  CD2   . TRP A 1 418 ? 17.509 6.957   -1.357  1.00 35.97 ? 415  TRP A CD2   1 
ATOM   3318 N  NE1   . TRP A 1 418 ? 18.344 5.171   -0.294  1.00 36.27 ? 415  TRP A NE1   1 
ATOM   3319 C  CE2   . TRP A 1 418 ? 18.149 5.716   -1.536  1.00 29.82 ? 415  TRP A CE2   1 
ATOM   3320 C  CE3   . TRP A 1 418 ? 17.195 7.724   -2.482  1.00 35.45 ? 415  TRP A CE3   1 
ATOM   3321 C  CZ2   . TRP A 1 418 ? 18.488 5.226   -2.794  1.00 37.95 ? 415  TRP A CZ2   1 
ATOM   3322 C  CZ3   . TRP A 1 418 ? 17.530 7.235   -3.731  1.00 39.20 ? 415  TRP A CZ3   1 
ATOM   3323 C  CH2   . TRP A 1 418 ? 18.169 5.998   -3.878  1.00 32.85 ? 415  TRP A CH2   1 
ATOM   3324 N  N     . SER A 1 419 ? 14.871 5.783   2.216   1.00 41.94 ? 416  SER A N     1 
ATOM   3325 C  CA    . SER A 1 419 ? 14.924 4.819   3.307   1.00 39.52 ? 416  SER A CA    1 
ATOM   3326 C  C     . SER A 1 419 ? 15.272 3.419   2.806   1.00 47.63 ? 416  SER A C     1 
ATOM   3327 O  O     . SER A 1 419 ? 14.815 3.015   1.737   1.00 49.77 ? 416  SER A O     1 
ATOM   3328 C  CB    . SER A 1 419 ? 13.592 4.794   4.058   1.00 52.85 ? 416  SER A CB    1 
ATOM   3329 O  OG    . SER A 1 419 ? 13.743 4.201   5.336   1.00 50.11 ? 416  SER A OG    1 
ATOM   3330 N  N     . PRO A 1 420 ? 16.110 2.686   3.563   1.00 43.39 ? 417  PRO A N     1 
ATOM   3331 C  CA    . PRO A 1 420 ? 16.828 3.184   4.742   1.00 46.51 ? 417  PRO A CA    1 
ATOM   3332 C  C     . PRO A 1 420 ? 17.935 4.144   4.326   1.00 42.45 ? 417  PRO A C     1 
ATOM   3333 O  O     . PRO A 1 420 ? 18.409 4.038   3.194   1.00 40.87 ? 417  PRO A O     1 
ATOM   3334 C  CB    . PRO A 1 420 ? 17.403 1.912   5.368   1.00 44.41 ? 417  PRO A CB    1 
ATOM   3335 C  CG    . PRO A 1 420 ? 17.561 0.982   4.218   1.00 46.04 ? 417  PRO A CG    1 
ATOM   3336 C  CD    . PRO A 1 420 ? 16.396 1.262   3.314   1.00 39.36 ? 417  PRO A CD    1 
ATOM   3337 N  N     . PRO A 1 421 ? 18.326 5.071   5.217   1.00 34.04 ? 418  PRO A N     1 
ATOM   3338 C  CA    . PRO A 1 421 ? 19.328 6.087   4.877   1.00 32.68 ? 418  PRO A CA    1 
ATOM   3339 C  C     . PRO A 1 421 ? 20.638 5.472   4.396   1.00 24.48 ? 418  PRO A C     1 
ATOM   3340 O  O     . PRO A 1 421 ? 20.989 4.367   4.824   1.00 28.57 ? 418  PRO A O     1 
ATOM   3341 C  CB    . PRO A 1 421 ? 19.533 6.840   6.197   1.00 31.56 ? 418  PRO A CB    1 
ATOM   3342 C  CG    . PRO A 1 421 ? 18.321 6.536   7.013   1.00 37.26 ? 418  PRO A CG    1 
ATOM   3343 C  CD    . PRO A 1 421 ? 17.922 5.150   6.632   1.00 40.76 ? 418  PRO A CD    1 
ATOM   3344 N  N     . LEU A 1 422 ? 21.338 6.183   3.517   1.00 29.04 ? 419  LEU A N     1 
ATOM   3345 C  CA    . LEU A 1 422 ? 22.581 5.696   2.917   1.00 23.21 ? 419  LEU A CA    1 
ATOM   3346 C  C     . LEU A 1 422 ? 23.782 6.100   3.764   1.00 23.73 ? 419  LEU A C     1 
ATOM   3347 O  O     . LEU A 1 422 ? 23.964 7.272   4.058   1.00 27.04 ? 419  LEU A O     1 
ATOM   3348 C  CB    . LEU A 1 422 ? 22.741 6.240   1.489   1.00 18.35 ? 419  LEU A CB    1 
ATOM   3349 C  CG    . LEU A 1 422 ? 21.638 5.809   0.515   1.00 28.87 ? 419  LEU A CG    1 
ATOM   3350 C  CD1   . LEU A 1 422 ? 21.896 6.295   -0.909  1.00 28.48 ? 419  LEU A CD1   1 
ATOM   3351 C  CD2   . LEU A 1 422 ? 21.502 4.303   0.557   1.00 23.53 ? 419  LEU A CD2   1 
ATOM   3352 N  N     . THR A 1 423 ? 24.600 5.124   4.140   1.00 24.95 ? 420  THR A N     1 
ATOM   3353 C  CA    . THR A 1 423 ? 25.780 5.388   4.959   1.00 23.14 ? 420  THR A CA    1 
ATOM   3354 C  C     . THR A 1 423 ? 27.075 5.315   4.144   1.00 23.49 ? 420  THR A C     1 
ATOM   3355 O  O     . THR A 1 423 ? 28.172 5.464   4.693   1.00 20.90 ? 420  THR A O     1 
ATOM   3356 C  CB    . THR A 1 423 ? 25.873 4.402   6.113   1.00 29.10 ? 420  THR A CB    1 
ATOM   3357 O  OG1   . THR A 1 423 ? 25.747 3.067   5.600   1.00 28.74 ? 420  THR A OG1   1 
ATOM   3358 C  CG2   . THR A 1 423 ? 24.758 4.669   7.113   1.00 33.42 ? 420  THR A CG2   1 
ATOM   3359 N  N     . MET A 1 424 ? 26.952 5.076   2.842   1.00 19.74 ? 421  MET A N     1 
ATOM   3360 C  CA    . MET A 1 424 ? 28.127 5.099   1.972   1.00 18.19 ? 421  MET A CA    1 
ATOM   3361 C  C     . MET A 1 424 ? 27.718 5.215   0.513   1.00 26.31 ? 421  MET A C     1 
ATOM   3362 O  O     . MET A 1 424 ? 26.753 4.586   0.089   1.00 22.64 ? 421  MET A O     1 
ATOM   3363 C  CB    . MET A 1 424 ? 28.987 3.848   2.186   1.00 22.97 ? 421  MET A CB    1 
ATOM   3364 C  CG    . MET A 1 424 ? 30.295 3.801   1.375   1.00 22.40 ? 421  MET A CG    1 
ATOM   3365 S  SD    . MET A 1 424 ? 30.082 3.180   -0.315  1.00 24.52 ? 421  MET A SD    1 
ATOM   3366 C  CE    . MET A 1 424 ? 29.533 1.506   -0.006  1.00 23.40 ? 421  MET A CE    1 
ATOM   3367 N  N     . LEU A 1 425 ? 28.456 6.032   -0.237  1.00 18.49 ? 422  LEU A N     1 
ATOM   3368 C  CA    . LEU A 1 425 ? 28.348 6.099   -1.694  1.00 16.05 ? 422  LEU A CA    1 
ATOM   3369 C  C     . LEU A 1 425 ? 29.721 5.843   -2.315  1.00 19.59 ? 422  LEU A C     1 
ATOM   3370 O  O     . LEU A 1 425 ? 30.743 6.210   -1.734  1.00 20.29 ? 422  LEU A O     1 
ATOM   3371 C  CB    . LEU A 1 425 ? 27.831 7.459   -2.159  1.00 16.26 ? 422  LEU A CB    1 
ATOM   3372 C  CG    . LEU A 1 425 ? 26.429 7.924   -1.781  1.00 21.20 ? 422  LEU A CG    1 
ATOM   3373 C  CD1   . LEU A 1 425 ? 26.197 9.347   -2.301  1.00 16.50 ? 422  LEU A CD1   1 
ATOM   3374 C  CD2   . LEU A 1 425 ? 25.371 6.962   -2.308  1.00 20.76 ? 422  LEU A CD2   1 
ATOM   3375 N  N     . PHE A 1 426 ? 29.747 5.236   -3.499  1.00 16.33 ? 423  PHE A N     1 
ATOM   3376 C  CA    . PHE A 1 426 ? 31.003 4.818   -4.120  1.00 14.22 ? 423  PHE A CA    1 
ATOM   3377 C  C     . PHE A 1 426 ? 30.818 4.812   -5.627  1.00 22.17 ? 423  PHE A C     1 
ATOM   3378 O  O     . PHE A 1 426 ? 29.889 4.188   -6.153  1.00 22.69 ? 423  PHE A O     1 
ATOM   3379 C  CB    . PHE A 1 426 ? 31.409 3.429   -3.603  1.00 20.47 ? 423  PHE A CB    1 
ATOM   3380 C  CG    . PHE A 1 426 ? 32.756 2.944   -4.082  1.00 26.17 ? 423  PHE A CG    1 
ATOM   3381 C  CD1   . PHE A 1 426 ? 33.073 1.598   -4.010  1.00 43.88 ? 423  PHE A CD1   1 
ATOM   3382 C  CD2   . PHE A 1 426 ? 33.712 3.819   -4.574  1.00 22.95 ? 423  PHE A CD2   1 
ATOM   3383 C  CE1   . PHE A 1 426 ? 34.304 1.134   -4.442  1.00 42.44 ? 423  PHE A CE1   1 
ATOM   3384 C  CE2   . PHE A 1 426 ? 34.948 3.362   -5.004  1.00 28.38 ? 423  PHE A CE2   1 
ATOM   3385 C  CZ    . PHE A 1 426 ? 35.245 2.024   -4.938  1.00 34.31 ? 423  PHE A CZ    1 
ATOM   3386 N  N     . LEU A 1 427 ? 31.682 5.534   -6.320  1.00 14.49 ? 424  LEU A N     1 
ATOM   3387 C  CA    . LEU A 1 427 ? 31.687 5.533   -7.774  1.00 19.46 ? 424  LEU A CA    1 
ATOM   3388 C  C     . LEU A 1 427 ? 33.051 5.074   -8.223  1.00 22.48 ? 424  LEU A C     1 
ATOM   3389 O  O     . LEU A 1 427 ? 34.053 5.651   -7.816  1.00 23.55 ? 424  LEU A O     1 
ATOM   3390 C  CB    . LEU A 1 427 ? 31.395 6.915   -8.342  1.00 16.81 ? 424  LEU A CB    1 
ATOM   3391 C  CG    . LEU A 1 427 ? 30.015 7.510   -8.095  1.00 20.84 ? 424  LEU A CG    1 
ATOM   3392 C  CD1   . LEU A 1 427 ? 29.895 8.829   -8.835  1.00 21.19 ? 424  LEU A CD1   1 
ATOM   3393 C  CD2   . LEU A 1 427 ? 28.947 6.532   -8.550  1.00 19.45 ? 424  LEU A CD2   1 
ATOM   3394 N  N     . CYS A 1 428 ? 33.097 4.049   -9.066  1.00 15.78 ? 425  CYS A N     1 
ATOM   3395 C  CA    . CYS A 1 428 ? 34.377 3.534   -9.519  1.00 20.99 ? 425  CYS A CA    1 
ATOM   3396 C  C     . CYS A 1 428 ? 34.376 3.331   -11.027 1.00 25.17 ? 425  CYS A C     1 
ATOM   3397 O  O     . CYS A 1 428 ? 33.481 2.675   -11.575 1.00 22.26 ? 425  CYS A O     1 
ATOM   3398 C  CB    . CYS A 1 428 ? 34.712 2.223   -8.812  1.00 26.11 ? 425  CYS A CB    1 
ATOM   3399 S  SG    . CYS A 1 428 ? 36.371 1.602   -9.206  1.00 26.45 ? 425  CYS A SG    1 
ATOM   3400 N  N     . ALA A 1 429 ? 35.380 3.899   -11.689 1.00 15.58 ? 426  ALA A N     1 
ATOM   3401 C  CA    . ALA A 1 429 ? 35.522 3.733   -13.127 1.00 17.55 ? 426  ALA A CA    1 
ATOM   3402 C  C     . ALA A 1 429 ? 36.455 2.554   -13.380 1.00 23.39 ? 426  ALA A C     1 
ATOM   3403 O  O     . ALA A 1 429 ? 37.522 2.452   -12.763 1.00 19.92 ? 426  ALA A O     1 
ATOM   3404 C  CB    . ALA A 1 429 ? 36.057 5.000   -13.766 1.00 18.11 ? 426  ALA A CB    1 
ATOM   3405 N  N     . THR A 1 430 ? 36.040 1.660   -14.271 1.00 20.31 ? 427  THR A N     1 
ATOM   3406 C  CA    . THR A 1 430 ? 36.759 0.408   -14.502 1.00 21.06 ? 427  THR A CA    1 
ATOM   3407 C  C     . THR A 1 430 ? 36.822 0.075   -15.990 1.00 25.46 ? 427  THR A C     1 
ATOM   3408 O  O     . THR A 1 430 ? 36.289 0.812   -16.821 1.00 19.10 ? 427  THR A O     1 
ATOM   3409 C  CB    . THR A 1 430 ? 36.091 -0.783  -13.774 1.00 21.17 ? 427  THR A CB    1 
ATOM   3410 O  OG1   . THR A 1 430 ? 34.804 -1.027  -14.351 1.00 29.24 ? 427  THR A OG1   1 
ATOM   3411 C  CG2   . THR A 1 430 ? 35.915 -0.502  -12.285 1.00 24.15 ? 427  THR A CG2   1 
ATOM   3412 N  N     . LYS A 1 431 ? 37.478 -1.044  -16.298 1.00 20.21 ? 428  LYS A N     1 
ATOM   3413 C  CA    . LYS A 1 431 ? 37.557 -1.604  -17.648 1.00 26.16 ? 428  LYS A CA    1 
ATOM   3414 C  C     . LYS A 1 431 ? 38.121 -0.615  -18.656 1.00 17.71 ? 428  LYS A C     1 
ATOM   3415 O  O     . LYS A 1 431 ? 37.423 -0.179  -19.578 1.00 20.31 ? 428  LYS A O     1 
ATOM   3416 C  CB    . LYS A 1 431 ? 36.184 -2.088  -18.108 1.00 17.67 ? 428  LYS A CB    1 
ATOM   3417 C  CG    . LYS A 1 431 ? 35.615 -3.224  -17.283 1.00 30.48 ? 428  LYS A CG    1 
ATOM   3418 C  CD    . LYS A 1 431 ? 34.363 -3.796  -17.930 1.00 36.97 ? 428  LYS A CD    1 
ATOM   3419 C  CE    . LYS A 1 431 ? 33.758 -4.907  -17.084 1.00 41.29 ? 428  LYS A CE    1 
ATOM   3420 N  NZ    . LYS A 1 431 ? 34.801 -5.775  -16.471 1.00 42.62 ? 428  LYS A NZ    1 
ATOM   3421 N  N     . PHE A 1 432 ? 39.388 -0.263  -18.483 1.00 21.78 ? 429  PHE A N     1 
ATOM   3422 C  CA    . PHE A 1 432 ? 40.030 0.698   -19.372 1.00 17.05 ? 429  PHE A CA    1 
ATOM   3423 C  C     . PHE A 1 432 ? 40.331 0.088   -20.732 1.00 27.27 ? 429  PHE A C     1 
ATOM   3424 O  O     . PHE A 1 432 ? 40.555 -1.119  -20.848 1.00 28.38 ? 429  PHE A O     1 
ATOM   3425 C  CB    . PHE A 1 432 ? 41.314 1.238   -18.735 1.00 22.24 ? 429  PHE A CB    1 
ATOM   3426 C  CG    . PHE A 1 432 ? 41.062 2.220   -17.634 1.00 23.59 ? 429  PHE A CG    1 
ATOM   3427 C  CD1   . PHE A 1 432 ? 41.054 3.577   -17.890 1.00 28.02 ? 429  PHE A CD1   1 
ATOM   3428 C  CD2   . PHE A 1 432 ? 40.795 1.782   -16.345 1.00 33.46 ? 429  PHE A CD2   1 
ATOM   3429 C  CE1   . PHE A 1 432 ? 40.798 4.489   -16.880 1.00 20.35 ? 429  PHE A CE1   1 
ATOM   3430 C  CE2   . PHE A 1 432 ? 40.541 2.687   -15.327 1.00 34.76 ? 429  PHE A CE2   1 
ATOM   3431 C  CZ    . PHE A 1 432 ? 40.545 4.044   -15.595 1.00 31.09 ? 429  PHE A CZ    1 
ATOM   3432 N  N     . SER A 1 433 ? 40.309 0.939   -21.755 1.00 27.00 ? 430  SER A N     1 
ATOM   3433 C  CA    . SER A 1 433 ? 40.737 0.577   -23.104 1.00 32.84 ? 430  SER A CA    1 
ATOM   3434 C  C     . SER A 1 433 ? 41.737 1.610   -23.597 1.00 31.48 ? 430  SER A C     1 
ATOM   3435 O  O     . SER A 1 433 ? 41.656 2.780   -23.217 1.00 25.93 ? 430  SER A O     1 
ATOM   3436 C  CB    . SER A 1 433 ? 39.539 0.492   -24.053 1.00 35.57 ? 430  SER A CB    1 
ATOM   3437 O  OG    . SER A 1 433 ? 38.616 -0.490  -23.618 1.00 41.12 ? 430  SER A OG    1 
ATOM   3438 N  N     . ALA A 1 434 ? 42.685 1.194   -24.431 1.00 28.70 ? 431  ALA A N     1 
ATOM   3439 C  CA    . ALA A 1 434 ? 43.675 2.139   -24.941 1.00 24.33 ? 431  ALA A CA    1 
ATOM   3440 C  C     . ALA A 1 434 ? 42.977 3.213   -25.770 1.00 38.35 ? 431  ALA A C     1 
ATOM   3441 O  O     . ALA A 1 434 ? 41.959 2.948   -26.416 1.00 43.46 ? 431  ALA A O     1 
ATOM   3442 C  CB    . ALA A 1 434 ? 44.740 1.421   -25.761 1.00 34.84 ? 431  ALA A CB    1 
ATOM   3443 N  N     . SER A 1 435 ? 43.508 4.430   -25.731 1.00 27.26 ? 432  SER A N     1 
ATOM   3444 C  CA    . SER A 1 435 ? 42.882 5.550   -26.433 1.00 39.18 ? 432  SER A CA    1 
ATOM   3445 C  C     . SER A 1 435 ? 43.914 6.522   -26.997 1.00 38.56 ? 432  SER A C     1 
ATOM   3446 O  O     . SER A 1 435 ? 43.562 7.599   -27.470 1.00 50.86 ? 432  SER A O     1 
ATOM   3447 C  CB    . SER A 1 435 ? 41.932 6.294   -25.498 1.00 39.33 ? 432  SER A CB    1 
ATOM   3448 O  OG    . SER A 1 435 ? 42.664 6.977   -24.493 1.00 41.92 ? 432  SER A OG    1 
ATOM   3449 O  OXT   . SER A 1 435 ? 45.116 6.264   -26.986 1.00 44.88 ? 432  SER A OXT   1 
ATOM   3450 O  "O3'" . DC  B 2 1   ? 27.879 4.685   11.572  1.00 55.28 ? 1    DC  T "O3'" 1 
ATOM   3451 P  P     . DA  B 2 2   ? 28.181 4.342   13.116  1.00 81.85 ? 2    DA  T P     1 
ATOM   3452 O  OP1   . DA  B 2 2   ? 28.246 2.868   13.256  1.00 74.79 ? 2    DA  T OP1   1 
ATOM   3453 O  OP2   . DA  B 2 2   ? 27.237 5.128   13.943  1.00 67.19 ? 2    DA  T OP2   1 
ATOM   3454 O  "O5'" . DA  B 2 2   ? 29.635 4.958   13.377  1.00 63.61 ? 2    DA  T "O5'" 1 
ATOM   3455 C  "C5'" . DA  B 2 2   ? 30.739 4.583   12.558  1.00 55.67 ? 2    DA  T "C5'" 1 
ATOM   3456 C  "C4'" . DA  B 2 2   ? 32.013 5.278   13.018  1.00 51.40 ? 2    DA  T "C4'" 1 
ATOM   3457 O  "O4'" . DA  B 2 2   ? 31.933 6.696   12.726  1.00 47.89 ? 2    DA  T "O4'" 1 
ATOM   3458 C  "C3'" . DA  B 2 2   ? 32.296 5.190   14.514  1.00 52.59 ? 2    DA  T "C3'" 1 
ATOM   3459 O  "O3'" . DA  B 2 2   ? 33.680 5.224   14.728  1.00 51.18 ? 2    DA  T "O3'" 1 
ATOM   3460 C  "C2'" . DA  B 2 2   ? 31.641 6.451   15.050  1.00 49.38 ? 2    DA  T "C2'" 1 
ATOM   3461 C  "C1'" . DA  B 2 2   ? 31.956 7.433   13.935  1.00 42.04 ? 2    DA  T "C1'" 1 
ATOM   3462 N  N9    . DA  B 2 2   ? 30.989 8.506   13.829  1.00 38.23 ? 2    DA  T N9    1 
ATOM   3463 C  C8    . DA  B 2 2   ? 29.730 8.547   14.365  1.00 38.54 ? 2    DA  T C8    1 
ATOM   3464 N  N7    . DA  B 2 2   ? 29.083 9.658   14.101  1.00 38.81 ? 2    DA  T N7    1 
ATOM   3465 C  C5    . DA  B 2 2   ? 29.985 10.389  13.339  1.00 39.42 ? 2    DA  T C5    1 
ATOM   3466 C  C6    . DA  B 2 2   ? 29.914 11.658  12.743  1.00 36.74 ? 2    DA  T C6    1 
ATOM   3467 N  N6    . DA  B 2 2   ? 28.838 12.451  12.827  1.00 34.64 ? 2    DA  T N6    1 
ATOM   3468 N  N1    . DA  B 2 2   ? 30.994 12.084  12.052  1.00 37.01 ? 2    DA  T N1    1 
ATOM   3469 C  C2    . DA  B 2 2   ? 32.065 11.286  11.968  1.00 34.42 ? 2    DA  T C2    1 
ATOM   3470 N  N3    . DA  B 2 2   ? 32.248 10.080  12.487  1.00 35.47 ? 2    DA  T N3    1 
ATOM   3471 C  C4    . DA  B 2 2   ? 31.161 9.688   13.167  1.00 38.93 ? 2    DA  T C4    1 
ATOM   3472 P  P     A DT  B 2 3   ? 34.467 3.896   15.168  0.50 49.16 ? 3    DT  T P     1 
ATOM   3473 P  P     B DT  B 2 3   ? 34.461 3.855   15.014  0.50 49.23 ? 3    DT  T P     1 
ATOM   3474 O  OP1   A DT  B 2 3   ? 33.458 2.900   15.597  0.50 51.79 ? 3    DT  T OP1   1 
ATOM   3475 O  OP1   B DT  B 2 3   ? 33.456 2.776   15.152  0.50 50.79 ? 3    DT  T OP1   1 
ATOM   3476 O  OP2   A DT  B 2 3   ? 35.542 4.321   16.092  0.50 47.74 ? 3    DT  T OP2   1 
ATOM   3477 O  OP2   B DT  B 2 3   ? 35.433 4.126   16.098  0.50 47.83 ? 3    DT  T OP2   1 
ATOM   3478 O  "O5'" A DT  B 2 3   ? 35.157 3.379   13.816  0.50 46.44 ? 3    DT  T "O5'" 1 
ATOM   3479 O  "O5'" B DT  B 2 3   ? 35.263 3.593   13.662  0.50 46.20 ? 3    DT  T "O5'" 1 
ATOM   3480 C  "C5'" A DT  B 2 3   ? 36.550 3.616   13.581  0.50 45.14 ? 3    DT  T "C5'" 1 
ATOM   3481 C  "C5'" B DT  B 2 3   ? 36.638 3.876   13.616  0.50 44.93 ? 3    DT  T "C5'" 1 
ATOM   3482 C  "C4'" A DT  B 2 3   ? 36.748 4.781   12.627  0.50 43.28 ? 3    DT  T "C4'" 1 
ATOM   3483 C  "C4'" B DT  B 2 3   ? 36.955 4.909   12.553  0.50 42.91 ? 3    DT  T "C4'" 1 
ATOM   3484 O  "O4'" A DT  B 2 3   ? 38.163 4.950   12.352  0.50 42.66 ? 3    DT  T "O4'" 1 
ATOM   3485 O  "O4'" B DT  B 2 3   ? 38.376 4.850   12.283  0.50 42.97 ? 3    DT  T "O4'" 1 
ATOM   3486 C  "C3'" A DT  B 2 3   ? 36.056 4.620   11.274  0.50 44.26 ? 3    DT  T "C3'" 1 
ATOM   3487 C  "C3'" B DT  B 2 3   ? 36.234 4.707   11.209  0.50 44.04 ? 3    DT  T "C3'" 1 
ATOM   3488 O  "O3'" A DT  B 2 3   ? 35.270 5.757   10.981  0.50 41.08 ? 3    DT  T "O3'" 1 
ATOM   3489 O  "O3'" B DT  B 2 3   ? 35.272 5.754   10.988  0.50 41.08 ? 3    DT  T "O3'" 1 
ATOM   3490 C  "C2'" A DT  B 2 3   ? 37.201 4.460   10.275  0.50 38.32 ? 3    DT  T "C2'" 1 
ATOM   3491 C  "C2'" B DT  B 2 3   ? 37.349 4.745   10.162  0.50 38.05 ? 3    DT  T "C2'" 1 
ATOM   3492 C  "C1'" A DT  B 2 3   ? 38.364 5.151   10.969  0.50 40.50 ? 3    DT  T "C1'" 1 
ATOM   3493 C  "C1'" B DT  B 2 3   ? 38.609 4.433   10.957  0.50 40.89 ? 3    DT  T "C1'" 1 
ATOM   3494 N  N1    A DT  B 2 3   ? 39.681 4.554   10.592  0.50 37.80 ? 3    DT  T N1    1 
ATOM   3495 N  N1    B DT  B 2 3   ? 39.023 2.970   10.932  0.50 36.44 ? 3    DT  T N1    1 
ATOM   3496 C  C2    A DT  B 2 3   ? 40.693 5.359   10.102  0.50 34.59 ? 3    DT  T C2    1 
ATOM   3497 C  C2    B DT  B 2 3   ? 40.296 2.646   10.515  0.50 36.43 ? 3    DT  T C2    1 
ATOM   3498 O  O2    A DT  B 2 3   ? 40.589 6.568   9.969   0.50 33.59 ? 3    DT  T O2    1 
ATOM   3499 O  O2    B DT  B 2 3   ? 41.120 3.478   10.172  0.50 37.75 ? 3    DT  T O2    1 
ATOM   3500 N  N3    A DT  B 2 3   ? 41.846 4.691   9.781   0.50 30.19 ? 3    DT  T N3    1 
ATOM   3501 N  N3    B DT  B 2 3   ? 40.574 1.303   10.514  0.50 39.88 ? 3    DT  T N3    1 
ATOM   3502 C  C4    A DT  B 2 3   ? 42.080 3.327   9.891   0.50 33.72 ? 3    DT  T C4    1 
ATOM   3503 C  C4    B DT  B 2 3   ? 39.726 0.271   10.876  0.50 38.69 ? 3    DT  T C4    1 
ATOM   3504 O  O4    A DT  B 2 3   ? 43.149 2.816   9.581   0.50 32.68 ? 3    DT  T O4    1 
ATOM   3505 O  O4    B DT  B 2 3   ? 40.069 -0.906  10.839  0.50 38.30 ? 3    DT  T O4    1 
ATOM   3506 C  C5    A DT  B 2 3   ? 40.978 2.548   10.401  0.50 36.11 ? 3    DT  T C5    1 
ATOM   3507 C  C5    B DT  B 2 3   ? 38.407 0.677   11.297  0.50 40.50 ? 3    DT  T C5    1 
ATOM   3508 C  C7    A DT  B 2 3   ? 41.118 1.063   10.569  0.50 39.41 ? 3    DT  T C7    1 
ATOM   3509 C  C7    B DT  B 2 3   ? 37.398 -0.351  11.711  0.50 34.65 ? 3    DT  T C7    1 
ATOM   3510 C  C6    A DT  B 2 3   ? 39.849 3.191   10.721  0.50 36.39 ? 3    DT  T C6    1 
ATOM   3511 C  C6    B DT  B 2 3   ? 38.123 1.987   11.303  0.50 37.89 ? 3    DT  T C6    1 
ATOM   3512 P  P     . DT  B 2 4   ? 34.387 5.779   9.642   1.00 42.56 ? 4    DT  T P     1 
ATOM   3513 O  OP1   . DT  B 2 4   ? 33.304 6.771   9.816   1.00 40.74 ? 4    DT  T OP1   1 
ATOM   3514 O  OP2   . DT  B 2 4   ? 34.107 4.381   9.265   1.00 47.59 ? 4    DT  T OP2   1 
ATOM   3515 O  "O5'" . DT  B 2 4   ? 35.379 6.343   8.531   1.00 33.59 ? 4    DT  T "O5'" 1 
ATOM   3516 C  "C5'" . DT  B 2 4   ? 35.861 7.658   8.619   1.00 20.65 ? 4    DT  T "C5'" 1 
ATOM   3517 C  "C4'" . DT  B 2 4   ? 36.616 8.014   7.353   1.00 21.24 ? 4    DT  T "C4'" 1 
ATOM   3518 O  "O4'" . DT  B 2 4   ? 37.858 7.267   7.289   1.00 21.21 ? 4    DT  T "O4'" 1 
ATOM   3519 C  "C3'" . DT  B 2 4   ? 35.889 7.712   6.047   1.00 18.44 ? 4    DT  T "C3'" 1 
ATOM   3520 O  "O3'" . DT  B 2 4   ? 36.211 8.746   5.136   1.00 16.21 ? 4    DT  T "O3'" 1 
ATOM   3521 C  "C2'" . DT  B 2 4   ? 36.489 6.364   5.625   1.00 20.72 ? 4    DT  T "C2'" 1 
ATOM   3522 C  "C1'" . DT  B 2 4   ? 37.926 6.547   6.080   1.00 17.86 ? 4    DT  T "C1'" 1 
ATOM   3523 N  N1    . DT  B 2 4   ? 38.688 5.299   6.341   1.00 21.93 ? 4    DT  T N1    1 
ATOM   3524 C  C2    . DT  B 2 4   ? 40.009 5.286   6.007   1.00 17.18 ? 4    DT  T C2    1 
ATOM   3525 O  O2    . DT  B 2 4   ? 40.552 6.229   5.468   1.00 16.34 ? 4    DT  T O2    1 
ATOM   3526 N  N3    . DT  B 2 4   ? 40.669 4.128   6.300   1.00 19.80 ? 4    DT  T N3    1 
ATOM   3527 C  C4    . DT  B 2 4   ? 40.157 3.004   6.901   1.00 22.87 ? 4    DT  T C4    1 
ATOM   3528 O  O4    . DT  B 2 4   ? 40.847 2.012   7.129   1.00 20.60 ? 4    DT  T O4    1 
ATOM   3529 C  C5    . DT  B 2 4   ? 38.755 3.082   7.254   1.00 25.98 ? 4    DT  T C5    1 
ATOM   3530 C  C7    . DT  B 2 4   ? 38.076 1.909   7.905   1.00 25.06 ? 4    DT  T C7    1 
ATOM   3531 C  C6    . DT  B 2 4   ? 38.093 4.221   6.961   1.00 21.53 ? 4    DT  T C6    1 
ATOM   3532 P  P     . DA  B 2 5   ? 35.597 8.781   3.653   1.00 17.29 ? 5    DA  T P     1 
ATOM   3533 O  OP1   . DA  B 2 5   ? 35.317 10.198  3.362   1.00 19.45 ? 5    DA  T OP1   1 
ATOM   3534 O  OP2   . DA  B 2 5   ? 34.528 7.755   3.537   1.00 16.30 ? 5    DA  T OP2   1 
ATOM   3535 O  "O5'" . DA  B 2 5   ? 36.820 8.309   2.748   1.00 13.79 ? 5    DA  T "O5'" 1 
ATOM   3536 C  "C5'" . DA  B 2 5   ? 37.957 9.171   2.594   1.00 14.38 ? 5    DA  T "C5'" 1 
ATOM   3537 C  "C4'" . DA  B 2 5   ? 38.923 8.588   1.588   1.00 14.86 ? 5    DA  T "C4'" 1 
ATOM   3538 O  "O4'" . DA  B 2 5   ? 39.546 7.386   2.143   1.00 15.20 ? 5    DA  T "O4'" 1 
ATOM   3539 C  "C3'" . DA  B 2 5   ? 38.283 8.146   0.273   1.00 13.62 ? 5    DA  T "C3'" 1 
ATOM   3540 O  "O3'" . DA  B 2 5   ? 39.173 8.379   -0.787  1.00 14.47 ? 5    DA  T "O3'" 1 
ATOM   3541 C  "C2'" . DA  B 2 5   ? 38.083 6.647   0.493   1.00 19.69 ? 5    DA  T "C2'" 1 
ATOM   3542 C  "C1'" . DA  B 2 5   ? 39.362 6.317   1.250   1.00 19.55 ? 5    DA  T "C1'" 1 
ATOM   3543 N  N9    . DA  B 2 5   ? 39.298 5.076   2.013   1.00 13.77 ? 5    DA  T N9    1 
ATOM   3544 C  C8    . DA  B 2 5   ? 38.223 4.571   2.679   1.00 14.77 ? 5    DA  T C8    1 
ATOM   3545 N  N7    . DA  B 2 5   ? 38.462 3.436   3.290   1.00 19.83 ? 5    DA  T N7    1 
ATOM   3546 C  C5    . DA  B 2 5   ? 39.794 3.182   3.012   1.00 15.85 ? 5    DA  T C5    1 
ATOM   3547 C  C6    . DA  B 2 5   ? 40.649 2.125   3.366   1.00 18.17 ? 5    DA  T C6    1 
ATOM   3548 N  N6    . DA  B 2 5   ? 40.268 1.095   4.114   1.00 18.15 ? 5    DA  T N6    1 
ATOM   3549 N  N1    . DA  B 2 5   ? 41.923 2.178   2.930   1.00 15.95 ? 5    DA  T N1    1 
ATOM   3550 C  C2    . DA  B 2 5   ? 42.302 3.221   2.180   1.00 13.14 ? 5    DA  T C2    1 
ATOM   3551 N  N3    . DA  B 2 5   ? 41.586 4.263   1.777   1.00 17.25 ? 5    DA  T N3    1 
ATOM   3552 C  C4    . DA  B 2 5   ? 40.328 4.180   2.229   1.00 17.02 ? 5    DA  T C4    1 
ATOM   3553 P  P     . DT  B 2 6   ? 38.640 8.383   -2.300  1.00 16.04 ? 6    DT  T P     1 
ATOM   3554 O  OP1   . DT  B 2 6   ? 39.789 8.812   -3.115  1.00 16.57 ? 6    DT  T OP1   1 
ATOM   3555 O  OP2   . DT  B 2 6   ? 37.339 9.082   -2.373  1.00 15.14 ? 6    DT  T OP2   1 
ATOM   3556 O  "O5'" . DT  B 2 6   ? 38.286 6.849   -2.563  1.00 18.03 ? 6    DT  T "O5'" 1 
ATOM   3557 C  "C5'" . DT  B 2 6   ? 38.987 6.098   -3.511  1.00 21.22 ? 6    DT  T "C5'" 1 
ATOM   3558 C  "C4'" . DT  B 2 6   ? 40.194 5.400   -2.901  1.00 21.27 ? 6    DT  T "C4'" 1 
ATOM   3559 O  "O4'" . DT  B 2 6   ? 39.829 4.692   -1.699  1.00 21.57 ? 6    DT  T "O4'" 1 
ATOM   3560 C  "C3'" . DT  B 2 6   ? 40.785 4.350   -3.815  1.00 20.76 ? 6    DT  T "C3'" 1 
ATOM   3561 O  "O3'" . DT  B 2 6   ? 41.846 4.922   -4.515  1.00 16.47 ? 6    DT  T "O3'" 1 
ATOM   3562 C  "C2'" . DT  B 2 6   ? 41.257 3.227   -2.878  1.00 20.78 ? 6    DT  T "C2'" 1 
ATOM   3563 C  "C1'" . DT  B 2 6   ? 40.754 3.656   -1.500  1.00 21.27 ? 6    DT  T "C1'" 1 
ATOM   3564 N  N1    . DT  B 2 6   ? 40.090 2.562   -0.734  1.00 20.34 ? 6    DT  T N1    1 
ATOM   3565 C  C2    . DT  B 2 6   ? 40.836 1.482   -0.328  1.00 15.85 ? 6    DT  T C2    1 
ATOM   3566 O  O2    . DT  B 2 6   ? 42.022 1.357   -0.591  1.00 20.73 ? 6    DT  T O2    1 
ATOM   3567 N  N3    . DT  B 2 6   ? 40.145 0.549   0.410   1.00 18.25 ? 6    DT  T N3    1 
ATOM   3568 C  C4    . DT  B 2 6   ? 38.810 0.591   0.763   1.00 20.29 ? 6    DT  T C4    1 
ATOM   3569 O  O4    . DT  B 2 6   ? 38.279 -0.289  1.425   1.00 22.24 ? 6    DT  T O4    1 
ATOM   3570 C  C5    . DT  B 2 6   ? 38.093 1.761   0.317   1.00 20.05 ? 6    DT  T C5    1 
ATOM   3571 C  C7    . DT  B 2 6   ? 36.640 1.925   0.654   1.00 21.88 ? 6    DT  T C7    1 
ATOM   3572 C  C6    . DT  B 2 6   ? 38.764 2.678   -0.398  1.00 17.20 ? 6    DT  T C6    1 
ATOM   3573 P  P     . DG  B 2 7   ? 42.018 4.596   -6.067  1.00 18.97 ? 7    DG  T P     1 
ATOM   3574 O  OP1   . DG  B 2 7   ? 43.185 5.383   -6.520  1.00 21.06 ? 7    DG  T OP1   1 
ATOM   3575 O  OP2   . DG  B 2 7   ? 40.731 4.636   -6.793  1.00 18.24 ? 7    DG  T OP2   1 
ATOM   3576 O  "O5'" . DG  B 2 7   ? 42.366 3.032   -6.066  1.00 21.85 ? 7    DG  T "O5'" 1 
ATOM   3577 C  "C5'" . DG  B 2 7   ? 43.640 2.595   -5.678  1.00 30.19 ? 7    DG  T "C5'" 1 
ATOM   3578 C  "C4'" . DG  B 2 7   ? 43.691 1.079   -5.662  1.00 17.71 ? 7    DG  T "C4'" 1 
ATOM   3579 O  "O4'" . DG  B 2 7   ? 43.015 0.579   -4.495  1.00 20.67 ? 7    DG  T "O4'" 1 
ATOM   3580 C  "C3'" . DG  B 2 7   ? 43.035 0.384   -6.867  1.00 26.98 ? 7    DG  T "C3'" 1 
ATOM   3581 O  "O3'" . DG  B 2 7   ? 44.006 -0.399  -7.526  1.00 25.21 ? 7    DG  T "O3'" 1 
ATOM   3582 C  "C2'" . DG  B 2 7   ? 41.934 -0.481  -6.239  1.00 22.96 ? 7    DG  T "C2'" 1 
ATOM   3583 C  "C1'" . DG  B 2 7   ? 42.452 -0.656  -4.824  1.00 23.87 ? 7    DG  T "C1'" 1 
ATOM   3584 N  N9    . DG  B 2 7   ? 41.413 -0.989  -3.853  1.00 21.52 ? 7    DG  T N9    1 
ATOM   3585 C  C8    . DG  B 2 7   ? 40.228 -0.329  -3.632  1.00 16.53 ? 7    DG  T C8    1 
ATOM   3586 N  N7    . DG  B 2 7   ? 39.497 -0.876  -2.696  1.00 20.07 ? 7    DG  T N7    1 
ATOM   3587 C  C5    . DG  B 2 7   ? 40.243 -1.970  -2.281  1.00 18.44 ? 7    DG  T C5    1 
ATOM   3588 C  C6    . DG  B 2 7   ? 39.958 -2.945  -1.299  1.00 16.62 ? 7    DG  T C6    1 
ATOM   3589 O  O6    . DG  B 2 7   ? 38.949 -3.031  -0.567  1.00 18.73 ? 7    DG  T O6    1 
ATOM   3590 N  N1    . DG  B 2 7   ? 40.984 -3.887  -1.199  1.00 14.14 ? 7    DG  T N1    1 
ATOM   3591 C  C2    . DG  B 2 7   ? 42.132 -3.883  -1.952  1.00 14.79 ? 7    DG  T C2    1 
ATOM   3592 N  N2    . DG  B 2 7   ? 43.016 -4.871  -1.711  1.00 18.31 ? 7    DG  T N2    1 
ATOM   3593 N  N3    . DG  B 2 7   ? 42.407 -2.973  -2.879  1.00 18.29 ? 7    DG  T N3    1 
ATOM   3594 C  C4    . DG  B 2 7   ? 41.421 -2.054  -2.986  1.00 22.47 ? 7    DG  T C4    1 
ATOM   3595 P  P     . DA  B 2 8   ? 43.638 -1.317  -8.792  1.00 22.27 ? 8    DA  T P     1 
ATOM   3596 O  OP1   . DA  B 2 8   ? 44.697 -1.095  -9.787  1.00 22.56 ? 8    DA  T OP1   1 
ATOM   3597 O  OP2   . DA  B 2 8   ? 42.196 -1.227  -9.171  1.00 26.21 ? 8    DA  T OP2   1 
ATOM   3598 O  "O5'" . DA  B 2 8   ? 43.943 -2.795  -8.266  1.00 17.65 ? 8    DA  T "O5'" 1 
ATOM   3599 C  "C5'" . DA  B 2 8   ? 45.250 -3.115  -7.794  1.00 14.88 ? 8    DA  T "C5'" 1 
ATOM   3600 C  "C4'" . DA  B 2 8   ? 45.308 -4.560  -7.362  1.00 24.71 ? 8    DA  T "C4'" 1 
ATOM   3601 O  "O4'" . DA  B 2 8   ? 44.430 -4.736  -6.222  1.00 21.39 ? 8    DA  T "O4'" 1 
ATOM   3602 C  "C3'" . DA  B 2 8   ? 44.847 -5.561  -8.430  1.00 27.61 ? 8    DA  T "C3'" 1 
ATOM   3603 O  "O3'" . DA  B 2 8   ? 45.721 -6.688  -8.464  1.00 26.70 ? 8    DA  T "O3'" 1 
ATOM   3604 C  "C2'" . DA  B 2 8   ? 43.447 -5.956  -7.974  1.00 22.02 ? 8    DA  T "C2'" 1 
ATOM   3605 C  "C1'" . DA  B 2 8   ? 43.534 -5.799  -6.461  1.00 23.50 ? 8    DA  T "C1'" 1 
ATOM   3606 N  N9    . DA  B 2 8   ? 42.249 -5.453  -5.870  1.00 18.82 ? 8    DA  T N9    1 
ATOM   3607 C  C8    . DA  B 2 8   ? 41.434 -4.423  -6.245  1.00 23.43 ? 8    DA  T C8    1 
ATOM   3608 N  N7    . DA  B 2 8   ? 40.326 -4.351  -5.559  1.00 16.31 ? 8    DA  T N7    1 
ATOM   3609 C  C5    . DA  B 2 8   ? 40.414 -5.400  -4.666  1.00 19.39 ? 8    DA  T C5    1 
ATOM   3610 C  C6    . DA  B 2 8   ? 39.544 -5.859  -3.658  1.00 18.90 ? 8    DA  T C6    1 
ATOM   3611 N  N6    . DA  B 2 8   ? 38.365 -5.279  -3.386  1.00 20.40 ? 8    DA  T N6    1 
ATOM   3612 N  N1    . DA  B 2 8   ? 39.927 -6.949  -2.941  1.00 18.09 ? 8    DA  T N1    1 
ATOM   3613 C  C2    . DA  B 2 8   ? 41.101 -7.522  -3.225  1.00 14.08 ? 8    DA  T C2    1 
ATOM   3614 N  N3    . DA  B 2 8   ? 42.010 -7.180  -4.153  1.00 13.82 ? 8    DA  T N3    1 
ATOM   3615 C  C4    . DA  B 2 8   ? 41.594 -6.100  -4.849  1.00 13.30 ? 8    DA  T C4    1 
ATOM   3616 P  P     . DC  B 2 9   ? 45.570 -7.806  -9.612  1.00 23.13 ? 9    DC  T P     1 
ATOM   3617 O  OP1   . DC  B 2 9   ? 46.935 -8.328  -9.839  1.00 29.99 ? 9    DC  T OP1   1 
ATOM   3618 O  OP2   . DC  B 2 9   ? 44.762 -7.311  -10.749 1.00 26.51 ? 9    DC  T OP2   1 
ATOM   3619 O  "O5'" . DC  B 2 9   ? 44.699 -8.934  -8.905  1.00 20.02 ? 9    DC  T "O5'" 1 
ATOM   3620 C  "C5'" . DC  B 2 9   ? 45.196 -9.540  -7.740  1.00 20.09 ? 9    DC  T "C5'" 1 
ATOM   3621 C  "C4'" . DC  B 2 9   ? 44.152 -10.428 -7.150  1.00 21.61 ? 9    DC  T "C4'" 1 
ATOM   3622 O  "O4'" . DC  B 2 9   ? 43.064 -9.629  -6.618  1.00 25.94 ? 9    DC  T "O4'" 1 
ATOM   3623 C  "C3'" . DC  B 2 9   ? 43.517 -11.388 -8.152  1.00 27.96 ? 9    DC  T "C3'" 1 
ATOM   3624 O  "O3'" . DC  B 2 9   ? 43.454 -12.648 -7.554  1.00 31.25 ? 9    DC  T "O3'" 1 
ATOM   3625 C  "C2'" . DC  B 2 9   ? 42.122 -10.789 -8.368  1.00 22.77 ? 9    DC  T "C2'" 1 
ATOM   3626 C  "C1'" . DC  B 2 9   ? 41.858 -10.250 -6.981  1.00 27.03 ? 9    DC  T "C1'" 1 
ATOM   3627 N  N1    . DC  B 2 9   ? 40.741 -9.269  -6.900  1.00 19.94 ? 9    DC  T N1    1 
ATOM   3628 C  C2    . DC  B 2 9   ? 39.821 -9.386  -5.861  1.00 19.84 ? 9    DC  T C2    1 
ATOM   3629 O  O2    . DC  B 2 9   ? 39.977 -10.285 -5.025  1.00 19.58 ? 9    DC  T O2    1 
ATOM   3630 N  N3    . DC  B 2 9   ? 38.801 -8.508  -5.781  1.00 21.45 ? 9    DC  T N3    1 
ATOM   3631 C  C4    . DC  B 2 9   ? 38.668 -7.549  -6.698  1.00 22.82 ? 9    DC  T C4    1 
ATOM   3632 N  N4    . DC  B 2 9   ? 37.637 -6.710  -6.570  1.00 23.60 ? 9    DC  T N4    1 
ATOM   3633 C  C5    . DC  B 2 9   ? 39.590 -7.410  -7.778  1.00 25.49 ? 9    DC  T C5    1 
ATOM   3634 C  C6    . DC  B 2 9   ? 40.607 -8.291  -7.842  1.00 24.79 ? 9    DC  T C6    1 
ATOM   3635 P  P     . DG  B 2 10  ? 43.155 -13.966 -8.412  1.00 28.16 ? 10   DG  T P     1 
ATOM   3636 O  OP1   . DG  B 2 10  ? 44.428 -14.702 -8.517  1.00 40.17 ? 10   DG  T OP1   1 
ATOM   3637 O  OP2   . DG  B 2 10  ? 42.362 -13.648 -9.619  1.00 30.86 ? 10   DG  T OP2   1 
ATOM   3638 O  "O5'" . DG  B 2 10  ? 42.194 -14.781 -7.448  1.00 27.44 ? 10   DG  T "O5'" 1 
ATOM   3639 C  "C5'" . DG  B 2 10  ? 42.349 -14.675 -6.051  1.00 24.32 ? 10   DG  T "C5'" 1 
ATOM   3640 C  "C4'" . DG  B 2 10  ? 41.197 -15.348 -5.338  1.00 27.46 ? 10   DG  T "C4'" 1 
ATOM   3641 O  "O4'" . DG  B 2 10  ? 40.154 -14.376 -5.090  1.00 25.94 ? 10   DG  T "O4'" 1 
ATOM   3642 C  "C3'" . DG  B 2 10  ? 40.535 -16.480 -6.119  1.00 36.53 ? 10   DG  T "C3'" 1 
ATOM   3643 O  "O3'" . DG  B 2 10  ? 40.034 -17.453 -5.216  1.00 32.79 ? 10   DG  T "O3'" 1 
ATOM   3644 C  "C2'" . DG  B 2 10  ? 39.407 -15.765 -6.852  1.00 32.50 ? 10   DG  T "C2'" 1 
ATOM   3645 C  "C1'" . DG  B 2 10  ? 38.995 -14.709 -5.839  1.00 24.27 ? 10   DG  T "C1'" 1 
ATOM   3646 N  N9    . DG  B 2 10  ? 38.470 -13.490 -6.453  1.00 24.19 ? 10   DG  T N9    1 
ATOM   3647 C  C8    . DG  B 2 10  ? 39.084 -12.702 -7.403  1.00 25.76 ? 10   DG  T C8    1 
ATOM   3648 N  N7    . DG  B 2 10  ? 38.365 -11.675 -7.774  1.00 20.51 ? 10   DG  T N7    1 
ATOM   3649 C  C5    . DG  B 2 10  ? 37.199 -11.791 -7.022  1.00 19.26 ? 10   DG  T C5    1 
ATOM   3650 C  C6    . DG  B 2 10  ? 36.052 -10.969 -6.986  1.00 22.00 ? 10   DG  T C6    1 
ATOM   3651 O  O6    . DG  B 2 10  ? 35.824 -9.937  -7.635  1.00 24.71 ? 10   DG  T O6    1 
ATOM   3652 N  N1    . DG  B 2 10  ? 35.103 -11.446 -6.085  1.00 25.78 ? 10   DG  T N1    1 
ATOM   3653 C  C2    . DG  B 2 10  ? 35.244 -12.577 -5.311  1.00 20.90 ? 10   DG  T C2    1 
ATOM   3654 N  N2    . DG  B 2 10  ? 34.213 -12.877 -4.503  1.00 24.78 ? 10   DG  T N2    1 
ATOM   3655 N  N3    . DG  B 2 10  ? 36.311 -13.364 -5.334  1.00 23.21 ? 10   DG  T N3    1 
ATOM   3656 C  C4    . DG  B 2 10  ? 37.252 -12.905 -6.204  1.00 19.74 ? 10   DG  T C4    1 
ATOM   3657 P  P     . DC  B 2 11  ? 39.389 -18.828 -5.748  1.00 32.54 ? 11   DC  T P     1 
ATOM   3658 O  OP1   . DC  B 2 11  ? 39.775 -19.840 -4.742  1.00 42.10 ? 11   DC  T OP1   1 
ATOM   3659 O  OP2   . DC  B 2 11  ? 39.691 -19.071 -7.167  1.00 29.19 ? 11   DC  T OP2   1 
ATOM   3660 O  "O5'" . DC  B 2 11  ? 37.823 -18.570 -5.608  1.00 33.34 ? 11   DC  T "O5'" 1 
ATOM   3661 C  "C5'" . DC  B 2 11  ? 37.277 -18.313 -4.334  1.00 27.24 ? 11   DC  T "C5'" 1 
ATOM   3662 C  "C4'" . DC  B 2 11  ? 35.768 -18.232 -4.409  1.00 25.07 ? 11   DC  T "C4'" 1 
ATOM   3663 O  "O4'" . DC  B 2 11  ? 35.373 -16.971 -4.999  1.00 25.59 ? 11   DC  T "O4'" 1 
ATOM   3664 C  "C3'" . DC  B 2 11  ? 35.090 -19.334 -5.229  1.00 19.93 ? 11   DC  T "C3'" 1 
ATOM   3665 O  "O3'" . DC  B 2 11  ? 34.022 -19.894 -4.446  1.00 18.27 ? 11   DC  T "O3'" 1 
ATOM   3666 C  "C2'" . DC  B 2 11  ? 34.588 -18.602 -6.490  1.00 21.84 ? 11   DC  T "C2'" 1 
ATOM   3667 C  "C1'" . DC  B 2 11  ? 34.393 -17.179 -5.984  1.00 19.67 ? 11   DC  T "C1'" 1 
ATOM   3668 N  N1    . DC  B 2 11  ? 34.577 -16.101 -7.004  1.00 17.18 ? 11   DC  T N1    1 
ATOM   3669 C  C2    . DC  B 2 11  ? 33.572 -15.153 -7.192  1.00 17.43 ? 11   DC  T C2    1 
ATOM   3670 O  O2    . DC  B 2 11  ? 32.512 -15.254 -6.552  1.00 22.83 ? 11   DC  T O2    1 
ATOM   3671 N  N3    . DC  B 2 11  ? 33.775 -14.149 -8.087  1.00 18.24 ? 11   DC  T N3    1 
ATOM   3672 C  C4    . DC  B 2 11  ? 34.924 -14.074 -8.760  1.00 17.88 ? 11   DC  T C4    1 
ATOM   3673 N  N4    . DC  B 2 11  ? 35.076 -13.064 -9.632  1.00 15.81 ? 11   DC  T N4    1 
ATOM   3674 C  C5    . DC  B 2 11  ? 35.972 -15.019 -8.565  1.00 15.77 ? 11   DC  T C5    1 
ATOM   3675 C  C6    . DC  B 2 11  ? 35.761 -16.001 -7.676  1.00 20.03 ? 11   DC  T C6    1 
ATOM   3676 P  P     . DT  B 2 12  ? 33.299 -21.262 -4.892  1.00 18.40 ? 12   DT  T P     1 
ATOM   3677 O  OP1   . DT  B 2 12  ? 32.760 -21.908 -3.669  1.00 21.29 ? 12   DT  T OP1   1 
ATOM   3678 O  OP2   . DT  B 2 12  ? 34.205 -22.000 -5.785  1.00 17.14 ? 12   DT  T OP2   1 
ATOM   3679 O  "O5'" . DT  B 2 12  ? 32.055 -20.755 -5.734  1.00 18.34 ? 12   DT  T "O5'" 1 
ATOM   3680 C  "C5'" . DT  B 2 12  ? 30.943 -20.211 -5.076  1.00 18.61 ? 12   DT  T "C5'" 1 
ATOM   3681 C  "C4'" . DT  B 2 12  ? 29.939 -19.723 -6.090  1.00 26.12 ? 12   DT  T "C4'" 1 
ATOM   3682 O  "O4'" . DT  B 2 12  ? 30.503 -18.598 -6.813  1.00 20.90 ? 12   DT  T "O4'" 1 
ATOM   3683 C  "C3'" . DT  B 2 12  ? 29.554 -20.756 -7.160  1.00 23.88 ? 12   DT  T "C3'" 1 
ATOM   3684 O  "O3'" . DT  B 2 12  ? 28.155 -20.667 -7.423  1.00 22.76 ? 12   DT  T "O3'" 1 
ATOM   3685 C  "C2'" . DT  B 2 12  ? 30.376 -20.309 -8.372  1.00 22.83 ? 12   DT  T "C2'" 1 
ATOM   3686 C  "C1'" . DT  B 2 12  ? 30.276 -18.807 -8.188  1.00 22.13 ? 12   DT  T "C1'" 1 
ATOM   3687 N  N1    . DT  B 2 12  ? 31.244 -18.000 -8.980  1.00 24.60 ? 12   DT  T N1    1 
ATOM   3688 C  C2    . DT  B 2 12  ? 30.876 -16.733 -9.356  1.00 22.64 ? 12   DT  T C2    1 
ATOM   3689 O  O2    . DT  B 2 12  ? 29.806 -16.241 -9.069  1.00 32.11 ? 12   DT  T O2    1 
ATOM   3690 N  N3    . DT  B 2 12  ? 31.803 -16.059 -10.084 1.00 27.78 ? 12   DT  T N3    1 
ATOM   3691 C  C4    . DT  B 2 12  ? 33.038 -16.508 -10.485 1.00 20.12 ? 12   DT  T C4    1 
ATOM   3692 O  O4    . DT  B 2 12  ? 33.791 -15.812 -11.159 1.00 23.80 ? 12   DT  T O4    1 
ATOM   3693 C  C5    . DT  B 2 12  ? 33.379 -17.848 -10.063 1.00 23.31 ? 12   DT  T C5    1 
ATOM   3694 C  C7    . DT  B 2 12  ? 34.702 -18.442 -10.441 1.00 22.08 ? 12   DT  T C7    1 
ATOM   3695 C  C6    . DT  B 2 12  ? 32.472 -18.530 -9.338  1.00 22.44 ? 12   DT  T C6    1 
ATOM   3696 O  "O5'" . DA  C 3 1   ? 29.172 -7.891  -15.212 1.00 38.56 ? 1    DA  P "O5'" 1 
ATOM   3697 C  "C5'" . DA  C 3 1   ? 27.836 -8.037  -15.657 1.00 27.84 ? 1    DA  P "C5'" 1 
ATOM   3698 C  "C4'" . DA  C 3 1   ? 26.950 -8.581  -14.551 1.00 31.35 ? 1    DA  P "C4'" 1 
ATOM   3699 O  "O4'" . DA  C 3 1   ? 27.350 -9.934  -14.224 1.00 36.69 ? 1    DA  P "O4'" 1 
ATOM   3700 C  "C3'" . DA  C 3 1   ? 26.976 -7.790  -13.247 1.00 25.41 ? 1    DA  P "C3'" 1 
ATOM   3701 O  "O3'" A DA  C 3 1   ? 25.662 -7.735  -12.704 0.57 28.36 ? 1    DA  P "O3'" 1 
ATOM   3702 O  "O3'" B DA  C 3 1   ? 25.678 -7.695  -12.692 0.43 28.41 ? 1    DA  P "O3'" 1 
ATOM   3703 C  "C2'" . DA  C 3 1   ? 27.916 -8.585  -12.343 1.00 29.83 ? 1    DA  P "C2'" 1 
ATOM   3704 C  "C1'" . DA  C 3 1   ? 27.854 -10.007 -12.904 1.00 31.27 ? 1    DA  P "C1'" 1 
ATOM   3705 N  N9    . DA  C 3 1   ? 29.168 -10.639 -12.963 1.00 28.74 ? 1    DA  P N9    1 
ATOM   3706 C  C8    . DA  C 3 1   ? 30.216 -10.269 -13.760 1.00 26.34 ? 1    DA  P C8    1 
ATOM   3707 N  N7    . DA  C 3 1   ? 31.287 -11.010 -13.601 1.00 31.91 ? 1    DA  P N7    1 
ATOM   3708 C  C5    . DA  C 3 1   ? 30.915 -11.922 -12.627 1.00 22.94 ? 1    DA  P C5    1 
ATOM   3709 C  C6    . DA  C 3 1   ? 31.606 -12.982 -12.018 1.00 24.51 ? 1    DA  P C6    1 
ATOM   3710 N  N6    . DA  C 3 1   ? 32.865 -13.299 -12.323 1.00 22.77 ? 1    DA  P N6    1 
ATOM   3711 N  N1    . DA  C 3 1   ? 30.950 -13.709 -11.085 1.00 26.42 ? 1    DA  P N1    1 
ATOM   3712 C  C2    . DA  C 3 1   ? 29.685 -13.387 -10.787 1.00 20.08 ? 1    DA  P C2    1 
ATOM   3713 N  N3    . DA  C 3 1   ? 28.928 -12.414 -11.299 1.00 20.46 ? 1    DA  P N3    1 
ATOM   3714 C  C4    . DA  C 3 1   ? 29.615 -11.709 -12.221 1.00 27.04 ? 1    DA  P C4    1 
ATOM   3715 P  P     A DG  C 3 2   ? 25.231 -6.542  -11.712 0.65 35.27 ? 2    DG  P P     1 
ATOM   3716 P  P     B DG  C 3 2   ? 25.333 -6.486  -11.689 0.35 35.23 ? 2    DG  P P     1 
ATOM   3717 O  OP1   A DG  C 3 2   ? 23.759 -6.433  -11.780 0.65 32.04 ? 2    DG  P OP1   1 
ATOM   3718 O  OP1   B DG  C 3 2   ? 23.881 -6.223  -11.777 0.35 32.36 ? 2    DG  P OP1   1 
ATOM   3719 O  OP2   A DG  C 3 2   ? 26.094 -5.372  -11.995 0.65 34.66 ? 2    DG  P OP2   1 
ATOM   3720 O  OP2   B DG  C 3 2   ? 26.313 -5.407  -11.951 0.35 34.39 ? 2    DG  P OP2   1 
ATOM   3721 O  "O5'" A DG  C 3 2   ? 25.620 -7.097  -10.263 0.65 31.48 ? 2    DG  P "O5'" 1 
ATOM   3722 O  "O5'" B DG  C 3 2   ? 25.669 -7.078  -10.241 0.35 31.43 ? 2    DG  P "O5'" 1 
ATOM   3723 C  "C5'" A DG  C 3 2   ? 24.776 -8.044  -9.642  0.65 28.32 ? 2    DG  P "C5'" 1 
ATOM   3724 C  "C5'" B DG  C 3 2   ? 24.801 -8.031  -9.651  0.35 28.35 ? 2    DG  P "C5'" 1 
ATOM   3725 C  "C4'" . DG  C 3 2   ? 25.452 -8.669  -8.441  1.00 25.00 ? 2    DG  P "C4'" 1 
ATOM   3726 O  "O4'" . DG  C 3 2   ? 26.672 -9.327  -8.847  1.00 21.56 ? 2    DG  P "O4'" 1 
ATOM   3727 C  "C3'" . DG  C 3 2   ? 25.830 -7.691  -7.326  1.00 21.60 ? 2    DG  P "C3'" 1 
ATOM   3728 O  "O3'" . DG  C 3 2   ? 25.285 -8.175  -6.122  1.00 29.58 ? 2    DG  P "O3'" 1 
ATOM   3729 C  "C2'" . DG  C 3 2   ? 27.365 -7.707  -7.329  1.00 22.44 ? 2    DG  P "C2'" 1 
ATOM   3730 C  "C1'" . DG  C 3 2   ? 27.658 -9.092  -7.878  1.00 19.90 ? 2    DG  P "C1'" 1 
ATOM   3731 N  N9    . DG  C 3 2   ? 28.980 -9.247  -8.491  1.00 23.33 ? 2    DG  P N9    1 
ATOM   3732 C  C8    . DG  C 3 2   ? 29.623 -8.386  -9.362  1.00 20.55 ? 2    DG  P C8    1 
ATOM   3733 N  N7    . DG  C 3 2   ? 30.799 -8.817  -9.746  1.00 19.89 ? 2    DG  P N7    1 
ATOM   3734 C  C5    . DG  C 3 2   ? 30.939 -10.043 -9.090  1.00 23.86 ? 2    DG  P C5    1 
ATOM   3735 C  C6    . DG  C 3 2   ? 32.005 -10.980 -9.100  1.00 18.53 ? 2    DG  P C6    1 
ATOM   3736 O  O6    . DG  C 3 2   ? 33.090 -10.928 -9.720  1.00 18.53 ? 2    DG  P O6    1 
ATOM   3737 N  N1    . DG  C 3 2   ? 31.727 -12.082 -8.287  1.00 20.42 ? 2    DG  P N1    1 
ATOM   3738 C  C2    . DG  C 3 2   ? 30.571 -12.257 -7.566  1.00 20.82 ? 2    DG  P C2    1 
ATOM   3739 N  N2    . DG  C 3 2   ? 30.483 -13.383 -6.843  1.00 23.71 ? 2    DG  P N2    1 
ATOM   3740 N  N3    . DG  C 3 2   ? 29.573 -11.393 -7.548  1.00 24.68 ? 2    DG  P N3    1 
ATOM   3741 C  C4    . DG  C 3 2   ? 29.824 -10.314 -8.323  1.00 23.01 ? 2    DG  P C4    1 
ATOM   3742 P  P     . DC  C 3 3   ? 25.427 -7.384  -4.733  1.00 31.96 ? 3    DC  P P     1 
ATOM   3743 O  OP1   . DC  C 3 3   ? 24.080 -7.404  -4.130  1.00 38.71 ? 3    DC  P OP1   1 
ATOM   3744 O  OP2   . DC  C 3 3   ? 26.172 -6.118  -4.898  1.00 34.85 ? 3    DC  P OP2   1 
ATOM   3745 O  "O5'" . DC  C 3 3   ? 26.370 -8.354  -3.876  1.00 40.94 ? 3    DC  P "O5'" 1 
ATOM   3746 C  "C5'" . DC  C 3 3   ? 26.240 -9.771  -4.007  1.00 39.65 ? 3    DC  P "C5'" 1 
ATOM   3747 C  "C4'" . DC  C 3 3   ? 27.429 -10.482 -3.383  1.00 36.80 ? 3    DC  P "C4'" 1 
ATOM   3748 O  "O4'" . DC  C 3 3   ? 28.497 -10.570 -4.356  1.00 34.45 ? 3    DC  P "O4'" 1 
ATOM   3749 C  "C3'" . DC  C 3 3   ? 28.015 -9.787  -2.142  1.00 32.85 ? 3    DC  P "C3'" 1 
ATOM   3750 O  "O3'" . DC  C 3 3   ? 27.977 -10.652 -1.018  1.00 41.44 ? 3    DC  P "O3'" 1 
ATOM   3751 C  "C2'" . DC  C 3 3   ? 29.449 -9.436  -2.536  1.00 35.17 ? 3    DC  P "C2'" 1 
ATOM   3752 C  "C1'" . DC  C 3 3   ? 29.727 -10.365 -3.710  1.00 36.01 ? 3    DC  P "C1'" 1 
ATOM   3753 N  N1    . DC  C 3 3   ? 30.669 -9.765  -4.675  1.00 35.11 ? 3    DC  P N1    1 
ATOM   3754 C  C2    . DC  C 3 3   ? 31.832 -10.449 -5.011  1.00 26.06 ? 3    DC  P C2    1 
ATOM   3755 O  O2    . DC  C 3 3   ? 32.035 -11.567 -4.517  1.00 31.85 ? 3    DC  P O2    1 
ATOM   3756 N  N3    . DC  C 3 3   ? 32.701 -9.878  -5.883  1.00 29.43 ? 3    DC  P N3    1 
ATOM   3757 C  C4    . DC  C 3 3   ? 32.441 -8.674  -6.387  1.00 27.45 ? 3    DC  P C4    1 
ATOM   3758 N  N4    . DC  C 3 3   ? 33.327 -8.150  -7.238  1.00 25.98 ? 3    DC  P N4    1 
ATOM   3759 C  C5    . DC  C 3 3   ? 31.258 -7.954  -6.047  1.00 32.99 ? 3    DC  P C5    1 
ATOM   3760 C  C6    . DC  C 3 3   ? 30.412 -8.528  -5.188  1.00 26.29 ? 3    DC  P C6    1 
ATOM   3761 P  P     . DG  C 3 4   ? 28.558 -10.161 0.399   1.00 36.00 ? 4    DG  P P     1 
ATOM   3762 O  OP1   . DG  C 3 4   ? 27.757 -10.851 1.435   1.00 47.87 ? 4    DG  P OP1   1 
ATOM   3763 O  OP2   . DG  C 3 4   ? 28.676 -8.684  0.408   1.00 38.04 ? 4    DG  P OP2   1 
ATOM   3764 O  "O5'" . DG  C 3 4   ? 30.037 -10.765 0.422   1.00 29.86 ? 4    DG  P "O5'" 1 
ATOM   3765 C  "C5'" . DG  C 3 4   ? 30.223 -12.142 0.126   1.00 37.24 ? 4    DG  P "C5'" 1 
ATOM   3766 C  "C4'" . DG  C 3 4   ? 31.688 -12.518 0.213   1.00 40.61 ? 4    DG  P "C4'" 1 
ATOM   3767 O  "O4'" . DG  C 3 4   ? 32.391 -11.980 -0.934  1.00 36.69 ? 4    DG  P "O4'" 1 
ATOM   3768 C  "C3'" . DG  C 3 4   ? 32.401 -11.992 1.458   1.00 35.51 ? 4    DG  P "C3'" 1 
ATOM   3769 O  "O3'" . DG  C 3 4   ? 33.098 -13.044 2.094   1.00 34.32 ? 4    DG  P "O3'" 1 
ATOM   3770 C  "C2'" . DG  C 3 4   ? 33.346 -10.914 0.926   1.00 28.83 ? 4    DG  P "C2'" 1 
ATOM   3771 C  "C1'" . DG  C 3 4   ? 33.570 -11.334 -0.516  1.00 26.85 ? 4    DG  P "C1'" 1 
ATOM   3772 N  N9    . DG  C 3 4   ? 33.812 -10.205 -1.411  1.00 29.03 ? 4    DG  P N9    1 
ATOM   3773 C  C8    . DG  C 3 4   ? 32.980 -9.133  -1.643  1.00 23.77 ? 4    DG  P C8    1 
ATOM   3774 N  N7    . DG  C 3 4   ? 33.460 -8.283  -2.507  1.00 25.37 ? 4    DG  P N7    1 
ATOM   3775 C  C5    . DG  C 3 4   ? 34.685 -8.823  -2.870  1.00 24.57 ? 4    DG  P C5    1 
ATOM   3776 C  C6    . DG  C 3 4   ? 35.658 -8.342  -3.769  1.00 18.80 ? 4    DG  P C6    1 
ATOM   3777 O  O6    . DG  C 3 4   ? 35.634 -7.302  -4.446  1.00 25.95 ? 4    DG  P O6    1 
ATOM   3778 N  N1    . DG  C 3 4   ? 36.757 -9.204  -3.849  1.00 19.74 ? 4    DG  P N1    1 
ATOM   3779 C  C2    . DG  C 3 4   ? 36.891 -10.371 -3.141  1.00 20.01 ? 4    DG  P C2    1 
ATOM   3780 N  N2    . DG  C 3 4   ? 38.015 -11.066 -3.348  1.00 19.24 ? 4    DG  P N2    1 
ATOM   3781 N  N3    . DG  C 3 4   ? 35.987 -10.830 -2.290  1.00 21.88 ? 4    DG  P N3    1 
ATOM   3782 C  C4    . DG  C 3 4   ? 34.912 -10.008 -2.210  1.00 20.78 ? 4    DG  P C4    1 
ATOM   3783 P  P     . DT  C 3 5   ? 33.858 -12.789 3.488   1.00 40.47 ? 5    DT  P P     1 
ATOM   3784 O  OP1   . DT  C 3 5   ? 33.722 -14.022 4.288   1.00 36.39 ? 5    DT  P OP1   1 
ATOM   3785 O  OP2   . DT  C 3 5   ? 33.436 -11.487 4.043   1.00 29.66 ? 5    DT  P OP2   1 
ATOM   3786 O  "O5'" . DT  C 3 5   ? 35.382 -12.602 3.043   1.00 32.71 ? 5    DT  P "O5'" 1 
ATOM   3787 C  "C5'" . DT  C 3 5   ? 35.953 -13.525 2.158   1.00 22.73 ? 5    DT  P "C5'" 1 
ATOM   3788 C  "C4'" . DT  C 3 5   ? 37.384 -13.148 1.833   1.00 19.66 ? 5    DT  P "C4'" 1 
ATOM   3789 O  "O4'" . DT  C 3 5   ? 37.404 -12.110 0.830   1.00 22.07 ? 5    DT  P "O4'" 1 
ATOM   3790 C  "C3'" . DT  C 3 5   ? 38.212 -12.630 3.010   1.00 20.26 ? 5    DT  P "C3'" 1 
ATOM   3791 O  "O3'" . DT  C 3 5   ? 39.411 -13.387 3.090   1.00 16.53 ? 5    DT  P "O3'" 1 
ATOM   3792 C  "C2'" . DT  C 3 5   ? 38.486 -11.159 2.658   1.00 15.52 ? 5    DT  P "C2'" 1 
ATOM   3793 C  "C1'" . DT  C 3 5   ? 38.414 -11.183 1.144   1.00 16.19 ? 5    DT  P "C1'" 1 
ATOM   3794 N  N1    . DT  C 3 5   ? 38.011 -9.905  0.544   1.00 20.46 ? 5    DT  P N1    1 
ATOM   3795 C  C2    . DT  C 3 5   ? 38.828 -9.323  -0.387  1.00 16.53 ? 5    DT  P C2    1 
ATOM   3796 O  O2    . DT  C 3 5   ? 39.897 -9.789  -0.718  1.00 20.34 ? 5    DT  P O2    1 
ATOM   3797 N  N3    . DT  C 3 5   ? 38.360 -8.158  -0.906  1.00 17.93 ? 5    DT  P N3    1 
ATOM   3798 C  C4    . DT  C 3 5   ? 37.163 -7.528  -0.611  1.00 18.01 ? 5    DT  P C4    1 
ATOM   3799 O  O4    . DT  C 3 5   ? 36.833 -6.469  -1.149  1.00 17.11 ? 5    DT  P O4    1 
ATOM   3800 C  C5    . DT  C 3 5   ? 36.341 -8.189  0.376   1.00 18.62 ? 5    DT  P C5    1 
ATOM   3801 C  C7    . DT  C 3 5   ? 35.025 -7.594  0.791   1.00 27.57 ? 5    DT  P C7    1 
ATOM   3802 C  C6    . DT  C 3 5   ? 36.798 -9.342  0.901   1.00 19.12 ? 5    DT  P C6    1 
ATOM   3803 P  P     . DC  C 3 6   ? 40.420 -13.234 4.338   1.00 16.23 ? 6    DC  P P     1 
ATOM   3804 O  OP1   . DC  C 3 6   ? 41.151 -14.518 4.386   1.00 17.21 ? 6    DC  P OP1   1 
ATOM   3805 O  OP2   . DC  C 3 6   ? 39.740 -12.694 5.526   1.00 17.32 ? 6    DC  P OP2   1 
ATOM   3806 O  "O5'" . DC  C 3 6   ? 41.443 -12.122 3.855   1.00 16.98 ? 6    DC  P "O5'" 1 
ATOM   3807 C  "C5'" . DC  C 3 6   ? 42.313 -12.392 2.797   1.00 12.95 ? 6    DC  P "C5'" 1 
ATOM   3808 C  "C4'" . DC  C 3 6   ? 43.045 -11.133 2.421   1.00 16.38 ? 6    DC  P "C4'" 1 
ATOM   3809 O  "O4'" . DC  C 3 6   ? 42.129 -10.219 1.779   1.00 17.26 ? 6    DC  P "O4'" 1 
ATOM   3810 C  "C3'" . DC  C 3 6   ? 43.641 -10.371 3.613   1.00 18.66 ? 6    DC  P "C3'" 1 
ATOM   3811 O  "O3'" . DC  C 3 6   ? 45.061 -10.450 3.539   1.00 18.51 ? 6    DC  P "O3'" 1 
ATOM   3812 C  "C2'" . DC  C 3 6   ? 43.134 -8.925  3.434   1.00 18.11 ? 6    DC  P "C2'" 1 
ATOM   3813 C  "C1'" . DC  C 3 6   ? 42.603 -8.924  2.000   1.00 16.38 ? 6    DC  P "C1'" 1 
ATOM   3814 N  N1    . DC  C 3 6   ? 41.489 -7.955  1.791   1.00 16.73 ? 6    DC  P N1    1 
ATOM   3815 C  C2    . DC  C 3 6   ? 41.577 -7.014  0.759   1.00 16.57 ? 6    DC  P C2    1 
ATOM   3816 O  O2    . DC  C 3 6   ? 42.558 -7.038  -0.001  1.00 15.00 ? 6    DC  P O2    1 
ATOM   3817 N  N3    . DC  C 3 6   ? 40.560 -6.122  0.601   1.00 17.20 ? 6    DC  P N3    1 
ATOM   3818 C  C4    . DC  C 3 6   ? 39.513 -6.142  1.441   1.00 14.85 ? 6    DC  P C4    1 
ATOM   3819 N  N4    . DC  C 3 6   ? 38.538 -5.240  1.254   1.00 18.30 ? 6    DC  P N4    1 
ATOM   3820 C  C5    . DC  C 3 6   ? 39.419 -7.084  2.509   1.00 17.89 ? 6    DC  P C5    1 
ATOM   3821 C  C6    . DC  C 3 6   ? 40.422 -7.963  2.645   1.00 17.59 ? 6    DC  P C6    1 
ATOM   3822 P  P     . DA  C 3 7   ? 45.998 -9.733  4.633   1.00 15.41 ? 7    DA  P P     1 
ATOM   3823 O  OP1   . DA  C 3 7   ? 47.217 -10.588 4.725   1.00 14.38 ? 7    DA  P OP1   1 
ATOM   3824 O  OP2   . DA  C 3 7   ? 45.218 -9.421  5.850   1.00 18.03 ? 7    DA  P OP2   1 
ATOM   3825 O  "O5'" . DA  C 3 7   ? 46.346 -8.312  3.994   1.00 19.33 ? 7    DA  P "O5'" 1 
ATOM   3826 C  "C5'" . DA  C 3 7   ? 46.988 -8.230  2.754   1.00 17.11 ? 7    DA  P "C5'" 1 
ATOM   3827 C  "C4'" . DA  C 3 7   ? 46.828 -6.837  2.141   1.00 15.52 ? 7    DA  P "C4'" 1 
ATOM   3828 O  "O4'" . DA  C 3 7   ? 45.446 -6.593  1.804   1.00 19.66 ? 7    DA  P "O4'" 1 
ATOM   3829 C  "C3'" . DA  C 3 7   ? 47.145 -5.656  3.036   1.00 21.45 ? 7    DA  P "C3'" 1 
ATOM   3830 O  "O3'" . DA  C 3 7   ? 48.547 -5.469  3.171   1.00 24.81 ? 7    DA  P "O3'" 1 
ATOM   3831 C  "C2'" . DA  C 3 7   ? 46.505 -4.514  2.241   1.00 19.44 ? 7    DA  P "C2'" 1 
ATOM   3832 C  "C1'" . DA  C 3 7   ? 45.309 -5.204  1.572   1.00 15.84 ? 7    DA  P "C1'" 1 
ATOM   3833 N  N9    . DA  C 3 7   ? 44.029 -4.747  2.084   1.00 15.43 ? 7    DA  P N9    1 
ATOM   3834 C  C8    . DA  C 3 7   ? 43.255 -5.329  3.048   1.00 20.16 ? 7    DA  P C8    1 
ATOM   3835 N  N7    . DA  C 3 7   ? 42.145 -4.666  3.303   1.00 20.03 ? 7    DA  P N7    1 
ATOM   3836 C  C5    . DA  C 3 7   ? 42.215 -3.576  2.450   1.00 17.74 ? 7    DA  P C5    1 
ATOM   3837 C  C6    . DA  C 3 7   ? 41.358 -2.493  2.236   1.00 18.62 ? 7    DA  P C6    1 
ATOM   3838 N  N6    . DA  C 3 7   ? 40.215 -2.337  2.893   1.00 17.94 ? 7    DA  P N6    1 
ATOM   3839 N  N1    . DA  C 3 7   ? 41.729 -1.570  1.321   1.00 14.65 ? 7    DA  P N1    1 
ATOM   3840 C  C2    . DA  C 3 7   ? 42.885 -1.732  0.673   1.00 19.30 ? 7    DA  P C2    1 
ATOM   3841 N  N3    . DA  C 3 7   ? 43.780 -2.712  0.799   1.00 17.22 ? 7    DA  P N3    1 
ATOM   3842 C  C4    . DA  C 3 7   ? 43.379 -3.603  1.711   1.00 16.48 ? 7    DA  P C4    1 
ATOM   3843 P  P     A DT  C 3 8   ? 49.104 -4.371  4.209   0.60 22.51 ? 8    DT  P P     1 
ATOM   3844 P  P     B DT  C 3 8   ? 49.124 -4.386  4.210   0.40 22.52 ? 8    DT  P P     1 
ATOM   3845 O  OP1   A DT  C 3 8   ? 50.543 -4.656  4.444   0.60 24.93 ? 8    DT  P OP1   1 
ATOM   3846 O  OP1   B DT  C 3 8   ? 50.584 -4.607  4.336   0.40 24.82 ? 8    DT  P OP1   1 
ATOM   3847 O  OP2   A DT  C 3 8   ? 48.163 -4.267  5.346   0.60 20.93 ? 8    DT  P OP2   1 
ATOM   3848 O  OP2   B DT  C 3 8   ? 48.260 -4.386  5.413   0.40 21.04 ? 8    DT  P OP2   1 
ATOM   3849 O  "O5'" A DT  C 3 8   ? 48.987 -3.001  3.427   0.60 20.90 ? 8    DT  P "O5'" 1 
ATOM   3850 O  "O5'" B DT  C 3 8   ? 48.890 -2.991  3.489   0.40 20.88 ? 8    DT  P "O5'" 1 
ATOM   3851 C  "C5'" A DT  C 3 8   ? 49.572 -2.838  2.151   0.60 19.52 ? 8    DT  P "C5'" 1 
ATOM   3852 C  "C5'" B DT  C 3 8   ? 49.528 -2.687  2.257   0.40 19.45 ? 8    DT  P "C5'" 1 
ATOM   3853 C  "C4'" A DT  C 3 8   ? 49.329 -1.426  1.699   0.60 17.12 ? 8    DT  P "C4'" 1 
ATOM   3854 C  "C4'" B DT  C 3 8   ? 49.297 -1.232  1.950   0.40 17.68 ? 8    DT  P "C4'" 1 
ATOM   3855 O  "O4'" A DT  C 3 8   ? 47.891 -1.217  1.624   0.60 16.50 ? 8    DT  P "O4'" 1 
ATOM   3856 O  "O4'" B DT  C 3 8   ? 47.873 -1.041  1.749   0.40 17.36 ? 8    DT  P "O4'" 1 
ATOM   3857 C  "C3'" A DT  C 3 8   ? 49.871 -0.381  2.684   0.60 17.33 ? 8    DT  P "C3'" 1 
ATOM   3858 C  "C3'" B DT  C 3 8   ? 49.630 -0.018  2.927   0.40 17.07 ? 8    DT  P "C3'" 1 
ATOM   3859 O  "O3'" A DT  C 3 8   ? 50.570 0.652   2.012   0.60 12.76 ? 8    DT  P "O3'" 1 
ATOM   3860 O  "O3'" B DT  C 3 8   ? 50.581 0.723   2.713   0.40 12.45 ? 8    DT  P "O3'" 1 
ATOM   3861 C  "C2'" A DT  C 3 8   ? 48.630 0.143   3.393   0.60 16.64 ? 8    DT  P "C2'" 1 
ATOM   3862 C  "C2'" B DT  C 3 8   ? 48.690 0.770   2.916   0.40 18.29 ? 8    DT  P "C2'" 1 
ATOM   3863 C  "C1'" A DT  C 3 8   ? 47.536 -0.061  2.356   0.60 20.38 ? 8    DT  P "C1'" 1 
ATOM   3864 C  "C1'" B DT  C 3 8   ? 47.418 0.060   2.507   0.40 19.77 ? 8    DT  P "C1'" 1 
ATOM   3865 N  N1    A DT  C 3 8   ? 46.204 -0.258  2.991   0.60 16.45 ? 8    DT  P N1    1 
ATOM   3866 N  N1    B DT  C 3 8   ? 46.071 -0.225  3.017   0.40 16.57 ? 8    DT  P N1    1 
ATOM   3867 C  C2    A DT  C 3 8   ? 45.197 0.650   2.741   0.60 16.51 ? 8    DT  P C2    1 
ATOM   3868 C  C2    B DT  C 3 8   ? 45.031 0.609   2.686   0.40 16.54 ? 8    DT  P C2    1 
ATOM   3869 O  O2    A DT  C 3 8   ? 45.321 1.597   1.982   0.60 18.90 ? 8    DT  P O2    1 
ATOM   3870 O  O2    B DT  C 3 8   ? 45.149 1.559   1.931   0.40 18.98 ? 8    DT  P O2    1 
ATOM   3871 N  N3    A DT  C 3 8   ? 44.026 0.398   3.401   0.60 16.57 ? 8    DT  P N3    1 
ATOM   3872 N  N3    B DT  C 3 8   ? 43.832 0.272   3.251   0.40 16.83 ? 8    DT  P N3    1 
ATOM   3873 C  C4    A DT  C 3 8   ? 43.765 -0.638  4.271   0.60 18.12 ? 8    DT  P C4    1 
ATOM   3874 C  C4    B DT  C 3 8   ? 43.582 -0.780  4.111   0.40 18.03 ? 8    DT  P C4    1 
ATOM   3875 O  O4    A DT  C 3 8   ? 42.677 -0.778  4.819   0.60 18.26 ? 8    DT  P O4    1 
ATOM   3876 O  O4    B DT  C 3 8   ? 42.469 -1.002  4.570   0.40 19.80 ? 8    DT  P O4    1 
ATOM   3877 C  C5    A DT  C 3 8   ? 44.865 -1.541  4.504   0.60 18.11 ? 8    DT  P C5    1 
ATOM   3878 C  C5    B DT  C 3 8   ? 44.724 -1.598  4.435   0.40 18.09 ? 8    DT  P C5    1 
ATOM   3879 C  C7    A DT  C 3 8   ? 44.701 -2.705  5.438   0.60 17.73 ? 8    DT  P C7    1 
ATOM   3880 C  C7    B DT  C 3 8   ? 44.576 -2.770  5.361   0.40 17.81 ? 8    DT  P C7    1 
ATOM   3881 C  C6    A DT  C 3 8   ? 46.020 -1.305  3.866   0.60 17.12 ? 8    DT  P C6    1 
ATOM   3882 C  C6    B DT  C 3 8   ? 45.900 -1.277  3.888   0.40 17.16 ? 8    DT  P C6    1 
ATOM   3883 P  P     B DA  C 3 9   ? 51.144 1.563   3.898   0.40 11.31 ? 9    DA  P P     1 
ATOM   3884 O  OP1   B DA  C 3 9   ? 52.582 1.709   3.612   0.40 14.30 ? 9    DA  P OP1   1 
ATOM   3885 O  OP2   B DA  C 3 9   ? 50.703 0.910   5.099   0.40 14.89 ? 9    DA  P OP2   1 
ATOM   3886 O  "O5'" B DA  C 3 9   ? 50.507 3.019   3.788   0.40 11.54 ? 9    DA  P "O5'" 1 
ATOM   3887 C  "C5'" B DA  C 3 9   ? 50.996 4.059   2.959   0.40 11.74 ? 9    DA  P "C5'" 1 
ATOM   3888 C  "C4'" B DA  C 3 9   ? 50.091 5.270   3.062   0.40 11.62 ? 9    DA  P "C4'" 1 
ATOM   3889 O  "O4'" B DA  C 3 9   ? 48.743 4.889   2.669   0.40 12.22 ? 9    DA  P "O4'" 1 
ATOM   3890 C  "C3'" B DA  C 3 9   ? 49.940 5.835   4.467   0.40 10.39 ? 9    DA  P "C3'" 1 
ATOM   3891 O  "O3'" B DA  C 3 9   ? 50.984 6.773   4.738   0.40 10.76 ? 9    DA  P "O3'" 1 
ATOM   3892 C  "C2'" B DA  C 3 9   ? 48.572 6.512   4.390   0.40 11.33 ? 9    DA  P "C2'" 1 
ATOM   3893 C  "C1'" B DA  C 3 9   ? 47.794 5.547   3.494   0.40 13.16 ? 9    DA  P "C1'" 1 
ATOM   3894 N  N9    B DA  C 3 9   ? 47.028 4.538   4.234   0.40 13.35 ? 9    DA  P N9    1 
ATOM   3895 C  C8    B DA  C 3 9   ? 47.480 3.339   4.715   0.40 15.12 ? 9    DA  P C8    1 
ATOM   3896 N  N7    B DA  C 3 9   ? 46.559 2.636   5.339   0.40 15.04 ? 9    DA  P N7    1 
ATOM   3897 C  C5    B DA  C 3 9   ? 45.424 3.429   5.257   0.40 15.35 ? 9    DA  P C5    1 
ATOM   3898 C  C6    B DA  C 3 9   ? 44.104 3.255   5.724   0.40 15.86 ? 9    DA  P C6    1 
ATOM   3899 N  N6    B DA  C 3 9   ? 43.698 2.175   6.397   0.40 15.75 ? 9    DA  P N6    1 
ATOM   3900 N  N1    B DA  C 3 9   ? 43.215 4.242   5.473   0.40 16.53 ? 9    DA  P N1    1 
ATOM   3901 C  C2    B DA  C 3 9   ? 43.625 5.325   4.802   0.40 14.60 ? 9    DA  P C2    1 
ATOM   3902 N  N3    B DA  C 3 9   ? 44.836 5.599   4.312   0.40 15.04 ? 9    DA  P N3    1 
ATOM   3903 C  C4    B DA  C 3 9   ? 45.696 4.602   4.579   0.40 13.66 ? 9    DA  P C4    1 
HETATM 3904 MN MN    . MN  D 4 .   ? 52.935 0.376   2.055   1.00 12.20 ? 501  MN  A MN    1 
HETATM 3905 CA CA    A CA  E 5 .   ? 54.873 2.636   3.976   0.25 12.72 ? 502  CA  A CA    1 
HETATM 3906 MN MN    B MN  F 4 .   ? 54.886 2.681   3.948   0.75 12.67 ? 503  MN  A MN    1 
HETATM 3907 C  C1    . GOL G 6 .   ? 60.390 -24.947 12.171  1.00 15.50 ? 504  GOL A C1    1 
HETATM 3908 O  O1    . GOL G 6 .   ? 58.997 -24.790 12.259  1.00 16.49 ? 504  GOL A O1    1 
HETATM 3909 C  C2    . GOL G 6 .   ? 60.974 -24.356 10.870  1.00 19.85 ? 504  GOL A C2    1 
HETATM 3910 O  O2    . GOL G 6 .   ? 60.477 -23.060 10.624  1.00 15.13 ? 504  GOL A O2    1 
HETATM 3911 C  C3    . GOL G 6 .   ? 60.739 -25.262 9.654   1.00 22.41 ? 504  GOL A C3    1 
HETATM 3912 O  O3    . GOL G 6 .   ? 61.555 -24.885 8.549   1.00 19.67 ? 504  GOL A O3    1 
HETATM 3913 C  C1    . GOL H 6 .   ? 53.954 16.569  -7.099  1.00 35.21 ? 505  GOL A C1    1 
HETATM 3914 O  O1    . GOL H 6 .   ? 53.891 15.226  -6.681  1.00 16.67 ? 505  GOL A O1    1 
HETATM 3915 C  C2    . GOL H 6 .   ? 54.685 16.630  -8.433  1.00 35.79 ? 505  GOL A C2    1 
HETATM 3916 O  O2    . GOL H 6 .   ? 53.822 16.156  -9.442  1.00 30.51 ? 505  GOL A O2    1 
HETATM 3917 C  C3    . GOL H 6 .   ? 55.122 18.063  -8.733  1.00 28.78 ? 505  GOL A C3    1 
HETATM 3918 O  O3    . GOL H 6 .   ? 55.911 18.067  -9.907  1.00 38.86 ? 505  GOL A O3    1 
HETATM 3919 C  C1    . GOL I 6 .   ? 54.235 28.210  4.685   1.00 29.71 ? 506  GOL A C1    1 
HETATM 3920 O  O1    . GOL I 6 .   ? 52.992 27.765  4.182   1.00 28.64 ? 506  GOL A O1    1 
HETATM 3921 C  C2    . GOL I 6 .   ? 54.815 27.169  5.641   1.00 38.15 ? 506  GOL A C2    1 
HETATM 3922 O  O2    . GOL I 6 .   ? 54.335 25.879  5.321   1.00 40.52 ? 506  GOL A O2    1 
HETATM 3923 C  C3    . GOL I 6 .   ? 56.336 27.180  5.557   1.00 35.94 ? 506  GOL A C3    1 
HETATM 3924 O  O3    . GOL I 6 .   ? 56.881 26.182  6.399   1.00 29.50 ? 506  GOL A O3    1 
HETATM 3925 P  PG    A DTP J 7 .   ? 55.374 2.725   7.385   0.60 11.30 ? 507  DTP A PG    1 
HETATM 3926 O  O1G   A DTP J 7 .   ? 55.251 1.906   6.128   0.60 11.89 ? 507  DTP A O1G   1 
HETATM 3927 O  O2G   A DTP J 7 .   ? 56.693 3.472   7.416   0.60 10.00 ? 507  DTP A O2G   1 
HETATM 3928 O  O3G   A DTP J 7 .   ? 55.211 1.851   8.631   0.60 11.26 ? 507  DTP A O3G   1 
HETATM 3929 P  PB    A DTP J 7 .   ? 53.177 4.103   6.218   0.60 11.98 ? 507  DTP A PB    1 
HETATM 3930 O  O1B   A DTP J 7 .   ? 53.871 4.411   4.906   0.60 10.60 ? 507  DTP A O1B   1 
HETATM 3931 O  O2B   A DTP J 7 .   ? 52.367 5.304   6.648   0.60 10.84 ? 507  DTP A O2B   1 
HETATM 3932 O  O3B   A DTP J 7 .   ? 54.208 3.808   7.410   0.60 11.01 ? 507  DTP A O3B   1 
HETATM 3933 P  PA    A DTP J 7 .   ? 51.705 2.081   4.895   0.60 10.18 ? 507  DTP A PA    1 
HETATM 3934 O  O1A   A DTP J 7 .   ? 52.798 1.821   3.925   0.60 14.44 ? 507  DTP A O1A   1 
HETATM 3935 O  O2A   A DTP J 7 .   ? 50.886 0.913   5.409   0.60 13.42 ? 507  DTP A O2A   1 
HETATM 3936 O  O3A   A DTP J 7 .   ? 52.246 2.822   6.179   0.60 10.75 ? 507  DTP A O3A   1 
HETATM 3937 O  "O5'" A DTP J 7 .   ? 50.713 3.045   4.128   0.60 9.86  ? 507  DTP A "O5'" 1 
HETATM 3938 C  "C5'" A DTP J 7 .   ? 51.150 3.991   3.193   0.60 12.39 ? 507  DTP A "C5'" 1 
HETATM 3939 C  "C4'" A DTP J 7 .   ? 50.205 5.187   3.173   0.60 11.51 ? 507  DTP A "C4'" 1 
HETATM 3940 O  "O4'" A DTP J 7 .   ? 48.904 4.775   2.780   0.60 12.50 ? 507  DTP A "O4'" 1 
HETATM 3941 C  "C3'" A DTP J 7 .   ? 50.092 5.792   4.485   0.60 10.25 ? 507  DTP A "C3'" 1 
HETATM 3942 O  "O3'" A DTP J 7 .   ? 51.049 6.848   4.622   0.60 10.69 ? 507  DTP A "O3'" 1 
HETATM 3943 C  "C2'" A DTP J 7 .   ? 48.725 6.298   4.610   0.60 12.28 ? 507  DTP A "C2'" 1 
HETATM 3944 C  "C1'" A DTP J 7 .   ? 47.970 5.450   3.655   0.60 13.12 ? 507  DTP A "C1'" 1 
HETATM 3945 N  N9    A DTP J 7 .   ? 47.211 4.472   4.344   0.60 13.13 ? 507  DTP A N9    1 
HETATM 3946 C  C8    A DTP J 7 .   ? 47.660 3.295   4.839   0.60 15.19 ? 507  DTP A C8    1 
HETATM 3947 N  N7    A DTP J 7 .   ? 46.664 2.630   5.407   0.60 14.97 ? 507  DTP A N7    1 
HETATM 3948 C  C5    A DTP J 7 .   ? 45.531 3.347   5.291   0.60 15.35 ? 507  DTP A C5    1 
HETATM 3949 C  C6    A DTP J 7 .   ? 44.201 3.173   5.679   0.60 15.74 ? 507  DTP A C6    1 
HETATM 3950 N  N6    A DTP J 7 .   ? 43.810 1.994   6.383   0.60 15.88 ? 507  DTP A N6    1 
HETATM 3951 N  N1    A DTP J 7 .   ? 43.298 4.112   5.395   0.60 16.56 ? 507  DTP A N1    1 
HETATM 3952 C  C2    A DTP J 7 .   ? 43.622 5.248   4.739   0.60 14.58 ? 507  DTP A C2    1 
HETATM 3953 N  N3    A DTP J 7 .   ? 44.914 5.446   4.341   0.60 14.95 ? 507  DTP A N3    1 
HETATM 3954 C  C4    A DTP J 7 .   ? 45.861 4.530   4.609   0.60 13.65 ? 507  DTP A C4    1 
HETATM 3955 P  P1    B DPO K 8 .   ? 53.135 4.192   6.361   0.40 11.84 ? 508  DPO A P1    1 
HETATM 3956 O  O1    B DPO K 8 .   ? 53.696 4.356   4.968   0.40 10.90 ? 508  DPO A O1    1 
HETATM 3957 O  O2    B DPO K 8 .   ? 52.162 3.040   6.427   0.40 11.31 ? 508  DPO A O2    1 
HETATM 3958 O  O3    B DPO K 8 .   ? 52.433 5.453   6.796   0.40 10.83 ? 508  DPO A O3    1 
HETATM 3959 O  O4    B DPO K 8 .   ? 54.271 3.911   7.385   0.40 11.07 ? 508  DPO A O4    1 
HETATM 3960 P  P2    B DPO K 8 .   ? 55.189 2.656   7.284   0.40 11.71 ? 508  DPO A P2    1 
HETATM 3961 O  O5    B DPO K 8 .   ? 55.003 2.027   5.923   0.40 11.76 ? 508  DPO A O5    1 
HETATM 3962 O  O6    B DPO K 8 .   ? 54.793 1.697   8.387   0.40 11.36 ? 508  DPO A O6    1 
HETATM 3963 O  O7    B DPO K 8 .   ? 56.617 3.117   7.463   0.40 11.43 ? 508  DPO A O7    1 
HETATM 3964 MN MN    B MN  L 4 .   ? 51.395 1.005   7.058   0.40 16.50 ? 101  MN  P MN    1 
HETATM 3965 O  O     . HOH M 9 .   ? 76.312 0.744   -6.102  1.00 26.54 ? 601  HOH A O     1 
HETATM 3966 O  O     . HOH M 9 .   ? 67.830 2.194   11.618  1.00 34.95 ? 602  HOH A O     1 
HETATM 3967 O  O     . HOH M 9 .   ? 65.444 -25.286 -0.437  1.00 16.67 ? 603  HOH A O     1 
HETATM 3968 O  O     . HOH M 9 .   ? 68.417 -15.886 -7.707  1.00 24.25 ? 604  HOH A O     1 
HETATM 3969 O  O     . HOH M 9 .   ? 14.055 10.924  5.473   1.00 47.92 ? 605  HOH A O     1 
HETATM 3970 O  O     . HOH M 9 .   ? 64.086 -24.173 -7.622  1.00 43.64 ? 606  HOH A O     1 
HETATM 3971 O  O     . HOH M 9 .   ? 51.267 -11.636 -9.752  1.00 30.47 ? 607  HOH A O     1 
HETATM 3972 O  O     . HOH M 9 .   ? 57.872 12.019  -11.934 1.00 38.70 ? 608  HOH A O     1 
HETATM 3973 O  O     . HOH M 9 .   ? 71.695 -18.922 13.952  1.00 33.20 ? 609  HOH A O     1 
HETATM 3974 O  O     . HOH M 9 .   ? 43.607 9.763   -10.050 1.00 21.78 ? 610  HOH A O     1 
HETATM 3975 O  O     . HOH M 9 .   ? 48.016 -33.436 -3.433  1.00 26.22 ? 611  HOH A O     1 
HETATM 3976 O  O     . HOH M 9 .   ? 48.476 -27.611 18.680  1.00 21.81 ? 612  HOH A O     1 
HETATM 3977 O  O     . HOH M 9 .   ? 43.248 5.540   -8.996  1.00 22.90 ? 613  HOH A O     1 
HETATM 3978 O  O     . HOH M 9 .   ? 53.121 24.211  4.089   1.00 28.74 ? 614  HOH A O     1 
HETATM 3979 O  O     . HOH M 9 .   ? 39.475 -1.765  -14.204 1.00 36.31 ? 615  HOH A O     1 
HETATM 3980 O  O     . HOH M 9 .   ? 64.986 -34.647 -6.121  1.00 46.26 ? 616  HOH A O     1 
HETATM 3981 O  O     . HOH M 9 .   ? 37.291 17.514  -6.564  1.00 29.27 ? 617  HOH A O     1 
HETATM 3982 O  O     . HOH M 9 .   ? 52.634 1.287   9.471   1.00 15.88 ? 618  HOH A O     1 
HETATM 3983 O  O     . HOH M 9 .   ? 57.272 -34.747 8.630   1.00 32.66 ? 619  HOH A O     1 
HETATM 3984 O  O     . HOH M 9 .   ? 68.363 -1.507  -13.910 1.00 29.76 ? 620  HOH A O     1 
HETATM 3985 O  O     A HOH M 9 .   ? 48.580 0.337   9.827   0.51 26.95 ? 621  HOH A O     1 
HETATM 3986 O  O     . HOH M 9 .   ? 60.818 -15.734 13.615  1.00 31.93 ? 622  HOH A O     1 
HETATM 3987 O  O     . HOH M 9 .   ? 47.157 -0.406  -8.591  1.00 29.01 ? 623  HOH A O     1 
HETATM 3988 O  O     . HOH M 9 .   ? 27.426 20.502  -6.639  1.00 41.01 ? 624  HOH A O     1 
HETATM 3989 O  O     . HOH M 9 .   ? 42.346 13.160  -23.559 1.00 32.49 ? 625  HOH A O     1 
HETATM 3990 O  O     . HOH M 9 .   ? 59.365 -32.437 7.849   1.00 30.81 ? 626  HOH A O     1 
HETATM 3991 O  O     . HOH M 9 .   ? 56.135 -2.762  3.918   1.00 23.66 ? 627  HOH A O     1 
HETATM 3992 O  O     . HOH M 9 .   ? 61.133 20.731  12.013  1.00 32.93 ? 628  HOH A O     1 
HETATM 3993 O  O     . HOH M 9 .   ? 55.989 -33.087 2.182   1.00 30.20 ? 629  HOH A O     1 
HETATM 3994 O  O     . HOH M 9 .   ? 44.513 23.234  -5.755  1.00 33.48 ? 630  HOH A O     1 
HETATM 3995 O  O     . HOH M 9 .   ? 57.373 -16.460 -11.201 1.00 25.85 ? 631  HOH A O     1 
HETATM 3996 O  O     . HOH M 9 .   ? 70.751 0.659   11.273  1.00 33.55 ? 632  HOH A O     1 
HETATM 3997 O  O     . HOH M 9 .   ? 37.223 15.905  -4.217  1.00 22.14 ? 633  HOH A O     1 
HETATM 3998 O  O     . HOH M 9 .   ? 69.474 9.958   -8.609  1.00 23.36 ? 634  HOH A O     1 
HETATM 3999 O  O     . HOH M 9 .   ? 61.313 -17.708 -13.109 1.00 38.52 ? 635  HOH A O     1 
HETATM 4000 O  O     . HOH M 9 .   ? 73.474 -20.673 1.084   1.00 25.93 ? 636  HOH A O     1 
HETATM 4001 O  O     . HOH M 9 .   ? 33.173 10.671  5.419   1.00 23.25 ? 637  HOH A O     1 
HETATM 4002 O  O     . HOH M 9 .   ? 34.990 5.474   2.014   1.00 17.25 ? 638  HOH A O     1 
HETATM 4003 O  O     . HOH M 9 .   ? 65.127 19.587  6.224   1.00 36.48 ? 639  HOH A O     1 
HETATM 4004 O  O     . HOH M 9 .   ? 48.533 -3.394  -1.285  1.00 28.39 ? 640  HOH A O     1 
HETATM 4005 O  O     . HOH M 9 .   ? 75.254 0.231   -3.671  1.00 25.53 ? 641  HOH A O     1 
HETATM 4006 O  O     . HOH M 9 .   ? 41.556 -30.349 -6.348  1.00 24.75 ? 642  HOH A O     1 
HETATM 4007 O  O     . HOH M 9 .   ? 37.148 18.554  16.637  1.00 34.62 ? 643  HOH A O     1 
HETATM 4008 O  O     . HOH M 9 .   ? 44.950 -33.098 -2.902  1.00 32.07 ? 644  HOH A O     1 
HETATM 4009 O  O     . HOH M 9 .   ? 60.523 -28.319 8.395   1.00 27.14 ? 645  HOH A O     1 
HETATM 4010 O  O     . HOH M 9 .   ? 47.882 -27.180 -7.163  1.00 30.42 ? 646  HOH A O     1 
HETATM 4011 O  O     . HOH M 9 .   ? 57.861 -23.443 14.168  1.00 12.25 ? 647  HOH A O     1 
HETATM 4012 O  O     . HOH M 9 .   ? 40.581 11.445  -3.578  1.00 16.58 ? 648  HOH A O     1 
HETATM 4013 O  O     . HOH M 9 .   ? 37.103 14.954  -20.473 1.00 40.17 ? 649  HOH A O     1 
HETATM 4014 O  O     . HOH M 9 .   ? 50.811 -1.222  6.896   1.00 26.96 ? 650  HOH A O     1 
HETATM 4015 O  O     . HOH M 9 .   ? 34.342 5.907   -21.926 1.00 33.22 ? 651  HOH A O     1 
HETATM 4016 O  O     . HOH M 9 .   ? 61.689 -31.392 -10.427 1.00 46.76 ? 652  HOH A O     1 
HETATM 4017 O  O     . HOH M 9 .   ? 51.905 5.797   9.331   1.00 13.10 ? 653  HOH A O     1 
HETATM 4018 O  O     . HOH M 9 .   ? 56.396 -13.986 -5.792  1.00 13.28 ? 654  HOH A O     1 
HETATM 4019 O  O     . HOH M 9 .   ? 48.414 -36.739 2.791   1.00 19.07 ? 655  HOH A O     1 
HETATM 4020 O  O     . HOH M 9 .   ? 30.804 1.785   -22.011 1.00 36.26 ? 656  HOH A O     1 
HETATM 4021 O  O     . HOH M 9 .   ? 58.271 -17.965 19.594  1.00 20.47 ? 657  HOH A O     1 
HETATM 4022 O  O     . HOH M 9 .   ? 52.307 20.177  5.066   1.00 17.90 ? 658  HOH A O     1 
HETATM 4023 O  O     . HOH M 9 .   ? 77.996 -0.915  5.343   1.00 21.11 ? 659  HOH A O     1 
HETATM 4024 O  O     . HOH M 9 .   ? 80.846 -15.668 7.675   1.00 31.52 ? 660  HOH A O     1 
HETATM 4025 O  O     . HOH M 9 .   ? 51.925 17.938  -9.824  1.00 26.01 ? 661  HOH A O     1 
HETATM 4026 O  O     . HOH M 9 .   ? 59.632 12.969  11.391  1.00 21.09 ? 662  HOH A O     1 
HETATM 4027 O  O     . HOH M 9 .   ? 41.012 6.893   19.171  1.00 20.11 ? 663  HOH A O     1 
HETATM 4028 O  O     . HOH M 9 .   ? 66.357 -2.351  12.790  1.00 30.49 ? 664  HOH A O     1 
HETATM 4029 O  O     . HOH M 9 .   ? 21.585 13.510  6.658   1.00 35.15 ? 665  HOH A O     1 
HETATM 4030 O  O     . HOH M 9 .   ? 65.616 5.737   2.228   1.00 19.49 ? 666  HOH A O     1 
HETATM 4031 O  O     . HOH M 9 .   ? 57.859 -7.420  8.152   1.00 20.64 ? 667  HOH A O     1 
HETATM 4032 O  O     . HOH M 9 .   ? 60.553 13.833  6.411   1.00 31.98 ? 668  HOH A O     1 
HETATM 4033 O  O     . HOH M 9 .   ? 66.363 3.976   10.700  1.00 33.71 ? 669  HOH A O     1 
HETATM 4034 O  O     . HOH M 9 .   ? 41.386 15.483  -22.922 1.00 26.22 ? 670  HOH A O     1 
HETATM 4035 O  O     . HOH M 9 .   ? 43.030 -25.286 17.356  1.00 31.91 ? 671  HOH A O     1 
HETATM 4036 O  O     . HOH M 9 .   ? 58.468 -12.127 -11.350 1.00 14.83 ? 672  HOH A O     1 
HETATM 4037 O  O     . HOH M 9 .   ? 52.234 15.736  -4.561  1.00 17.73 ? 673  HOH A O     1 
HETATM 4038 O  O     . HOH M 9 .   ? 40.234 9.035   26.833  1.00 21.80 ? 674  HOH A O     1 
HETATM 4039 O  O     . HOH M 9 .   ? 71.021 3.501   -0.318  1.00 15.86 ? 675  HOH A O     1 
HETATM 4040 O  O     . HOH M 9 .   ? 53.289 -28.191 15.266  1.00 20.77 ? 676  HOH A O     1 
HETATM 4041 O  O     . HOH M 9 .   ? 40.230 22.083  -2.533  1.00 42.77 ? 677  HOH A O     1 
HETATM 4042 O  O     . HOH M 9 .   ? 63.238 12.804  -10.842 1.00 23.34 ? 678  HOH A O     1 
HETATM 4043 O  O     . HOH M 9 .   ? 33.608 7.494   17.397  1.00 35.73 ? 679  HOH A O     1 
HETATM 4044 O  O     . HOH M 9 .   ? 64.051 -3.366  6.066   1.00 10.91 ? 680  HOH A O     1 
HETATM 4045 O  O     . HOH M 9 .   ? 55.235 -1.344  -14.688 1.00 29.68 ? 681  HOH A O     1 
HETATM 4046 O  O     . HOH M 9 .   ? 40.434 16.619  5.930   1.00 20.36 ? 682  HOH A O     1 
HETATM 4047 O  O     . HOH M 9 .   ? 49.635 -9.221  -8.449  1.00 27.81 ? 683  HOH A O     1 
HETATM 4048 O  O     . HOH M 9 .   ? 34.828 17.510  -12.747 1.00 30.20 ? 684  HOH A O     1 
HETATM 4049 O  O     . HOH M 9 .   ? 53.666 13.526  -9.883  1.00 18.62 ? 685  HOH A O     1 
HETATM 4050 O  O     . HOH M 9 .   ? 14.680 14.778  -1.187  1.00 42.69 ? 686  HOH A O     1 
HETATM 4051 O  O     . HOH M 9 .   ? 54.152 15.726  23.341  1.00 30.13 ? 687  HOH A O     1 
HETATM 4052 O  O     . HOH M 9 .   ? 27.699 6.768   -17.046 1.00 29.19 ? 688  HOH A O     1 
HETATM 4053 O  O     . HOH M 9 .   ? 51.271 5.462   -8.215  1.00 17.61 ? 689  HOH A O     1 
HETATM 4054 O  O     . HOH M 9 .   ? 65.572 -6.628  -13.737 1.00 20.04 ? 690  HOH A O     1 
HETATM 4055 O  O     . HOH M 9 .   ? 59.123 27.000  7.629   1.00 30.71 ? 691  HOH A O     1 
HETATM 4056 O  O     . HOH M 9 .   ? 50.504 -6.370  -5.600  1.00 30.57 ? 692  HOH A O     1 
HETATM 4057 O  O     . HOH M 9 .   ? 63.432 -17.192 15.217  1.00 29.11 ? 693  HOH A O     1 
HETATM 4058 O  O     . HOH M 9 .   ? 50.979 -8.608  -5.134  1.00 34.66 ? 694  HOH A O     1 
HETATM 4059 O  O     . HOH M 9 .   ? 49.006 2.680   21.166  1.00 27.76 ? 695  HOH A O     1 
HETATM 4060 O  O     . HOH M 9 .   ? 65.570 12.869  3.196   1.00 28.91 ? 696  HOH A O     1 
HETATM 4061 O  O     . HOH M 9 .   ? 43.349 -33.279 -0.378  1.00 18.08 ? 697  HOH A O     1 
HETATM 4062 O  O     . HOH M 9 .   ? 72.049 -3.838  -13.873 1.00 26.41 ? 698  HOH A O     1 
HETATM 4063 O  O     . HOH M 9 .   ? 50.840 5.769   -23.035 1.00 38.33 ? 699  HOH A O     1 
HETATM 4064 O  O     . HOH M 9 .   ? 46.738 -0.330  -15.001 1.00 21.90 ? 700  HOH A O     1 
HETATM 4065 O  O     . HOH M 9 .   ? 39.715 7.168   13.309  1.00 30.58 ? 701  HOH A O     1 
HETATM 4066 O  O     . HOH M 9 .   ? 53.848 -28.393 4.180   1.00 18.04 ? 702  HOH A O     1 
HETATM 4067 O  O     . HOH M 9 .   ? 48.841 13.658  28.301  1.00 28.26 ? 703  HOH A O     1 
HETATM 4068 O  O     . HOH M 9 .   ? 41.090 7.598   -18.506 1.00 18.08 ? 704  HOH A O     1 
HETATM 4069 O  O     B HOH M 9 .   ? 49.355 4.545   7.772   0.40 13.76 ? 705  HOH A O     1 
HETATM 4070 O  O     . HOH M 9 .   ? 43.095 -1.472  -24.739 1.00 27.74 ? 706  HOH A O     1 
HETATM 4071 O  O     . HOH M 9 .   ? 62.507 14.836  -9.114  1.00 13.48 ? 707  HOH A O     1 
HETATM 4072 O  O     . HOH M 9 .   ? 69.741 -12.965 -11.447 1.00 26.69 ? 708  HOH A O     1 
HETATM 4073 O  O     . HOH M 9 .   ? 62.728 -17.098 -7.148  1.00 23.89 ? 709  HOH A O     1 
HETATM 4074 O  O     . HOH M 9 .   ? 42.024 8.252   3.355   1.00 17.21 ? 710  HOH A O     1 
HETATM 4075 O  O     . HOH M 9 .   ? 55.522 17.470  -0.583  1.00 13.49 ? 711  HOH A O     1 
HETATM 4076 O  O     . HOH M 9 .   ? 64.937 -9.413  12.352  1.00 41.04 ? 712  HOH A O     1 
HETATM 4077 O  O     . HOH M 9 .   ? 33.864 2.927   3.072   1.00 26.90 ? 713  HOH A O     1 
HETATM 4078 O  O     . HOH M 9 .   ? 58.787 4.662   23.034  1.00 25.81 ? 714  HOH A O     1 
HETATM 4079 O  O     . HOH M 9 .   ? 63.048 -26.554 6.999   1.00 23.42 ? 715  HOH A O     1 
HETATM 4080 O  O     . HOH M 9 .   ? 47.439 -16.516 -0.815  1.00 27.98 ? 716  HOH A O     1 
HETATM 4081 O  O     . HOH M 9 .   ? 81.628 -18.666 5.836   1.00 37.67 ? 717  HOH A O     1 
HETATM 4082 O  O     . HOH M 9 .   ? 62.470 7.491   7.141   1.00 13.59 ? 718  HOH A O     1 
HETATM 4083 O  O     . HOH M 9 .   ? 38.018 7.603   22.357  1.00 36.47 ? 719  HOH A O     1 
HETATM 4084 O  O     . HOH M 9 .   ? 52.988 -26.540 -3.921  1.00 26.60 ? 720  HOH A O     1 
HETATM 4085 O  O     . HOH M 9 .   ? 60.791 -23.441 6.359   1.00 19.18 ? 721  HOH A O     1 
HETATM 4086 O  O     . HOH M 9 .   ? 54.167 -9.403  5.358   1.00 18.19 ? 722  HOH A O     1 
HETATM 4087 O  O     . HOH M 9 .   ? 34.477 14.982  11.380  1.00 27.65 ? 723  HOH A O     1 
HETATM 4088 O  O     . HOH M 9 .   ? 45.895 7.199   -12.936 1.00 31.73 ? 724  HOH A O     1 
HETATM 4089 O  O     . HOH M 9 .   ? 46.911 16.372  25.584  1.00 25.73 ? 725  HOH A O     1 
HETATM 4090 O  O     . HOH M 9 .   ? 65.439 -32.269 -12.591 1.00 40.34 ? 726  HOH A O     1 
HETATM 4091 O  O     . HOH M 9 .   ? 49.738 -8.981  12.777  1.00 32.08 ? 727  HOH A O     1 
HETATM 4092 O  O     . HOH M 9 .   ? 37.342 13.825  21.486  1.00 25.44 ? 728  HOH A O     1 
HETATM 4093 O  O     . HOH M 9 .   ? 53.735 6.132   -12.297 1.00 22.73 ? 729  HOH A O     1 
HETATM 4094 O  O     . HOH M 9 .   ? 45.861 1.914   18.670  1.00 40.72 ? 730  HOH A O     1 
HETATM 4095 O  O     . HOH M 9 .   ? 62.311 12.016  5.494   1.00 32.41 ? 731  HOH A O     1 
HETATM 4096 O  O     . HOH M 9 .   ? 70.409 -17.176 12.391  1.00 29.57 ? 732  HOH A O     1 
HETATM 4097 O  O     . HOH M 9 .   ? 53.410 19.247  -1.421  1.00 24.48 ? 733  HOH A O     1 
HETATM 4098 O  O     . HOH M 9 .   ? 42.708 15.625  23.685  1.00 22.74 ? 734  HOH A O     1 
HETATM 4099 O  O     . HOH M 9 .   ? 52.859 -12.683 -3.917  1.00 23.00 ? 735  HOH A O     1 
HETATM 4100 O  O     . HOH M 9 .   ? 76.527 2.684   6.707   1.00 27.99 ? 736  HOH A O     1 
HETATM 4101 O  O     . HOH M 9 .   ? 45.559 15.872  -1.524  1.00 16.56 ? 737  HOH A O     1 
HETATM 4102 O  O     . HOH M 9 .   ? 41.440 16.934  -14.823 1.00 21.33 ? 738  HOH A O     1 
HETATM 4103 O  O     . HOH M 9 .   ? 63.226 -7.346  12.930  1.00 32.20 ? 739  HOH A O     1 
HETATM 4104 O  O     . HOH M 9 .   ? 72.239 -7.684  11.692  1.00 18.00 ? 740  HOH A O     1 
HETATM 4105 O  O     . HOH M 9 .   ? 49.844 -3.137  -17.083 1.00 23.49 ? 741  HOH A O     1 
HETATM 4106 O  O     . HOH M 9 .   ? 60.007 14.037  -8.655  1.00 19.64 ? 742  HOH A O     1 
HETATM 4107 O  O     . HOH M 9 .   ? 70.763 -18.966 1.483   1.00 16.14 ? 743  HOH A O     1 
HETATM 4108 O  O     . HOH M 9 .   ? 65.849 8.592   8.878   1.00 28.77 ? 744  HOH A O     1 
HETATM 4109 O  O     . HOH M 9 .   ? 70.638 -15.993 7.725   1.00 17.35 ? 745  HOH A O     1 
HETATM 4110 O  O     . HOH M 9 .   ? 69.159 -17.550 -1.249  1.00 12.45 ? 746  HOH A O     1 
HETATM 4111 O  O     . HOH M 9 .   ? 63.271 -19.044 -1.633  1.00 19.64 ? 747  HOH A O     1 
HETATM 4112 O  O     . HOH M 9 .   ? 55.624 -32.751 5.113   1.00 33.00 ? 748  HOH A O     1 
HETATM 4113 O  O     . HOH M 9 .   ? 59.904 11.496  -10.336 1.00 18.15 ? 749  HOH A O     1 
HETATM 4114 O  O     . HOH M 9 .   ? 52.601 -5.336  -0.814  1.00 22.55 ? 750  HOH A O     1 
HETATM 4115 O  O     . HOH M 9 .   ? 44.862 -14.219 10.337  1.00 15.74 ? 751  HOH A O     1 
HETATM 4116 O  O     . HOH M 9 .   ? 43.519 12.008  -7.222  1.00 20.18 ? 752  HOH A O     1 
HETATM 4117 O  O     . HOH M 9 .   ? 59.677 10.530  19.973  1.00 22.16 ? 753  HOH A O     1 
HETATM 4118 O  O     . HOH M 9 .   ? 45.155 16.978  -18.038 1.00 33.44 ? 754  HOH A O     1 
HETATM 4119 O  O     . HOH M 9 .   ? 17.489 -3.066  -6.038  1.00 49.33 ? 755  HOH A O     1 
HETATM 4120 O  O     . HOH M 9 .   ? 33.066 2.598   -0.220  1.00 28.99 ? 756  HOH A O     1 
HETATM 4121 O  O     . HOH M 9 .   ? 52.662 3.637   17.945  1.00 29.21 ? 757  HOH A O     1 
HETATM 4122 O  O     . HOH M 9 .   ? 67.514 -8.185  9.856   1.00 27.14 ? 758  HOH A O     1 
HETATM 4123 O  O     . HOH M 9 .   ? 69.136 -13.471 5.082   1.00 12.73 ? 759  HOH A O     1 
HETATM 4124 O  O     . HOH M 9 .   ? 43.743 -14.488 5.584   1.00 14.82 ? 760  HOH A O     1 
HETATM 4125 O  O     . HOH M 9 .   ? 67.344 -20.669 8.814   1.00 14.53 ? 761  HOH A O     1 
HETATM 4126 O  O     . HOH M 9 .   ? 35.808 10.953  0.698   1.00 19.91 ? 762  HOH A O     1 
HETATM 4127 O  O     . HOH M 9 .   ? 68.806 16.245  -3.923  1.00 13.36 ? 763  HOH A O     1 
HETATM 4128 O  O     . HOH M 9 .   ? 31.922 -1.299  -3.020  1.00 37.15 ? 764  HOH A O     1 
HETATM 4129 O  O     . HOH M 9 .   ? 29.600 4.026   6.612   1.00 31.18 ? 765  HOH A O     1 
HETATM 4130 O  O     . HOH M 9 .   ? 67.040 -16.620 9.712   1.00 14.67 ? 766  HOH A O     1 
HETATM 4131 O  O     . HOH M 9 .   ? 67.666 6.484   0.702   1.00 22.52 ? 767  HOH A O     1 
HETATM 4132 O  O     . HOH M 9 .   ? 64.588 6.624   -0.374  1.00 19.69 ? 768  HOH A O     1 
HETATM 4133 O  O     . HOH M 9 .   ? 50.036 -17.154 15.385  1.00 17.24 ? 769  HOH A O     1 
HETATM 4134 O  O     . HOH M 9 .   ? 23.208 14.322  -9.310  1.00 31.20 ? 770  HOH A O     1 
HETATM 4135 O  O     . HOH M 9 .   ? 42.229 -22.495 -2.672  1.00 17.06 ? 771  HOH A O     1 
HETATM 4136 O  O     . HOH M 9 .   ? 60.258 6.299   -15.692 1.00 29.26 ? 772  HOH A O     1 
HETATM 4137 O  O     . HOH M 9 .   ? 43.987 10.975  -12.347 1.00 23.43 ? 773  HOH A O     1 
HETATM 4138 O  O     . HOH M 9 .   ? 26.358 10.807  14.093  1.00 45.20 ? 774  HOH A O     1 
HETATM 4139 O  O     . HOH M 9 .   ? 53.643 7.628   -14.730 1.00 28.35 ? 775  HOH A O     1 
HETATM 4140 O  O     . HOH M 9 .   ? 61.675 1.608   13.997  1.00 38.62 ? 776  HOH A O     1 
HETATM 4141 O  O     . HOH M 9 .   ? 56.126 18.635  18.223  1.00 23.78 ? 777  HOH A O     1 
HETATM 4142 O  O     . HOH M 9 .   ? 53.727 -20.583 -2.581  1.00 18.36 ? 778  HOH A O     1 
HETATM 4143 O  O     . HOH M 9 .   ? 38.355 -25.391 6.014   1.00 38.83 ? 779  HOH A O     1 
HETATM 4144 O  O     . HOH M 9 .   ? 52.865 -1.179  3.623   1.00 13.97 ? 780  HOH A O     1 
HETATM 4145 O  O     . HOH M 9 .   ? 59.346 11.103  8.646   1.00 17.50 ? 781  HOH A O     1 
HETATM 4146 O  O     . HOH M 9 .   ? 59.437 4.891   16.667  1.00 24.07 ? 782  HOH A O     1 
HETATM 4147 O  O     . HOH M 9 .   ? 46.691 19.448  1.363   1.00 22.09 ? 783  HOH A O     1 
HETATM 4148 O  O     . HOH M 9 .   ? 59.143 -18.315 -10.073 1.00 36.33 ? 784  HOH A O     1 
HETATM 4149 O  O     . HOH M 9 .   ? 67.728 -6.492  12.865  1.00 24.59 ? 785  HOH A O     1 
HETATM 4150 O  O     . HOH M 9 .   ? 48.272 19.816  4.683   1.00 28.62 ? 786  HOH A O     1 
HETATM 4151 O  O     . HOH M 9 .   ? 51.540 5.239   -10.804 1.00 21.03 ? 787  HOH A O     1 
HETATM 4152 O  O     . HOH M 9 .   ? 48.837 -9.499  10.380  1.00 30.61 ? 788  HOH A O     1 
HETATM 4153 O  O     . HOH M 9 .   ? 52.879 -19.638 22.168  1.00 31.51 ? 789  HOH A O     1 
HETATM 4154 O  O     . HOH M 9 .   ? 49.937 2.902   12.916  1.00 24.48 ? 790  HOH A O     1 
HETATM 4155 O  O     . HOH M 9 .   ? 46.641 0.260   6.963   1.00 24.84 ? 791  HOH A O     1 
HETATM 4156 O  O     . HOH M 9 .   ? 45.954 -8.478  -15.162 1.00 28.49 ? 792  HOH A O     1 
HETATM 4157 O  O     . HOH M 9 .   ? 58.030 -27.403 11.353  1.00 18.17 ? 793  HOH A O     1 
HETATM 4158 O  O     . HOH M 9 .   ? 71.195 -12.225 14.305  1.00 31.82 ? 794  HOH A O     1 
HETATM 4159 O  O     . HOH M 9 .   ? 39.477 18.630  18.108  1.00 31.23 ? 795  HOH A O     1 
HETATM 4160 O  O     A HOH M 9 .   ? 54.567 -0.851  5.929   0.60 13.23 ? 796  HOH A O     1 
HETATM 4161 O  O     B HOH M 9 .   ? 53.349 -0.185  6.463   0.40 11.24 ? 796  HOH A O     1 
HETATM 4162 O  O     . HOH M 9 .   ? 65.797 -15.209 11.676  1.00 18.60 ? 797  HOH A O     1 
HETATM 4163 O  O     . HOH M 9 .   ? 79.092 3.422   2.105   1.00 34.29 ? 798  HOH A O     1 
HETATM 4164 O  O     . HOH M 9 .   ? 44.346 10.228  -24.655 1.00 35.52 ? 799  HOH A O     1 
HETATM 4165 O  O     . HOH M 9 .   ? 51.453 6.183   -18.978 1.00 31.16 ? 800  HOH A O     1 
HETATM 4166 O  O     . HOH M 9 .   ? 60.406 -18.520 -4.616  1.00 11.12 ? 801  HOH A O     1 
HETATM 4167 O  O     . HOH M 9 .   ? 46.385 -9.577  10.694  1.00 33.83 ? 802  HOH A O     1 
HETATM 4168 O  O     . HOH M 9 .   ? 81.323 -10.791 -8.196  1.00 48.42 ? 803  HOH A O     1 
HETATM 4169 O  O     . HOH M 9 .   ? 46.488 -18.775 -2.694  1.00 32.03 ? 804  HOH A O     1 
HETATM 4170 O  O     . HOH M 9 .   ? 71.530 6.088   -7.182  1.00 19.23 ? 805  HOH A O     1 
HETATM 4171 O  O     . HOH M 9 .   ? 40.758 -1.510  -16.297 1.00 25.31 ? 806  HOH A O     1 
HETATM 4172 O  O     . HOH M 9 .   ? 44.022 -15.097 1.214   1.00 20.19 ? 807  HOH A O     1 
HETATM 4173 O  O     . HOH M 9 .   ? 62.967 -23.681 3.518   1.00 24.86 ? 808  HOH A O     1 
HETATM 4174 O  O     . HOH M 9 .   ? 44.493 -16.890 -0.598  1.00 26.99 ? 809  HOH A O     1 
HETATM 4175 O  O     . HOH M 9 .   ? 46.989 -22.476 17.498  1.00 26.32 ? 810  HOH A O     1 
HETATM 4176 O  O     . HOH M 9 .   ? 40.823 -29.634 13.188  1.00 31.00 ? 811  HOH A O     1 
HETATM 4177 O  O     . HOH M 9 .   ? 53.128 -33.433 -0.117  1.00 21.73 ? 812  HOH A O     1 
HETATM 4178 O  O     . HOH M 9 .   ? 73.256 2.223   8.228   1.00 30.06 ? 813  HOH A O     1 
HETATM 4179 O  O     . HOH M 9 .   ? 66.060 3.565   -17.595 1.00 33.53 ? 814  HOH A O     1 
HETATM 4180 O  O     . HOH M 9 .   ? 53.693 -32.650 -2.570  1.00 37.36 ? 815  HOH A O     1 
HETATM 4181 O  O     . HOH M 9 .   ? 62.629 9.428   -13.674 1.00 36.79 ? 816  HOH A O     1 
HETATM 4182 O  O     . HOH M 9 .   ? 83.870 -5.118  2.589   1.00 27.86 ? 817  HOH A O     1 
HETATM 4183 O  O     . HOH M 9 .   ? 21.850 11.883  -9.373  1.00 31.21 ? 818  HOH A O     1 
HETATM 4184 O  O     . HOH M 9 .   ? 49.858 -15.898 -8.772  1.00 32.54 ? 819  HOH A O     1 
HETATM 4185 O  O     . HOH M 9 .   ? 56.357 1.118   13.275  1.00 23.22 ? 820  HOH A O     1 
HETATM 4186 O  O     . HOH M 9 .   ? 62.120 -13.251 -13.582 1.00 29.87 ? 821  HOH A O     1 
HETATM 4187 O  O     . HOH M 9 .   ? 60.104 -18.158 -7.753  1.00 20.63 ? 822  HOH A O     1 
HETATM 4188 O  O     . HOH M 9 .   ? 55.811 -35.246 11.169  1.00 33.07 ? 823  HOH A O     1 
HETATM 4189 O  O     . HOH M 9 .   ? 54.567 -11.404 3.371   1.00 12.32 ? 824  HOH A O     1 
HETATM 4190 O  O     . HOH M 9 .   ? 41.256 21.602  2.517   1.00 29.91 ? 825  HOH A O     1 
HETATM 4191 O  O     . HOH M 9 .   ? 51.277 8.879   -15.416 1.00 37.13 ? 826  HOH A O     1 
HETATM 4192 O  O     . HOH M 9 .   ? 38.604 -17.930 10.308  1.00 25.93 ? 827  HOH A O     1 
HETATM 4193 O  O     . HOH M 9 .   ? 64.124 -9.367  -14.404 1.00 19.39 ? 828  HOH A O     1 
HETATM 4194 O  O     . HOH M 9 .   ? 68.051 -14.439 -9.946  1.00 20.92 ? 829  HOH A O     1 
HETATM 4195 O  O     . HOH M 9 .   ? 40.889 -18.231 0.520   1.00 30.10 ? 830  HOH A O     1 
HETATM 4196 O  O     . HOH M 9 .   ? 73.116 -7.444  8.988   1.00 15.29 ? 831  HOH A O     1 
HETATM 4197 O  O     . HOH M 9 .   ? 65.513 -23.043 3.252   1.00 13.92 ? 832  HOH A O     1 
HETATM 4198 O  O     . HOH M 9 .   ? 46.200 16.713  1.203   1.00 12.32 ? 833  HOH A O     1 
HETATM 4199 O  O     . HOH M 9 .   ? 58.417 18.986  -8.722  1.00 26.73 ? 834  HOH A O     1 
HETATM 4200 O  O     . HOH M 9 .   ? 42.269 -18.796 14.940  1.00 27.25 ? 835  HOH A O     1 
HETATM 4201 O  O     . HOH M 9 .   ? 45.031 20.599  3.606   1.00 25.68 ? 836  HOH A O     1 
HETATM 4202 O  O     . HOH M 9 .   ? 45.486 17.961  -3.497  1.00 28.94 ? 837  HOH A O     1 
HETATM 4203 O  O     . HOH M 9 .   ? 41.113 -3.067  -22.975 1.00 28.63 ? 838  HOH A O     1 
HETATM 4204 O  O     . HOH M 9 .   ? 49.062 -34.516 10.167  1.00 35.34 ? 839  HOH A O     1 
HETATM 4205 O  O     . HOH M 9 .   ? 57.406 0.112   -14.717 1.00 31.15 ? 840  HOH A O     1 
HETATM 4206 O  O     . HOH M 9 .   ? 46.527 0.756   14.013  1.00 34.45 ? 841  HOH A O     1 
HETATM 4207 O  O     . HOH M 9 .   ? 50.080 -14.823 -3.142  1.00 42.09 ? 842  HOH A O     1 
HETATM 4208 O  O     . HOH M 9 .   ? 49.032 -15.485 13.622  1.00 20.61 ? 843  HOH A O     1 
HETATM 4209 O  O     . HOH M 9 .   ? 59.440 9.618   10.870  1.00 12.94 ? 844  HOH A O     1 
HETATM 4210 O  O     . HOH M 9 .   ? 82.840 -3.428  -4.206  1.00 36.44 ? 845  HOH A O     1 
HETATM 4211 O  O     . HOH M 9 .   ? 41.381 -23.750 -5.158  1.00 20.57 ? 846  HOH A O     1 
HETATM 4212 O  O     . HOH M 9 .   ? 48.740 -22.319 -5.807  1.00 21.78 ? 847  HOH A O     1 
HETATM 4213 O  O     . HOH M 9 .   ? 69.728 -18.783 -9.684  1.00 37.17 ? 848  HOH A O     1 
HETATM 4214 O  O     . HOH M 9 .   ? 51.290 21.648  7.191   1.00 23.97 ? 849  HOH A O     1 
HETATM 4215 O  O     . HOH M 9 .   ? 65.534 -22.260 -8.048  1.00 30.09 ? 850  HOH A O     1 
HETATM 4216 O  O     . HOH M 9 .   ? 35.518 22.353  -3.504  1.00 34.72 ? 851  HOH A O     1 
HETATM 4217 O  O     . HOH M 9 .   ? 36.691 12.765  12.013  1.00 26.66 ? 852  HOH A O     1 
HETATM 4218 O  O     . HOH M 9 .   ? 69.014 -10.756 12.099  1.00 24.93 ? 853  HOH A O     1 
HETATM 4219 O  O     . HOH M 9 .   ? 34.065 15.488  18.682  1.00 36.25 ? 854  HOH A O     1 
HETATM 4220 O  O     . HOH M 9 .   ? 44.923 7.359   -10.319 1.00 21.57 ? 855  HOH A O     1 
HETATM 4221 O  O     . HOH M 9 .   ? 51.422 -33.670 10.761  1.00 40.94 ? 856  HOH A O     1 
HETATM 4222 O  O     . HOH M 9 .   ? 50.580 14.064  -20.030 1.00 48.07 ? 857  HOH A O     1 
HETATM 4223 O  O     . HOH M 9 .   ? 47.279 2.346   -1.008  1.00 18.68 ? 858  HOH A O     1 
HETATM 4224 O  O     . HOH M 9 .   ? 60.031 14.558  3.278   1.00 27.33 ? 859  HOH A O     1 
HETATM 4225 O  O     . HOH M 9 .   ? 41.454 20.326  4.734   1.00 20.94 ? 860  HOH A O     1 
HETATM 4226 O  O     . HOH M 9 .   ? 44.959 0.520   -18.552 1.00 28.73 ? 861  HOH A O     1 
HETATM 4227 O  O     . HOH M 9 .   ? 46.838 -14.564 14.579  1.00 35.52 ? 862  HOH A O     1 
HETATM 4228 O  O     . HOH M 9 .   ? 69.114 7.912   4.219   1.00 31.92 ? 863  HOH A O     1 
HETATM 4229 O  O     . HOH M 9 .   ? 49.527 -14.832 18.396  1.00 39.83 ? 864  HOH A O     1 
HETATM 4230 O  O     . HOH M 9 .   ? 46.078 18.030  -10.361 1.00 46.00 ? 865  HOH A O     1 
HETATM 4231 O  O     . HOH M 9 .   ? 49.010 -37.897 0.587   1.00 33.49 ? 866  HOH A O     1 
HETATM 4232 O  O     . HOH M 9 .   ? 69.277 4.521   3.849   1.00 18.98 ? 867  HOH A O     1 
HETATM 4233 O  O     . HOH M 9 .   ? 55.966 -3.339  8.275   1.00 28.77 ? 868  HOH A O     1 
HETATM 4234 O  O     . HOH M 9 .   ? 40.508 -29.460 -2.138  1.00 27.04 ? 869  HOH A O     1 
HETATM 4235 O  O     . HOH M 9 .   ? 50.494 -34.781 -0.713  1.00 22.97 ? 870  HOH A O     1 
HETATM 4236 O  O     . HOH M 9 .   ? 37.609 10.917  21.520  1.00 36.79 ? 871  HOH A O     1 
HETATM 4237 O  O     . HOH M 9 .   ? 43.555 -28.514 15.852  1.00 35.58 ? 872  HOH A O     1 
HETATM 4238 O  O     . HOH M 9 .   ? 50.134 21.367  8.929   1.00 30.66 ? 873  HOH A O     1 
HETATM 4239 O  O     . HOH M 9 .   ? 47.894 -30.586 -6.852  1.00 40.89 ? 874  HOH A O     1 
HETATM 4240 O  O     . HOH M 9 .   ? 69.754 -8.876  10.870  1.00 26.27 ? 875  HOH A O     1 
HETATM 4241 O  O     . HOH M 9 .   ? 19.100 14.310  6.345   1.00 38.31 ? 876  HOH A O     1 
HETATM 4242 O  O     . HOH M 9 .   ? 61.454 14.559  8.722   1.00 24.78 ? 877  HOH A O     1 
HETATM 4243 O  O     . HOH M 9 .   ? 65.517 -4.376  -15.284 1.00 21.43 ? 878  HOH A O     1 
HETATM 4244 O  O     . HOH M 9 .   ? 64.999 19.618  1.896   1.00 25.30 ? 879  HOH A O     1 
HETATM 4245 O  O     . HOH M 9 .   ? 35.473 20.691  0.532   1.00 26.46 ? 880  HOH A O     1 
HETATM 4246 O  O     . HOH M 9 .   ? 83.908 -7.813  1.074   1.00 44.58 ? 881  HOH A O     1 
HETATM 4247 O  O     . HOH M 9 .   ? 49.081 7.233   -7.599  1.00 25.67 ? 882  HOH A O     1 
HETATM 4248 O  O     . HOH M 9 .   ? 43.130 -2.538  -19.919 1.00 27.38 ? 883  HOH A O     1 
HETATM 4249 O  O     . HOH M 9 .   ? 42.447 -8.674  9.226   1.00 35.52 ? 884  HOH A O     1 
HETATM 4250 O  O     . HOH M 9 .   ? 28.911 8.154   -18.959 1.00 25.04 ? 885  HOH A O     1 
HETATM 4251 O  O     . HOH M 9 .   ? 42.109 -20.642 16.717  1.00 42.77 ? 886  HOH A O     1 
HETATM 4252 O  O     . HOH M 9 .   ? 38.235 10.434  9.388   1.00 28.68 ? 887  HOH A O     1 
HETATM 4253 O  O     . HOH M 9 .   ? 30.965 19.209  11.246  1.00 38.30 ? 888  HOH A O     1 
HETATM 4254 O  O     . HOH M 9 .   ? 54.647 -33.779 12.694  1.00 32.17 ? 889  HOH A O     1 
HETATM 4255 O  O     . HOH M 9 .   ? 53.482 -8.416  8.711   1.00 26.08 ? 890  HOH A O     1 
HETATM 4256 O  O     . HOH M 9 .   ? 80.703 -3.727  14.195  1.00 36.45 ? 891  HOH A O     1 
HETATM 4257 O  O     . HOH M 9 .   ? 57.525 5.729   -15.718 1.00 31.45 ? 892  HOH A O     1 
HETATM 4258 O  O     . HOH M 9 .   ? 68.706 -21.657 -8.563  1.00 39.83 ? 893  HOH A O     1 
HETATM 4259 O  O     . HOH M 9 .   ? 62.304 -2.404  12.518  1.00 28.12 ? 894  HOH A O     1 
HETATM 4260 O  O     . HOH M 9 .   ? 39.796 -18.925 14.628  1.00 39.71 ? 895  HOH A O     1 
HETATM 4261 O  O     . HOH M 9 .   ? 53.739 17.307  -3.037  1.00 18.28 ? 896  HOH A O     1 
HETATM 4262 O  O     . HOH M 9 .   ? 64.038 20.038  11.148  1.00 28.04 ? 897  HOH A O     1 
HETATM 4263 O  O     . HOH M 9 .   ? 25.547 14.599  5.210   1.00 31.62 ? 898  HOH A O     1 
HETATM 4264 O  O     . HOH M 9 .   ? 43.301 19.765  -11.949 1.00 37.86 ? 899  HOH A O     1 
HETATM 4265 O  O     . HOH M 9 .   ? 38.858 -3.689  -20.056 1.00 28.71 ? 900  HOH A O     1 
HETATM 4266 O  O     . HOH M 9 .   ? 43.365 17.474  18.066  1.00 32.61 ? 901  HOH A O     1 
HETATM 4267 O  O     . HOH M 9 .   ? 50.481 -13.254 -1.100  1.00 33.53 ? 902  HOH A O     1 
HETATM 4268 O  O     . HOH M 9 .   ? 74.890 -22.439 -6.356  1.00 45.43 ? 903  HOH A O     1 
HETATM 4269 O  O     . HOH M 9 .   ? 63.141 -11.450 12.899  1.00 49.25 ? 904  HOH A O     1 
HETATM 4270 O  O     . HOH M 9 .   ? 61.513 16.195  4.815   1.00 31.65 ? 905  HOH A O     1 
HETATM 4271 O  O     . HOH M 9 .   ? 61.693 24.227  9.853   1.00 29.88 ? 906  HOH A O     1 
HETATM 4272 O  O     . HOH M 9 .   ? 67.524 -25.398 -0.794  1.00 43.45 ? 907  HOH A O     1 
HETATM 4273 O  O     . HOH M 9 .   ? 51.849 -17.914 -6.150  1.00 35.06 ? 908  HOH A O     1 
HETATM 4274 O  O     . HOH M 9 .   ? 53.192 -20.123 -5.035  1.00 29.50 ? 909  HOH A O     1 
HETATM 4275 O  O     . HOH M 9 .   ? 81.016 -4.547  23.066  1.00 50.70 ? 910  HOH A O     1 
HETATM 4276 O  O     . HOH M 9 .   ? 49.280 8.444   -13.485 1.00 28.65 ? 911  HOH A O     1 
HETATM 4277 O  O     . HOH M 9 .   ? 57.332 -18.900 21.886  1.00 30.07 ? 912  HOH A O     1 
HETATM 4278 O  O     . HOH M 9 .   ? 59.108 -13.208 14.943  1.00 33.54 ? 913  HOH A O     1 
HETATM 4279 O  O     . HOH M 9 .   ? 51.164 3.392   10.478  1.00 21.49 ? 914  HOH A O     1 
HETATM 4280 O  O     . HOH M 9 .   ? 31.085 21.761  -3.244  1.00 31.20 ? 915  HOH A O     1 
HETATM 4281 O  O     . HOH M 9 .   ? 51.041 4.603   24.768  1.00 24.78 ? 916  HOH A O     1 
HETATM 4282 O  O     . HOH M 9 .   ? 41.229 7.827   -29.860 1.00 33.83 ? 917  HOH A O     1 
HETATM 4283 O  O     . HOH M 9 .   ? 47.410 21.834  9.500   1.00 28.18 ? 918  HOH A O     1 
HETATM 4284 O  O     . HOH M 9 .   ? 61.750 7.848   16.534  1.00 27.71 ? 919  HOH A O     1 
HETATM 4285 O  O     . HOH M 9 .   ? 39.914 -22.685 3.048   1.00 27.63 ? 920  HOH A O     1 
HETATM 4286 O  O     . HOH M 9 .   ? 33.802 22.269  -0.889  1.00 37.83 ? 921  HOH A O     1 
HETATM 4287 O  O     . HOH M 9 .   ? 48.380 22.018  3.199   1.00 45.12 ? 922  HOH A O     1 
HETATM 4288 O  O     . HOH M 9 .   ? 35.527 -1.911  -24.227 1.00 54.96 ? 923  HOH A O     1 
HETATM 4289 O  O     . HOH M 9 .   ? 62.141 16.108  2.695   1.00 28.36 ? 924  HOH A O     1 
HETATM 4290 O  O     . HOH M 9 .   ? 51.854 -18.466 -8.944  1.00 37.90 ? 925  HOH A O     1 
HETATM 4291 O  O     . HOH M 9 .   ? 38.490 13.882  24.201  1.00 34.99 ? 926  HOH A O     1 
HETATM 4292 O  O     . HOH M 9 .   ? 38.500 -27.939 7.035   1.00 30.68 ? 927  HOH A O     1 
HETATM 4293 O  O     . HOH M 9 .   ? 61.397 4.647   -16.927 1.00 35.75 ? 928  HOH A O     1 
HETATM 4294 O  O     . HOH M 9 .   ? 42.625 10.663  -26.075 1.00 36.98 ? 929  HOH A O     1 
HETATM 4295 O  O     . HOH M 9 .   ? 65.833 13.337  -12.874 1.00 25.33 ? 930  HOH A O     1 
HETATM 4296 O  O     . HOH M 9 .   ? 60.007 -29.243 -8.678  1.00 37.80 ? 931  HOH A O     1 
HETATM 4297 O  O     . HOH M 9 .   ? 61.194 10.088  7.323   1.00 28.51 ? 932  HOH A O     1 
HETATM 4298 O  O     . HOH M 9 .   ? 51.631 -8.868  5.023   1.00 26.54 ? 933  HOH A O     1 
HETATM 4299 O  O     . HOH M 9 .   ? 23.128 14.694  -17.451 1.00 47.59 ? 934  HOH A O     1 
HETATM 4300 O  O     . HOH M 9 .   ? 32.428 2.899   -23.780 1.00 42.42 ? 935  HOH A O     1 
HETATM 4301 O  O     . HOH M 9 .   ? 53.282 -0.138  11.890  1.00 34.70 ? 936  HOH A O     1 
HETATM 4302 O  O     . HOH M 9 .   ? 51.471 -15.792 17.423  1.00 28.24 ? 937  HOH A O     1 
HETATM 4303 O  O     . HOH M 9 .   ? 52.411 -17.860 -11.194 1.00 30.62 ? 938  HOH A O     1 
HETATM 4304 O  O     . HOH M 9 .   ? 67.885 -4.962  -17.158 1.00 34.97 ? 939  HOH A O     1 
HETATM 4305 O  O     . HOH M 9 .   ? 22.202 17.790  -6.948  1.00 35.67 ? 940  HOH A O     1 
HETATM 4306 O  O     . HOH M 9 .   ? 39.583 4.800   17.810  1.00 38.18 ? 941  HOH A O     1 
HETATM 4307 O  O     . HOH M 9 .   ? 49.088 12.038  -11.483 1.00 27.33 ? 942  HOH A O     1 
HETATM 4308 O  O     . HOH M 9 .   ? 42.855 17.236  -17.152 1.00 30.05 ? 943  HOH A O     1 
HETATM 4309 O  O     . HOH M 9 .   ? 48.513 -24.088 19.795  1.00 37.21 ? 944  HOH A O     1 
HETATM 4310 O  O     . HOH M 9 .   ? 55.387 -7.366  6.579   1.00 26.57 ? 945  HOH A O     1 
HETATM 4311 O  O     . HOH M 9 .   ? 47.941 10.498  -9.660  1.00 26.98 ? 946  HOH A O     1 
HETATM 4312 O  O     . HOH M 9 .   ? 38.763 -19.043 5.464   1.00 36.62 ? 947  HOH A O     1 
HETATM 4313 O  O     . HOH M 9 .   ? 44.044 0.418   -21.115 1.00 30.78 ? 948  HOH A O     1 
HETATM 4314 O  O     . HOH M 9 .   ? 64.318 -15.394 13.798  1.00 34.19 ? 949  HOH A O     1 
HETATM 4315 O  O     . HOH M 9 .   ? 62.158 12.245  9.501   1.00 33.73 ? 950  HOH A O     1 
HETATM 4316 O  O     . HOH M 9 .   ? 38.848 -19.500 12.520  1.00 35.66 ? 951  HOH A O     1 
HETATM 4317 O  O     . HOH M 9 .   ? 49.548 -0.256  -16.338 1.00 30.13 ? 952  HOH A O     1 
HETATM 4318 O  O     . HOH M 9 .   ? 55.114 -17.422 -13.260 1.00 33.97 ? 953  HOH A O     1 
HETATM 4319 O  O     . HOH M 9 .   ? 55.795 13.365  -11.552 1.00 27.40 ? 954  HOH A O     1 
HETATM 4320 O  O     . HOH M 9 .   ? 46.716 -8.477  -4.610  1.00 35.33 ? 955  HOH A O     1 
HETATM 4321 O  O     . HOH M 9 .   ? 71.296 8.963   -6.667  1.00 34.80 ? 956  HOH A O     1 
HETATM 4322 O  O     . HOH M 9 .   ? 79.277 1.984   4.487   1.00 38.87 ? 957  HOH A O     1 
HETATM 4323 O  O     . HOH M 9 .   ? 82.880 -23.999 -0.464  1.00 36.80 ? 958  HOH A O     1 
HETATM 4324 O  O     . HOH M 9 .   ? 73.429 4.535   -1.226  1.00 33.26 ? 959  HOH A O     1 
HETATM 4325 O  O     . HOH M 9 .   ? 42.278 5.488   21.010  1.00 39.28 ? 960  HOH A O     1 
HETATM 4326 O  O     . HOH M 9 .   ? 45.338 -1.685  -24.117 1.00 33.57 ? 961  HOH A O     1 
HETATM 4327 O  O     . HOH M 9 .   ? 43.216 3.027   18.413  1.00 40.53 ? 962  HOH A O     1 
HETATM 4328 O  O     . HOH M 9 .   ? 69.629 5.296   1.240   1.00 26.65 ? 963  HOH A O     1 
HETATM 4329 O  O     . HOH M 9 .   ? 47.935 -18.921 -5.458  1.00 35.61 ? 964  HOH A O     1 
HETATM 4330 O  O     . HOH M 9 .   ? 59.351 30.650  12.727  1.00 42.12 ? 965  HOH A O     1 
HETATM 4331 O  O     . HOH M 9 .   ? 58.480 15.089  -10.662 1.00 26.72 ? 966  HOH A O     1 
HETATM 4332 O  O     . HOH M 9 .   ? 46.441 10.280  -13.260 1.00 41.66 ? 967  HOH A O     1 
HETATM 4333 O  O     . HOH M 9 .   ? 51.672 -29.411 16.378  1.00 27.18 ? 968  HOH A O     1 
HETATM 4334 O  O     . HOH M 9 .   ? 43.392 -16.111 -2.588  1.00 34.70 ? 969  HOH A O     1 
HETATM 4335 O  O     . HOH M 9 .   ? 53.154 5.549   -16.983 1.00 43.96 ? 970  HOH A O     1 
HETATM 4336 O  O     . HOH M 9 .   ? 33.148 -2.220  -6.480  1.00 48.24 ? 971  HOH A O     1 
HETATM 4337 O  O     . HOH M 9 .   ? 49.702 0.894   20.062  1.00 36.54 ? 972  HOH A O     1 
HETATM 4338 O  O     . HOH M 9 .   ? 59.338 -28.184 -2.237  1.00 39.72 ? 973  HOH A O     1 
HETATM 4339 O  O     . HOH M 9 .   ? 51.487 13.320  -11.412 1.00 29.18 ? 974  HOH A O     1 
HETATM 4340 O  O     . HOH M 9 .   ? 58.124 -14.342 -12.953 1.00 21.01 ? 975  HOH A O     1 
HETATM 4341 O  O     . HOH M 9 .   ? 47.228 -20.195 18.615  1.00 31.26 ? 976  HOH A O     1 
HETATM 4342 O  O     . HOH M 9 .   ? 62.626 -29.605 -12.220 1.00 41.36 ? 977  HOH A O     1 
HETATM 4343 O  O     . HOH M 9 .   ? 47.731 7.928   -9.630  1.00 25.91 ? 978  HOH A O     1 
HETATM 4344 O  O     . HOH M 9 .   ? 44.093 15.635  26.091  1.00 22.93 ? 979  HOH A O     1 
HETATM 4345 O  O     . HOH M 9 .   ? 61.516 11.447  -12.334 1.00 31.52 ? 980  HOH A O     1 
HETATM 4346 O  O     . HOH M 9 .   ? 54.489 -35.208 1.416   1.00 35.28 ? 981  HOH A O     1 
HETATM 4347 O  O     . HOH M 9 .   ? 27.533 6.738   -26.881 1.00 30.20 ? 982  HOH A O     1 
HETATM 4348 O  O     . HOH M 9 .   ? 45.665 11.552  -9.185  1.00 32.57 ? 983  HOH A O     1 
HETATM 4349 O  O     . HOH M 9 .   ? 38.261 -22.516 10.805  1.00 39.09 ? 984  HOH A O     1 
HETATM 4350 O  O     . HOH M 9 .   ? 44.460 13.071  -10.219 1.00 30.35 ? 985  HOH A O     1 
HETATM 4351 O  O     . HOH M 9 .   ? 46.884 -38.075 4.627   1.00 28.46 ? 986  HOH A O     1 
HETATM 4352 O  O     . HOH M 9 .   ? 61.781 9.134   18.862  1.00 31.99 ? 987  HOH A O     1 
HETATM 4353 O  O     . HOH M 9 .   ? 40.076 15.454  25.470  1.00 37.77 ? 988  HOH A O     1 
HETATM 4354 O  O     . HOH M 9 .   ? 55.672 -27.300 -3.921  1.00 36.01 ? 989  HOH A O     1 
HETATM 4355 O  O     . HOH M 9 .   ? 37.693 -29.064 9.386   1.00 35.71 ? 990  HOH A O     1 
HETATM 4356 O  O     . HOH M 9 .   ? 37.479 -4.471  -21.804 1.00 35.34 ? 991  HOH A O     1 
HETATM 4357 O  O     . HOH M 9 .   ? 48.098 -17.775 17.292  1.00 26.21 ? 992  HOH A O     1 
HETATM 4358 O  O     . HOH M 9 .   ? 57.912 -26.582 -3.069  1.00 36.88 ? 993  HOH A O     1 
HETATM 4359 O  O     . HOH M 9 .   ? 48.880 6.705   -11.821 1.00 23.90 ? 994  HOH A O     1 
HETATM 4360 O  O     . HOH M 9 .   ? 38.270 -15.703 11.780  1.00 32.52 ? 995  HOH A O     1 
HETATM 4361 O  O     . HOH M 9 .   ? 65.402 5.620   13.062  1.00 51.56 ? 996  HOH A O     1 
HETATM 4362 O  O     . HOH M 9 .   ? 34.547 14.322  21.918  1.00 32.62 ? 997  HOH A O     1 
HETATM 4363 O  O     . HOH M 9 .   ? 61.602 8.115   9.895   1.00 24.80 ? 998  HOH A O     1 
HETATM 4364 O  O     . HOH M 9 .   ? 60.232 9.915   22.325  1.00 31.06 ? 999  HOH A O     1 
HETATM 4365 O  O     . HOH M 9 .   ? 47.727 16.529  28.217  1.00 29.01 ? 1000 HOH A O     1 
HETATM 4366 O  O     . HOH M 9 .   ? 58.132 17.786  19.992  1.00 29.67 ? 1001 HOH A O     1 
HETATM 4367 O  O     . HOH M 9 .   ? 52.608 -21.269 -9.223  1.00 42.60 ? 1002 HOH A O     1 
HETATM 4368 O  O     . HOH M 9 .   ? 63.092 4.945   14.381  1.00 47.86 ? 1003 HOH A O     1 
HETATM 4369 O  O     . HOH N 9 .   ? 41.541 -19.968 -3.437  1.00 29.53 ? 101  HOH T O     1 
HETATM 4370 O  O     . HOH N 9 .   ? 39.992 8.580   9.139   1.00 32.79 ? 102  HOH T O     1 
HETATM 4371 O  O     . HOH N 9 .   ? 35.035 5.695   17.909  1.00 41.49 ? 103  HOH T O     1 
HETATM 4372 O  O     . HOH N 9 .   ? 28.983 4.254   9.500   1.00 47.41 ? 104  HOH T O     1 
HETATM 4373 O  O     . HOH N 9 .   ? 36.670 -2.158  -1.009  1.00 32.34 ? 105  HOH T O     1 
HETATM 4374 O  O     . HOH N 9 .   ? 32.183 13.960  10.768  1.00 35.01 ? 106  HOH T O     1 
HETATM 4375 O  O     . HOH N 9 .   ? 39.319 2.485   -7.379  1.00 33.68 ? 107  HOH T O     1 
HETATM 4376 O  O     . HOH N 9 .   ? 44.129 -8.731  -3.736  1.00 22.68 ? 108  HOH T O     1 
HETATM 4377 O  O     . HOH N 9 .   ? 31.181 -16.193 -4.447  1.00 30.53 ? 109  HOH T O     1 
HETATM 4378 O  O     . HOH N 9 .   ? 29.059 0.381   13.873  1.00 62.83 ? 110  HOH T O     1 
HETATM 4379 O  O     . HOH N 9 .   ? 44.285 1.255   -2.046  1.00 33.67 ? 111  HOH T O     1 
HETATM 4380 O  O     . HOH N 9 .   ? 36.285 2.478   4.613   1.00 26.26 ? 112  HOH T O     1 
HETATM 4381 O  O     . HOH N 9 .   ? 36.592 -23.196 -5.163  1.00 29.17 ? 113  HOH T O     1 
HETATM 4382 O  O     . HOH N 9 .   ? 25.804 -19.421 -6.736  1.00 34.33 ? 114  HOH T O     1 
HETATM 4383 O  O     . HOH N 9 .   ? 40.781 -3.576  -9.357  1.00 29.51 ? 115  HOH T O     1 
HETATM 4384 O  O     . HOH N 9 .   ? 38.690 -10.301 -10.145 1.00 27.34 ? 116  HOH T O     1 
HETATM 4385 O  O     . HOH N 9 .   ? 42.228 -11.316 -3.738  1.00 31.14 ? 117  HOH T O     1 
HETATM 4386 O  O     . HOH N 9 .   ? 38.468 -2.391  -6.291  1.00 32.07 ? 118  HOH T O     1 
HETATM 4387 O  O     . HOH N 9 .   ? 41.954 -7.376  -10.605 1.00 36.34 ? 119  HOH T O     1 
HETATM 4388 O  O     . HOH N 9 .   ? 40.547 -0.696  7.959   1.00 40.75 ? 120  HOH T O     1 
HETATM 4389 O  O     . HOH N 9 .   ? 43.648 5.673   0.394   1.00 21.00 ? 121  HOH T O     1 
HETATM 4390 O  O     . HOH N 9 .   ? 45.563 -5.356  -2.931  1.00 37.43 ? 122  HOH T O     1 
HETATM 4391 O  O     . HOH N 9 .   ? 38.160 -21.764 -3.350  1.00 27.01 ? 123  HOH T O     1 
HETATM 4392 O  O     . HOH N 9 .   ? 37.517 -12.895 -11.172 1.00 27.24 ? 124  HOH T O     1 
HETATM 4393 O  O     . HOH N 9 .   ? 45.211 -2.800  -3.602  1.00 34.41 ? 125  HOH T O     1 
HETATM 4394 O  O     . HOH N 9 .   ? 40.110 -21.947 -6.918  1.00 39.20 ? 126  HOH T O     1 
HETATM 4395 O  O     . HOH N 9 .   ? 45.524 5.340   -4.705  1.00 29.72 ? 127  HOH T O     1 
HETATM 4396 O  O     . HOH N 9 .   ? 36.649 -2.945  -4.441  1.00 30.22 ? 128  HOH T O     1 
HETATM 4397 O  O     . HOH N 9 .   ? 37.366 -0.101  4.594   1.00 31.21 ? 129  HOH T O     1 
HETATM 4398 O  O     . HOH N 9 .   ? 40.282 -18.397 -1.644  1.00 27.22 ? 130  HOH T O     1 
HETATM 4399 O  O     . HOH N 9 .   ? 29.886 15.512  11.103  1.00 39.23 ? 131  HOH T O     1 
HETATM 4400 O  O     . HOH N 9 .   ? 33.296 10.746  8.566   1.00 35.14 ? 132  HOH T O     1 
HETATM 4401 O  O     . HOH N 9 .   ? 35.908 10.851  10.367  1.00 28.20 ? 133  HOH T O     1 
HETATM 4402 O  O     . HOH N 9 .   ? 40.617 -9.920  -11.335 1.00 37.10 ? 134  HOH T O     1 
HETATM 4403 O  O     . HOH O 9 .   ? 46.064 3.842   1.223   1.00 20.59 ? 201  HOH P O     1 
HETATM 4404 O  O     . HOH O 9 .   ? 38.374 -10.698 6.178   1.00 34.26 ? 202  HOH P O     1 
HETATM 4405 O  O     . HOH O 9 .   ? 49.011 2.466   1.170   0.55 11.48 ? 203  HOH P O     1 
HETATM 4406 O  O     . HOH O 9 .   ? 32.233 -7.618  -11.573 1.00 33.84 ? 204  HOH P O     1 
HETATM 4407 O  O     . HOH O 9 .   ? 41.818 -11.489 -1.288  1.00 27.50 ? 205  HOH P O     1 
HETATM 4408 O  O     . HOH O 9 .   ? 46.369 -5.383  6.966   1.00 32.19 ? 206  HOH P O     1 
HETATM 4409 O  O     . HOH O 9 .   ? 44.454 7.344   2.310   1.00 19.55 ? 207  HOH P O     1 
HETATM 4410 O  O     . HOH O 9 .   ? 49.198 -10.092 6.514   1.00 23.47 ? 208  HOH P O     1 
HETATM 4411 O  O     . HOH O 9 .   ? 42.802 -8.919  6.984   1.00 26.51 ? 209  HOH P O     1 
HETATM 4412 O  O     . HOH O 9 .   ? 34.524 -9.098  -11.162 1.00 37.34 ? 210  HOH P O     1 
HETATM 4413 O  O     . HOH O 9 .   ? 44.712 -8.368  -1.151  1.00 28.14 ? 211  HOH P O     1 
HETATM 4414 O  O     . HOH O 9 .   ? 26.333 -12.779 -10.346 1.00 24.91 ? 212  HOH P O     1 
HETATM 4415 O  O     . HOH O 9 .   ? 48.072 -1.982  6.942   1.00 18.75 ? 213  HOH P O     1 
HETATM 4416 O  O     . HOH O 9 .   ? 46.749 -7.894  7.677   1.00 38.62 ? 214  HOH P O     1 
HETATM 4417 O  O     . HOH O 9 .   ? 30.730 -6.404  -13.348 1.00 38.46 ? 215  HOH P O     1 
HETATM 4418 O  O     . HOH O 9 .   ? 46.098 -2.502  -0.862  1.00 22.92 ? 216  HOH P O     1 
HETATM 4419 O  O     . HOH O 9 .   ? 36.577 -4.579  3.260   1.00 30.72 ? 217  HOH P O     1 
HETATM 4420 O  O     . HOH O 9 .   ? 41.446 -15.757 1.771   1.00 24.33 ? 218  HOH P O     1 
HETATM 4421 O  O     . HOH O 9 .   ? 40.500 -5.537  5.574   1.00 30.37 ? 219  HOH P O     1 
HETATM 4422 O  O     . HOH O 9 .   ? 38.741 -4.183  4.652   1.00 34.42 ? 220  HOH P O     1 
HETATM 4423 O  O     . HOH O 9 .   ? 44.094 -6.575  6.026   1.00 30.50 ? 221  HOH P O     1 
HETATM 4424 O  O     B HOH O 9 .   ? 49.625 1.831   7.842   0.40 17.20 ? 222  HOH P O     1 
HETATM 4425 O  O     . HOH O 9 .   ? 40.338 -14.069 -0.278  1.00 30.25 ? 223  HOH P O     1 
HETATM 4426 O  O     . HOH O 9 .   ? 40.330 -9.095  5.923   1.00 33.03 ? 224  HOH P O     1 
HETATM 4427 O  O     . HOH O 9 .   ? 45.794 -10.788 -0.146  1.00 25.39 ? 225  HOH P O     1 
HETATM 4428 O  O     . HOH O 9 .   ? 44.158 -12.778 -0.393  1.00 24.96 ? 226  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1   501  501  MN  MN  A . 
E 5 CA  1   502  502  CA  CA  A . 
F 4 MN  1   503  503  MN  MN  A . 
G 6 GOL 1   504  506  GOL GOL A . 
H 6 GOL 1   505  507  GOL GOL A . 
I 6 GOL 1   506  508  GOL GOL A . 
J 7 DTP 1   507  504  DTP DTP A . 
K 8 DPO 1   508  505  DPO DPO A . 
L 4 MN  1   101  506  MN  MN  P . 
M 9 HOH 1   601  759  HOH HOH A . 
M 9 HOH 2   602  843  HOH HOH A . 
M 9 HOH 3   603  840  HOH HOH A . 
M 9 HOH 4   604  644  HOH HOH A . 
M 9 HOH 5   605  995  HOH HOH A . 
M 9 HOH 6   606  975  HOH HOH A . 
M 9 HOH 7   607  735  HOH HOH A . 
M 9 HOH 8   608  797  HOH HOH A . 
M 9 HOH 9   609  806  HOH HOH A . 
M 9 HOH 10  610  977  HOH HOH A . 
M 9 HOH 11  611  842  HOH HOH A . 
M 9 HOH 12  612  865  HOH HOH A . 
M 9 HOH 13  613  110  HOH HOH A . 
M 9 HOH 14  614  803  HOH HOH A . 
M 9 HOH 15  615  913  HOH HOH A . 
M 9 HOH 16  616  827  HOH HOH A . 
M 9 HOH 17  617  999  HOH HOH A . 
M 9 HOH 18  618  653  HOH HOH A . 
M 9 HOH 19  619  724  HOH HOH A . 
M 9 HOH 20  620  863  HOH HOH A . 
M 9 HOH 21  621  601  HOH HOH A . 
M 9 HOH 22  622  778  HOH HOH A . 
M 9 HOH 23  623  105  HOH HOH A . 
M 9 HOH 24  624  935  HOH HOH A . 
M 9 HOH 25  625  846  HOH HOH A . 
M 9 HOH 26  626  783  HOH HOH A . 
M 9 HOH 27  627  886  HOH HOH A . 
M 9 HOH 28  628  834  HOH HOH A . 
M 9 HOH 29  629  958  HOH HOH A . 
M 9 HOH 30  630  801  HOH HOH A . 
M 9 HOH 31  631  722  HOH HOH A . 
M 9 HOH 32  632  725  HOH HOH A . 
M 9 HOH 33  633  686  HOH HOH A . 
M 9 HOH 34  634  776  HOH HOH A . 
M 9 HOH 35  635  884  HOH HOH A . 
M 9 HOH 36  636  852  HOH HOH A . 
M 9 HOH 37  637  646  HOH HOH A . 
M 9 HOH 38  638  640  HOH HOH A . 
M 9 HOH 39  639  923  HOH HOH A . 
M 9 HOH 40  640  2    HOH HOH A . 
M 9 HOH 41  641  707  HOH HOH A . 
M 9 HOH 42  642  714  HOH HOH A . 
M 9 HOH 43  643  900  HOH HOH A . 
M 9 HOH 44  644  838  HOH HOH A . 
M 9 HOH 45  645  824  HOH HOH A . 
M 9 HOH 46  646  679  HOH HOH A . 
M 9 HOH 47  647  609  HOH HOH A . 
M 9 HOH 48  648  622  HOH HOH A . 
M 9 HOH 49  649  875  HOH HOH A . 
M 9 HOH 50  650  841  HOH HOH A . 
M 9 HOH 51  651  819  HOH HOH A . 
M 9 HOH 52  652  758  HOH HOH A . 
M 9 HOH 53  653  611  HOH HOH A . 
M 9 HOH 54  654  605  HOH HOH A . 
M 9 HOH 55  655  658  HOH HOH A . 
M 9 HOH 56  656  899  HOH HOH A . 
M 9 HOH 57  657  701  HOH HOH A . 
M 9 HOH 58  658  645  HOH HOH A . 
M 9 HOH 59  659  660  HOH HOH A . 
M 9 HOH 60  660  831  HOH HOH A . 
M 9 HOH 61  661  972  HOH HOH A . 
M 9 HOH 62  662  705  HOH HOH A . 
M 9 HOH 63  663  635  HOH HOH A . 
M 9 HOH 64  664  998  HOH HOH A . 
M 9 HOH 65  665  813  HOH HOH A . 
M 9 HOH 66  666  692  HOH HOH A . 
M 9 HOH 67  667  689  HOH HOH A . 
M 9 HOH 68  668  904  HOH HOH A . 
M 9 HOH 69  669  782  HOH HOH A . 
M 9 HOH 70  670  712  HOH HOH A . 
M 9 HOH 71  671  990  HOH HOH A . 
M 9 HOH 72  672  617  HOH HOH A . 
M 9 HOH 73  673  647  HOH HOH A . 
M 9 HOH 74  674  668  HOH HOH A . 
M 9 HOH 75  675  638  HOH HOH A . 
M 9 HOH 76  676  667  HOH HOH A . 
M 9 HOH 77  677  944  HOH HOH A . 
M 9 HOH 78  678  671  HOH HOH A . 
M 9 HOH 79  679  848  HOH HOH A . 
M 9 HOH 80  680  606  HOH HOH A . 
M 9 HOH 81  681  822  HOH HOH A . 
M 9 HOH 82  682  661  HOH HOH A . 
M 9 HOH 83  683  704  HOH HOH A . 
M 9 HOH 84  684  850  HOH HOH A . 
M 9 HOH 85  685  642  HOH HOH A . 
M 9 HOH 86  686  936  HOH HOH A . 
M 9 HOH 87  687  744  HOH HOH A . 
M 9 HOH 88  688  890  HOH HOH A . 
M 9 HOH 89  689  648  HOH HOH A . 
M 9 HOH 90  690  657  HOH HOH A . 
M 9 HOH 91  691  771  HOH HOH A . 
M 9 HOH 92  692  872  HOH HOH A . 
M 9 HOH 93  693  805  HOH HOH A . 
M 9 HOH 94  694  739  HOH HOH A . 
M 9 HOH 95  695  685  HOH HOH A . 
M 9 HOH 96  696  793  HOH HOH A . 
M 9 HOH 97  697  639  HOH HOH A . 
M 9 HOH 98  698  728  HOH HOH A . 
M 9 HOH 99  699  870  HOH HOH A . 
M 9 HOH 100 700  682  HOH HOH A . 
M 9 HOH 101 701  791  HOH HOH A . 
M 9 HOH 102 702  618  HOH HOH A . 
M 9 HOH 103 703  730  HOH HOH A . 
M 9 HOH 104 704  669  HOH HOH A . 
M 9 HOH 105 705  603  HOH HOH A . 
M 9 HOH 106 706  677  HOH HOH A . 
M 9 HOH 107 707  626  HOH HOH A . 
M 9 HOH 108 708  742  HOH HOH A . 
M 9 HOH 109 709  727  HOH HOH A . 
M 9 HOH 110 710  676  HOH HOH A . 
M 9 HOH 111 711  625  HOH HOH A . 
M 9 HOH 112 712  825  HOH HOH A . 
M 9 HOH 113 713  917  HOH HOH A . 
M 9 HOH 114 714  766  HOH HOH A . 
M 9 HOH 115 715  688  HOH HOH A . 
M 9 HOH 116 716  973  HOH HOH A . 
M 9 HOH 117 717  919  HOH HOH A . 
M 9 HOH 118 718  634  HOH HOH A . 
M 9 HOH 119 719  1002 HOH HOH A . 
M 9 HOH 120 720  721  HOH HOH A . 
M 9 HOH 121 721  627  HOH HOH A . 
M 9 HOH 122 722  623  HOH HOH A . 
M 9 HOH 123 723  810  HOH HOH A . 
M 9 HOH 124 724  858  HOH HOH A . 
M 9 HOH 125 725  715  HOH HOH A . 
M 9 HOH 126 726  932  HOH HOH A . 
M 9 HOH 127 727  733  HOH HOH A . 
M 9 HOH 128 728  855  HOH HOH A . 
M 9 HOH 129 729  743  HOH HOH A . 
M 9 HOH 130 730  835  HOH HOH A . 
M 9 HOH 131 731  740  HOH HOH A . 
M 9 HOH 132 732  808  HOH HOH A . 
M 9 HOH 133 733  769  HOH HOH A . 
M 9 HOH 134 734  663  HOH HOH A . 
M 9 HOH 135 735  741  HOH HOH A . 
M 9 HOH 136 736  729  HOH HOH A . 
M 9 HOH 137 737  630  HOH HOH A . 
M 9 HOH 138 738  670  HOH HOH A . 
M 9 HOH 139 739  877  HOH HOH A . 
M 9 HOH 140 740  752  HOH HOH A . 
M 9 HOH 141 741  695  HOH HOH A . 
M 9 HOH 142 742  678  HOH HOH A . 
M 9 HOH 143 743  650  HOH HOH A . 
M 9 HOH 144 744  796  HOH HOH A . 
M 9 HOH 145 745  629  HOH HOH A . 
M 9 HOH 146 746  608  HOH HOH A . 
M 9 HOH 147 747  651  HOH HOH A . 
M 9 HOH 148 748  779  HOH HOH A . 
M 9 HOH 149 749  632  HOH HOH A . 
M 9 HOH 150 750  853  HOH HOH A . 
M 9 HOH 151 751  628  HOH HOH A . 
M 9 HOH 152 752  633  HOH HOH A . 
M 9 HOH 153 753  683  HOH HOH A . 
M 9 HOH 154 754  761  HOH HOH A . 
M 9 HOH 155 755  996  HOH HOH A . 
M 9 HOH 156 756  794  HOH HOH A . 
M 9 HOH 157 757  788  HOH HOH A . 
M 9 HOH 158 758  687  HOH HOH A . 
M 9 HOH 159 759  613  HOH HOH A . 
M 9 HOH 160 760  610  HOH HOH A . 
M 9 HOH 161 761  607  HOH HOH A . 
M 9 HOH 162 762  107  HOH HOH A . 
M 9 HOH 163 763  616  HOH HOH A . 
M 9 HOH 164 764  882  HOH HOH A . 
M 9 HOH 165 765  976  HOH HOH A . 
M 9 HOH 166 766  619  HOH HOH A . 
M 9 HOH 167 767  888  HOH HOH A . 
M 9 HOH 168 768  672  HOH HOH A . 
M 9 HOH 169 769  656  HOH HOH A . 
M 9 HOH 170 770  680  HOH HOH A . 
M 9 HOH 171 771  652  HOH HOH A . 
M 9 HOH 172 772  768  HOH HOH A . 
M 9 HOH 173 773  662  HOH HOH A . 
M 9 HOH 174 774  979  HOH HOH A . 
M 9 HOH 175 775  820  HOH HOH A . 
M 9 HOH 176 776  861  HOH HOH A . 
M 9 HOH 177 777  736  HOH HOH A . 
M 9 HOH 178 778  621  HOH HOH A . 
M 9 HOH 179 779  830  HOH HOH A . 
M 9 HOH 180 780  604  HOH HOH A . 
M 9 HOH 181 781  665  HOH HOH A . 
M 9 HOH 182 782  694  HOH HOH A . 
M 9 HOH 183 783  708  HOH HOH A . 
M 9 HOH 184 784  773  HOH HOH A . 
M 9 HOH 185 785  717  HOH HOH A . 
M 9 HOH 186 786  775  HOH HOH A . 
M 9 HOH 187 787  674  HOH HOH A . 
M 9 HOH 188 788  684  HOH HOH A . 
M 9 HOH 189 789  763  HOH HOH A . 
M 9 HOH 190 790  702  HOH HOH A . 
M 9 HOH 191 791  867  HOH HOH A . 
M 9 HOH 192 792  786  HOH HOH A . 
M 9 HOH 193 793  703  HOH HOH A . 
M 9 HOH 194 794  994  HOH HOH A . 
M 9 HOH 195 795  849  HOH HOH A . 
M 9 HOH 196 796  889  HOH HOH A . 
M 9 HOH 197 797  655  HOH HOH A . 
M 9 HOH 198 798  772  HOH HOH A . 
M 9 HOH 199 799  745  HOH HOH A . 
M 9 HOH 200 800  737  HOH HOH A . 
M 9 HOH 201 801  620  HOH HOH A . 
M 9 HOH 202 802  777  HOH HOH A . 
M 9 HOH 203 803  921  HOH HOH A . 
M 9 HOH 204 804  914  HOH HOH A . 
M 9 HOH 205 805  643  HOH HOH A . 
M 9 HOH 206 806  818  HOH HOH A . 
M 9 HOH 207 807  636  HOH HOH A . 
M 9 HOH 208 808  814  HOH HOH A . 
M 9 HOH 209 809  799  HOH HOH A . 
M 9 HOH 210 810  896  HOH HOH A . 
M 9 HOH 211 811  868  HOH HOH A . 
M 9 HOH 212 812  654  HOH HOH A . 
M 9 HOH 213 813  719  HOH HOH A . 
M 9 HOH 214 814  881  HOH HOH A . 
M 9 HOH 215 815  790  HOH HOH A . 
M 9 HOH 216 816  760  HOH HOH A . 
M 9 HOH 217 817  720  HOH HOH A . 
M 9 HOH 218 818  894  HOH HOH A . 
M 9 HOH 219 819  956  HOH HOH A . 
M 9 HOH 220 820  815  HOH HOH A . 
M 9 HOH 221 821  781  HOH HOH A . 
M 9 HOH 222 822  964  HOH HOH A . 
M 9 HOH 223 823  829  HOH HOH A . 
M 9 HOH 224 824  614  HOH HOH A . 
M 9 HOH 225 825  789  HOH HOH A . 
M 9 HOH 226 826  750  HOH HOH A . 
M 9 HOH 227 827  780  HOH HOH A . 
M 9 HOH 228 828  659  HOH HOH A . 
M 9 HOH 229 829  723  HOH HOH A . 
M 9 HOH 230 830  929  HOH HOH A . 
M 9 HOH 231 831  612  HOH HOH A . 
M 9 HOH 232 832  631  HOH HOH A . 
M 9 HOH 233 833  624  HOH HOH A . 
M 9 HOH 234 834  807  HOH HOH A . 
M 9 HOH 235 835  757  HOH HOH A . 
M 9 HOH 236 836  885  HOH HOH A . 
M 9 HOH 237 837  746  HOH HOH A . 
M 9 HOH 238 838  847  HOH HOH A . 
M 9 HOH 239 839  826  HOH HOH A . 
M 9 HOH 240 840  901  HOH HOH A . 
M 9 HOH 241 841  933  HOH HOH A . 
M 9 HOH 242 842  925  HOH HOH A . 
M 9 HOH 243 843  637  HOH HOH A . 
M 9 HOH 244 844  615  HOH HOH A . 
M 9 HOH 245 845  984  HOH HOH A . 
M 9 HOH 246 846  713  HOH HOH A . 
M 9 HOH 247 847  649  HOH HOH A . 
M 9 HOH 248 848  950  HOH HOH A . 
M 9 HOH 249 849  732  HOH HOH A . 
M 9 HOH 250 850  800  HOH HOH A . 
M 9 HOH 251 851  967  HOH HOH A . 
M 9 HOH 252 852  710  HOH HOH A . 
M 9 HOH 253 853  968  HOH HOH A . 
M 9 HOH 254 854  934  HOH HOH A . 
M 9 HOH 255 855  666  HOH HOH A . 
M 9 HOH 256 856  946  HOH HOH A . 
M 9 HOH 257 857  980  HOH HOH A . 
M 9 HOH 258 858  709  HOH HOH A . 
M 9 HOH 259 859  859  HOH HOH A . 
M 9 HOH 260 860  762  HOH HOH A . 
M 9 HOH 261 861  749  HOH HOH A . 
M 9 HOH 262 862  731  HOH HOH A . 
M 9 HOH 263 863  926  HOH HOH A . 
M 9 HOH 264 864  817  HOH HOH A . 
M 9 HOH 265 865  862  HOH HOH A . 
M 9 HOH 266 866  856  HOH HOH A . 
M 9 HOH 267 867  699  HOH HOH A . 
M 9 HOH 268 868  948  HOH HOH A . 
M 9 HOH 269 869  966  HOH HOH A . 
M 9 HOH 270 870  681  HOH HOH A . 
M 9 HOH 271 871  784  HOH HOH A . 
M 9 HOH 272 872  816  HOH HOH A . 
M 9 HOH 273 873  928  HOH HOH A . 
M 9 HOH 274 874  963  HOH HOH A . 
M 9 HOH 275 875  809  HOH HOH A . 
M 9 HOH 276 876  854  HOH HOH A . 
M 9 HOH 277 877  718  HOH HOH A . 
M 9 HOH 278 878  804  HOH HOH A . 
M 9 HOH 279 879  747  HOH HOH A . 
M 9 HOH 280 880  833  HOH HOH A . 
M 9 HOH 281 881  938  HOH HOH A . 
M 9 HOH 282 882  675  HOH HOH A . 
M 9 HOH 283 883  754  HOH HOH A . 
M 9 HOH 284 884  767  HOH HOH A . 
M 9 HOH 285 885  734  HOH HOH A . 
M 9 HOH 286 886  989  HOH HOH A . 
M 9 HOH 287 887  774  HOH HOH A . 
M 9 HOH 288 888  133  HOH HOH A . 
M 9 HOH 289 889  960  HOH HOH A . 
M 9 HOH 290 890  873  HOH HOH A . 
M 9 HOH 291 891  949  HOH HOH A . 
M 9 HOH 292 892  1001 HOH HOH A . 
M 9 HOH 293 893  965  HOH HOH A . 
M 9 HOH 294 894  951  HOH HOH A . 
M 9 HOH 295 895  927  HOH HOH A . 
M 9 HOH 296 896  641  HOH HOH A . 
M 9 HOH 297 897  755  HOH HOH A . 
M 9 HOH 298 898  216  HOH HOH A . 
M 9 HOH 299 899  902  HOH HOH A . 
M 9 HOH 300 900  787  HOH HOH A . 
M 9 HOH 301 901  912  HOH HOH A . 
M 9 HOH 302 902  891  HOH HOH A . 
M 9 HOH 303 903  931  HOH HOH A . 
M 9 HOH 304 904  906  HOH HOH A . 
M 9 HOH 305 905  942  HOH HOH A . 
M 9 HOH 306 906  892  HOH HOH A . 
M 9 HOH 307 907  869  HOH HOH A . 
M 9 HOH 308 908  915  HOH HOH A . 
M 9 HOH 309 909  716  HOH HOH A . 
M 9 HOH 310 910  997  HOH HOH A . 
M 9 HOH 311 911  711  HOH HOH A . 
M 9 HOH 312 912  785  HOH HOH A . 
M 9 HOH 313 913  969  HOH HOH A . 
M 9 HOH 314 914  706  HOH HOH A . 
M 9 HOH 315 915  1000 HOH HOH A . 
M 9 HOH 316 916  910  HOH HOH A . 
M 9 HOH 317 917  930  HOH HOH A . 
M 9 HOH 318 918  811  HOH HOH A . 
M 9 HOH 319 919  770  HOH HOH A . 
M 9 HOH 320 920  970  HOH HOH A . 
M 9 HOH 321 921  993  HOH HOH A . 
M 9 HOH 322 922  941  HOH HOH A . 
M 9 HOH 323 923  957  HOH HOH A . 
M 9 HOH 324 924  756  HOH HOH A . 
M 9 HOH 325 925  983  HOH HOH A . 
M 9 HOH 326 926  802  HOH HOH A . 
M 9 HOH 327 927  907  HOH HOH A . 
M 9 HOH 328 928  988  HOH HOH A . 
M 9 HOH 329 929  908  HOH HOH A . 
M 9 HOH 330 930  860  HOH HOH A . 
M 9 HOH 331 931  920  HOH HOH A . 
M 9 HOH 332 932  857  HOH HOH A . 
M 9 HOH 333 933  698  HOH HOH A . 
M 9 HOH 334 934  937  HOH HOH A . 
M 9 HOH 335 935  992  HOH HOH A . 
M 9 HOH 336 936  974  HOH HOH A . 
M 9 HOH 337 937  836  HOH HOH A . 
M 9 HOH 338 938  764  HOH HOH A . 
M 9 HOH 339 939  981  HOH HOH A . 
M 9 HOH 340 940  952  HOH HOH A . 
M 9 HOH 341 941  874  HOH HOH A . 
M 9 HOH 342 942  792  HOH HOH A . 
M 9 HOH 343 943  812  HOH HOH A . 
M 9 HOH 344 944  916  HOH HOH A . 
M 9 HOH 345 945  765  HOH HOH A . 
M 9 HOH 346 946  690  HOH HOH A . 
M 9 HOH 347 947  971  HOH HOH A . 
M 9 HOH 348 948  866  HOH HOH A . 
M 9 HOH 349 949  909  HOH HOH A . 
M 9 HOH 350 950  922  HOH HOH A . 
M 9 HOH 351 951  753  HOH HOH A . 
M 9 HOH 352 952  897  HOH HOH A . 
M 9 HOH 353 953  924  HOH HOH A . 
M 9 HOH 354 954  751  HOH HOH A . 
M 9 HOH 355 955  124  HOH HOH A . 
M 9 HOH 356 956  903  HOH HOH A . 
M 9 HOH 357 957  961  HOH HOH A . 
M 9 HOH 358 958  962  HOH HOH A . 
M 9 HOH 359 959  893  HOH HOH A . 
M 9 HOH 360 960  953  HOH HOH A . 
M 9 HOH 361 961  898  HOH HOH A . 
M 9 HOH 362 962  1003 HOH HOH A . 
M 9 HOH 363 963  726  HOH HOH A . 
M 9 HOH 364 964  943  HOH HOH A . 
M 9 HOH 365 965  945  HOH HOH A . 
M 9 HOH 366 966  693  HOH HOH A . 
M 9 HOH 367 967  947  HOH HOH A . 
M 9 HOH 368 968  878  HOH HOH A . 
M 9 HOH 369 969  828  HOH HOH A . 
M 9 HOH 370 970  978  HOH HOH A . 
M 9 HOH 371 971  991  HOH HOH A . 
M 9 HOH 372 972  895  HOH HOH A . 
M 9 HOH 373 973  982  HOH HOH A . 
M 9 HOH 374 974  837  HOH HOH A . 
M 9 HOH 375 975  664  HOH HOH A . 
M 9 HOH 376 976  795  HOH HOH A . 
M 9 HOH 377 977  821  HOH HOH A . 
M 9 HOH 378 978  697  HOH HOH A . 
M 9 HOH 379 979  696  HOH HOH A . 
M 9 HOH 380 980  823  HOH HOH A . 
M 9 HOH 381 981  880  HOH HOH A . 
M 9 HOH 382 982  748  HOH HOH A . 
M 9 HOH 383 983  905  HOH HOH A . 
M 9 HOH 384 984  876  HOH HOH A . 
M 9 HOH 385 985  955  HOH HOH A . 
M 9 HOH 386 986  887  HOH HOH A . 
M 9 HOH 387 987  839  HOH HOH A . 
M 9 HOH 388 988  883  HOH HOH A . 
M 9 HOH 389 989  911  HOH HOH A . 
M 9 HOH 390 990  959  HOH HOH A . 
M 9 HOH 391 991  987  HOH HOH A . 
M 9 HOH 392 992  738  HOH HOH A . 
M 9 HOH 393 993  954  HOH HOH A . 
M 9 HOH 394 994  691  HOH HOH A . 
M 9 HOH 395 995  940  HOH HOH A . 
M 9 HOH 396 996  985  HOH HOH A . 
M 9 HOH 397 997  851  HOH HOH A . 
M 9 HOH 398 998  700  HOH HOH A . 
M 9 HOH 399 999  864  HOH HOH A . 
M 9 HOH 400 1000 845  HOH HOH A . 
M 9 HOH 401 1001 879  HOH HOH A . 
M 9 HOH 402 1002 918  HOH HOH A . 
M 9 HOH 403 1003 986  HOH HOH A . 
N 9 HOH 1   101  109  HOH HOH T . 
N 9 HOH 2   102  115  HOH HOH T . 
N 9 HOH 3   103  106  HOH HOH T . 
N 9 HOH 4   104  136  HOH HOH T . 
N 9 HOH 5   105  123  HOH HOH T . 
N 9 HOH 6   106  128  HOH HOH T . 
N 9 HOH 7   107  113  HOH HOH T . 
N 9 HOH 8   108  104  HOH HOH T . 
N 9 HOH 9   109  111  HOH HOH T . 
N 9 HOH 10  110  120  HOH HOH T . 
N 9 HOH 11  111  119  HOH HOH T . 
N 9 HOH 12  112  108  HOH HOH T . 
N 9 HOH 13  113  102  HOH HOH T . 
N 9 HOH 14  114  122  HOH HOH T . 
N 9 HOH 15  115  101  HOH HOH T . 
N 9 HOH 16  116  125  HOH HOH T . 
N 9 HOH 17  117  134  HOH HOH T . 
N 9 HOH 18  118  116  HOH HOH T . 
N 9 HOH 19  119  103  HOH HOH T . 
N 9 HOH 20  120  130  HOH HOH T . 
N 9 HOH 21  121  127  HOH HOH T . 
N 9 HOH 22  122  117  HOH HOH T . 
N 9 HOH 23  123  118  HOH HOH T . 
N 9 HOH 24  124  121  HOH HOH T . 
N 9 HOH 25  125  135  HOH HOH T . 
N 9 HOH 26  126  114  HOH HOH T . 
N 9 HOH 27  127  132  HOH HOH T . 
N 9 HOH 28  128  112  HOH HOH T . 
N 9 HOH 29  129  126  HOH HOH T . 
N 9 HOH 30  130  798  HOH HOH T . 
N 9 HOH 31  131  129  HOH HOH T . 
N 9 HOH 32  132  832  HOH HOH T . 
N 9 HOH 33  133  871  HOH HOH T . 
N 9 HOH 34  134  131  HOH HOH T . 
O 9 HOH 1   201  211  HOH HOH P . 
O 9 HOH 2   202  215  HOH HOH P . 
O 9 HOH 3   203  1    HOH HOH P . 
O 9 HOH 4   204  217  HOH HOH P . 
O 9 HOH 5   205  202  HOH HOH P . 
O 9 HOH 6   206  218  HOH HOH P . 
O 9 HOH 7   207  673  HOH HOH P . 
O 9 HOH 8   208  201  HOH HOH P . 
O 9 HOH 9   209  203  HOH HOH P . 
O 9 HOH 10  210  221  HOH HOH P . 
O 9 HOH 11  211  204  HOH HOH P . 
O 9 HOH 12  212  209  HOH HOH P . 
O 9 HOH 13  213  212  HOH HOH P . 
O 9 HOH 14  214  214  HOH HOH P . 
O 9 HOH 15  215  219  HOH HOH P . 
O 9 HOH 16  216  210  HOH HOH P . 
O 9 HOH 17  217  222  HOH HOH P . 
O 9 HOH 18  218  205  HOH HOH P . 
O 9 HOH 19  219  220  HOH HOH P . 
O 9 HOH 20  220  224  HOH HOH P . 
O 9 HOH 21  221  223  HOH HOH P . 
O 9 HOH 22  222  602  HOH HOH P . 
O 9 HOH 23  223  213  HOH HOH P . 
O 9 HOH 24  224  207  HOH HOH P . 
O 9 HOH 25  225  208  HOH HOH P . 
O 9 HOH 26  226  206  HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6550  ? 
1 MORE         -63   ? 
1 'SSA (A^2)'  21940 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 83.2  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 101.0 ? 
3  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.5  ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   A J DTP .   ? A DTP 507 ? 1_555 166.9 ? 
5  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   A J DTP .   ? A DTP 507 ? 1_555 90.1  ? 
6  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   A J DTP .   ? A DTP 507 ? 1_555 89.4  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 105.9 ? 
8  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 163.8 ? 
9  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 81.8  ? 
10 O1B   A J DTP .   ? A DTP 507 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 83.3  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 83.8  ? 
12 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 101.0 ? 
13 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 173.9 ? 
14 O1B   A J DTP .   ? A DTP 507 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 86.4  ? 
15 O1A   A J DTP .   ? A DTP 507 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 93.3  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 83.7  ? 
17 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 101.5 ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 85.2  ? 
19 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 102.0 ? 
20 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 160.8 ? 
21 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 75.7  ? 
22 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1    B K DPO .   ? A DPO 508 ? 1_555 167.0 ? 
23 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1    B K DPO .   ? A DPO 508 ? 1_555 96.1  ? 
24 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1    B K DPO .   ? A DPO 508 ? 1_555 91.4  ? 
25 OP1   B C DA  9   ? P DA  9   ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1    B K DPO .   ? A DPO 508 ? 1_555 82.3  ? 
26 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 86.9  ? 
27 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 105.5 ? 
28 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 167.2 ? 
29 OP1   B C DA  9   ? P DA  9   ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 93.2  ? 
30 O1    B K DPO .   ? A DPO 508 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 80.6  ? 
31 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 92.6  ? 
32 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 93.8  ? 
33 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 93.8  ? 
34 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 172.4 ? 
35 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 83.4  ? 
36 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 80.1  ? 
37 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 171.0 ? 
38 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 92.1  ? 
39 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 93.5  ? 
40 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 16.6  ? 
41 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 109.6 ? 
42 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 86.2  ? 
43 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 156.7 ? 
44 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 76.7  ? 
45 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 63.2  ? 
46 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? A HOH 780 ? 1_555 91.2  ? 
47 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? A HOH 780 ? 1_555 171.2 ? 
48 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? A HOH 780 ? 1_555 93.8  ? 
49 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? A HOH 780 ? 1_555 93.6  ? 
50 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? A HOH 780 ? 1_555 83.1  ? 
51 OP1   B C DA  9   ? P DA  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? A HOH 780 ? 1_555 85.1  ? 
52 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 103.0 ? 
53 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 89.1  ? 
54 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 162.8 ? 
55 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 83.5  ? 
56 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 69.4  ? 
57 OP1   B C DA  9   ? P DA  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 7.1   ? 
58 O     ? M HOH .   ? A HOH 780 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 82.4  ? 
59 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O2    B K DPO .   ? A DPO 508 ? 1_555 83.8  ? 
60 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 650 ? 1_555 78.8  ? 
61 O2    B K DPO .   ? A DPO 508 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 650 ? 1_555 159.0 ? 
62 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B M HOH .   ? A HOH 796 ? 1_555 90.9  ? 
63 O2    B K DPO .   ? A DPO 508 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B M HOH .   ? A HOH 796 ? 1_555 95.9  ? 
64 O     ? M HOH .   ? A HOH 650 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B M HOH .   ? A HOH 796 ? 1_555 72.9  ? 
65 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B O HOH .   ? P HOH 222 ? 1_555 95.1  ? 
66 O2    B K DPO .   ? A DPO 508 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B O HOH .   ? P HOH 222 ? 1_555 92.1  ? 
67 O     ? M HOH .   ? A HOH 650 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B O HOH .   ? P HOH 222 ? 1_555 101.1 ? 
68 O     B M HOH .   ? A HOH 796 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B O HOH .   ? P HOH 222 ? 1_555 170.6 ? 
69 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 618 ? 1_555 171.6 ? 
70 O2    B K DPO .   ? A DPO 508 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 618 ? 1_555 90.0  ? 
71 O     ? M HOH .   ? A HOH 650 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 618 ? 1_555 106.1 ? 
72 O     B M HOH .   ? A HOH 796 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 618 ? 1_555 84.2  ? 
73 O     B O HOH .   ? P HOH 222 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 618 ? 1_555 90.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-29 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Derived calculations'       
3 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support    
2 2 'Structure model' pdbx_struct_oper_list 
3 3 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization'  
2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 3 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .    2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .    4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .    5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 849 ? ? O A HOH 873 ? ? 2.11 
2 1 O   A HOH 603 ? ? O A HOH 907 ? ? 2.11 
3 1 OE1 A GLU 199 ? ? O A HOH 601 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     823 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     837 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_545 
_pdbx_validate_symm_contact.dist              2.10 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "C4'" P DT 8 ? B "C3'" P DT 8 ? B 1.593 1.529 0.064  0.010 N 
2 1 "C3'" P DT 8 ? B "C2'" P DT 8 ? B 1.227 1.516 -0.289 0.008 N 
3 1 "O3'" P DT 8 ? B "C3'" P DT 8 ? B 1.224 1.419 -0.195 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DT 3 ? B "C1'" T DT 3 ? B N1    T DT 3 ? B 110.19 108.30 1.89  0.30 N 
2 1 "O4'" P DA 7 ? ? "C4'" P DA 7 ? ? "C3'" P DA 7 ? ? 101.92 104.50 -2.58 0.40 N 
3 1 "O4'" P DT 8 ? B "C4'" P DT 8 ? B "C3'" P DT 8 ? B 100.94 104.50 -3.56 0.40 N 
4 1 "C5'" P DT 8 ? B "C4'" P DT 8 ? B "C3'" P DT 8 ? B 125.41 115.70 9.71  1.20 N 
5 1 "C4'" P DT 8 ? B "C3'" P DT 8 ? B "C2'" P DT 8 ? B 108.89 103.10 5.79  0.90 N 
6 1 "C3'" P DT 8 ? B "C2'" P DT 8 ? B "C1'" P DT 8 ? B 110.19 102.50 7.69  1.20 N 
7 1 N1    P DT 8 ? B "C1'" P DT 8 ? B "C2'" P DT 8 ? B 140.21 114.30 25.91 1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 34.97   57.69   
2 1 TYR A 39  ? ? 68.00   -179.90 
3 1 LYS A 40  ? ? -157.17 -32.13  
4 1 SER A 62  ? ? 85.09   -11.96  
5 1 SER A 217 ? ? -152.13 -158.56 
6 1 SER A 257 ? ? 92.41   -10.34  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KFI 'double helix'        
5KFI 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 4  1_555 C DA 9 1_555 0.127  -0.263 -0.024 0.313  -4.459  4.075  1 T_DT4:DA9_P  T 4  ? P 9 ? 20 1 
1 B DA 5  1_555 C DT 8 1_555 0.139  -0.110 0.066  -0.919 -5.776  4.702  2 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.014 -0.145 0.341  1.661  -15.072 3.156  3 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.119 -0.138 -0.445 -6.064 -1.834  -0.456 4 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.100  -0.113 0.137  4.960  -3.489  -0.439 5 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.287  -0.109 -0.271 12.342 -6.727  2.297  6 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.458 -0.136 -0.174 -5.644 -6.167  5.603  7 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.131  -0.093 0.213  -6.443 -2.661  0.469  8 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.050 -0.211 -0.200 17.239 -0.385  2.653  9 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 4  1_555 C DA 9 1_555 B DA 5  1_555 C DT 8 1_555 0.539  -0.133 3.376 0.152  9.188 38.223 -1.324 -0.783 3.261 13.789 -0.228  
39.272 1 TT_DT4DA5:DT8DA9_PP   T 4  ? P 9 ? T 5  ? P 8 ? 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.865  -1.132 3.322 -3.925 2.573 25.147 -3.274 -3.046 3.025 5.844  8.916   
25.575 2 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.491 -1.120 3.475 7.163  8.599 30.291 -3.549 2.161  2.872 15.795 -13.156 
32.247 3 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.698 -0.481 3.125 -3.754 0.415 34.291 -0.873 0.615  3.175 0.702  6.342   
34.493 4 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.509  -0.680 3.218 3.612  1.072 30.600 -1.486 -0.261 3.230 2.021  -6.812  
30.825 5 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.378 -0.535 3.838 -4.635 5.841 34.659 -1.883 -0.175 3.720 9.666  7.670   
35.427 6 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.615 -0.575 3.382 -3.104 0.424 36.783 -0.968 0.535  3.414 0.671  4.908   
36.911 7 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.199  0.249  2.937 0.535  2.835 27.129 -0.111 -0.301 2.951 6.022  -1.135  
27.279 8 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Intramural DK036146-08' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION'                MN  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 DIPHOSPHATE                         DPO 
9 water                               HOH 
#