data_5KFR
# 
_entry.id   5KFR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.285 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KFR         
WWPDB D_1000222165 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5KFA PDB . 
unspecified 5KFB PDB . 
unspecified 5KFC PDB . 
unspecified 5KG0 PDB . 
unspecified 5KG1 PDB . 
unspecified 5KG2 PDB . 
unspecified 5KG3 PDB . 
unspecified 5KG4 PDB . 
unspecified 5KG5 PDB . 
unspecified 5KG6 PDB . 
unspecified 5KG7 PDB . 
unspecified 5KFD PDB . 
unspecified 5KFE PDB . 
unspecified 5KFS PDB . 
unspecified 5KFT PDB . 
unspecified 5KFU PDB . 
unspecified 5KFV PDB . 
unspecified 5KFW PDB . 
unspecified 5KFX PDB . 
unspecified 5KFG PDB . 
unspecified 5KFY PDB . 
unspecified 5KFZ PDB . 
unspecified 5KFH PDB . 
unspecified 5KFK PDB . 
unspecified 5KFL PDB . 
unspecified 5KFI PDB . 
unspecified 5KFJ PDB . 
unspecified 5KFM PDB . 
unspecified 5KFN PDB . 
unspecified 5KFO PDB . 
unspecified 5KFP PDB . 
unspecified 5KFQ PDB . 
unspecified 5KFF PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KFR 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gao, Y.'  1 
primary 'Yang, W.' 2 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5KFR 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     98.250 
_cell.length_a_esd                 ? 
_cell.length_b                     98.250 
_cell.length_b_esd                 ? 
_cell.length_c                     81.320 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5KFR 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*(AS))-3')
;
2755.889  1   ?       ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                 54.938    2   ?       ? ? ? 
5 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
6 non-polymer syn 
;2'-DEOXYADENOSINE 5'-O-(1-THIOTRIPHOSPHATE)
;
507.247   1   ?       ? ? ? 
7 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
8 water       nat water                                                18.015    461 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no  '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no yes '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(AS)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   AS  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' ? 9606 ? 
3 1 sample 1 9  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5KFR       5KFR   ? 2 ? 1 
3 PDB 5KFR       5KFR   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KFR A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5KFR T 1 ? 12  ? 5KFR   1 ? 12  ? 1 12  
3 3 5KFR P 1 ? 9   ? 5KFR   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KFR GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5KFR PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5KFR HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ?                               'C3 H7 N O2'          
89.093  
ARG 'L-peptide linking' y ARGININE                                      ?                               'C6 H15 N4 O2 1'      
175.209 
AS  'DNA linking'       n 
;2-DEOXY-ADENOSINE -5'-THIO-MONOPHOSPHATE
;
?                               'C10 H14 N5 O5 P S'   347.287 
ASN 'L-peptide linking' y ASPARAGINE                                    ?                               'C4 H8 N2 O3'         
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ?                               'C4 H7 N O4'          
133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ?                               'C3 H7 N O2 S'        
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"          ?                               'C10 H14 N5 O6 P'     
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"           ?                               'C9 H14 N3 O7 P'      
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"          ?                               'C10 H14 N5 O7 P'     
347.221 
DPO non-polymer         . DIPHOSPHATE                                   ?                               'O7 P2 -4'            
173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                  ?                               'C10 H15 N2 O8 P'     
322.208 
GLN 'L-peptide linking' y GLUTAMINE                                     ?                               'C5 H10 N2 O3'        
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ?                               'C5 H9 N O4'          
147.129 
GLY 'peptide linking'   y GLYCINE                                       ?                               'C2 H5 N O2'          
75.067  
GOL non-polymer         . GLYCEROL                                      'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'            
92.094  
HIS 'L-peptide linking' y HISTIDINE                                     ?                               'C6 H10 N3 O2 1'      
156.162 
HOH non-polymer         . WATER                                         ?                               'H2 O'                
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ?                               'C6 H13 N O2'         
131.173 
LEU 'L-peptide linking' y LEUCINE                                       ?                               'C6 H13 N O2'         
131.173 
LYS 'L-peptide linking' y LYSINE                                        ?                               'C6 H15 N2 O2 1'      
147.195 
MET 'L-peptide linking' y METHIONINE                                    ?                               'C5 H11 N O2 S'       
149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                          ?                               'Mn 2'                
54.938  
PHE 'L-peptide linking' y PHENYLALANINE                                 ?                               'C9 H11 N O2'         
165.189 
PRO 'L-peptide linking' y PROLINE                                       ?                               'C5 H9 N O2'          
115.130 
SER 'L-peptide linking' y SERINE                                        ?                               'C3 H7 N O3'          
105.093 
STP non-polymer         . 
;2'-DEOXYADENOSINE 5'-O-(1-THIOTRIPHOSPHATE)
;
?                               'C10 H16 N5 O11 P3 S' 507.247 
THR 'L-peptide linking' y THREONINE                                     ?                               'C4 H9 N O3'          
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ?                               'C11 H12 N2 O2'       
204.225 
TYR 'L-peptide linking' y TYROSINE                                      ?                               'C9 H11 N O3'         
181.189 
VAL 'L-peptide linking' y VALINE                                        ?                               'C5 H11 N O2'         
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KFR 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.06 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.28 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            36.152 
_reflns.entry_id                         5KFR 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.750 
_reflns.d_resolution_low                 20.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       44854 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             99.700 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.5 
_reflns.pdbx_Rmerge_I_obs                0.063 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.270 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.750 1.800 ? 2.430  ? ? ? ? ? 100.000 ? ? ? ? 0.985 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1  1 ? ? 
1.800 1.840 ? 3.170  ? ? ? ? ? 99.900  ? ? ? ? 0.750 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2  1 ? ? 
1.840 1.900 ? 3.960  ? ? ? ? ? 99.800  ? ? ? ? 0.614 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3  1 ? ? 
1.900 1.960 ? 5.510  ? ? ? ? ? 99.500  ? ? ? ? 0.448 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4  1 ? ? 
1.960 2.020 ? 6.910  ? ? ? ? ? 100.000 ? ? ? ? 0.327 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5  1 ? ? 
2.020 2.090 ? 9.270  ? ? ? ? ? 99.900  ? ? ? ? 0.242 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6  1 ? ? 
2.090 2.170 ? 11.510 ? ? ? ? ? 100.000 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7  1 ? ? 
2.170 2.260 ? 13.710 ? ? ? ? ? 99.700  ? ? ? ? 0.154 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8  1 ? ? 
2.260 2.360 ? 16.110 ? ? ? ? ? 99.800  ? ? ? ? 0.118 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9  1 ? ? 
2.360 2.470 ? 19.140 ? ? ? ? ? 99.900  ? ? ? ? 0.095 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 ? ? 
2.470 2.610 ? 21.760 ? ? ? ? ? 99.800  ? ? ? ? 0.082 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 ? ? 
2.610 2.770 ? 24.950 ? ? ? ? ? 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 ? ? 
2.770 2.960 ? 28.510 ? ? ? ? ? 99.900  ? ? ? ? 0.057 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 ? ? 
2.960 3.200 ? 32.500 ? ? ? ? ? 99.400  ? ? ? ? 0.049 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 ? ? 
3.200 3.500 ? 36.990 ? ? ? ? ? 99.700  ? ? ? ? 0.042 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 ? ? 
3.500 3.910 ? 39.490 ? ? ? ? ? 99.400  ? ? ? ? 0.040 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 ? ? 
3.910 4.520 ? 41.320 ? ? ? ? ? 99.100  ? ? ? ? 0.037 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 ? ? 
4.520 5.530 ? 42.440 ? ? ? ? ? 99.000  ? ? ? ? 0.036 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 ? ? 
5.530 7.830 ? 42.220 ? ? ? ? ? 99.800  ? ? ? ? 0.038 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 ? ? 
7.830 ?     ? 41.460 ? ? ? ? ? 93.000  ? ? ? ? 0.057 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                107.190 
_refine.B_iso_mean                               35.5241 
_refine.B_iso_min                                14.160 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5KFR 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.7500 
_refine.ls_d_res_low                             19.7730 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     44851 
_refine.ls_number_reflns_R_free                  3453 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7500 
_refine.ls_percent_reflns_R_free                 7.7000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1788 
_refine.ls_R_factor_R_free                       0.2229 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1752 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4ECQ 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.6000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.7500 
_refine_hist.d_res_low                        19.7730 
_refine_hist.pdbx_number_atoms_ligand         59 
_refine_hist.number_atoms_solvent             461 
_refine_hist.number_atoms_total               4294 
_refine_hist.pdbx_number_residues_total       451 
_refine_hist.pdbx_B_iso_mean_ligand           33.48 
_refine_hist.pdbx_B_iso_mean_solvent          42.16 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
# 
_struct.entry_id                     5KFR 
_struct.title                        
'Human DNA polymerase eta-DNA ternary complex with Sp-dATP-alpha-S: reaction with 20 mM Mn2+ for 600s' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KFR 
_struct_keywords.text            
'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, replication, transferase-dna complex' 
_struct_keywords.pdbx_keywords   'replication, transferase/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 AB2 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 AB3 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 AB4 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 AB5 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 AB6 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 AB7 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 AB8 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 AB9 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 AC1 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 AC2 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 AC3 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 16  OD1   ? ? ? 1_555 E MN  . MN  B ? A ASP 13  A MN  502 1_555 ? ? ? ? ? ? ?            2.175 ? 
metalc2  metalc ?    ? A ASP 16  OD2   ? ? ? 1_555 D MN  . MN  ? ? A ASP 13  A MN  501 1_555 ? ? ? ? ? ? ?            2.273 ? 
metalc3  metalc ?    ? A MET 17  O     ? ? ? 1_555 E MN  . MN  B ? A MET 14  A MN  502 1_555 ? ? ? ? ? ? ?            2.257 ? 
metalc4  metalc ?    ? A ASP 118 OD1   ? ? ? 1_555 D MN  . MN  ? ? A ASP 115 A MN  501 1_555 ? ? ? ? ? ? ?            2.175 ? 
metalc5  metalc ?    ? A ASP 118 OD2   ? ? ? 1_555 E MN  . MN  B ? A ASP 115 A MN  502 1_555 ? ? ? ? ? ? ?            2.123 ? 
metalc6  metalc ?    ? A GLU 119 OE2   ? ? ? 1_555 D MN  . MN  ? ? A GLU 116 A MN  501 1_555 ? ? ? ? ? ? ?            2.227 ? 
metalc7  metalc ?    ? C DT  8   "O3'" A ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.234 ? 
covale1  covale both ? C DT  8   "O3'" B ? ? 1_555 C AS  9 P   B ? P DT  8   P AS  9   1_555 ? ? ? ? ? ? ?            1.599 ? 
metalc8  metalc ?    ? C DT  8   "O3'" B ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.505 ? 
metalc9  metalc ?    ? C AS  9   OP1   B ? ? 1_555 D MN  . MN  ? ? P AS  9   A MN  501 1_555 ? ? ? ? ? ? ?            2.006 ? 
metalc10 metalc ?    ? C AS  9   OP1   B ? ? 1_555 E MN  . MN  B ? P AS  9   A MN  502 1_555 ? ? ? ? ? ? ?            2.520 ? 
metalc11 metalc ?    ? D MN  .   MN    ? ? ? 1_555 M HOH . O   ? ? A MN  501 P HOH 107 1_555 ? ? ? ? ? ? ?            2.226 ? 
metalc12 metalc ?    ? D MN  .   MN    ? ? ? 1_555 I STP . O2A A ? A MN  501 A STP 506 1_555 ? ? ? ? ? ? ?            2.116 ? 
hydrog1  hydrog ?    ? B DT  4   N3    B ? ? 1_555 C AS  9 N1  B ? T DT  4   P AS  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DT  4   O4    B ? ? 1_555 C AS  9 N6  B ? T DT  4   P AS  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -2.30 
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 0.82  
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -9.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  501 ? 8  'binding site for residue MN A 501'  
AC2 Software A MN  502 ? 7  'binding site for residue MN A 502'  
AC3 Software A GOL 503 ? 10 'binding site for residue GOL A 503' 
AC4 Software A GOL 504 ? 7  'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 10 'binding site for residue GOL A 505' 
AC6 Software A STP 506 ? 29 'binding site for residue STP A 506' 
AC7 Software A DPO 507 ? 17 'binding site for residue DPO A 507' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4  AC1 8  MN  E .   ? MN  A 502 . ? 1_555 ? 
5  AC1 8  STP I .   ? STP A 506 . ? 1_555 ? 
6  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
7  AC1 8  AS  C 9   ? AS  P 9   . ? 1_555 ? 
8  AC1 8  HOH M .   ? HOH P 107 . ? 1_555 ? 
9  AC2 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 7  MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
12 AC2 7  MN  D .   ? MN  A 501 . ? 1_555 ? 
13 AC2 7  STP I .   ? STP A 506 . ? 1_555 ? 
14 AC2 7  DPO J .   ? DPO A 507 . ? 1_555 ? 
15 AC2 7  AS  C 9   ? AS  P 9   . ? 1_555 ? 
16 AC3 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
17 AC3 10 GLN A 28  ? GLN A 25  . ? 6_545 ? 
18 AC3 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
19 AC3 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
20 AC3 10 SER A 251 ? SER A 248 . ? 1_555 ? 
21 AC3 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
22 AC3 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
23 AC3 10 HOH K .   ? HOH A 638 . ? 1_555 ? 
24 AC3 10 HOH K .   ? HOH A 670 . ? 1_555 ? 
25 AC3 10 HOH K .   ? HOH A 792 . ? 1_555 ? 
26 AC4 7  GLU A 97  ? GLU A 94  . ? 1_555 ? 
27 AC4 7  ALA A 98  ? ALA A 95  . ? 1_555 ? 
28 AC4 7  GLU A 101 ? GLU A 98  . ? 1_555 ? 
29 AC4 7  HOH K .   ? HOH A 682 . ? 1_555 ? 
30 AC4 7  HOH K .   ? HOH A 714 . ? 1_555 ? 
31 AC4 7  HOH K .   ? HOH A 715 . ? 1_555 ? 
32 AC4 7  HOH K .   ? HOH A 860 . ? 1_555 ? 
33 AC5 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
34 AC5 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
35 AC5 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
36 AC5 10 ILE A 275 ? ILE A 272 . ? 5_664 ? 
37 AC5 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
38 AC5 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
39 AC5 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
40 AC5 10 HOH K .   ? HOH A 611 . ? 1_555 ? 
41 AC5 10 HOH K .   ? HOH A 617 . ? 1_555 ? 
42 AC5 10 HOH K .   ? HOH A 738 . ? 1_555 ? 
43 AC6 29 ASP A 16  ? ASP A 13  . ? 1_555 ? 
44 AC6 29 MET A 17  ? MET A 14  . ? 1_555 ? 
45 AC6 29 ASP A 18  ? ASP A 15  . ? 1_555 ? 
46 AC6 29 CYS A 19  ? CYS A 16  . ? 1_555 ? 
47 AC6 29 PHE A 20  ? PHE A 17  . ? 1_555 ? 
48 AC6 29 PHE A 21  ? PHE A 18  . ? 1_555 ? 
49 AC6 29 ILE A 51  ? ILE A 48  . ? 1_555 ? 
50 AC6 29 ALA A 52  ? ALA A 49  . ? 1_555 ? 
51 AC6 29 TYR A 55  ? TYR A 52  . ? 1_555 ? 
52 AC6 29 ARG A 58  ? ARG A 55  . ? 1_555 ? 
53 AC6 29 ARG A 64  ? ARG A 61  . ? 1_555 ? 
54 AC6 29 ASP A 118 ? ASP A 115 . ? 1_555 ? 
55 AC6 29 LYS A 234 ? LYS A 231 . ? 1_555 ? 
56 AC6 29 MN  D .   ? MN  A 501 . ? 1_555 ? 
57 AC6 29 MN  E .   ? MN  A 502 . ? 1_555 ? 
58 AC6 29 DPO J .   ? DPO A 507 . ? 1_555 ? 
59 AC6 29 HOH K .   ? HOH A 601 . ? 1_555 ? 
60 AC6 29 HOH K .   ? HOH A 621 . ? 1_555 ? 
61 AC6 29 HOH K .   ? HOH A 632 . ? 1_555 ? 
62 AC6 29 HOH K .   ? HOH A 662 . ? 1_555 ? 
63 AC6 29 HOH K .   ? HOH A 735 . ? 1_555 ? 
64 AC6 29 HOH K .   ? HOH A 802 . ? 1_555 ? 
65 AC6 29 DT  C 8   ? DT  P 8   . ? 1_555 ? 
66 AC6 29 AS  C 9   ? AS  P 9   . ? 1_555 ? 
67 AC6 29 HOH M .   ? HOH P 102 . ? 1_555 ? 
68 AC6 29 HOH M .   ? HOH P 107 . ? 1_555 ? 
69 AC6 29 DT  B 3   ? DT  T 3   . ? 1_555 ? 
70 AC6 29 DT  B 4   ? DT  T 4   . ? 1_555 ? 
71 AC6 29 DA  B 5   ? DA  T 5   . ? 1_555 ? 
72 AC7 17 ASP A 16  ? ASP A 13  . ? 1_555 ? 
73 AC7 17 MET A 17  ? MET A 14  . ? 1_555 ? 
74 AC7 17 ASP A 18  ? ASP A 15  . ? 1_555 ? 
75 AC7 17 CYS A 19  ? CYS A 16  . ? 1_555 ? 
76 AC7 17 PHE A 20  ? PHE A 17  . ? 1_555 ? 
77 AC7 17 TYR A 55  ? TYR A 52  . ? 1_555 ? 
78 AC7 17 ARG A 58  ? ARG A 55  . ? 1_555 ? 
79 AC7 17 ARG A 64  ? ARG A 61  . ? 1_555 ? 
80 AC7 17 ASP A 118 ? ASP A 115 . ? 1_555 ? 
81 AC7 17 LYS A 234 ? LYS A 231 . ? 1_555 ? 
82 AC7 17 MN  E .   ? MN  A 502 . ? 1_555 ? 
83 AC7 17 STP I .   ? STP A 506 . ? 1_555 ? 
84 AC7 17 HOH K .   ? HOH A 621 . ? 1_555 ? 
85 AC7 17 HOH K .   ? HOH A 632 . ? 1_555 ? 
86 AC7 17 HOH K .   ? HOH A 662 . ? 1_555 ? 
87 AC7 17 HOH K .   ? HOH A 735 . ? 1_555 ? 
88 AC7 17 AS  C 9   ? AS  P 9   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KFR 
_atom_sites.fract_transf_matrix[1][1]   0.010178 
_atom_sites.fract_transf_matrix[1][2]   0.005876 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011753 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012297 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.920 -34.169 -4.201  1.00 63.79  ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 66.405 -32.835 -3.905  1.00 76.46  ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.266 -32.336 -5.038  1.00 79.79  ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.556 -31.147 -5.163  1.00 85.54  ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 67.718 -33.349 -5.890  1.00 82.62  ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.282 -32.834 -7.147  1.00 82.86  ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.264 -32.081 -7.985  1.00 83.22  ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.601 -31.110 -8.652  1.00 87.40  ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 68.770 -34.084 -7.891  1.00 76.62  ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.026 -35.227 -7.318  1.00 72.45  ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 67.965 -34.880 -5.877  1.00 75.36  ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.037 -32.576 -7.988  1.00 83.86  ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 64.956 -32.045 -8.830  1.00 82.94  ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 63.978 -31.177 -8.043  1.00 85.26  ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 62.936 -30.763 -8.531  1.00 80.42  ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.221 -33.203 -9.509  1.00 75.38  ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.108 -34.358 -9.820  1.00 70.60  ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.901 -34.400 -10.942 1.00 70.43  ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.394 -35.470 -9.114  1.00 66.40  ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.595 -35.520 -10.945 1.00 69.59  ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.305 -36.186 -9.844  1.00 69.23  ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.330 -30.919 -6.800  1.00 88.88  ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.464 -30.172 -5.939  1.00 88.96  ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.587 -28.678 -6.105  1.00 89.24  ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.428 -28.047 -5.475  1.00 88.06  ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.699 -30.525 -4.481  1.00 89.71  ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.691 -29.795 -3.614  1.00 94.86  ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.031 -29.951 -4.315  1.00 99.56  ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 60.903 -31.735 -4.309  1.00 80.84  ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.713 -28.110 -6.931  1.00 88.57  ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.843 -26.740 -7.396  1.00 76.63  ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.013 -25.893 -6.188  1.00 71.48  ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.316 -26.073 -5.223  1.00 68.00  ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.597 -26.312 -8.125  1.00 72.96  ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.962 -24.980 -6.248  1.00 59.83  ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.371 -24.277 -5.052  1.00 56.05  ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.587 -23.034 -4.819  1.00 46.08  ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.652 -22.506 -3.765  1.00 49.26  ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.874 -23.929 -5.127  1.00 52.31  ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.282 -23.042 -4.066  1.00 51.62  ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.167 -23.333 -6.458  1.00 51.33  ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.845 -22.565 -5.803  1.00 43.93  ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.121 -21.304 -5.696  1.00 33.49  ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.084 -20.150 -5.473  1.00 31.20  ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 62.817 -19.235 -4.692  1.00 29.99  ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.213 -20.212 -6.172  1.00 27.60  ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.294 -19.250 -6.010  1.00 23.78  ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 65.706 -18.651 -7.352  1.00 23.05  ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 66.776 -18.066 -7.468  1.00 28.91  ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.513 -19.921 -5.358  1.00 29.56  ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.407 -20.133 -3.860  1.00 32.79  ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 67.628 -20.873 -3.285  1.00 31.91  ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 67.731 -22.085 -3.401  1.00 37.54  ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.540 -20.143 -2.661  1.00 38.25  ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 64.843 -18.811 -8.353  1.00 29.57  ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.105 -18.367 -9.721  1.00 29.45  ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.044 -16.845 -9.909  1.00 25.30  ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.662 -16.297 -10.820 1.00 25.84  ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.104 -19.045 -10.675 1.00 32.96  ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.665 -19.066 -10.122 1.00 45.70  ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.435 -19.507 -8.961  1.00 42.09  ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.747 -18.642 -10.861 1.00 56.50  ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.288 -16.172 -9.053  1.00 23.85  ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.058 -14.739 -9.196  1.00 26.02  ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.680 -13.914 -8.087  1.00 22.68  ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 64.902 -14.407 -6.983  1.00 21.63  ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.566 -14.433 -9.209  1.00 21.05  ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 61.762 -15.063 -10.341 1.00 24.60  ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.287 -14.664 -10.196 1.00 27.81  ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.634 -15.291 -9.047  1.00 22.06  ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.598 -14.775 -8.391  1.00 23.84  ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.053 -15.429 -7.369  1.00 22.03  ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.096 -13.603 -8.759  1.00 24.38  ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 64.928 -12.638 -8.387  1.00 17.66  ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.242 -11.665 -7.359  1.00 14.48  ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.097 -10.665 -7.371  1.00 20.64  ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 63.852 -10.045 -8.399  1.00 22.31  ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.596 -10.953 -7.597  1.00 18.24  ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 66.839 -9.903  -6.516  1.00 20.82  ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 67.743 -11.974 -7.616  1.00 18.66  ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.392 -10.532 -6.245  1.00 18.73  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.225 -9.649  -6.166  1.00 18.96  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.435 -8.649  -5.043  1.00 17.04  ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 62.861 -9.028  -3.962  1.00 18.51  ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 60.905 -10.436 -5.929  1.00 19.10  ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 59.699 -9.491  -5.722  1.00 19.45  ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.630 -11.353 -7.090  1.00 22.10  ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.152 -7.366  -5.288  1.00 18.09  ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.204 -6.425  -4.174  1.00 18.09  ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 60.823 -5.821  -3.892  1.00 16.27  ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 59.956 -5.800  -4.765  1.00 19.86  ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.233 -5.334  -4.435  1.00 17.74  ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.610 -5.385  -2.651  1.00 14.16  ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.424 -4.594  -2.325  1.00 16.18  ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 59.920 -3.300  -1.709  1.00 19.81  ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.643 -3.321  -0.713  1.00 20.49  ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.483 -5.354  -1.385  1.00 19.08  ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.142 -4.731  -0.941  1.00 20.79  ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.311 -3.822  0.289   1.00 20.58  ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.473 -3.965  -2.110  1.00 18.58  ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.547 -2.173  -2.309  1.00 17.79  ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 59.964 -0.873  -1.789  1.00 16.18  ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.736 -0.188  -1.207  1.00 17.86  ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.724 -0.056  -1.882  1.00 18.27  ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.591 -0.002  -2.878  1.00 20.71  ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 60.971 1.356   -2.327  1.00 16.93  ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.807 -0.722  -3.492  1.00 21.60  ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 58.810 0.237   0.039   1.00 16.74  ? 13   ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.685 0.853   0.707   1.00 20.51  ? 13   ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 58.057 2.162   1.370   1.00 17.82  ? 13   ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 58.903 2.173   2.166   1.00 19.54  ? 13   ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.153 -0.069  1.763   1.00 18.75  ? 13   ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 55.956 0.462   2.409   1.00 27.15  ? 13   ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 56.081 1.292   3.239   1.00 24.80  ? 13   ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 54.917 0.056   2.039   1.00 27.20  ? 13   ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.411 3.258   1.023   1.00 18.75  ? 14   MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 57.761 4.549   1.583   1.00 19.34  ? 14   MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.504 4.595   3.089   1.00 21.01  ? 14   MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.526 4.135   3.520   1.00 20.56  ? 14   MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 56.920 5.621   0.929   1.00 19.85  ? 14   MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 56.946 5.612   -0.576  1.00 20.24  ? 14   MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.594 5.592   -1.220  1.00 23.91  ? 14   MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.141 7.208   -0.815  1.00 28.28  ? 14   MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.413 5.152   3.863   1.00 19.81  ? 15   ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.194 5.299   5.286   1.00 17.57  ? 15   ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.131 6.379   5.542   1.00 23.14  ? 15   ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.190 7.413   4.950   1.00 21.44  ? 15   ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.484 5.683   5.987   1.00 20.47  ? 15   ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.593 4.667   5.792   1.00 21.73  ? 15   ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.302 3.504   5.656   1.00 23.86  ? 15   ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.742 5.048   5.791   1.00 24.45  ? 15   ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.145 6.070   6.366   1.00 19.60  ? 16   CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.135 7.027   6.831   1.00 22.33  ? 16   CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.686 7.997   5.737   1.00 20.94  ? 16   CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 54.827 9.154   5.860   1.00 21.06  ? 16   CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.453 7.688   8.170   1.00 24.37  ? 16   CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 56.968 8.595   8.249   1.00 27.09  ? 16   CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.214 7.452   4.646   1.00 18.00  ? 17   PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.254 8.178   3.404   1.00 20.74  ? 17   PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.493 9.512   3.365   1.00 20.78  ? 17   PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.054 10.487  3.018   1.00 17.37  ? 17   PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.729 7.318   2.287   1.00 18.61  ? 17   PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.799 7.971   0.931   1.00 17.48  ? 17   PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 54.941 8.547   0.491   1.00 19.32  ? 17   PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.739 7.942   0.101   1.00 21.37  ? 17   PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 55.021 9.118   -0.746  1.00 21.93  ? 17   PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.794 8.519   -1.133  1.00 25.40  ? 17   PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 53.944 9.095   -1.560  1.00 23.43  ? 17   PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.255 9.553   3.793   1.00 17.64  ? 18   PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.510 10.825  3.725   1.00 16.63  ? 18   PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.170 11.853  4.648   1.00 18.06  ? 18   PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.166 13.048  4.362   1.00 18.81  ? 18   PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.030 10.661  4.118   1.00 17.29  ? 18   PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.182 9.942   3.101   1.00 17.92  ? 18   PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 49.746 9.208   2.066   1.00 18.81  ? 18   PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 47.800 9.997   3.191   1.00 22.35  ? 18   PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 48.948 8.544   1.150   1.00 20.29  ? 18   PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 47.001 9.342   2.280   1.00 20.96  ? 18   PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.573 8.606   1.260   1.00 24.67  ? 18   PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.737 11.388  5.761   1.00 16.99  ? 19   VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.470 12.279  6.653   1.00 17.11  ? 19   VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.700 12.895  5.942   1.00 21.08  ? 19   VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 54.937 14.118  6.004   1.00 19.05  ? 19   VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 53.915 11.529  7.939   1.00 17.77  ? 19   VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 55.009 12.318  8.653   1.00 21.51  ? 19   VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.724 11.313  8.858   1.00 21.81  ? 19   VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.490 12.067  5.257   1.00 18.70  ? 20   GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.629 12.630  4.523   1.00 19.15  ? 20   GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.201 13.628  3.459   1.00 19.08  ? 20   GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 56.902 14.621  3.224   1.00 20.39  ? 20   GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.449 11.542  3.848   1.00 19.41  ? 20   GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.222 10.666  4.798   1.00 22.34  ? 20   GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.341 9.991   4.041   1.00 22.77  ? 20   GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.429 10.543  3.927   1.00 22.17  ? 20   GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.063 8.815   3.478   1.00 28.46  ? 20   GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.077 13.355  2.799   1.00 17.22  ? 21   VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.593 14.280  1.772   1.00 15.93  ? 21   VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.306 15.638  2.439   1.00 18.59  ? 21   VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.744 16.684  1.944   1.00 18.65  ? 21   VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.350 13.758  1.052   1.00 17.74  ? 21   VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.745 14.842  0.146   1.00 19.77  ? 21   VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.704 12.479  0.243   1.00 16.94  ? 21   VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.623 15.613  3.582   1.00 21.53  ? 22   GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.328 16.855  4.310   1.00 17.20  ? 22   GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.584 17.520  4.885   1.00 17.09  ? 22   GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.678 18.740  4.894   1.00 21.23  ? 22   GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.300 16.598  5.435   1.00 15.22  ? 22   GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 50.962 16.119  4.914   1.00 15.49  ? 22   GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.228 17.173  4.071   1.00 24.82  ? 22   GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.517 18.385  4.203   1.00 23.07  ? 22   GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.345 16.785  3.278   1.00 24.93  ? 22   GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.556 16.729  5.343   1.00 17.02  ? 23   GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 56.794 17.281  5.903   1.00 18.92  ? 23   GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.693 17.926  4.845   1.00 18.07  ? 23   GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.384 18.913  5.105   1.00 20.11  ? 23   GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.582 16.175  6.607   1.00 18.72  ? 23   GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 56.968 15.734  7.927   1.00 22.02  ? 23   GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.718 14.569  8.546   1.00 20.15  ? 23   GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.176 13.665  7.844   1.00 23.26  ? 23   GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 57.866 14.593  9.867   1.00 23.26  ? 23   GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.690 17.356  3.647   1.00 20.78  ? 24   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.428 17.981  2.557   1.00 18.03  ? 24   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 57.815 19.359  2.269   1.00 19.41  ? 24   ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.535 20.332  2.136   1.00 20.78  ? 24   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.425 17.091  1.298   1.00 21.70  ? 24   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 59.205 17.694  0.128   1.00 24.99  ? 24   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.204 16.769  -1.088  1.00 20.50  ? 24   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 57.906 16.724  -1.763  1.00 21.45  ? 24   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.713 16.141  -2.940  1.00 23.90  ? 24   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.733 15.537  -3.550  1.00 18.75  ? 24   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.515 16.167  -3.509  1.00 23.10  ? 24   ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.491 19.438  2.206   1.00 18.93  ? 25   GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 55.811 20.701  1.956   1.00 20.79  ? 25   GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 55.976 21.735  3.073   1.00 22.31  ? 25   GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 56.086 22.948  2.826   1.00 20.60  ? 25   GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.318 20.438  1.742   1.00 23.35  ? 25   GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.539 21.676  1.328   1.00 21.36  ? 25   GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 52.069 21.363  1.107   1.00 30.92  ? 25   GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.726 20.366  0.484   1.00 34.14  ? 25   GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.196 22.216  1.625   1.00 31.62  ? 25   GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 55.952 21.266  4.312   1.00 20.54  ? 26   ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 56.009 22.153  5.469   1.00 21.32  ? 26   ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.147 21.747  6.394   1.00 21.50  ? 26   ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 56.990 20.873  7.242   1.00 20.99  ? 26   ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.670 22.148  6.221   1.00 20.07  ? 26   ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.673 23.061  7.449   1.00 24.75  ? 26   ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.643 23.760  7.714   1.00 26.30  ? 26   ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.570 23.049  8.203   1.00 27.31  ? 26   ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.318 22.361  6.199   1.00 22.11  ? 27   PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.543 22.073  6.951   1.00 23.53  ? 27   PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.374 22.161  8.474   1.00 26.88  ? 27   PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 60.112 21.501  9.198   1.00 25.45  ? 27   PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.514 23.150  6.449   1.00 27.20  ? 27   PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 60.052 23.434  5.052   1.00 24.71  ? 27   PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.553 23.311  5.092   1.00 22.42  ? 27   PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.419 22.953  8.953   1.00 26.16  ? 28   HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.125 22.995  10.391  1.00 32.25  ? 28   HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.705 21.633  10.982  1.00 32.02  ? 28   HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 57.797 21.424  12.191  1.00 33.88  ? 28   HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 57.023 24.013  10.674  1.00 34.09  ? 28   HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.460 25.437  10.561  1.00 41.78  ? 28   HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 56.696 26.400  9.936   1.00 50.68  ? 28   HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.570 26.071  11.012  1.00 46.18  ? 28   HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.319 27.563  10.000  1.00 54.44  ? 28   HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.459 27.391  10.644  1.00 43.34  ? 28   HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.241 20.711  10.141  1.00 24.25  ? 29   LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 56.793 19.392  10.619  1.00 23.65  ? 29   LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 57.915 18.355  10.654  1.00 28.66  ? 29   LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 57.740 17.257  11.183  1.00 25.01  ? 29   LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.677 18.850  9.728   1.00 20.93  ? 29   LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.475 19.752  9.500   1.00 25.23  ? 29   LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.490 19.053  8.571   1.00 22.70  ? 29   LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 53.827 20.102  10.838  1.00 25.69  ? 29   LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 59.061 18.689  10.068  1.00 23.33  ? 30   ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.149 17.724  9.940   1.00 24.32  ? 30   ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 60.744 17.338  11.299  1.00 27.31  ? 30   ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 60.874 18.177  12.169  1.00 24.83  ? 30   ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.233 18.282  9.015   1.00 30.59  ? 30   ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.697 18.549  7.607   1.00 24.12  ? 30   ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 61.758 19.105  6.668   1.00 30.33  ? 30   ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.219 19.347  5.326   1.00 31.48  ? 30   ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 61.926 19.874  4.333   1.00 36.38  ? 30   ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.195 20.201  4.531   1.00 32.77  ? 30   ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.371 20.066  3.148   1.00 30.42  ? 30   ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.056 16.050  11.464  1.00 34.54  ? 31   ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 61.650 15.541  12.704  1.00 38.90  ? 31   ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 60.835 15.918  13.931  1.00 38.42  ? 31   ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.371 16.379  14.935  1.00 33.18  ? 31   ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.079 16.056  12.858  1.00 38.72  ? 31   ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 63.905 15.835  11.614  1.00 41.30  ? 31   ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.043 14.705  11.141  1.00 48.52  ? 31   ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.435 16.919  11.053  1.00 49.37  ? 31   ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.525 15.759  13.822  1.00 28.50  ? 32   LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.618 16.051  14.925  1.00 26.85  ? 32   LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.608 14.924  14.985  1.00 26.80  ? 32   LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.342 14.281  13.972  1.00 23.23  ? 32   LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 57.893 17.393  14.726  1.00 28.95  ? 32   LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 58.781 18.607  14.749  1.00 33.22  ? 32   LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 58.797 19.250  16.120  1.00 49.87  ? 32   LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 59.695 20.481  16.132  1.00 52.47  ? 32   LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 59.627 21.209  14.832  1.00 55.69  ? 32   LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 57.057 14.664  16.177  1.00 25.63  ? 33   PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 55.898 13.774  16.208  1.00 22.11  ? 33   PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 54.777 14.425  15.404  1.00 21.81  ? 33   PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 54.308 15.521  15.754  1.00 22.02  ? 33   PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 55.552 13.670  17.696  1.00 26.42  ? 33   PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 56.175 14.867  18.328  1.00 29.48  ? 33   PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 57.362 15.255  17.495  1.00 29.64  ? 33   PRO A CD    1 
ATOM   289  N  N     A CYS A 1 37  ? 54.369 13.779  14.323  0.52 21.65  ? 34   CYS A N     1 
ATOM   290  N  N     B CYS A 1 37  ? 54.360 13.758  14.329  0.48 21.65  ? 34   CYS A N     1 
ATOM   291  C  CA    A CYS A 1 37  ? 53.274 14.324  13.551  0.52 23.20  ? 34   CYS A CA    1 
ATOM   292  C  CA    B CYS A 1 37  ? 53.420 14.320  13.358  0.48 22.91  ? 34   CYS A CA    1 
ATOM   293  C  C     . CYS A 1 37  ? 52.455 13.236  12.886  1.00 21.12  ? 34   CYS A C     1 
ATOM   294  O  O     . CYS A 1 37  ? 52.847 12.074  12.807  1.00 23.25  ? 34   CYS A O     1 
ATOM   295  C  CB    A CYS A 1 37  ? 53.784 15.330  12.518  0.52 26.07  ? 34   CYS A CB    1 
ATOM   296  C  CB    B CYS A 1 37  ? 54.194 14.923  12.166  0.48 21.61  ? 34   CYS A CB    1 
ATOM   297  S  SG    A CYS A 1 37  ? 54.962 14.671  11.372  0.52 24.64  ? 34   CYS A SG    1 
ATOM   298  S  SG    B CYS A 1 37  ? 53.218 15.739  10.850  0.48 21.66  ? 34   CYS A SG    1 
ATOM   299  N  N     . ALA A 1 38  ? 51.242 13.612  12.522  1.00 16.96  ? 35   ALA A N     1 
ATOM   300  C  CA    . ALA A 1 38  ? 50.333 12.669  11.901  1.00 15.88  ? 35   ALA A CA    1 
ATOM   301  C  C     . ALA A 1 38  ? 49.499 13.372  10.860  1.00 21.27  ? 35   ALA A C     1 
ATOM   302  O  O     . ALA A 1 38  ? 49.359 14.601  10.899  1.00 22.85  ? 35   ALA A O     1 
ATOM   303  C  CB    . ALA A 1 38  ? 49.438 12.004  12.943  1.00 20.54  ? 35   ALA A CB    1 
ATOM   304  N  N     . VAL A 1 39  ? 48.958 12.582  9.935   1.00 20.18  ? 36   VAL A N     1 
ATOM   305  C  CA    . VAL A 1 39  ? 48.036 13.086  8.926   1.00 19.23  ? 36   VAL A CA    1 
ATOM   306  C  C     . VAL A 1 39  ? 46.625 12.648  9.273   1.00 22.91  ? 36   VAL A C     1 
ATOM   307  O  O     . VAL A 1 39  ? 46.375 11.483  9.576   1.00 22.83  ? 36   VAL A O     1 
ATOM   308  C  CB    . VAL A 1 39  ? 48.417 12.605  7.532   1.00 18.86  ? 36   VAL A CB    1 
ATOM   309  C  CG1   . VAL A 1 39  ? 47.337 12.971  6.494   1.00 21.35  ? 36   VAL A CG1   1 
ATOM   310  C  CG2   . VAL A 1 39  ? 49.795 13.205  7.143   1.00 18.68  ? 36   VAL A CG2   1 
ATOM   311  N  N     . VAL A 1 40  ? 45.703 13.604  9.232   1.00 22.53  ? 37   VAL A N     1 
ATOM   312  C  CA    . VAL A 1 40  ? 44.340 13.404  9.698   1.00 18.88  ? 37   VAL A CA    1 
ATOM   313  C  C     . VAL A 1 40  ? 43.345 13.776  8.598   1.00 28.45  ? 37   VAL A C     1 
ATOM   314  O  O     . VAL A 1 40  ? 43.588 14.726  7.849   1.00 26.96  ? 37   VAL A O     1 
ATOM   315  C  CB    . VAL A 1 40  ? 44.067 14.255  10.979  1.00 26.74  ? 37   VAL A CB    1 
ATOM   316  C  CG1   A VAL A 1 40  ? 44.879 13.726  12.145  0.39 22.08  ? 37   VAL A CG1   1 
ATOM   317  C  CG1   B VAL A 1 40  ? 44.215 15.745  10.692  0.61 26.75  ? 37   VAL A CG1   1 
ATOM   318  C  CG2   A VAL A 1 40  ? 44.367 15.726  10.733  0.39 26.76  ? 37   VAL A CG2   1 
ATOM   319  C  CG2   B VAL A 1 40  ? 42.731 13.966  11.548  0.61 22.41  ? 37   VAL A CG2   1 
ATOM   320  N  N     . GLN A 1 41  ? 42.239 13.042  8.483   1.00 28.73  ? 38   GLN A N     1 
ATOM   321  C  CA    . GLN A 1 41  ? 41.168 13.528  7.612   1.00 27.77  ? 38   GLN A CA    1 
ATOM   322  C  C     . GLN A 1 41  ? 39.933 13.891  8.426   1.00 26.57  ? 38   GLN A C     1 
ATOM   323  O  O     . GLN A 1 41  ? 39.547 13.188  9.370   1.00 22.38  ? 38   GLN A O     1 
ATOM   324  C  CB    . GLN A 1 41  ? 40.825 12.538  6.485   1.00 37.52  ? 38   GLN A CB    1 
ATOM   325  C  CG    . GLN A 1 41  ? 40.746 11.108  6.848   1.00 41.15  ? 38   GLN A CG    1 
ATOM   326  C  CD    . GLN A 1 41  ? 40.626 10.182  5.626   1.00 34.39  ? 38   GLN A CD    1 
ATOM   327  O  OE1   . GLN A 1 41  ? 40.983 10.528  4.483   1.00 31.17  ? 38   GLN A OE1   1 
ATOM   328  N  NE2   . GLN A 1 41  ? 40.109 9.001   5.874   1.00 32.34  ? 38   GLN A NE2   1 
ATOM   329  N  N     . TYR A 1 42  ? 39.351 15.022  8.025   1.00 29.09  ? 39   TYR A N     1 
ATOM   330  C  CA    . TYR A 1 42  ? 38.248 15.685  8.704   1.00 30.22  ? 39   TYR A CA    1 
ATOM   331  C  C     . TYR A 1 42  ? 38.743 16.176  10.072  1.00 36.78  ? 39   TYR A C     1 
ATOM   332  O  O     . TYR A 1 42  ? 39.945 16.079  10.374  1.00 34.79  ? 39   TYR A O     1 
ATOM   333  C  CB    . TYR A 1 42  ? 37.035 14.758  8.790   1.00 23.42  ? 39   TYR A CB    1 
ATOM   334  C  CG    . TYR A 1 42  ? 36.606 14.246  7.411   1.00 23.38  ? 39   TYR A CG    1 
ATOM   335  C  CD1   . TYR A 1 42  ? 36.276 15.133  6.395   1.00 27.95  ? 39   TYR A CD1   1 
ATOM   336  C  CD2   . TYR A 1 42  ? 36.571 12.879  7.122   1.00 27.42  ? 39   TYR A CD2   1 
ATOM   337  C  CE1   . TYR A 1 42  ? 35.902 14.683  5.126   1.00 23.99  ? 39   TYR A CE1   1 
ATOM   338  C  CE2   . TYR A 1 42  ? 36.188 12.421  5.851   1.00 27.25  ? 39   TYR A CE2   1 
ATOM   339  C  CZ    . TYR A 1 42  ? 35.850 13.330  4.865   1.00 25.92  ? 39   TYR A CZ    1 
ATOM   340  O  OH    . TYR A 1 42  ? 35.455 12.904  3.604   1.00 25.66  ? 39   TYR A OH    1 
ATOM   341  N  N     . LYS A 1 43  ? 37.857 16.761  10.867  1.00 34.15  ? 40   LYS A N     1 
ATOM   342  C  CA    . LYS A 1 43  ? 38.277 17.381  12.130  1.00 32.09  ? 40   LYS A CA    1 
ATOM   343  C  C     . LYS A 1 43  ? 37.166 17.455  13.152  1.00 38.47  ? 40   LYS A C     1 
ATOM   344  O  O     . LYS A 1 43  ? 37.410 17.345  14.345  1.00 37.29  ? 40   LYS A O     1 
ATOM   345  C  CB    . LYS A 1 43  ? 38.811 18.787  11.892  1.00 34.46  ? 40   LYS A CB    1 
ATOM   346  C  CG    . LYS A 1 43  ? 40.313 18.905  12.062  1.00 55.47  ? 40   LYS A CG    1 
ATOM   347  C  CD    . LYS A 1 43  ? 40.774 19.272  13.445  1.00 49.83  ? 40   LYS A CD    1 
ATOM   348  C  CE    . LYS A 1 43  ? 42.295 19.208  13.484  1.00 47.74  ? 40   LYS A CE    1 
ATOM   349  N  NZ    . LYS A 1 43  ? 42.797 18.962  14.858  1.00 53.08  ? 40   LYS A NZ    1 
ATOM   350  N  N     . SER A 1 44  ? 35.944 17.654  12.676  1.00 34.05  ? 41   SER A N     1 
ATOM   351  C  CA    . SER A 1 44  ? 34.805 17.865  13.555  1.00 37.91  ? 41   SER A CA    1 
ATOM   352  C  C     . SER A 1 44  ? 34.602 16.718  14.530  1.00 37.64  ? 41   SER A C     1 
ATOM   353  O  O     . SER A 1 44  ? 34.369 16.931  15.717  1.00 41.73  ? 41   SER A O     1 
ATOM   354  C  CB    . SER A 1 44  ? 33.533 18.065  12.723  1.00 40.75  ? 41   SER A CB    1 
ATOM   355  O  OG    . SER A 1 44  ? 33.743 19.080  11.758  1.00 53.62  ? 41   SER A OG    1 
ATOM   356  N  N     . TRP A 1 45  ? 34.682 15.498  14.023  1.00 39.91  ? 42   TRP A N     1 
ATOM   357  C  CA    . TRP A 1 45  ? 34.414 14.334  14.851  1.00 36.54  ? 42   TRP A CA    1 
ATOM   358  C  C     . TRP A 1 45  ? 35.692 13.847  15.517  1.00 35.71  ? 42   TRP A C     1 
ATOM   359  O  O     . TRP A 1 45  ? 36.563 13.278  14.859  1.00 31.56  ? 42   TRP A O     1 
ATOM   360  C  CB    . TRP A 1 45  ? 33.791 13.217  14.021  1.00 35.86  ? 42   TRP A CB    1 
ATOM   361  C  CG    . TRP A 1 45  ? 33.362 12.049  14.830  1.00 44.43  ? 42   TRP A CG    1 
ATOM   362  C  CD1   . TRP A 1 45  ? 34.083 10.922  15.096  1.00 43.00  ? 42   TRP A CD1   1 
ATOM   363  C  CD2   . TRP A 1 45  ? 32.103 11.885  15.478  1.00 47.98  ? 42   TRP A CD2   1 
ATOM   364  N  NE1   . TRP A 1 45  ? 33.349 10.063  15.878  1.00 47.74  ? 42   TRP A NE1   1 
ATOM   365  C  CE2   . TRP A 1 45  ? 32.127 10.632  16.124  1.00 57.73  ? 42   TRP A CE2   1 
ATOM   366  C  CE3   . TRP A 1 45  ? 30.953 12.675  15.578  1.00 57.68  ? 42   TRP A CE3   1 
ATOM   367  C  CZ2   . TRP A 1 45  ? 31.043 10.152  16.862  1.00 57.91  ? 42   TRP A CZ2   1 
ATOM   368  C  CZ3   . TRP A 1 45  ? 29.879 12.198  16.305  1.00 56.71  ? 42   TRP A CZ3   1 
ATOM   369  C  CH2   . TRP A 1 45  ? 29.931 10.949  16.938  1.00 52.46  ? 42   TRP A CH2   1 
ATOM   370  N  N     . LYS A 1 46  ? 35.790 14.107  16.820  1.00 38.26  ? 43   LYS A N     1 
ATOM   371  C  CA    . LYS A 1 46  ? 36.895 13.649  17.657  1.00 34.81  ? 43   LYS A CA    1 
ATOM   372  C  C     . LYS A 1 46  ? 38.267 14.074  17.138  1.00 34.44  ? 43   LYS A C     1 
ATOM   373  O  O     . LYS A 1 46  ? 39.268 13.375  17.337  1.00 31.91  ? 43   LYS A O     1 
ATOM   374  C  CB    . LYS A 1 46  ? 36.845 12.133  17.800  1.00 33.81  ? 43   LYS A CB    1 
ATOM   375  C  CG    . LYS A 1 46  ? 35.573 11.627  18.449  1.00 43.80  ? 43   LYS A CG    1 
ATOM   376  C  CD    . LYS A 1 46  ? 35.621 10.135  18.658  1.00 45.62  ? 43   LYS A CD    1 
ATOM   377  C  CE    . LYS A 1 46  ? 34.494 9.688   19.562  1.00 55.42  ? 43   LYS A CE    1 
ATOM   378  N  NZ    . LYS A 1 46  ? 34.437 8.206   19.634  1.00 65.67  ? 43   LYS A NZ    1 
ATOM   379  N  N     . GLY A 1 47  ? 38.304 15.219  16.470  1.00 30.02  ? 44   GLY A N     1 
ATOM   380  C  CA    . GLY A 1 47  ? 39.552 15.802  16.033  1.00 28.19  ? 44   GLY A CA    1 
ATOM   381  C  C     . GLY A 1 47  ? 40.011 15.281  14.690  1.00 30.81  ? 44   GLY A C     1 
ATOM   382  O  O     . GLY A 1 47  ? 40.995 15.753  14.155  1.00 25.65  ? 44   GLY A O     1 
ATOM   383  N  N     . GLY A 1 48  ? 39.300 14.296  14.154  1.00 30.68  ? 45   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 48  ? 39.650 13.730  12.868  1.00 29.83  ? 45   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 48  ? 40.279 12.357  12.993  1.00 27.58  ? 45   GLY A C     1 
ATOM   386  O  O     . GLY A 1 48  ? 40.765 11.979  14.059  1.00 26.68  ? 45   GLY A O     1 
ATOM   387  N  N     . GLY A 1 49  ? 40.272 11.600  11.899  1.00 23.63  ? 46   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 49  ? 40.791 10.242  11.932  1.00 20.67  ? 46   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 49  ? 42.217 10.198  11.416  1.00 26.67  ? 46   GLY A C     1 
ATOM   390  O  O     . GLY A 1 49  ? 42.500 10.717  10.348  1.00 25.59  ? 46   GLY A O     1 
ATOM   391  N  N     . ILE A 1 50  ? 43.127 9.589   12.166  1.00 21.07  ? 47   ILE A N     1 
ATOM   392  C  CA    . ILE A 1 50  ? 44.528 9.544   11.732  1.00 22.84  ? 47   ILE A CA    1 
ATOM   393  C  C     . ILE A 1 50  ? 44.748 8.452   10.673  1.00 23.61  ? 47   ILE A C     1 
ATOM   394  O  O     . ILE A 1 50  ? 44.301 7.324   10.851  1.00 26.61  ? 47   ILE A O     1 
ATOM   395  C  CB    . ILE A 1 50  ? 45.464 9.303   12.935  1.00 21.03  ? 47   ILE A CB    1 
ATOM   396  C  CG1   . ILE A 1 50  ? 45.396 10.503  13.877  1.00 29.27  ? 47   ILE A CG1   1 
ATOM   397  C  CG2   . ILE A 1 50  ? 46.911 9.022   12.476  1.00 20.98  ? 47   ILE A CG2   1 
ATOM   398  C  CD1   . ILE A 1 50  ? 46.383 10.432  15.000  1.00 32.10  ? 47   ILE A CD1   1 
ATOM   399  N  N     . ILE A 1 51  ? 45.422 8.789   9.570   1.00 19.50  ? 48   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 51  ? 45.699 7.767   8.567   1.00 24.02  ? 48   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 51  ? 47.200 7.564   8.316   1.00 20.22  ? 48   ILE A C     1 
ATOM   402  O  O     . ILE A 1 51  ? 47.567 6.605   7.655   1.00 21.92  ? 48   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 51  ? 44.992 8.066   7.223   1.00 26.70  ? 48   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 51  ? 45.387 9.439   6.676   1.00 22.99  ? 48   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 51  ? 43.460 7.935   7.367   1.00 29.64  ? 48   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 51  ? 44.900 9.638   5.254   1.00 28.04  ? 48   ILE A CD1   1 
ATOM   407  N  N     . ALA A 1 52  ? 48.065 8.419   8.874   1.00 19.12  ? 49   ALA A N     1 
ATOM   408  C  CA    . ALA A 1 52  ? 49.523 8.202   8.788   1.00 19.19  ? 49   ALA A CA    1 
ATOM   409  C  C     . ALA A 1 52  ? 50.223 8.843   9.969   1.00 17.52  ? 49   ALA A C     1 
ATOM   410  O  O     . ALA A 1 52  ? 49.794 9.893   10.448  1.00 19.15  ? 49   ALA A O     1 
ATOM   411  C  CB    . ALA A 1 52  ? 50.098 8.764   7.481   1.00 17.72  ? 49   ALA A CB    1 
ATOM   412  N  N     . VAL A 1 53  ? 51.304 8.220   10.431  1.00 18.92  ? 50   VAL A N     1 
ATOM   413  C  CA    . VAL A 1 53  ? 51.966 8.612   11.680  1.00 17.30  ? 50   VAL A CA    1 
ATOM   414  C  C     . VAL A 1 53  ? 53.490 8.587   11.574  1.00 18.93  ? 50   VAL A C     1 
ATOM   415  O  O     . VAL A 1 53  ? 54.051 7.578   11.134  1.00 20.56  ? 50   VAL A O     1 
ATOM   416  C  CB    . VAL A 1 53  ? 51.556 7.649   12.830  1.00 21.94  ? 50   VAL A CB    1 
ATOM   417  C  CG1   . VAL A 1 53  ? 52.109 8.127   14.155  1.00 23.21  ? 50   VAL A CG1   1 
ATOM   418  C  CG2   . VAL A 1 53  ? 50.052 7.494   12.882  1.00 21.41  ? 50   VAL A CG2   1 
ATOM   419  N  N     . SER A 1 54  ? 54.163 9.673   11.958  1.00 16.60  ? 51   SER A N     1 
ATOM   420  C  CA    . SER A 1 54  ? 55.619 9.721   11.864  1.00 17.17  ? 51   SER A CA    1 
ATOM   421  C  C     . SER A 1 54  ? 56.195 8.773   12.908  1.00 22.14  ? 51   SER A C     1 
ATOM   422  O  O     . SER A 1 54  ? 55.518 8.438   13.887  1.00 22.61  ? 51   SER A O     1 
ATOM   423  C  CB    . SER A 1 54  ? 56.174 11.128  12.095  1.00 18.57  ? 51   SER A CB    1 
ATOM   424  O  OG    . SER A 1 54  ? 56.174 11.473  13.479  1.00 20.65  ? 51   SER A OG    1 
ATOM   425  N  N     . TYR A 1 55  ? 57.442 8.352   12.715  1.00 20.74  ? 52   TYR A N     1 
ATOM   426  C  CA    . TYR A 1 55  ? 58.049 7.435   13.681  1.00 25.40  ? 52   TYR A CA    1 
ATOM   427  C  C     . TYR A 1 55  ? 58.248 8.082   15.050  1.00 27.41  ? 52   TYR A C     1 
ATOM   428  O  O     . TYR A 1 55  ? 58.117 7.407   16.079  1.00 24.53  ? 52   TYR A O     1 
ATOM   429  C  CB    . TYR A 1 55  ? 59.353 6.879   13.109  1.00 25.70  ? 52   TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 55  ? 59.038 5.792   12.115  1.00 25.89  ? 52   TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 55  ? 58.727 6.099   10.797  1.00 25.74  ? 52   TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 55  ? 58.972 4.461   12.507  1.00 27.56  ? 52   TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 55  ? 58.398 5.116   9.898   1.00 23.95  ? 52   TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 55  ? 58.649 3.462   11.607  1.00 23.59  ? 52   TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 55  ? 58.361 3.790   10.305  1.00 32.24  ? 52   TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 55  ? 58.035 2.798   9.394   1.00 31.77  ? 52   TYR A OH    1 
ATOM   437  N  N     . GLU A 1 56  ? 58.505 9.387   15.075  1.00 22.98  ? 53   GLU A N     1 
ATOM   438  C  CA    . GLU A 1 56  ? 58.570 10.103  16.345  1.00 29.40  ? 53   GLU A CA    1 
ATOM   439  C  C     . GLU A 1 56  ? 57.263 9.996   17.110  1.00 26.96  ? 53   GLU A C     1 
ATOM   440  O  O     . GLU A 1 56  ? 57.255 9.858   18.332  1.00 25.86  ? 53   GLU A O     1 
ATOM   441  C  CB    . GLU A 1 56  ? 58.913 11.571  16.121  1.00 27.69  ? 53   GLU A CB    1 
ATOM   442  C  CG    . GLU A 1 56  ? 60.314 11.809  15.583  1.00 31.89  ? 53   GLU A CG    1 
ATOM   443  C  CD    . GLU A 1 56  ? 60.409 11.739  14.060  1.00 45.37  ? 53   GLU A CD    1 
ATOM   444  O  OE1   . GLU A 1 56  ? 59.458 11.271  13.392  1.00 32.89  ? 53   GLU A OE1   1 
ATOM   445  O  OE2   . GLU A 1 56  ? 61.455 12.166  13.530  1.00 48.20  ? 53   GLU A OE2   1 
ATOM   446  N  N     . ALA A 1 57  ? 56.143 10.073  16.397  1.00 20.43  ? 54   ALA A N     1 
ATOM   447  C  CA    . ALA A 1 57  ? 54.849 9.959   17.055  1.00 20.39  ? 54   ALA A CA    1 
ATOM   448  C  C     . ALA A 1 57  ? 54.502 8.516   17.439  1.00 20.33  ? 54   ALA A C     1 
ATOM   449  O  O     . ALA A 1 57  ? 53.819 8.285   18.436  1.00 21.98  ? 54   ALA A O     1 
ATOM   450  C  CB    . ALA A 1 57  ? 53.753 10.535  16.170  1.00 21.08  ? 54   ALA A CB    1 
ATOM   451  N  N     . ARG A 1 58  ? 54.954 7.545   16.645  1.00 23.72  ? 55   ARG A N     1 
ATOM   452  C  CA    . ARG A 1 58  ? 54.718 6.135   16.985  1.00 20.51  ? 55   ARG A CA    1 
ATOM   453  C  C     . ARG A 1 58  ? 55.361 5.770   18.313  1.00 24.43  ? 55   ARG A C     1 
ATOM   454  O  O     . ARG A 1 58  ? 54.849 4.915   19.038  1.00 25.80  ? 55   ARG A O     1 
ATOM   455  C  CB    . ARG A 1 58  ? 55.253 5.208   15.902  1.00 22.76  ? 55   ARG A CB    1 
ATOM   456  C  CG    . ARG A 1 58  ? 54.609 5.452   14.592  1.00 25.38  ? 55   ARG A CG    1 
ATOM   457  C  CD    . ARG A 1 58  ? 55.061 4.451   13.567  1.00 27.38  ? 55   ARG A CD    1 
ATOM   458  N  NE    . ARG A 1 58  ? 54.643 4.896   12.249  1.00 27.23  ? 55   ARG A NE    1 
ATOM   459  C  CZ    . ARG A 1 58  ? 54.773 4.175   11.151  1.00 28.12  ? 55   ARG A CZ    1 
ATOM   460  N  NH1   . ARG A 1 58  ? 55.314 2.970   11.222  1.00 26.77  ? 55   ARG A NH1   1 
ATOM   461  N  NH2   . ARG A 1 58  ? 54.365 4.665   9.988   1.00 27.25  ? 55   ARG A NH2   1 
ATOM   462  N  N     . ALA A 1 59  ? 56.470 6.433   18.619  1.00 23.59  ? 56   ALA A N     1 
ATOM   463  C  CA    . ALA A 1 59  ? 57.153 6.277   19.900  1.00 25.81  ? 56   ALA A CA    1 
ATOM   464  C  C     . ALA A 1 59  ? 56.239 6.556   21.103  1.00 31.22  ? 56   ALA A C     1 
ATOM   465  O  O     . ALA A 1 59  ? 56.449 5.998   22.182  1.00 31.30  ? 56   ALA A O     1 
ATOM   466  C  CB    . ALA A 1 59  ? 58.377 7.182   19.954  1.00 30.06  ? 56   ALA A CB    1 
ATOM   467  N  N     . PHE A 1 60  ? 55.233 7.409   20.922  1.00 23.62  ? 57   PHE A N     1 
ATOM   468  C  CA    . PHE A 1 60  ? 54.284 7.717   21.993  1.00 24.91  ? 57   PHE A CA    1 
ATOM   469  C  C     . PHE A 1 60  ? 53.076 6.791   21.985  1.00 27.36  ? 57   PHE A C     1 
ATOM   470  O  O     . PHE A 1 60  ? 52.212 6.898   22.855  1.00 30.83  ? 57   PHE A O     1 
ATOM   471  C  CB    . PHE A 1 60  ? 53.801 9.169   21.902  1.00 20.25  ? 57   PHE A CB    1 
ATOM   472  C  CG    . PHE A 1 60  ? 54.852 10.183  22.215  1.00 25.01  ? 57   PHE A CG    1 
ATOM   473  C  CD1   . PHE A 1 60  ? 54.977 10.699  23.497  1.00 34.85  ? 57   PHE A CD1   1 
ATOM   474  C  CD2   . PHE A 1 60  ? 55.712 10.641  21.224  1.00 23.71  ? 57   PHE A CD2   1 
ATOM   475  C  CE1   . PHE A 1 60  ? 55.948 11.652  23.787  1.00 36.29  ? 57   PHE A CE1   1 
ATOM   476  C  CE2   . PHE A 1 60  ? 56.691 11.582  21.505  1.00 28.86  ? 57   PHE A CE2   1 
ATOM   477  C  CZ    . PHE A 1 60  ? 56.808 12.092  22.788  1.00 41.56  ? 57   PHE A CZ    1 
ATOM   478  N  N     . GLY A 1 61  ? 53.005 5.884   21.013  1.00 24.24  ? 58   GLY A N     1 
ATOM   479  C  CA    . GLY A 1 61  ? 51.867 4.990   20.890  1.00 23.63  ? 58   GLY A CA    1 
ATOM   480  C  C     . GLY A 1 61  ? 50.779 5.466   19.947  1.00 26.65  ? 58   GLY A C     1 
ATOM   481  O  O     . GLY A 1 61  ? 49.693 4.882   19.890  1.00 24.57  ? 58   GLY A O     1 
ATOM   482  N  N     . VAL A 1 62  ? 51.045 6.541   19.205  1.00 20.43  ? 59   VAL A N     1 
ATOM   483  C  CA    . VAL A 1 62  ? 50.080 6.989   18.207  1.00 25.20  ? 59   VAL A CA    1 
ATOM   484  C  C     . VAL A 1 62  ? 50.029 5.997   17.049  1.00 24.65  ? 59   VAL A C     1 
ATOM   485  O  O     . VAL A 1 62  ? 51.068 5.552   16.578  1.00 22.60  ? 59   VAL A O     1 
ATOM   486  C  CB    . VAL A 1 62  ? 50.428 8.396   17.685  1.00 24.38  ? 59   VAL A CB    1 
ATOM   487  C  CG1   . VAL A 1 62  ? 49.386 8.864   16.662  1.00 26.60  ? 59   VAL A CG1   1 
ATOM   488  C  CG2   . VAL A 1 62  ? 50.487 9.379   18.866  1.00 24.25  ? 59   VAL A CG2   1 
ATOM   489  N  N     . THR A 1 63  ? 48.823 5.647   16.606  1.00 26.51  ? 60   THR A N     1 
ATOM   490  C  CA    . THR A 1 63  ? 48.657 4.726   15.486  1.00 27.66  ? 60   THR A CA    1 
ATOM   491  C  C     . THR A 1 63  ? 47.638 5.211   14.486  1.00 27.46  ? 60   THR A C     1 
ATOM   492  O  O     . THR A 1 63  ? 46.822 6.084   14.771  1.00 29.00  ? 60   THR A O     1 
ATOM   493  C  CB    . THR A 1 63  ? 48.185 3.329   15.934  1.00 31.73  ? 60   THR A CB    1 
ATOM   494  O  OG1   . THR A 1 63  ? 46.839 3.422   16.425  1.00 34.00  ? 60   THR A OG1   1 
ATOM   495  C  CG2   . THR A 1 63  ? 49.105 2.752   17.015  1.00 30.13  ? 60   THR A CG2   1 
ATOM   496  N  N     . ARG A 1 64  ? 47.763 4.679   13.293  1.00 25.26  ? 61   ARG A N     1 
ATOM   497  C  CA    A ARG A 1 64  ? 46.647 4.780   12.411  0.70 28.89  ? 61   ARG A CA    1 
ATOM   498  C  CA    B ARG A 1 64  ? 46.652 4.797   12.435  0.30 28.97  ? 61   ARG A CA    1 
ATOM   499  C  C     . ARG A 1 64  ? 45.111 4.332   12.883  1.00 33.41  ? 61   ARG A C     1 
ATOM   500  O  O     . ARG A 1 64  ? 45.150 3.525   13.754  1.00 31.69  ? 61   ARG A O     1 
ATOM   501  C  CB    A ARG A 1 64  ? 47.018 4.113   11.103  0.70 32.37  ? 61   ARG A CB    1 
ATOM   502  C  CB    B ARG A 1 64  ? 47.021 4.141   11.138  0.30 32.36  ? 61   ARG A CB    1 
ATOM   503  C  CG    A ARG A 1 64  ? 45.868 3.644   10.294  0.70 37.66  ? 61   ARG A CG    1 
ATOM   504  C  CG    B ARG A 1 64  ? 45.873 3.888   10.257  0.30 36.55  ? 61   ARG A CG    1 
ATOM   505  C  CD    A ARG A 1 64  ? 46.345 2.933   9.066   0.70 35.17  ? 61   ARG A CD    1 
ATOM   506  C  CD    B ARG A 1 64  ? 46.240 2.778   9.348   0.30 34.31  ? 61   ARG A CD    1 
ATOM   507  N  NE    A ARG A 1 64  ? 47.376 3.716   8.402   0.70 34.71  ? 61   ARG A NE    1 
ATOM   508  N  NE    B ARG A 1 64  ? 45.268 1.712   9.400   0.30 32.50  ? 61   ARG A NE    1 
ATOM   509  C  CZ    A ARG A 1 64  ? 48.652 3.399   8.439   0.70 30.76  ? 61   ARG A CZ    1 
ATOM   510  C  CZ    B ARG A 1 64  ? 45.339 0.670   8.597   0.30 33.74  ? 61   ARG A CZ    1 
ATOM   511  N  NH1   A ARG A 1 64  ? 49.037 2.319   9.086   0.70 31.86  ? 61   ARG A NH1   1 
ATOM   512  N  NH1   B ARG A 1 64  ? 46.338 0.591   7.724   0.30 29.67  ? 61   ARG A NH1   1 
ATOM   513  N  NH2   A ARG A 1 64  ? 49.534 4.154   7.816   0.70 32.31  ? 61   ARG A NH2   1 
ATOM   514  N  NH2   B ARG A 1 64  ? 44.448 -0.279  8.682   0.30 31.44  ? 61   ARG A NH2   1 
ATOM   515  N  N     . SER A 1 65  ? 44.013 4.804   12.377  1.00 26.22  ? 62   SER A N     1 
ATOM   516  C  CA    . SER A 1 65  ? 42.752 4.426   12.893  1.00 36.80  ? 62   SER A CA    1 
ATOM   517  C  C     . SER A 1 65  ? 42.638 4.835   14.334  1.00 37.67  ? 62   SER A C     1 
ATOM   518  O  O     . SER A 1 65  ? 42.135 4.085   15.112  1.00 46.71  ? 62   SER A O     1 
ATOM   519  C  CB    . SER A 1 65  ? 42.555 2.921   12.714  1.00 47.38  ? 62   SER A CB    1 
ATOM   520  O  OG    . SER A 1 65  ? 42.552 2.182   13.927  1.00 54.87  ? 62   SER A OG    1 
ATOM   521  N  N     . MET A 1 66  ? 43.187 5.962   14.678  1.00 33.65  ? 63   MET A N     1 
ATOM   522  C  CA    . MET A 1 66  ? 43.054 6.514   15.988  1.00 29.92  ? 63   MET A CA    1 
ATOM   523  C  C     . MET A 1 66  ? 42.447 7.874   15.747  1.00 25.90  ? 63   MET A C     1 
ATOM   524  O  O     . MET A 1 66  ? 42.794 8.505   14.821  1.00 25.34  ? 63   MET A O     1 
ATOM   525  C  CB    . MET A 1 66  ? 44.430 6.674   16.596  1.00 29.56  ? 63   MET A CB    1 
ATOM   526  C  CG    . MET A 1 66  ? 44.461 6.993   18.051  1.00 33.58  ? 63   MET A CG    1 
ATOM   527  S  SD    . MET A 1 66  ? 46.080 6.912   18.806  1.00 31.01  ? 63   MET A SD    1 
ATOM   528  C  CE    . MET A 1 66  ? 46.107 5.266   19.386  1.00 28.77  ? 63   MET A CE    1 
ATOM   529  N  N     . TRP A 1 67  ? 41.528 8.298   16.590  1.00 23.91  ? 64   TRP A N     1 
ATOM   530  C  CA    . TRP A 1 67  ? 41.009 9.663   16.521  1.00 28.84  ? 64   TRP A CA    1 
ATOM   531  C  C     . TRP A 1 67  ? 42.097 10.613  16.980  1.00 23.77  ? 64   TRP A C     1 
ATOM   532  O  O     . TRP A 1 67  ? 42.823 10.303  17.922  1.00 26.84  ? 64   TRP A O     1 
ATOM   533  C  CB    . TRP A 1 67  ? 39.757 9.834   17.389  1.00 27.36  ? 64   TRP A CB    1 
ATOM   534  C  CG    . TRP A 1 67  ? 38.630 8.998   16.920  1.00 30.28  ? 64   TRP A CG    1 
ATOM   535  C  CD1   . TRP A 1 67  ? 38.068 7.940   17.566  1.00 38.36  ? 64   TRP A CD1   1 
ATOM   536  C  CD2   . TRP A 1 67  ? 37.954 9.114   15.665  1.00 30.62  ? 64   TRP A CD2   1 
ATOM   537  N  NE1   . TRP A 1 67  ? 37.066 7.400   16.796  1.00 42.80  ? 64   TRP A NE1   1 
ATOM   538  C  CE2   . TRP A 1 67  ? 36.979 8.103   15.623  1.00 41.14  ? 64   TRP A CE2   1 
ATOM   539  C  CE3   . TRP A 1 67  ? 38.076 9.982   14.576  1.00 28.62  ? 64   TRP A CE3   1 
ATOM   540  C  CZ2   . TRP A 1 67  ? 36.125 7.936   14.533  1.00 44.40  ? 64   TRP A CZ2   1 
ATOM   541  C  CZ3   . TRP A 1 67  ? 37.232 9.817   13.497  1.00 36.81  ? 64   TRP A CZ3   1 
ATOM   542  C  CH2   . TRP A 1 67  ? 36.270 8.801   13.482  1.00 37.84  ? 64   TRP A CH2   1 
ATOM   543  N  N     . ALA A 1 68  ? 42.211 11.768  16.334  1.00 20.76  ? 65   ALA A N     1 
ATOM   544  C  CA    . ALA A 1 68  ? 43.265 12.715  16.704  1.00 25.84  ? 65   ALA A CA    1 
ATOM   545  C  C     . ALA A 1 68  ? 43.130 13.200  18.154  1.00 27.02  ? 65   ALA A C     1 
ATOM   546  O  O     . ALA A 1 68  ? 44.134 13.439  18.820  1.00 26.38  ? 65   ALA A O     1 
ATOM   547  C  CB    . ALA A 1 68  ? 43.278 13.894  15.760  1.00 26.66  ? 65   ALA A CB    1 
ATOM   548  N  N     . ASP A 1 69  ? 41.905 13.341  18.656  1.00 28.25  ? 66   ASP A N     1 
ATOM   549  C  CA    . ASP A 1 69  ? 41.761 13.775  20.052  1.00 27.07  ? 66   ASP A CA    1 
ATOM   550  C  C     . ASP A 1 69  ? 42.389 12.757  21.012  1.00 24.38  ? 66   ASP A C     1 
ATOM   551  O  O     . ASP A 1 69  ? 42.975 13.119  22.035  1.00 25.49  ? 66   ASP A O     1 
ATOM   552  C  CB    . ASP A 1 69  ? 40.303 13.986  20.423  1.00 29.97  ? 66   ASP A CB    1 
ATOM   553  C  CG    . ASP A 1 69  ? 39.721 15.246  19.802  1.00 33.92  ? 66   ASP A CG    1 
ATOM   554  O  OD1   . ASP A 1 69  ? 40.492 16.095  19.289  1.00 38.01  ? 66   ASP A OD1   1 
ATOM   555  O  OD2   . ASP A 1 69  ? 38.489 15.387  19.851  1.00 39.23  ? 66   ASP A OD2   1 
ATOM   556  N  N     . ASP A 1 70  ? 42.266 11.485  20.669  1.00 26.26  ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 70  ? 42.834 10.423  21.493  1.00 24.87  ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 70  ? 44.337 10.352  21.340  1.00 25.06  ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 70  ? 45.066 10.151  22.305  1.00 22.83  ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 70  ? 42.208 9.078   21.136  1.00 25.29  ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 70  ? 40.721 9.034   21.460  1.00 40.17  ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 70  ? 40.258 9.856   22.286  1.00 34.12  ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 70  ? 40.020 8.184   20.884  1.00 42.63  ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 71  ? 44.808 10.533  20.114  1.00 21.41  ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 71  ? 46.241 10.589  19.886  1.00 21.72  ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 71  ? 46.915 11.732  20.670  1.00 24.54  ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 71  ? 48.030 11.582  21.136  1.00 21.72  ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 71  ? 46.526 10.738  18.397  1.00 24.98  ? 68   ALA A CB    1 
ATOM   569  N  N     . LYS A 1 72  ? 46.238 12.870  20.781  1.00 19.64  ? 69   LYS A N     1 
ATOM   570  C  CA    . LYS A 1 72  ? 46.753 14.027  21.541  1.00 20.90  ? 69   LYS A CA    1 
ATOM   571  C  C     . LYS A 1 72  ? 46.853 13.734  23.037  1.00 24.93  ? 69   LYS A C     1 
ATOM   572  O  O     . LYS A 1 72  ? 47.619 14.370  23.766  1.00 23.88  ? 69   LYS A O     1 
ATOM   573  C  CB    . LYS A 1 72  ? 45.851 15.257  21.321  1.00 26.82  ? 69   LYS A CB    1 
ATOM   574  C  CG    . LYS A 1 72  ? 46.145 16.029  20.037  1.00 32.03  ? 69   LYS A CG    1 
ATOM   575  C  CD    . LYS A 1 72  ? 47.428 16.837  20.184  1.00 35.34  ? 69   LYS A CD    1 
ATOM   576  C  CE    . LYS A 1 72  ? 47.513 17.990  19.201  1.00 32.28  ? 69   LYS A CE    1 
ATOM   577  N  NZ    . LYS A 1 72  ? 48.786 18.754  19.445  1.00 27.90  ? 69   LYS A NZ    1 
ATOM   578  N  N     . LYS A 1 73  ? 46.048 12.790  23.504  1.00 22.96  ? 70   LYS A N     1 
ATOM   579  C  CA    . LYS A 1 73  ? 46.158 12.363  24.888  1.00 26.70  ? 70   LYS A CA    1 
ATOM   580  C  C     . LYS A 1 73  ? 47.480 11.622  25.117  1.00 22.76  ? 70   LYS A C     1 
ATOM   581  O  O     . LYS A 1 73  ? 48.098 11.757  26.166  1.00 27.65  ? 70   LYS A O     1 
ATOM   582  C  CB    . LYS A 1 73  ? 44.973 11.482  25.259  1.00 23.57  ? 70   LYS A CB    1 
ATOM   583  C  CG    . LYS A 1 73  ? 43.626 12.142  25.046  1.00 21.75  ? 70   LYS A CG    1 
ATOM   584  C  CD    . LYS A 1 73  ? 42.515 11.139  25.338  1.00 23.89  ? 70   LYS A CD    1 
ATOM   585  C  CE    . LYS A 1 73  ? 41.149 11.750  25.062  1.00 27.90  ? 70   LYS A CE    1 
ATOM   586  N  NZ    . LYS A 1 73  ? 40.118 10.687  25.081  1.00 34.02  ? 70   LYS A NZ    1 
ATOM   587  N  N     . LEU A 1 74  ? 47.930 10.859  24.122  1.00 23.02  ? 71   LEU A N     1 
ATOM   588  C  CA    . LEU A 1 74  ? 49.195 10.127  24.252  1.00 25.39  ? 71   LEU A CA    1 
ATOM   589  C  C     . LEU A 1 74  ? 50.384 11.037  23.987  1.00 27.75  ? 71   LEU A C     1 
ATOM   590  O  O     . LEU A 1 74  ? 51.469 10.870  24.554  1.00 27.82  ? 71   LEU A O     1 
ATOM   591  C  CB    . LEU A 1 74  ? 49.257 8.961   23.269  1.00 22.39  ? 71   LEU A CB    1 
ATOM   592  C  CG    . LEU A 1 74  ? 48.246 7.832   23.428  1.00 29.34  ? 71   LEU A CG    1 
ATOM   593  C  CD1   . LEU A 1 74  ? 48.487 6.811   22.313  1.00 30.08  ? 71   LEU A CD1   1 
ATOM   594  C  CD2   . LEU A 1 74  ? 48.374 7.182   24.789  1.00 25.31  ? 71   LEU A CD2   1 
ATOM   595  N  N     . CYS A 1 75  ? 50.167 11.983  23.087  1.00 23.51  ? 72   CYS A N     1 
ATOM   596  C  CA    . CYS A 1 75  ? 51.243 12.838  22.600  1.00 25.26  ? 72   CYS A CA    1 
ATOM   597  C  C     . CYS A 1 75  ? 50.731 14.267  22.455  1.00 29.25  ? 72   CYS A C     1 
ATOM   598  O  O     . CYS A 1 75  ? 50.234 14.660  21.395  1.00 27.38  ? 72   CYS A O     1 
ATOM   599  C  CB    . CYS A 1 75  ? 51.760 12.299  21.279  1.00 24.94  ? 72   CYS A CB    1 
ATOM   600  S  SG    . CYS A 1 75  ? 53.089 13.261  20.549  1.00 31.45  ? 72   CYS A SG    1 
ATOM   601  N  N     . PRO A 1 76  ? 50.827 15.050  23.537  1.00 27.79  ? 73   PRO A N     1 
ATOM   602  C  CA    . PRO A 1 76  ? 50.215 16.390  23.563  1.00 25.59  ? 73   PRO A CA    1 
ATOM   603  C  C     . PRO A 1 76  ? 50.811 17.357  22.545  1.00 23.25  ? 73   PRO A C     1 
ATOM   604  O  O     . PRO A 1 76  ? 50.112 18.272  22.106  1.00 28.96  ? 73   PRO A O     1 
ATOM   605  C  CB    . PRO A 1 76  ? 50.497 16.876  24.986  1.00 31.22  ? 73   PRO A CB    1 
ATOM   606  C  CG    . PRO A 1 76  ? 50.586 15.601  25.800  1.00 31.98  ? 73   PRO A CG    1 
ATOM   607  C  CD    . PRO A 1 76  ? 51.210 14.574  24.881  1.00 32.04  ? 73   PRO A CD    1 
ATOM   608  N  N     . ASP A 1 77  ? 52.075 17.160  22.196  1.00 25.47  ? 74   ASP A N     1 
ATOM   609  C  CA    . ASP A 1 77  ? 52.742 18.051  21.248  1.00 33.06  ? 74   ASP A CA    1 
ATOM   610  C  C     . ASP A 1 77  ? 52.634 17.550  19.813  1.00 30.69  ? 74   ASP A C     1 
ATOM   611  O  O     . ASP A 1 77  ? 53.307 18.074  18.914  1.00 27.78  ? 74   ASP A O     1 
ATOM   612  C  CB    . ASP A 1 77  ? 54.213 18.223  21.612  1.00 30.93  ? 74   ASP A CB    1 
ATOM   613  C  CG    . ASP A 1 77  ? 54.406 18.853  22.980  1.00 47.40  ? 74   ASP A CG    1 
ATOM   614  O  OD1   . ASP A 1 77  ? 55.144 18.268  23.800  1.00 50.06  ? 74   ASP A OD1   1 
ATOM   615  O  OD2   . ASP A 1 77  ? 53.817 19.928  23.236  1.00 45.73  ? 74   ASP A OD2   1 
ATOM   616  N  N     . LEU A 1 78  ? 51.787 16.539  19.602  1.00 25.14  ? 75   LEU A N     1 
ATOM   617  C  CA    . LEU A 1 78  ? 51.585 15.969  18.266  1.00 21.40  ? 75   LEU A CA    1 
ATOM   618  C  C     . LEU A 1 78  ? 51.198 17.054  17.282  1.00 23.37  ? 75   LEU A C     1 
ATOM   619  O  O     . LEU A 1 78  ? 50.271 17.815  17.534  1.00 24.33  ? 75   LEU A O     1 
ATOM   620  C  CB    . LEU A 1 78  ? 50.490 14.901  18.291  1.00 20.21  ? 75   LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 78  ? 50.190 14.186  16.976  1.00 22.84  ? 75   LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 78  ? 51.388 13.318  16.599  1.00 20.55  ? 75   LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 78  ? 48.945 13.343  17.173  1.00 22.83  ? 75   LEU A CD2   1 
ATOM   624  N  N     . LEU A 1 79  ? 51.897 17.111  16.155  1.00 20.43  ? 76   LEU A N     1 
ATOM   625  C  CA    . LEU A 1 79  ? 51.523 18.050  15.106  1.00 21.31  ? 76   LEU A CA    1 
ATOM   626  C  C     . LEU A 1 79  ? 50.660 17.330  14.079  1.00 27.95  ? 76   LEU A C     1 
ATOM   627  O  O     . LEU A 1 79  ? 50.852 16.147  13.808  1.00 21.31  ? 76   LEU A O     1 
ATOM   628  C  CB    . LEU A 1 79  ? 52.774 18.657  14.454  1.00 21.59  ? 76   LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 79  ? 53.676 19.455  15.405  1.00 22.74  ? 76   LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 79  ? 54.882 20.008  14.658  1.00 23.40  ? 76   LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 79  ? 52.900 20.588  16.088  1.00 22.91  ? 76   LEU A CD2   1 
ATOM   632  N  N     . LEU A 1 80  ? 49.690 18.040  13.520  1.00 22.79  ? 77   LEU A N     1 
ATOM   633  C  CA    . LEU A 1 80  ? 48.744 17.402  12.612  1.00 24.50  ? 77   LEU A CA    1 
ATOM   634  C  C     . LEU A 1 80  ? 48.697 18.136  11.289  1.00 30.61  ? 77   LEU A C     1 
ATOM   635  O  O     . LEU A 1 80  ? 48.650 19.361  11.255  1.00 33.09  ? 77   LEU A O     1 
ATOM   636  C  CB    . LEU A 1 80  ? 47.345 17.365  13.224  1.00 22.30  ? 77   LEU A CB    1 
ATOM   637  C  CG    . LEU A 1 80  ? 47.194 16.576  14.514  1.00 21.86  ? 77   LEU A CG    1 
ATOM   638  C  CD1   . LEU A 1 80  ? 45.803 16.759  15.087  1.00 30.96  ? 77   LEU A CD1   1 
ATOM   639  C  CD2   . LEU A 1 80  ? 47.484 15.101  14.227  1.00 25.09  ? 77   LEU A CD2   1 
ATOM   640  N  N     . ALA A 1 81  ? 48.707 17.383  10.202  1.00 20.45  ? 78   ALA A N     1 
ATOM   641  C  CA    . ALA A 1 81  ? 48.437 17.938  8.875   1.00 22.85  ? 78   ALA A CA    1 
ATOM   642  C  C     . ALA A 1 81  ? 47.143 17.359  8.352   1.00 24.33  ? 78   ALA A C     1 
ATOM   643  O  O     . ALA A 1 81  ? 46.894 16.170  8.458   1.00 22.74  ? 78   ALA A O     1 
ATOM   644  C  CB    . ALA A 1 81  ? 49.596 17.656  7.907   1.00 24.79  ? 78   ALA A CB    1 
ATOM   645  N  N     . GLN A 1 82  ? 46.310 18.227  7.789   1.00 22.23  ? 79   GLN A N     1 
ATOM   646  C  CA    . GLN A 1 82  ? 44.968 17.894  7.343   1.00 27.25  ? 79   GLN A CA    1 
ATOM   647  C  C     . GLN A 1 82  ? 44.918 17.510  5.871   1.00 18.92  ? 79   GLN A C     1 
ATOM   648  O  O     . GLN A 1 82  ? 45.452 18.234  5.030   1.00 26.22  ? 79   GLN A O     1 
ATOM   649  C  CB    . GLN A 1 82  ? 44.088 19.119  7.573   1.00 27.90  ? 79   GLN A CB    1 
ATOM   650  C  CG    . GLN A 1 82  ? 42.686 18.875  7.919   1.00 44.41  ? 79   GLN A CG    1 
ATOM   651  C  CD    . GLN A 1 82  ? 42.167 19.967  8.828   1.00 51.06  ? 79   GLN A CD    1 
ATOM   652  O  OE1   . GLN A 1 82  ? 41.220 19.757  9.551   1.00 56.42  ? 79   GLN A OE1   1 
ATOM   653  N  NE2   . GLN A 1 82  ? 42.819 21.126  8.819   1.00 41.34  ? 79   GLN A NE2   1 
ATOM   654  N  N     . VAL A 1 83  ? 44.276 16.386  5.549   1.00 20.90  ? 80   VAL A N     1 
ATOM   655  C  CA    . VAL A 1 83  ? 44.002 16.038  4.160   1.00 21.15  ? 80   VAL A CA    1 
ATOM   656  C  C     . VAL A 1 83  ? 43.112 17.109  3.545   1.00 24.12  ? 80   VAL A C     1 
ATOM   657  O  O     . VAL A 1 83  ? 42.175 17.576  4.172   1.00 23.22  ? 80   VAL A O     1 
ATOM   658  C  CB    . VAL A 1 83  ? 43.311 14.660  4.048   1.00 24.26  ? 80   VAL A CB    1 
ATOM   659  C  CG1   . VAL A 1 83  ? 42.809 14.420  2.665   1.00 21.31  ? 80   VAL A CG1   1 
ATOM   660  C  CG2   . VAL A 1 83  ? 44.270 13.543  4.469   1.00 25.15  ? 80   VAL A CG2   1 
ATOM   661  N  N     . ARG A 1 84  ? 43.416 17.500  2.318   1.00 25.25  ? 81   ARG A N     1 
ATOM   662  C  CA    . ARG A 1 84  ? 42.631 18.503  1.608   1.00 22.83  ? 81   ARG A CA    1 
ATOM   663  C  C     . ARG A 1 84  ? 41.160 18.094  1.495   1.00 25.27  ? 81   ARG A C     1 
ATOM   664  O  O     . ARG A 1 84  ? 40.832 16.912  1.399   1.00 22.94  ? 81   ARG A O     1 
ATOM   665  C  CB    . ARG A 1 84  ? 43.235 18.728  0.221   1.00 31.35  ? 81   ARG A CB    1 
ATOM   666  C  CG    . ARG A 1 84  ? 42.493 19.732  -0.658  1.00 36.68  ? 81   ARG A CG    1 
ATOM   667  C  CD    . ARG A 1 84  ? 43.258 19.909  -1.969  1.00 49.19  ? 81   ARG A CD    1 
ATOM   668  N  NE    . ARG A 1 84  ? 42.680 20.919  -2.851  1.00 60.31  ? 81   ARG A NE    1 
ATOM   669  C  CZ    . ARG A 1 84  ? 42.486 20.740  -4.156  1.00 63.81  ? 81   ARG A CZ    1 
ATOM   670  N  NH1   . ARG A 1 84  ? 42.812 19.583  -4.731  1.00 54.04  ? 81   ARG A NH1   1 
ATOM   671  N  NH2   . ARG A 1 84  ? 41.959 21.712  -4.888  1.00 68.86  ? 81   ARG A NH2   1 
ATOM   672  N  N     . GLU A 1 85  ? 40.265 19.073  1.548   1.00 22.48  ? 82   GLU A N     1 
ATOM   673  C  CA    . GLU A 1 85  ? 38.864 18.801  1.285   1.00 25.93  ? 82   GLU A CA    1 
ATOM   674  C  C     . GLU A 1 85  ? 38.427 19.547  0.031   1.00 28.98  ? 82   GLU A C     1 
ATOM   675  O  O     . GLU A 1 85  ? 38.709 20.733  -0.125  1.00 29.06  ? 82   GLU A O     1 
ATOM   676  C  CB    . GLU A 1 85  ? 37.994 19.183  2.489   1.00 33.08  ? 82   GLU A CB    1 
ATOM   677  C  CG    . GLU A 1 85  ? 38.021 18.117  3.583   1.00 40.13  ? 82   GLU A CG    1 
ATOM   678  C  CD    . GLU A 1 85  ? 37.340 18.560  4.874   1.00 52.95  ? 82   GLU A CD    1 
ATOM   679  O  OE1   . GLU A 1 85  ? 36.120 18.889  4.859   1.00 40.91  ? 82   GLU A OE1   1 
ATOM   680  O  OE2   . GLU A 1 85  ? 38.044 18.574  5.909   1.00 46.42  ? 82   GLU A OE2   1 
ATOM   681  N  N     . SER A 1 86  ? 37.766 18.831  -0.878  1.00 25.16  ? 83   SER A N     1 
ATOM   682  C  CA    . SER A 1 86  ? 37.205 19.433  -2.078  1.00 26.38  ? 83   SER A CA    1 
ATOM   683  C  C     . SER A 1 86  ? 35.832 18.851  -2.342  1.00 29.23  ? 83   SER A C     1 
ATOM   684  O  O     . SER A 1 86  ? 35.642 17.639  -2.254  1.00 28.45  ? 83   SER A O     1 
ATOM   685  C  CB    . SER A 1 86  ? 38.105 19.202  -3.290  1.00 31.04  ? 83   SER A CB    1 
ATOM   686  O  OG    . SER A 1 86  ? 39.400 19.707  -3.041  1.00 45.22  ? 83   SER A OG    1 
ATOM   687  N  N     . ARG A 1 87  ? 34.877 19.724  -2.659  1.00 30.50  ? 84   ARG A N     1 
ATOM   688  C  CA    . ARG A 1 87  ? 33.507 19.297  -2.926  1.00 35.84  ? 84   ARG A CA    1 
ATOM   689  C  C     . ARG A 1 87  ? 32.918 18.497  -1.775  1.00 27.12  ? 84   ARG A C     1 
ATOM   690  O  O     . ARG A 1 87  ? 32.162 17.548  -1.983  1.00 33.14  ? 84   ARG A O     1 
ATOM   691  C  CB    . ARG A 1 87  ? 33.440 18.483  -4.218  1.00 32.63  ? 84   ARG A CB    1 
ATOM   692  C  CG    . ARG A 1 87  ? 34.058 19.205  -5.392  1.00 40.05  ? 84   ARG A CG    1 
ATOM   693  C  CD    . ARG A 1 87  ? 33.642 18.584  -6.699  1.00 40.64  ? 84   ARG A CD    1 
ATOM   694  N  NE    . ARG A 1 87  ? 33.856 19.509  -7.811  1.00 51.04  ? 84   ARG A NE    1 
ATOM   695  C  CZ    . ARG A 1 87  ? 34.980 19.579  -8.520  1.00 57.68  ? 84   ARG A CZ    1 
ATOM   696  N  NH1   . ARG A 1 87  ? 36.000 18.773  -8.241  1.00 51.83  ? 84   ARG A NH1   1 
ATOM   697  N  NH2   . ARG A 1 87  ? 35.081 20.454  -9.517  1.00 54.69  ? 84   ARG A NH2   1 
ATOM   698  N  N     . GLY A 1 88  ? 33.262 18.890  -0.557  1.00 25.88  ? 85   GLY A N     1 
ATOM   699  C  CA    . GLY A 1 88  ? 32.673 18.295  0.625   1.00 30.45  ? 85   GLY A CA    1 
ATOM   700  C  C     . GLY A 1 88  ? 33.315 17.004  1.090   1.00 28.66  ? 85   GLY A C     1 
ATOM   701  O  O     . GLY A 1 88  ? 32.827 16.364  2.017   1.00 27.06  ? 85   GLY A O     1 
ATOM   702  N  N     . LYS A 1 89  ? 34.416 16.609  0.461   1.00 24.83  ? 86   LYS A N     1 
ATOM   703  C  CA    . LYS A 1 89  ? 35.035 15.333  0.832   1.00 22.31  ? 86   LYS A CA    1 
ATOM   704  C  C     . LYS A 1 89  ? 36.555 15.380  0.833   1.00 20.44  ? 86   LYS A C     1 
ATOM   705  O  O     . LYS A 1 89  ? 37.170 16.249  0.211   1.00 22.93  ? 86   LYS A O     1 
ATOM   706  C  CB    . LYS A 1 89  ? 34.572 14.226  -0.115  1.00 29.50  ? 86   LYS A CB    1 
ATOM   707  C  CG    . LYS A 1 89  ? 35.076 14.402  -1.533  1.00 27.88  ? 86   LYS A CG    1 
ATOM   708  C  CD    . LYS A 1 89  ? 34.540 13.316  -2.470  1.00 33.15  ? 86   LYS A CD    1 
ATOM   709  C  CE    . LYS A 1 89  ? 35.139 11.952  -2.165  1.00 26.69  ? 86   LYS A CE    1 
ATOM   710  N  NZ    . LYS A 1 89  ? 36.611 11.918  -2.373  1.00 26.26  ? 86   LYS A NZ    1 
ATOM   711  N  N     . ALA A 1 90  ? 37.145 14.430  1.536   1.00 26.46  ? 87   ALA A N     1 
ATOM   712  C  CA    . ALA A 1 90  ? 38.598 14.261  1.508   1.00 25.14  ? 87   ALA A CA    1 
ATOM   713  C  C     . ALA A 1 90  ? 39.065 14.050  0.081   1.00 26.34  ? 87   ALA A C     1 
ATOM   714  O  O     . ALA A 1 90  ? 38.443 13.312  -0.688  1.00 27.05  ? 87   ALA A O     1 
ATOM   715  C  CB    . ALA A 1 90  ? 39.017 13.097  2.388   1.00 29.93  ? 87   ALA A CB    1 
ATOM   716  N  N     . ASN A 1 91  ? 40.154 14.714  -0.273  1.00 21.97  ? 88   ASN A N     1 
ATOM   717  C  CA    . ASN A 1 91  ? 40.718 14.596  -1.608  1.00 27.73  ? 88   ASN A CA    1 
ATOM   718  C  C     . ASN A 1 91  ? 42.183 14.207  -1.522  1.00 22.10  ? 88   ASN A C     1 
ATOM   719  O  O     . ASN A 1 91  ? 42.978 14.914  -0.912  1.00 25.39  ? 88   ASN A O     1 
ATOM   720  C  CB    . ASN A 1 91  ? 40.562 15.907  -2.375  1.00 29.97  ? 88   ASN A CB    1 
ATOM   721  C  CG    . ASN A 1 91  ? 40.951 15.767  -3.830  1.00 36.97  ? 88   ASN A CG    1 
ATOM   722  O  OD1   . ASN A 1 91  ? 42.109 15.538  -4.137  1.00 28.55  ? 88   ASN A OD1   1 
ATOM   723  N  ND2   . ASN A 1 91  ? 39.980 15.897  -4.732  1.00 35.97  ? 88   ASN A ND2   1 
ATOM   724  N  N     . LEU A 1 92  ? 42.535 13.065  -2.105  1.00 21.08  ? 89   LEU A N     1 
ATOM   725  C  CA    . LEU A 1 92  ? 43.862 12.494  -1.866  1.00 25.95  ? 89   LEU A CA    1 
ATOM   726  C  C     . LEU A 1 92  ? 44.837 12.801  -2.997  1.00 23.09  ? 89   LEU A C     1 
ATOM   727  O  O     . LEU A 1 92  ? 45.887 12.167  -3.111  1.00 21.52  ? 89   LEU A O     1 
ATOM   728  C  CB    . LEU A 1 92  ? 43.756 10.979  -1.662  1.00 24.54  ? 89   LEU A CB    1 
ATOM   729  C  CG    . LEU A 1 92  ? 42.808 10.594  -0.518  1.00 25.25  ? 89   LEU A CG    1 
ATOM   730  C  CD1   . LEU A 1 92  ? 42.518 9.107   -0.496  1.00 32.82  ? 89   LEU A CD1   1 
ATOM   731  C  CD2   . LEU A 1 92  ? 43.392 11.062  0.808   1.00 25.83  ? 89   LEU A CD2   1 
ATOM   732  N  N     . THR A 1 93  ? 44.509 13.801  -3.810  1.00 23.71  ? 90   THR A N     1 
ATOM   733  C  CA    . THR A 1 93  ? 45.299 14.078  -5.009  1.00 19.98  ? 90   THR A CA    1 
ATOM   734  C  C     . THR A 1 93  ? 46.773 14.332  -4.746  1.00 22.97  ? 90   THR A C     1 
ATOM   735  O  O     . THR A 1 93  ? 47.624 13.840  -5.484  1.00 24.54  ? 90   THR A O     1 
ATOM   736  C  CB    . THR A 1 93  ? 44.700 15.285  -5.783  1.00 27.31  ? 90   THR A CB    1 
ATOM   737  O  OG1   . THR A 1 93  ? 43.428 14.893  -6.307  1.00 31.98  ? 90   THR A OG1   1 
ATOM   738  C  CG2   . THR A 1 93  ? 45.601 15.713  -6.918  1.00 30.82  ? 90   THR A CG2   1 
ATOM   739  N  N     . LYS A 1 94  ? 47.083 15.091  -3.695  1.00 21.49  ? 91   LYS A N     1 
ATOM   740  C  CA    . LYS A 1 94  ? 48.472 15.382  -3.369  1.00 20.91  ? 91   LYS A CA    1 
ATOM   741  C  C     . LYS A 1 94  ? 49.309 14.118  -3.181  1.00 19.14  ? 91   LYS A C     1 
ATOM   742  O  O     . LYS A 1 94  ? 50.470 14.066  -3.603  1.00 21.45  ? 91   LYS A O     1 
ATOM   743  C  CB    . LYS A 1 94  ? 48.564 16.225  -2.102  1.00 22.54  ? 91   LYS A CB    1 
ATOM   744  C  CG    . LYS A 1 94  ? 49.990 16.662  -1.737  1.00 23.08  ? 91   LYS A CG    1 
ATOM   745  C  CD    . LYS A 1 94  ? 50.056 17.185  -0.290  1.00 27.28  ? 91   LYS A CD    1 
ATOM   746  C  CE    . LYS A 1 94  ? 49.238 18.443  -0.105  1.00 32.29  ? 91   LYS A CE    1 
ATOM   747  N  NZ    . LYS A 1 94  ? 49.295 18.964  1.308   1.00 23.29  ? 91   LYS A NZ    1 
ATOM   748  N  N     . TYR A 1 95  ? 48.713 13.105  -2.559  1.00 22.01  ? 92   TYR A N     1 
ATOM   749  C  CA    . TYR A 1 95  ? 49.444 11.885  -2.240  1.00 18.48  ? 92   TYR A CA    1 
ATOM   750  C  C     . TYR A 1 95  ? 49.519 10.984  -3.448  1.00 19.23  ? 92   TYR A C     1 
ATOM   751  O  O     . TYR A 1 95  ? 50.534 10.310  -3.651  1.00 20.57  ? 92   TYR A O     1 
ATOM   752  C  CB    . TYR A 1 95  ? 48.799 11.153  -1.060  1.00 17.47  ? 92   TYR A CB    1 
ATOM   753  C  CG    . TYR A 1 95  ? 48.503 12.129  0.044   1.00 17.92  ? 92   TYR A CG    1 
ATOM   754  C  CD1   . TYR A 1 95  ? 47.202 12.530  0.282   1.00 19.53  ? 92   TYR A CD1   1 
ATOM   755  C  CD2   . TYR A 1 95  ? 49.531 12.709  0.795   1.00 17.51  ? 92   TYR A CD2   1 
ATOM   756  C  CE1   . TYR A 1 95  ? 46.911 13.463  1.262   1.00 21.81  ? 92   TYR A CE1   1 
ATOM   757  C  CE2   . TYR A 1 95  ? 49.258 13.642  1.763   1.00 21.60  ? 92   TYR A CE2   1 
ATOM   758  C  CZ    . TYR A 1 95  ? 47.930 14.009  1.994   1.00 21.25  ? 92   TYR A CZ    1 
ATOM   759  O  OH    . TYR A 1 95  ? 47.617 14.937  2.954   1.00 22.82  ? 92   TYR A OH    1 
ATOM   760  N  N     . ARG A 1 96  ? 48.472 10.989  -4.272  1.00 20.24  ? 93   ARG A N     1 
ATOM   761  C  CA    . ARG A 1 96  ? 48.526 10.252  -5.541  1.00 20.56  ? 93   ARG A CA    1 
ATOM   762  C  C     . ARG A 1 96  ? 49.601 10.796  -6.478  1.00 25.23  ? 93   ARG A C     1 
ATOM   763  O  O     . ARG A 1 96  ? 50.297 10.024  -7.146  1.00 25.86  ? 93   ARG A O     1 
ATOM   764  C  CB    . ARG A 1 96  ? 47.169 10.267  -6.250  1.00 24.09  ? 93   ARG A CB    1 
ATOM   765  C  CG    . ARG A 1 96  ? 46.109 9.430   -5.565  1.00 22.63  ? 93   ARG A CG    1 
ATOM   766  C  CD    . ARG A 1 96  ? 44.868 9.246   -6.423  1.00 24.57  ? 93   ARG A CD    1 
ATOM   767  N  NE    . ARG A 1 96  ? 43.835 8.542   -5.670  1.00 28.96  ? 93   ARG A NE    1 
ATOM   768  C  CZ    . ARG A 1 96  ? 42.780 9.122   -5.100  1.00 30.48  ? 93   ARG A CZ    1 
ATOM   769  N  NH1   . ARG A 1 96  ? 41.925 8.369   -4.421  1.00 26.48  ? 93   ARG A NH1   1 
ATOM   770  N  NH2   . ARG A 1 96  ? 42.579 10.437  -5.211  1.00 25.37  ? 93   ARG A NH2   1 
ATOM   771  N  N     . GLU A 1 97  ? 49.754 12.116  -6.517  1.00 23.22  ? 94   GLU A N     1 
ATOM   772  C  CA    . GLU A 1 97  ? 50.771 12.731  -7.366  1.00 22.64  ? 94   GLU A CA    1 
ATOM   773  C  C     . GLU A 1 97  ? 52.184 12.459  -6.835  1.00 22.80  ? 94   GLU A C     1 
ATOM   774  O  O     . GLU A 1 97  ? 53.113 12.229  -7.614  1.00 21.02  ? 94   GLU A O     1 
ATOM   775  C  CB    . GLU A 1 97  ? 50.511 14.235  -7.510  1.00 27.18  ? 94   GLU A CB    1 
ATOM   776  C  CG    . GLU A 1 97  ? 49.225 14.494  -8.272  1.00 30.97  ? 94   GLU A CG    1 
ATOM   777  C  CD    . GLU A 1 97  ? 48.875 15.959  -8.422  1.00 45.55  ? 94   GLU A CD    1 
ATOM   778  O  OE1   . GLU A 1 97  ? 49.378 16.789  -7.634  1.00 46.64  ? 94   GLU A OE1   1 
ATOM   779  O  OE2   . GLU A 1 97  ? 48.073 16.272  -9.334  1.00 42.58  ? 94   GLU A OE2   1 
ATOM   780  N  N     . ALA A 1 98  ? 52.344 12.476  -5.515  1.00 22.42  ? 95   ALA A N     1 
ATOM   781  C  CA    . ALA A 1 98  ? 53.626 12.124  -4.907  1.00 24.88  ? 95   ALA A CA    1 
ATOM   782  C  C     . ALA A 1 98  ? 53.988 10.679  -5.207  1.00 19.34  ? 95   ALA A C     1 
ATOM   783  O  O     . ALA A 1 98  ? 55.148 10.363  -5.454  1.00 24.82  ? 95   ALA A O     1 
ATOM   784  C  CB    . ALA A 1 98  ? 53.590 12.349  -3.401  1.00 18.61  ? 95   ALA A CB    1 
ATOM   785  N  N     . SER A 1 99  ? 52.991 9.805   -5.160  1.00 19.78  ? 96   SER A N     1 
ATOM   786  C  CA    . SER A 1 99  ? 53.192 8.404   -5.493  1.00 18.27  ? 96   SER A CA    1 
ATOM   787  C  C     . SER A 1 99  ? 53.702 8.247   -6.926  1.00 23.14  ? 96   SER A C     1 
ATOM   788  O  O     . SER A 1 99  ? 54.600 7.449   -7.193  1.00 21.64  ? 96   SER A O     1 
ATOM   789  C  CB    . SER A 1 99  ? 51.886 7.628   -5.311  1.00 22.44  ? 96   SER A CB    1 
ATOM   790  O  OG    . SER A 1 99  ? 52.054 6.274   -5.668  1.00 25.32  ? 96   SER A OG    1 
ATOM   791  N  N     . VAL A 1 100 ? 53.123 9.004   -7.850  1.00 22.28  ? 97   VAL A N     1 
ATOM   792  C  CA    . VAL A 1 100 ? 53.578 8.933   -9.234  1.00 21.49  ? 97   VAL A CA    1 
ATOM   793  C  C     . VAL A 1 100 ? 55.046 9.323   -9.338  1.00 21.02  ? 97   VAL A C     1 
ATOM   794  O  O     . VAL A 1 100 ? 55.794 8.700   -10.106 1.00 26.81  ? 97   VAL A O     1 
ATOM   795  C  CB    . VAL A 1 100 ? 52.724 9.824   -10.158 1.00 22.31  ? 97   VAL A CB    1 
ATOM   796  C  CG1   . VAL A 1 100 ? 53.445 10.080  -11.506 1.00 26.04  ? 97   VAL A CG1   1 
ATOM   797  C  CG2   . VAL A 1 100 ? 51.369 9.185   -10.370 1.00 27.65  ? 97   VAL A CG2   1 
ATOM   798  N  N     . GLU A 1 101 ? 55.474 10.334  -8.567  1.00 18.94  ? 98   GLU A N     1 
ATOM   799  C  CA    . GLU A 1 101 ? 56.886 10.745  -8.559  1.00 21.79  ? 98   GLU A CA    1 
ATOM   800  C  C     . GLU A 1 101 ? 57.814 9.564   -8.276  1.00 22.97  ? 98   GLU A C     1 
ATOM   801  O  O     . GLU A 1 101 ? 58.839 9.360   -8.949  1.00 21.16  ? 98   GLU A O     1 
ATOM   802  C  CB    . GLU A 1 101 ? 57.177 11.807  -7.487  1.00 23.14  ? 98   GLU A CB    1 
ATOM   803  C  CG    . GLU A 1 101 ? 56.769 13.251  -7.758  1.00 30.57  ? 98   GLU A CG    1 
ATOM   804  C  CD    . GLU A 1 101 ? 57.119 14.154  -6.569  1.00 31.76  ? 98   GLU A CD    1 
ATOM   805  O  OE1   . GLU A 1 101 ? 58.317 14.448  -6.365  1.00 30.32  ? 98   GLU A OE1   1 
ATOM   806  O  OE2   . GLU A 1 101 ? 56.198 14.559  -5.822  1.00 32.27  ? 98   GLU A OE2   1 
ATOM   807  N  N     . VAL A 1 102 ? 57.468 8.823   -7.231  1.00 19.09  ? 99   VAL A N     1 
ATOM   808  C  CA    . VAL A 1 102 ? 58.290 7.716   -6.787  1.00 18.87  ? 99   VAL A CA    1 
ATOM   809  C  C     . VAL A 1 102 ? 58.233 6.553   -7.764  1.00 18.94  ? 99   VAL A C     1 
ATOM   810  O  O     . VAL A 1 102 ? 59.276 5.959   -8.087  1.00 22.57  ? 99   VAL A O     1 
ATOM   811  C  CB    . VAL A 1 102 ? 57.866 7.225   -5.384  1.00 21.35  ? 99   VAL A CB    1 
ATOM   812  C  CG1   . VAL A 1 102 ? 58.636 5.947   -5.026  1.00 25.68  ? 99   VAL A CG1   1 
ATOM   813  C  CG2   . VAL A 1 102 ? 58.145 8.336   -4.367  1.00 22.23  ? 99   VAL A CG2   1 
ATOM   814  N  N     . MET A 1 103 ? 57.031 6.227   -8.227  1.00 18.12  ? 100  MET A N     1 
ATOM   815  C  CA    . MET A 1 103 ? 56.868 5.109   -9.156  1.00 23.16  ? 100  MET A CA    1 
ATOM   816  C  C     . MET A 1 103 ? 57.632 5.357   -10.455 1.00 27.56  ? 100  MET A C     1 
ATOM   817  O  O     . MET A 1 103 ? 58.168 4.424   -11.039 1.00 22.87  ? 100  MET A O     1 
ATOM   818  C  CB    . MET A 1 103 ? 55.391 4.856   -9.475  1.00 24.19  ? 100  MET A CB    1 
ATOM   819  C  CG    A MET A 1 103 ? 54.482 4.667   -8.256  0.40 25.92  ? 100  MET A CG    1 
ATOM   820  C  CG    B MET A 1 103 ? 54.541 4.506   -8.279  0.60 26.02  ? 100  MET A CG    1 
ATOM   821  S  SD    A MET A 1 103 ? 54.128 2.980   -7.712  0.40 26.14  ? 100  MET A SD    1 
ATOM   822  S  SD    B MET A 1 103 ? 55.234 3.109   -7.395  0.60 23.44  ? 100  MET A SD    1 
ATOM   823  C  CE    A MET A 1 103 ? 53.478 3.287   -6.070  0.40 24.65  ? 100  MET A CE    1 
ATOM   824  C  CE    B MET A 1 103 ? 54.230 3.085   -5.899  0.60 23.87  ? 100  MET A CE    1 
ATOM   825  N  N     . GLU A 1 104 ? 57.681 6.608   -10.918 1.00 20.10  ? 101  GLU A N     1 
ATOM   826  C  CA    . GLU A 1 104 ? 58.393 6.878   -12.166 1.00 25.79  ? 101  GLU A CA    1 
ATOM   827  C  C     . GLU A 1 104 ? 59.911 6.701   -12.002 1.00 28.15  ? 101  GLU A C     1 
ATOM   828  O  O     . GLU A 1 104 ? 60.577 6.211   -12.917 1.00 25.11  ? 101  GLU A O     1 
ATOM   829  C  CB    . GLU A 1 104 ? 58.052 8.287   -12.680 1.00 29.32  ? 101  GLU A CB    1 
ATOM   830  C  CG    . GLU A 1 104 ? 56.655 8.347   -13.258 1.00 28.34  ? 101  GLU A CG    1 
ATOM   831  C  CD    . GLU A 1 104 ? 56.285 9.714   -13.806 1.00 50.10  ? 101  GLU A CD    1 
ATOM   832  O  OE1   . GLU A 1 104 ? 57.127 10.639  -13.751 1.00 53.24  ? 101  GLU A OE1   1 
ATOM   833  O  OE2   . GLU A 1 104 ? 55.146 9.856   -14.304 1.00 45.57  ? 101  GLU A OE2   1 
ATOM   834  N  N     . ILE A 1 105 ? 60.447 7.058   -10.836 1.00 21.04  ? 102  ILE A N     1 
ATOM   835  C  CA    . ILE A 1 105 ? 61.864 6.794   -10.532 1.00 19.36  ? 102  ILE A CA    1 
ATOM   836  C  C     . ILE A 1 105 ? 62.165 5.292   -10.478 1.00 20.63  ? 102  ILE A C     1 
ATOM   837  O  O     . ILE A 1 105 ? 63.134 4.810   -11.097 1.00 23.59  ? 102  ILE A O     1 
ATOM   838  C  CB    . ILE A 1 105 ? 62.278 7.449   -9.201  1.00 19.60  ? 102  ILE A CB    1 
ATOM   839  C  CG1   . ILE A 1 105 ? 62.190 8.966   -9.306  1.00 25.82  ? 102  ILE A CG1   1 
ATOM   840  C  CG2   . ILE A 1 105 ? 63.698 7.045   -8.784  1.00 23.35  ? 102  ILE A CG2   1 
ATOM   841  C  CD1   . ILE A 1 105 ? 62.229 9.628   -7.977  1.00 25.78  ? 102  ILE A CD1   1 
ATOM   842  N  N     . MET A 1 106 ? 61.332 4.537   -9.772  1.00 22.52  ? 103  MET A N     1 
ATOM   843  C  CA    . MET A 1 106 ? 61.577 3.098   -9.696  1.00 20.52  ? 103  MET A CA    1 
ATOM   844  C  C     . MET A 1 106 ? 61.573 2.452   -11.075 1.00 23.75  ? 103  MET A C     1 
ATOM   845  O  O     . MET A 1 106 ? 62.366 1.550   -11.349 1.00 22.55  ? 103  MET A O     1 
ATOM   846  C  CB    . MET A 1 106 ? 60.538 2.423   -8.790  1.00 24.71  ? 103  MET A CB    1 
ATOM   847  C  CG    A MET A 1 106 ? 60.854 2.678   -7.324  0.47 23.78  ? 103  MET A CG    1 
ATOM   848  C  CG    B MET A 1 106 ? 60.536 2.883   -7.349  0.53 23.65  ? 103  MET A CG    1 
ATOM   849  S  SD    A MET A 1 106 ? 59.755 1.836   -6.184  0.47 23.71  ? 103  MET A SD    1 
ATOM   850  S  SD    B MET A 1 106 ? 59.256 2.007   -6.407  0.53 24.68  ? 103  MET A SD    1 
ATOM   851  C  CE    A MET A 1 106 ? 58.213 2.650   -6.582  0.47 23.44  ? 103  MET A CE    1 
ATOM   852  C  CE    B MET A 1 106 ? 59.786 0.301   -6.573  0.53 23.15  ? 103  MET A CE    1 
ATOM   853  N  N     . SER A 1 107 ? 60.689 2.925   -11.942 1.00 21.45  ? 104  SER A N     1 
ATOM   854  C  CA    . SER A 1 107 ? 60.531 2.364   -13.273 1.00 26.98  ? 104  SER A CA    1 
ATOM   855  C  C     . SER A 1 107 ? 61.766 2.529   -14.151 1.00 24.50  ? 104  SER A C     1 
ATOM   856  O  O     . SER A 1 107 ? 61.855 1.880   -15.186 1.00 27.57  ? 104  SER A O     1 
ATOM   857  C  CB    . SER A 1 107 ? 59.319 2.988   -13.970 1.00 27.59  ? 104  SER A CB    1 
ATOM   858  O  OG    . SER A 1 107 ? 58.132 2.601   -13.309 1.00 35.28  ? 104  SER A OG    1 
ATOM   859  N  N     . ARG A 1 108 ? 62.702 3.395   -13.755 1.00 24.14  ? 105  ARG A N     1 
ATOM   860  C  CA    . ARG A 1 108 ? 63.959 3.558   -14.509 1.00 25.52  ? 105  ARG A CA    1 
ATOM   861  C  C     . ARG A 1 108 ? 64.878 2.363   -14.303 1.00 31.84  ? 105  ARG A C     1 
ATOM   862  O  O     . ARG A 1 108 ? 65.756 2.093   -15.123 1.00 28.81  ? 105  ARG A O     1 
ATOM   863  C  CB    . ARG A 1 108 ? 64.715 4.829   -14.108 1.00 29.33  ? 105  ARG A CB    1 
ATOM   864  C  CG    . ARG A 1 108 ? 63.982 6.139   -14.351 1.00 28.37  ? 105  ARG A CG    1 
ATOM   865  C  CD    . ARG A 1 108 ? 64.940 7.331   -14.498 1.00 36.75  ? 105  ARG A CD    1 
ATOM   866  N  NE    . ARG A 1 108 ? 65.890 7.453   -13.395 1.00 38.09  ? 105  ARG A NE    1 
ATOM   867  C  CZ    . ARG A 1 108 ? 65.790 8.325   -12.394 1.00 30.22  ? 105  ARG A CZ    1 
ATOM   868  N  NH1   . ARG A 1 108 ? 66.717 8.346   -11.442 1.00 34.52  ? 105  ARG A NH1   1 
ATOM   869  N  NH2   . ARG A 1 108 ? 64.779 9.180   -12.342 1.00 31.91  ? 105  ARG A NH2   1 
ATOM   870  N  N     . PHE A 1 109 ? 64.685 1.667   -13.188 1.00 31.90  ? 106  PHE A N     1 
ATOM   871  C  CA    . PHE A 1 109 ? 65.546 0.546   -12.826 1.00 34.50  ? 106  PHE A CA    1 
ATOM   872  C  C     . PHE A 1 109 ? 64.979 -0.781  -13.336 1.00 33.50  ? 106  PHE A C     1 
ATOM   873  O  O     . PHE A 1 109 ? 65.729 -1.653  -13.794 1.00 35.14  ? 106  PHE A O     1 
ATOM   874  C  CB    . PHE A 1 109 ? 65.749 0.510   -11.302 1.00 26.69  ? 106  PHE A CB    1 
ATOM   875  C  CG    . PHE A 1 109 ? 66.543 1.682   -10.765 1.00 33.48  ? 106  PHE A CG    1 
ATOM   876  C  CD1   . PHE A 1 109 ? 65.924 2.897   -10.475 1.00 24.66  ? 106  PHE A CD1   1 
ATOM   877  C  CD2   . PHE A 1 109 ? 67.904 1.565   -10.549 1.00 29.46  ? 106  PHE A CD2   1 
ATOM   878  C  CE1   . PHE A 1 109 ? 66.648 3.971   -9.982  1.00 28.42  ? 106  PHE A CE1   1 
ATOM   879  C  CE2   . PHE A 1 109 ? 68.642 2.628   -10.054 1.00 29.24  ? 106  PHE A CE2   1 
ATOM   880  C  CZ    . PHE A 1 109 ? 68.022 3.845   -9.771  1.00 25.72  ? 106  PHE A CZ    1 
ATOM   881  N  N     . ALA A 1 110 ? 63.659 -0.922  -13.281 1.00 30.88  ? 107  ALA A N     1 
ATOM   882  C  CA    . ALA A 1 110 ? 63.007 -2.155  -13.693 1.00 32.25  ? 107  ALA A CA    1 
ATOM   883  C  C     . ALA A 1 110 ? 61.500 -2.015  -13.813 1.00 37.41  ? 107  ALA A C     1 
ATOM   884  O  O     . ALA A 1 110 ? 60.908 -1.031  -13.367 1.00 37.40  ? 107  ALA A O     1 
ATOM   885  C  CB    . ALA A 1 110 ? 63.337 -3.287  -12.702 1.00 32.34  ? 107  ALA A CB    1 
ATOM   886  N  N     . VAL A 1 111 ? 60.901 -3.020  -14.434 1.00 35.80  ? 108  VAL A N     1 
ATOM   887  C  CA    . VAL A 1 111 ? 59.464 -3.252  -14.410 1.00 41.75  ? 108  VAL A CA    1 
ATOM   888  C  C     . VAL A 1 111 ? 58.932 -3.271  -12.974 1.00 33.52  ? 108  VAL A C     1 
ATOM   889  O  O     . VAL A 1 111 ? 59.458 -3.998  -12.131 1.00 39.41  ? 108  VAL A O     1 
ATOM   890  C  CB    . VAL A 1 111 ? 59.125 -4.595  -15.086 1.00 45.15  ? 108  VAL A CB    1 
ATOM   891  C  CG1   . VAL A 1 111 ? 57.721 -5.051  -14.719 1.00 41.47  ? 108  VAL A CG1   1 
ATOM   892  C  CG2   . VAL A 1 111 ? 59.305 -4.493  -16.591 1.00 51.97  ? 108  VAL A CG2   1 
ATOM   893  N  N     . ILE A 1 112 ? 57.917 -2.460  -12.682 1.00 34.11  ? 109  ILE A N     1 
ATOM   894  C  CA    . ILE A 1 112 ? 57.340 -2.491  -11.339 1.00 26.91  ? 109  ILE A CA    1 
ATOM   895  C  C     . ILE A 1 112 ? 55.870 -2.865  -11.346 1.00 25.15  ? 109  ILE A C     1 
ATOM   896  O  O     . ILE A 1 112 ? 55.170 -2.689  -12.341 1.00 23.56  ? 109  ILE A O     1 
ATOM   897  C  CB    . ILE A 1 112 ? 57.510 -1.140  -10.602 1.00 28.93  ? 109  ILE A CB    1 
ATOM   898  C  CG1   . ILE A 1 112 ? 56.589 -0.066  -11.194 1.00 33.02  ? 109  ILE A CG1   1 
ATOM   899  C  CG2   . ILE A 1 112 ? 58.985 -0.729  -10.599 1.00 29.42  ? 109  ILE A CG2   1 
ATOM   900  C  CD1   . ILE A 1 112 ? 56.507 1.229   -10.348 1.00 29.64  ? 109  ILE A CD1   1 
ATOM   901  N  N     . GLU A 1 113 ? 55.430 -3.429  -10.226 1.00 18.79  ? 110  GLU A N     1 
ATOM   902  C  CA    . GLU A 1 113 ? 54.024 -3.655  -9.933  1.00 21.48  ? 110  GLU A CA    1 
ATOM   903  C  C     . GLU A 1 113 ? 53.602 -2.723  -8.808  1.00 20.34  ? 110  GLU A C     1 
ATOM   904  O  O     . GLU A 1 113 ? 54.051 -2.874  -7.685  1.00 19.98  ? 110  GLU A O     1 
ATOM   905  C  CB    . GLU A 1 113 ? 53.757 -5.116  -9.513  1.00 20.06  ? 110  GLU A CB    1 
ATOM   906  C  CG    . GLU A 1 113 ? 52.289 -5.393  -9.190  1.00 22.25  ? 110  GLU A CG    1 
ATOM   907  C  CD    . GLU A 1 113 ? 52.010 -6.823  -8.706  1.00 36.19  ? 110  GLU A CD    1 
ATOM   908  O  OE1   . GLU A 1 113 ? 50.940 -7.041  -8.090  1.00 37.17  ? 110  GLU A OE1   1 
ATOM   909  O  OE2   . GLU A 1 113 ? 52.833 -7.733  -8.955  1.00 25.04  ? 110  GLU A OE2   1 
ATOM   910  N  N     . ARG A 1 114 ? 52.735 -1.764  -9.113  1.00 24.01  ? 111  ARG A N     1 
ATOM   911  C  CA    . ARG A 1 114 ? 52.180 -0.890  -8.083  1.00 22.63  ? 111  ARG A CA    1 
ATOM   912  C  C     . ARG A 1 114 ? 51.300 -1.722  -7.161  1.00 26.37  ? 111  ARG A C     1 
ATOM   913  O  O     . ARG A 1 114 ? 50.310 -2.300  -7.603  1.00 31.68  ? 111  ARG A O     1 
ATOM   914  C  CB    . ARG A 1 114 ? 51.373 0.247   -8.723  1.00 23.25  ? 111  ARG A CB    1 
ATOM   915  C  CG    . ARG A 1 114 ? 50.887 1.332   -7.752  1.00 24.36  ? 111  ARG A CG    1 
ATOM   916  C  CD    . ARG A 1 114 ? 49.701 2.067   -8.353  1.00 30.48  ? 111  ARG A CD    1 
ATOM   917  N  NE    . ARG A 1 114 ? 49.427 3.350   -7.712  1.00 29.64  ? 111  ARG A NE    1 
ATOM   918  C  CZ    . ARG A 1 114 ? 48.477 3.545   -6.800  1.00 32.60  ? 111  ARG A CZ    1 
ATOM   919  N  NH1   . ARG A 1 114 ? 47.725 2.528   -6.397  1.00 32.13  ? 111  ARG A NH1   1 
ATOM   920  N  NH2   . ARG A 1 114 ? 48.299 4.754   -6.273  1.00 30.70  ? 111  ARG A NH2   1 
ATOM   921  N  N     . ALA A 1 115 ? 51.656 -1.806  -5.888  1.00 22.49  ? 112  ALA A N     1 
ATOM   922  C  CA    . ALA A 1 115 ? 50.898 -2.644  -4.966  1.00 23.29  ? 112  ALA A CA    1 
ATOM   923  C  C     . ALA A 1 115 ? 50.022 -1.812  -4.036  1.00 24.76  ? 112  ALA A C     1 
ATOM   924  O  O     . ALA A 1 115 ? 49.057 -2.318  -3.466  1.00 23.86  ? 112  ALA A O     1 
ATOM   925  C  CB    . ALA A 1 115 ? 51.838 -3.541  -4.157  1.00 21.97  ? 112  ALA A CB    1 
ATOM   926  N  N     . SER A 1 116 ? 50.363 -0.537  -3.879  1.00 19.84  ? 113  SER A N     1 
ATOM   927  C  CA    . SER A 1 116 ? 49.528 0.405   -3.139  1.00 20.27  ? 113  SER A CA    1 
ATOM   928  C  C     . SER A 1 116 ? 49.978 1.797   -3.516  1.00 19.96  ? 113  SER A C     1 
ATOM   929  O  O     . SER A 1 116 ? 50.871 1.954   -4.340  1.00 20.63  ? 113  SER A O     1 
ATOM   930  C  CB    . SER A 1 116 ? 49.633 0.210   -1.624  1.00 22.30  ? 113  SER A CB    1 
ATOM   931  O  OG    . SER A 1 116 ? 50.849 0.744   -1.109  1.00 26.89  ? 113  SER A OG    1 
ATOM   932  N  N     . ILE A 1 117 ? 49.376 2.805   -2.895  1.00 20.84  ? 114  ILE A N     1 
ATOM   933  C  CA    . ILE A 1 117 ? 49.768 4.169   -3.173  1.00 17.42  ? 114  ILE A CA    1 
ATOM   934  C  C     . ILE A 1 117 ? 51.235 4.390   -2.825  1.00 23.03  ? 114  ILE A C     1 
ATOM   935  O  O     . ILE A 1 117 ? 51.855 5.282   -3.364  1.00 21.70  ? 114  ILE A O     1 
ATOM   936  C  CB    . ILE A 1 117 ? 48.889 5.176   -2.393  1.00 19.70  ? 114  ILE A CB    1 
ATOM   937  C  CG1   . ILE A 1 117 ? 49.034 6.586   -2.957  1.00 22.49  ? 114  ILE A CG1   1 
ATOM   938  C  CG2   . ILE A 1 117 ? 49.198 5.149   -0.905  1.00 24.71  ? 114  ILE A CG2   1 
ATOM   939  C  CD1   . ILE A 1 117 ? 47.857 7.466   -2.574  1.00 20.37  ? 114  ILE A CD1   1 
ATOM   940  N  N     . ASP A 1 118 ? 51.810 3.557   -1.948  1.00 18.50  ? 115  ASP A N     1 
ATOM   941  C  CA    . ASP A 1 118 ? 53.146 3.904   -1.479  1.00 20.39  ? 115  ASP A CA    1 
ATOM   942  C  C     . ASP A 1 118 ? 54.148 2.747   -1.586  1.00 21.75  ? 115  ASP A C     1 
ATOM   943  O  O     . ASP A 1 118 ? 55.212 2.762   -0.957  1.00 20.83  ? 115  ASP A O     1 
ATOM   944  C  CB    . ASP A 1 118 ? 53.086 4.424   -0.031  1.00 20.00  ? 115  ASP A CB    1 
ATOM   945  C  CG    . ASP A 1 118 ? 53.349 3.344   1.015   1.00 22.70  ? 115  ASP A CG    1 
ATOM   946  O  OD1   . ASP A 1 118 ? 52.799 2.207   0.892   1.00 20.81  ? 115  ASP A OD1   1 
ATOM   947  O  OD2   . ASP A 1 118 ? 54.141 3.645   1.941   1.00 23.51  ? 115  ASP A OD2   1 
ATOM   948  N  N     . GLU A 1 119 ? 53.811 1.724   -2.359  1.00 18.35  ? 116  GLU A N     1 
ATOM   949  C  CA    . GLU A 1 119 ? 54.775 0.628   -2.497  1.00 19.26  ? 116  GLU A CA    1 
ATOM   950  C  C     . GLU A 1 119 ? 54.648 -0.090  -3.820  1.00 19.43  ? 116  GLU A C     1 
ATOM   951  O  O     . GLU A 1 119 ? 53.589 -0.089  -4.450  1.00 20.36  ? 116  GLU A O     1 
ATOM   952  C  CB    . GLU A 1 119 ? 54.617 -0.360  -1.349  1.00 26.57  ? 116  GLU A CB    1 
ATOM   953  C  CG    . GLU A 1 119 ? 53.449 -1.283  -1.483  1.00 28.06  ? 116  GLU A CG    1 
ATOM   954  C  CD    . GLU A 1 119 ? 52.955 -1.741  -0.143  1.00 29.27  ? 116  GLU A CD    1 
ATOM   955  O  OE1   . GLU A 1 119 ? 53.316 -2.866  0.267   1.00 34.96  ? 116  GLU A OE1   1 
ATOM   956  O  OE2   . GLU A 1 119 ? 52.245 -0.950  0.513   1.00 29.38  ? 116  GLU A OE2   1 
ATOM   957  N  N     . ALA A 1 120 ? 55.763 -0.663  -4.258  1.00 16.57  ? 117  ALA A N     1 
ATOM   958  C  CA    . ALA A 1 120 ? 55.791 -1.377  -5.513  1.00 18.37  ? 117  ALA A CA    1 
ATOM   959  C  C     . ALA A 1 120 ? 56.763 -2.547  -5.428  1.00 17.52  ? 117  ALA A C     1 
ATOM   960  O  O     . ALA A 1 120 ? 57.807 -2.452  -4.775  1.00 18.82  ? 117  ALA A O     1 
ATOM   961  C  CB    . ALA A 1 120 ? 56.182 -0.448  -6.637  1.00 21.89  ? 117  ALA A CB    1 
ATOM   962  N  N     . TYR A 1 121 ? 56.415 -3.633  -6.098  1.00 20.02  ? 118  TYR A N     1 
ATOM   963  C  CA    . TYR A 1 121 ? 57.341 -4.748  -6.265  1.00 18.04  ? 118  TYR A CA    1 
ATOM   964  C  C     . TYR A 1 121 ? 58.198 -4.533  -7.507  1.00 20.64  ? 118  TYR A C     1 
ATOM   965  O  O     . TYR A 1 121 ? 57.751 -3.925  -8.491  1.00 22.20  ? 118  TYR A O     1 
ATOM   966  C  CB    . TYR A 1 121 ? 56.576 -6.073  -6.377  1.00 17.67  ? 118  TYR A CB    1 
ATOM   967  C  CG    . TYR A 1 121 ? 55.872 -6.434  -5.097  1.00 19.08  ? 118  TYR A CG    1 
ATOM   968  C  CD1   . TYR A 1 121 ? 54.552 -6.061  -4.873  1.00 22.99  ? 118  TYR A CD1   1 
ATOM   969  C  CD2   . TYR A 1 121 ? 56.541 -7.127  -4.094  1.00 17.31  ? 118  TYR A CD2   1 
ATOM   970  C  CE1   . TYR A 1 121 ? 53.904 -6.381  -3.678  1.00 20.78  ? 118  TYR A CE1   1 
ATOM   971  C  CE2   . TYR A 1 121 ? 55.905 -7.450  -2.898  1.00 21.06  ? 118  TYR A CE2   1 
ATOM   972  C  CZ    . TYR A 1 121 ? 54.597 -7.069  -2.697  1.00 21.68  ? 118  TYR A CZ    1 
ATOM   973  O  OH    . TYR A 1 121 ? 53.978 -7.401  -1.520  1.00 24.42  ? 118  TYR A OH    1 
ATOM   974  N  N     . VAL A 1 122 ? 59.416 -5.056  -7.465  1.00 19.47  ? 119  VAL A N     1 
ATOM   975  C  CA    . VAL A 1 122 ? 60.388 -4.913  -8.534  1.00 20.76  ? 119  VAL A CA    1 
ATOM   976  C  C     . VAL A 1 122 ? 60.888 -6.306  -8.869  1.00 20.98  ? 119  VAL A C     1 
ATOM   977  O  O     . VAL A 1 122 ? 61.324 -7.015  -7.960  1.00 22.36  ? 119  VAL A O     1 
ATOM   978  C  CB    . VAL A 1 122 ? 61.609 -4.053  -8.098  1.00 26.24  ? 119  VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 122 ? 62.233 -3.375  -9.292  1.00 38.95  ? 119  VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 122 ? 61.232 -3.050  -7.032  1.00 29.81  ? 119  VAL A CG2   1 
ATOM   981  N  N     . ASP A 1 123 ? 60.842 -6.715  -10.135 1.00 23.51  ? 120  ASP A N     1 
ATOM   982  C  CA    . ASP A 1 123 ? 61.550 -7.934  -10.524 1.00 25.40  ? 120  ASP A CA    1 
ATOM   983  C  C     . ASP A 1 123 ? 62.943 -7.551  -11.042 1.00 31.27  ? 120  ASP A C     1 
ATOM   984  O  O     . ASP A 1 123 ? 63.081 -6.937  -12.097 1.00 27.70  ? 120  ASP A O     1 
ATOM   985  C  CB    . ASP A 1 123 ? 60.769 -8.727  -11.567 1.00 31.88  ? 120  ASP A CB    1 
ATOM   986  C  CG    . ASP A 1 123 ? 61.316 -10.136 -11.760 1.00 37.50  ? 120  ASP A CG    1 
ATOM   987  O  OD1   . ASP A 1 123 ? 62.550 -10.287 -11.908 1.00 29.07  ? 120  ASP A OD1   1 
ATOM   988  O  OD2   . ASP A 1 123 ? 60.516 -11.101 -11.741 1.00 46.25  ? 120  ASP A OD2   1 
ATOM   989  N  N     . LEU A 1 124 ? 63.969 -7.920  -10.284 1.00 23.32  ? 121  LEU A N     1 
ATOM   990  C  CA    . LEU A 1 124 ? 65.335 -7.480  -10.531 1.00 19.65  ? 121  LEU A CA    1 
ATOM   991  C  C     . LEU A 1 124 ? 66.188 -8.553  -11.186 1.00 17.57  ? 121  LEU A C     1 
ATOM   992  O  O     . LEU A 1 124 ? 67.401 -8.370  -11.371 1.00 23.55  ? 121  LEU A O     1 
ATOM   993  C  CB    . LEU A 1 124 ? 66.000 -7.049  -9.217  1.00 22.81  ? 121  LEU A CB    1 
ATOM   994  C  CG    . LEU A 1 124 ? 65.427 -5.814  -8.520  1.00 21.29  ? 121  LEU A CG    1 
ATOM   995  C  CD1   . LEU A 1 124 ? 65.983 -5.692  -7.107  1.00 26.31  ? 121  LEU A CD1   1 
ATOM   996  C  CD2   . LEU A 1 124 ? 65.756 -4.607  -9.357  1.00 29.56  ? 121  LEU A CD2   1 
ATOM   997  N  N     . THR A 1 125 ? 65.558 -9.670  -11.511 1.00 22.27  ? 122  THR A N     1 
ATOM   998  C  CA    . THR A 1 125 ? 66.297 -10.819 -12.026 1.00 23.20  ? 122  THR A CA    1 
ATOM   999  C  C     . THR A 1 125 ? 67.222 -10.434 -13.193 1.00 24.18  ? 122  THR A C     1 
ATOM   1000 O  O     . THR A 1 125 ? 68.407 -10.755 -13.168 1.00 23.38  ? 122  THR A O     1 
ATOM   1001 C  CB    . THR A 1 125 ? 65.352 -11.915 -12.459 1.00 29.06  ? 122  THR A CB    1 
ATOM   1002 O  OG1   . THR A 1 125 ? 64.502 -12.244 -11.356 1.00 22.83  ? 122  THR A OG1   1 
ATOM   1003 C  CG2   . THR A 1 125 ? 66.146 -13.161 -12.858 1.00 27.38  ? 122  THR A CG2   1 
ATOM   1004 N  N     . SER A 1 126 ? 66.684 -9.712  -14.176 1.00 26.21  ? 123  SER A N     1 
ATOM   1005 C  CA    . SER A 1 126 ? 67.461 -9.313  -15.356 1.00 26.49  ? 123  SER A CA    1 
ATOM   1006 C  C     A SER A 1 126 ? 68.525 -8.269  -15.027 0.57 31.48  ? 123  SER A C     1 
ATOM   1007 C  C     B SER A 1 126 ? 68.525 -8.269  -15.027 0.43 31.00  ? 123  SER A C     1 
ATOM   1008 O  O     . SER A 1 126 ? 69.668 -8.377  -15.472 1.00 31.45  ? 123  SER A O     1 
ATOM   1009 C  CB    . SER A 1 126 ? 66.534 -8.779  -16.442 1.00 35.08  ? 123  SER A CB    1 
ATOM   1010 O  OG    A SER A 1 126 ? 65.685 -9.798  -16.925 0.57 35.61  ? 123  SER A OG    1 
ATOM   1011 O  OG    B SER A 1 126 ? 65.767 -7.687  -15.966 0.43 33.59  ? 123  SER A OG    1 
ATOM   1012 N  N     . ALA A 1 127 ? 68.146 -7.254  -14.256 1.00 23.38  ? 124  ALA A N     1 
ATOM   1013 C  CA    . ALA A 1 127 ? 69.087 -6.215  -13.839 1.00 23.38  ? 124  ALA A CA    1 
ATOM   1014 C  C     . ALA A 1 127 ? 70.275 -6.827  -13.100 1.00 27.89  ? 124  ALA A C     1 
ATOM   1015 O  O     . ALA A 1 127 ? 71.409 -6.361  -13.225 1.00 27.82  ? 124  ALA A O     1 
ATOM   1016 C  CB    . ALA A 1 127 ? 68.395 -5.182  -12.958 1.00 25.85  ? 124  ALA A CB    1 
ATOM   1017 N  N     . VAL A 1 128 ? 70.002 -7.871  -12.317 1.00 26.90  ? 125  VAL A N     1 
ATOM   1018 C  CA    . VAL A 1 128 ? 71.044 -8.545  -11.558 1.00 26.16  ? 125  VAL A CA    1 
ATOM   1019 C  C     . VAL A 1 128 ? 72.008 -9.284  -12.478 1.00 26.68  ? 125  VAL A C     1 
ATOM   1020 O  O     . VAL A 1 128 ? 73.221 -9.192  -12.303 1.00 33.30  ? 125  VAL A O     1 
ATOM   1021 C  CB    . VAL A 1 128 ? 70.441 -9.530  -10.525 1.00 25.07  ? 125  VAL A CB    1 
ATOM   1022 C  CG1   . VAL A 1 128 ? 71.462 -10.568 -10.109 1.00 25.80  ? 125  VAL A CG1   1 
ATOM   1023 C  CG2   . VAL A 1 128 ? 69.959 -8.746  -9.304  1.00 22.53  ? 125  VAL A CG2   1 
ATOM   1024 N  N     . GLN A 1 129 ? 71.466 -10.004 -13.455 1.00 27.42  ? 126  GLN A N     1 
ATOM   1025 C  CA    . GLN A 1 129 ? 72.310 -10.693 -14.432 1.00 33.34  ? 126  GLN A CA    1 
ATOM   1026 C  C     . GLN A 1 129 ? 73.251 -9.722  -15.132 1.00 39.11  ? 126  GLN A C     1 
ATOM   1027 O  O     . GLN A 1 129 ? 74.420 -10.031 -15.361 1.00 39.68  ? 126  GLN A O     1 
ATOM   1028 C  CB    . GLN A 1 129 ? 71.455 -11.427 -15.463 1.00 33.55  ? 126  GLN A CB    1 
ATOM   1029 C  CG    . GLN A 1 129 ? 70.742 -12.656 -14.918 1.00 45.13  ? 126  GLN A CG    1 
ATOM   1030 C  CD    . GLN A 1 129 ? 71.667 -13.565 -14.123 1.00 51.37  ? 126  GLN A CD    1 
ATOM   1031 O  OE1   . GLN A 1 129 ? 71.436 -13.823 -12.942 1.00 51.78  ? 126  GLN A OE1   1 
ATOM   1032 N  NE2   . GLN A 1 129 ? 72.728 -14.044 -14.765 1.00 55.48  ? 126  GLN A NE2   1 
ATOM   1033 N  N     . GLU A 1 130 ? 72.750 -8.537  -15.459 1.00 37.70  ? 127  GLU A N     1 
ATOM   1034 C  CA    . GLU A 1 130 ? 73.573 -7.565  -16.159 1.00 41.44  ? 127  GLU A CA    1 
ATOM   1035 C  C     . GLU A 1 130 ? 74.637 -6.997  -15.240 1.00 41.70  ? 127  GLU A C     1 
ATOM   1036 O  O     . GLU A 1 130 ? 75.798 -6.880  -15.633 1.00 44.62  ? 127  GLU A O     1 
ATOM   1037 C  CB    . GLU A 1 130 ? 72.717 -6.435  -16.740 1.00 43.01  ? 127  GLU A CB    1 
ATOM   1038 C  CG    . GLU A 1 130 ? 71.502 -6.906  -17.528 1.00 48.67  ? 127  GLU A CG    1 
ATOM   1039 C  CD    . GLU A 1 130 ? 71.782 -8.088  -18.456 1.00 65.84  ? 127  GLU A CD    1 
ATOM   1040 O  OE1   . GLU A 1 130 ? 72.890 -8.163  -19.040 1.00 68.38  ? 127  GLU A OE1   1 
ATOM   1041 O  OE2   . GLU A 1 130 ? 70.879 -8.946  -18.600 1.00 58.91  ? 127  GLU A OE2   1 
ATOM   1042 N  N     . ARG A 1 131 ? 74.250 -6.651  -14.018 1.00 33.38  ? 128  ARG A N     1 
ATOM   1043 C  CA    . ARG A 1 131 ? 75.199 -6.058  -13.086 1.00 35.44  ? 128  ARG A CA    1 
ATOM   1044 C  C     . ARG A 1 131 ? 76.291 -7.073  -12.754 1.00 39.07  ? 128  ARG A C     1 
ATOM   1045 O  O     . ARG A 1 131 ? 77.441 -6.695  -12.568 1.00 43.01  ? 128  ARG A O     1 
ATOM   1046 C  CB    . ARG A 1 131 ? 74.497 -5.577  -11.810 1.00 34.97  ? 128  ARG A CB    1 
ATOM   1047 C  CG    A ARG A 1 131 ? 75.397 -4.884  -10.800 0.46 37.50  ? 128  ARG A CG    1 
ATOM   1048 C  CG    B ARG A 1 131 ? 75.460 -4.961  -10.806 0.54 37.54  ? 128  ARG A CG    1 
ATOM   1049 C  CD    A ARG A 1 131 ? 75.963 -3.572  -11.337 0.46 35.97  ? 128  ARG A CD    1 
ATOM   1050 C  CD    B ARG A 1 131 ? 76.048 -3.670  -11.362 0.54 36.00  ? 128  ARG A CD    1 
ATOM   1051 N  NE    A ARG A 1 131 ? 76.674 -2.838  -10.297 0.46 38.12  ? 128  ARG A NE    1 
ATOM   1052 N  NE    B ARG A 1 131 ? 74.960 -2.754  -11.659 0.54 35.64  ? 128  ARG A NE    1 
ATOM   1053 C  CZ    A ARG A 1 131 ? 76.100 -1.960  -9.479  0.46 32.03  ? 128  ARG A CZ    1 
ATOM   1054 C  CZ    B ARG A 1 131 ? 74.439 -1.921  -10.768 0.54 33.95  ? 128  ARG A CZ    1 
ATOM   1055 N  NH1   A ARG A 1 131 ? 76.819 -1.336  -8.557  0.46 34.54  ? 128  ARG A NH1   1 
ATOM   1056 N  NH1   B ARG A 1 131 ? 73.427 -1.135  -11.105 0.54 33.08  ? 128  ARG A NH1   1 
ATOM   1057 N  NH2   A ARG A 1 131 ? 74.805 -1.704  -9.592  0.46 36.42  ? 128  ARG A NH2   1 
ATOM   1058 N  NH2   B ARG A 1 131 ? 74.942 -1.869  -9.542  0.54 36.04  ? 128  ARG A NH2   1 
ATOM   1059 N  N     . LEU A 1 132 ? 75.928 -8.353  -12.725 1.00 37.24  ? 129  LEU A N     1 
ATOM   1060 C  CA    . LEU A 1 132 ? 76.873 -9.437  -12.429 1.00 42.84  ? 129  LEU A CA    1 
ATOM   1061 C  C     . LEU A 1 132 ? 77.985 -9.545  -13.474 1.00 52.94  ? 129  LEU A C     1 
ATOM   1062 O  O     . LEU A 1 132 ? 79.123 -9.859  -13.144 1.00 48.46  ? 129  LEU A O     1 
ATOM   1063 C  CB    . LEU A 1 132 ? 76.139 -10.777 -12.324 1.00 41.87  ? 129  LEU A CB    1 
ATOM   1064 C  CG    . LEU A 1 132 ? 75.766 -11.224 -10.908 1.00 34.72  ? 129  LEU A CG    1 
ATOM   1065 C  CD1   . LEU A 1 132 ? 74.886 -12.470 -10.919 1.00 35.62  ? 129  LEU A CD1   1 
ATOM   1066 C  CD2   . LEU A 1 132 ? 77.020 -11.455 -10.067 1.00 36.61  ? 129  LEU A CD2   1 
ATOM   1067 N  N     . GLN A 1 133 ? 77.644 -9.299  -14.733 1.00 48.35  ? 130  GLN A N     1 
ATOM   1068 C  CA    . GLN A 1 133 ? 78.621 -9.377  -15.813 1.00 51.61  ? 130  GLN A CA    1 
ATOM   1069 C  C     . GLN A 1 133 ? 79.457 -8.120  -15.851 1.00 51.87  ? 130  GLN A C     1 
ATOM   1070 O  O     . GLN A 1 133 ? 80.655 -8.156  -16.135 1.00 63.06  ? 130  GLN A O     1 
ATOM   1071 C  CB    . GLN A 1 133 ? 77.921 -9.593  -17.143 1.00 53.29  ? 130  GLN A CB    1 
ATOM   1072 C  CG    . GLN A 1 133 ? 77.116 -10.868 -17.163 1.00 59.73  ? 130  GLN A CG    1 
ATOM   1073 C  CD    . GLN A 1 133 ? 76.438 -11.096 -18.485 1.00 74.38  ? 130  GLN A CD    1 
ATOM   1074 O  OE1   . GLN A 1 133 ? 77.069 -11.021 -19.539 1.00 95.07  ? 130  GLN A OE1   1 
ATOM   1075 N  NE2   . GLN A 1 133 ? 75.142 -11.376 -18.445 1.00 71.06  ? 130  GLN A NE2   1 
ATOM   1076 N  N     . LYS A 1 134 ? 78.871 -7.011  -15.513 1.00 49.38  ? 131  LYS A N     1 
ATOM   1077 C  CA    . LYS A 1 134 ? 79.610 -5.789  -15.455 1.00 58.49  ? 131  LYS A CA    1 
ATOM   1078 C  C     . LYS A 1 134 ? 80.673 -5.978  -14.403 1.00 63.83  ? 131  LYS A C     1 
ATOM   1079 O  O     . LYS A 1 134 ? 81.750 -5.427  -14.482 1.00 65.95  ? 131  LYS A O     1 
ATOM   1080 C  CB    . LYS A 1 134 ? 78.705 -4.638  -15.063 1.00 53.31  ? 131  LYS A CB    1 
ATOM   1081 C  CG    . LYS A 1 134 ? 78.760 -3.449  -15.992 1.00 65.04  ? 131  LYS A CG    1 
ATOM   1082 C  CD    . LYS A 1 134 ? 78.336 -2.155  -15.320 1.00 62.62  ? 131  LYS A CD    1 
ATOM   1083 C  CE    . LYS A 1 134 ? 76.968 -2.232  -14.681 1.00 52.73  ? 131  LYS A CE    1 
ATOM   1084 N  NZ    . LYS A 1 134 ? 76.217 -0.965  -14.785 1.00 54.45  ? 131  LYS A NZ    1 
ATOM   1085 N  N     . LEU A 1 135 ? 80.342 -6.730  -13.373 1.00 56.26  ? 132  LEU A N     1 
ATOM   1086 C  CA    . LEU A 1 135 ? 81.145 -6.806  -12.173 1.00 64.02  ? 132  LEU A CA    1 
ATOM   1087 C  C     . LEU A 1 135 ? 82.547 -7.415  -12.325 1.00 75.17  ? 132  LEU A C     1 
ATOM   1088 O  O     . LEU A 1 135 ? 83.513 -6.872  -11.785 1.00 76.16  ? 132  LEU A O     1 
ATOM   1089 C  CB    . LEU A 1 135 ? 80.368 -7.569  -11.107 1.00 63.33  ? 132  LEU A CB    1 
ATOM   1090 C  CG    . LEU A 1 135 ? 79.819 -6.827  -9.893  1.00 57.56  ? 132  LEU A CG    1 
ATOM   1091 C  CD1   . LEU A 1 135 ? 79.926 -5.351  -10.040 1.00 57.75  ? 132  LEU A CD1   1 
ATOM   1092 C  CD2   . LEU A 1 135 ? 78.396 -7.199  -9.654  1.00 50.19  ? 132  LEU A CD2   1 
ATOM   1093 N  N     . GLN A 1 136 ? 82.630 -8.514  -13.079 1.00 70.65  ? 133  GLN A N     1 
ATOM   1094 C  CA    . GLN A 1 136 ? 83.863 -9.279  -13.303 1.00 75.79  ? 133  GLN A CA    1 
ATOM   1095 C  C     . GLN A 1 136 ? 84.225 -10.359 -12.302 1.00 78.74  ? 133  GLN A C     1 
ATOM   1096 O  O     . GLN A 1 136 ? 85.338 -10.856 -12.328 1.00 82.62  ? 133  GLN A O     1 
ATOM   1097 C  CB    . GLN A 1 136 ? 85.055 -8.352  -13.468 1.00 76.86  ? 133  GLN A CB    1 
ATOM   1098 C  CG    . GLN A 1 136 ? 85.896 -8.064  -12.226 1.00 80.97  ? 133  GLN A CG    1 
ATOM   1099 C  CD    . GLN A 1 136 ? 87.180 -7.330  -12.547 1.00 85.54  ? 133  GLN A CD    1 
ATOM   1100 O  OE1   . GLN A 1 136 ? 87.169 -6.136  -12.766 1.00 89.92  ? 133  GLN A OE1   1 
ATOM   1101 N  NE2   . GLN A 1 136 ? 88.285 -8.045  -12.555 1.00 78.83  ? 133  GLN A NE2   1 
ATOM   1102 N  N     . GLY A 1 137 ? 83.330 -10.681 -11.401 1.00 73.08  ? 134  GLY A N     1 
ATOM   1103 C  CA    . GLY A 1 137 ? 83.685 -11.561 -10.313 1.00 66.53  ? 134  GLY A CA    1 
ATOM   1104 C  C     . GLY A 1 137 ? 84.556 -10.882 -9.288  1.00 68.84  ? 134  GLY A C     1 
ATOM   1105 O  O     . GLY A 1 137 ? 85.241 -11.536 -8.566  1.00 65.87  ? 134  GLY A O     1 
ATOM   1106 N  N     . GLN A 1 138 ? 84.557 -9.570  -9.226  1.00 63.95  ? 135  GLN A N     1 
ATOM   1107 C  CA    . GLN A 1 138 ? 85.042 -8.910  -7.992  1.00 70.91  ? 135  GLN A CA    1 
ATOM   1108 C  C     . GLN A 1 138 ? 84.040 -9.145  -6.873  1.00 64.45  ? 135  GLN A C     1 
ATOM   1109 O  O     . GLN A 1 138 ? 82.819 -9.279  -7.087  1.00 60.89  ? 135  GLN A O     1 
ATOM   1110 C  CB    . GLN A 1 138 ? 85.270 -7.364  -8.102  1.00 71.58  ? 135  GLN A CB    1 
ATOM   1111 C  CG    . GLN A 1 138 ? 85.794 -6.795  -9.334  1.00 80.23  ? 135  GLN A CG    1 
ATOM   1112 C  CD    . GLN A 1 138 ? 85.754 -5.293  -9.434  1.00 87.04  ? 135  GLN A CD    1 
ATOM   1113 O  OE1   . GLN A 1 138 ? 85.259 -4.590  -8.555  1.00 77.21  ? 135  GLN A OE1   1 
ATOM   1114 N  NE2   . GLN A 1 138 ? 86.092 -4.825  -10.604 1.00 92.06  ? 135  GLN A NE2   1 
ATOM   1115 N  N     . PRO A 1 139 ? 84.570 -9.185  -5.656  1.00 64.24  ? 136  PRO A N     1 
ATOM   1116 C  CA    . PRO A 1 139 ? 83.840 -9.108  -4.395  1.00 58.56  ? 136  PRO A CA    1 
ATOM   1117 C  C     . PRO A 1 139 ? 82.892 -7.914  -4.391  1.00 53.35  ? 136  PRO A C     1 
ATOM   1118 O  O     . PRO A 1 139 ? 83.126 -6.896  -5.053  1.00 48.57  ? 136  PRO A O     1 
ATOM   1119 C  CB    . PRO A 1 139 ? 84.951 -8.944  -3.357  1.00 57.10  ? 136  PRO A CB    1 
ATOM   1120 C  CG    . PRO A 1 139 ? 86.182 -8.535  -4.137  1.00 61.89  ? 136  PRO A CG    1 
ATOM   1121 C  CD    . PRO A 1 139 ? 86.022 -9.256  -5.419  1.00 67.69  ? 136  PRO A CD    1 
ATOM   1122 N  N     . ILE A 1 140 ? 81.814 -8.062  -3.646  1.00 47.14  ? 137  ILE A N     1 
ATOM   1123 C  CA    . ILE A 1 140 ? 80.951 -6.942  -3.347  1.00 32.09  ? 137  ILE A CA    1 
ATOM   1124 C  C     . ILE A 1 140 ? 81.403 -6.352  -2.028  1.00 36.12  ? 137  ILE A C     1 
ATOM   1125 O  O     . ILE A 1 140 ? 81.457 -7.041  -1.010  1.00 36.29  ? 137  ILE A O     1 
ATOM   1126 C  CB    . ILE A 1 140 ? 79.478 -7.367  -3.283  1.00 41.07  ? 137  ILE A CB    1 
ATOM   1127 C  CG1   . ILE A 1 140 ? 79.077 -7.990  -4.623  1.00 43.35  ? 137  ILE A CG1   1 
ATOM   1128 C  CG2   . ILE A 1 140 ? 78.580 -6.175  -2.920  1.00 29.62  ? 137  ILE A CG2   1 
ATOM   1129 C  CD1   . ILE A 1 140 ? 77.619 -8.244  -4.759  1.00 38.64  ? 137  ILE A CD1   1 
ATOM   1130 N  N     . SER A 1 141 ? 81.742 -5.074  -2.059  1.00 30.05  ? 138  SER A N     1 
ATOM   1131 C  CA    . SER A 1 141 ? 82.218 -4.363  -0.880  1.00 33.58  ? 138  SER A CA    1 
ATOM   1132 C  C     . SER A 1 141 ? 81.055 -3.974  0.030   1.00 36.03  ? 138  SER A C     1 
ATOM   1133 O  O     . SER A 1 141 ? 79.965 -3.647  -0.455  1.00 34.04  ? 138  SER A O     1 
ATOM   1134 C  CB    . SER A 1 141 ? 83.010 -3.121  -1.318  1.00 36.04  ? 138  SER A CB    1 
ATOM   1135 O  OG    . SER A 1 141 ? 83.084 -2.147  -0.293  1.00 46.34  ? 138  SER A OG    1 
ATOM   1136 N  N     . ALA A 1 142 ? 81.282 -4.016  1.343   1.00 30.90  ? 139  ALA A N     1 
ATOM   1137 C  CA    . ALA A 1 142 ? 80.290 -3.551  2.310   1.00 30.34  ? 139  ALA A CA    1 
ATOM   1138 C  C     . ALA A 1 142 ? 79.817 -2.131  1.980   1.00 35.48  ? 139  ALA A C     1 
ATOM   1139 O  O     . ALA A 1 142 ? 78.671 -1.763  2.245   1.00 30.49  ? 139  ALA A O     1 
ATOM   1140 C  CB    . ALA A 1 142 ? 80.851 -3.604  3.708   1.00 31.68  ? 139  ALA A CB    1 
ATOM   1141 N  N     . ASP A 1 143 ? 80.710 -1.348  1.383   1.00 30.95  ? 140  ASP A N     1 
ATOM   1142 C  CA    . ASP A 1 143 ? 80.428 0.037   1.020   1.00 34.11  ? 140  ASP A CA    1 
ATOM   1143 C  C     . ASP A 1 143 ? 79.296 0.188   0.020   1.00 33.85  ? 140  ASP A C     1 
ATOM   1144 O  O     . ASP A 1 143 ? 78.694 1.260   -0.083  1.00 31.88  ? 140  ASP A O     1 
ATOM   1145 C  CB    . ASP A 1 143 ? 81.688 0.686   0.456   1.00 32.01  ? 140  ASP A CB    1 
ATOM   1146 C  CG    . ASP A 1 143 ? 82.798 0.764   1.477   1.00 50.58  ? 140  ASP A CG    1 
ATOM   1147 O  OD1   . ASP A 1 143 ? 82.490 0.701   2.690   1.00 50.17  ? 140  ASP A OD1   1 
ATOM   1148 O  OD2   . ASP A 1 143 ? 83.973 0.890   1.071   1.00 61.24  ? 140  ASP A OD2   1 
ATOM   1149 N  N     . LEU A 1 144 ? 79.017 -0.871  -0.729  1.00 28.03  ? 141  LEU A N     1 
ATOM   1150 C  CA    . LEU A 1 144 ? 77.917 -0.844  -1.674  1.00 26.78  ? 141  LEU A CA    1 
ATOM   1151 C  C     . LEU A 1 144 ? 76.575 -1.152  -0.995  1.00 29.16  ? 141  LEU A C     1 
ATOM   1152 O  O     . LEU A 1 144 ? 75.529 -1.033  -1.620  1.00 25.44  ? 141  LEU A O     1 
ATOM   1153 C  CB    . LEU A 1 144 ? 78.164 -1.831  -2.804  1.00 32.93  ? 141  LEU A CB    1 
ATOM   1154 C  CG    . LEU A 1 144 ? 79.380 -1.523  -3.682  1.00 35.27  ? 141  LEU A CG    1 
ATOM   1155 C  CD1   . LEU A 1 144 ? 79.472 -2.532  -4.798  1.00 36.87  ? 141  LEU A CD1   1 
ATOM   1156 C  CD2   . LEU A 1 144 ? 79.282 -0.117  -4.236  1.00 35.24  ? 141  LEU A CD2   1 
ATOM   1157 N  N     . LEU A 1 145 ? 76.616 -1.518  0.283   1.00 22.95  ? 142  LEU A N     1 
ATOM   1158 C  CA    . LEU A 1 145 ? 75.403 -1.918  1.010   1.00 21.40  ? 142  LEU A CA    1 
ATOM   1159 C  C     . LEU A 1 145 ? 75.240 -1.184  2.349   1.00 25.21  ? 142  LEU A C     1 
ATOM   1160 O  O     . LEU A 1 145 ? 75.093 -1.808  3.399   1.00 25.42  ? 142  LEU A O     1 
ATOM   1161 C  CB    . LEU A 1 145 ? 75.428 -3.444  1.221   1.00 21.85  ? 142  LEU A CB    1 
ATOM   1162 C  CG    . LEU A 1 145 ? 75.384 -4.285  -0.052  1.00 23.02  ? 142  LEU A CG    1 
ATOM   1163 C  CD1   . LEU A 1 145 ? 75.791 -5.749  0.202   1.00 25.81  ? 142  LEU A CD1   1 
ATOM   1164 C  CD2   . LEU A 1 145 ? 73.984 -4.244  -0.621  1.00 24.73  ? 142  LEU A CD2   1 
ATOM   1165 N  N     . PRO A 1 146 ? 75.231 0.165   2.318   1.00 27.69  ? 143  PRO A N     1 
ATOM   1166 C  CA    . PRO A 1 146 ? 75.353 0.947   3.555   1.00 25.35  ? 143  PRO A CA    1 
ATOM   1167 C  C     . PRO A 1 146 ? 74.117 0.951   4.442   1.00 23.08  ? 143  PRO A C     1 
ATOM   1168 O  O     . PRO A 1 146 ? 74.192 1.382   5.591   1.00 26.78  ? 143  PRO A O     1 
ATOM   1169 C  CB    . PRO A 1 146 ? 75.641 2.366   3.039   1.00 29.08  ? 143  PRO A CB    1 
ATOM   1170 C  CG    . PRO A 1 146 ? 75.002 2.413   1.700   1.00 26.57  ? 143  PRO A CG    1 
ATOM   1171 C  CD    . PRO A 1 146 ? 75.170 1.024   1.125   1.00 24.68  ? 143  PRO A CD    1 
ATOM   1172 N  N     . SER A 1 147 ? 72.981 0.482   3.937   1.00 24.48  ? 144  SER A N     1 
ATOM   1173 C  CA    . SER A 1 147 ? 71.784 0.506   4.770   1.00 19.16  ? 144  SER A CA    1 
ATOM   1174 C  C     . SER A 1 147 ? 71.097 -0.858  4.779   1.00 19.73  ? 144  SER A C     1 
ATOM   1175 O  O     . SER A 1 147 ? 69.927 -0.959  5.154   1.00 21.61  ? 144  SER A O     1 
ATOM   1176 C  CB    . SER A 1 147 ? 70.802 1.584   4.293   1.00 25.08  ? 144  SER A CB    1 
ATOM   1177 O  OG    . SER A 1 147 ? 70.333 1.305   2.989   1.00 29.17  ? 144  SER A OG    1 
ATOM   1178 N  N     . THR A 1 148 ? 71.855 -1.895  4.416   1.00 20.85  ? 145  THR A N     1 
ATOM   1179 C  CA    . THR A 1 148 ? 71.319 -3.263  4.279   1.00 20.21  ? 145  THR A CA    1 
ATOM   1180 C  C     . THR A 1 148 ? 71.514 -4.123  5.526   1.00 19.49  ? 145  THR A C     1 
ATOM   1181 O  O     . THR A 1 148 ? 72.609 -4.166  6.096   1.00 23.37  ? 145  THR A O     1 
ATOM   1182 C  CB    . THR A 1 148 ? 71.980 -3.979  3.079   1.00 17.24  ? 145  THR A CB    1 
ATOM   1183 O  OG1   . THR A 1 148 ? 71.620 -3.302  1.872   1.00 20.14  ? 145  THR A OG1   1 
ATOM   1184 C  CG2   . THR A 1 148 ? 71.523 -5.437  2.993   1.00 17.66  ? 145  THR A CG2   1 
ATOM   1185 N  N     . TYR A 1 149 ? 70.441 -4.793  5.938   1.00 20.61  ? 146  TYR A N     1 
ATOM   1186 C  CA    . TYR A 1 149 ? 70.475 -5.833  6.973   1.00 19.92  ? 146  TYR A CA    1 
ATOM   1187 C  C     . TYR A 1 149 ? 70.404 -7.189  6.311   1.00 23.09  ? 146  TYR A C     1 
ATOM   1188 O  O     . TYR A 1 149 ? 69.658 -7.368  5.356   1.00 19.67  ? 146  TYR A O     1 
ATOM   1189 C  CB    . TYR A 1 149 ? 69.307 -5.699  7.940   1.00 21.75  ? 146  TYR A CB    1 
ATOM   1190 C  CG    . TYR A 1 149 ? 69.497 -4.627  8.962   1.00 21.16  ? 146  TYR A CG    1 
ATOM   1191 C  CD1   . TYR A 1 149 ? 69.868 -4.953  10.257  1.00 24.57  ? 146  TYR A CD1   1 
ATOM   1192 C  CD2   . TYR A 1 149 ? 69.310 -3.281  8.640   1.00 25.24  ? 146  TYR A CD2   1 
ATOM   1193 C  CE1   . TYR A 1 149 ? 70.054 -3.976  11.209  1.00 28.63  ? 146  TYR A CE1   1 
ATOM   1194 C  CE2   . TYR A 1 149 ? 69.496 -2.298  9.584   1.00 27.06  ? 146  TYR A CE2   1 
ATOM   1195 C  CZ    . TYR A 1 149 ? 69.870 -2.655  10.871  1.00 33.49  ? 146  TYR A CZ    1 
ATOM   1196 O  OH    . TYR A 1 149 ? 70.059 -1.694  11.838  1.00 37.22  ? 146  TYR A OH    1 
ATOM   1197 N  N     . ILE A 1 150 ? 71.155 -8.152  6.836   1.00 18.54  ? 147  ILE A N     1 
ATOM   1198 C  CA    . ILE A 1 150 ? 71.029 -9.530  6.369   1.00 17.75  ? 147  ILE A CA    1 
ATOM   1199 C  C     . ILE A 1 150 ? 70.257 -10.284 7.433   1.00 21.47  ? 147  ILE A C     1 
ATOM   1200 O  O     . ILE A 1 150 ? 70.765 -10.459 8.541   1.00 19.34  ? 147  ILE A O     1 
ATOM   1201 C  CB    . ILE A 1 150 ? 72.407 -10.198 6.138   1.00 19.05  ? 147  ILE A CB    1 
ATOM   1202 C  CG1   . ILE A 1 150 ? 73.310 -9.334  5.247   1.00 19.10  ? 147  ILE A CG1   1 
ATOM   1203 C  CG2   . ILE A 1 150 ? 72.240 -11.626 5.550   1.00 22.38  ? 147  ILE A CG2   1 
ATOM   1204 C  CD1   . ILE A 1 150 ? 72.713 -9.073  3.866   1.00 19.31  ? 147  ILE A CD1   1 
ATOM   1205 N  N     . GLU A 1 151 ? 69.026 -10.700 7.133   1.00 18.02  ? 148  GLU A N     1 
ATOM   1206 C  CA    . GLU A 1 151 ? 68.190 -11.303 8.168   1.00 17.62  ? 148  GLU A CA    1 
ATOM   1207 C  C     . GLU A 1 151 ? 68.845 -12.603 8.659   1.00 23.52  ? 148  GLU A C     1 
ATOM   1208 O  O     . GLU A 1 151 ? 69.304 -13.398 7.849   1.00 20.38  ? 148  GLU A O     1 
ATOM   1209 C  CB    . GLU A 1 151 ? 66.768 -11.589 7.652   1.00 18.51  ? 148  GLU A CB    1 
ATOM   1210 C  CG    . GLU A 1 151 ? 65.912 -12.441 8.634   1.00 20.90  ? 148  GLU A CG    1 
ATOM   1211 C  CD    . GLU A 1 151 ? 65.661 -11.768 9.978   1.00 31.39  ? 148  GLU A CD    1 
ATOM   1212 O  OE1   . GLU A 1 151 ? 65.336 -12.482 10.957  1.00 31.79  ? 148  GLU A OE1   1 
ATOM   1213 O  OE2   . GLU A 1 151 ? 65.765 -10.531 10.064  1.00 33.34  ? 148  GLU A OE2   1 
ATOM   1214 N  N     . GLY A 1 152 ? 68.925 -12.782 9.980   1.00 19.76  ? 149  GLY A N     1 
ATOM   1215 C  CA    . GLY A 1 152 ? 69.503 -14.002 10.550  1.00 21.33  ? 149  GLY A CA    1 
ATOM   1216 C  C     . GLY A 1 152 ? 70.952 -13.855 10.993  1.00 30.55  ? 149  GLY A C     1 
ATOM   1217 O  O     . GLY A 1 152 ? 71.501 -14.716 11.691  1.00 27.16  ? 149  GLY A O     1 
ATOM   1218 N  N     . LEU A 1 153 ? 71.577 -12.759 10.593  1.00 22.01  ? 150  LEU A N     1 
ATOM   1219 C  CA    . LEU A 1 153 ? 72.985 -12.527 10.903  1.00 24.82  ? 150  LEU A CA    1 
ATOM   1220 C  C     . LEU A 1 153 ? 73.112 -11.220 11.684  1.00 31.34  ? 150  LEU A C     1 
ATOM   1221 O  O     . LEU A 1 153 ? 72.242 -10.359 11.574  1.00 26.98  ? 150  LEU A O     1 
ATOM   1222 C  CB    . LEU A 1 153 ? 73.820 -12.488 9.620   1.00 20.58  ? 150  LEU A CB    1 
ATOM   1223 C  CG    . LEU A 1 153 ? 73.883 -13.775 8.786   1.00 25.15  ? 150  LEU A CG    1 
ATOM   1224 C  CD1   . LEU A 1 153 ? 74.720 -13.607 7.546   1.00 21.61  ? 150  LEU A CD1   1 
ATOM   1225 C  CD2   . LEU A 1 153 ? 74.396 -14.954 9.624   1.00 24.92  ? 150  LEU A CD2   1 
ATOM   1226 N  N     . PRO A 1 154 ? 74.164 -11.081 12.519  1.00 25.75  ? 151  PRO A N     1 
ATOM   1227 C  CA    . PRO A 1 154 ? 75.203 -12.084 12.806  1.00 24.94  ? 151  PRO A CA    1 
ATOM   1228 C  C     . PRO A 1 154 ? 74.714 -13.229 13.672  1.00 28.45  ? 151  PRO A C     1 
ATOM   1229 O  O     . PRO A 1 154 ? 73.734 -13.109 14.404  1.00 31.46  ? 151  PRO A O     1 
ATOM   1230 C  CB    . PRO A 1 154 ? 76.269 -11.283 13.556  1.00 23.89  ? 151  PRO A CB    1 
ATOM   1231 C  CG    . PRO A 1 154 ? 75.488 -10.177 14.227  1.00 33.38  ? 151  PRO A CG    1 
ATOM   1232 C  CD    . PRO A 1 154 ? 74.415 -9.811  13.223  1.00 26.94  ? 151  PRO A CD    1 
ATOM   1233 N  N     . GLN A 1 155 ? 75.416 -14.348 13.591  1.00 31.49  ? 152  GLN A N     1 
ATOM   1234 C  CA    . GLN A 1 155 ? 75.098 -15.494 14.422  1.00 36.23  ? 152  GLN A CA    1 
ATOM   1235 C  C     . GLN A 1 155 ? 76.383 -16.194 14.822  1.00 39.32  ? 152  GLN A C     1 
ATOM   1236 O  O     . GLN A 1 155 ? 77.447 -15.895 14.286  1.00 40.59  ? 152  GLN A O     1 
ATOM   1237 C  CB    . GLN A 1 155 ? 74.199 -16.475 13.680  1.00 40.55  ? 152  GLN A CB    1 
ATOM   1238 C  CG    . GLN A 1 155 ? 74.966 -17.182 12.596  1.00 44.08  ? 152  GLN A CG    1 
ATOM   1239 C  CD    . GLN A 1 155 ? 74.407 -18.536 12.272  1.00 50.79  ? 152  GLN A CD    1 
ATOM   1240 O  OE1   . GLN A 1 155 ? 73.194 -18.755 12.327  1.00 47.49  ? 152  GLN A OE1   1 
ATOM   1241 N  NE2   . GLN A 1 155 ? 75.299 -19.473 11.946  1.00 42.89  ? 152  GLN A NE2   1 
ATOM   1242 N  N     . GLY A 1 156 ? 76.271 -17.129 15.760  1.00 41.97  ? 153  GLY A N     1 
ATOM   1243 C  CA    . GLY A 1 156 ? 77.385 -17.992 16.116  1.00 52.04  ? 153  GLY A CA    1 
ATOM   1244 C  C     . GLY A 1 156 ? 78.443 -17.328 16.976  1.00 51.30  ? 153  GLY A C     1 
ATOM   1245 O  O     . GLY A 1 156 ? 78.256 -16.207 17.443  1.00 51.37  ? 153  GLY A O     1 
ATOM   1246 N  N     . PRO A 1 157 ? 79.567 -18.033 17.191  1.00 56.28  ? 154  PRO A N     1 
ATOM   1247 C  CA    . PRO A 1 157 ? 80.708 -17.609 18.014  1.00 51.24  ? 154  PRO A CA    1 
ATOM   1248 C  C     . PRO A 1 157 ? 81.509 -16.452 17.414  1.00 45.27  ? 154  PRO A C     1 
ATOM   1249 O  O     . PRO A 1 157 ? 81.891 -16.507 16.247  1.00 57.48  ? 154  PRO A O     1 
ATOM   1250 C  CB    . PRO A 1 157 ? 81.571 -18.876 18.095  1.00 44.67  ? 154  PRO A CB    1 
ATOM   1251 C  CG    . PRO A 1 157 ? 81.183 -19.682 16.896  1.00 41.45  ? 154  PRO A CG    1 
ATOM   1252 C  CD    . PRO A 1 157 ? 79.725 -19.412 16.693  1.00 58.48  ? 154  PRO A CD    1 
ATOM   1253 N  N     . THR A 1 163 ? 79.628 -6.260  20.570  1.00 69.03  ? 160  THR A N     1 
ATOM   1254 C  CA    . THR A 1 163 ? 79.179 -4.876  20.487  1.00 72.84  ? 160  THR A CA    1 
ATOM   1255 C  C     . THR A 1 163 ? 77.659 -4.781  20.668  1.00 65.08  ? 160  THR A C     1 
ATOM   1256 O  O     . THR A 1 163 ? 76.929 -5.728  20.376  1.00 68.52  ? 160  THR A O     1 
ATOM   1257 C  CB    . THR A 1 163 ? 79.600 -4.229  19.152  1.00 71.37  ? 160  THR A CB    1 
ATOM   1258 O  OG1   . THR A 1 163 ? 79.661 -2.810  19.312  1.00 76.44  ? 160  THR A OG1   1 
ATOM   1259 C  CG2   . THR A 1 163 ? 78.628 -4.577  18.027  1.00 63.28  ? 160  THR A CG2   1 
ATOM   1260 N  N     . VAL A 1 164 ? 77.184 -3.641  21.161  1.00 60.24  ? 161  VAL A N     1 
ATOM   1261 C  CA    . VAL A 1 164 ? 75.796 -3.523  21.602  1.00 62.93  ? 161  VAL A CA    1 
ATOM   1262 C  C     . VAL A 1 164 ? 75.053 -2.394  20.875  1.00 59.81  ? 161  VAL A C     1 
ATOM   1263 O  O     . VAL A 1 164 ? 73.969 -1.974  21.283  1.00 59.37  ? 161  VAL A O     1 
ATOM   1264 C  CB    . VAL A 1 164 ? 75.730 -3.285  23.119  1.00 61.54  ? 161  VAL A CB    1 
ATOM   1265 C  CG1   . VAL A 1 164 ? 76.319 -4.477  23.862  1.00 53.59  ? 161  VAL A CG1   1 
ATOM   1266 C  CG2   . VAL A 1 164 ? 76.474 -2.006  23.482  1.00 53.98  ? 161  VAL A CG2   1 
ATOM   1267 N  N     . GLN A 1 165 ? 75.663 -1.932  19.792  1.00 44.35  ? 162  GLN A N     1 
ATOM   1268 C  CA    . GLN A 1 165 ? 75.137 -0.861  18.954  1.00 56.44  ? 162  GLN A CA    1 
ATOM   1269 C  C     . GLN A 1 165 ? 74.311 -1.449  17.821  1.00 46.39  ? 162  GLN A C     1 
ATOM   1270 O  O     . GLN A 1 165 ? 74.613 -2.537  17.348  1.00 42.98  ? 162  GLN A O     1 
ATOM   1271 C  CB    . GLN A 1 165 ? 76.307 -0.060  18.394  1.00 60.60  ? 162  GLN A CB    1 
ATOM   1272 C  CG    . GLN A 1 165 ? 77.542 -0.941  18.319  1.00 66.21  ? 162  GLN A CG    1 
ATOM   1273 C  CD    . GLN A 1 165 ? 78.844 -0.195  18.103  1.00 78.43  ? 162  GLN A CD    1 
ATOM   1274 O  OE1   . GLN A 1 165 ? 79.901 -0.600  18.587  1.00 84.94  ? 162  GLN A OE1   1 
ATOM   1275 N  NE2   . GLN A 1 165 ? 78.773 0.902   17.354  1.00 75.80  ? 162  GLN A NE2   1 
ATOM   1276 N  N     . LYS A 1 166 ? 73.287 -0.730  17.383  1.00 46.99  ? 163  LYS A N     1 
ATOM   1277 C  CA    . LYS A 1 166 ? 72.429 -1.231  16.313  1.00 40.79  ? 163  LYS A CA    1 
ATOM   1278 C  C     . LYS A 1 166 ? 73.159 -1.243  14.962  1.00 30.85  ? 163  LYS A C     1 
ATOM   1279 O  O     . LYS A 1 166 ? 73.134 -2.248  14.246  1.00 34.33  ? 163  LYS A O     1 
ATOM   1280 C  CB    . LYS A 1 166 ? 71.138 -0.403  16.254  1.00 45.79  ? 163  LYS A CB    1 
ATOM   1281 C  CG    . LYS A 1 166 ? 70.625 -0.071  14.874  1.00 48.95  ? 163  LYS A CG    1 
ATOM   1282 C  CD    . LYS A 1 166 ? 69.554 1.006   14.955  1.00 55.42  ? 163  LYS A CD    1 
ATOM   1283 C  CE    . LYS A 1 166 ? 69.732 2.039   13.861  1.00 51.64  ? 163  LYS A CE    1 
ATOM   1284 N  NZ    . LYS A 1 166 ? 68.593 3.005   13.817  1.00 65.74  ? 163  LYS A NZ    1 
ATOM   1285 N  N     . GLU A 1 167 ? 73.835 -0.145  14.624  1.00 38.30  ? 164  GLU A N     1 
ATOM   1286 C  CA    . GLU A 1 167 ? 74.597 -0.068  13.371  1.00 37.19  ? 164  GLU A CA    1 
ATOM   1287 C  C     . GLU A 1 167 ? 75.822 -0.987  13.406  1.00 36.52  ? 164  GLU A C     1 
ATOM   1288 O  O     . GLU A 1 167 ? 76.289 -1.468  12.366  1.00 32.14  ? 164  GLU A O     1 
ATOM   1289 C  CB    . GLU A 1 167 ? 75.026 1.383   13.089  1.00 45.16  ? 164  GLU A CB    1 
ATOM   1290 C  CG    . GLU A 1 167 ? 76.021 1.570   11.933  1.00 37.26  ? 164  GLU A CG    1 
ATOM   1291 C  CD    . GLU A 1 167 ? 75.458 1.177   10.558  1.00 40.24  ? 164  GLU A CD    1 
ATOM   1292 O  OE1   . GLU A 1 167 ? 76.268 0.970   9.624   1.00 41.86  ? 164  GLU A OE1   1 
ATOM   1293 O  OE2   . GLU A 1 167 ? 74.219 1.086   10.403  1.00 44.45  ? 164  GLU A OE2   1 
ATOM   1294 N  N     . GLY A 1 168 ? 76.337 -1.226  14.606  1.00 42.31  ? 165  GLY A N     1 
ATOM   1295 C  CA    . GLY A 1 168 ? 77.433 -2.155  14.791  1.00 41.11  ? 165  GLY A CA    1 
ATOM   1296 C  C     . GLY A 1 168 ? 77.003 -3.580  14.486  1.00 31.77  ? 165  GLY A C     1 
ATOM   1297 O  O     . GLY A 1 168 ? 77.719 -4.315  13.801  1.00 35.17  ? 165  GLY A O     1 
ATOM   1298 N  N     . MET A 1 169 ? 75.848 -3.972  15.020  1.00 33.58  ? 166  MET A N     1 
ATOM   1299 C  CA    . MET A 1 169 ? 75.233 -5.265  14.720  1.00 30.44  ? 166  MET A CA    1 
ATOM   1300 C  C     . MET A 1 169 ? 74.975 -5.433  13.225  1.00 31.39  ? 166  MET A C     1 
ATOM   1301 O  O     . MET A 1 169 ? 75.246 -6.496  12.654  1.00 29.38  ? 166  MET A O     1 
ATOM   1302 C  CB    . MET A 1 169 ? 73.916 -5.426  15.483  1.00 42.29  ? 166  MET A CB    1 
ATOM   1303 C  CG    . MET A 1 169 ? 74.070 -5.659  16.982  1.00 58.37  ? 166  MET A CG    1 
ATOM   1304 S  SD    . MET A 1 169 ? 74.650 -7.328  17.347  1.00 76.70  ? 166  MET A SD    1 
ATOM   1305 C  CE    . MET A 1 169 ? 73.323 -8.309  16.632  1.00 49.52  ? 166  MET A CE    1 
ATOM   1306 N  N     . ARG A 1 170 ? 74.452 -4.391  12.585  1.00 28.30  ? 167  ARG A N     1 
ATOM   1307 C  CA    . ARG A 1 170 ? 74.158 -4.488  11.152  1.00 25.51  ? 167  ARG A CA    1 
ATOM   1308 C  C     . ARG A 1 170 ? 75.419 -4.789  10.350  1.00 30.11  ? 167  ARG A C     1 
ATOM   1309 O  O     . ARG A 1 170 ? 75.403 -5.645  9.462   1.00 25.99  ? 167  ARG A O     1 
ATOM   1310 C  CB    . ARG A 1 170 ? 73.494 -3.196  10.628  1.00 27.87  ? 167  ARG A CB    1 
ATOM   1311 C  CG    . ARG A 1 170 ? 73.146 -3.235  9.126   1.00 24.92  ? 167  ARG A CG    1 
ATOM   1312 C  CD    . ARG A 1 170 ? 72.959 -1.822  8.539   1.00 26.19  ? 167  ARG A CD    1 
ATOM   1313 N  NE    . ARG A 1 170 ? 74.236 -1.136  8.297   1.00 29.58  ? 167  ARG A NE    1 
ATOM   1314 C  CZ    . ARG A 1 170 ? 75.007 -1.338  7.226   1.00 25.83  ? 167  ARG A CZ    1 
ATOM   1315 N  NH1   . ARG A 1 170 ? 74.651 -2.214  6.302   1.00 24.82  ? 167  ARG A NH1   1 
ATOM   1316 N  NH2   . ARG A 1 170 ? 76.147 -0.673  7.073   1.00 30.90  ? 167  ARG A NH2   1 
ATOM   1317 N  N     . LYS A 1 171 ? 76.524 -4.099  10.653  1.00 26.24  ? 168  LYS A N     1 
ATOM   1318 C  CA    . LYS A 1 171 ? 77.758 -4.330  9.905   1.00 29.32  ? 168  LYS A CA    1 
ATOM   1319 C  C     . LYS A 1 171 ? 78.341 -5.711  10.205  1.00 28.81  ? 168  LYS A C     1 
ATOM   1320 O  O     . LYS A 1 171 ? 78.881 -6.358  9.307   1.00 29.80  ? 168  LYS A O     1 
ATOM   1321 C  CB    . LYS A 1 171 ? 78.805 -3.255  10.201  1.00 39.78  ? 168  LYS A CB    1 
ATOM   1322 C  CG    . LYS A 1 171 ? 78.560 -1.945  9.472   1.00 43.79  ? 168  LYS A CG    1 
ATOM   1323 C  CD    . LYS A 1 171 ? 79.781 -1.027  9.557   1.00 46.32  ? 168  LYS A CD    1 
ATOM   1324 C  CE    . LYS A 1 171 ? 79.514 0.311   8.883   1.00 53.20  ? 168  LYS A CE    1 
ATOM   1325 N  NZ    . LYS A 1 171 ? 80.773 1.038   8.578   1.00 56.05  ? 168  LYS A NZ    1 
ATOM   1326 N  N     . GLN A 1 172 ? 78.233 -6.154  11.456  1.00 28.73  ? 169  GLN A N     1 
ATOM   1327 C  CA    . GLN A 1 172 ? 78.667 -7.504  11.834  1.00 29.94  ? 169  GLN A CA    1 
ATOM   1328 C  C     . GLN A 1 172 ? 77.996 -8.537  10.949  1.00 26.00  ? 169  GLN A C     1 
ATOM   1329 O  O     . GLN A 1 172 ? 78.646 -9.418  10.389  1.00 24.26  ? 169  GLN A O     1 
ATOM   1330 C  CB    . GLN A 1 172 ? 78.324 -7.821  13.293  1.00 32.59  ? 169  GLN A CB    1 
ATOM   1331 C  CG    . GLN A 1 172 ? 79.174 -7.108  14.325  1.00 46.67  ? 169  GLN A CG    1 
ATOM   1332 C  CD    . GLN A 1 172 ? 78.709 -7.392  15.744  1.00 56.54  ? 169  GLN A CD    1 
ATOM   1333 O  OE1   . GLN A 1 172 ? 77.517 -7.604  15.995  1.00 53.47  ? 169  GLN A OE1   1 
ATOM   1334 N  NE2   . GLN A 1 172 ? 79.652 -7.409  16.679  1.00 60.86  ? 169  GLN A NE2   1 
ATOM   1335 N  N     . GLY A 1 173 ? 76.675 -8.422  10.839  1.00 25.48  ? 170  GLY A N     1 
ATOM   1336 C  CA    . GLY A 1 173 ? 75.917 -9.371  10.046  1.00 22.99  ? 170  GLY A CA    1 
ATOM   1337 C  C     . GLY A 1 173 ? 76.275 -9.290  8.578   1.00 24.70  ? 170  GLY A C     1 
ATOM   1338 O  O     . GLY A 1 173 ? 76.415 -10.301 7.900   1.00 24.02  ? 170  GLY A O     1 
ATOM   1339 N  N     . LEU A 1 174 ? 76.425 -8.068  8.074   1.00 23.66  ? 171  LEU A N     1 
ATOM   1340 C  CA    . LEU A 1 174 ? 76.759 -7.895  6.673   1.00 23.31  ? 171  LEU A CA    1 
ATOM   1341 C  C     . LEU A 1 174 ? 78.151 -8.457  6.369   1.00 28.55  ? 171  LEU A C     1 
ATOM   1342 O  O     . LEU A 1 174 ? 78.388 -9.056  5.319   1.00 27.19  ? 171  LEU A O     1 
ATOM   1343 C  CB    . LEU A 1 174 ? 76.675 -6.408  6.292   1.00 26.01  ? 171  LEU A CB    1 
ATOM   1344 C  CG    . LEU A 1 174 ? 77.054 -6.049  4.857   1.00 24.48  ? 171  LEU A CG    1 
ATOM   1345 C  CD1   . LEU A 1 174 ? 76.120 -6.715  3.869   1.00 24.67  ? 171  LEU A CD1   1 
ATOM   1346 C  CD2   . LEU A 1 174 ? 77.056 -4.524  4.690   1.00 25.13  ? 171  LEU A CD2   1 
ATOM   1347 N  N     . PHE A 1 175 ? 79.082 -8.273  7.296   1.00 26.07  ? 172  PHE A N     1 
ATOM   1348 C  CA    . PHE A 1 175 ? 80.418 -8.802  7.068   1.00 26.29  ? 172  PHE A CA    1 
ATOM   1349 C  C     . PHE A 1 175 ? 80.413 -10.333 7.004   1.00 25.51  ? 172  PHE A C     1 
ATOM   1350 O  O     . PHE A 1 175 ? 81.069 -10.916 6.132   1.00 30.05  ? 172  PHE A O     1 
ATOM   1351 C  CB    . PHE A 1 175 ? 81.376 -8.304  8.145   1.00 24.92  ? 172  PHE A CB    1 
ATOM   1352 C  CG    . PHE A 1 175 ? 81.934 -6.944  7.854   1.00 44.17  ? 172  PHE A CG    1 
ATOM   1353 C  CD1   . PHE A 1 175 ? 82.356 -6.622  6.571   1.00 51.13  ? 172  PHE A CD1   1 
ATOM   1354 C  CD2   . PHE A 1 175 ? 82.017 -5.981  8.844   1.00 50.04  ? 172  PHE A CD2   1 
ATOM   1355 C  CE1   . PHE A 1 175 ? 82.864 -5.369  6.280   1.00 51.88  ? 172  PHE A CE1   1 
ATOM   1356 C  CE2   . PHE A 1 175 ? 82.529 -4.718  8.563   1.00 57.43  ? 172  PHE A CE2   1 
ATOM   1357 C  CZ    . PHE A 1 175 ? 82.952 -4.414  7.277   1.00 60.20  ? 172  PHE A CZ    1 
ATOM   1358 N  N     . GLN A 1 176 ? 79.661 -10.984 7.893   1.00 27.57  ? 173  GLN A N     1 
ATOM   1359 C  CA    . GLN A 1 176 ? 79.572 -12.453 7.869   1.00 24.49  ? 173  GLN A CA    1 
ATOM   1360 C  C     . GLN A 1 176 ? 78.981 -12.934 6.554   1.00 28.77  ? 173  GLN A C     1 
ATOM   1361 O  O     . GLN A 1 176 ? 79.421 -13.936 5.977   1.00 30.61  ? 173  GLN A O     1 
ATOM   1362 C  CB    . GLN A 1 176 ? 78.730 -12.992 9.036   1.00 29.10  ? 173  GLN A CB    1 
ATOM   1363 C  CG    . GLN A 1 176 ? 79.298 -12.692 10.422  1.00 32.66  ? 173  GLN A CG    1 
ATOM   1364 C  CD    . GLN A 1 176 ? 78.548 -13.406 11.534  1.00 34.59  ? 173  GLN A CD    1 
ATOM   1365 O  OE1   . GLN A 1 176 ? 77.484 -13.988 11.318  1.00 35.22  ? 173  GLN A OE1   1 
ATOM   1366 N  NE2   . GLN A 1 176 ? 79.115 -13.377 12.737  1.00 36.40  ? 173  GLN A NE2   1 
ATOM   1367 N  N     . TRP A 1 177 ? 77.963 -12.221 6.086   1.00 23.27  ? 174  TRP A N     1 
ATOM   1368 C  CA    . TRP A 1 177 ? 77.326 -12.561 4.822   1.00 25.29  ? 174  TRP A CA    1 
ATOM   1369 C  C     . TRP A 1 177 ? 78.313 -12.442 3.662   1.00 23.03  ? 174  TRP A C     1 
ATOM   1370 O  O     . TRP A 1 177 ? 78.458 -13.360 2.860   1.00 27.62  ? 174  TRP A O     1 
ATOM   1371 C  CB    . TRP A 1 177 ? 76.111 -11.647 4.594   1.00 20.51  ? 174  TRP A CB    1 
ATOM   1372 C  CG    . TRP A 1 177 ? 75.422 -11.845 3.275   1.00 21.75  ? 174  TRP A CG    1 
ATOM   1373 C  CD1   . TRP A 1 177 ? 75.477 -11.015 2.196   1.00 22.67  ? 174  TRP A CD1   1 
ATOM   1374 C  CD2   . TRP A 1 177 ? 74.532 -12.923 2.908   1.00 19.82  ? 174  TRP A CD2   1 
ATOM   1375 N  NE1   . TRP A 1 177 ? 74.711 -11.518 1.170   1.00 21.42  ? 174  TRP A NE1   1 
ATOM   1376 C  CE2   . TRP A 1 177 ? 74.108 -12.677 1.585   1.00 24.97  ? 174  TRP A CE2   1 
ATOM   1377 C  CE3   . TRP A 1 177 ? 74.056 -14.054 3.570   1.00 23.68  ? 174  TRP A CE3   1 
ATOM   1378 C  CZ2   . TRP A 1 177 ? 73.233 -13.518 0.909   1.00 19.99  ? 174  TRP A CZ2   1 
ATOM   1379 C  CZ3   . TRP A 1 177 ? 73.188 -14.902 2.899   1.00 24.76  ? 174  TRP A CZ3   1 
ATOM   1380 C  CH2   . TRP A 1 177 ? 72.786 -14.634 1.577   1.00 27.53  ? 174  TRP A CH2   1 
ATOM   1381 N  N     . LEU A 1 178 ? 78.990 -11.302 3.582   1.00 22.98  ? 175  LEU A N     1 
ATOM   1382 C  CA    . LEU A 1 178 ? 79.905 -11.035 2.472   1.00 24.24  ? 175  LEU A CA    1 
ATOM   1383 C  C     . LEU A 1 178 ? 81.143 -11.931 2.543   1.00 32.57  ? 175  LEU A C     1 
ATOM   1384 O  O     . LEU A 1 178 ? 81.680 -12.336 1.515   1.00 34.73  ? 175  LEU A O     1 
ATOM   1385 C  CB    . LEU A 1 178 ? 80.328 -9.567  2.447   1.00 25.62  ? 175  LEU A CB    1 
ATOM   1386 C  CG    . LEU A 1 178 ? 79.229 -8.564  2.069   1.00 29.00  ? 175  LEU A CG    1 
ATOM   1387 C  CD1   . LEU A 1 178 ? 79.743 -7.130  2.093   1.00 29.39  ? 175  LEU A CD1   1 
ATOM   1388 C  CD2   . LEU A 1 178 ? 78.615 -8.901  0.698   1.00 25.67  ? 175  LEU A CD2   1 
ATOM   1389 N  N     . ASP A 1 179 ? 81.574 -12.242 3.761   1.00 33.19  ? 176  ASP A N     1 
ATOM   1390 C  CA    . ASP A 1 179 ? 82.684 -13.176 3.966   1.00 37.42  ? 176  ASP A CA    1 
ATOM   1391 C  C     . ASP A 1 179 ? 82.362 -14.536 3.389   1.00 40.02  ? 176  ASP A C     1 
ATOM   1392 O  O     . ASP A 1 179 ? 83.225 -15.183 2.805   1.00 42.66  ? 176  ASP A O     1 
ATOM   1393 C  CB    . ASP A 1 179 ? 83.024 -13.325 5.453   1.00 32.32  ? 176  ASP A CB    1 
ATOM   1394 C  CG    . ASP A 1 179 ? 83.851 -12.179 5.982   1.00 44.41  ? 176  ASP A CG    1 
ATOM   1395 O  OD1   . ASP A 1 179 ? 84.773 -11.726 5.272   1.00 57.21  ? 176  ASP A OD1   1 
ATOM   1396 O  OD2   . ASP A 1 179 ? 83.589 -11.738 7.122   1.00 58.43  ? 176  ASP A OD2   1 
ATOM   1397 N  N     . SER A 1 180 ? 81.115 -14.966 3.545   1.00 34.44  ? 177  SER A N     1 
ATOM   1398 C  CA    . SER A 1 180 ? 80.699 -16.288 3.089   1.00 32.78  ? 177  SER A CA    1 
ATOM   1399 C  C     . SER A 1 180 ? 80.412 -16.360 1.599   1.00 41.26  ? 177  SER A C     1 
ATOM   1400 O  O     . SER A 1 180 ? 80.400 -17.445 1.021   1.00 51.42  ? 177  SER A O     1 
ATOM   1401 C  CB    . SER A 1 180 ? 79.454 -16.739 3.845   1.00 36.15  ? 177  SER A CB    1 
ATOM   1402 O  OG    . SER A 1 180 ? 79.700 -16.772 5.238   1.00 47.86  ? 177  SER A OG    1 
ATOM   1403 N  N     . LEU A 1 181 ? 80.135 -15.222 0.969   1.00 28.25  ? 178  LEU A N     1 
ATOM   1404 C  CA    . LEU A 1 181 ? 79.628 -15.246 -0.407  1.00 30.76  ? 178  LEU A CA    1 
ATOM   1405 C  C     . LEU A 1 181 ? 80.570 -15.913 -1.393  1.00 50.14  ? 178  LEU A C     1 
ATOM   1406 O  O     . LEU A 1 181 ? 81.786 -15.761 -1.296  1.00 49.16  ? 178  LEU A O     1 
ATOM   1407 C  CB    . LEU A 1 181 ? 79.336 -13.827 -0.895  1.00 39.87  ? 178  LEU A CB    1 
ATOM   1408 C  CG    . LEU A 1 181 ? 77.966 -13.251 -0.554  1.00 40.47  ? 178  LEU A CG    1 
ATOM   1409 C  CD1   . LEU A 1 181 ? 77.819 -11.889 -1.213  1.00 33.50  ? 178  LEU A CD1   1 
ATOM   1410 C  CD2   . LEU A 1 181 ? 76.859 -14.194 -1.010  1.00 37.52  ? 178  LEU A CD2   1 
ATOM   1411 N  N     . GLN A 1 182 ? 80.008 -16.649 -2.346  1.00 53.72  ? 179  GLN A N     1 
ATOM   1412 C  CA    . GLN A 1 182 ? 80.826 -17.159 -3.436  1.00 63.95  ? 179  GLN A CA    1 
ATOM   1413 C  C     . GLN A 1 182 ? 80.599 -16.361 -4.712  1.00 64.09  ? 179  GLN A C     1 
ATOM   1414 O  O     . GLN A 1 182 ? 79.819 -16.754 -5.583  1.00 61.67  ? 179  GLN A O     1 
ATOM   1415 C  CB    . GLN A 1 182 ? 80.560 -18.636 -3.694  1.00 62.57  ? 179  GLN A CB    1 
ATOM   1416 C  CG    . GLN A 1 182 ? 81.640 -19.247 -4.564  1.00 67.42  ? 179  GLN A CG    1 
ATOM   1417 C  CD    . GLN A 1 182 ? 83.034 -18.800 -4.139  1.00 75.04  ? 179  GLN A CD    1 
ATOM   1418 O  OE1   . GLN A 1 182 ? 83.606 -17.868 -4.710  1.00 70.28  ? 179  GLN A OE1   1 
ATOM   1419 N  NE2   . GLN A 1 182 ? 83.582 -19.461 -3.126  1.00 70.26  ? 179  GLN A NE2   1 
ATOM   1420 N  N     . ILE A 1 183 ? 81.318 -15.251 -4.820  1.00 59.44  ? 180  ILE A N     1 
ATOM   1421 C  CA    . ILE A 1 183 ? 81.178 -14.325 -5.936  1.00 62.56  ? 180  ILE A CA    1 
ATOM   1422 C  C     . ILE A 1 183 ? 81.681 -14.932 -7.247  1.00 67.79  ? 180  ILE A C     1 
ATOM   1423 O  O     . ILE A 1 183 ? 81.546 -14.337 -8.319  1.00 69.48  ? 180  ILE A O     1 
ATOM   1424 C  CB    . ILE A 1 183 ? 81.920 -13.004 -5.639  1.00 60.30  ? 180  ILE A CB    1 
ATOM   1425 C  CG1   . ILE A 1 183 ? 83.260 -13.274 -4.947  1.00 64.95  ? 180  ILE A CG1   1 
ATOM   1426 C  CG2   . ILE A 1 183 ? 81.085 -12.124 -4.736  1.00 56.24  ? 180  ILE A CG2   1 
ATOM   1427 C  CD1   . ILE A 1 183 ? 84.398 -13.630 -5.880  1.00 64.04  ? 180  ILE A CD1   1 
ATOM   1428 N  N     . ASP A 1 184 ? 82.260 -16.122 -7.140  1.00 68.91  ? 181  ASP A N     1 
ATOM   1429 C  CA    . ASP A 1 184 ? 82.771 -16.862 -8.284  1.00 69.16  ? 181  ASP A CA    1 
ATOM   1430 C  C     . ASP A 1 184 ? 81.644 -17.423 -9.152  1.00 70.32  ? 181  ASP A C     1 
ATOM   1431 O  O     . ASP A 1 184 ? 81.808 -17.609 -10.358 1.00 69.10  ? 181  ASP A O     1 
ATOM   1432 C  CB    . ASP A 1 184 ? 83.671 -18.000 -7.793  1.00 72.72  ? 181  ASP A CB    1 
ATOM   1433 C  CG    . ASP A 1 184 ? 84.306 -18.774 -8.923  1.00 79.58  ? 181  ASP A CG    1 
ATOM   1434 O  OD1   . ASP A 1 184 ? 84.569 -18.168 -9.982  1.00 83.38  ? 181  ASP A OD1   1 
ATOM   1435 O  OD2   . ASP A 1 184 ? 84.544 -19.989 -8.748  1.00 79.60  ? 181  ASP A OD2   1 
ATOM   1436 N  N     . ASN A 1 185 ? 80.499 -17.685 -8.529  1.00 70.14  ? 182  ASN A N     1 
ATOM   1437 C  CA    . ASN A 1 185 ? 79.390 -18.361 -9.195  1.00 63.19  ? 182  ASN A CA    1 
ATOM   1438 C  C     . ASN A 1 185 ? 78.256 -17.405 -9.566  1.00 60.86  ? 182  ASN A C     1 
ATOM   1439 O  O     . ASN A 1 185 ? 77.511 -16.950 -8.701  1.00 59.89  ? 182  ASN A O     1 
ATOM   1440 C  CB    . ASN A 1 185 ? 78.866 -19.484 -8.294  1.00 58.37  ? 182  ASN A CB    1 
ATOM   1441 C  CG    . ASN A 1 185 ? 77.728 -20.263 -8.917  1.00 57.49  ? 182  ASN A CG    1 
ATOM   1442 O  OD1   . ASN A 1 185 ? 77.410 -20.097 -10.096 1.00 61.67  ? 182  ASN A OD1   1 
ATOM   1443 N  ND2   . ASN A 1 185 ? 77.109 -21.134 -8.125  1.00 55.65  ? 182  ASN A ND2   1 
ATOM   1444 N  N     . LEU A 1 186 ? 78.115 -17.132 -10.859 1.00 52.83  ? 183  LEU A N     1 
ATOM   1445 C  CA    . LEU A 1 186 ? 77.129 -16.168 -11.351 1.00 52.46  ? 183  LEU A CA    1 
ATOM   1446 C  C     . LEU A 1 186 ? 75.689 -16.666 -11.231 1.00 52.68  ? 183  LEU A C     1 
ATOM   1447 O  O     . LEU A 1 186 ? 74.745 -15.908 -11.465 1.00 52.41  ? 183  LEU A O     1 
ATOM   1448 C  CB    . LEU A 1 186 ? 77.425 -15.805 -12.812 1.00 51.21  ? 183  LEU A CB    1 
ATOM   1449 C  CG    . LEU A 1 186 ? 78.459 -14.709 -13.089 1.00 56.51  ? 183  LEU A CG    1 
ATOM   1450 C  CD1   . LEU A 1 186 ? 79.863 -15.122 -12.660 1.00 64.65  ? 183  LEU A CD1   1 
ATOM   1451 C  CD2   . LEU A 1 186 ? 78.438 -14.321 -14.561 1.00 53.19  ? 183  LEU A CD2   1 
ATOM   1452 N  N     . THR A 1 187 ? 75.519 -17.937 -10.882 1.00 54.14  ? 184  THR A N     1 
ATOM   1453 C  CA    . THR A 1 187 ? 74.185 -18.512 -10.757 1.00 53.45  ? 184  THR A CA    1 
ATOM   1454 C  C     . THR A 1 187 ? 73.829 -18.813 -9.297  1.00 45.60  ? 184  THR A C     1 
ATOM   1455 O  O     . THR A 1 187 ? 72.793 -19.412 -9.017  1.00 48.95  ? 184  THR A O     1 
ATOM   1456 C  CB    . THR A 1 187 ? 74.046 -19.804 -11.591 1.00 58.90  ? 184  THR A CB    1 
ATOM   1457 O  OG1   . THR A 1 187 ? 74.919 -20.814 -11.069 1.00 65.30  ? 184  THR A OG1   1 
ATOM   1458 C  CG2   . THR A 1 187 ? 74.405 -19.542 -13.054 1.00 56.58  ? 184  THR A CG2   1 
ATOM   1459 N  N     . SER A 1 188 ? 74.691 -18.402 -8.371  1.00 39.05  ? 185  SER A N     1 
ATOM   1460 C  CA    . SER A 1 188 ? 74.413 -18.559 -6.942  1.00 33.03  ? 185  SER A CA    1 
ATOM   1461 C  C     . SER A 1 188 ? 73.265 -17.652 -6.491  1.00 26.21  ? 185  SER A C     1 
ATOM   1462 O  O     . SER A 1 188 ? 73.371 -16.434 -6.610  1.00 25.71  ? 185  SER A O     1 
ATOM   1463 C  CB    . SER A 1 188 ? 75.661 -18.244 -6.121  1.00 39.29  ? 185  SER A CB    1 
ATOM   1464 O  OG    . SER A 1 188 ? 75.344 -18.194 -4.742  1.00 37.92  ? 185  SER A OG    1 
ATOM   1465 N  N     . PRO A 1 189 ? 72.170 -18.239 -5.969  1.00 24.67  ? 186  PRO A N     1 
ATOM   1466 C  CA    . PRO A 1 189 ? 71.039 -17.396 -5.535  1.00 22.99  ? 186  PRO A CA    1 
ATOM   1467 C  C     . PRO A 1 189 ? 71.400 -16.364 -4.468  1.00 24.70  ? 186  PRO A C     1 
ATOM   1468 O  O     . PRO A 1 189 ? 70.858 -15.262 -4.493  1.00 24.23  ? 186  PRO A O     1 
ATOM   1469 C  CB    . PRO A 1 189 ? 70.048 -18.408 -4.962  1.00 26.26  ? 186  PRO A CB    1 
ATOM   1470 C  CG    . PRO A 1 189 ? 70.312 -19.653 -5.728  1.00 30.58  ? 186  PRO A CG    1 
ATOM   1471 C  CD    . PRO A 1 189 ? 71.799 -19.668 -5.973  1.00 31.14  ? 186  PRO A CD    1 
ATOM   1472 N  N     . ASP A 1 190 ? 72.281 -16.709 -3.534  1.00 20.50  ? 187  ASP A N     1 
ATOM   1473 C  CA    . ASP A 1 190 ? 72.668 -15.750 -2.501  1.00 21.96  ? 187  ASP A CA    1 
ATOM   1474 C  C     . ASP A 1 190 ? 73.421 -14.561 -3.113  1.00 20.68  ? 187  ASP A C     1 
ATOM   1475 O  O     . ASP A 1 190 ? 73.215 -13.407 -2.722  1.00 23.57  ? 187  ASP A O     1 
ATOM   1476 C  CB    . ASP A 1 190 ? 73.540 -16.405 -1.428  1.00 23.84  ? 187  ASP A CB    1 
ATOM   1477 C  CG    . ASP A 1 190 ? 72.758 -17.344 -0.515  1.00 28.97  ? 187  ASP A CG    1 
ATOM   1478 O  OD1   . ASP A 1 190 ? 71.514 -17.256 -0.456  1.00 23.83  ? 187  ASP A OD1   1 
ATOM   1479 O  OD2   . ASP A 1 190 ? 73.399 -18.171 0.173   1.00 32.36  ? 187  ASP A OD2   1 
ATOM   1480 N  N     . LEU A 1 191 ? 74.310 -14.859 -4.053  1.00 19.42  ? 188  LEU A N     1 
ATOM   1481 C  CA    . LEU A 1 191 ? 75.024 -13.810 -4.789  1.00 24.67  ? 188  LEU A CA    1 
ATOM   1482 C  C     . LEU A 1 191 ? 74.042 -12.935 -5.557  1.00 22.81  ? 188  LEU A C     1 
ATOM   1483 O  O     . LEU A 1 191 ? 74.160 -11.715 -5.571  1.00 23.30  ? 188  LEU A O     1 
ATOM   1484 C  CB    . LEU A 1 191 ? 76.038 -14.413 -5.767  1.00 24.41  ? 188  LEU A CB    1 
ATOM   1485 C  CG    . LEU A 1 191 ? 76.771 -13.376 -6.623  1.00 26.08  ? 188  LEU A CG    1 
ATOM   1486 C  CD1   . LEU A 1 191 ? 77.447 -12.349 -5.778  1.00 26.41  ? 188  LEU A CD1   1 
ATOM   1487 C  CD2   . LEU A 1 191 ? 77.797 -14.040 -7.549  1.00 29.54  ? 188  LEU A CD2   1 
ATOM   1488 N  N     . GLN A 1 192 ? 73.067 -13.569 -6.189  1.00 19.48  ? 189  GLN A N     1 
ATOM   1489 C  CA    . GLN A 1 192 ? 72.067 -12.834 -6.958  1.00 20.95  ? 189  GLN A CA    1 
ATOM   1490 C  C     . GLN A 1 192 ? 71.261 -11.893 -6.060  1.00 21.81  ? 189  GLN A C     1 
ATOM   1491 O  O     . GLN A 1 192 ? 71.064 -10.735 -6.405  1.00 20.43  ? 189  GLN A O     1 
ATOM   1492 C  CB    . GLN A 1 192 ? 71.158 -13.798 -7.702  1.00 24.39  ? 189  GLN A CB    1 
ATOM   1493 C  CG    . GLN A 1 192 ? 71.906 -14.483 -8.858  1.00 24.17  ? 189  GLN A CG    1 
ATOM   1494 C  CD    . GLN A 1 192 ? 71.116 -15.555 -9.561  1.00 40.43  ? 189  GLN A CD    1 
ATOM   1495 O  OE1   . GLN A 1 192 ? 69.997 -15.882 -9.173  1.00 44.63  ? 189  GLN A OE1   1 
ATOM   1496 N  NE2   . GLN A 1 192 ? 71.693 -16.104 -10.626 1.00 46.29  ? 189  GLN A NE2   1 
ATOM   1497 N  N     . LEU A 1 193 ? 70.816 -12.380 -4.900  1.00 19.87  ? 190  LEU A N     1 
ATOM   1498 C  CA    . LEU A 1 193 ? 70.142 -11.490 -3.938  1.00 21.96  ? 190  LEU A CA    1 
ATOM   1499 C  C     . LEU A 1 193 ? 71.032 -10.316 -3.520  1.00 21.24  ? 190  LEU A C     1 
ATOM   1500 O  O     . LEU A 1 193 ? 70.556 -9.200  -3.336  1.00 21.02  ? 190  LEU A O     1 
ATOM   1501 C  CB    . LEU A 1 193 ? 69.705 -12.248 -2.678  1.00 19.80  ? 190  LEU A CB    1 
ATOM   1502 C  CG    . LEU A 1 193 ? 68.600 -13.290 -2.786  1.00 20.54  ? 190  LEU A CG    1 
ATOM   1503 C  CD1   . LEU A 1 193 ? 68.273 -13.862 -1.402  1.00 23.96  ? 190  LEU A CD1   1 
ATOM   1504 C  CD2   . LEU A 1 193 ? 67.357 -12.686 -3.391  1.00 18.82  ? 190  LEU A CD2   1 
ATOM   1505 N  N     . THR A 1 194 ? 72.318 -10.585 -3.317  1.00 19.95  ? 191  THR A N     1 
ATOM   1506 C  CA    . THR A 1 194 ? 73.233 -9.563  -2.848  1.00 19.74  ? 191  THR A CA    1 
ATOM   1507 C  C     . THR A 1 194 ? 73.372 -8.442  -3.873  1.00 20.38  ? 191  THR A C     1 
ATOM   1508 O  O     . THR A 1 194 ? 73.362 -7.274  -3.510  1.00 21.32  ? 191  THR A O     1 
ATOM   1509 C  CB    . THR A 1 194 ? 74.613 -10.143 -2.559  1.00 21.85  ? 191  THR A CB    1 
ATOM   1510 O  OG1   . THR A 1 194 ? 74.473 -11.206 -1.617  1.00 21.65  ? 191  THR A OG1   1 
ATOM   1511 C  CG2   . THR A 1 194 ? 75.524 -9.065  -1.995  1.00 23.07  ? 191  THR A CG2   1 
ATOM   1512 N  N     . VAL A 1 195 ? 73.511 -8.815  -5.142  1.00 24.59  ? 192  VAL A N     1 
ATOM   1513 C  CA    . VAL A 1 195 ? 73.574 -7.817  -6.208  1.00 20.77  ? 192  VAL A CA    1 
ATOM   1514 C  C     . VAL A 1 195 ? 72.210 -7.118  -6.312  1.00 19.55  ? 192  VAL A C     1 
ATOM   1515 O  O     . VAL A 1 195 ? 72.137 -5.904  -6.541  1.00 20.75  ? 192  VAL A O     1 
ATOM   1516 C  CB    . VAL A 1 195 ? 73.976 -8.465  -7.543  1.00 23.40  ? 192  VAL A CB    1 
ATOM   1517 C  CG1   . VAL A 1 195 ? 73.929 -7.446  -8.678  1.00 25.73  ? 192  VAL A CG1   1 
ATOM   1518 C  CG2   . VAL A 1 195 ? 75.381 -9.057  -7.418  1.00 24.04  ? 192  VAL A CG2   1 
ATOM   1519 N  N     . GLY A 1 196 ? 71.137 -7.874  -6.121  1.00 16.69  ? 193  GLY A N     1 
ATOM   1520 C  CA    . GLY A 1 196 ? 69.803 -7.268  -6.029  1.00 20.07  ? 193  GLY A CA    1 
ATOM   1521 C  C     . GLY A 1 196 ? 69.780 -6.157  -4.986  1.00 22.22  ? 193  GLY A C     1 
ATOM   1522 O  O     . GLY A 1 196 ? 69.284 -5.040  -5.237  1.00 22.34  ? 193  GLY A O     1 
ATOM   1523 N  N     . ALA A 1 197 ? 70.362 -6.428  -3.823  1.00 18.63  ? 194  ALA A N     1 
ATOM   1524 C  CA    . ALA A 1 197 ? 70.387 -5.432  -2.749  1.00 17.27  ? 194  ALA A CA    1 
ATOM   1525 C  C     . ALA A 1 197 ? 71.228 -4.207  -3.118  1.00 20.96  ? 194  ALA A C     1 
ATOM   1526 O  O     . ALA A 1 197 ? 70.901 -3.080  -2.726  1.00 20.85  ? 194  ALA A O     1 
ATOM   1527 C  CB    . ALA A 1 197 ? 70.892 -6.047  -1.447  1.00 19.42  ? 194  ALA A CB    1 
ATOM   1528 N  N     . VAL A 1 198 ? 72.313 -4.427  -3.854  1.00 21.12  ? 195  VAL A N     1 
ATOM   1529 C  CA    . VAL A 1 198 ? 73.137 -3.312  -4.339  1.00 17.78  ? 195  VAL A CA    1 
ATOM   1530 C  C     . VAL A 1 198 ? 72.289 -2.383  -5.218  1.00 20.43  ? 195  VAL A C     1 
ATOM   1531 O  O     . VAL A 1 198 ? 72.289 -1.158  -5.012  1.00 24.49  ? 195  VAL A O     1 
ATOM   1532 C  CB    . VAL A 1 198 ? 74.378 -3.814  -5.126  1.00 24.04  ? 195  VAL A CB    1 
ATOM   1533 C  CG1   . VAL A 1 198 ? 75.090 -2.660  -5.827  1.00 24.80  ? 195  VAL A CG1   1 
ATOM   1534 C  CG2   . VAL A 1 198 ? 75.337 -4.526  -4.186  1.00 24.60  ? 195  VAL A CG2   1 
ATOM   1535 N  N     . ILE A 1 199 ? 71.517 -2.975  -6.122  1.00 22.33  ? 196  ILE A N     1 
ATOM   1536 C  CA    . ILE A 1 199 ? 70.644 -2.206  -7.010  1.00 22.05  ? 196  ILE A CA    1 
ATOM   1537 C  C     . ILE A 1 199 ? 69.559 -1.467  -6.211  1.00 26.84  ? 196  ILE A C     1 
ATOM   1538 O  O     . ILE A 1 199 ? 69.273 -0.300  -6.470  1.00 20.84  ? 196  ILE A O     1 
ATOM   1539 C  CB    . ILE A 1 199 ? 70.016 -3.110  -8.084  1.00 21.78  ? 196  ILE A CB    1 
ATOM   1540 C  CG1   . ILE A 1 199 ? 71.107 -3.612  -9.042  1.00 22.96  ? 196  ILE A CG1   1 
ATOM   1541 C  CG2   . ILE A 1 199 ? 68.906 -2.366  -8.869  1.00 20.47  ? 196  ILE A CG2   1 
ATOM   1542 C  CD1   . ILE A 1 199 ? 70.697 -4.783  -9.924  1.00 23.63  ? 196  ILE A CD1   1 
ATOM   1543 N  N     . VAL A 1 200 ? 68.984 -2.121  -5.207  1.00 21.48  ? 197  VAL A N     1 
ATOM   1544 C  CA    . VAL A 1 200 ? 67.949 -1.472  -4.415  1.00 18.91  ? 197  VAL A CA    1 
ATOM   1545 C  C     . VAL A 1 200 ? 68.506 -0.314  -3.569  1.00 21.52  ? 197  VAL A C     1 
ATOM   1546 O  O     . VAL A 1 200 ? 67.836 0.724   -3.425  1.00 20.13  ? 197  VAL A O     1 
ATOM   1547 C  CB    . VAL A 1 200 ? 67.211 -2.517  -3.522  1.00 18.04  ? 197  VAL A CB    1 
ATOM   1548 C  CG1   . VAL A 1 200 ? 66.235 -1.837  -2.610  1.00 21.64  ? 197  VAL A CG1   1 
ATOM   1549 C  CG2   . VAL A 1 200 ? 66.503 -3.495  -4.408  1.00 19.36  ? 197  VAL A CG2   1 
ATOM   1550 N  N     . GLU A 1 201 ? 69.734 -0.441  -3.057  1.00 21.30  ? 198  GLU A N     1 
ATOM   1551 C  CA    . GLU A 1 201 ? 70.390 0.698   -2.423  1.00 20.09  ? 198  GLU A CA    1 
ATOM   1552 C  C     . GLU A 1 201 ? 70.420 1.874   -3.401  1.00 20.58  ? 198  GLU A C     1 
ATOM   1553 O  O     . GLU A 1 201 ? 70.145 3.013   -3.022  1.00 21.72  ? 198  GLU A O     1 
ATOM   1554 C  CB    . GLU A 1 201 ? 71.829 0.377   -1.980  1.00 21.34  ? 198  GLU A CB    1 
ATOM   1555 C  CG    . GLU A 1 201 ? 71.954 -0.608  -0.809  1.00 23.34  ? 198  GLU A CG    1 
ATOM   1556 C  CD    . GLU A 1 201 ? 71.906 0.036   0.569   1.00 27.82  ? 198  GLU A CD    1 
ATOM   1557 O  OE1   . GLU A 1 201 ? 71.502 1.217   0.691   1.00 26.60  ? 198  GLU A OE1   1 
ATOM   1558 O  OE2   . GLU A 1 201 ? 72.270 -0.649  1.558   1.00 26.17  ? 198  GLU A OE2   1 
ATOM   1559 N  N     . GLU A 1 202 ? 70.755 1.587   -4.653  1.00 21.77  ? 199  GLU A N     1 
ATOM   1560 C  CA    . GLU A 1 202 ? 70.844 2.646   -5.668  1.00 24.12  ? 199  GLU A CA    1 
ATOM   1561 C  C     . GLU A 1 202 ? 69.472 3.265   -5.943  1.00 25.97  ? 199  GLU A C     1 
ATOM   1562 O  O     . GLU A 1 202 ? 69.329 4.498   -6.030  1.00 22.55  ? 199  GLU A O     1 
ATOM   1563 C  CB    . GLU A 1 202 ? 71.456 2.087   -6.959  1.00 25.43  ? 199  GLU A CB    1 
ATOM   1564 C  CG    . GLU A 1 202 ? 72.920 1.682   -6.768  1.00 27.90  ? 199  GLU A CG    1 
ATOM   1565 C  CD    . GLU A 1 202 ? 73.482 0.825   -7.900  1.00 36.48  ? 199  GLU A CD    1 
ATOM   1566 O  OE1   . GLU A 1 202 ? 74.712 0.593   -7.887  1.00 42.30  ? 199  GLU A OE1   1 
ATOM   1567 O  OE2   . GLU A 1 202 ? 72.717 0.383   -8.786  1.00 38.81  ? 199  GLU A OE2   1 
ATOM   1568 N  N     . MET A 1 203 ? 68.463 2.406   -6.055  1.00 23.24  ? 200  MET A N     1 
ATOM   1569 C  CA    . MET A 1 203 ? 67.078 2.836   -6.260  1.00 19.96  ? 200  MET A CA    1 
ATOM   1570 C  C     . MET A 1 203 ? 66.605 3.684   -5.115  1.00 18.32  ? 200  MET A C     1 
ATOM   1571 O  O     . MET A 1 203 ? 65.986 4.729   -5.330  1.00 20.77  ? 200  MET A O     1 
ATOM   1572 C  CB    . MET A 1 203 ? 66.136 1.634   -6.410  1.00 21.27  ? 200  MET A CB    1 
ATOM   1573 C  CG    A MET A 1 203 ? 64.713 1.998   -6.720  0.46 20.37  ? 200  MET A CG    1 
ATOM   1574 C  CG    B MET A 1 203 ? 66.425 0.708   -7.560  0.54 26.34  ? 200  MET A CG    1 
ATOM   1575 S  SD    A MET A 1 203 ? 63.658 0.541   -6.690  0.46 29.33  ? 200  MET A SD    1 
ATOM   1576 S  SD    B MET A 1 203 ? 65.200 -0.617  -7.593  0.54 26.49  ? 200  MET A SD    1 
ATOM   1577 C  CE    A MET A 1 203 ? 64.114 -0.289  -8.204  0.46 26.74  ? 200  MET A CE    1 
ATOM   1578 C  CE    B MET A 1 203 ? 63.704 0.351   -7.770  0.54 23.98  ? 200  MET A CE    1 
ATOM   1579 N  N     . ARG A 1 204 ? 66.879 3.247   -3.884  1.00 17.23  ? 201  ARG A N     1 
ATOM   1580 C  CA    . ARG A 1 204 ? 66.442 4.008   -2.721  1.00 18.14  ? 201  ARG A CA    1 
ATOM   1581 C  C     . ARG A 1 204 ? 67.190 5.349   -2.630  1.00 21.16  ? 201  ARG A C     1 
ATOM   1582 O  O     . ARG A 1 204 ? 66.629 6.365   -2.212  1.00 19.92  ? 201  ARG A O     1 
ATOM   1583 C  CB    . ARG A 1 204 ? 66.614 3.189   -1.447  1.00 18.36  ? 201  ARG A CB    1 
ATOM   1584 C  CG    . ARG A 1 204 ? 65.635 1.981   -1.412  1.00 19.00  ? 201  ARG A CG    1 
ATOM   1585 C  CD    . ARG A 1 204 ? 65.796 1.127   -0.160  1.00 21.47  ? 201  ARG A CD    1 
ATOM   1586 N  NE    . ARG A 1 204 ? 65.788 1.966   1.018   1.00 21.73  ? 201  ARG A NE    1 
ATOM   1587 C  CZ    . ARG A 1 204 ? 66.833 2.141   1.817   1.00 24.30  ? 201  ARG A CZ    1 
ATOM   1588 N  NH1   . ARG A 1 204 ? 66.736 2.971   2.841   1.00 22.55  ? 201  ARG A NH1   1 
ATOM   1589 N  NH2   . ARG A 1 204 ? 67.968 1.490   1.589   1.00 24.01  ? 201  ARG A NH2   1 
ATOM   1590 N  N     . ALA A 1 205 ? 68.454 5.354   -3.029  1.00 21.73  ? 202  ALA A N     1 
ATOM   1591 C  CA    . ALA A 1 205 ? 69.215 6.598   -3.016  1.00 21.86  ? 202  ALA A CA    1 
ATOM   1592 C  C     . ALA A 1 205 ? 68.602 7.567   -4.039  1.00 19.80  ? 202  ALA A C     1 
ATOM   1593 O  O     . ALA A 1 205 ? 68.484 8.777   -3.775  1.00 22.74  ? 202  ALA A O     1 
ATOM   1594 C  CB    . ALA A 1 205 ? 70.692 6.335   -3.326  1.00 19.67  ? 202  ALA A CB    1 
ATOM   1595 N  N     . ALA A 1 206 ? 68.206 7.030   -5.189  1.00 19.88  ? 203  ALA A N     1 
ATOM   1596 C  CA    . ALA A 1 206 ? 67.629 7.857   -6.244  1.00 20.27  ? 203  ALA A CA    1 
ATOM   1597 C  C     . ALA A 1 206 ? 66.283 8.432   -5.790  1.00 20.87  ? 203  ALA A C     1 
ATOM   1598 O  O     . ALA A 1 206 ? 65.993 9.606   -6.027  1.00 21.54  ? 203  ALA A O     1 
ATOM   1599 C  CB    . ALA A 1 206 ? 67.470 7.061   -7.525  1.00 24.09  ? 203  ALA A CB    1 
ATOM   1600 N  N     . ILE A 1 207 ? 65.455 7.608   -5.150  1.00 18.63  ? 204  ILE A N     1 
ATOM   1601 C  CA    . ILE A 1 207 ? 64.184 8.128   -4.655  1.00 20.67  ? 204  ILE A CA    1 
ATOM   1602 C  C     . ILE A 1 207 ? 64.438 9.255   -3.661  1.00 21.76  ? 204  ILE A C     1 
ATOM   1603 O  O     . ILE A 1 207 ? 63.830 10.321  -3.768  1.00 20.25  ? 204  ILE A O     1 
ATOM   1604 C  CB    . ILE A 1 207 ? 63.316 7.013   -4.019  1.00 17.87  ? 204  ILE A CB    1 
ATOM   1605 C  CG1   . ILE A 1 207 ? 62.908 6.022   -5.103  1.00 16.98  ? 204  ILE A CG1   1 
ATOM   1606 C  CG2   . ILE A 1 207 ? 62.102 7.610   -3.276  1.00 20.09  ? 204  ILE A CG2   1 
ATOM   1607 C  CD1   . ILE A 1 207 ? 62.302 4.694   -4.515  1.00 21.90  ? 204  ILE A CD1   1 
ATOM   1608 N  N     . GLU A 1 208 ? 65.359 9.068   -2.721  1.00 20.20  ? 205  GLU A N     1 
ATOM   1609 C  CA    . GLU A 1 208 ? 65.564 10.112  -1.720  1.00 23.16  ? 205  GLU A CA    1 
ATOM   1610 C  C     . GLU A 1 208 ? 66.157 11.385  -2.336  1.00 24.18  ? 205  GLU A C     1 
ATOM   1611 O  O     . GLU A 1 208 ? 65.743 12.500  -2.004  1.00 24.24  ? 205  GLU A O     1 
ATOM   1612 C  CB    . GLU A 1 208 ? 66.472 9.645   -0.590  1.00 23.59  ? 205  GLU A CB    1 
ATOM   1613 C  CG    . GLU A 1 208 ? 66.568 10.701  0.535   1.00 26.72  ? 205  GLU A CG    1 
ATOM   1614 C  CD    . GLU A 1 208 ? 67.276 10.185  1.774   1.00 34.36  ? 205  GLU A CD    1 
ATOM   1615 O  OE1   . GLU A 1 208 ? 67.243 10.884  2.809   1.00 32.02  ? 205  GLU A OE1   1 
ATOM   1616 O  OE2   . GLU A 1 208 ? 67.860 9.082   1.713   1.00 30.40  ? 205  GLU A OE2   1 
ATOM   1617 N  N     . ARG A 1 209 ? 67.108 11.213  -3.245  1.00 22.08  ? 206  ARG A N     1 
ATOM   1618 C  CA    . ARG A 1 209 ? 67.739 12.369  -3.864  1.00 24.02  ? 206  ARG A CA    1 
ATOM   1619 C  C     . ARG A 1 209 ? 66.711 13.182  -4.634  1.00 25.04  ? 206  ARG A C     1 
ATOM   1620 O  O     . ARG A 1 209 ? 66.710 14.410  -4.551  1.00 24.97  ? 206  ARG A O     1 
ATOM   1621 C  CB    . ARG A 1 209 ? 68.878 11.962  -4.805  1.00 26.53  ? 206  ARG A CB    1 
ATOM   1622 C  CG    . ARG A 1 209 ? 69.635 13.180  -5.345  1.00 29.27  ? 206  ARG A CG    1 
ATOM   1623 C  CD    . ARG A 1 209 ? 70.707 12.840  -6.378  1.00 30.46  ? 206  ARG A CD    1 
ATOM   1624 N  NE    . ARG A 1 209 ? 70.171 12.514  -7.706  1.00 35.30  ? 206  ARG A NE    1 
ATOM   1625 C  CZ    . ARG A 1 209 ? 69.760 13.410  -8.610  1.00 32.74  ? 206  ARG A CZ    1 
ATOM   1626 N  NH1   . ARG A 1 209 ? 69.310 13.000  -9.793  1.00 27.74  ? 206  ARG A NH1   1 
ATOM   1627 N  NH2   . ARG A 1 209 ? 69.787 14.714  -8.339  1.00 26.96  ? 206  ARG A NH2   1 
ATOM   1628 N  N     . GLU A 1 210 ? 65.821 12.492  -5.350  1.00 20.42  ? 207  GLU A N     1 
ATOM   1629 C  CA    . GLU A 1 210 ? 64.989 13.150  -6.350  1.00 19.91  ? 207  GLU A CA    1 
ATOM   1630 C  C     . GLU A 1 210 ? 63.615 13.559  -5.810  1.00 21.59  ? 207  GLU A C     1 
ATOM   1631 O  O     . GLU A 1 210 ? 62.903 14.322  -6.460  1.00 21.65  ? 207  GLU A O     1 
ATOM   1632 C  CB    . GLU A 1 210 ? 64.850 12.248  -7.581  1.00 20.57  ? 207  GLU A CB    1 
ATOM   1633 C  CG    . GLU A 1 210 ? 66.196 11.924  -8.207  1.00 23.01  ? 207  GLU A CG    1 
ATOM   1634 C  CD    . GLU A 1 210 ? 66.090 11.084  -9.469  1.00 31.06  ? 207  GLU A CD    1 
ATOM   1635 O  OE1   . GLU A 1 210 ? 65.030 11.126  -10.135 1.00 31.53  ? 207  GLU A OE1   1 
ATOM   1636 O  OE2   . GLU A 1 210 ? 67.084 10.391  -9.796  1.00 33.56  ? 207  GLU A OE2   1 
ATOM   1637 N  N     . THR A 1 211 ? 63.243 13.085  -4.615  1.00 20.04  ? 208  THR A N     1 
ATOM   1638 C  CA    . THR A 1 211 ? 61.932 13.453  -4.084  1.00 17.75  ? 208  THR A CA    1 
ATOM   1639 C  C     . THR A 1 211 ? 62.025 13.972  -2.667  1.00 19.55  ? 208  THR A C     1 
ATOM   1640 O  O     . THR A 1 211 ? 61.124 14.640  -2.189  1.00 23.02  ? 208  THR A O     1 
ATOM   1641 C  CB    . THR A 1 211 ? 60.953 12.258  -4.072  1.00 26.47  ? 208  THR A CB    1 
ATOM   1642 O  OG1   . THR A 1 211 ? 61.400 11.312  -3.103  1.00 21.48  ? 208  THR A OG1   1 
ATOM   1643 C  CG2   . THR A 1 211 ? 60.855 11.601  -5.430  1.00 21.77  ? 208  THR A CG2   1 
ATOM   1644 N  N     . GLY A 1 212 ? 63.103 13.643  -1.982  1.00 20.43  ? 209  GLY A N     1 
ATOM   1645 C  CA    . GLY A 1 212 ? 63.193 13.923  -0.568  1.00 22.00  ? 209  GLY A CA    1 
ATOM   1646 C  C     . GLY A 1 212 ? 62.621 12.833  0.324   1.00 26.29  ? 209  GLY A C     1 
ATOM   1647 O  O     . GLY A 1 212 ? 62.751 12.918  1.531   1.00 28.47  ? 209  GLY A O     1 
ATOM   1648 N  N     . PHE A 1 213 ? 61.996 11.809  -0.255  1.00 21.64  ? 210  PHE A N     1 
ATOM   1649 C  CA    . PHE A 1 213 ? 61.313 10.802  0.558   1.00 17.07  ? 210  PHE A CA    1 
ATOM   1650 C  C     . PHE A 1 213 ? 62.217 9.620   0.873   1.00 19.41  ? 210  PHE A C     1 
ATOM   1651 O  O     . PHE A 1 213 ? 62.959 9.161   0.009   1.00 22.22  ? 210  PHE A O     1 
ATOM   1652 C  CB    . PHE A 1 213 ? 60.060 10.282  -0.147  1.00 17.46  ? 210  PHE A CB    1 
ATOM   1653 C  CG    . PHE A 1 213 ? 59.064 11.348  -0.516  1.00 18.40  ? 210  PHE A CG    1 
ATOM   1654 C  CD1   . PHE A 1 213 ? 58.336 11.243  -1.696  1.00 22.08  ? 210  PHE A CD1   1 
ATOM   1655 C  CD2   . PHE A 1 213 ? 58.842 12.430  0.314   1.00 22.06  ? 210  PHE A CD2   1 
ATOM   1656 C  CE1   . PHE A 1 213 ? 57.398 12.211  -2.052  1.00 19.91  ? 210  PHE A CE1   1 
ATOM   1657 C  CE2   . PHE A 1 213 ? 57.907 13.400  -0.039  1.00 20.49  ? 210  PHE A CE2   1 
ATOM   1658 C  CZ    . PHE A 1 213 ? 57.189 13.286  -1.218  1.00 20.99  ? 210  PHE A CZ    1 
ATOM   1659 N  N     . GLN A 1 214 ? 62.136 9.138   2.115   1.00 21.92  ? 211  GLN A N     1 
ATOM   1660 C  CA    . GLN A 1 214 ? 62.826 7.921   2.531   1.00 19.56  ? 211  GLN A CA    1 
ATOM   1661 C  C     . GLN A 1 214 ? 61.904 6.728   2.463   1.00 21.41  ? 211  GLN A C     1 
ATOM   1662 O  O     . GLN A 1 214 ? 60.690 6.861   2.597   1.00 19.86  ? 211  GLN A O     1 
ATOM   1663 C  CB    . GLN A 1 214 ? 63.368 8.063   3.948   1.00 19.13  ? 211  GLN A CB    1 
ATOM   1664 C  CG    . GLN A 1 214 ? 64.564 9.010   3.983   1.00 25.14  ? 211  GLN A CG    1 
ATOM   1665 C  CD    . GLN A 1 214 ? 65.088 9.235   5.364   1.00 29.72  ? 211  GLN A CD    1 
ATOM   1666 O  OE1   . GLN A 1 214 ? 64.516 8.759   6.351   1.00 29.65  ? 211  GLN A OE1   1 
ATOM   1667 N  NE2   . GLN A 1 214 ? 66.181 9.981   5.455   1.00 32.87  ? 211  GLN A NE2   1 
ATOM   1668 N  N     . CYS A 1 215 ? 62.495 5.558   2.263   1.00 19.04  ? 212  CYS A N     1 
ATOM   1669 C  CA    . CYS A 1 215 ? 61.713 4.346   2.127   1.00 18.27  ? 212  CYS A CA    1 
ATOM   1670 C  C     . CYS A 1 215 ? 62.518 3.197   2.684   1.00 19.61  ? 212  CYS A C     1 
ATOM   1671 O  O     . CYS A 1 215 ? 63.732 3.318   2.919   1.00 23.49  ? 212  CYS A O     1 
ATOM   1672 C  CB    . CYS A 1 215 ? 61.354 4.070   0.666   1.00 19.20  ? 212  CYS A CB    1 
ATOM   1673 S  SG    . CYS A 1 215 ? 62.810 3.848   -0.374  1.00 28.72  ? 212  CYS A SG    1 
ATOM   1674 N  N     . SER A 1 216 ? 61.827 2.091   2.900   1.00 17.87  ? 213  SER A N     1 
ATOM   1675 C  CA    . SER A 1 216 ? 62.482 0.854   3.291   1.00 18.85  ? 213  SER A CA    1 
ATOM   1676 C  C     . SER A 1 216 ? 62.315 -0.140  2.147   1.00 19.04  ? 213  SER A C     1 
ATOM   1677 O  O     . SER A 1 216 ? 61.545 0.101   1.224   1.00 19.29  ? 213  SER A O     1 
ATOM   1678 C  CB    . SER A 1 216 ? 61.892 0.324   4.593   1.00 22.78  ? 213  SER A CB    1 
ATOM   1679 O  OG    . SER A 1 216 ? 62.144 1.240   5.647   1.00 22.03  ? 213  SER A OG    1 
ATOM   1680 N  N     . ALA A 1 217 ? 63.034 -1.259  2.191   1.00 18.28  ? 214  ALA A N     1 
ATOM   1681 C  CA    . ALA A 1 217 ? 62.844 -2.257  1.145   1.00 15.38  ? 214  ALA A CA    1 
ATOM   1682 C  C     . ALA A 1 217 ? 63.179 -3.638  1.635   1.00 16.76  ? 214  ALA A C     1 
ATOM   1683 O  O     . ALA A 1 217 ? 63.959 -3.803  2.580   1.00 17.68  ? 214  ALA A O     1 
ATOM   1684 C  CB    . ALA A 1 217 ? 63.705 -1.933  -0.091  1.00 16.59  ? 214  ALA A CB    1 
ATOM   1685 N  N     . GLY A 1 218 ? 62.615 -4.618  0.975   1.00 17.90  ? 215  GLY A N     1 
ATOM   1686 C  CA    . GLY A 1 218 ? 62.946 -5.987  1.207   1.00 17.90  ? 215  GLY A CA    1 
ATOM   1687 C  C     . GLY A 1 218 ? 63.433 -6.591  -0.077  1.00 17.45  ? 215  GLY A C     1 
ATOM   1688 O  O     . GLY A 1 218 ? 62.918 -6.303  -1.082  1.00 17.10  ? 215  GLY A O     1 
ATOM   1689 N  N     . ILE A 1 219 ? 64.452 -7.431  0.010   1.00 15.16  ? 216  ILE A N     1 
ATOM   1690 C  CA    . ILE A 1 219 ? 64.942 -8.167  -1.130  1.00 16.22  ? 216  ILE A CA    1 
ATOM   1691 C  C     . ILE A 1 219 ? 64.919 -9.652  -0.833  1.00 19.28  ? 216  ILE A C     1 
ATOM   1692 O  O     . ILE A 1 219 ? 65.491 -10.077 0.093   1.00 18.54  ? 216  ILE A O     1 
ATOM   1693 C  CB    . ILE A 1 219 ? 66.385 -7.789  -1.467  1.00 22.58  ? 216  ILE A CB    1 
ATOM   1694 C  CG1   . ILE A 1 219 ? 66.510 -6.292  -1.677  1.00 23.67  ? 216  ILE A CG1   1 
ATOM   1695 C  CG2   . ILE A 1 219 ? 66.855 -8.500  -2.709  1.00 20.57  ? 216  ILE A CG2   1 
ATOM   1696 C  CD1   . ILE A 1 219 ? 66.947 -5.501  -0.488  1.00 22.17  ? 216  ILE A CD1   1 
ATOM   1697 N  N     . SER A 1 220 ? 64.285 -10.406 -1.692  1.00 16.17  ? 217  SER A N     1 
ATOM   1698 C  CA    . SER A 1 220 ? 64.219 -11.845 -1.541  1.00 16.39  ? 217  SER A CA    1 
ATOM   1699 C  C     . SER A 1 220 ? 63.920 -12.520 -2.864  1.00 16.04  ? 217  SER A C     1 
ATOM   1700 O  O     . SER A 1 220 ? 64.158 -11.965 -3.867  1.00 20.25  ? 217  SER A O     1 
ATOM   1701 C  CB    . SER A 1 220 ? 63.260 -12.283 -0.436  1.00 21.83  ? 217  SER A CB    1 
ATOM   1702 O  OG    . SER A 1 220 ? 63.400 -13.620 -0.068  1.00 20.18  ? 217  SER A OG    1 
ATOM   1703 N  N     . HIS A 1 221 ? 63.491 -13.759 -2.824  1.00 18.70  ? 218  HIS A N     1 
ATOM   1704 C  CA    . HIS A 1 221 ? 63.232 -14.501 -4.032  1.00 17.56  ? 218  HIS A CA    1 
ATOM   1705 C  C     . HIS A 1 221 ? 61.790 -14.442 -4.511  1.00 19.72  ? 218  HIS A C     1 
ATOM   1706 O  O     . HIS A 1 221 ? 61.506 -14.928 -5.528  1.00 19.68  ? 218  HIS A O     1 
ATOM   1707 C  CB    . HIS A 1 221 ? 63.657 -15.967 -3.867  1.00 18.65  ? 218  HIS A CB    1 
ATOM   1708 C  CG    . HIS A 1 221 ? 65.128 -16.162 -3.763  1.00 20.82  ? 218  HIS A CG    1 
ATOM   1709 N  ND1   . HIS A 1 221 ? 65.991 -15.812 -4.761  1.00 19.12  ? 218  HIS A ND1   1 
ATOM   1710 C  CD2   . HIS A 1 221 ? 65.885 -16.686 -2.782  1.00 20.18  ? 218  HIS A CD2   1 
ATOM   1711 C  CE1   . HIS A 1 221 ? 67.216 -16.103 -4.393  1.00 23.50  ? 218  HIS A CE1   1 
ATOM   1712 N  NE2   . HIS A 1 221 ? 67.176 -16.633 -3.197  1.00 20.97  ? 218  HIS A NE2   1 
ATOM   1713 N  N     . ASN A 1 222 ? 60.904 -13.837 -3.760  1.00 15.37  ? 219  ASN A N     1 
ATOM   1714 C  CA    . ASN A 1 222 ? 59.498 -13.740 -4.163  1.00 15.60  ? 219  ASN A CA    1 
ATOM   1715 C  C     . ASN A 1 222 ? 58.817 -12.570 -3.447  1.00 17.42  ? 219  ASN A C     1 
ATOM   1716 O  O     . ASN A 1 222 ? 59.422 -11.918 -2.581  1.00 20.35  ? 219  ASN A O     1 
ATOM   1717 C  CB    . ASN A 1 222 ? 58.755 -15.062 -3.881  1.00 16.00  ? 219  ASN A CB    1 
ATOM   1718 C  CG    . ASN A 1 222 ? 58.901 -15.502 -2.435  1.00 25.26  ? 219  ASN A CG    1 
ATOM   1719 O  OD1   . ASN A 1 222 ? 58.439 -14.812 -1.532  1.00 20.30  ? 219  ASN A OD1   1 
ATOM   1720 N  ND2   . ASN A 1 222 ? 59.513 -16.668 -2.213  1.00 23.06  ? 219  ASN A ND2   1 
ATOM   1721 N  N     . LYS A 1 223 ? 57.577 -12.290 -3.813  1.00 20.38  ? 220  LYS A N     1 
ATOM   1722 C  CA    . LYS A 1 223 ? 56.873 -11.126 -3.265  1.00 18.04  ? 220  LYS A CA    1 
ATOM   1723 C  C     . LYS A 1 223 ? 56.575 -11.225 -1.789  1.00 18.30  ? 220  LYS A C     1 
ATOM   1724 O  O     . LYS A 1 223 ? 56.710 -10.239 -1.052  1.00 18.05  ? 220  LYS A O     1 
ATOM   1725 C  CB    . LYS A 1 223 ? 55.570 -10.908 -4.032  1.00 19.83  ? 220  LYS A CB    1 
ATOM   1726 C  CG    . LYS A 1 223 ? 55.830 -10.434 -5.444  1.00 19.80  ? 220  LYS A CG    1 
ATOM   1727 C  CD    . LYS A 1 223 ? 54.580 -10.551 -6.327  1.00 28.97  ? 220  LYS A CD    1 
ATOM   1728 C  CE    . LYS A 1 223 ? 53.581 -9.475  -6.036  1.00 36.90  ? 220  LYS A CE    1 
ATOM   1729 N  NZ    . LYS A 1 223 ? 52.392 -9.585  -6.973  1.00 32.50  ? 220  LYS A NZ    1 
ATOM   1730 N  N     . VAL A 1 224 ? 56.129 -12.398 -1.345  1.00 18.18  ? 221  VAL A N     1 
ATOM   1731 C  CA    . VAL A 1 224 ? 55.757 -12.521 0.057   1.00 18.47  ? 221  VAL A CA    1 
ATOM   1732 C  C     . VAL A 1 224 ? 56.959 -12.319 0.976   1.00 18.20  ? 221  VAL A C     1 
ATOM   1733 O  O     . VAL A 1 224 ? 56.845 -11.611 1.990   1.00 17.70  ? 221  VAL A O     1 
ATOM   1734 C  CB    . VAL A 1 224 ? 55.093 -13.877 0.370   1.00 21.31  ? 221  VAL A CB    1 
ATOM   1735 C  CG1   . VAL A 1 224 ? 55.111 -14.147 1.896   1.00 21.21  ? 221  VAL A CG1   1 
ATOM   1736 C  CG2   . VAL A 1 224 ? 53.680 -13.869 -0.166  1.00 22.52  ? 221  VAL A CG2   1 
ATOM   1737 N  N     . LEU A 1 225 ? 58.101 -12.909 0.621   1.00 18.11  ? 222  LEU A N     1 
ATOM   1738 C  CA    . LEU A 1 225 ? 59.299 -12.775 1.440   1.00 17.90  ? 222  LEU A CA    1 
ATOM   1739 C  C     . LEU A 1 225 ? 59.849 -11.353 1.334   1.00 18.40  ? 222  LEU A C     1 
ATOM   1740 O  O     . LEU A 1 225 ? 60.346 -10.802 2.310   1.00 17.88  ? 222  LEU A O     1 
ATOM   1741 C  CB    . LEU A 1 225 ? 60.397 -13.791 1.050   1.00 16.94  ? 222  LEU A CB    1 
ATOM   1742 C  CG    . LEU A 1 225 ? 60.151 -15.257 1.441   1.00 19.37  ? 222  LEU A CG    1 
ATOM   1743 C  CD1   . LEU A 1 225 ? 61.319 -16.125 1.020   1.00 19.90  ? 222  LEU A CD1   1 
ATOM   1744 C  CD2   . LEU A 1 225 ? 59.889 -15.363 2.931   1.00 22.00  ? 222  LEU A CD2   1 
ATOM   1745 N  N     . ALA A 1 226 ? 59.757 -10.754 0.150   1.00 18.63  ? 223  ALA A N     1 
ATOM   1746 C  CA    . ALA A 1 226 ? 60.224 -9.376  0.013   1.00 17.15  ? 223  ALA A CA    1 
ATOM   1747 C  C     . ALA A 1 226 ? 59.409 -8.411  0.877   1.00 19.16  ? 223  ALA A C     1 
ATOM   1748 O  O     . ALA A 1 226 ? 59.974 -7.496  1.480   1.00 16.97  ? 223  ALA A O     1 
ATOM   1749 C  CB    . ALA A 1 226 ? 60.189 -8.937  -1.461  1.00 15.45  ? 223  ALA A CB    1 
ATOM   1750 N  N     . LYS A 1 227 ? 58.088 -8.607  0.932   1.00 16.47  ? 224  LYS A N     1 
ATOM   1751 C  CA    . LYS A 1 227 ? 57.206 -7.754  1.730   1.00 17.14  ? 224  LYS A CA    1 
ATOM   1752 C  C     . LYS A 1 227 ? 57.519 -7.935  3.210   1.00 19.79  ? 224  LYS A C     1 
ATOM   1753 O  O     . LYS A 1 227 ? 57.646 -6.966  3.965   1.00 20.80  ? 224  LYS A O     1 
ATOM   1754 C  CB    . LYS A 1 227 ? 55.723 -8.079  1.462   1.00 19.53  ? 224  LYS A CB    1 
ATOM   1755 C  CG    . LYS A 1 227 ? 54.739 -7.288  2.343   1.00 23.02  ? 224  LYS A CG    1 
ATOM   1756 C  CD    . LYS A 1 227 ? 54.927 -5.777  2.223   1.00 26.28  ? 224  LYS A CD    1 
ATOM   1757 C  CE    . LYS A 1 227 ? 53.769 -5.013  2.854   1.00 32.00  ? 224  LYS A CE    1 
ATOM   1758 N  NZ    . LYS A 1 227 ? 53.993 -3.546  2.776   1.00 32.67  ? 224  LYS A NZ    1 
ATOM   1759 N  N     . LEU A 1 228 ? 57.641 -9.190  3.622   1.00 20.09  ? 225  LEU A N     1 
ATOM   1760 C  CA    . LEU A 1 228 ? 57.988 -9.503  4.996   1.00 21.47  ? 225  LEU A CA    1 
ATOM   1761 C  C     . LEU A 1 228 ? 59.347 -8.890  5.374   1.00 20.61  ? 225  LEU A C     1 
ATOM   1762 O  O     . LEU A 1 228 ? 59.468 -8.235  6.420   1.00 20.21  ? 225  LEU A O     1 
ATOM   1763 C  CB    . LEU A 1 228 ? 57.986 -11.025 5.194   1.00 21.27  ? 225  LEU A CB    1 
ATOM   1764 C  CG    . LEU A 1 228 ? 58.127 -11.522 6.632   1.00 35.81  ? 225  LEU A CG    1 
ATOM   1765 C  CD1   . LEU A 1 228 ? 56.940 -11.049 7.473   1.00 30.92  ? 225  LEU A CD1   1 
ATOM   1766 C  CD2   . LEU A 1 228 ? 58.240 -13.049 6.632   1.00 28.75  ? 225  LEU A CD2   1 
ATOM   1767 N  N     . ALA A 1 229 ? 60.346 -9.072  4.507   1.00 19.39  ? 226  ALA A N     1 
ATOM   1768 C  CA    . ALA A 1 229 ? 61.683 -8.517  4.713   1.00 17.93  ? 226  ALA A CA    1 
ATOM   1769 C  C     . ALA A 1 229 ? 61.663 -7.011  4.894   1.00 22.66  ? 226  ALA A C     1 
ATOM   1770 O  O     . ALA A 1 229 ? 62.383 -6.474  5.727   1.00 22.33  ? 226  ALA A O     1 
ATOM   1771 C  CB    . ALA A 1 229 ? 62.609 -8.873  3.548   1.00 17.68  ? 226  ALA A CB    1 
ATOM   1772 N  N     . CYS A 1 230 ? 60.845 -6.336  4.093   1.00 19.37  ? 227  CYS A N     1 
ATOM   1773 C  CA    . CYS A 1 230 ? 60.780 -4.871  4.125   1.00 18.77  ? 227  CYS A CA    1 
ATOM   1774 C  C     . CYS A 1 230 ? 60.435 -4.349  5.525   1.00 23.19  ? 227  CYS A C     1 
ATOM   1775 O  O     . CYS A 1 230 ? 61.024 -3.375  6.013   1.00 24.48  ? 227  CYS A O     1 
ATOM   1776 C  CB    . CYS A 1 230 ? 59.753 -4.382  3.113   1.00 18.69  ? 227  CYS A CB    1 
ATOM   1777 S  SG    . CYS A 1 230 ? 59.673 -2.577  2.982   1.00 21.85  ? 227  CYS A SG    1 
ATOM   1778 N  N     . GLY A 1 231 ? 59.519 -5.039  6.182   1.00 20.08  ? 228  GLY A N     1 
ATOM   1779 C  CA    . GLY A 1 231 ? 59.085 -4.666  7.503   1.00 22.09  ? 228  GLY A CA    1 
ATOM   1780 C  C     . GLY A 1 231 ? 60.070 -4.872  8.656   1.00 29.25  ? 228  GLY A C     1 
ATOM   1781 O  O     . GLY A 1 231 ? 59.868 -4.392  9.726   1.00 27.29  ? 228  GLY A O     1 
ATOM   1782 N  N     . LEU A 1 232 ? 61.084 -5.666  8.430   1.00 24.43  ? 229  LEU A N     1 
ATOM   1783 C  CA    . LEU A 1 232 ? 61.941 -6.104  9.496   1.00 23.77  ? 229  LEU A CA    1 
ATOM   1784 C  C     . LEU A 1 232 ? 62.779 -5.026  10.117  1.00 26.47  ? 229  LEU A C     1 
ATOM   1785 O  O     . LEU A 1 232 ? 63.109 -5.092  11.266  1.00 25.68  ? 229  LEU A O     1 
ATOM   1786 C  CB    . LEU A 1 232 ? 62.781 -7.298  9.093   1.00 24.20  ? 229  LEU A CB    1 
ATOM   1787 C  CG    . LEU A 1 232 ? 62.012 -8.587  8.878   1.00 23.80  ? 229  LEU A CG    1 
ATOM   1788 C  CD1   . LEU A 1 232 ? 62.859 -9.720  8.334   1.00 23.56  ? 229  LEU A CD1   1 
ATOM   1789 C  CD2   . LEU A 1 232 ? 61.275 -9.003  10.131  1.00 29.88  ? 229  LEU A CD2   1 
ATOM   1790 N  N     . ASN A 1 233 ? 63.219 -4.102  9.297   1.00 22.39  ? 230  ASN A N     1 
ATOM   1791 C  CA    . ASN A 1 233 ? 64.053 -3.039  9.755   1.00 20.00  ? 230  ASN A CA    1 
ATOM   1792 C  C     . ASN A 1 233 ? 63.572 -1.718  9.186   1.00 29.42  ? 230  ASN A C     1 
ATOM   1793 O  O     . ASN A 1 233 ? 64.151 -1.226  8.328   1.00 39.55  ? 230  ASN A O     1 
ATOM   1794 C  CB    . ASN A 1 233 ? 65.492 -3.327  9.356   1.00 22.49  ? 230  ASN A CB    1 
ATOM   1795 C  CG    . ASN A 1 233 ? 66.059 -4.527  10.053  1.00 27.61  ? 230  ASN A CG    1 
ATOM   1796 O  OD1   . ASN A 1 233 ? 66.463 -4.431  11.170  1.00 24.15  ? 230  ASN A OD1   1 
ATOM   1797 N  ND2   . ASN A 1 233 ? 66.136 -5.617  9.369   1.00 21.69  ? 230  ASN A ND2   1 
ATOM   1798 N  N     . LYS A 1 234 ? 62.489 -1.180  9.675   1.00 28.24  ? 231  LYS A N     1 
ATOM   1799 C  CA    . LYS A 1 234 ? 61.969 0.098   9.216   1.00 26.92  ? 231  LYS A CA    1 
ATOM   1800 C  C     . LYS A 1 234 ? 62.271 1.069   10.326  1.00 29.77  ? 231  LYS A C     1 
ATOM   1801 O  O     . LYS A 1 234 ? 62.344 0.661   11.438  1.00 33.72  ? 231  LYS A O     1 
ATOM   1802 C  CB    . LYS A 1 234 ? 60.473 0.024   9.015   1.00 30.02  ? 231  LYS A CB    1 
ATOM   1803 C  CG    . LYS A 1 234 ? 60.029 -0.508  7.697   1.00 33.27  ? 231  LYS A CG    1 
ATOM   1804 C  CD    . LYS A 1 234 ? 58.650 0.040   7.342   1.00 40.74  ? 231  LYS A CD    1 
ATOM   1805 C  CE    . LYS A 1 234 ? 58.359 0.098   5.848   1.00 40.20  ? 231  LYS A CE    1 
ATOM   1806 N  NZ    . LYS A 1 234 ? 58.180 1.457   5.232   1.00 25.57  ? 231  LYS A NZ    1 
ATOM   1807 N  N     . PRO A 1 235 ? 62.491 2.341   10.063  1.00 23.62  ? 232  PRO A N     1 
ATOM   1808 C  CA    . PRO A 1 235 ? 62.471 3.010   8.763   1.00 23.56  ? 232  PRO A CA    1 
ATOM   1809 C  C     . PRO A 1 235 ? 63.838 3.181   8.129   1.00 21.32  ? 232  PRO A C     1 
ATOM   1810 O  O     . PRO A 1 235 ? 64.884 2.980   8.774   1.00 21.85  ? 232  PRO A O     1 
ATOM   1811 C  CB    . PRO A 1 235 ? 61.891 4.382   9.108   1.00 23.41  ? 232  PRO A CB    1 
ATOM   1812 C  CG    . PRO A 1 235 ? 62.491 4.664   10.464  1.00 25.27  ? 232  PRO A CG    1 
ATOM   1813 C  CD    . PRO A 1 235 ? 62.571 3.319   11.164  1.00 28.44  ? 232  PRO A CD    1 
ATOM   1814 N  N     . ASN A 1 236 ? 63.807 3.588   6.864   1.00 20.34  ? 233  ASN A N     1 
ATOM   1815 C  CA    . ASN A 1 236 ? 65.006 3.974   6.107   1.00 19.47  ? 233  ASN A CA    1 
ATOM   1816 C  C     . ASN A 1 236 ? 66.123 2.933   6.061   1.00 19.49  ? 233  ASN A C     1 
ATOM   1817 O  O     . ASN A 1 236 ? 67.306 3.283   6.090   1.00 20.17  ? 233  ASN A O     1 
ATOM   1818 C  CB    . ASN A 1 236 ? 65.564 5.296   6.659   1.00 24.12  ? 233  ASN A CB    1 
ATOM   1819 C  CG    . ASN A 1 236 ? 66.482 5.990   5.673   1.00 27.16  ? 233  ASN A CG    1 
ATOM   1820 O  OD1   . ASN A 1 236 ? 66.287 5.891   4.460   1.00 29.53  ? 233  ASN A OD1   1 
ATOM   1821 N  ND2   . ASN A 1 236 ? 67.503 6.667   6.185   1.00 31.06  ? 233  ASN A ND2   1 
ATOM   1822 N  N     . ARG A 1 237 ? 65.748 1.658   5.972   1.00 20.89  ? 234  ARG A N     1 
ATOM   1823 C  CA    . ARG A 1 237 ? 66.725 0.574   5.863   1.00 20.31  ? 234  ARG A CA    1 
ATOM   1824 C  C     . ARG A 1 237 ? 66.183 -0.479  4.908   1.00 18.01  ? 234  ARG A C     1 
ATOM   1825 O  O     . ARG A 1 237 ? 64.988 -0.487  4.594   1.00 19.41  ? 234  ARG A O     1 
ATOM   1826 C  CB    . ARG A 1 237 ? 67.010 -0.067  7.230   1.00 20.98  ? 234  ARG A CB    1 
ATOM   1827 C  CG    . ARG A 1 237 ? 67.614 0.854   8.275   1.00 23.41  ? 234  ARG A CG    1 
ATOM   1828 C  CD    . ARG A 1 237 ? 69.051 1.161   7.930   1.00 28.13  ? 234  ARG A CD    1 
ATOM   1829 N  NE    . ARG A 1 237 ? 69.710 1.919   8.988   1.00 33.11  ? 234  ARG A NE    1 
ATOM   1830 C  CZ    . ARG A 1 237 ? 69.758 3.247   9.048   1.00 37.29  ? 234  ARG A CZ    1 
ATOM   1831 N  NH1   . ARG A 1 237 ? 69.193 3.998   8.105   1.00 30.62  ? 234  ARG A NH1   1 
ATOM   1832 N  NH2   . ARG A 1 237 ? 70.384 3.824   10.059  1.00 35.33  ? 234  ARG A NH2   1 
ATOM   1833 N  N     . GLN A 1 238 ? 67.049 -1.366  4.434   1.00 18.89  ? 235  GLN A N     1 
ATOM   1834 C  CA    . GLN A 1 238 ? 66.557 -2.476  3.617   1.00 15.68  ? 235  GLN A CA    1 
ATOM   1835 C  C     . GLN A 1 238 ? 67.077 -3.800  4.148   1.00 16.48  ? 235  GLN A C     1 
ATOM   1836 O  O     . GLN A 1 238 ? 68.119 -3.841  4.778   1.00 20.60  ? 235  GLN A O     1 
ATOM   1837 C  CB    . GLN A 1 238 ? 66.958 -2.307  2.166   1.00 20.11  ? 235  GLN A CB    1 
ATOM   1838 C  CG    . GLN A 1 238 ? 68.445 -2.098  1.966   1.00 19.12  ? 235  GLN A CG    1 
ATOM   1839 C  CD    . GLN A 1 238 ? 68.777 -1.883  0.505   1.00 22.91  ? 235  GLN A CD    1 
ATOM   1840 O  OE1   . GLN A 1 238 ? 68.326 -0.918  -0.104  1.00 24.21  ? 235  GLN A OE1   1 
ATOM   1841 N  NE2   . GLN A 1 238 ? 69.532 -2.810  -0.077  1.00 17.13  ? 235  GLN A NE2   1 
ATOM   1842 N  N     . THR A 1 239 ? 66.336 -4.881  3.887   1.00 17.09  ? 236  THR A N     1 
ATOM   1843 C  CA    . THR A 1 239 ? 66.651 -6.177  4.491   1.00 17.84  ? 236  THR A CA    1 
ATOM   1844 C  C     . THR A 1 239 ? 66.649 -7.249  3.431   1.00 18.14  ? 236  THR A C     1 
ATOM   1845 O  O     . THR A 1 239 ? 65.697 -7.360  2.669   1.00 18.94  ? 236  THR A O     1 
ATOM   1846 C  CB    . THR A 1 239 ? 65.625 -6.552  5.593   1.00 21.64  ? 236  THR A CB    1 
ATOM   1847 O  OG1   . THR A 1 239 ? 65.558 -5.491  6.549   1.00 18.81  ? 236  THR A OG1   1 
ATOM   1848 C  CG2   . THR A 1 239 ? 66.004 -7.859  6.328   1.00 21.36  ? 236  THR A CG2   1 
ATOM   1849 N  N     . LEU A 1 240 ? 67.720 -8.043  3.414   1.00 15.68  ? 237  LEU A N     1 
ATOM   1850 C  CA    . LEU A 1 240 ? 67.852 -9.188  2.515   1.00 16.77  ? 237  LEU A CA    1 
ATOM   1851 C  C     . LEU A 1 240 ? 67.425 -10.440 3.287   1.00 18.07  ? 237  LEU A C     1 
ATOM   1852 O  O     . LEU A 1 240 ? 68.000 -10.753 4.339   1.00 19.31  ? 237  LEU A O     1 
ATOM   1853 C  CB    . LEU A 1 240 ? 69.308 -9.291  2.007   1.00 16.65  ? 237  LEU A CB    1 
ATOM   1854 C  CG    . LEU A 1 240 ? 69.650 -10.297 0.903   1.00 17.86  ? 237  LEU A CG    1 
ATOM   1855 C  CD1   . LEU A 1 240 ? 71.018 -9.933  0.326   1.00 19.52  ? 237  LEU A CD1   1 
ATOM   1856 C  CD2   . LEU A 1 240 ? 69.677 -11.745 1.419   1.00 21.03  ? 237  LEU A CD2   1 
ATOM   1857 N  N     . VAL A 1 241 ? 66.404 -11.133 2.783   1.00 15.21  ? 238  VAL A N     1 
ATOM   1858 C  CA    . VAL A 1 241 ? 65.952 -12.420 3.356   1.00 17.59  ? 238  VAL A CA    1 
ATOM   1859 C  C     . VAL A 1 241 ? 66.321 -13.510 2.369   1.00 19.37  ? 238  VAL A C     1 
ATOM   1860 O  O     . VAL A 1 241 ? 65.737 -13.595 1.296   1.00 17.77  ? 238  VAL A O     1 
ATOM   1861 C  CB    . VAL A 1 241 ? 64.441 -12.414 3.654   1.00 16.14  ? 238  VAL A CB    1 
ATOM   1862 C  CG1   . VAL A 1 241 ? 63.866 -13.848 3.810   1.00 17.74  ? 238  VAL A CG1   1 
ATOM   1863 C  CG2   . VAL A 1 241 ? 64.183 -11.609 4.921   1.00 20.10  ? 238  VAL A CG2   1 
ATOM   1864 N  N     . SER A 1 242 ? 67.341 -14.300 2.714   1.00 15.27  ? 239  SER A N     1 
ATOM   1865 C  CA    . SER A 1 242 ? 67.813 -15.365 1.842   1.00 17.26  ? 239  SER A CA    1 
ATOM   1866 C  C     . SER A 1 242 ? 66.924 -16.599 1.971   1.00 18.01  ? 239  SER A C     1 
ATOM   1867 O  O     . SER A 1 242 ? 66.211 -16.750 2.950   1.00 19.38  ? 239  SER A O     1 
ATOM   1868 C  CB    . SER A 1 242 ? 69.252 -15.725 2.198   1.00 21.91  ? 239  SER A CB    1 
ATOM   1869 O  OG    . SER A 1 242 ? 69.313 -16.181 3.545   1.00 23.00  ? 239  SER A OG    1 
ATOM   1870 N  N     . HIS A 1 243 ? 67.003 -17.499 0.996   1.00 16.40  ? 240  HIS A N     1 
ATOM   1871 C  CA    . HIS A 1 243 ? 66.268 -18.755 1.086   1.00 19.20  ? 240  HIS A CA    1 
ATOM   1872 C  C     . HIS A 1 243 ? 66.643 -19.502 2.369   1.00 18.38  ? 240  HIS A C     1 
ATOM   1873 O  O     . HIS A 1 243 ? 65.787 -20.102 3.026   1.00 19.40  ? 240  HIS A O     1 
ATOM   1874 C  CB    . HIS A 1 243 ? 66.568 -19.635 -0.119  1.00 19.66  ? 240  HIS A CB    1 
ATOM   1875 C  CG    . HIS A 1 243 ? 65.766 -20.901 -0.161  1.00 19.30  ? 240  HIS A CG    1 
ATOM   1876 N  ND1   . HIS A 1 243 ? 64.438 -20.927 -0.532  1.00 23.09  ? 240  HIS A ND1   1 
ATOM   1877 C  CD2   . HIS A 1 243 ? 66.114 -22.188 0.085   1.00 28.73  ? 240  HIS A CD2   1 
ATOM   1878 C  CE1   . HIS A 1 243 ? 63.998 -22.173 -0.498  1.00 30.78  ? 240  HIS A CE1   1 
ATOM   1879 N  NE2   . HIS A 1 243 ? 64.992 -22.958 -0.128  1.00 22.78  ? 240  HIS A NE2   1 
ATOM   1880 N  N     . GLY A 1 244 ? 67.931 -19.457 2.702   1.00 19.32  ? 241  GLY A N     1 
ATOM   1881 C  CA    . GLY A 1 244 ? 68.442 -20.165 3.868   1.00 20.24  ? 241  GLY A CA    1 
ATOM   1882 C  C     . GLY A 1 244 ? 67.953 -19.618 5.205   1.00 20.42  ? 241  GLY A C     1 
ATOM   1883 O  O     . GLY A 1 244 ? 67.871 -20.338 6.198   1.00 20.94  ? 241  GLY A O     1 
ATOM   1884 N  N     . SER A 1 245 ? 67.597 -18.337 5.228   1.00 17.98  ? 242  SER A N     1 
ATOM   1885 C  CA    . SER A 1 245 ? 67.154 -17.715 6.470   1.00 18.52  ? 242  SER A CA    1 
ATOM   1886 C  C     . SER A 1 245 ? 65.708 -18.054 6.810   1.00 18.84  ? 242  SER A C     1 
ATOM   1887 O  O     . SER A 1 245 ? 65.222 -17.728 7.900   1.00 20.14  ? 242  SER A O     1 
ATOM   1888 C  CB    . SER A 1 245 ? 67.294 -16.200 6.384   1.00 20.90  ? 242  SER A CB    1 
ATOM   1889 O  OG    . SER A 1 245 ? 66.205 -15.667 5.657   1.00 23.54  ? 242  SER A OG    1 
ATOM   1890 N  N     . VAL A 1 246 ? 65.007 -18.687 5.878   1.00 17.28  ? 243  VAL A N     1 
ATOM   1891 C  CA    . VAL A 1 246 ? 63.569 -18.910 6.077   1.00 17.78  ? 243  VAL A CA    1 
ATOM   1892 C  C     . VAL A 1 246 ? 63.197 -19.854 7.246   1.00 24.28  ? 243  VAL A C     1 
ATOM   1893 O  O     . VAL A 1 246 ? 62.299 -19.523 8.024   1.00 19.94  ? 243  VAL A O     1 
ATOM   1894 C  CB    . VAL A 1 246 ? 62.895 -19.412 4.773   1.00 19.58  ? 243  VAL A CB    1 
ATOM   1895 C  CG1   . VAL A 1 246 ? 61.435 -19.837 5.041   1.00 19.57  ? 243  VAL A CG1   1 
ATOM   1896 C  CG2   . VAL A 1 246 ? 62.912 -18.296 3.738   1.00 22.56  ? 243  VAL A CG2   1 
ATOM   1897 N  N     . PRO A 1 247 ? 63.875 -21.008 7.397   1.00 19.64  ? 244  PRO A N     1 
ATOM   1898 C  CA    . PRO A 1 247 ? 63.457 -21.868 8.518   1.00 17.41  ? 244  PRO A CA    1 
ATOM   1899 C  C     . PRO A 1 247 ? 63.488 -21.167 9.878   1.00 18.04  ? 244  PRO A C     1 
ATOM   1900 O  O     . PRO A 1 247 ? 62.547 -21.286 10.659  1.00 21.30  ? 244  PRO A O     1 
ATOM   1901 C  CB    . PRO A 1 247 ? 64.488 -23.015 8.477   1.00 19.25  ? 244  PRO A CB    1 
ATOM   1902 C  CG    . PRO A 1 247 ? 64.812 -23.127 7.000   1.00 26.32  ? 244  PRO A CG    1 
ATOM   1903 C  CD    . PRO A 1 247 ? 64.892 -21.676 6.549   1.00 19.40  ? 244  PRO A CD    1 
ATOM   1904 N  N     . GLN A 1 248 ? 64.563 -20.446 10.161  1.00 19.99  ? 245  GLN A N     1 
ATOM   1905 C  CA    . GLN A 1 248 ? 64.643 -19.802 11.457  1.00 21.45  ? 245  GLN A CA    1 
ATOM   1906 C  C     . GLN A 1 248 ? 63.644 -18.648 11.541  1.00 25.77  ? 245  GLN A C     1 
ATOM   1907 O  O     . GLN A 1 248 ? 62.944 -18.490 12.540  1.00 19.27  ? 245  GLN A O     1 
ATOM   1908 C  CB    . GLN A 1 248 ? 66.066 -19.322 11.736  1.00 25.14  ? 245  GLN A CB    1 
ATOM   1909 C  CG    . GLN A 1 248 ? 67.004 -20.464 12.127  1.00 33.61  ? 245  GLN A CG    1 
ATOM   1910 C  CD    . GLN A 1 248 ? 67.991 -20.067 13.221  1.00 46.35  ? 245  GLN A CD    1 
ATOM   1911 O  OE1   . GLN A 1 248 ? 69.198 -19.926 12.976  1.00 44.15  ? 245  GLN A OE1   1 
ATOM   1912 N  NE2   . GLN A 1 248 ? 67.480 -19.903 14.439  1.00 42.99  ? 245  GLN A NE2   1 
ATOM   1913 N  N     . LEU A 1 249 ? 63.562 -17.868 10.471  1.00 20.37  ? 246  LEU A N     1 
ATOM   1914 C  CA    . LEU A 1 249 ? 62.624 -16.736 10.430  1.00 18.54  ? 246  LEU A CA    1 
ATOM   1915 C  C     . LEU A 1 249 ? 61.189 -17.204 10.663  1.00 17.64  ? 246  LEU A C     1 
ATOM   1916 O  O     . LEU A 1 249 ? 60.437 -16.590 11.426  1.00 21.54  ? 246  LEU A O     1 
ATOM   1917 C  CB    . LEU A 1 249 ? 62.737 -16.021 9.085   1.00 22.57  ? 246  LEU A CB    1 
ATOM   1918 C  CG    . LEU A 1 249 ? 61.848 -14.793 8.879   1.00 21.60  ? 246  LEU A CG    1 
ATOM   1919 C  CD1   . LEU A 1 249 ? 62.273 -13.681 9.831   1.00 24.13  ? 246  LEU A CD1   1 
ATOM   1920 C  CD2   . LEU A 1 249 ? 61.862 -14.316 7.412   1.00 24.00  ? 246  LEU A CD2   1 
ATOM   1921 N  N     . PHE A 1 250 ? 60.808 -18.288 9.995   1.00 18.57  ? 247  PHE A N     1 
ATOM   1922 C  CA    . PHE A 1 250 ? 59.432 -18.761 10.069  1.00 18.08  ? 247  PHE A CA    1 
ATOM   1923 C  C     . PHE A 1 250 ? 59.127 -19.518 11.360  1.00 20.52  ? 247  PHE A C     1 
ATOM   1924 O  O     . PHE A 1 250 ? 57.963 -19.697 11.698  1.00 20.53  ? 247  PHE A O     1 
ATOM   1925 C  CB    . PHE A 1 250 ? 59.097 -19.648 8.870   1.00 18.23  ? 247  PHE A CB    1 
ATOM   1926 C  CG    . PHE A 1 250 ? 58.666 -18.877 7.649   1.00 20.21  ? 247  PHE A CG    1 
ATOM   1927 C  CD1   . PHE A 1 250 ? 58.159 -19.538 6.542   1.00 23.14  ? 247  PHE A CD1   1 
ATOM   1928 C  CD2   . PHE A 1 250 ? 58.790 -17.495 7.606   1.00 20.71  ? 247  PHE A CD2   1 
ATOM   1929 C  CE1   . PHE A 1 250 ? 57.761 -18.834 5.406   1.00 27.79  ? 247  PHE A CE1   1 
ATOM   1930 C  CE2   . PHE A 1 250 ? 58.402 -16.781 6.469   1.00 22.71  ? 247  PHE A CE2   1 
ATOM   1931 C  CZ    . PHE A 1 250 ? 57.870 -17.460 5.375   1.00 20.20  ? 247  PHE A CZ    1 
ATOM   1932 N  N     . SER A 1 251 ? 60.166 -19.942 12.078  1.00 17.51  ? 248  SER A N     1 
ATOM   1933 C  CA    . SER A 1 251 ? 59.959 -20.814 13.242  1.00 17.92  ? 248  SER A CA    1 
ATOM   1934 C  C     . SER A 1 251 ? 59.222 -20.089 14.356  1.00 20.05  ? 248  SER A C     1 
ATOM   1935 O  O     . SER A 1 251 ? 58.568 -20.710 15.182  1.00 18.91  ? 248  SER A O     1 
ATOM   1936 C  CB    . SER A 1 251 ? 61.301 -21.359 13.767  1.00 17.10  ? 248  SER A CB    1 
ATOM   1937 O  OG    . SER A 1 251 ? 62.064 -20.362 14.403  1.00 23.85  ? 248  SER A OG    1 
ATOM   1938 N  N     . GLN A 1 252 ? 59.326 -18.764 14.384  1.00 22.87  ? 249  GLN A N     1 
ATOM   1939 C  CA    . GLN A 1 252 ? 58.546 -18.011 15.357  1.00 22.69  ? 249  GLN A CA    1 
ATOM   1940 C  C     . GLN A 1 252 ? 57.759 -16.860 14.722  1.00 26.30  ? 249  GLN A C     1 
ATOM   1941 O  O     . GLN A 1 252 ? 57.500 -15.850 15.372  1.00 27.08  ? 249  GLN A O     1 
ATOM   1942 C  CB    . GLN A 1 252 ? 59.438 -17.445 16.453  1.00 26.35  ? 249  GLN A CB    1 
ATOM   1943 C  CG    . GLN A 1 252 ? 60.466 -18.379 17.025  1.00 30.08  ? 249  GLN A CG    1 
ATOM   1944 C  CD    . GLN A 1 252 ? 61.211 -17.699 18.146  1.00 43.44  ? 249  GLN A CD    1 
ATOM   1945 O  OE1   . GLN A 1 252 ? 60.656 -17.471 19.228  1.00 36.43  ? 249  GLN A OE1   1 
ATOM   1946 N  NE2   . GLN A 1 252 ? 62.458 -17.323 17.882  1.00 43.45  ? 249  GLN A NE2   1 
ATOM   1947 N  N     . MET A 1 253 ? 57.384 -17.022 13.458  1.00 18.40  ? 250  MET A N     1 
ATOM   1948 C  CA    . MET A 1 253 ? 56.671 -15.972 12.737  1.00 23.25  ? 250  MET A CA    1 
ATOM   1949 C  C     . MET A 1 253 ? 55.199 -16.273 12.822  1.00 21.30  ? 250  MET A C     1 
ATOM   1950 O  O     . MET A 1 253 ? 54.746 -17.270 12.289  1.00 21.38  ? 250  MET A O     1 
ATOM   1951 C  CB    . MET A 1 253 ? 57.138 -15.904 11.269  1.00 22.37  ? 250  MET A CB    1 
ATOM   1952 C  CG    . MET A 1 253 ? 56.500 -14.804 10.414  1.00 29.09  ? 250  MET A CG    1 
ATOM   1953 S  SD    . MET A 1 253 ? 56.892 -13.156 11.009  1.00 31.48  ? 250  MET A SD    1 
ATOM   1954 C  CE    . MET A 1 253 ? 58.697 -13.093 10.903  1.00 25.02  ? 250  MET A CE    1 
ATOM   1955 N  N     . PRO A 1 254 ? 54.437 -15.415 13.507  1.00 22.36  ? 251  PRO A N     1 
ATOM   1956 C  CA    . PRO A 1 254 ? 52.989 -15.632 13.547  1.00 25.58  ? 251  PRO A CA    1 
ATOM   1957 C  C     . PRO A 1 254 ? 52.412 -15.702 12.142  1.00 22.62  ? 251  PRO A C     1 
ATOM   1958 O  O     . PRO A 1 254 ? 52.833 -14.956 11.269  1.00 24.54  ? 251  PRO A O     1 
ATOM   1959 C  CB    . PRO A 1 254 ? 52.465 -14.401 14.294  1.00 22.02  ? 251  PRO A CB    1 
ATOM   1960 C  CG    . PRO A 1 254 ? 53.642 -13.929 15.090  1.00 26.97  ? 251  PRO A CG    1 
ATOM   1961 C  CD    . PRO A 1 254 ? 54.827 -14.165 14.179  1.00 22.65  ? 251  PRO A CD    1 
ATOM   1962 N  N     . ILE A 1 255 ? 51.488 -16.624 11.934  1.00 22.45  ? 252  ILE A N     1 
ATOM   1963 C  CA    . ILE A 1 255 ? 50.919 -16.856 10.619  1.00 19.30  ? 252  ILE A CA    1 
ATOM   1964 C  C     . ILE A 1 255 ? 50.314 -15.561 10.053  1.00 20.35  ? 252  ILE A C     1 
ATOM   1965 O  O     . ILE A 1 255 ? 50.462 -15.289 8.862   1.00 20.83  ? 252  ILE A O     1 
ATOM   1966 C  CB    . ILE A 1 255 ? 49.893 -17.998 10.691  1.00 23.72  ? 252  ILE A CB    1 
ATOM   1967 C  CG1   . ILE A 1 255 ? 50.660 -19.335 10.716  1.00 29.53  ? 252  ILE A CG1   1 
ATOM   1968 C  CG2   . ILE A 1 255 ? 48.915 -17.980 9.508   1.00 22.80  ? 252  ILE A CG2   1 
ATOM   1969 C  CD1   . ILE A 1 255 ? 49.887 -20.473 11.286  1.00 31.24  ? 252  ILE A CD1   1 
ATOM   1970 N  N     . ARG A 1 256 ? 49.709 -14.736 10.910  1.00 20.13  ? 253  ARG A N     1 
ATOM   1971 C  CA    . ARG A 1 256 ? 48.977 -13.566 10.428  1.00 22.20  ? 253  ARG A CA    1 
ATOM   1972 C  C     . ARG A 1 256 ? 49.903 -12.507 9.831   1.00 25.41  ? 253  ARG A C     1 
ATOM   1973 O  O     . ARG A 1 256 ? 49.457 -11.571 9.162   1.00 24.90  ? 253  ARG A O     1 
ATOM   1974 C  CB    . ARG A 1 256 ? 48.148 -12.961 11.561  1.00 27.59  ? 253  ARG A CB    1 
ATOM   1975 C  CG    . ARG A 1 256 ? 49.007 -12.251 12.572  1.00 33.97  ? 253  ARG A CG    1 
ATOM   1976 C  CD    . ARG A 1 256 ? 48.199 -11.713 13.729  1.00 42.24  ? 253  ARG A CD    1 
ATOM   1977 N  NE    . ARG A 1 256 ? 49.096 -11.280 14.790  1.00 47.88  ? 253  ARG A NE    1 
ATOM   1978 C  CZ    . ARG A 1 256 ? 49.586 -12.086 15.726  1.00 49.92  ? 253  ARG A CZ    1 
ATOM   1979 N  NH1   . ARG A 1 256 ? 49.261 -13.373 15.734  1.00 44.64  ? 253  ARG A NH1   1 
ATOM   1980 N  NH2   . ARG A 1 256 ? 50.406 -11.604 16.651  1.00 51.66  ? 253  ARG A NH2   1 
ATOM   1981 N  N     . LYS A 1 257 ? 51.203 -12.641 10.067  1.00 24.09  ? 254  LYS A N     1 
ATOM   1982 C  CA    . LYS A 1 257 ? 52.141 -11.655 9.540   1.00 26.06  ? 254  LYS A CA    1 
ATOM   1983 C  C     . LYS A 1 257 ? 52.392 -11.783 8.041   1.00 22.90  ? 254  LYS A C     1 
ATOM   1984 O  O     . LYS A 1 257 ? 52.915 -10.859 7.415   1.00 26.44  ? 254  LYS A O     1 
ATOM   1985 C  CB    . LYS A 1 257 ? 53.472 -11.727 10.296  1.00 23.21  ? 254  LYS A CB    1 
ATOM   1986 C  CG    . LYS A 1 257 ? 53.324 -11.403 11.754  1.00 37.59  ? 254  LYS A CG    1 
ATOM   1987 C  CD    . LYS A 1 257 ? 52.629 -10.073 11.943  1.00 41.76  ? 254  LYS A CD    1 
ATOM   1988 C  CE    . LYS A 1 257 ? 52.527 -9.722  13.423  1.00 55.80  ? 254  LYS A CE    1 
ATOM   1989 N  NZ    . LYS A 1 257 ? 51.839 -8.417  13.634  1.00 54.53  ? 254  LYS A NZ    1 
ATOM   1990 N  N     . ILE A 1 258 ? 52.065 -12.912 7.463   1.00 21.04  ? 255  ILE A N     1 
ATOM   1991 C  CA    . ILE A 1 258 ? 52.283 -13.182 6.062   1.00 20.97  ? 255  ILE A CA    1 
ATOM   1992 C  C     . ILE A 1 258 ? 51.149 -12.582 5.223   1.00 28.76  ? 255  ILE A C     1 
ATOM   1993 O  O     . ILE A 1 258 ? 50.029 -12.733 5.543   1.00 24.19  ? 255  ILE A O     1 
ATOM   1994 C  CB    . ILE A 1 258 ? 52.402 -14.691 5.794   1.00 22.77  ? 255  ILE A CB    1 
ATOM   1995 C  CG1   . ILE A 1 258 ? 53.764 -15.244 6.182   1.00 33.59  ? 255  ILE A CG1   1 
ATOM   1996 C  CG2   . ILE A 1 258 ? 52.303 -15.023 4.340   1.00 22.93  ? 255  ILE A CG2   1 
ATOM   1997 C  CD1   . ILE A 1 258 ? 54.308 -14.843 7.489   1.00 34.62  ? 255  ILE A CD1   1 
ATOM   1998 N  N     . ARG A 1 259 ? 51.492 -11.970 4.117   1.00 26.27  ? 256  ARG A N     1 
ATOM   1999 C  CA    . ARG A 1 259 ? 50.502 -11.293 3.320   1.00 25.59  ? 256  ARG A CA    1 
ATOM   2000 C  C     . ARG A 1 259 ? 49.481 -12.264 2.796   1.00 25.99  ? 256  ARG A C     1 
ATOM   2001 O  O     . ARG A 1 259 ? 49.819 -13.198 2.168   1.00 26.33  ? 256  ARG A O     1 
ATOM   2002 C  CB    . ARG A 1 259 ? 51.138 -10.552 2.150   1.00 26.30  ? 256  ARG A CB    1 
ATOM   2003 C  CG    . ARG A 1 259 ? 50.218 -9.544  1.498   1.00 27.40  ? 256  ARG A CG    1 
ATOM   2004 C  CD    . ARG A 1 259 ? 50.803 -8.926  0.242   1.00 39.74  ? 256  ARG A CD    1 
ATOM   2005 N  NE    . ARG A 1 259 ? 49.889 -7.989  -0.398  1.00 41.68  ? 256  ARG A NE    1 
ATOM   2006 C  CZ    . ARG A 1 259 ? 48.896 -8.357  -1.186  1.00 51.43  ? 256  ARG A CZ    1 
ATOM   2007 N  NH1   . ARG A 1 259 ? 48.101 -7.465  -1.735  1.00 42.27  ? 256  ARG A NH1   1 
ATOM   2008 N  NH2   . ARG A 1 259 ? 48.716 -9.639  -1.441  1.00 50.00  ? 256  ARG A NH2   1 
ATOM   2009 N  N     . SER A 1 260 ? 48.231 -11.925 3.027   1.00 26.82  ? 257  SER A N     1 
ATOM   2010 C  CA    . SER A 1 260 ? 47.049 -12.709 2.721   1.00 24.41  ? 257  SER A CA    1 
ATOM   2011 C  C     . SER A 1 260 ? 46.522 -13.608 3.844   1.00 29.24  ? 257  SER A C     1 
ATOM   2012 O  O     . SER A 1 260 ? 45.449 -14.102 3.770   1.00 22.44  ? 257  SER A O     1 
ATOM   2013 C  CB    . SER A 1 260 ? 47.220 -13.485 1.425   1.00 26.75  ? 257  SER A CB    1 
ATOM   2014 O  OG    . SER A 1 260 ? 47.782 -14.732 1.615   1.00 24.71  ? 257  SER A OG    1 
ATOM   2015 N  N     . LEU A 1 261 ? 47.290 -13.736 4.897   1.00 22.42  ? 258  LEU A N     1 
ATOM   2016 C  CA    . LEU A 1 261 ? 46.920 -14.524 6.043   1.00 21.35  ? 258  LEU A CA    1 
ATOM   2017 C  C     . LEU A 1 261 ? 46.515 -13.687 7.244   1.00 26.73  ? 258  LEU A C     1 
ATOM   2018 O  O     . LEU A 1 261 ? 46.386 -14.176 8.318   1.00 22.81  ? 258  LEU A O     1 
ATOM   2019 C  CB    . LEU A 1 261 ? 48.077 -15.425 6.413   1.00 19.76  ? 258  LEU A CB    1 
ATOM   2020 C  CG    . LEU A 1 261 ? 48.408 -16.428 5.332   1.00 22.47  ? 258  LEU A CG    1 
ATOM   2021 C  CD1   . LEU A 1 261 ? 49.470 -17.388 5.785   1.00 20.91  ? 258  LEU A CD1   1 
ATOM   2022 C  CD2   . LEU A 1 261 ? 47.213 -17.208 4.887   1.00 26.02  ? 258  LEU A CD2   1 
ATOM   2023 N  N     . GLY A 1 262 ? 46.346 -12.402 7.041   1.00 23.68  ? 259  GLY A N     1 
ATOM   2024 C  CA    . GLY A 1 262 ? 46.043 -11.519 8.149   1.00 22.25  ? 259  GLY A CA    1 
ATOM   2025 C  C     . GLY A 1 262 ? 44.584 -11.503 8.560   1.00 28.47  ? 259  GLY A C     1 
ATOM   2026 O  O     . GLY A 1 262 ? 44.227 -10.829 9.512   1.00 29.23  ? 259  GLY A O     1 
ATOM   2027 N  N     . GLY A 1 263 ? 43.751 -12.251 7.844   1.00 25.02  ? 260  GLY A N     1 
ATOM   2028 C  CA    . GLY A 1 263 ? 42.311 -12.206 8.025   1.00 24.78  ? 260  GLY A CA    1 
ATOM   2029 C  C     . GLY A 1 263 ? 41.688 -13.527 8.426   1.00 27.58  ? 260  GLY A C     1 
ATOM   2030 O  O     . GLY A 1 263 ? 42.249 -14.263 9.242   1.00 25.19  ? 260  GLY A O     1 
ATOM   2031 N  N     . LYS A 1 264 ? 40.521 -13.835 7.851   1.00 25.60  ? 261  LYS A N     1 
ATOM   2032 C  CA    . LYS A 1 264 ? 39.789 -15.051 8.200   1.00 25.86  ? 261  LYS A CA    1 
ATOM   2033 C  C     . LYS A 1 264 ? 40.528 -16.340 7.826   1.00 26.56  ? 261  LYS A C     1 
ATOM   2034 O  O     . LYS A 1 264 ? 40.520 -17.300 8.607   1.00 26.90  ? 261  LYS A O     1 
ATOM   2035 C  CB    . LYS A 1 264 ? 38.407 -15.039 7.528   1.00 31.70  ? 261  LYS A CB    1 
ATOM   2036 C  CG    . LYS A 1 264 ? 37.535 -13.884 7.991   1.00 37.22  ? 261  LYS A CG    1 
ATOM   2037 C  CD    . LYS A 1 264 ? 36.133 -13.949 7.375   1.00 37.27  ? 261  LYS A CD    1 
ATOM   2038 C  CE    . LYS A 1 264 ? 35.232 -12.848 7.919   1.00 48.93  ? 261  LYS A CE    1 
ATOM   2039 N  NZ    . LYS A 1 264 ? 33.841 -12.980 7.385   1.00 55.69  ? 261  LYS A NZ    1 
ATOM   2040 N  N     . LEU A 1 265 ? 41.144 -16.375 6.643   1.00 22.74  ? 262  LEU A N     1 
ATOM   2041 C  CA    . LEU A 1 265 ? 41.876 -17.575 6.225   1.00 26.58  ? 262  LEU A CA    1 
ATOM   2042 C  C     . LEU A 1 265 ? 42.988 -17.886 7.211   1.00 26.10  ? 262  LEU A C     1 
ATOM   2043 O  O     . LEU A 1 265 ? 43.150 -19.032 7.630   1.00 22.85  ? 262  LEU A O     1 
ATOM   2044 C  CB    . LEU A 1 265 ? 42.473 -17.423 4.821   1.00 25.47  ? 262  LEU A CB    1 
ATOM   2045 C  CG    . LEU A 1 265 ? 43.280 -18.607 4.289   1.00 27.70  ? 262  LEU A CG    1 
ATOM   2046 C  CD1   . LEU A 1 265 ? 42.419 -19.888 4.237   1.00 28.94  ? 262  LEU A CD1   1 
ATOM   2047 C  CD2   . LEU A 1 265 ? 43.858 -18.302 2.909   1.00 29.08  ? 262  LEU A CD2   1 
ATOM   2048 N  N     . GLY A 1 266 ? 43.759 -16.861 7.570   1.00 25.09  ? 263  GLY A N     1 
ATOM   2049 C  CA    . GLY A 1 266 ? 44.843 -17.040 8.518   1.00 24.44  ? 263  GLY A CA    1 
ATOM   2050 C  C     . GLY A 1 266 ? 44.332 -17.527 9.858   1.00 32.69  ? 263  GLY A C     1 
ATOM   2051 O  O     . GLY A 1 266 ? 44.942 -18.374 10.508  1.00 23.81  ? 263  GLY A O     1 
ATOM   2052 N  N     . ALA A 1 267 ? 43.195 -16.993 10.282  1.00 25.74  ? 264  ALA A N     1 
ATOM   2053 C  CA    . ALA A 1 267 ? 42.622 -17.418 11.543  1.00 28.79  ? 264  ALA A CA    1 
ATOM   2054 C  C     . ALA A 1 267 ? 42.168 -18.875 11.461  1.00 23.75  ? 264  ALA A C     1 
ATOM   2055 O  O     . ALA A 1 267 ? 42.245 -19.609 12.441  1.00 26.27  ? 264  ALA A O     1 
ATOM   2056 C  CB    . ALA A 1 267 ? 41.455 -16.505 11.945  1.00 24.97  ? 264  ALA A CB    1 
ATOM   2057 N  N     . SER A 1 268 ? 41.709 -19.302 10.289  1.00 25.18  ? 265  SER A N     1 
ATOM   2058 C  CA    . SER A 1 268 ? 41.265 -20.682 10.137  1.00 23.67  ? 265  SER A CA    1 
ATOM   2059 C  C     . SER A 1 268 ? 42.455 -21.652 10.061  1.00 26.85  ? 265  SER A C     1 
ATOM   2060 O  O     . SER A 1 268 ? 42.349 -22.780 10.528  1.00 27.17  ? 265  SER A O     1 
ATOM   2061 C  CB    . SER A 1 268 ? 40.375 -20.845 8.908   1.00 28.78  ? 265  SER A CB    1 
ATOM   2062 O  OG    . SER A 1 268 ? 41.119 -20.746 7.713   1.00 32.40  ? 265  SER A OG    1 
ATOM   2063 N  N     . VAL A 1 269 ? 43.580 -21.214 9.491   1.00 25.15  ? 266  VAL A N     1 
ATOM   2064 C  CA    . VAL A 1 269 ? 44.788 -22.059 9.485   1.00 24.23  ? 266  VAL A CA    1 
ATOM   2065 C  C     . VAL A 1 269 ? 45.179 -22.377 10.944  1.00 30.53  ? 266  VAL A C     1 
ATOM   2066 O  O     . VAL A 1 269 ? 45.425 -23.527 11.326  1.00 27.39  ? 266  VAL A O     1 
ATOM   2067 C  CB    . VAL A 1 269 ? 45.968 -21.372 8.743   1.00 24.51  ? 266  VAL A CB    1 
ATOM   2068 C  CG1   . VAL A 1 269 ? 47.257 -22.192 8.888   1.00 25.55  ? 266  VAL A CG1   1 
ATOM   2069 C  CG2   . VAL A 1 269 ? 45.641 -21.171 7.254   1.00 19.17  ? 266  VAL A CG2   1 
ATOM   2070 N  N     . ILE A 1 270 ? 45.189 -21.338 11.759  1.00 23.87  ? 267  ILE A N     1 
ATOM   2071 C  CA    . ILE A 1 270 ? 45.582 -21.436 13.162  1.00 26.18  ? 267  ILE A CA    1 
ATOM   2072 C  C     . ILE A 1 270 ? 44.635 -22.346 13.947  1.00 29.44  ? 267  ILE A C     1 
ATOM   2073 O  O     . ILE A 1 270 ? 45.070 -23.241 14.678  1.00 29.74  ? 267  ILE A O     1 
ATOM   2074 C  CB    . ILE A 1 270 ? 45.628 -20.033 13.801  1.00 28.37  ? 267  ILE A CB    1 
ATOM   2075 C  CG1   . ILE A 1 270 ? 46.810 -19.228 13.243  1.00 28.12  ? 267  ILE A CG1   1 
ATOM   2076 C  CG2   . ILE A 1 270 ? 45.682 -20.107 15.320  1.00 36.36  ? 267  ILE A CG2   1 
ATOM   2077 C  CD1   . ILE A 1 270 ? 46.693 -17.720 13.489  1.00 32.04  ? 267  ILE A CD1   1 
ATOM   2078 N  N     . GLU A 1 271 ? 43.336 -22.121 13.777  1.00 29.61  ? 268  GLU A N     1 
ATOM   2079 C  CA    . GLU A 1 271 ? 42.329 -22.872 14.512  1.00 30.56  ? 268  GLU A CA    1 
ATOM   2080 C  C     . GLU A 1 271 ? 42.224 -24.323 14.061  1.00 34.10  ? 268  GLU A C     1 
ATOM   2081 O  O     . GLU A 1 271 ? 42.219 -25.237 14.890  1.00 30.99  ? 268  GLU A O     1 
ATOM   2082 C  CB    . GLU A 1 271 ? 40.965 -22.191 14.374  1.00 30.10  ? 268  GLU A CB    1 
ATOM   2083 C  CG    . GLU A 1 271 ? 39.808 -23.041 14.859  1.00 46.70  ? 268  GLU A CG    1 
ATOM   2084 C  CD    . GLU A 1 271 ? 38.632 -22.200 15.292  1.00 56.32  ? 268  GLU A CD    1 
ATOM   2085 O  OE1   . GLU A 1 271 ? 38.849 -21.012 15.626  1.00 61.74  ? 268  GLU A OE1   1 
ATOM   2086 O  OE2   . GLU A 1 271 ? 37.496 -22.721 15.295  1.00 59.11  ? 268  GLU A OE2   1 
ATOM   2087 N  N     . ILE A 1 272 ? 42.133 -24.536 12.751  1.00 29.08  ? 269  ILE A N     1 
ATOM   2088 C  CA    . ILE A 1 272 ? 41.954 -25.883 12.226  1.00 23.97  ? 269  ILE A CA    1 
ATOM   2089 C  C     . ILE A 1 272 ? 43.185 -26.756 12.473  1.00 26.42  ? 269  ILE A C     1 
ATOM   2090 O  O     . ILE A 1 272 ? 43.072 -27.941 12.775  1.00 31.07  ? 269  ILE A O     1 
ATOM   2091 C  CB    . ILE A 1 272 ? 41.629 -25.857 10.719  1.00 23.95  ? 269  ILE A CB    1 
ATOM   2092 C  CG1   . ILE A 1 272 ? 40.231 -25.269 10.494  1.00 33.13  ? 269  ILE A CG1   1 
ATOM   2093 C  CG2   . ILE A 1 272 ? 41.734 -27.243 10.105  1.00 31.82  ? 269  ILE A CG2   1 
ATOM   2094 C  CD1   . ILE A 1 272 ? 39.827 -25.207 9.044   1.00 37.48  ? 269  ILE A CD1   1 
ATOM   2095 N  N     . LEU A 1 273 ? 44.369 -26.177 12.352  1.00 30.06  ? 270  LEU A N     1 
ATOM   2096 C  CA    . LEU A 1 273 ? 45.580 -26.988 12.446  1.00 31.17  ? 270  LEU A CA    1 
ATOM   2097 C  C     . LEU A 1 273 ? 46.175 -27.010 13.851  1.00 26.89  ? 270  LEU A C     1 
ATOM   2098 O  O     . LEU A 1 273 ? 47.030 -27.843 14.155  1.00 27.65  ? 270  LEU A O     1 
ATOM   2099 C  CB    . LEU A 1 273 ? 46.614 -26.491 11.443  1.00 26.44  ? 270  LEU A CB    1 
ATOM   2100 C  CG    . LEU A 1 273 ? 46.177 -26.671 9.980   1.00 25.59  ? 270  LEU A CG    1 
ATOM   2101 C  CD1   . LEU A 1 273 ? 47.237 -26.131 9.008   1.00 23.06  ? 270  LEU A CD1   1 
ATOM   2102 C  CD2   . LEU A 1 273 ? 45.877 -28.129 9.688   1.00 29.95  ? 270  LEU A CD2   1 
ATOM   2103 N  N     . GLY A 1 274 ? 45.731 -26.090 14.698  1.00 28.54  ? 271  GLY A N     1 
ATOM   2104 C  CA    . GLY A 1 274 ? 46.223 -26.003 16.059  1.00 27.06  ? 271  GLY A CA    1 
ATOM   2105 C  C     . GLY A 1 274 ? 47.653 -25.523 16.132  1.00 34.02  ? 271  GLY A C     1 
ATOM   2106 O  O     . GLY A 1 274 ? 48.429 -25.968 16.986  1.00 32.90  ? 271  GLY A O     1 
ATOM   2107 N  N     . ILE A 1 275 ? 48.005 -24.593 15.243  1.00 27.68  ? 272  ILE A N     1 
ATOM   2108 C  CA    . ILE A 1 275 ? 49.378 -24.074 15.170  1.00 27.10  ? 272  ILE A CA    1 
ATOM   2109 C  C     . ILE A 1 275 ? 49.402 -22.546 15.291  1.00 27.92  ? 272  ILE A C     1 
ATOM   2110 O  O     . ILE A 1 275 ? 48.350 -21.901 15.177  1.00 29.53  ? 272  ILE A O     1 
ATOM   2111 C  CB    . ILE A 1 275 ? 50.051 -24.485 13.845  1.00 25.94  ? 272  ILE A CB    1 
ATOM   2112 C  CG1   . ILE A 1 275 ? 49.313 -23.844 12.664  1.00 28.15  ? 272  ILE A CG1   1 
ATOM   2113 C  CG2   . ILE A 1 275 ? 50.104 -26.013 13.713  1.00 27.57  ? 272  ILE A CG2   1 
ATOM   2114 C  CD1   . ILE A 1 275 ? 49.987 -24.101 11.310  1.00 31.64  ? 272  ILE A CD1   1 
ATOM   2115 N  N     . GLU A 1 276 ? 50.591 -21.969 15.508  1.00 24.80  ? 273  GLU A N     1 
ATOM   2116 C  CA    . GLU A 1 276 ? 50.732 -20.515 15.684  1.00 23.27  ? 273  GLU A CA    1 
ATOM   2117 C  C     . GLU A 1 276 ? 51.688 -19.871 14.681  1.00 29.50  ? 273  GLU A C     1 
ATOM   2118 O  O     . GLU A 1 276 ? 51.523 -18.711 14.301  1.00 26.49  ? 273  GLU A O     1 
ATOM   2119 C  CB    . GLU A 1 276 ? 51.224 -20.168 17.088  1.00 26.44  ? 273  GLU A CB    1 
ATOM   2120 C  CG    . GLU A 1 276 ? 50.298 -20.585 18.227  1.00 40.64  ? 273  GLU A CG    1 
ATOM   2121 C  CD    . GLU A 1 276 ? 50.920 -20.363 19.605  1.00 56.69  ? 273  GLU A CD    1 
ATOM   2122 O  OE1   . GLU A 1 276 ? 51.011 -21.335 20.386  1.00 66.20  ? 273  GLU A OE1   1 
ATOM   2123 O  OE2   . GLU A 1 276 ? 51.307 -19.216 19.913  1.00 56.19  ? 273  GLU A OE2   1 
ATOM   2124 N  N     . TYR A 1 277 ? 52.699 -20.628 14.278  1.00 25.30  ? 274  TYR A N     1 
ATOM   2125 C  CA    . TYR A 1 277 ? 53.804 -20.074 13.497  1.00 24.72  ? 274  TYR A CA    1 
ATOM   2126 C  C     . TYR A 1 277 ? 53.875 -20.652 12.099  1.00 24.38  ? 274  TYR A C     1 
ATOM   2127 O  O     . TYR A 1 277 ? 53.536 -21.811 11.866  1.00 24.67  ? 274  TYR A O     1 
ATOM   2128 C  CB    . TYR A 1 277 ? 55.132 -20.311 14.215  1.00 21.42  ? 274  TYR A CB    1 
ATOM   2129 C  CG    . TYR A 1 277 ? 55.151 -19.773 15.622  1.00 23.96  ? 274  TYR A CG    1 
ATOM   2130 C  CD1   . TYR A 1 277 ? 55.363 -20.617 16.707  1.00 22.21  ? 274  TYR A CD1   1 
ATOM   2131 C  CD2   . TYR A 1 277 ? 54.944 -18.426 15.867  1.00 23.88  ? 274  TYR A CD2   1 
ATOM   2132 C  CE1   . TYR A 1 277 ? 55.380 -20.126 17.998  1.00 30.73  ? 274  TYR A CE1   1 
ATOM   2133 C  CE2   . TYR A 1 277 ? 54.945 -17.926 17.148  1.00 27.94  ? 274  TYR A CE2   1 
ATOM   2134 C  CZ    . TYR A 1 277 ? 55.168 -18.783 18.216  1.00 32.83  ? 274  TYR A CZ    1 
ATOM   2135 O  OH    . TYR A 1 277 ? 55.183 -18.287 19.502  1.00 36.18  ? 274  TYR A OH    1 
ATOM   2136 N  N     . MET A 1 278 ? 54.333 -19.822 11.167  1.00 19.29  ? 275  MET A N     1 
ATOM   2137 C  CA    . MET A 1 278 ? 54.433 -20.223 9.782   1.00 21.06  ? 275  MET A CA    1 
ATOM   2138 C  C     . MET A 1 278 ? 55.230 -21.527 9.595   1.00 25.04  ? 275  MET A C     1 
ATOM   2139 O  O     . MET A 1 278 ? 54.853 -22.381 8.795   1.00 22.13  ? 275  MET A O     1 
ATOM   2140 C  CB    . MET A 1 278 ? 55.060 -19.074 8.969   1.00 26.11  ? 275  MET A CB    1 
ATOM   2141 C  CG    . MET A 1 278 ? 54.705 -19.126 7.505   1.00 28.44  ? 275  MET A CG    1 
ATOM   2142 S  SD    . MET A 1 278 ? 52.944 -18.860 7.149   1.00 30.97  ? 275  MET A SD    1 
ATOM   2143 C  CE    . MET A 1 278 ? 53.028 -19.264 5.404   1.00 34.95  ? 275  MET A CE    1 
ATOM   2144 N  N     . GLY A 1 279 ? 56.311 -21.704 10.350  1.00 21.17  ? 276  GLY A N     1 
ATOM   2145 C  CA    . GLY A 1 279 ? 57.153 -22.874 10.154  1.00 23.43  ? 276  GLY A CA    1 
ATOM   2146 C  C     . GLY A 1 279 ? 56.447 -24.179 10.484  1.00 28.81  ? 276  GLY A C     1 
ATOM   2147 O  O     . GLY A 1 279 ? 56.767 -25.237 9.918   1.00 27.82  ? 276  GLY A O     1 
ATOM   2148 N  N     . GLU A 1 280 ? 55.462 -24.112 11.377  1.00 20.51  ? 277  GLU A N     1 
ATOM   2149 C  CA    . GLU A 1 280 ? 54.733 -25.318 11.767  1.00 21.39  ? 277  GLU A CA    1 
ATOM   2150 C  C     . GLU A 1 280 ? 53.930 -25.914 10.604  1.00 24.11  ? 277  GLU A C     1 
ATOM   2151 O  O     . GLU A 1 280 ? 53.494 -27.065 10.666  1.00 26.90  ? 277  GLU A O     1 
ATOM   2152 C  CB    . GLU A 1 280 ? 53.785 -25.039 12.939  1.00 19.64  ? 277  GLU A CB    1 
ATOM   2153 C  CG    . GLU A 1 280 ? 54.447 -24.550 14.223  1.00 26.50  ? 277  GLU A CG    1 
ATOM   2154 C  CD    . GLU A 1 280 ? 53.437 -24.376 15.350  1.00 33.07  ? 277  GLU A CD    1 
ATOM   2155 O  OE1   . GLU A 1 280 ? 53.151 -23.225 15.697  1.00 31.96  ? 277  GLU A OE1   1 
ATOM   2156 O  OE2   . GLU A 1 280 ? 52.933 -25.386 15.893  1.00 33.92  ? 277  GLU A OE2   1 
ATOM   2157 N  N     . LEU A 1 281 ? 53.717 -25.140 9.550   1.00 22.81  ? 278  LEU A N     1 
ATOM   2158 C  CA    . LEU A 1 281 ? 52.977 -25.654 8.391   1.00 19.64  ? 278  LEU A CA    1 
ATOM   2159 C  C     . LEU A 1 281 ? 53.718 -26.771 7.656   1.00 19.67  ? 278  LEU A C     1 
ATOM   2160 O  O     . LEU A 1 281 ? 53.101 -27.548 6.926   1.00 23.17  ? 278  LEU A O     1 
ATOM   2161 C  CB    . LEU A 1 281 ? 52.684 -24.529 7.396   1.00 22.14  ? 278  LEU A CB    1 
ATOM   2162 C  CG    . LEU A 1 281 ? 51.506 -23.632 7.794   1.00 25.19  ? 278  LEU A CG    1 
ATOM   2163 C  CD1   . LEU A 1 281 ? 51.486 -22.362 6.946   1.00 25.45  ? 278  LEU A CD1   1 
ATOM   2164 C  CD2   . LEU A 1 281 ? 50.230 -24.412 7.607   1.00 23.12  ? 278  LEU A CD2   1 
ATOM   2165 N  N     . THR A 1 282 ? 55.041 -26.822 7.789   1.00 22.14  ? 279  THR A N     1 
ATOM   2166 C  CA    . THR A 1 282 ? 55.822 -27.780 6.997   1.00 22.68  ? 279  THR A CA    1 
ATOM   2167 C  C     . THR A 1 282 ? 55.473 -29.228 7.319   1.00 23.31  ? 279  THR A C     1 
ATOM   2168 O  O     . THR A 1 282 ? 55.793 -30.125 6.563   1.00 24.39  ? 279  THR A O     1 
ATOM   2169 C  CB    . THR A 1 282 ? 57.355 -27.646 7.209   1.00 26.21  ? 279  THR A CB    1 
ATOM   2170 O  OG1   . THR A 1 282 ? 57.659 -27.864 8.589   1.00 27.17  ? 279  THR A OG1   1 
ATOM   2171 C  CG2   . THR A 1 282 ? 57.878 -26.268 6.752   1.00 23.60  ? 279  THR A CG2   1 
ATOM   2172 N  N     . GLN A 1 283 ? 54.839 -29.452 8.451   1.00 23.46  ? 280  GLN A N     1 
ATOM   2173 C  CA    . GLN A 1 283 ? 54.548 -30.818 8.869   1.00 26.90  ? 280  GLN A CA    1 
ATOM   2174 C  C     . GLN A 1 283 ? 53.307 -31.443 8.242   1.00 35.06  ? 280  GLN A C     1 
ATOM   2175 O  O     . GLN A 1 283 ? 52.961 -32.586 8.519   1.00 35.37  ? 280  GLN A O     1 
ATOM   2176 C  CB    . GLN A 1 283 ? 54.409 -30.837 10.390  1.00 29.98  ? 280  GLN A CB    1 
ATOM   2177 C  CG    A GLN A 1 283 ? 55.705 -31.028 11.167  0.46 35.25  ? 280  GLN A CG    1 
ATOM   2178 C  CG    B GLN A 1 283 ? 53.222 -30.121 10.940  0.54 28.85  ? 280  GLN A CG    1 
ATOM   2179 C  CD    A GLN A 1 283 ? 56.870 -31.449 10.267  0.46 29.55  ? 280  GLN A CD    1 
ATOM   2180 C  CD    B GLN A 1 283 ? 53.405 -29.840 12.422  0.54 35.57  ? 280  GLN A CD    1 
ATOM   2181 O  OE1   A GLN A 1 283 ? 57.485 -30.651 9.539   0.46 33.81  ? 280  GLN A OE1   1 
ATOM   2182 O  OE1   B GLN A 1 283 ? 54.074 -30.602 13.131  0.54 41.71  ? 280  GLN A OE1   1 
ATOM   2183 N  NE2   A GLN A 1 283 ? 57.140 -32.734 10.290  0.46 31.23  ? 280  GLN A NE2   1 
ATOM   2184 N  NE2   B GLN A 1 283 ? 52.831 -28.745 12.893  0.54 22.62  ? 280  GLN A NE2   1 
ATOM   2185 N  N     . PHE A 1 284 ? 52.646 -30.691 7.385   1.00 24.73  ? 281  PHE A N     1 
ATOM   2186 C  CA    . PHE A 1 284 ? 51.457 -31.184 6.742   1.00 21.93  ? 281  PHE A CA    1 
ATOM   2187 C  C     . PHE A 1 284 ? 51.741 -31.512 5.280   1.00 28.76  ? 281  PHE A C     1 
ATOM   2188 O  O     . PHE A 1 284 ? 52.597 -30.885 4.657   1.00 29.25  ? 281  PHE A O     1 
ATOM   2189 C  CB    . PHE A 1 284 ? 50.350 -30.152 6.875   1.00 20.46  ? 281  PHE A CB    1 
ATOM   2190 C  CG    . PHE A 1 284 ? 49.999 -29.852 8.303   1.00 24.10  ? 281  PHE A CG    1 
ATOM   2191 C  CD1   . PHE A 1 284 ? 49.161 -30.702 9.019   1.00 29.91  ? 281  PHE A CD1   1 
ATOM   2192 C  CD2   . PHE A 1 284 ? 50.522 -28.736 8.942   1.00 24.87  ? 281  PHE A CD2   1 
ATOM   2193 C  CE1   . PHE A 1 284 ? 48.841 -30.430 10.346  1.00 29.24  ? 281  PHE A CE1   1 
ATOM   2194 C  CE2   . PHE A 1 284 ? 50.206 -28.465 10.264  1.00 27.18  ? 281  PHE A CE2   1 
ATOM   2195 C  CZ    . PHE A 1 284 ? 49.373 -29.317 10.969  1.00 27.88  ? 281  PHE A CZ    1 
ATOM   2196 N  N     . THR A 1 285 ? 51.050 -32.505 4.734   1.00 24.60  ? 282  THR A N     1 
ATOM   2197 C  CA    . THR A 1 285 ? 51.227 -32.798 3.320   1.00 26.40  ? 282  THR A CA    1 
ATOM   2198 C  C     . THR A 1 285 ? 50.477 -31.764 2.503   1.00 20.45  ? 282  THR A C     1 
ATOM   2199 O  O     . THR A 1 285 ? 49.602 -31.068 3.022   1.00 22.53  ? 282  THR A O     1 
ATOM   2200 C  CB    . THR A 1 285 ? 50.726 -34.197 2.942   1.00 24.65  ? 282  THR A CB    1 
ATOM   2201 O  OG1   . THR A 1 285 ? 49.308 -34.246 3.109   1.00 25.44  ? 282  THR A OG1   1 
ATOM   2202 C  CG2   . THR A 1 285 ? 51.404 -35.251 3.817   1.00 25.82  ? 282  THR A CG2   1 
ATOM   2203 N  N     . GLU A 1 286 ? 50.838 -31.654 1.233   1.00 24.25  ? 283  GLU A N     1 
ATOM   2204 C  CA    . GLU A 1 286 ? 50.173 -30.706 0.367   1.00 27.50  ? 283  GLU A CA    1 
ATOM   2205 C  C     . GLU A 1 286 ? 48.691 -31.077 0.274   1.00 24.53  ? 283  GLU A C     1 
ATOM   2206 O  O     . GLU A 1 286 ? 47.835 -30.199 0.304   1.00 23.53  ? 283  GLU A O     1 
ATOM   2207 C  CB    . GLU A 1 286 ? 50.829 -30.670 -1.015  1.00 24.67  ? 283  GLU A CB    1 
ATOM   2208 C  CG    . GLU A 1 286 ? 50.230 -29.617 -1.922  1.00 24.27  ? 283  GLU A CG    1 
ATOM   2209 C  CD    . GLU A 1 286 ? 50.962 -29.493 -3.244  1.00 38.49  ? 283  GLU A CD    1 
ATOM   2210 O  OE1   . GLU A 1 286 ? 51.975 -30.190 -3.438  1.00 34.89  ? 283  GLU A OE1   1 
ATOM   2211 O  OE2   . GLU A 1 286 ? 50.535 -28.672 -4.080  1.00 34.89  ? 283  GLU A OE2   1 
ATOM   2212 N  N     A SER A 1 287 ? 48.397 -32.376 0.203   0.78 21.84  ? 284  SER A N     1 
ATOM   2213 N  N     B SER A 1 287 ? 48.398 -32.372 0.183   0.22 22.04  ? 284  SER A N     1 
ATOM   2214 C  CA    . SER A 1 287 ? 47.013 -32.827 0.113   1.00 23.11  ? 284  SER A CA    1 
ATOM   2215 C  C     . SER A 1 287 ? 46.254 -32.463 1.384   1.00 25.57  ? 284  SER A C     1 
ATOM   2216 O  O     . SER A 1 287 ? 45.080 -32.098 1.328   1.00 22.68  ? 284  SER A O     1 
ATOM   2217 C  CB    . SER A 1 287 ? 46.941 -34.350 -0.129  1.00 25.78  ? 284  SER A CB    1 
ATOM   2218 O  OG    A SER A 1 287 ? 47.497 -34.715 -1.384  0.78 29.99  ? 284  SER A OG    1 
ATOM   2219 O  OG    B SER A 1 287 ? 47.666 -35.071 0.851   0.22 27.02  ? 284  SER A OG    1 
ATOM   2220 N  N     . GLN A 1 288 ? 46.925 -32.546 2.530   1.00 24.67  ? 285  GLN A N     1 
ATOM   2221 C  CA    . GLN A 1 288 ? 46.273 -32.205 3.795   1.00 23.92  ? 285  GLN A CA    1 
ATOM   2222 C  C     . GLN A 1 288 ? 45.855 -30.731 3.773   1.00 23.74  ? 285  GLN A C     1 
ATOM   2223 O  O     . GLN A 1 288 ? 44.725 -30.381 4.097   1.00 25.03  ? 285  GLN A O     1 
ATOM   2224 C  CB    . GLN A 1 288 ? 47.198 -32.468 4.992   1.00 20.83  ? 285  GLN A CB    1 
ATOM   2225 C  CG    . GLN A 1 288 ? 47.256 -33.909 5.469   1.00 30.47  ? 285  GLN A CG    1 
ATOM   2226 C  CD    . GLN A 1 288 ? 48.270 -34.116 6.587   1.00 33.56  ? 285  GLN A CD    1 
ATOM   2227 O  OE1   . GLN A 1 288 ? 49.410 -33.677 6.504   1.00 28.88  ? 285  GLN A OE1   1 
ATOM   2228 N  NE2   . GLN A 1 288 ? 47.843 -34.787 7.651   1.00 44.30  ? 285  GLN A NE2   1 
ATOM   2229 N  N     . LEU A 1 289 ? 46.779 -29.867 3.385   1.00 24.19  ? 286  LEU A N     1 
ATOM   2230 C  CA    . LEU A 1 289 ? 46.470 -28.441 3.347   1.00 20.31  ? 286  LEU A CA    1 
ATOM   2231 C  C     . LEU A 1 289 ? 45.389 -28.130 2.323   1.00 24.98  ? 286  LEU A C     1 
ATOM   2232 O  O     . LEU A 1 289 ? 44.539 -27.288 2.565   1.00 24.36  ? 286  LEU A O     1 
ATOM   2233 C  CB    . LEU A 1 289 ? 47.712 -27.619 3.029   1.00 20.75  ? 286  LEU A CB    1 
ATOM   2234 C  CG    . LEU A 1 289 ? 48.805 -27.766 4.078   1.00 19.93  ? 286  LEU A CG    1 
ATOM   2235 C  CD1   . LEU A 1 289 ? 50.042 -26.982 3.654   1.00 20.71  ? 286  LEU A CD1   1 
ATOM   2236 C  CD2   . LEU A 1 289 ? 48.294 -27.352 5.453   1.00 24.14  ? 286  LEU A CD2   1 
ATOM   2237 N  N     . GLN A 1 290 ? 45.454 -28.773 1.162   1.00 23.64  ? 287  GLN A N     1 
ATOM   2238 C  CA    . GLN A 1 290 ? 44.413 -28.582 0.150   1.00 25.91  ? 287  GLN A CA    1 
ATOM   2239 C  C     . GLN A 1 290 ? 43.042 -29.042 0.668   1.00 28.93  ? 287  GLN A C     1 
ATOM   2240 O  O     . GLN A 1 290 ? 42.007 -28.434 0.351   1.00 26.40  ? 287  GLN A O     1 
ATOM   2241 C  CB    . GLN A 1 290 ? 44.774 -29.339 -1.132  1.00 24.27  ? 287  GLN A CB    1 
ATOM   2242 C  CG    . GLN A 1 290 ? 45.907 -28.713 -1.938  1.00 27.19  ? 287  GLN A CG    1 
ATOM   2243 C  CD    . GLN A 1 290 ? 46.303 -29.580 -3.108  1.00 31.63  ? 287  GLN A CD    1 
ATOM   2244 O  OE1   . GLN A 1 290 ? 46.314 -30.814 -3.007  1.00 31.69  ? 287  GLN A OE1   1 
ATOM   2245 N  NE2   . GLN A 1 290 ? 46.633 -28.950 -4.226  1.00 33.00  ? 287  GLN A NE2   1 
ATOM   2246 N  N     . SER A 1 291 ? 43.025 -30.093 1.483   1.00 25.54  ? 288  SER A N     1 
ATOM   2247 C  CA    . SER A 1 291 ? 41.743 -30.591 1.994   1.00 25.18  ? 288  SER A CA    1 
ATOM   2248 C  C     . SER A 1 291 ? 41.059 -29.558 2.886   1.00 29.80  ? 288  SER A C     1 
ATOM   2249 O  O     . SER A 1 291 ? 39.829 -29.437 2.897   1.00 34.24  ? 288  SER A O     1 
ATOM   2250 C  CB    . SER A 1 291 ? 41.917 -31.903 2.768   1.00 25.35  ? 288  SER A CB    1 
ATOM   2251 O  OG    A SER A 1 291 ? 42.297 -31.674 4.120   0.65 29.94  ? 288  SER A OG    1 
ATOM   2252 O  OG    B SER A 1 291 ? 40.671 -32.568 2.867   0.35 26.76  ? 288  SER A OG    1 
ATOM   2253 N  N     . HIS A 1 292 ? 41.854 -28.797 3.622   1.00 28.17  ? 289  HIS A N     1 
ATOM   2254 C  CA    . HIS A 1 292 ? 41.294 -27.825 4.541   1.00 26.45  ? 289  HIS A CA    1 
ATOM   2255 C  C     . HIS A 1 292 ? 41.016 -26.485 3.872   1.00 33.68  ? 289  HIS A C     1 
ATOM   2256 O  O     . HIS A 1 292 ? 40.014 -25.842 4.168   1.00 37.28  ? 289  HIS A O     1 
ATOM   2257 C  CB    . HIS A 1 292 ? 42.236 -27.600 5.726   1.00 32.11  ? 289  HIS A CB    1 
ATOM   2258 C  CG    . HIS A 1 292 ? 42.422 -28.797 6.610   1.00 28.32  ? 289  HIS A CG    1 
ATOM   2259 N  ND1   . HIS A 1 292 ? 41.415 -29.304 7.402   1.00 38.23  ? 289  HIS A ND1   1 
ATOM   2260 C  CD2   . HIS A 1 292 ? 43.521 -29.544 6.876   1.00 33.11  ? 289  HIS A CD2   1 
ATOM   2261 C  CE1   . HIS A 1 292 ? 41.875 -30.329 8.097   1.00 30.98  ? 289  HIS A CE1   1 
ATOM   2262 N  NE2   . HIS A 1 292 ? 43.150 -30.495 7.798   1.00 41.18  ? 289  HIS A NE2   1 
ATOM   2263 N  N     . PHE A 1 293 ? 41.914 -26.057 2.983   1.00 26.88  ? 290  PHE A N     1 
ATOM   2264 C  CA    . PHE A 1 293 ? 41.898 -24.667 2.532   1.00 27.32  ? 290  PHE A CA    1 
ATOM   2265 C  C     . PHE A 1 293 ? 41.653 -24.510 1.028   1.00 30.36  ? 290  PHE A C     1 
ATOM   2266 O  O     . PHE A 1 293 ? 41.754 -23.406 0.477   1.00 29.90  ? 290  PHE A O     1 
ATOM   2267 C  CB    . PHE A 1 293 ? 43.217 -24.001 2.960   1.00 24.42  ? 290  PHE A CB    1 
ATOM   2268 C  CG    . PHE A 1 293 ? 43.527 -24.210 4.422   1.00 23.52  ? 290  PHE A CG    1 
ATOM   2269 C  CD1   . PHE A 1 293 ? 42.699 -23.683 5.407   1.00 24.25  ? 290  PHE A CD1   1 
ATOM   2270 C  CD2   . PHE A 1 293 ? 44.616 -24.969 4.812   1.00 25.33  ? 290  PHE A CD2   1 
ATOM   2271 C  CE1   . PHE A 1 293 ? 42.960 -23.907 6.754   1.00 24.87  ? 290  PHE A CE1   1 
ATOM   2272 C  CE2   . PHE A 1 293 ? 44.888 -25.195 6.156   1.00 26.29  ? 290  PHE A CE2   1 
ATOM   2273 C  CZ    . PHE A 1 293 ? 44.059 -24.662 7.127   1.00 27.58  ? 290  PHE A CZ    1 
ATOM   2274 N  N     . GLY A 1 294 ? 41.304 -25.612 0.370   1.00 28.62  ? 291  GLY A N     1 
ATOM   2275 C  CA    . GLY A 1 294 ? 41.085 -25.597 -1.065  1.00 27.93  ? 291  GLY A CA    1 
ATOM   2276 C  C     . GLY A 1 294 ? 42.366 -25.862 -1.822  1.00 32.36  ? 291  GLY A C     1 
ATOM   2277 O  O     . GLY A 1 294 ? 43.458 -25.766 -1.261  1.00 27.25  ? 291  GLY A O     1 
ATOM   2278 N  N     . GLU A 1 295 ? 42.223 -26.175 -3.106  1.00 27.75  ? 292  GLU A N     1 
ATOM   2279 C  CA    . GLU A 1 295 ? 43.331 -26.556 -3.960  1.00 29.12  ? 292  GLU A CA    1 
ATOM   2280 C  C     . GLU A 1 295 ? 44.367 -25.452 -4.084  1.00 30.03  ? 292  GLU A C     1 
ATOM   2281 O  O     . GLU A 1 295 ? 45.565 -25.683 -3.892  1.00 25.86  ? 292  GLU A O     1 
ATOM   2282 C  CB    . GLU A 1 295 ? 42.810 -26.943 -5.348  1.00 29.42  ? 292  GLU A CB    1 
ATOM   2283 C  CG    . GLU A 1 295 ? 43.860 -27.467 -6.300  1.00 37.17  ? 292  GLU A CG    1 
ATOM   2284 C  CD    . GLU A 1 295 ? 43.287 -27.814 -7.674  1.00 59.84  ? 292  GLU A CD    1 
ATOM   2285 O  OE1   . GLU A 1 295 ? 44.031 -27.699 -8.673  1.00 69.48  ? 292  GLU A OE1   1 
ATOM   2286 O  OE2   . GLU A 1 295 ? 42.099 -28.201 -7.760  1.00 50.01  ? 292  GLU A OE2   1 
ATOM   2287 N  N     . LYS A 1 296 ? 43.907 -24.252 -4.421  1.00 24.20  ? 293  LYS A N     1 
ATOM   2288 C  CA    . LYS A 1 296 ? 44.826 -23.143 -4.635  1.00 24.36  ? 293  LYS A CA    1 
ATOM   2289 C  C     . LYS A 1 296 ? 45.547 -22.740 -3.349  1.00 25.58  ? 293  LYS A C     1 
ATOM   2290 O  O     . LYS A 1 296 ? 46.784 -22.673 -3.320  1.00 23.89  ? 293  LYS A O     1 
ATOM   2291 C  CB    . LYS A 1 296 ? 44.082 -21.931 -5.225  1.00 24.63  ? 293  LYS A CB    1 
ATOM   2292 C  CG    . LYS A 1 296 ? 44.975 -21.049 -6.082  1.00 41.99  ? 293  LYS A CG    1 
ATOM   2293 C  CD    . LYS A 1 296 ? 44.176 -20.086 -6.960  1.00 44.09  ? 293  LYS A CD    1 
ATOM   2294 C  CE    . LYS A 1 296 ? 45.071 -19.396 -7.999  1.00 59.32  ? 293  LYS A CE    1 
ATOM   2295 N  NZ    . LYS A 1 296 ? 46.236 -20.225 -8.434  1.00 61.31  ? 293  LYS A NZ    1 
ATOM   2296 N  N     . ASN A 1 297 ? 44.781 -22.481 -2.293  1.00 25.06  ? 294  ASN A N     1 
ATOM   2297 C  CA    . ASN A 1 297 ? 45.368 -22.048 -1.019  1.00 25.29  ? 294  ASN A CA    1 
ATOM   2298 C  C     . ASN A 1 297 ? 46.274 -23.105 -0.424  1.00 24.73  ? 294  ASN A C     1 
ATOM   2299 O  O     . ASN A 1 297 ? 47.311 -22.782 0.131   1.00 23.08  ? 294  ASN A O     1 
ATOM   2300 C  CB    . ASN A 1 297 ? 44.303 -21.721 0.016   1.00 27.97  ? 294  ASN A CB    1 
ATOM   2301 C  CG    . ASN A 1 297 ? 43.584 -20.440 -0.266  1.00 34.19  ? 294  ASN A CG    1 
ATOM   2302 O  OD1   . ASN A 1 297 ? 44.097 -19.562 -0.958  1.00 33.72  ? 294  ASN A OD1   1 
ATOM   2303 N  ND2   . ASN A 1 297 ? 42.374 -20.322 0.271   1.00 32.87  ? 294  ASN A ND2   1 
ATOM   2304 N  N     . GLY A 1 298 ? 45.868 -24.369 -0.496  1.00 27.68  ? 295  GLY A N     1 
ATOM   2305 C  CA    . GLY A 1 298 ? 46.681 -25.437 0.073   1.00 24.60  ? 295  GLY A CA    1 
ATOM   2306 C  C     . GLY A 1 298 ? 48.044 -25.583 -0.606  1.00 24.46  ? 295  GLY A C     1 
ATOM   2307 O  O     . GLY A 1 298 ? 49.068 -25.778 0.056   1.00 24.46  ? 295  GLY A O     1 
ATOM   2308 N  N     . SER A 1 299 ? 48.058 -25.506 -1.934  1.00 22.12  ? 296  SER A N     1 
ATOM   2309 C  CA    . SER A 1 299 ? 49.297 -25.583 -2.702  1.00 20.69  ? 296  SER A CA    1 
ATOM   2310 C  C     . SER A 1 299 ? 50.176 -24.375 -2.369  1.00 23.37  ? 296  SER A C     1 
ATOM   2311 O  O     . SER A 1 299 ? 51.385 -24.491 -2.240  1.00 24.57  ? 296  SER A O     1 
ATOM   2312 C  CB    . SER A 1 299 ? 49.014 -25.626 -4.214  1.00 27.87  ? 296  SER A CB    1 
ATOM   2313 O  OG    . SER A 1 299 ? 48.610 -26.920 -4.625  1.00 30.84  ? 296  SER A OG    1 
ATOM   2314 N  N     . TRP A 1 300 ? 49.543 -23.217 -2.250  1.00 23.06  ? 297  TRP A N     1 
ATOM   2315 C  CA    . TRP A 1 300 ? 50.243 -21.976 -1.949  1.00 20.23  ? 297  TRP A CA    1 
ATOM   2316 C  C     . TRP A 1 300 ? 50.888 -22.074 -0.572  1.00 24.77  ? 297  TRP A C     1 
ATOM   2317 O  O     . TRP A 1 300 ? 52.089 -21.821 -0.433  1.00 23.44  ? 297  TRP A O     1 
ATOM   2318 C  CB    . TRP A 1 300 ? 49.275 -20.786 -2.022  1.00 20.80  ? 297  TRP A CB    1 
ATOM   2319 C  CG    . TRP A 1 300 ? 49.956 -19.465 -1.755  1.00 27.08  ? 297  TRP A CG    1 
ATOM   2320 C  CD1   . TRP A 1 300 ? 50.632 -18.696 -2.663  1.00 31.05  ? 297  TRP A CD1   1 
ATOM   2321 C  CD2   . TRP A 1 300 ? 50.023 -18.760 -0.507  1.00 25.19  ? 297  TRP A CD2   1 
ATOM   2322 N  NE1   . TRP A 1 300 ? 51.124 -17.567 -2.054  1.00 33.63  ? 297  TRP A NE1   1 
ATOM   2323 C  CE2   . TRP A 1 300 ? 50.762 -17.580 -0.732  1.00 28.22  ? 297  TRP A CE2   1 
ATOM   2324 C  CE3   . TRP A 1 300 ? 49.536 -19.012 0.777   1.00 27.02  ? 297  TRP A CE3   1 
ATOM   2325 C  CZ2   . TRP A 1 300 ? 51.016 -16.653 0.277   1.00 27.83  ? 297  TRP A CZ2   1 
ATOM   2326 C  CZ3   . TRP A 1 300 ? 49.801 -18.094 1.779   1.00 30.97  ? 297  TRP A CZ3   1 
ATOM   2327 C  CH2   . TRP A 1 300 ? 50.530 -16.931 1.524   1.00 26.42  ? 297  TRP A CH2   1 
ATOM   2328 N  N     . LEU A 1 301 ? 50.100 -22.480 0.427   1.00 23.76  ? 298  LEU A N     1 
ATOM   2329 C  CA    . LEU A 1 301 ? 50.617 -22.661 1.792   1.00 24.45  ? 298  LEU A CA    1 
ATOM   2330 C  C     . LEU A 1 301 ? 51.743 -23.687 1.875   1.00 23.59  ? 298  LEU A C     1 
ATOM   2331 O  O     . LEU A 1 301 ? 52.731 -23.488 2.594   1.00 21.39  ? 298  LEU A O     1 
ATOM   2332 C  CB    . LEU A 1 301 ? 49.495 -23.083 2.747   1.00 20.96  ? 298  LEU A CB    1 
ATOM   2333 C  CG    . LEU A 1 301 ? 48.474 -22.014 3.176   1.00 22.37  ? 298  LEU A CG    1 
ATOM   2334 C  CD1   . LEU A 1 301 ? 47.230 -22.639 3.780   1.00 22.61  ? 298  LEU A CD1   1 
ATOM   2335 C  CD2   . LEU A 1 301 ? 49.085 -21.019 4.175   1.00 26.41  ? 298  LEU A CD2   1 
ATOM   2336 N  N     . TYR A 1 302 ? 51.584 -24.795 1.169   1.00 20.56  ? 299  TYR A N     1 
ATOM   2337 C  CA    . TYR A 1 302 ? 52.591 -25.856 1.210   1.00 21.61  ? 299  TYR A CA    1 
ATOM   2338 C  C     . TYR A 1 302 ? 53.957 -25.334 0.730   1.00 26.82  ? 299  TYR A C     1 
ATOM   2339 O  O     . TYR A 1 302 ? 54.994 -25.578 1.365   1.00 20.78  ? 299  TYR A O     1 
ATOM   2340 C  CB    . TYR A 1 302 ? 52.131 -27.060 0.368   1.00 19.50  ? 299  TYR A CB    1 
ATOM   2341 C  CG    . TYR A 1 302 ? 53.138 -28.203 0.355   1.00 23.62  ? 299  TYR A CG    1 
ATOM   2342 C  CD1   . TYR A 1 302 ? 53.153 -29.144 1.372   1.00 24.81  ? 299  TYR A CD1   1 
ATOM   2343 C  CD2   . TYR A 1 302 ? 54.088 -28.315 -0.656  1.00 28.76  ? 299  TYR A CD2   1 
ATOM   2344 C  CE1   . TYR A 1 302 ? 54.075 -30.184 1.383   1.00 26.99  ? 299  TYR A CE1   1 
ATOM   2345 C  CE2   . TYR A 1 302 ? 55.021 -29.348 -0.648  1.00 30.90  ? 299  TYR A CE2   1 
ATOM   2346 C  CZ    . TYR A 1 302 ? 54.997 -30.281 0.378   1.00 34.54  ? 299  TYR A CZ    1 
ATOM   2347 O  OH    . TYR A 1 302 ? 55.907 -31.314 0.406   1.00 37.32  ? 299  TYR A OH    1 
ATOM   2348 N  N     . ALA A 1 303 ? 53.956 -24.588 -0.373  1.00 23.31  ? 300  ALA A N     1 
ATOM   2349 C  CA    . ALA A 1 303 ? 55.197 -23.997 -0.876  1.00 19.38  ? 300  ALA A CA    1 
ATOM   2350 C  C     . ALA A 1 303 ? 55.647 -22.803 -0.023  1.00 17.38  ? 300  ALA A C     1 
ATOM   2351 O  O     . ALA A 1 303 ? 56.843 -22.635 0.232   1.00 19.70  ? 300  ALA A O     1 
ATOM   2352 C  CB    . ALA A 1 303 ? 55.027 -23.562 -2.360  1.00 24.58  ? 300  ALA A CB    1 
ATOM   2353 N  N     . MET A 1 304 ? 54.703 -21.977 0.417   1.00 18.31  ? 301  MET A N     1 
ATOM   2354 C  CA    . MET A 1 304 ? 55.064 -20.727 1.117   1.00 19.74  ? 301  MET A CA    1 
ATOM   2355 C  C     . MET A 1 304 ? 55.770 -20.965 2.437   1.00 17.14  ? 301  MET A C     1 
ATOM   2356 O  O     . MET A 1 304 ? 56.690 -20.219 2.790   1.00 19.07  ? 301  MET A O     1 
ATOM   2357 C  CB    . MET A 1 304 ? 53.843 -19.861 1.378   1.00 21.72  ? 301  MET A CB    1 
ATOM   2358 C  CG    . MET A 1 304 ? 54.189 -18.426 1.829   1.00 25.90  ? 301  MET A CG    1 
ATOM   2359 S  SD    . MET A 1 304 ? 54.949 -17.509 0.479   1.00 28.88  ? 301  MET A SD    1 
ATOM   2360 C  CE    . MET A 1 304 ? 56.720 -17.591 0.877   1.00 23.85  ? 301  MET A CE    1 
ATOM   2361 N  N     . CYS A 1 305 ? 55.356 -21.991 3.170   1.00 21.66  ? 302  CYS A N     1 
ATOM   2362 C  CA    . CYS A 1 305 ? 56.010 -22.263 4.451   1.00 21.41  ? 302  CYS A CA    1 
ATOM   2363 C  C     . CYS A 1 305 ? 57.454 -22.768 4.257   1.00 21.86  ? 302  CYS A C     1 
ATOM   2364 O  O     . CYS A 1 305 ? 58.241 -22.779 5.206   1.00 26.01  ? 302  CYS A O     1 
ATOM   2365 C  CB    . CYS A 1 305 ? 55.205 -23.253 5.290   1.00 20.17  ? 302  CYS A CB    1 
ATOM   2366 S  SG    . CYS A 1 305 ? 55.111 -24.912 4.633   1.00 22.21  ? 302  CYS A SG    1 
ATOM   2367 N  N     . ARG A 1 306 ? 57.794 -23.153 3.027   1.00 18.31  ? 303  ARG A N     1 
ATOM   2368 C  CA    . ARG A 1 306 ? 59.147 -23.542 2.646   1.00 19.07  ? 303  ARG A CA    1 
ATOM   2369 C  C     . ARG A 1 306 ? 59.917 -22.376 1.972   1.00 21.14  ? 303  ARG A C     1 
ATOM   2370 O  O     . ARG A 1 306 ? 61.051 -22.540 1.520   1.00 22.63  ? 303  ARG A O     1 
ATOM   2371 C  CB    . ARG A 1 306 ? 59.084 -24.779 1.720   1.00 21.91  ? 303  ARG A CB    1 
ATOM   2372 C  CG    . ARG A 1 306 ? 58.533 -26.013 2.448   1.00 24.22  ? 303  ARG A CG    1 
ATOM   2373 C  CD    . ARG A 1 306 ? 58.181 -27.194 1.530   1.00 26.49  ? 303  ARG A CD    1 
ATOM   2374 N  NE    . ARG A 1 306 ? 57.990 -28.402 2.338   1.00 25.76  ? 303  ARG A NE    1 
ATOM   2375 C  CZ    . ARG A 1 306 ? 56.904 -28.657 3.065   1.00 27.30  ? 303  ARG A CZ    1 
ATOM   2376 N  NH1   . ARG A 1 306 ? 56.834 -29.773 3.784   1.00 25.13  ? 303  ARG A NH1   1 
ATOM   2377 N  NH2   . ARG A 1 306 ? 55.875 -27.810 3.064   1.00 24.03  ? 303  ARG A NH2   1 
ATOM   2378 N  N     . GLY A 1 307 ? 59.304 -21.201 1.956   1.00 17.27  ? 304  GLY A N     1 
ATOM   2379 C  CA    . GLY A 1 307 ? 59.927 -19.992 1.417   1.00 17.13  ? 304  GLY A CA    1 
ATOM   2380 C  C     . GLY A 1 307 ? 59.728 -19.832 -0.077  1.00 20.10  ? 304  GLY A C     1 
ATOM   2381 O  O     . GLY A 1 307 ? 60.407 -19.037 -0.735  1.00 20.07  ? 304  GLY A O     1 
ATOM   2382 N  N     . ILE A 1 308 ? 58.803 -20.604 -0.629  1.00 21.80  ? 305  ILE A N     1 
ATOM   2383 C  CA    . ILE A 1 308 ? 58.631 -20.644 -2.081  1.00 21.80  ? 305  ILE A CA    1 
ATOM   2384 C  C     . ILE A 1 308 ? 57.266 -20.121 -2.503  1.00 22.35  ? 305  ILE A C     1 
ATOM   2385 O  O     . ILE A 1 308 ? 56.244 -20.517 -1.959  1.00 21.17  ? 305  ILE A O     1 
ATOM   2386 C  CB    . ILE A 1 308 ? 58.837 -22.090 -2.594  1.00 25.52  ? 305  ILE A CB    1 
ATOM   2387 C  CG1   . ILE A 1 308 ? 60.290 -22.505 -2.330  1.00 26.67  ? 305  ILE A CG1   1 
ATOM   2388 C  CG2   . ILE A 1 308 ? 58.460 -22.229 -4.058  1.00 23.65  ? 305  ILE A CG2   1 
ATOM   2389 C  CD1   . ILE A 1 308 ? 60.596 -23.954 -2.724  1.00 32.68  ? 305  ILE A CD1   1 
ATOM   2390 N  N     . GLU A 1 309 ? 57.262 -19.202 -3.469  1.00 18.18  ? 306  GLU A N     1 
ATOM   2391 C  CA    . GLU A 1 309 ? 56.004 -18.659 -3.986  1.00 23.39  ? 306  GLU A CA    1 
ATOM   2392 C  C     . GLU A 1 309 ? 56.249 -18.173 -5.404  1.00 28.92  ? 306  GLU A C     1 
ATOM   2393 O  O     . GLU A 1 309 ? 57.322 -17.637 -5.697  1.00 25.84  ? 306  GLU A O     1 
ATOM   2394 C  CB    . GLU A 1 309 ? 55.490 -17.511 -3.119  1.00 33.94  ? 306  GLU A CB    1 
ATOM   2395 C  CG    . GLU A 1 309 ? 54.136 -17.019 -3.554  1.00 44.02  ? 306  GLU A CG    1 
ATOM   2396 C  CD    . GLU A 1 309 ? 53.877 -15.557 -3.249  1.00 35.56  ? 306  GLU A CD    1 
ATOM   2397 O  OE1   . GLU A 1 309 ? 54.811 -14.716 -3.340  1.00 30.09  ? 306  GLU A OE1   1 
ATOM   2398 O  OE2   . GLU A 1 309 ? 52.712 -15.250 -2.925  1.00 41.70  ? 306  GLU A OE2   1 
ATOM   2399 N  N     . HIS A 1 310 ? 55.274 -18.340 -6.293  1.00 26.67  ? 307  HIS A N     1 
ATOM   2400 C  CA    . HIS A 1 310 ? 55.567 -18.082 -7.694  1.00 30.00  ? 307  HIS A CA    1 
ATOM   2401 C  C     . HIS A 1 310 ? 54.854 -16.856 -8.282  1.00 28.34  ? 307  HIS A C     1 
ATOM   2402 O  O     . HIS A 1 310 ? 55.143 -16.482 -9.416  1.00 31.71  ? 307  HIS A O     1 
ATOM   2403 C  CB    . HIS A 1 310 ? 55.260 -19.340 -8.512  1.00 35.62  ? 307  HIS A CB    1 
ATOM   2404 C  CG    . HIS A 1 310 ? 56.188 -20.481 -8.203  1.00 40.10  ? 307  HIS A CG    1 
ATOM   2405 N  ND1   . HIS A 1 310 ? 57.558 -20.330 -8.174  1.00 43.11  ? 307  HIS A ND1   1 
ATOM   2406 C  CD2   . HIS A 1 310 ? 55.944 -21.771 -7.878  1.00 44.95  ? 307  HIS A CD2   1 
ATOM   2407 C  CE1   . HIS A 1 310 ? 58.121 -21.485 -7.862  1.00 45.02  ? 307  HIS A CE1   1 
ATOM   2408 N  NE2   . HIS A 1 310 ? 57.163 -22.378 -7.680  1.00 42.33  ? 307  HIS A NE2   1 
ATOM   2409 N  N     . ASP A 1 311 ? 53.987 -16.221 -7.497  1.00 25.12  ? 308  ASP A N     1 
ATOM   2410 C  CA    . ASP A 1 311 ? 53.210 -15.059 -7.957  1.00 23.99  ? 308  ASP A CA    1 
ATOM   2411 C  C     . ASP A 1 311 ? 54.099 -14.039 -8.668  1.00 30.22  ? 308  ASP A C     1 
ATOM   2412 O  O     . ASP A 1 311 ? 55.063 -13.544 -8.094  1.00 22.35  ? 308  ASP A O     1 
ATOM   2413 C  CB    . ASP A 1 311 ? 52.490 -14.404 -6.781  1.00 26.21  ? 308  ASP A CB    1 
ATOM   2414 C  CG    . ASP A 1 311 ? 51.578 -13.264 -7.218  1.00 32.42  ? 308  ASP A CG    1 
ATOM   2415 O  OD1   . ASP A 1 311 ? 51.412 -12.305 -6.449  1.00 42.13  ? 308  ASP A OD1   1 
ATOM   2416 O  OD2   . ASP A 1 311 ? 51.014 -13.336 -8.330  1.00 45.75  ? 308  ASP A OD2   1 
ATOM   2417 N  N     . PRO A 1 312 ? 53.807 -13.740 -9.948  1.00 24.15  ? 309  PRO A N     1 
ATOM   2418 C  CA    . PRO A 1 312 ? 54.770 -12.847 -10.591 1.00 21.67  ? 309  PRO A CA    1 
ATOM   2419 C  C     . PRO A 1 312 ? 54.591 -11.396 -10.210 1.00 18.85  ? 309  PRO A C     1 
ATOM   2420 O  O     . PRO A 1 312 ? 53.517 -10.986 -9.760  1.00 24.56  ? 309  PRO A O     1 
ATOM   2421 C  CB    . PRO A 1 312 ? 54.486 -13.033 -12.088 1.00 28.27  ? 309  PRO A CB    1 
ATOM   2422 C  CG    . PRO A 1 312 ? 53.061 -13.486 -12.144 1.00 26.47  ? 309  PRO A CG    1 
ATOM   2423 C  CD    . PRO A 1 312 ? 52.859 -14.331 -10.910 1.00 26.49  ? 309  PRO A CD    1 
ATOM   2424 N  N     . VAL A 1 313 ? 55.620 -10.623 -10.452 1.00 21.18  ? 310  VAL A N     1 
ATOM   2425 C  CA    . VAL A 1 313 ? 55.561 -9.209  -10.307 1.00 21.43  ? 310  VAL A CA    1 
ATOM   2426 C  C     . VAL A 1 313 ? 54.916 -8.768  -11.617 1.00 27.41  ? 310  VAL A C     1 
ATOM   2427 O  O     . VAL A 1 313 ? 55.490 -8.888  -12.647 1.00 24.03  ? 310  VAL A O     1 
ATOM   2428 C  CB    . VAL A 1 313 ? 56.980 -8.623  -10.232 1.00 27.34  ? 310  VAL A CB    1 
ATOM   2429 C  CG1   . VAL A 1 313 ? 56.988 -7.125  -10.354 1.00 22.93  ? 310  VAL A CG1   1 
ATOM   2430 C  CG2   . VAL A 1 313 ? 57.679 -9.037  -8.973  1.00 22.71  ? 310  VAL A CG2   1 
ATOM   2431 N  N     . LYS A 1 314 ? 53.696 -8.307  -11.534 1.00 26.37  ? 311  LYS A N     1 
ATOM   2432 C  CA    . LYS A 1 314 ? 53.018 -7.819  -12.695 1.00 28.15  ? 311  LYS A CA    1 
ATOM   2433 C  C     . LYS A 1 314 ? 53.522 -6.493  -13.158 1.00 24.30  ? 311  LYS A C     1 
ATOM   2434 O  O     . LYS A 1 314 ? 53.715 -5.577  -12.410 1.00 24.95  ? 311  LYS A O     1 
ATOM   2435 C  CB    . LYS A 1 314 ? 51.540 -7.713  -12.469 1.00 26.02  ? 311  LYS A CB    1 
ATOM   2436 C  CG    . LYS A 1 314 ? 50.877 -9.020  -12.170 1.00 34.31  ? 311  LYS A CG    1 
ATOM   2437 C  CD    . LYS A 1 314 ? 49.494 -8.790  -11.625 1.00 41.75  ? 311  LYS A CD    1 
ATOM   2438 C  CE    . LYS A 1 314 ? 48.720 -10.079 -11.570 1.00 46.73  ? 311  LYS A CE    1 
ATOM   2439 N  NZ    . LYS A 1 314 ? 47.280 -9.830  -11.742 1.00 54.43  ? 311  LYS A NZ    1 
ATOM   2440 N  N     . PRO A 1 315 ? 53.650 -6.455  -14.544 1.00 23.47  ? 312  PRO A N     1 
ATOM   2441 C  CA    . PRO A 1 315 ? 54.034 -5.150  -15.048 1.00 23.28  ? 312  PRO A CA    1 
ATOM   2442 C  C     . PRO A 1 315 ? 52.813 -4.250  -15.107 1.00 27.10  ? 312  PRO A C     1 
ATOM   2443 O  O     . PRO A 1 315 ? 52.111 -4.200  -16.070 1.00 29.46  ? 312  PRO A O     1 
ATOM   2444 C  CB    . PRO A 1 315 ? 54.536 -5.464  -16.437 1.00 32.16  ? 312  PRO A CB    1 
ATOM   2445 C  CG    . PRO A 1 315 ? 53.640 -6.518  -16.909 1.00 31.83  ? 312  PRO A CG    1 
ATOM   2446 C  CD    . PRO A 1 315 ? 53.627 -7.425  -15.755 1.00 25.65  ? 312  PRO A CD    1 
ATOM   2447 N  N     . ARG A 1 316 ? 52.578 -3.541  -14.019 1.00 24.24  ? 313  ARG A N     1 
ATOM   2448 C  CA    . ARG A 1 316 ? 51.486 -2.594  -13.928 1.00 25.32  ? 313  ARG A CA    1 
ATOM   2449 C  C     . ARG A 1 316 ? 51.888 -1.460  -13.009 1.00 27.20  ? 313  ARG A C     1 
ATOM   2450 O  O     . ARG A 1 316 ? 51.972 -1.641  -11.842 1.00 28.02  ? 313  ARG A O     1 
ATOM   2451 C  CB    . ARG A 1 316 ? 50.224 -3.269  -13.387 1.00 24.70  ? 313  ARG A CB    1 
ATOM   2452 C  CG    A ARG A 1 316 ? 49.032 -2.450  -13.247 0.54 29.85  ? 313  ARG A CG    1 
ATOM   2453 C  CG    B ARG A 1 316 ? 49.029 -2.436  -13.370 0.46 29.91  ? 313  ARG A CG    1 
ATOM   2454 C  CD    A ARG A 1 316 ? 47.886 -3.194  -12.578 0.54 33.78  ? 313  ARG A CD    1 
ATOM   2455 C  CD    B ARG A 1 316 ? 47.820 -3.128  -12.777 0.46 33.59  ? 313  ARG A CD    1 
ATOM   2456 N  NE    A ARG A 1 316 ? 48.185 -3.530  -11.187 0.54 31.81  ? 313  ARG A NE    1 
ATOM   2457 N  NE    B ARG A 1 316 ? 48.072 -3.606  -11.421 0.46 32.26  ? 313  ARG A NE    1 
ATOM   2458 C  CZ    A ARG A 1 316 ? 48.403 -4.765  -10.743 0.54 39.26  ? 313  ARG A CZ    1 
ATOM   2459 C  CZ    B ARG A 1 316 ? 48.084 -2.830  -10.341 0.46 32.60  ? 313  ARG A CZ    1 
ATOM   2460 N  NH1   A ARG A 1 316 ? 48.668 -4.974  -9.461  0.54 35.15  ? 313  ARG A NH1   1 
ATOM   2461 N  NH1   B ARG A 1 316 ? 48.319 -3.365  -9.146  0.46 29.71  ? 313  ARG A NH1   1 
ATOM   2462 N  NH2   A ARG A 1 316 ? 48.351 -5.789  -11.580 0.54 33.45  ? 313  ARG A NH2   1 
ATOM   2463 N  NH2   B ARG A 1 316 ? 47.860 -1.522  -10.446 0.46 28.63  ? 313  ARG A NH2   1 
ATOM   2464 N  N     . GLN A 1 317 ? 52.095 -0.294  -13.564 1.00 26.03  ? 314  GLN A N     1 
ATOM   2465 C  CA    . GLN A 1 317 ? 52.514 0.865   -12.788 1.00 34.28  ? 314  GLN A CA    1 
ATOM   2466 C  C     . GLN A 1 317 ? 51.321 1.732   -12.385 1.00 33.45  ? 314  GLN A C     1 
ATOM   2467 O  O     . GLN A 1 317 ? 51.400 2.514   -11.437 1.00 33.15  ? 314  GLN A O     1 
ATOM   2468 C  CB    . GLN A 1 317 ? 53.518 1.681   -13.596 1.00 35.92  ? 314  GLN A CB    1 
ATOM   2469 C  CG    . GLN A 1 317 ? 54.130 2.843   -12.871 1.00 41.36  ? 314  GLN A CG    1 
ATOM   2470 C  CD    . GLN A 1 317 ? 55.109 3.572   -13.751 1.00 42.99  ? 314  GLN A CD    1 
ATOM   2471 O  OE1   . GLN A 1 317 ? 55.498 3.062   -14.808 1.00 54.66  ? 314  GLN A OE1   1 
ATOM   2472 N  NE2   . GLN A 1 317 ? 55.523 4.763   -13.329 1.00 42.12  ? 314  GLN A NE2   1 
ATOM   2473 N  N     . LEU A 1 318 ? 50.214 1.562   -13.101 1.00 28.18  ? 315  LEU A N     1 
ATOM   2474 C  CA    . LEU A 1 318 ? 49.021 2.388   -12.930 1.00 33.24  ? 315  LEU A CA    1 
ATOM   2475 C  C     . LEU A 1 318 ? 47.857 1.612   -12.308 1.00 32.80  ? 315  LEU A C     1 
ATOM   2476 O  O     . LEU A 1 318 ? 47.683 0.421   -12.572 1.00 30.30  ? 315  LEU A O     1 
ATOM   2477 C  CB    . LEU A 1 318 ? 48.581 2.956   -14.287 1.00 32.37  ? 315  LEU A CB    1 
ATOM   2478 C  CG    . LEU A 1 318 ? 49.620 3.660   -15.168 1.00 31.89  ? 315  LEU A CG    1 
ATOM   2479 C  CD1   . LEU A 1 318 ? 49.020 3.988   -16.527 1.00 35.39  ? 315  LEU A CD1   1 
ATOM   2480 C  CD2   . LEU A 1 318 ? 50.177 4.931   -14.500 1.00 37.68  ? 315  LEU A CD2   1 
ATOM   2481 N  N     . PRO A 1 319 ? 47.043 2.291   -11.489 1.00 30.91  ? 316  PRO A N     1 
ATOM   2482 C  CA    . PRO A 1 319 ? 45.820 1.669   -10.957 1.00 31.35  ? 316  PRO A CA    1 
ATOM   2483 C  C     . PRO A 1 319 ? 44.849 1.240   -12.077 1.00 28.16  ? 316  PRO A C     1 
ATOM   2484 O  O     . PRO A 1 319 ? 44.798 1.927   -13.095 1.00 38.56  ? 316  PRO A O     1 
ATOM   2485 C  CB    . PRO A 1 319 ? 45.215 2.770   -10.074 1.00 35.19  ? 316  PRO A CB    1 
ATOM   2486 C  CG    . PRO A 1 319 ? 45.944 4.027   -10.428 1.00 37.79  ? 316  PRO A CG    1 
ATOM   2487 C  CD    . PRO A 1 319 ? 47.282 3.640   -10.947 1.00 28.83  ? 316  PRO A CD    1 
ATOM   2488 N  N     . LYS A 1 320 ? 44.144 0.117   -11.892 1.00 30.94  ? 317  LYS A N     1 
ATOM   2489 C  CA    . LYS A 1 320 ? 43.167 -0.420  -12.857 1.00 30.62  ? 317  LYS A CA    1 
ATOM   2490 C  C     . LYS A 1 320 ? 41.783 0.205   -12.723 1.00 35.82  ? 317  LYS A C     1 
ATOM   2491 O  O     . LYS A 1 320 ? 40.907 0.005   -13.569 1.00 35.94  ? 317  LYS A O     1 
ATOM   2492 C  CB    . LYS A 1 320 ? 42.971 -1.936  -12.678 1.00 38.37  ? 317  LYS A CB    1 
ATOM   2493 C  CG    . LYS A 1 320 ? 44.183 -2.829  -12.825 1.00 38.48  ? 317  LYS A CG    1 
ATOM   2494 C  CD    . LYS A 1 320 ? 43.742 -4.299  -12.797 1.00 39.34  ? 317  LYS A CD    1 
ATOM   2495 C  CE    . LYS A 1 320 ? 44.930 -5.234  -12.962 1.00 49.59  ? 317  LYS A CE    1 
ATOM   2496 N  NZ    . LYS A 1 320 ? 44.553 -6.569  -13.505 1.00 50.96  ? 317  LYS A NZ    1 
ATOM   2497 N  N     . THR A 1 321 ? 41.568 0.901   -11.615 1.00 32.67  ? 318  THR A N     1 
ATOM   2498 C  CA    . THR A 1 321 ? 40.265 1.480   -11.310 1.00 32.62  ? 318  THR A CA    1 
ATOM   2499 C  C     . THR A 1 321 ? 40.516 2.867   -10.756 1.00 31.50  ? 318  THR A C     1 
ATOM   2500 O  O     . THR A 1 321 ? 41.552 3.112   -10.133 1.00 37.70  ? 318  THR A O     1 
ATOM   2501 C  CB    . THR A 1 321 ? 39.460 0.642   -10.277 1.00 38.63  ? 318  THR A CB    1 
ATOM   2502 O  OG1   . THR A 1 321 ? 40.196 0.562   -9.052  1.00 37.01  ? 318  THR A OG1   1 
ATOM   2503 C  CG2   . THR A 1 321 ? 39.160 -0.769  -10.776 1.00 29.13  ? 318  THR A CG2   1 
ATOM   2504 N  N     . ILE A 1 322 ? 39.589 3.785   -10.999 1.00 27.36  ? 319  ILE A N     1 
ATOM   2505 C  CA    . ILE A 1 322 ? 39.646 5.112   -10.407 1.00 28.15  ? 319  ILE A CA    1 
ATOM   2506 C  C     . ILE A 1 322 ? 38.308 5.322   -9.710  1.00 32.36  ? 319  ILE A C     1 
ATOM   2507 O  O     . ILE A 1 322 ? 37.261 5.319   -10.363 1.00 27.90  ? 319  ILE A O     1 
ATOM   2508 C  CB    . ILE A 1 322 ? 39.912 6.212   -11.462 1.00 27.82  ? 319  ILE A CB    1 
ATOM   2509 C  CG1   . ILE A 1 322 ? 41.305 6.036   -12.092 1.00 30.71  ? 319  ILE A CG1   1 
ATOM   2510 C  CG2   . ILE A 1 322 ? 39.759 7.616   -10.862 1.00 28.95  ? 319  ILE A CG2   1 
ATOM   2511 C  CD1   . ILE A 1 322 ? 41.695 7.188   -13.016 1.00 30.61  ? 319  ILE A CD1   1 
ATOM   2512 N  N     . GLY A 1 323 ? 38.337 5.440   -8.385  1.00 27.43  ? 320  GLY A N     1 
ATOM   2513 C  CA    . GLY A 1 323 ? 37.103 5.495   -7.612  1.00 29.09  ? 320  GLY A CA    1 
ATOM   2514 C  C     . GLY A 1 323 ? 37.027 6.673   -6.668  1.00 28.21  ? 320  GLY A C     1 
ATOM   2515 O  O     . GLY A 1 323 ? 38.044 7.239   -6.296  1.00 29.28  ? 320  GLY A O     1 
ATOM   2516 N  N     . CYS A 1 324 ? 35.798 7.028   -6.292  1.00 28.63  ? 321  CYS A N     1 
ATOM   2517 C  CA    . CYS A 1 324 ? 35.492 8.167   -5.435  1.00 28.83  ? 321  CYS A CA    1 
ATOM   2518 C  C     . CYS A 1 324 ? 34.433 7.690   -4.456  1.00 28.28  ? 321  CYS A C     1 
ATOM   2519 O  O     . CYS A 1 324 ? 33.388 7.201   -4.886  1.00 28.81  ? 321  CYS A O     1 
ATOM   2520 C  CB    . CYS A 1 324 ? 34.991 9.365   -6.260  1.00 26.41  ? 321  CYS A CB    1 
ATOM   2521 S  SG    A CYS A 1 324 ? 35.179 10.944  -5.493  0.53 38.53  ? 321  CYS A SG    1 
ATOM   2522 S  SG    B CYS A 1 324 ? 36.239 10.101  -7.336  0.47 29.23  ? 321  CYS A SG    1 
ATOM   2523 N  N     . SER A 1 325 ? 34.690 7.790   -3.156  1.00 27.89  ? 322  SER A N     1 
ATOM   2524 C  CA    A SER A 1 325 ? 33.719 7.296   -2.187  0.55 27.94  ? 322  SER A CA    1 
ATOM   2525 C  CA    B SER A 1 325 ? 33.794 7.240   -2.144  0.45 27.97  ? 322  SER A CA    1 
ATOM   2526 C  C     . SER A 1 325 ? 33.587 8.198   -0.965  1.00 29.25  ? 322  SER A C     1 
ATOM   2527 O  O     . SER A 1 325 ? 34.503 8.936   -0.596  1.00 27.82  ? 322  SER A O     1 
ATOM   2528 C  CB    A SER A 1 325 ? 34.071 5.871   -1.736  0.55 29.84  ? 322  SER A CB    1 
ATOM   2529 C  CB    B SER A 1 325 ? 34.351 5.899   -1.644  0.45 29.80  ? 322  SER A CB    1 
ATOM   2530 O  OG    A SER A 1 325 ? 35.200 5.853   -0.887  0.55 27.51  ? 322  SER A OG    1 
ATOM   2531 O  OG    B SER A 1 325 ? 33.701 5.455   -0.469  0.45 28.44  ? 322  SER A OG    1 
ATOM   2532 N  N     . LYS A 1 326 ? 32.411 8.153   -0.354  1.00 28.96  ? 323  LYS A N     1 
ATOM   2533 C  CA    . LYS A 1 326 ? 32.191 8.916   0.869   1.00 27.94  ? 323  LYS A CA    1 
ATOM   2534 C  C     . LYS A 1 326 ? 31.202 8.234   1.800   1.00 29.99  ? 323  LYS A C     1 
ATOM   2535 O  O     . LYS A 1 326 ? 30.136 7.789   1.375   1.00 28.80  ? 323  LYS A O     1 
ATOM   2536 C  CB    . LYS A 1 326 ? 31.707 10.327  0.550   1.00 24.77  ? 323  LYS A CB    1 
ATOM   2537 C  CG    . LYS A 1 326 ? 31.640 11.185  1.818   1.00 30.44  ? 323  LYS A CG    1 
ATOM   2538 C  CD    . LYS A 1 326 ? 31.467 12.649  1.528   1.00 33.63  ? 323  LYS A CD    1 
ATOM   2539 C  CE    . LYS A 1 326 ? 31.334 13.411  2.847   1.00 36.92  ? 323  LYS A CE    1 
ATOM   2540 N  NZ    . LYS A 1 326 ? 32.272 12.848  3.846   1.00 39.45  ? 323  LYS A NZ    1 
ATOM   2541 N  N     . ASN A 1 327 ? 31.577 8.145   3.072   1.00 28.75  ? 324  ASN A N     1 
ATOM   2542 C  CA    . ASN A 1 327 ? 30.700 7.652   4.122   1.00 27.78  ? 324  ASN A CA    1 
ATOM   2543 C  C     . ASN A 1 327 ? 29.834 8.772   4.669   1.00 29.69  ? 324  ASN A C     1 
ATOM   2544 O  O     . ASN A 1 327 ? 30.239 9.925   4.710   1.00 27.45  ? 324  ASN A O     1 
ATOM   2545 C  CB    . ASN A 1 327 ? 31.501 7.046   5.274   1.00 32.58  ? 324  ASN A CB    1 
ATOM   2546 C  CG    . ASN A 1 327 ? 32.091 5.702   4.936   1.00 40.38  ? 324  ASN A CG    1 
ATOM   2547 O  OD1   . ASN A 1 327 ? 31.737 5.078   3.931   1.00 40.46  ? 324  ASN A OD1   1 
ATOM   2548 N  ND2   . ASN A 1 327 ? 32.991 5.231   5.791   1.00 39.22  ? 324  ASN A ND2   1 
ATOM   2549 N  N     . PHE A 1 328 ? 28.632 8.420   5.094   1.00 31.32  ? 325  PHE A N     1 
ATOM   2550 C  CA    . PHE A 1 328 ? 27.760 9.362   5.770   1.00 30.19  ? 325  PHE A CA    1 
ATOM   2551 C  C     . PHE A 1 328 ? 27.315 8.673   7.051   1.00 42.51  ? 325  PHE A C     1 
ATOM   2552 O  O     . PHE A 1 328 ? 26.244 8.063   7.105   1.00 42.30  ? 325  PHE A O     1 
ATOM   2553 C  CB    . PHE A 1 328 ? 26.594 9.753   4.863   1.00 38.98  ? 325  PHE A CB    1 
ATOM   2554 C  CG    . PHE A 1 328 ? 27.032 10.279  3.527   1.00 34.02  ? 325  PHE A CG    1 
ATOM   2555 C  CD1   . PHE A 1 328 ? 27.153 9.431   2.432   1.00 29.10  ? 325  PHE A CD1   1 
ATOM   2556 C  CD2   . PHE A 1 328 ? 27.353 11.618  3.368   1.00 31.00  ? 325  PHE A CD2   1 
ATOM   2557 C  CE1   . PHE A 1 328 ? 27.574 9.913   1.205   1.00 27.73  ? 325  PHE A CE1   1 
ATOM   2558 C  CE2   . PHE A 1 328 ? 27.763 12.114  2.136   1.00 30.48  ? 325  PHE A CE2   1 
ATOM   2559 C  CZ    . PHE A 1 328 ? 27.875 11.252  1.050   1.00 29.17  ? 325  PHE A CZ    1 
ATOM   2560 N  N     . PRO A 1 329 ? 28.180 8.721   8.076   1.00 40.80  ? 326  PRO A N     1 
ATOM   2561 C  CA    . PRO A 1 329 ? 28.007 7.927   9.293   1.00 51.92  ? 326  PRO A CA    1 
ATOM   2562 C  C     . PRO A 1 329 ? 26.979 8.534   10.232  1.00 57.61  ? 326  PRO A C     1 
ATOM   2563 O  O     . PRO A 1 329 ? 26.633 9.708   10.077  1.00 46.50  ? 326  PRO A O     1 
ATOM   2564 C  CB    . PRO A 1 329 ? 29.401 7.949   9.920   1.00 51.94  ? 326  PRO A CB    1 
ATOM   2565 C  CG    . PRO A 1 329 ? 29.955 9.258   9.501   1.00 47.44  ? 326  PRO A CG    1 
ATOM   2566 C  CD    . PRO A 1 329 ? 29.410 9.530   8.121   1.00 45.80  ? 326  PRO A CD    1 
ATOM   2567 N  N     . GLY A 1 330 ? 26.504 7.726   11.178  1.00 63.91  ? 327  GLY A N     1 
ATOM   2568 C  CA    . GLY A 1 330 ? 25.562 8.160   12.195  1.00 60.32  ? 327  GLY A CA    1 
ATOM   2569 C  C     . GLY A 1 330 ? 24.385 8.956   11.671  1.00 56.73  ? 327  GLY A C     1 
ATOM   2570 O  O     . GLY A 1 330 ? 23.644 8.502   10.797  1.00 54.43  ? 327  GLY A O     1 
ATOM   2571 N  N     . LYS A 1 331 ? 24.237 10.166  12.194  1.00 49.18  ? 328  LYS A N     1 
ATOM   2572 C  CA    . LYS A 1 331 ? 23.101 11.018  11.871  1.00 55.78  ? 328  LYS A CA    1 
ATOM   2573 C  C     . LYS A 1 331 ? 23.231 11.780  10.552  1.00 52.81  ? 328  LYS A C     1 
ATOM   2574 O  O     . LYS A 1 331 ? 22.303 12.487  10.157  1.00 51.38  ? 328  LYS A O     1 
ATOM   2575 C  CB    . LYS A 1 331 ? 22.862 12.020  13.007  1.00 62.91  ? 328  LYS A CB    1 
ATOM   2576 C  CG    . LYS A 1 331 ? 21.715 11.639  13.936  1.00 65.68  ? 328  LYS A CG    1 
ATOM   2577 C  CD    . LYS A 1 331 ? 20.953 12.871  14.412  1.00 70.22  ? 328  LYS A CD    1 
ATOM   2578 C  CE    . LYS A 1 331 ? 19.852 12.508  15.399  1.00 68.01  ? 328  LYS A CE    1 
ATOM   2579 N  NZ    . LYS A 1 331 ? 18.653 13.386  15.243  1.00 72.90  ? 328  LYS A NZ    1 
ATOM   2580 N  N     . THR A 1 332 ? 24.363 11.656  9.864   1.00 52.05  ? 329  THR A N     1 
ATOM   2581 C  CA    . THR A 1 332 ? 24.528 12.383  8.604   1.00 46.73  ? 329  THR A CA    1 
ATOM   2582 C  C     . THR A 1 332 ? 24.068 11.562  7.396   1.00 40.89  ? 329  THR A C     1 
ATOM   2583 O  O     . THR A 1 332 ? 24.208 12.007  6.258   1.00 43.30  ? 329  THR A O     1 
ATOM   2584 C  CB    . THR A 1 332 ? 25.993 12.818  8.367   1.00 44.20  ? 329  THR A CB    1 
ATOM   2585 O  OG1   . THR A 1 332 ? 26.784 11.677  8.010   1.00 40.84  ? 329  THR A OG1   1 
ATOM   2586 C  CG2   . THR A 1 332 ? 26.573 13.486  9.612   1.00 45.10  ? 329  THR A CG2   1 
ATOM   2587 N  N     . ALA A 1 333 ? 23.525 10.372  7.646   1.00 44.49  ? 330  ALA A N     1 
ATOM   2588 C  CA    . ALA A 1 333 ? 23.049 9.502   6.569   1.00 42.05  ? 330  ALA A CA    1 
ATOM   2589 C  C     . ALA A 1 333 ? 22.049 10.220  5.668   1.00 45.35  ? 330  ALA A C     1 
ATOM   2590 O  O     . ALA A 1 333 ? 21.265 11.046  6.131   1.00 45.03  ? 330  ALA A O     1 
ATOM   2591 C  CB    . ALA A 1 333 ? 22.435 8.232   7.146   1.00 36.87  ? 330  ALA A CB    1 
ATOM   2592 N  N     . LEU A 1 334 ? 22.088 9.910   4.377   1.00 41.23  ? 331  LEU A N     1 
ATOM   2593 C  CA    . LEU A 1 334 ? 21.324 10.666  3.390   1.00 42.94  ? 331  LEU A CA    1 
ATOM   2594 C  C     . LEU A 1 334 ? 19.878 10.178  3.341   1.00 40.93  ? 331  LEU A C     1 
ATOM   2595 O  O     . LEU A 1 334 ? 19.612 9.046   2.943   1.00 42.41  ? 331  LEU A O     1 
ATOM   2596 C  CB    . LEU A 1 334 ? 21.969 10.549  2.004   1.00 42.51  ? 331  LEU A CB    1 
ATOM   2597 C  CG    . LEU A 1 334 ? 23.476 10.800  1.900   1.00 33.19  ? 331  LEU A CG    1 
ATOM   2598 C  CD1   . LEU A 1 334 ? 23.894 10.804  0.434   1.00 31.90  ? 331  LEU A CD1   1 
ATOM   2599 C  CD2   . LEU A 1 334 ? 23.850 12.121  2.579   1.00 30.43  ? 331  LEU A CD2   1 
ATOM   2600 N  N     . ALA A 1 335 ? 18.945 11.038  3.736   1.00 46.34  ? 332  ALA A N     1 
ATOM   2601 C  CA    . ALA A 1 335 ? 17.556 10.613  3.915   1.00 47.22  ? 332  ALA A CA    1 
ATOM   2602 C  C     . ALA A 1 335 ? 16.636 11.282  2.899   1.00 44.73  ? 332  ALA A C     1 
ATOM   2603 O  O     . ALA A 1 335 ? 15.431 11.046  2.877   1.00 52.95  ? 332  ALA A O     1 
ATOM   2604 C  CB    . ALA A 1 335 ? 17.100 10.912  5.326   1.00 45.14  ? 332  ALA A CB    1 
ATOM   2605 N  N     . THR A 1 336 ? 17.235 12.093  2.044   1.00 38.97  ? 333  THR A N     1 
ATOM   2606 C  CA    . THR A 1 336 ? 16.522 12.933  1.103   1.00 47.80  ? 333  THR A CA    1 
ATOM   2607 C  C     . THR A 1 336 ? 17.006 12.669  -0.323  1.00 54.61  ? 333  THR A C     1 
ATOM   2608 O  O     . THR A 1 336 ? 18.201 12.488  -0.542  1.00 48.42  ? 333  THR A O     1 
ATOM   2609 C  CB    . THR A 1 336 ? 16.718 14.420  1.468   1.00 53.00  ? 333  THR A CB    1 
ATOM   2610 O  OG1   . THR A 1 336 ? 15.661 14.846  2.341   1.00 51.91  ? 333  THR A OG1   1 
ATOM   2611 C  CG2   . THR A 1 336 ? 16.747 15.291  0.236   1.00 44.76  ? 333  THR A CG2   1 
ATOM   2612 N  N     . ARG A 1 337 ? 16.090 12.635  -1.289  1.00 51.05  ? 334  ARG A N     1 
ATOM   2613 C  CA    . ARG A 1 337 ? 16.482 12.450  -2.685  1.00 53.05  ? 334  ARG A CA    1 
ATOM   2614 C  C     . ARG A 1 337 ? 17.505 13.492  -3.132  1.00 50.42  ? 334  ARG A C     1 
ATOM   2615 O  O     . ARG A 1 337 ? 18.567 13.147  -3.657  1.00 49.32  ? 334  ARG A O     1 
ATOM   2616 C  CB    . ARG A 1 337 ? 15.267 12.514  -3.614  1.00 58.00  ? 334  ARG A CB    1 
ATOM   2617 C  CG    . ARG A 1 337 ? 15.607 13.065  -4.998  1.00 55.72  ? 334  ARG A CG    1 
ATOM   2618 C  CD    . ARG A 1 337 ? 14.368 13.385  -5.802  1.00 68.68  ? 334  ARG A CD    1 
ATOM   2619 N  NE    . ARG A 1 337 ? 13.798 12.181  -6.392  1.00 77.92  ? 334  ARG A NE    1 
ATOM   2620 C  CZ    . ARG A 1 337 ? 12.586 12.117  -6.927  1.00 82.08  ? 334  ARG A CZ    1 
ATOM   2621 N  NH1   . ARG A 1 337 ? 11.809 13.192  -6.939  1.00 76.64  ? 334  ARG A NH1   1 
ATOM   2622 N  NH2   . ARG A 1 337 ? 12.149 10.977  -7.445  1.00 86.52  ? 334  ARG A NH2   1 
ATOM   2623 N  N     . GLU A 1 338 ? 17.180 14.764  -2.923  1.00 47.10  ? 335  GLU A N     1 
ATOM   2624 C  CA    . GLU A 1 338 ? 18.042 15.862  -3.331  1.00 41.69  ? 335  GLU A CA    1 
ATOM   2625 C  C     . GLU A 1 338 ? 19.413 15.772  -2.664  1.00 35.33  ? 335  GLU A C     1 
ATOM   2626 O  O     . GLU A 1 338 ? 20.415 16.178  -3.237  1.00 40.67  ? 335  GLU A O     1 
ATOM   2627 C  CB    . GLU A 1 338 ? 17.390 17.195  -2.996  1.00 46.56  ? 335  GLU A CB    1 
ATOM   2628 C  CG    . GLU A 1 338 ? 15.938 17.266  -3.410  1.00 64.74  ? 335  GLU A CG    1 
ATOM   2629 C  CD    . GLU A 1 338 ? 15.523 18.663  -3.793  1.00 77.29  ? 335  GLU A CD    1 
ATOM   2630 O  OE1   . GLU A 1 338 ? 16.418 19.483  -4.085  1.00 79.09  ? 335  GLU A OE1   1 
ATOM   2631 O  OE2   . GLU A 1 338 ? 14.304 18.942  -3.806  1.00 81.74  ? 335  GLU A OE2   1 
ATOM   2632 N  N     . GLN A 1 339 ? 19.435 15.248  -1.445  1.00 38.90  ? 336  GLN A N     1 
ATOM   2633 C  CA    . GLN A 1 339 ? 20.684 15.011  -0.733  1.00 36.73  ? 336  GLN A CA    1 
ATOM   2634 C  C     . GLN A 1 339 ? 21.502 13.978  -1.487  1.00 43.11  ? 336  GLN A C     1 
ATOM   2635 O  O     . GLN A 1 339 ? 22.703 14.155  -1.711  1.00 34.29  ? 336  GLN A O     1 
ATOM   2636 C  CB    . GLN A 1 339 ? 20.413 14.522  0.685   1.00 42.69  ? 336  GLN A CB    1 
ATOM   2637 C  CG    . GLN A 1 339 ? 21.014 15.385  1.768   1.00 43.56  ? 336  GLN A CG    1 
ATOM   2638 C  CD    . GLN A 1 339 ? 20.867 14.748  3.123   1.00 42.50  ? 336  GLN A CD    1 
ATOM   2639 O  OE1   . GLN A 1 339 ? 19.965 13.939  3.339   1.00 46.69  ? 336  GLN A OE1   1 
ATOM   2640 N  NE2   . GLN A 1 339 ? 21.752 15.096  4.043   1.00 43.80  ? 336  GLN A NE2   1 
ATOM   2641 N  N     . VAL A 1 340 ? 20.834 12.894  -1.873  1.00 39.78  ? 337  VAL A N     1 
ATOM   2642 C  CA    . VAL A 1 340 ? 21.493 11.798  -2.568  1.00 38.87  ? 337  VAL A CA    1 
ATOM   2643 C  C     . VAL A 1 340 ? 22.036 12.281  -3.900  1.00 36.66  ? 337  VAL A C     1 
ATOM   2644 O  O     . VAL A 1 340 ? 23.166 11.980  -4.261  1.00 37.00  ? 337  VAL A O     1 
ATOM   2645 C  CB    . VAL A 1 340 ? 20.539 10.613  -2.791  1.00 37.44  ? 337  VAL A CB    1 
ATOM   2646 C  CG1   . VAL A 1 340 ? 21.113 9.652   -3.843  1.00 35.86  ? 337  VAL A CG1   1 
ATOM   2647 C  CG2   . VAL A 1 340 ? 20.290 9.890   -1.482  1.00 33.03  ? 337  VAL A CG2   1 
ATOM   2648 N  N     . GLN A 1 341 ? 21.229 13.054  -4.619  1.00 34.97  ? 338  GLN A N     1 
ATOM   2649 C  CA    . GLN A 1 341 ? 21.630 13.589  -5.917  1.00 37.67  ? 338  GLN A CA    1 
ATOM   2650 C  C     . GLN A 1 341 ? 22.726 14.651  -5.836  1.00 38.23  ? 338  GLN A C     1 
ATOM   2651 O  O     . GLN A 1 341 ? 23.574 14.745  -6.727  1.00 39.37  ? 338  GLN A O     1 
ATOM   2652 C  CB    . GLN A 1 341 ? 20.399 14.140  -6.643  1.00 42.96  ? 338  GLN A CB    1 
ATOM   2653 C  CG    . GLN A 1 341 ? 19.406 13.031  -6.976  1.00 46.84  ? 338  GLN A CG    1 
ATOM   2654 C  CD    . GLN A 1 341 ? 18.149 13.528  -7.670  1.00 55.63  ? 338  GLN A CD    1 
ATOM   2655 O  OE1   . GLN A 1 341 ? 17.822 14.714  -7.623  1.00 48.59  ? 338  GLN A OE1   1 
ATOM   2656 N  NE2   . GLN A 1 341 ? 17.435 12.611  -8.318  1.00 53.86  ? 338  GLN A NE2   1 
ATOM   2657 N  N     . TRP A 1 342 ? 22.724 15.450  -4.775  1.00 34.06  ? 339  TRP A N     1 
ATOM   2658 C  CA    . TRP A 1 342 ? 23.779 16.437  -4.606  1.00 32.12  ? 339  TRP A CA    1 
ATOM   2659 C  C     . TRP A 1 342 ? 25.147 15.765  -4.411  1.00 29.70  ? 339  TRP A C     1 
ATOM   2660 O  O     . TRP A 1 342 ? 26.142 16.181  -5.002  1.00 31.23  ? 339  TRP A O     1 
ATOM   2661 C  CB    . TRP A 1 342 ? 23.489 17.362  -3.425  1.00 31.78  ? 339  TRP A CB    1 
ATOM   2662 C  CG    . TRP A 1 342 ? 24.475 18.482  -3.349  1.00 34.63  ? 339  TRP A CG    1 
ATOM   2663 C  CD1   . TRP A 1 342 ? 24.477 19.624  -4.094  1.00 37.34  ? 339  TRP A CD1   1 
ATOM   2664 C  CD2   . TRP A 1 342 ? 25.615 18.561  -2.491  1.00 34.47  ? 339  TRP A CD2   1 
ATOM   2665 N  NE1   . TRP A 1 342 ? 25.547 20.411  -3.753  1.00 45.80  ? 339  TRP A NE1   1 
ATOM   2666 C  CE2   . TRP A 1 342 ? 26.260 19.783  -2.767  1.00 36.32  ? 339  TRP A CE2   1 
ATOM   2667 C  CE3   . TRP A 1 342 ? 26.145 17.724  -1.509  1.00 32.74  ? 339  TRP A CE3   1 
ATOM   2668 C  CZ2   . TRP A 1 342 ? 27.419 20.183  -2.105  1.00 41.55  ? 339  TRP A CZ2   1 
ATOM   2669 C  CZ3   . TRP A 1 342 ? 27.296 18.124  -0.850  1.00 39.16  ? 339  TRP A CZ3   1 
ATOM   2670 C  CH2   . TRP A 1 342 ? 27.923 19.340  -1.153  1.00 37.73  ? 339  TRP A CH2   1 
ATOM   2671 N  N     . TRP A 1 343 ? 25.177 14.731  -3.588  1.00 29.44  ? 340  TRP A N     1 
ATOM   2672 C  CA    . TRP A 1 343 ? 26.430 14.046  -3.275  1.00 29.02  ? 340  TRP A CA    1 
ATOM   2673 C  C     . TRP A 1 343 ? 26.901 13.179  -4.437  1.00 31.12  ? 340  TRP A C     1 
ATOM   2674 O  O     . TRP A 1 343 ? 28.095 13.059  -4.668  1.00 28.38  ? 340  TRP A O     1 
ATOM   2675 C  CB    . TRP A 1 343 ? 26.276 13.203  -2.009  1.00 30.59  ? 340  TRP A CB    1 
ATOM   2676 C  CG    . TRP A 1 343 ? 26.417 14.023  -0.762  1.00 33.60  ? 340  TRP A CG    1 
ATOM   2677 C  CD1   . TRP A 1 343 ? 25.431 14.369  0.114   1.00 33.73  ? 340  TRP A CD1   1 
ATOM   2678 C  CD2   . TRP A 1 343 ? 27.622 14.620  -0.271  1.00 28.76  ? 340  TRP A CD2   1 
ATOM   2679 N  NE1   . TRP A 1 343 ? 25.952 15.145  1.132   1.00 35.79  ? 340  TRP A NE1   1 
ATOM   2680 C  CE2   . TRP A 1 343 ? 27.296 15.313  0.913   1.00 32.88  ? 340  TRP A CE2   1 
ATOM   2681 C  CE3   . TRP A 1 343 ? 28.949 14.640  -0.724  1.00 29.82  ? 340  TRP A CE3   1 
ATOM   2682 C  CZ2   . TRP A 1 343 ? 28.251 16.009  1.660   1.00 36.69  ? 340  TRP A CZ2   1 
ATOM   2683 C  CZ3   . TRP A 1 343 ? 29.893 15.341  0.013   1.00 31.18  ? 340  TRP A CZ3   1 
ATOM   2684 C  CH2   . TRP A 1 343 ? 29.542 16.012  1.194   1.00 34.72  ? 340  TRP A CH2   1 
ATOM   2685 N  N     . LEU A 1 344 ? 25.967 12.584  -5.174  1.00 30.08  ? 341  LEU A N     1 
ATOM   2686 C  CA    . LEU A 1 344 ? 26.350 11.834  -6.363  1.00 30.06  ? 341  LEU A CA    1 
ATOM   2687 C  C     . LEU A 1 344 ? 27.028 12.776  -7.334  1.00 31.03  ? 341  LEU A C     1 
ATOM   2688 O  O     . LEU A 1 344 ? 28.007 12.415  -7.981  1.00 29.82  ? 341  LEU A O     1 
ATOM   2689 C  CB    . LEU A 1 344 ? 25.145 11.155  -7.019  1.00 28.66  ? 341  LEU A CB    1 
ATOM   2690 C  CG    . LEU A 1 344 ? 24.600 9.922   -6.304  1.00 37.49  ? 341  LEU A CG    1 
ATOM   2691 C  CD1   . LEU A 1 344 ? 23.278 9.496   -6.939  1.00 38.68  ? 341  LEU A CD1   1 
ATOM   2692 C  CD2   . LEU A 1 344 ? 25.609 8.779   -6.327  1.00 35.88  ? 341  LEU A CD2   1 
ATOM   2693 N  N     . LEU A 1 345 ? 26.527 14.007  -7.424  1.00 25.14  ? 342  LEU A N     1 
ATOM   2694 C  CA    . LEU A 1 345 ? 27.151 14.994  -8.283  1.00 28.66  ? 342  LEU A CA    1 
ATOM   2695 C  C     . LEU A 1 345 ? 28.550 15.378  -7.789  1.00 28.99  ? 342  LEU A C     1 
ATOM   2696 O  O     . LEU A 1 345 ? 29.473 15.545  -8.589  1.00 32.91  ? 342  LEU A O     1 
ATOM   2697 C  CB    . LEU A 1 345 ? 26.274 16.249  -8.392  1.00 31.14  ? 342  LEU A CB    1 
ATOM   2698 C  CG    . LEU A 1 345 ? 26.809 17.361  -9.296  1.00 35.59  ? 342  LEU A CG    1 
ATOM   2699 C  CD1   . LEU A 1 345 ? 27.147 16.826  -10.692 1.00 39.20  ? 342  LEU A CD1   1 
ATOM   2700 C  CD2   . LEU A 1 345 ? 25.807 18.511  -9.395  1.00 41.93  ? 342  LEU A CD2   1 
ATOM   2701 N  N     . GLN A 1 346 ? 28.696 15.526  -6.474  1.00 26.00  ? 343  GLN A N     1 
ATOM   2702 C  CA    . GLN A 1 346 ? 29.996 15.874  -5.891  1.00 25.57  ? 343  GLN A CA    1 
ATOM   2703 C  C     . GLN A 1 346 ? 31.028 14.793  -6.250  1.00 24.45  ? 343  GLN A C     1 
ATOM   2704 O  O     . GLN A 1 346 ? 32.094 15.095  -6.792  1.00 28.40  ? 343  GLN A O     1 
ATOM   2705 C  CB    . GLN A 1 346 ? 29.908 16.020  -4.367  1.00 30.08  ? 343  GLN A CB    1 
ATOM   2706 C  CG    . GLN A 1 346 ? 29.059 17.203  -3.874  1.00 30.97  ? 343  GLN A CG    1 
ATOM   2707 C  CD    . GLN A 1 346 ? 29.089 18.387  -4.822  1.00 30.68  ? 343  GLN A CD    1 
ATOM   2708 O  OE1   . GLN A 1 346 ? 30.077 19.117  -4.912  1.00 34.71  ? 343  GLN A OE1   1 
ATOM   2709 N  NE2   . GLN A 1 346 ? 27.993 18.577  -5.546  1.00 39.13  ? 343  GLN A NE2   1 
ATOM   2710 N  N     . LEU A 1 347 ? 30.675 13.548  -5.954  1.00 30.18  ? 344  LEU A N     1 
ATOM   2711 C  CA    . LEU A 1 347 ? 31.517 12.390  -6.291  1.00 26.44  ? 344  LEU A CA    1 
ATOM   2712 C  C     . LEU A 1 347 ? 31.831 12.341  -7.784  1.00 29.76  ? 344  LEU A C     1 
ATOM   2713 O  O     . LEU A 1 347 ? 32.981 12.161  -8.184  1.00 26.89  ? 344  LEU A O     1 
ATOM   2714 C  CB    . LEU A 1 347 ? 30.834 11.092  -5.863  1.00 27.01  ? 344  LEU A CB    1 
ATOM   2715 C  CG    . LEU A 1 347 ? 30.789 10.813  -4.364  1.00 31.39  ? 344  LEU A CG    1 
ATOM   2716 C  CD1   . LEU A 1 347 ? 30.250 9.417   -4.088  1.00 34.85  ? 344  LEU A CD1   1 
ATOM   2717 C  CD2   . LEU A 1 347 ? 32.155 10.943  -3.790  1.00 33.05  ? 344  LEU A CD2   1 
ATOM   2718 N  N     . ALA A 1 348 ? 30.801 12.509  -8.606  1.00 24.49  ? 345  ALA A N     1 
ATOM   2719 C  CA    . ALA A 1 348 ? 30.961 12.461  -10.052 1.00 28.99  ? 345  ALA A CA    1 
ATOM   2720 C  C     . ALA A 1 348 ? 31.870 13.558  -10.587 1.00 26.63  ? 345  ALA A C     1 
ATOM   2721 O  O     . ALA A 1 348 ? 32.553 13.355  -11.588 1.00 27.77  ? 345  ALA A O     1 
ATOM   2722 C  CB    . ALA A 1 348 ? 29.593 12.540  -10.736 1.00 27.61  ? 345  ALA A CB    1 
ATOM   2723 N  N     . GLN A 1 349 ? 31.879 14.724  -9.937  1.00 25.37  ? 346  GLN A N     1 
ATOM   2724 C  CA    . GLN A 1 349 ? 32.723 15.819  -10.392 1.00 24.31  ? 346  GLN A CA    1 
ATOM   2725 C  C     . GLN A 1 349 ? 34.191 15.541  -10.081 1.00 24.88  ? 346  GLN A C     1 
ATOM   2726 O  O     . GLN A 1 349 ? 35.068 15.872  -10.881 1.00 25.91  ? 346  GLN A O     1 
ATOM   2727 C  CB    . GLN A 1 349 ? 32.307 17.146  -9.765  1.00 29.71  ? 346  GLN A CB    1 
ATOM   2728 C  CG    . GLN A 1 349 ? 31.094 17.794  -10.436 1.00 31.65  ? 346  GLN A CG    1 
ATOM   2729 C  CD    . GLN A 1 349 ? 30.513 18.940  -9.610  1.00 42.80  ? 346  GLN A CD    1 
ATOM   2730 O  OE1   . GLN A 1 349 ? 31.124 19.413  -8.652  1.00 47.15  ? 346  GLN A OE1   1 
ATOM   2731 N  NE2   . GLN A 1 349 ? 29.319 19.384  -9.984  1.00 53.18  ? 346  GLN A NE2   1 
ATOM   2732 N  N     . GLU A 1 350 ? 34.456 14.932  -8.930  1.00 28.41  ? 347  GLU A N     1 
ATOM   2733 C  CA    . GLU A 1 350 ? 35.842 14.588  -8.619  1.00 27.13  ? 347  GLU A CA    1 
ATOM   2734 C  C     . GLU A 1 350 ? 36.279 13.472  -9.553  1.00 23.90  ? 347  GLU A C     1 
ATOM   2735 O  O     . GLU A 1 350 ? 37.400 13.499  -10.063 1.00 30.48  ? 347  GLU A O     1 
ATOM   2736 C  CB    . GLU A 1 350 ? 36.045 14.163  -7.165  1.00 28.88  ? 347  GLU A CB    1 
ATOM   2737 C  CG    . GLU A 1 350 ? 37.501 13.680  -6.931  1.00 31.51  ? 347  GLU A CG    1 
ATOM   2738 C  CD    . GLU A 1 350 ? 37.773 13.172  -5.525  1.00 39.87  ? 347  GLU A CD    1 
ATOM   2739 O  OE1   . GLU A 1 350 ? 37.024 13.538  -4.593  1.00 38.19  ? 347  GLU A OE1   1 
ATOM   2740 O  OE2   . GLU A 1 350 ? 38.747 12.406  -5.357  1.00 29.86  ? 347  GLU A OE2   1 
ATOM   2741 N  N     . LEU A 1 351 ? 35.385 12.514  -9.789  1.00 25.32  ? 348  LEU A N     1 
ATOM   2742 C  CA    . LEU A 1 351 ? 35.692 11.401  -10.679 1.00 23.86  ? 348  LEU A CA    1 
ATOM   2743 C  C     . LEU A 1 351 ? 36.004 11.926  -12.073 1.00 33.90  ? 348  LEU A C     1 
ATOM   2744 O  O     . LEU A 1 351 ? 37.008 11.538  -12.654 1.00 30.52  ? 348  LEU A O     1 
ATOM   2745 C  CB    . LEU A 1 351 ? 34.545 10.386  -10.719 1.00 28.50  ? 348  LEU A CB    1 
ATOM   2746 C  CG    . LEU A 1 351 ? 34.844 9.061   -11.448 1.00 31.78  ? 348  LEU A CG    1 
ATOM   2747 C  CD1   . LEU A 1 351 ? 36.134 8.405   -10.928 1.00 31.41  ? 348  LEU A CD1   1 
ATOM   2748 C  CD2   . LEU A 1 351 ? 33.681 8.082   -11.336 1.00 34.02  ? 348  LEU A CD2   1 
ATOM   2749 N  N     . GLU A 1 352 ? 35.168 12.826  -12.601 1.00 28.54  ? 349  GLU A N     1 
ATOM   2750 C  CA    . GLU A 1 352 ? 35.440 13.403  -13.920 1.00 29.01  ? 349  GLU A CA    1 
ATOM   2751 C  C     . GLU A 1 352 ? 36.806 14.068  -13.954 1.00 29.64  ? 349  GLU A C     1 
ATOM   2752 O  O     . GLU A 1 352 ? 37.553 13.928  -14.924 1.00 33.53  ? 349  GLU A O     1 
ATOM   2753 C  CB    . GLU A 1 352 ? 34.366 14.429  -14.332 1.00 33.14  ? 349  GLU A CB    1 
ATOM   2754 C  CG    . GLU A 1 352 ? 34.653 15.057  -15.709 1.00 32.79  ? 349  GLU A CG    1 
ATOM   2755 C  CD    . GLU A 1 352 ? 33.667 16.157  -16.127 1.00 56.15  ? 349  GLU A CD    1 
ATOM   2756 O  OE1   . GLU A 1 352 ? 32.488 16.139  -15.698 1.00 49.02  ? 349  GLU A OE1   1 
ATOM   2757 O  OE2   . GLU A 1 352 ? 34.083 17.050  -16.900 1.00 54.72  ? 349  GLU A OE2   1 
ATOM   2758 N  N     . GLU A 1 353 ? 37.142 14.790  -12.892 1.00 29.95  ? 350  GLU A N     1 
ATOM   2759 C  CA    . GLU A 1 353 ? 38.410 15.500  -12.844 1.00 27.99  ? 350  GLU A CA    1 
ATOM   2760 C  C     . GLU A 1 353 ? 39.593 14.519  -12.927 1.00 30.97  ? 350  GLU A C     1 
ATOM   2761 O  O     . GLU A 1 353 ? 40.547 14.728  -13.683 1.00 30.46  ? 350  GLU A O     1 
ATOM   2762 C  CB    . GLU A 1 353 ? 38.496 16.338  -11.570 1.00 36.67  ? 350  GLU A CB    1 
ATOM   2763 C  CG    . GLU A 1 353 ? 39.806 17.083  -11.402 1.00 49.84  ? 350  GLU A CG    1 
ATOM   2764 C  CD    . GLU A 1 353 ? 39.740 18.115  -10.287 1.00 61.93  ? 350  GLU A CD    1 
ATOM   2765 O  OE1   . GLU A 1 353 ? 39.240 17.778  -9.189  1.00 60.85  ? 350  GLU A OE1   1 
ATOM   2766 O  OE2   . GLU A 1 353 ? 40.185 19.261  -10.512 1.00 65.95  ? 350  GLU A OE2   1 
ATOM   2767 N  N     . ARG A 1 354 ? 39.493 13.427  -12.175 1.00 31.37  ? 351  ARG A N     1 
ATOM   2768 C  CA    . ARG A 1 354 ? 40.558 12.427  -12.145 1.00 32.17  ? 351  ARG A CA    1 
ATOM   2769 C  C     . ARG A 1 354 ? 40.608 11.620  -13.444 1.00 32.48  ? 351  ARG A C     1 
ATOM   2770 O  O     . ARG A 1 354 ? 41.682 11.304  -13.939 1.00 29.59  ? 351  ARG A O     1 
ATOM   2771 C  CB    . ARG A 1 354 ? 40.372 11.499  -10.942 1.00 28.83  ? 351  ARG A CB    1 
ATOM   2772 C  CG    A ARG A 1 354 ? 40.681 12.230  -9.633  0.69 29.66  ? 351  ARG A CG    1 
ATOM   2773 C  CG    B ARG A 1 354 ? 40.718 12.095  -9.587  0.31 29.66  ? 351  ARG A CG    1 
ATOM   2774 C  CD    A ARG A 1 354 ? 40.150 11.505  -8.418  0.69 30.93  ? 351  ARG A CD    1 
ATOM   2775 C  CD    B ARG A 1 354 ? 40.642 11.017  -8.507  0.31 28.99  ? 351  ARG A CD    1 
ATOM   2776 N  NE    A ARG A 1 354 ? 40.742 10.183  -8.309  0.69 23.90  ? 351  ARG A NE    1 
ATOM   2777 N  NE    B ARG A 1 354 ? 41.564 9.917   -8.777  0.31 28.83  ? 351  ARG A NE    1 
ATOM   2778 C  CZ    A ARG A 1 354 ? 40.385 9.278   -7.411  0.69 30.17  ? 351  ARG A CZ    1 
ATOM   2779 C  CZ    B ARG A 1 354 ? 41.488 8.711   -8.219  0.31 28.49  ? 351  ARG A CZ    1 
ATOM   2780 N  NH1   A ARG A 1 354 ? 39.431 9.559   -6.519  0.69 22.28  ? 351  ARG A NH1   1 
ATOM   2781 N  NH1   B ARG A 1 354 ? 40.516 8.430   -7.367  0.31 28.19  ? 351  ARG A NH1   1 
ATOM   2782 N  NH2   A ARG A 1 354 ? 40.989 8.091   -7.411  0.69 26.14  ? 351  ARG A NH2   1 
ATOM   2783 N  NH2   B ARG A 1 354 ? 42.376 7.778   -8.532  0.31 27.33  ? 351  ARG A NH2   1 
ATOM   2784 N  N     . LEU A 1 355 ? 39.439 11.308  -13.995 1.00 28.57  ? 352  LEU A N     1 
ATOM   2785 C  CA    . LEU A 1 355 ? 39.366 10.556  -15.246 1.00 31.71  ? 352  LEU A CA    1 
ATOM   2786 C  C     . LEU A 1 355 ? 39.935 11.343  -16.425 1.00 33.90  ? 352  LEU A C     1 
ATOM   2787 O  O     . LEU A 1 355 ? 40.603 10.772  -17.293 1.00 35.87  ? 352  LEU A O     1 
ATOM   2788 C  CB    . LEU A 1 355 ? 37.925 10.142  -15.545 1.00 27.88  ? 352  LEU A CB    1 
ATOM   2789 C  CG    . LEU A 1 355 ? 37.331 8.962   -14.784 1.00 35.86  ? 352  LEU A CG    1 
ATOM   2790 C  CD1   . LEU A 1 355 ? 35.891 8.732   -15.204 1.00 29.28  ? 352  LEU A CD1   1 
ATOM   2791 C  CD2   . LEU A 1 355 ? 38.153 7.706   -15.023 1.00 32.47  ? 352  LEU A CD2   1 
ATOM   2792 N  N     . THR A 1 356 ? 39.675 12.650  -16.462 1.00 32.70  ? 353  THR A N     1 
ATOM   2793 C  CA    . THR A 1 356 ? 40.195 13.490  -17.542 1.00 32.95  ? 353  THR A CA    1 
ATOM   2794 C  C     . THR A 1 356 ? 41.712 13.613  -17.463 1.00 33.26  ? 353  THR A C     1 
ATOM   2795 O  O     . THR A 1 356 ? 42.412 13.509  -18.473 1.00 37.50  ? 353  THR A O     1 
ATOM   2796 C  CB    . THR A 1 356 ? 39.558 14.904  -17.527 1.00 36.81  ? 353  THR A CB    1 
ATOM   2797 O  OG1   . THR A 1 356 ? 38.176 14.799  -17.882 1.00 39.52  ? 353  THR A OG1   1 
ATOM   2798 C  CG2   . THR A 1 356 ? 40.249 15.827  -18.512 1.00 41.82  ? 353  THR A CG2   1 
ATOM   2799 N  N     . LYS A 1 357 ? 42.217 13.836  -16.256 1.00 37.57  ? 354  LYS A N     1 
ATOM   2800 C  CA    . LYS A 1 357 ? 43.657 13.845  -16.025 1.00 31.37  ? 354  LYS A CA    1 
ATOM   2801 C  C     . LYS A 1 357 ? 44.293 12.511  -16.434 1.00 32.60  ? 354  LYS A C     1 
ATOM   2802 O  O     . LYS A 1 357 ? 45.378 12.480  -17.026 1.00 36.80  ? 354  LYS A O     1 
ATOM   2803 C  CB    . LYS A 1 357 ? 43.946 14.151  -14.552 1.00 32.93  ? 354  LYS A CB    1 
ATOM   2804 C  CG    . LYS A 1 357 ? 45.399 14.012  -14.131 1.00 43.52  ? 354  LYS A CG    1 
ATOM   2805 C  CD    . LYS A 1 357 ? 46.271 15.127  -14.699 1.00 50.14  ? 354  LYS A CD    1 
ATOM   2806 C  CE    . LYS A 1 357 ? 47.584 15.227  -13.927 1.00 52.09  ? 354  LYS A CE    1 
ATOM   2807 N  NZ    . LYS A 1 357 ? 48.002 13.898  -13.375 1.00 57.90  ? 354  LYS A NZ    1 
ATOM   2808 N  N     . ASP A 1 358 ? 43.611 11.415  -16.124 1.00 31.73  ? 355  ASP A N     1 
ATOM   2809 C  CA    . ASP A 1 358 ? 44.100 10.076  -16.453 1.00 31.61  ? 355  ASP A CA    1 
ATOM   2810 C  C     . ASP A 1 358 ? 44.186 9.881   -17.959 1.00 37.72  ? 355  ASP A C     1 
ATOM   2811 O  O     . ASP A 1 358 ? 45.159 9.325   -18.466 1.00 35.60  ? 355  ASP A O     1 
ATOM   2812 C  CB    . ASP A 1 358 ? 43.194 9.006   -15.840 1.00 38.45  ? 355  ASP A CB    1 
ATOM   2813 C  CG    . ASP A 1 358 ? 43.740 7.596   -16.018 1.00 47.18  ? 355  ASP A CG    1 
ATOM   2814 O  OD1   . ASP A 1 358 ? 44.662 7.216   -15.262 1.00 36.48  ? 355  ASP A OD1   1 
ATOM   2815 O  OD2   . ASP A 1 358 ? 43.232 6.862   -16.896 1.00 38.21  ? 355  ASP A OD2   1 
ATOM   2816 N  N     . ARG A 1 359 ? 43.162 10.345  -18.671 1.00 31.28  ? 356  ARG A N     1 
ATOM   2817 C  CA    . ARG A 1 359 ? 43.103 10.164  -20.117 1.00 39.87  ? 356  ARG A CA    1 
ATOM   2818 C  C     . ARG A 1 359 ? 44.254 10.890  -20.797 1.00 31.75  ? 356  ARG A C     1 
ATOM   2819 O  O     . ARG A 1 359 ? 44.848 10.370  -21.740 1.00 37.57  ? 356  ARG A O     1 
ATOM   2820 C  CB    . ARG A 1 359 ? 41.758 10.655  -20.666 1.00 39.57  ? 356  ARG A CB    1 
ATOM   2821 C  CG    . ARG A 1 359 ? 41.449 10.218  -22.100 1.00 49.66  ? 356  ARG A CG    1 
ATOM   2822 C  CD    . ARG A 1 359 ? 40.083 10.743  -22.526 1.00 42.61  ? 356  ARG A CD    1 
ATOM   2823 N  NE    . ARG A 1 359 ? 39.966 12.171  -22.243 1.00 45.31  ? 356  ARG A NE    1 
ATOM   2824 C  CZ    . ARG A 1 359 ? 38.817 12.826  -22.110 1.00 55.91  ? 356  ARG A CZ    1 
ATOM   2825 N  NH1   . ARG A 1 359 ? 37.661 12.183  -22.239 1.00 54.94  ? 356  ARG A NH1   1 
ATOM   2826 N  NH2   . ARG A 1 359 ? 38.824 14.128  -21.845 1.00 51.90  ? 356  ARG A NH2   1 
ATOM   2827 N  N     . ASN A 1 360 ? 44.584 12.085  -20.307 1.00 35.48  ? 357  ASN A N     1 
ATOM   2828 C  CA    . ASN A 1 360 ? 45.675 12.877  -20.871 1.00 29.33  ? 357  ASN A CA    1 
ATOM   2829 C  C     . ASN A 1 360 ? 47.065 12.305  -20.582 1.00 41.39  ? 357  ASN A C     1 
ATOM   2830 O  O     . ASN A 1 360 ? 47.958 12.365  -21.420 1.00 41.40  ? 357  ASN A O     1 
ATOM   2831 C  CB    . ASN A 1 360 ? 45.616 14.312  -20.347 1.00 40.44  ? 357  ASN A CB    1 
ATOM   2832 C  CG    . ASN A 1 360 ? 44.402 15.062  -20.843 1.00 42.73  ? 357  ASN A CG    1 
ATOM   2833 O  OD1   . ASN A 1 360 ? 43.809 14.701  -21.860 1.00 47.13  ? 357  ASN A OD1   1 
ATOM   2834 N  ND2   . ASN A 1 360 ? 44.024 16.119  -20.130 1.00 38.39  ? 357  ASN A ND2   1 
ATOM   2835 N  N     . ASP A 1 361 ? 47.245 11.771  -19.381 1.00 34.08  ? 358  ASP A N     1 
ATOM   2836 C  CA    . ASP A 1 361 ? 48.557 11.301  -18.944 1.00 41.10  ? 358  ASP A CA    1 
ATOM   2837 C  C     . ASP A 1 361 ? 48.873 9.901   -19.426 1.00 37.51  ? 358  ASP A C     1 
ATOM   2838 O  O     . ASP A 1 361 ? 50.028 9.578   -19.704 1.00 38.70  ? 358  ASP A O     1 
ATOM   2839 C  CB    . ASP A 1 361 ? 48.659 11.317  -17.415 1.00 43.88  ? 358  ASP A CB    1 
ATOM   2840 C  CG    . ASP A 1 361 ? 48.806 12.712  -16.853 1.00 51.59  ? 358  ASP A CG    1 
ATOM   2841 O  OD1   . ASP A 1 361 ? 48.996 13.660  -17.646 1.00 49.28  ? 358  ASP A OD1   1 
ATOM   2842 O  OD2   . ASP A 1 361 ? 48.742 12.854  -15.612 1.00 49.44  ? 358  ASP A OD2   1 
ATOM   2843 N  N     . ASN A 1 362 ? 47.845 9.068   -19.506 1.00 36.59  ? 359  ASN A N     1 
ATOM   2844 C  CA    . ASN A 1 362 ? 48.067 7.638   -19.661 1.00 39.25  ? 359  ASN A CA    1 
ATOM   2845 C  C     . ASN A 1 362 ? 47.435 7.019   -20.901 1.00 39.15  ? 359  ASN A C     1 
ATOM   2846 O  O     . ASN A 1 362 ? 47.519 5.816   -21.082 1.00 35.51  ? 359  ASN A O     1 
ATOM   2847 C  CB    . ASN A 1 362 ? 47.570 6.912   -18.406 1.00 32.04  ? 359  ASN A CB    1 
ATOM   2848 C  CG    . ASN A 1 362 ? 48.292 7.366   -17.145 1.00 36.83  ? 359  ASN A CG    1 
ATOM   2849 O  OD1   . ASN A 1 362 ? 49.517 7.519   -17.131 1.00 40.39  ? 359  ASN A OD1   1 
ATOM   2850 N  ND2   . ASN A 1 362 ? 47.535 7.575   -16.074 1.00 33.63  ? 359  ASN A ND2   1 
ATOM   2851 N  N     . ASP A 1 363 ? 46.809 7.833   -21.750 1.00 38.16  ? 360  ASP A N     1 
ATOM   2852 C  CA    . ASP A 1 363 ? 46.260 7.341   -23.019 1.00 43.74  ? 360  ASP A CA    1 
ATOM   2853 C  C     . ASP A 1 363 ? 45.313 6.179   -22.861 1.00 44.26  ? 360  ASP A C     1 
ATOM   2854 O  O     . ASP A 1 363 ? 45.553 5.111   -23.428 1.00 41.73  ? 360  ASP A O     1 
ATOM   2855 C  CB    . ASP A 1 363 ? 47.363 6.873   -23.971 1.00 52.26  ? 360  ASP A CB    1 
ATOM   2856 C  CG    . ASP A 1 363 ? 48.343 7.949   -24.306 1.00 58.13  ? 360  ASP A CG    1 
ATOM   2857 O  OD1   . ASP A 1 363 ? 47.956 9.139   -24.287 1.00 59.71  ? 360  ASP A OD1   1 
ATOM   2858 O  OD2   . ASP A 1 363 ? 49.501 7.588   -24.612 1.00 61.79  ? 360  ASP A OD2   1 
ATOM   2859 N  N     . ARG A 1 364 ? 44.252 6.370   -22.091 1.00 42.35  ? 361  ARG A N     1 
ATOM   2860 C  CA    . ARG A 1 364 ? 43.265 5.319   -21.917 1.00 38.24  ? 361  ARG A CA    1 
ATOM   2861 C  C     . ARG A 1 364 ? 41.946 5.919   -21.487 1.00 37.27  ? 361  ARG A C     1 
ATOM   2862 O  O     . ARG A 1 364 ? 41.900 7.036   -20.976 1.00 43.01  ? 361  ARG A O     1 
ATOM   2863 C  CB    . ARG A 1 364 ? 43.740 4.297   -20.890 1.00 36.94  ? 361  ARG A CB    1 
ATOM   2864 C  CG    . ARG A 1 364 ? 44.066 4.908   -19.536 1.00 35.46  ? 361  ARG A CG    1 
ATOM   2865 C  CD    . ARG A 1 364 ? 44.601 3.867   -18.558 1.00 35.89  ? 361  ARG A CD    1 
ATOM   2866 N  NE    . ARG A 1 364 ? 44.563 4.362   -17.191 1.00 35.02  ? 361  ARG A NE    1 
ATOM   2867 C  CZ    . ARG A 1 364 ? 44.667 3.585   -16.113 1.00 40.29  ? 361  ARG A CZ    1 
ATOM   2868 N  NH1   . ARG A 1 364 ? 44.613 4.118   -14.896 1.00 33.86  ? 361  ARG A NH1   1 
ATOM   2869 N  NH2   . ARG A 1 364 ? 44.827 2.278   -16.253 1.00 38.04  ? 361  ARG A NH2   1 
ATOM   2870 N  N     . VAL A 1 365 ? 40.879 5.160   -21.685 1.00 38.68  ? 362  VAL A N     1 
ATOM   2871 C  CA    . VAL A 1 365 ? 39.544 5.595   -21.316 1.00 44.23  ? 362  VAL A CA    1 
ATOM   2872 C  C     . VAL A 1 365 ? 38.806 4.501   -20.558 1.00 41.92  ? 362  VAL A C     1 
ATOM   2873 O  O     . VAL A 1 365 ? 38.814 3.333   -20.954 1.00 39.79  ? 362  VAL A O     1 
ATOM   2874 C  CB    . VAL A 1 365 ? 38.726 5.996   -22.562 1.00 43.76  ? 362  VAL A CB    1 
ATOM   2875 C  CG1   . VAL A 1 365 ? 39.192 7.342   -23.086 1.00 47.62  ? 362  VAL A CG1   1 
ATOM   2876 C  CG2   . VAL A 1 365 ? 38.849 4.930   -23.638 1.00 50.04  ? 362  VAL A CG2   1 
ATOM   2877 N  N     . ALA A 1 366 ? 38.177 4.880   -19.455 1.00 35.09  ? 363  ALA A N     1 
ATOM   2878 C  CA    . ALA A 1 366 ? 37.301 3.963   -18.744 1.00 34.74  ? 363  ALA A CA    1 
ATOM   2879 C  C     . ALA A 1 366 ? 36.003 3.739   -19.523 1.00 39.72  ? 363  ALA A C     1 
ATOM   2880 O  O     . ALA A 1 366 ? 35.504 4.647   -20.192 1.00 39.06  ? 363  ALA A O     1 
ATOM   2881 C  CB    . ALA A 1 366 ? 37.002 4.493   -17.359 1.00 30.43  ? 363  ALA A CB    1 
ATOM   2882 N  N     . THR A 1 367 ? 35.448 2.537   -19.420 1.00 31.33  ? 364  THR A N     1 
ATOM   2883 C  CA    . THR A 1 367 ? 34.259 2.181   -20.186 1.00 42.12  ? 364  THR A CA    1 
ATOM   2884 C  C     . THR A 1 367 ? 33.095 1.703   -19.317 1.00 40.56  ? 364  THR A C     1 
ATOM   2885 O  O     . THR A 1 367 ? 31.978 1.524   -19.805 1.00 39.28  ? 364  THR A O     1 
ATOM   2886 C  CB    . THR A 1 367 ? 34.581 1.084   -21.213 1.00 41.36  ? 364  THR A CB    1 
ATOM   2887 O  OG1   . THR A 1 367 ? 34.865 -0.142  -20.527 1.00 38.63  ? 364  THR A OG1   1 
ATOM   2888 C  CG2   . THR A 1 367 ? 35.785 1.485   -22.058 1.00 41.44  ? 364  THR A CG2   1 
ATOM   2889 N  N     . GLN A 1 368 ? 33.356 1.474   -18.033 1.00 36.02  ? 365  GLN A N     1 
ATOM   2890 C  CA    . GLN A 1 368 ? 32.315 1.007   -17.128 1.00 35.90  ? 365  GLN A CA    1 
ATOM   2891 C  C     . GLN A 1 368 ? 32.292 1.887   -15.885 1.00 37.39  ? 365  GLN A C     1 
ATOM   2892 O  O     . GLN A 1 368 ? 33.344 2.287   -15.390 1.00 34.08  ? 365  GLN A O     1 
ATOM   2893 C  CB    . GLN A 1 368 ? 32.538 -0.459  -16.737 1.00 41.98  ? 365  GLN A CB    1 
ATOM   2894 C  CG    . GLN A 1 368 ? 31.372 -1.093  -15.992 1.00 41.73  ? 365  GLN A CG    1 
ATOM   2895 C  CD    . GLN A 1 368 ? 31.553 -2.584  -15.766 1.00 53.22  ? 365  GLN A CD    1 
ATOM   2896 O  OE1   . GLN A 1 368 ? 32.430 -3.005  -15.014 1.00 59.03  ? 365  GLN A OE1   1 
ATOM   2897 N  NE2   . GLN A 1 368 ? 30.718 -3.391  -16.412 1.00 55.58  ? 365  GLN A NE2   1 
ATOM   2898 N  N     . LEU A 1 369 ? 31.092 2.194   -15.409 1.00 34.37  ? 366  LEU A N     1 
ATOM   2899 C  CA    . LEU A 1 369 ? 30.904 2.930   -14.161 1.00 35.83  ? 366  LEU A CA    1 
ATOM   2900 C  C     . LEU A 1 369 ? 30.211 2.037   -13.132 1.00 32.34  ? 366  LEU A C     1 
ATOM   2901 O  O     . LEU A 1 369 ? 29.096 1.565   -13.354 1.00 40.34  ? 366  LEU A O     1 
ATOM   2902 C  CB    . LEU A 1 369 ? 30.082 4.201   -14.393 1.00 38.43  ? 366  LEU A CB    1 
ATOM   2903 C  CG    . LEU A 1 369 ? 29.794 5.046   -13.148 1.00 33.92  ? 366  LEU A CG    1 
ATOM   2904 C  CD1   . LEU A 1 369 ? 31.042 5.794   -12.707 1.00 33.83  ? 366  LEU A CD1   1 
ATOM   2905 C  CD2   . LEU A 1 369 ? 28.626 6.008   -13.396 1.00 41.70  ? 366  LEU A CD2   1 
ATOM   2906 N  N     . VAL A 1 370 ? 30.880 1.792   -12.014 1.00 31.23  ? 367  VAL A N     1 
ATOM   2907 C  CA    . VAL A 1 370 ? 30.306 0.995   -10.947 1.00 28.84  ? 367  VAL A CA    1 
ATOM   2908 C  C     . VAL A 1 370 ? 29.730 1.924   -9.882  1.00 35.00  ? 367  VAL A C     1 
ATOM   2909 O  O     . VAL A 1 370 ? 30.353 2.924   -9.516  1.00 33.56  ? 367  VAL A O     1 
ATOM   2910 C  CB    . VAL A 1 370 ? 31.360 0.056   -10.323 1.00 41.66  ? 367  VAL A CB    1 
ATOM   2911 C  CG1   . VAL A 1 370 ? 30.794 -0.660  -9.117  1.00 38.63  ? 367  VAL A CG1   1 
ATOM   2912 C  CG2   . VAL A 1 370 ? 31.857 -0.943  -11.364 1.00 33.74  ? 367  VAL A CG2   1 
ATOM   2913 N  N     . VAL A 1 371 ? 28.529 1.609   -9.412  1.00 32.35  ? 368  VAL A N     1 
ATOM   2914 C  CA    . VAL A 1 371 ? 27.889 2.411   -8.375  1.00 31.24  ? 368  VAL A CA    1 
ATOM   2915 C  C     . VAL A 1 371 ? 27.609 1.528   -7.186  1.00 32.32  ? 368  VAL A C     1 
ATOM   2916 O  O     . VAL A 1 371 ? 27.051 0.444   -7.318  1.00 33.85  ? 368  VAL A O     1 
ATOM   2917 C  CB    . VAL A 1 371 ? 26.588 3.057   -8.878  1.00 30.93  ? 368  VAL A CB    1 
ATOM   2918 C  CG1   . VAL A 1 371 ? 26.016 4.016   -7.829  1.00 33.86  ? 368  VAL A CG1   1 
ATOM   2919 C  CG2   . VAL A 1 371 ? 26.856 3.786   -10.187 1.00 30.76  ? 368  VAL A CG2   1 
ATOM   2920 N  N     . SER A 1 372 ? 28.027 1.982   -6.016  1.00 32.73  ? 369  SER A N     1 
ATOM   2921 C  CA    . SER A 1 372 ? 27.899 1.182   -4.817  1.00 29.10  ? 369  SER A CA    1 
ATOM   2922 C  C     . SER A 1 372 ? 27.329 2.038   -3.711  1.00 34.33  ? 369  SER A C     1 
ATOM   2923 O  O     . SER A 1 372 ? 27.634 3.226   -3.617  1.00 33.81  ? 369  SER A O     1 
ATOM   2924 C  CB    . SER A 1 372 ? 29.250 0.602   -4.395  1.00 35.36  ? 369  SER A CB    1 
ATOM   2925 O  OG    . SER A 1 372 ? 29.119 -0.117  -3.182  1.00 47.26  ? 369  SER A OG    1 
ATOM   2926 N  N     . ILE A 1 373 ? 26.473 1.445   -2.894  1.00 32.31  ? 370  ILE A N     1 
ATOM   2927 C  CA    . ILE A 1 373 ? 25.924 2.164   -1.758  1.00 32.21  ? 370  ILE A CA    1 
ATOM   2928 C  C     . ILE A 1 373 ? 25.923 1.286   -0.526  1.00 39.95  ? 370  ILE A C     1 
ATOM   2929 O  O     . ILE A 1 373 ? 26.071 0.063   -0.606  1.00 41.48  ? 370  ILE A O     1 
ATOM   2930 C  CB    . ILE A 1 373 ? 24.467 2.674   -2.007  1.00 37.78  ? 370  ILE A CB    1 
ATOM   2931 C  CG1   . ILE A 1 373 ? 23.494 1.503   -2.130  1.00 45.90  ? 370  ILE A CG1   1 
ATOM   2932 C  CG2   . ILE A 1 373 ? 24.387 3.611   -3.211  1.00 30.90  ? 370  ILE A CG2   1 
ATOM   2933 C  CD1   . ILE A 1 373 ? 22.058 1.935   -2.263  1.00 41.88  ? 370  ILE A CD1   1 
ATOM   2934 N  N     . ARG A 1 374 ? 25.757 1.925   0.624   1.00 39.02  ? 371  ARG A N     1 
ATOM   2935 C  CA    . ARG A 1 374 ? 25.523 1.193   1.848   1.00 38.57  ? 371  ARG A CA    1 
ATOM   2936 C  C     . ARG A 1 374 ? 24.279 1.782   2.464   1.00 47.75  ? 371  ARG A C     1 
ATOM   2937 O  O     . ARG A 1 374 ? 23.962 2.958   2.271   1.00 37.84  ? 371  ARG A O     1 
ATOM   2938 C  CB    . ARG A 1 374 ? 26.709 1.272   2.803   1.00 45.97  ? 371  ARG A CB    1 
ATOM   2939 C  CG    . ARG A 1 374 ? 26.631 0.307   3.987   1.00 49.15  ? 371  ARG A CG    1 
ATOM   2940 C  CD    . ARG A 1 374 ? 27.782 0.558   4.954   1.00 58.82  ? 371  ARG A CD    1 
ATOM   2941 N  NE    . ARG A 1 374 ? 27.732 -0.303  6.132   1.00 70.50  ? 371  ARG A NE    1 
ATOM   2942 C  CZ    . ARG A 1 374 ? 28.583 -0.216  7.152   1.00 75.40  ? 371  ARG A CZ    1 
ATOM   2943 N  NH1   . ARG A 1 374 ? 29.547 0.697   7.139   1.00 71.71  ? 371  ARG A NH1   1 
ATOM   2944 N  NH2   . ARG A 1 374 ? 28.468 -1.039  8.185   1.00 81.97  ? 371  ARG A NH2   1 
ATOM   2945 N  N     . VAL A 1 375 ? 23.566 0.936   3.184   1.00 50.54  ? 372  VAL A N     1 
ATOM   2946 C  CA    . VAL A 1 375 ? 22.305 1.298   3.783   1.00 57.85  ? 372  VAL A CA    1 
ATOM   2947 C  C     . VAL A 1 375 ? 22.484 1.241   5.304   1.00 52.00  ? 372  VAL A C     1 
ATOM   2948 O  O     . VAL A 1 375 ? 23.412 0.609   5.790   1.00 60.20  ? 372  VAL A O     1 
ATOM   2949 C  CB    . VAL A 1 375 ? 21.202 0.364   3.260   1.00 64.38  ? 372  VAL A CB    1 
ATOM   2950 C  CG1   . VAL A 1 375 ? 19.976 0.438   4.098   1.00 63.22  ? 372  VAL A CG1   1 
ATOM   2951 C  CG2   . VAL A 1 375 ? 20.877 0.714   1.808   1.00 60.57  ? 372  VAL A CG2   1 
ATOM   2952 N  N     . GLN A 1 376 ? 21.657 1.962   6.050   1.00 58.05  ? 373  GLN A N     1 
ATOM   2953 C  CA    . GLN A 1 376 ? 21.789 2.026   7.503   1.00 61.19  ? 373  GLN A CA    1 
ATOM   2954 C  C     . GLN A 1 376 ? 21.498 0.689   8.209   1.00 64.08  ? 373  GLN A C     1 
ATOM   2955 O  O     . GLN A 1 376 ? 20.531 0.005   7.882   1.00 67.10  ? 373  GLN A O     1 
ATOM   2956 C  CB    . GLN A 1 376 ? 20.866 3.122   8.031   1.00 58.47  ? 373  GLN A CB    1 
ATOM   2957 C  CG    . GLN A 1 376 ? 20.927 3.370   9.519   1.00 67.18  ? 373  GLN A CG    1 
ATOM   2958 C  CD    . GLN A 1 376 ? 19.989 4.484   9.935   1.00 70.09  ? 373  GLN A CD    1 
ATOM   2959 O  OE1   . GLN A 1 376 ? 20.121 5.623   9.482   1.00 66.96  ? 373  GLN A OE1   1 
ATOM   2960 N  NE2   . GLN A 1 376 ? 19.018 4.158   10.782  1.00 81.34  ? 373  GLN A NE2   1 
ATOM   2961 N  N     . GLY A 1 377 ? 22.345 0.328   9.173   1.00 67.08  ? 374  GLY A N     1 
ATOM   2962 C  CA    . GLY A 1 377 ? 22.160 -0.868  9.987   1.00 78.25  ? 374  GLY A CA    1 
ATOM   2963 C  C     . GLY A 1 377 ? 22.705 -2.125  9.341   1.00 82.92  ? 374  GLY A C     1 
ATOM   2964 O  O     . GLY A 1 377 ? 22.543 -3.244  9.841   1.00 81.44  ? 374  GLY A O     1 
ATOM   2965 N  N     . ASP A 1 378 ? 23.323 -1.941  8.171   1.00 79.11  ? 375  ASP A N     1 
ATOM   2966 C  CA    . ASP A 1 378 ? 23.744 -2.997  7.264   1.00 67.89  ? 375  ASP A CA    1 
ATOM   2967 C  C     . ASP A 1 378 ? 25.124 -3.471  7.587   1.00 79.25  ? 375  ASP A C     1 
ATOM   2968 O  O     . ASP A 1 378 ? 26.038 -2.693  7.712   1.00 78.15  ? 375  ASP A O     1 
ATOM   2969 C  CB    . ASP A 1 378 ? 23.846 -2.416  5.851   1.00 72.15  ? 375  ASP A CB    1 
ATOM   2970 C  CG    . ASP A 1 378 ? 23.214 -3.263  4.791   1.00 74.19  ? 375  ASP A CG    1 
ATOM   2971 O  OD1   . ASP A 1 378 ? 23.861 -4.137  4.202   1.00 70.25  ? 375  ASP A OD1   1 
ATOM   2972 O  OD2   . ASP A 1 378 ? 22.049 -3.026  4.492   1.00 77.96  ? 375  ASP A OD2   1 
ATOM   2973 N  N     . LYS A 1 379 ? 25.232 -4.777  7.676   1.00 83.71  ? 376  LYS A N     1 
ATOM   2974 C  CA    . LYS A 1 379 ? 26.064 -5.538  6.844   1.00 84.19  ? 376  LYS A CA    1 
ATOM   2975 C  C     . LYS A 1 379 ? 27.473 -5.068  7.097   1.00 82.44  ? 376  LYS A C     1 
ATOM   2976 O  O     . LYS A 1 379 ? 27.981 -5.114  8.205   1.00 87.73  ? 376  LYS A O     1 
ATOM   2977 C  CB    . LYS A 1 379 ? 25.573 -5.387  5.373   1.00 79.60  ? 376  LYS A CB    1 
ATOM   2978 C  CG    . LYS A 1 379 ? 26.522 -5.921  4.279   1.00 82.00  ? 376  LYS A CG    1 
ATOM   2979 C  CD    . LYS A 1 379 ? 25.983 -7.145  3.574   1.00 72.23  ? 376  LYS A CD    1 
ATOM   2980 C  CE    . LYS A 1 379 ? 24.803 -6.795  2.719   1.00 71.94  ? 376  LYS A CE    1 
ATOM   2981 N  NZ    . LYS A 1 379 ? 24.813 -7.547  1.446   1.00 61.85  ? 376  LYS A NZ    1 
ATOM   2982 N  N     . ARG A 1 380 ? 28.065 -4.553  6.062   1.00 85.40  ? 377  ARG A N     1 
ATOM   2983 C  CA    . ARG A 1 380 ? 29.377 -4.756  5.594   1.00 86.44  ? 377  ARG A CA    1 
ATOM   2984 C  C     . ARG A 1 380 ? 29.682 -3.474  4.862   1.00 80.56  ? 377  ARG A C     1 
ATOM   2985 O  O     . ARG A 1 380 ? 28.869 -2.569  4.856   1.00 78.97  ? 377  ARG A O     1 
ATOM   2986 C  CB    . ARG A 1 380 ? 29.353 -5.936  4.652   1.00 87.39  ? 377  ARG A CB    1 
ATOM   2987 C  CG    . ARG A 1 380 ? 28.853 -7.214  5.304   1.00 90.43  ? 377  ARG A CG    1 
ATOM   2988 C  CD    . ARG A 1 380 ? 29.654 -8.413  4.826   1.00 89.49  ? 377  ARG A CD    1 
ATOM   2989 N  NE    . ARG A 1 380 ? 28.916 -9.652  4.947   1.00 86.59  ? 377  ARG A NE    1 
ATOM   2990 C  CZ    . ARG A 1 380 ? 29.283 -10.648 5.730   1.00 91.90  ? 377  ARG A CZ    1 
ATOM   2991 N  NH1   . ARG A 1 380 ? 30.388 -10.560 6.448   1.00 86.78  ? 377  ARG A NH1   1 
ATOM   2992 N  NH2   . ARG A 1 380 ? 28.549 -11.741 5.780   1.00 96.98  ? 377  ARG A NH2   1 
ATOM   2993 N  N     . LEU A 1 381 ? 30.875 -3.363  4.303   1.00 80.17  ? 378  LEU A N     1 
ATOM   2994 C  CA    . LEU A 1 381 ? 31.281 -2.110  3.742   1.00 77.50  ? 378  LEU A CA    1 
ATOM   2995 C  C     . LEU A 1 381 ? 30.298 -1.731  2.635   1.00 72.17  ? 378  LEU A C     1 
ATOM   2996 O  O     . LEU A 1 381 ? 29.852 -0.609  2.554   1.00 66.08  ? 378  LEU A O     1 
ATOM   2997 C  CB    . LEU A 1 381 ? 32.709 -2.204  3.239   1.00 78.17  ? 378  LEU A CB    1 
ATOM   2998 C  CG    . LEU A 1 381 ? 33.803 -1.664  4.178   1.00 78.12  ? 378  LEU A CG    1 
ATOM   2999 C  CD1   . LEU A 1 381 ? 34.162 -2.653  5.275   1.00 70.20  ? 378  LEU A CD1   1 
ATOM   3000 C  CD2   . LEU A 1 381 ? 35.029 -1.143  3.416   1.00 63.44  ? 378  LEU A CD2   1 
ATOM   3001 N  N     . SER A 1 382 ? 29.926 -2.692  1.819   1.00 72.48  ? 379  SER A N     1 
ATOM   3002 C  CA    . SER A 1 382 ? 29.001 -2.454  0.712   1.00 61.06  ? 379  SER A CA    1 
ATOM   3003 C  C     . SER A 1 382 ? 27.717 -3.250  0.844   1.00 56.03  ? 379  SER A C     1 
ATOM   3004 O  O     . SER A 1 382 ? 27.743 -4.430  1.188   1.00 58.77  ? 379  SER A O     1 
ATOM   3005 C  CB    . SER A 1 382 ? 29.655 -2.793  -0.628  1.00 53.71  ? 379  SER A CB    1 
ATOM   3006 O  OG    . SER A 1 382 ? 28.664 -2.955  -1.634  1.00 52.88  ? 379  SER A OG    1 
ATOM   3007 N  N     . SER A 1 383 ? 26.596 -2.594  0.552   1.00 50.30  ? 380  SER A N     1 
ATOM   3008 C  CA    . SER A 1 383 ? 25.291 -3.244  0.545   1.00 51.33  ? 380  SER A CA    1 
ATOM   3009 C  C     . SER A 1 383 ? 24.950 -3.736  -0.848  1.00 62.64  ? 380  SER A C     1 
ATOM   3010 O  O     . SER A 1 383 ? 24.385 -4.817  -1.022  1.00 54.91  ? 380  SER A O     1 
ATOM   3011 C  CB    . SER A 1 383 ? 24.190 -2.289  1.018   1.00 57.35  ? 380  SER A CB    1 
ATOM   3012 O  OG    . SER A 1 383 ? 24.380 -1.880  2.361   1.00 60.33  ? 380  SER A OG    1 
ATOM   3013 N  N     . LEU A 1 384 ? 25.299 -2.928  -1.842  1.00 58.09  ? 381  LEU A N     1 
ATOM   3014 C  CA    . LEU A 1 384 ? 24.804 -3.132  -3.193  1.00 50.15  ? 381  LEU A CA    1 
ATOM   3015 C  C     . LEU A 1 384 ? 25.696 -2.499  -4.248  1.00 47.09  ? 381  LEU A C     1 
ATOM   3016 O  O     . LEU A 1 384 ? 26.057 -1.330  -4.148  1.00 38.99  ? 381  LEU A O     1 
ATOM   3017 C  CB    . LEU A 1 384 ? 23.392 -2.569  -3.309  1.00 47.04  ? 381  LEU A CB    1 
ATOM   3018 C  CG    . LEU A 1 384 ? 22.713 -2.744  -4.664  1.00 54.18  ? 381  LEU A CG    1 
ATOM   3019 C  CD1   . LEU A 1 384 ? 21.298 -3.256  -4.460  1.00 55.70  ? 381  LEU A CD1   1 
ATOM   3020 C  CD2   . LEU A 1 384 ? 22.697 -1.427  -5.414  1.00 51.95  ? 381  LEU A CD2   1 
ATOM   3021 N  N     . ARG A 1 385 ? 26.020 -3.270  -5.277  1.00 36.08  ? 382  ARG A N     1 
ATOM   3022 C  CA    . ARG A 1 385 ? 26.926 -2.819  -6.317  1.00 33.62  ? 382  ARG A CA    1 
ATOM   3023 C  C     . ARG A 1 385 ? 26.323 -3.066  -7.694  1.00 46.41  ? 382  ARG A C     1 
ATOM   3024 O  O     . ARG A 1 385 ? 26.076 -4.213  -8.066  1.00 44.91  ? 382  ARG A O     1 
ATOM   3025 C  CB    . ARG A 1 385 ? 28.266 -3.541  -6.181  1.00 47.24  ? 382  ARG A CB    1 
ATOM   3026 C  CG    . ARG A 1 385 ? 29.308 -3.150  -7.202  1.00 50.80  ? 382  ARG A CG    1 
ATOM   3027 C  CD    . ARG A 1 385 ? 30.592 -3.929  -6.969  1.00 66.06  ? 382  ARG A CD    1 
ATOM   3028 N  NE    . ARG A 1 385 ? 31.641 -3.593  -7.928  1.00 76.78  ? 382  ARG A NE    1 
ATOM   3029 C  CZ    . ARG A 1 385 ? 31.762 -4.149  -9.132  1.00 61.11  ? 382  ARG A CZ    1 
ATOM   3030 N  NH1   . ARG A 1 385 ? 32.754 -3.785  -9.935  1.00 67.03  ? 382  ARG A NH1   1 
ATOM   3031 N  NH2   . ARG A 1 385 ? 30.887 -5.058  -9.539  1.00 55.98  ? 382  ARG A NH2   1 
ATOM   3032 N  N     . ARG A 1 386 ? 26.068 -1.994  -8.437  1.00 34.37  ? 383  ARG A N     1 
ATOM   3033 C  CA    . ARG A 1 386 ? 25.490 -2.116  -9.772  1.00 42.13  ? 383  ARG A CA    1 
ATOM   3034 C  C     . ARG A 1 386 ? 26.380 -1.426  -10.792 1.00 38.68  ? 383  ARG A C     1 
ATOM   3035 O  O     . ARG A 1 386 ? 26.941 -0.372  -10.519 1.00 36.11  ? 383  ARG A O     1 
ATOM   3036 C  CB    . ARG A 1 386 ? 24.082 -1.522  -9.808  1.00 45.97  ? 383  ARG A CB    1 
ATOM   3037 C  CG    . ARG A 1 386 ? 23.076 -2.236  -8.916  1.00 51.46  ? 383  ARG A CG    1 
ATOM   3038 C  CD    . ARG A 1 386 ? 22.506 -3.470  -9.596  1.00 41.21  ? 383  ARG A CD    1 
ATOM   3039 N  NE    . ARG A 1 386 ? 21.355 -4.015  -8.884  1.00 44.93  ? 383  ARG A NE    1 
ATOM   3040 C  CZ    . ARG A 1 386 ? 21.432 -4.928  -7.920  1.00 51.27  ? 383  ARG A CZ    1 
ATOM   3041 N  NH1   . ARG A 1 386 ? 22.614 -5.402  -7.537  1.00 49.91  ? 383  ARG A NH1   1 
ATOM   3042 N  NH2   . ARG A 1 386 ? 20.322 -5.365  -7.332  1.00 57.96  ? 383  ARG A NH2   1 
ATOM   3043 N  N     A CYS A 1 387 ? 26.517 -2.025  -11.971 0.65 43.74  ? 384  CYS A N     1 
ATOM   3044 N  N     B CYS A 1 387 ? 26.517 -2.024  -11.971 0.35 43.71  ? 384  CYS A N     1 
ATOM   3045 C  CA    . CYS A 1 387 ? 27.334 -1.424  -13.022 1.00 40.71  ? 384  CYS A CA    1 
ATOM   3046 C  C     . CYS A 1 387 ? 26.465 -0.813  -14.107 1.00 45.60  ? 384  CYS A C     1 
ATOM   3047 O  O     . CYS A 1 387 ? 25.334 -1.241  -14.325 1.00 42.35  ? 384  CYS A O     1 
ATOM   3048 C  CB    . CYS A 1 387 ? 28.280 -2.459  -13.636 1.00 44.46  ? 384  CYS A CB    1 
ATOM   3049 S  SG    A CYS A 1 387 ? 27.444 -3.687  -14.673 0.65 45.95  ? 384  CYS A SG    1 
ATOM   3050 S  SG    B CYS A 1 387 ? 29.207 -3.434  -12.428 0.35 55.69  ? 384  CYS A SG    1 
ATOM   3051 N  N     . CYS A 1 388 ? 27.000 0.192   -14.788 1.00 49.84  ? 385  CYS A N     1 
ATOM   3052 C  CA    . CYS A 1 388 ? 26.353 0.730   -15.975 1.00 53.12  ? 385  CYS A CA    1 
ATOM   3053 C  C     . CYS A 1 388 ? 27.421 1.257   -16.926 1.00 47.14  ? 385  CYS A C     1 
ATOM   3054 O  O     . CYS A 1 388 ? 28.592 1.344   -16.558 1.00 44.03  ? 385  CYS A O     1 
ATOM   3055 C  CB    . CYS A 1 388 ? 25.344 1.819   -15.602 1.00 48.67  ? 385  CYS A CB    1 
ATOM   3056 S  SG    . CYS A 1 388 ? 26.064 3.394   -15.104 1.00 46.70  ? 385  CYS A SG    1 
ATOM   3057 N  N     . ALA A 1 389 ? 27.029 1.598   -18.152 1.00 44.52  ? 386  ALA A N     1 
ATOM   3058 C  CA    . ALA A 1 389 ? 27.994 2.055   -19.148 1.00 38.86  ? 386  ALA A CA    1 
ATOM   3059 C  C     . ALA A 1 389 ? 28.603 3.408   -18.784 1.00 44.63  ? 386  ALA A C     1 
ATOM   3060 O  O     . ALA A 1 389 ? 27.952 4.245   -18.164 1.00 50.93  ? 386  ALA A O     1 
ATOM   3061 C  CB    . ALA A 1 389 ? 27.341 2.136   -20.519 1.00 40.95  ? 386  ALA A CB    1 
ATOM   3062 N  N     . LEU A 1 390 ? 29.854 3.613   -19.172 1.00 35.93  ? 387  LEU A N     1 
ATOM   3063 C  CA    . LEU A 1 390 ? 30.497 4.910   -19.028 1.00 36.98  ? 387  LEU A CA    1 
ATOM   3064 C  C     . LEU A 1 390 ? 30.978 5.343   -20.401 1.00 46.01  ? 387  LEU A C     1 
ATOM   3065 O  O     . LEU A 1 390 ? 32.002 4.871   -20.890 1.00 48.08  ? 387  LEU A O     1 
ATOM   3066 C  CB    . LEU A 1 390 ? 31.661 4.848   -18.038 1.00 38.15  ? 387  LEU A CB    1 
ATOM   3067 C  CG    . LEU A 1 390 ? 32.031 6.090   -17.222 1.00 40.32  ? 387  LEU A CG    1 
ATOM   3068 C  CD1   . LEU A 1 390 ? 33.179 5.765   -16.277 1.00 41.58  ? 387  LEU A CD1   1 
ATOM   3069 C  CD2   . LEU A 1 390 ? 32.394 7.275   -18.087 1.00 39.05  ? 387  LEU A CD2   1 
ATOM   3070 N  N     . THR A 1 391 ? 30.236 6.239   -21.034 1.00 42.95  ? 388  THR A N     1 
ATOM   3071 C  CA    . THR A 1 391 ? 30.526 6.568   -22.420 1.00 47.56  ? 388  THR A CA    1 
ATOM   3072 C  C     . THR A 1 391 ? 31.111 7.965   -22.543 1.00 48.44  ? 388  THR A C     1 
ATOM   3073 O  O     . THR A 1 391 ? 31.750 8.297   -23.540 1.00 47.49  ? 388  THR A O     1 
ATOM   3074 C  CB    . THR A 1 391 ? 29.261 6.450   -23.297 1.00 53.28  ? 388  THR A CB    1 
ATOM   3075 O  OG1   . THR A 1 391 ? 28.329 7.479   -22.942 1.00 53.86  ? 388  THR A OG1   1 
ATOM   3076 C  CG2   . THR A 1 391 ? 28.608 5.088   -23.105 1.00 46.11  ? 388  THR A CG2   1 
ATOM   3077 N  N     . ARG A 1 392 ? 30.903 8.780   -21.515 1.00 46.91  ? 389  ARG A N     1 
ATOM   3078 C  CA    . ARG A 1 392 ? 31.362 10.162  -21.550 1.00 43.21  ? 389  ARG A CA    1 
ATOM   3079 C  C     . ARG A 1 392 ? 31.883 10.648  -20.213 1.00 37.74  ? 389  ARG A C     1 
ATOM   3080 O  O     . ARG A 1 392 ? 31.283 10.406  -19.177 1.00 37.72  ? 389  ARG A O     1 
ATOM   3081 C  CB    . ARG A 1 392 ? 30.237 11.077  -22.009 1.00 46.38  ? 389  ARG A CB    1 
ATOM   3082 C  CG    . ARG A 1 392 ? 30.251 11.278  -23.488 1.00 54.00  ? 389  ARG A CG    1 
ATOM   3083 C  CD    . ARG A 1 392 ? 29.004 11.962  -23.962 1.00 60.99  ? 389  ARG A CD    1 
ATOM   3084 N  NE    . ARG A 1 392 ? 28.769 11.622  -25.356 1.00 62.86  ? 389  ARG A NE    1 
ATOM   3085 C  CZ    . ARG A 1 392 ? 27.636 11.860  -26.002 1.00 52.89  ? 389  ARG A CZ    1 
ATOM   3086 N  NH1   . ARG A 1 392 ? 27.521 11.507  -27.273 1.00 48.81  ? 389  ARG A NH1   1 
ATOM   3087 N  NH2   . ARG A 1 392 ? 26.624 12.437  -25.376 1.00 54.10  ? 389  ARG A NH2   1 
ATOM   3088 N  N     . TYR A 1 393 ? 33.001 11.352  -20.253 1.00 39.22  ? 390  TYR A N     1 
ATOM   3089 C  CA    . TYR A 1 393 ? 33.541 11.937  -19.044 1.00 36.54  ? 390  TYR A CA    1 
ATOM   3090 C  C     . TYR A 1 393 ? 32.824 13.242  -18.758 1.00 42.31  ? 390  TYR A C     1 
ATOM   3091 O  O     . TYR A 1 393 ? 33.382 14.315  -18.963 1.00 40.32  ? 390  TYR A O     1 
ATOM   3092 C  CB    . TYR A 1 393 ? 35.043 12.175  -19.166 1.00 39.21  ? 390  TYR A CB    1 
ATOM   3093 C  CG    . TYR A 1 393 ? 35.883 10.917  -19.125 1.00 40.42  ? 390  TYR A CG    1 
ATOM   3094 C  CD1   . TYR A 1 393 ? 37.266 10.991  -19.121 1.00 34.72  ? 390  TYR A CD1   1 
ATOM   3095 C  CD2   . TYR A 1 393 ? 35.295 9.666   -19.082 1.00 42.56  ? 390  TYR A CD2   1 
ATOM   3096 C  CE1   . TYR A 1 393 ? 38.039 9.847   -19.077 1.00 34.17  ? 390  TYR A CE1   1 
ATOM   3097 C  CE2   . TYR A 1 393 ? 36.057 8.521   -19.034 1.00 44.44  ? 390  TYR A CE2   1 
ATOM   3098 C  CZ    . TYR A 1 393 ? 37.426 8.617   -19.034 1.00 40.62  ? 390  TYR A CZ    1 
ATOM   3099 O  OH    . TYR A 1 393 ? 38.181 7.461   -18.983 1.00 46.83  ? 390  TYR A OH    1 
ATOM   3100 N  N     . ASP A 1 394 ? 31.579 13.160  -18.309 1.00 42.74  ? 391  ASP A N     1 
ATOM   3101 C  CA    . ASP A 1 394 ? 30.941 14.339  -17.745 1.00 43.46  ? 391  ASP A CA    1 
ATOM   3102 C  C     . ASP A 1 394 ? 30.186 13.942  -16.493 1.00 33.07  ? 391  ASP A C     1 
ATOM   3103 O  O     . ASP A 1 394 ? 29.451 12.942  -16.463 1.00 35.47  ? 391  ASP A O     1 
ATOM   3104 C  CB    . ASP A 1 394 ? 30.023 15.041  -18.751 1.00 47.69  ? 391  ASP A CB    1 
ATOM   3105 C  CG    . ASP A 1 394 ? 29.073 16.023  -18.079 1.00 46.06  ? 391  ASP A CG    1 
ATOM   3106 O  OD1   . ASP A 1 394 ? 29.446 17.211  -17.896 1.00 65.27  ? 391  ASP A OD1   1 
ATOM   3107 O  OD2   . ASP A 1 394 ? 27.956 15.603  -17.728 1.00 43.57  ? 391  ASP A OD2   1 
ATOM   3108 N  N     . ALA A 1 395 ? 30.402 14.729  -15.446 1.00 36.28  ? 392  ALA A N     1 
ATOM   3109 C  CA    . ALA A 1 395 ? 29.894 14.454  -14.114 1.00 36.70  ? 392  ALA A CA    1 
ATOM   3110 C  C     . ALA A 1 395 ? 28.371 14.401  -14.041 1.00 30.33  ? 392  ALA A C     1 
ATOM   3111 O  O     . ALA A 1 395 ? 27.807 13.574  -13.325 1.00 33.81  ? 392  ALA A O     1 
ATOM   3112 C  CB    . ALA A 1 395 ? 30.425 15.492  -13.135 1.00 33.03  ? 392  ALA A CB    1 
ATOM   3113 N  N     . HIS A 1 396 ? 27.695 15.276  -14.773 1.00 38.38  ? 393  HIS A N     1 
ATOM   3114 C  CA    . HIS A 1 396 ? 26.236 15.299  -14.678 1.00 36.99  ? 393  HIS A CA    1 
ATOM   3115 C  C     . HIS A 1 396 ? 25.612 14.039  -15.267 1.00 32.13  ? 393  HIS A C     1 
ATOM   3116 O  O     . HIS A 1 396 ? 24.650 13.504  -14.714 1.00 37.19  ? 393  HIS A O     1 
ATOM   3117 C  CB    . HIS A 1 396 ? 25.676 16.559  -15.333 1.00 42.38  ? 393  HIS A CB    1 
ATOM   3118 C  CG    . HIS A 1 396 ? 25.845 17.785  -14.487 1.00 44.78  ? 393  HIS A CG    1 
ATOM   3119 N  ND1   . HIS A 1 396 ? 26.799 18.746  -14.746 1.00 45.90  ? 393  HIS A ND1   1 
ATOM   3120 C  CD2   . HIS A 1 396 ? 25.210 18.180  -13.358 1.00 48.75  ? 393  HIS A CD2   1 
ATOM   3121 C  CE1   . HIS A 1 396 ? 26.726 19.693  -13.826 1.00 42.50  ? 393  HIS A CE1   1 
ATOM   3122 N  NE2   . HIS A 1 396 ? 25.772 19.372  -12.971 1.00 54.06  ? 393  HIS A NE2   1 
ATOM   3123 N  N     . LYS A 1 397 ? 26.178 13.541  -16.360 1.00 38.22  ? 394  LYS A N     1 
ATOM   3124 C  CA    . LYS A 1 397 ? 25.705 12.277  -16.918 1.00 34.31  ? 394  LYS A CA    1 
ATOM   3125 C  C     . LYS A 1 397 ? 25.972 11.107  -15.977 1.00 38.39  ? 394  LYS A C     1 
ATOM   3126 O  O     . LYS A 1 397 ? 25.087 10.276  -15.732 1.00 39.59  ? 394  LYS A O     1 
ATOM   3127 C  CB    . LYS A 1 397 ? 26.349 11.997  -18.273 1.00 40.40  ? 394  LYS A CB    1 
ATOM   3128 C  CG    . LYS A 1 397 ? 25.977 10.619  -18.808 1.00 49.20  ? 394  LYS A CG    1 
ATOM   3129 C  CD    . LYS A 1 397 ? 26.418 10.396  -20.240 1.00 54.49  ? 394  LYS A CD    1 
ATOM   3130 C  CE    . LYS A 1 397 ? 26.044 8.993   -20.701 1.00 51.63  ? 394  LYS A CE    1 
ATOM   3131 N  NZ    . LYS A 1 397 ? 24.590 8.687   -20.497 1.00 58.55  ? 394  LYS A NZ    1 
ATOM   3132 N  N     . MET A 1 398 ? 27.191 11.044  -15.444 1.00 36.61  ? 395  MET A N     1 
ATOM   3133 C  CA    . MET A 1 398 ? 27.564 9.949   -14.559 1.00 33.58  ? 395  MET A CA    1 
ATOM   3134 C  C     . MET A 1 398 ? 26.687 9.937   -13.309 1.00 31.43  ? 395  MET A C     1 
ATOM   3135 O  O     . MET A 1 398 ? 26.222 8.884   -12.881 1.00 36.80  ? 395  MET A O     1 
ATOM   3136 C  CB    . MET A 1 398 ? 29.054 10.041  -14.187 1.00 33.02  ? 395  MET A CB    1 
ATOM   3137 C  CG    . MET A 1 398 ? 29.976 9.740   -15.365 1.00 34.59  ? 395  MET A CG    1 
ATOM   3138 S  SD    . MET A 1 398 ? 31.719 9.493   -14.930 1.00 45.91  ? 395  MET A SD    1 
ATOM   3139 C  CE    . MET A 1 398 ? 32.268 11.175  -14.681 1.00 38.59  ? 395  MET A CE    1 
ATOM   3140 N  N     . SER A 1 399 ? 26.439 11.111  -12.738 1.00 36.01  ? 396  SER A N     1 
ATOM   3141 C  CA    . SER A 1 399 ? 25.652 11.192  -11.510 1.00 33.15  ? 396  SER A CA    1 
ATOM   3142 C  C     . SER A 1 399 ? 24.179 10.892  -11.773 1.00 33.83  ? 396  SER A C     1 
ATOM   3143 O  O     . SER A 1 399 ? 23.497 10.300  -10.936 1.00 34.21  ? 396  SER A O     1 
ATOM   3144 C  CB    . SER A 1 399 ? 25.800 12.568  -10.858 1.00 34.38  ? 396  SER A CB    1 
ATOM   3145 O  OG    . SER A 1 399 ? 25.354 13.609  -11.715 1.00 38.00  ? 396  SER A OG    1 
ATOM   3146 N  N     . HIS A 1 400 ? 23.689 11.295  -12.937 1.00 37.15  ? 397  HIS A N     1 
ATOM   3147 C  CA    . HIS A 1 400 ? 22.320 10.951  -13.293 1.00 43.15  ? 397  HIS A CA    1 
ATOM   3148 C  C     . HIS A 1 400 ? 22.193 9.439   -13.504 1.00 40.97  ? 397  HIS A C     1 
ATOM   3149 O  O     . HIS A 1 400 ? 21.259 8.811   -13.002 1.00 41.74  ? 397  HIS A O     1 
ATOM   3150 C  CB    . HIS A 1 400 ? 21.868 11.702  -14.543 1.00 48.34  ? 397  HIS A CB    1 
ATOM   3151 C  CG    . HIS A 1 400 ? 20.438 11.452  -14.896 1.00 60.49  ? 397  HIS A CG    1 
ATOM   3152 N  ND1   . HIS A 1 400 ? 19.958 11.538  -16.184 1.00 65.54  ? 397  HIS A ND1   1 
ATOM   3153 C  CD2   . HIS A 1 400 ? 19.379 11.110  -14.122 1.00 58.37  ? 397  HIS A CD2   1 
ATOM   3154 C  CE1   . HIS A 1 400 ? 18.668 11.260  -16.191 1.00 62.17  ? 397  HIS A CE1   1 
ATOM   3155 N  NE2   . HIS A 1 400 ? 18.291 10.998  -14.952 1.00 69.57  ? 397  HIS A NE2   1 
ATOM   3156 N  N     . ASP A 1 401 ? 23.154 8.862   -14.225 1.00 41.09  ? 398  ASP A N     1 
ATOM   3157 C  CA    . ASP A 1 401 ? 23.207 7.415   -14.444 1.00 39.27  ? 398  ASP A CA    1 
ATOM   3158 C  C     . ASP A 1 401 ? 23.294 6.622   -13.152 1.00 43.60  ? 398  ASP A C     1 
ATOM   3159 O  O     . ASP A 1 401 ? 22.615 5.606   -12.992 1.00 43.01  ? 398  ASP A O     1 
ATOM   3160 C  CB    . ASP A 1 401 ? 24.387 7.059   -15.337 1.00 45.00  ? 398  ASP A CB    1 
ATOM   3161 C  CG    . ASP A 1 401 ? 24.200 7.541   -16.755 1.00 51.31  ? 398  ASP A CG    1 
ATOM   3162 O  OD1   . ASP A 1 401 ? 23.041 7.837   -17.119 1.00 50.24  ? 398  ASP A OD1   1 
ATOM   3163 O  OD2   . ASP A 1 401 ? 25.199 7.630   -17.502 1.00 54.45  ? 398  ASP A OD2   1 
ATOM   3164 N  N     . ALA A 1 402 ? 24.133 7.090   -12.233 1.00 39.75  ? 399  ALA A N     1 
ATOM   3165 C  CA    . ALA A 1 402 ? 24.284 6.461   -10.929 1.00 38.42  ? 399  ALA A CA    1 
ATOM   3166 C  C     . ALA A 1 402 ? 22.972 6.447   -10.165 1.00 31.93  ? 399  ALA A C     1 
ATOM   3167 O  O     . ALA A 1 402 ? 22.628 5.452   -9.529  1.00 38.45  ? 399  ALA A O     1 
ATOM   3168 C  CB    . ALA A 1 402 ? 25.355 7.183   -10.115 1.00 36.55  ? 399  ALA A CB    1 
ATOM   3169 N  N     . PHE A 1 403 ? 22.240 7.555   -10.217 1.00 33.85  ? 400  PHE A N     1 
ATOM   3170 C  CA    . PHE A 1 403 ? 20.971 7.650   -9.507  1.00 42.67  ? 400  PHE A CA    1 
ATOM   3171 C  C     . PHE A 1 403 ? 19.970 6.674   -10.099 1.00 41.77  ? 400  PHE A C     1 
ATOM   3172 O  O     . PHE A 1 403 ? 19.199 6.053   -9.383  1.00 42.75  ? 400  PHE A O     1 
ATOM   3173 C  CB    . PHE A 1 403 ? 20.401 9.069   -9.559  1.00 44.05  ? 400  PHE A CB    1 
ATOM   3174 C  CG    . PHE A 1 403 ? 19.145 9.241   -8.747  1.00 47.72  ? 400  PHE A CG    1 
ATOM   3175 C  CD1   . PHE A 1 403 ? 17.901 9.313   -9.365  1.00 47.08  ? 400  PHE A CD1   1 
ATOM   3176 C  CD2   . PHE A 1 403 ? 19.207 9.311   -7.362  1.00 47.81  ? 400  PHE A CD2   1 
ATOM   3177 C  CE1   . PHE A 1 403 ? 16.742 9.461   -8.612  1.00 52.75  ? 400  PHE A CE1   1 
ATOM   3178 C  CE2   . PHE A 1 403 ? 18.055 9.462   -6.605  1.00 57.08  ? 400  PHE A CE2   1 
ATOM   3179 C  CZ    . PHE A 1 403 ? 16.821 9.537   -7.231  1.00 56.96  ? 400  PHE A CZ    1 
ATOM   3180 N  N     . THR A 1 404 ? 20.004 6.543   -11.417 1.00 46.04  ? 401  THR A N     1 
ATOM   3181 C  CA    . THR A 1 404 ? 19.119 5.619   -12.115 1.00 47.75  ? 401  THR A CA    1 
ATOM   3182 C  C     . THR A 1 404 ? 19.276 4.184   -11.625 1.00 51.69  ? 401  THR A C     1 
ATOM   3183 O  O     . THR A 1 404 ? 18.286 3.507   -11.353 1.00 53.32  ? 401  THR A O     1 
ATOM   3184 C  CB    . THR A 1 404 ? 19.368 5.655   -13.631 1.00 52.24  ? 401  THR A CB    1 
ATOM   3185 O  OG1   . THR A 1 404 ? 19.164 6.988   -14.117 1.00 46.78  ? 401  THR A OG1   1 
ATOM   3186 C  CG2   . THR A 1 404 ? 18.426 4.703   -14.347 1.00 54.24  ? 401  THR A CG2   1 
ATOM   3187 N  N     . VAL A 1 405 ? 20.514 3.714   -11.498 1.00 43.99  ? 402  VAL A N     1 
ATOM   3188 C  CA    . VAL A 1 405 ? 20.720 2.310   -11.172 1.00 41.85  ? 402  VAL A CA    1 
ATOM   3189 C  C     . VAL A 1 405 ? 20.459 2.021   -9.696  1.00 44.89  ? 402  VAL A C     1 
ATOM   3190 O  O     . VAL A 1 405 ? 20.273 0.870   -9.329  1.00 43.48  ? 402  VAL A O     1 
ATOM   3191 C  CB    . VAL A 1 405 ? 22.144 1.832   -11.543 1.00 49.21  ? 402  VAL A CB    1 
ATOM   3192 C  CG1   . VAL A 1 405 ? 22.510 2.285   -12.948 1.00 53.52  ? 402  VAL A CG1   1 
ATOM   3193 C  CG2   . VAL A 1 405 ? 23.159 2.333   -10.545 1.00 56.34  ? 402  VAL A CG2   1 
ATOM   3194 N  N     . ILE A 1 406 ? 20.424 3.055   -8.853  1.00 48.19  ? 403  ILE A N     1 
ATOM   3195 C  CA    . ILE A 1 406 ? 20.207 2.847   -7.417  1.00 48.23  ? 403  ILE A CA    1 
ATOM   3196 C  C     . ILE A 1 406 ? 18.840 3.297   -6.885  1.00 47.88  ? 403  ILE A C     1 
ATOM   3197 O  O     . ILE A 1 406 ? 18.451 2.904   -5.786  1.00 52.20  ? 403  ILE A O     1 
ATOM   3198 C  CB    . ILE A 1 406 ? 21.268 3.578   -6.561  1.00 43.38  ? 403  ILE A CB    1 
ATOM   3199 C  CG1   . ILE A 1 406 ? 21.072 5.097   -6.654  1.00 43.47  ? 403  ILE A CG1   1 
ATOM   3200 C  CG2   . ILE A 1 406 ? 22.666 3.134   -6.942  1.00 40.51  ? 403  ILE A CG2   1 
ATOM   3201 C  CD1   . ILE A 1 406 ? 21.797 5.876   -5.585  1.00 45.84  ? 403  ILE A CD1   1 
ATOM   3202 N  N     . LYS A 1 407 ? 18.123 4.111   -7.653  1.00 49.74  ? 404  LYS A N     1 
ATOM   3203 C  CA    . LYS A 1 407 ? 16.918 4.784   -7.157  1.00 55.04  ? 404  LYS A CA    1 
ATOM   3204 C  C     . LYS A 1 407 ? 15.805 3.838   -6.713  1.00 54.49  ? 404  LYS A C     1 
ATOM   3205 O  O     . LYS A 1 407 ? 14.929 4.219   -5.934  1.00 54.00  ? 404  LYS A O     1 
ATOM   3206 C  CB    . LYS A 1 407 ? 16.365 5.725   -8.223  1.00 51.86  ? 404  LYS A CB    1 
ATOM   3207 C  CG    . LYS A 1 407 ? 15.881 5.012   -9.468  1.00 49.89  ? 404  LYS A CG    1 
ATOM   3208 C  CD    . LYS A 1 407 ? 15.287 5.998   -10.462 1.00 56.85  ? 404  LYS A CD    1 
ATOM   3209 C  CE    . LYS A 1 407 ? 14.745 5.273   -11.677 1.00 63.88  ? 404  LYS A CE    1 
ATOM   3210 N  NZ    . LYS A 1 407 ? 15.756 4.342   -12.258 1.00 58.76  ? 404  LYS A NZ    1 
ATOM   3211 N  N     . ASN A 1 408 ? 15.840 2.610   -7.212  1.00 50.62  ? 405  ASN A N     1 
ATOM   3212 C  CA    . ASN A 1 408 ? 14.852 1.606   -6.838  1.00 59.08  ? 405  ASN A CA    1 
ATOM   3213 C  C     . ASN A 1 408 ? 15.179 0.924   -5.515  1.00 61.94  ? 405  ASN A C     1 
ATOM   3214 O  O     . ASN A 1 408 ? 14.425 0.067   -5.050  1.00 59.06  ? 405  ASN A O     1 
ATOM   3215 C  CB    . ASN A 1 408 ? 14.739 0.560   -7.939  1.00 57.45  ? 405  ASN A CB    1 
ATOM   3216 C  CG    . ASN A 1 408 ? 16.094 0.136   -8.465  1.00 67.95  ? 405  ASN A CG    1 
ATOM   3217 O  OD1   . ASN A 1 408 ? 17.008 0.954   -8.596  1.00 64.88  ? 405  ASN A OD1   1 
ATOM   3218 N  ND2   . ASN A 1 408 ? 16.241 -1.149  -8.744  1.00 71.76  ? 405  ASN A ND2   1 
ATOM   3219 N  N     . CYS A 1 409 ? 16.312 1.293   -4.918  1.00 63.49  ? 406  CYS A N     1 
ATOM   3220 C  CA    . CYS A 1 409 ? 16.712 0.762   -3.617  1.00 59.83  ? 406  CYS A CA    1 
ATOM   3221 C  C     . CYS A 1 409 ? 15.964 1.483   -2.511  1.00 57.98  ? 406  CYS A C     1 
ATOM   3222 O  O     . CYS A 1 409 ? 15.992 1.081   -1.347  1.00 61.92  ? 406  CYS A O     1 
ATOM   3223 C  CB    . CYS A 1 409 ? 18.218 0.907   -3.407  1.00 57.55  ? 406  CYS A CB    1 
ATOM   3224 S  SG    . CYS A 1 409 ? 19.162 -0.502  -3.978  1.00 77.81  ? 406  CYS A SG    1 
ATOM   3225 N  N     . ASN A 1 410 ? 15.300 2.563   -2.896  1.00 56.75  ? 407  ASN A N     1 
ATOM   3226 C  CA    . ASN A 1 410 ? 14.529 3.369   -1.973  1.00 62.82  ? 407  ASN A CA    1 
ATOM   3227 C  C     . ASN A 1 410 ? 13.220 2.686   -1.563  1.00 65.81  ? 407  ASN A C     1 
ATOM   3228 O  O     . ASN A 1 410 ? 12.245 2.707   -2.315  1.00 63.81  ? 407  ASN A O     1 
ATOM   3229 C  CB    . ASN A 1 410 ? 14.241 4.730   -2.609  1.00 54.74  ? 407  ASN A CB    1 
ATOM   3230 C  CG    . ASN A 1 410 ? 13.788 5.745   -1.603  1.00 54.65  ? 407  ASN A CG    1 
ATOM   3231 O  OD1   . ASN A 1 410 ? 13.905 5.523   -0.400  1.00 64.05  ? 407  ASN A OD1   1 
ATOM   3232 N  ND2   . ASN A 1 410 ? 13.272 6.876   -2.083  1.00 58.01  ? 407  ASN A ND2   1 
ATOM   3233 N  N     . THR A 1 411 ? 13.196 2.081   -0.376  1.00 64.23  ? 408  THR A N     1 
ATOM   3234 C  CA    . THR A 1 411 ? 11.987 1.411   0.108   1.00 65.66  ? 408  THR A CA    1 
ATOM   3235 C  C     . THR A 1 411 ? 10.916 2.428   0.454   1.00 65.89  ? 408  THR A C     1 
ATOM   3236 O  O     . THR A 1 411 ? 9.748  2.076   0.606   1.00 80.71  ? 408  THR A O     1 
ATOM   3237 C  CB    . THR A 1 411 ? 12.246 0.536   1.356   1.00 61.29  ? 408  THR A CB    1 
ATOM   3238 O  OG1   . THR A 1 411 ? 12.836 1.331   2.393   1.00 67.32  ? 408  THR A OG1   1 
ATOM   3239 C  CG2   . THR A 1 411 ? 13.160 -0.632  1.023   1.00 67.30  ? 408  THR A CG2   1 
ATOM   3240 N  N     . SER A 1 412 ? 11.330 3.685   0.582   1.00 70.81  ? 409  SER A N     1 
ATOM   3241 C  CA    . SER A 1 412 ? 10.437 4.796   0.894   1.00 65.52  ? 409  SER A CA    1 
ATOM   3242 C  C     . SER A 1 412 ? 9.153  4.792   0.080   1.00 76.08  ? 409  SER A C     1 
ATOM   3243 O  O     . SER A 1 412 ? 9.159  4.494   -1.115  1.00 73.89  ? 409  SER A O     1 
ATOM   3244 C  CB    . SER A 1 412 ? 11.158 6.122   0.677   1.00 69.55  ? 409  SER A CB    1 
ATOM   3245 O  OG    . SER A 1 412 ? 10.259 7.119   0.242   1.00 69.00  ? 409  SER A OG    1 
ATOM   3246 N  N     . GLY A 1 413 ? 8.049  5.120   0.741   1.00 79.28  ? 410  GLY A N     1 
ATOM   3247 C  CA    . GLY A 1 413 ? 6.776  5.246   0.063   1.00 81.87  ? 410  GLY A CA    1 
ATOM   3248 C  C     . GLY A 1 413 ? 6.801  6.452   -0.854  1.00 80.63  ? 410  GLY A C     1 
ATOM   3249 O  O     . GLY A 1 413 ? 6.507  6.355   -2.042  1.00 78.09  ? 410  GLY A O     1 
ATOM   3250 N  N     . ILE A 1 414 ? 7.172  7.594   -0.285  1.00 80.93  ? 411  ILE A N     1 
ATOM   3251 C  CA    . ILE A 1 414 ? 7.258  8.844   -1.032  1.00 84.96  ? 411  ILE A CA    1 
ATOM   3252 C  C     . ILE A 1 414 ? 8.684  9.011   -1.562  1.00 86.36  ? 411  ILE A C     1 
ATOM   3253 O  O     . ILE A 1 414 ? 9.649  8.699   -0.868  1.00 77.40  ? 411  ILE A O     1 
ATOM   3254 C  CB    . ILE A 1 414 ? 6.849  10.053  -0.142  1.00 82.32  ? 411  ILE A CB    1 
ATOM   3255 C  CG1   . ILE A 1 414 ? 6.753  11.345  -0.963  1.00 83.18  ? 411  ILE A CG1   1 
ATOM   3256 C  CG2   . ILE A 1 414 ? 7.792  10.183  1.061   1.00 72.14  ? 411  ILE A CG2   1 
ATOM   3257 C  CD1   . ILE A 1 414 ? 6.068  12.498  -0.235  1.00 85.01  ? 411  ILE A CD1   1 
ATOM   3258 N  N     . GLN A 1 415 ? 8.820  9.505   -2.789  1.00 85.62  ? 412  GLN A N     1 
ATOM   3259 C  CA    . GLN A 1 415 ? 10.114 9.479   -3.470  1.00 83.38  ? 412  GLN A CA    1 
ATOM   3260 C  C     . GLN A 1 415 ? 11.041 10.622  -3.070  1.00 82.73  ? 412  GLN A C     1 
ATOM   3261 O  O     . GLN A 1 415 ? 12.215 10.629  -3.440  1.00 80.32  ? 412  GLN A O     1 
ATOM   3262 C  CB    . GLN A 1 415 ? 9.907  9.489   -4.984  1.00 88.43  ? 412  GLN A CB    1 
ATOM   3263 C  CG    . GLN A 1 415 ? 9.167  8.269   -5.507  1.00 94.12  ? 412  GLN A CG    1 
ATOM   3264 C  CD    . GLN A 1 415 ? 8.900  8.337   -6.999  1.00 102.96 ? 412  GLN A CD    1 
ATOM   3265 O  OE1   . GLN A 1 415 ? 9.546  9.093   -7.725  1.00 98.85  ? 412  GLN A OE1   1 
ATOM   3266 N  NE2   . GLN A 1 415 ? 7.942  7.546   -7.462  1.00 107.19 ? 412  GLN A NE2   1 
ATOM   3267 N  N     . THR A 1 416 ? 10.507 11.582  -2.321  1.00 80.36  ? 413  THR A N     1 
ATOM   3268 C  CA    . THR A 1 416 ? 11.297 12.686  -1.788  1.00 75.06  ? 413  THR A CA    1 
ATOM   3269 C  C     . THR A 1 416 ? 12.188 12.217  -0.644  1.00 68.89  ? 413  THR A C     1 
ATOM   3270 O  O     . THR A 1 416 ? 13.330 12.654  -0.520  1.00 68.16  ? 413  THR A O     1 
ATOM   3271 C  CB    . THR A 1 416 ? 10.395 13.829  -1.298  1.00 73.96  ? 413  THR A CB    1 
ATOM   3272 O  OG1   . THR A 1 416 ? 9.678  14.370  -2.412  1.00 76.17  ? 413  THR A OG1   1 
ATOM   3273 C  CG2   . THR A 1 416 ? 11.214 14.934  -0.642  1.00 75.33  ? 413  THR A CG2   1 
ATOM   3274 N  N     . GLU A 1 417 ? 11.658 11.326  0.184   1.00 69.57  ? 414  GLU A N     1 
ATOM   3275 C  CA    . GLU A 1 417 ? 12.450 10.729  1.245   1.00 64.30  ? 414  GLU A CA    1 
ATOM   3276 C  C     . GLU A 1 417 ? 13.281 9.573   0.721   1.00 66.00  ? 414  GLU A C     1 
ATOM   3277 O  O     . GLU A 1 417 ? 12.947 8.959   -0.291  1.00 64.33  ? 414  GLU A O     1 
ATOM   3278 C  CB    . GLU A 1 417 ? 11.556 10.235  2.382   1.00 65.11  ? 414  GLU A CB    1 
ATOM   3279 C  CG    . GLU A 1 417 ? 10.684 11.308  2.987   1.00 67.60  ? 414  GLU A CG    1 
ATOM   3280 C  CD    . GLU A 1 417 ? 11.399 12.641  3.117   1.00 67.58  ? 414  GLU A CD    1 
ATOM   3281 O  OE1   . GLU A 1 417 ? 12.189 12.813  4.070   1.00 66.04  ? 414  GLU A OE1   1 
ATOM   3282 O  OE2   . GLU A 1 417 ? 11.149 13.527  2.270   1.00 67.42  ? 414  GLU A OE2   1 
ATOM   3283 N  N     . TRP A 1 418 ? 14.366 9.275   1.422   1.00 58.79  ? 415  TRP A N     1 
ATOM   3284 C  CA    . TRP A 1 418 ? 15.126 8.084   1.116   1.00 49.57  ? 415  TRP A CA    1 
ATOM   3285 C  C     . TRP A 1 418 ? 15.166 7.162   2.319   1.00 53.06  ? 415  TRP A C     1 
ATOM   3286 O  O     . TRP A 1 418 ? 15.695 7.514   3.373   1.00 49.65  ? 415  TRP A O     1 
ATOM   3287 C  CB    . TRP A 1 418 ? 16.543 8.428   0.672   1.00 54.53  ? 415  TRP A CB    1 
ATOM   3288 C  CG    . TRP A 1 418 ? 17.176 7.276   -0.005  1.00 46.60  ? 415  TRP A CG    1 
ATOM   3289 C  CD1   . TRP A 1 418 ? 17.667 6.150   0.582   1.00 42.24  ? 415  TRP A CD1   1 
ATOM   3290 C  CD2   . TRP A 1 418 ? 17.347 7.104   -1.414  1.00 44.93  ? 415  TRP A CD2   1 
ATOM   3291 N  NE1   . TRP A 1 418 ? 18.145 5.290   -0.374  1.00 46.95  ? 415  TRP A NE1   1 
ATOM   3292 C  CE2   . TRP A 1 418 ? 17.964 5.855   -1.609  1.00 42.97  ? 415  TRP A CE2   1 
ATOM   3293 C  CE3   . TRP A 1 418 ? 17.045 7.890   -2.530  1.00 50.08  ? 415  TRP A CE3   1 
ATOM   3294 C  CZ2   . TRP A 1 418 ? 18.290 5.371   -2.874  1.00 53.33  ? 415  TRP A CZ2   1 
ATOM   3295 C  CZ3   . TRP A 1 418 ? 17.374 7.410   -3.787  1.00 54.63  ? 415  TRP A CZ3   1 
ATOM   3296 C  CH2   . TRP A 1 418 ? 17.990 6.163   -3.949  1.00 46.84  ? 415  TRP A CH2   1 
ATOM   3297 N  N     . SER A 1 419 ? 14.596 5.976   2.154   1.00 58.01  ? 416  SER A N     1 
ATOM   3298 C  CA    . SER A 1 419 ? 14.626 4.976   3.207   1.00 58.33  ? 416  SER A CA    1 
ATOM   3299 C  C     . SER A 1 419 ? 14.970 3.606   2.639   1.00 55.42  ? 416  SER A C     1 
ATOM   3300 O  O     . SER A 1 419 ? 14.556 3.268   1.531   1.00 57.59  ? 416  SER A O     1 
ATOM   3301 C  CB    . SER A 1 419 ? 13.288 4.930   3.941   1.00 66.45  ? 416  SER A CB    1 
ATOM   3302 O  OG    . SER A 1 419 ? 12.933 6.223   4.395   1.00 72.28  ? 416  SER A OG    1 
ATOM   3303 N  N     . PRO A 1 420 ? 15.771 2.829   3.383   1.00 56.74  ? 417  PRO A N     1 
ATOM   3304 C  CA    . PRO A 1 420 ? 16.462 3.329   4.580   1.00 60.29  ? 417  PRO A CA    1 
ATOM   3305 C  C     . PRO A 1 420 ? 17.640 4.218   4.178   1.00 46.17  ? 417  PRO A C     1 
ATOM   3306 O  O     . PRO A 1 420 ? 18.203 4.004   3.105   1.00 54.61  ? 417  PRO A O     1 
ATOM   3307 C  CB    . PRO A 1 420 ? 16.918 2.055   5.302   1.00 58.70  ? 417  PRO A CB    1 
ATOM   3308 C  CG    . PRO A 1 420 ? 16.729 0.940   4.337   1.00 57.06  ? 417  PRO A CG    1 
ATOM   3309 C  CD    . PRO A 1 420 ? 15.866 1.368   3.223   1.00 57.10  ? 417  PRO A CD    1 
ATOM   3310 N  N     . PRO A 1 421 ? 17.971 5.222   5.010   1.00 49.07  ? 418  PRO A N     1 
ATOM   3311 C  CA    . PRO A 1 421 ? 18.965 6.254   4.681   1.00 46.52  ? 418  PRO A CA    1 
ATOM   3312 C  C     . PRO A 1 421 ? 20.281 5.668   4.188   1.00 38.69  ? 418  PRO A C     1 
ATOM   3313 O  O     . PRO A 1 421 ? 20.641 4.561   4.588   1.00 41.74  ? 418  PRO A O     1 
ATOM   3314 C  CB    . PRO A 1 421 ? 19.160 6.989   6.009   1.00 51.20  ? 418  PRO A CB    1 
ATOM   3315 C  CG    . PRO A 1 421 ? 17.883 6.773   6.747   1.00 56.47  ? 418  PRO A CG    1 
ATOM   3316 C  CD    . PRO A 1 421 ? 17.448 5.384   6.377   1.00 54.17  ? 418  PRO A CD    1 
ATOM   3317 N  N     . LEU A 1 422 ? 20.978 6.405   3.327   1.00 42.02  ? 419  LEU A N     1 
ATOM   3318 C  CA    . LEU A 1 422 ? 22.232 5.935   2.738   1.00 36.43  ? 419  LEU A CA    1 
ATOM   3319 C  C     . LEU A 1 422 ? 23.434 6.366   3.566   1.00 34.67  ? 419  LEU A C     1 
ATOM   3320 O  O     . LEU A 1 422 ? 23.595 7.545   3.864   1.00 40.65  ? 419  LEU A O     1 
ATOM   3321 C  CB    . LEU A 1 422 ? 22.374 6.452   1.305   1.00 29.94  ? 419  LEU A CB    1 
ATOM   3322 C  CG    . LEU A 1 422 ? 21.340 5.941   0.301   1.00 35.63  ? 419  LEU A CG    1 
ATOM   3323 C  CD1   . LEU A 1 422 ? 21.649 6.432   -1.123  1.00 32.79  ? 419  LEU A CD1   1 
ATOM   3324 C  CD2   . LEU A 1 422 ? 21.273 4.431   0.351   1.00 36.51  ? 419  LEU A CD2   1 
ATOM   3325 N  N     . THR A 1 423 ? 24.274 5.404   3.928   1.00 38.64  ? 420  THR A N     1 
ATOM   3326 C  CA    . THR A 1 423 ? 25.436 5.668   4.774   1.00 33.25  ? 420  THR A CA    1 
ATOM   3327 C  C     . THR A 1 423 ? 26.748 5.615   3.984   1.00 35.79  ? 420  THR A C     1 
ATOM   3328 O  O     . THR A 1 423 ? 27.833 5.810   4.539   1.00 31.35  ? 420  THR A O     1 
ATOM   3329 C  CB    . THR A 1 423 ? 25.500 4.667   5.929   1.00 41.07  ? 420  THR A CB    1 
ATOM   3330 O  OG1   . THR A 1 423 ? 25.533 3.339   5.392   1.00 40.78  ? 420  THR A OG1   1 
ATOM   3331 C  CG2   . THR A 1 423 ? 24.267 4.815   6.829   1.00 43.02  ? 420  THR A CG2   1 
ATOM   3332 N  N     . MET A 1 424 ? 26.647 5.336   2.689   1.00 34.17  ? 421  MET A N     1 
ATOM   3333 C  CA    . MET A 1 424 ? 27.820 5.355   1.818   1.00 26.49  ? 421  MET A CA    1 
ATOM   3334 C  C     . MET A 1 424 ? 27.425 5.455   0.345   1.00 33.76  ? 421  MET A C     1 
ATOM   3335 O  O     . MET A 1 424 ? 26.450 4.847   -0.100  1.00 32.58  ? 421  MET A O     1 
ATOM   3336 C  CB    . MET A 1 424 ? 28.690 4.118   2.055   1.00 31.61  ? 421  MET A CB    1 
ATOM   3337 C  CG    . MET A 1 424 ? 29.992 4.092   1.245   1.00 35.35  ? 421  MET A CG    1 
ATOM   3338 S  SD    . MET A 1 424 ? 29.799 3.288   -0.368  1.00 39.03  ? 421  MET A SD    1 
ATOM   3339 C  CE    . MET A 1 424 ? 29.407 1.601   0.123   1.00 38.97  ? 421  MET A CE    1 
ATOM   3340 N  N     . LEU A 1 425 ? 28.187 6.252   -0.393  1.00 26.08  ? 422  LEU A N     1 
ATOM   3341 C  CA    . LEU A 1 425 ? 28.111 6.312   -1.846  1.00 30.47  ? 422  LEU A CA    1 
ATOM   3342 C  C     . LEU A 1 425 ? 29.506 6.052   -2.414  1.00 31.05  ? 422  LEU A C     1 
ATOM   3343 O  O     . LEU A 1 425 ? 30.498 6.506   -1.858  1.00 32.12  ? 422  LEU A O     1 
ATOM   3344 C  CB    . LEU A 1 425 ? 27.618 7.676   -2.338  1.00 25.45  ? 422  LEU A CB    1 
ATOM   3345 C  CG    . LEU A 1 425 ? 26.229 8.187   -1.993  1.00 37.46  ? 422  LEU A CG    1 
ATOM   3346 C  CD1   . LEU A 1 425 ? 26.001 9.527   -2.688  1.00 33.92  ? 422  LEU A CD1   1 
ATOM   3347 C  CD2   . LEU A 1 425 ? 25.180 7.168   -2.412  1.00 33.98  ? 422  LEU A CD2   1 
ATOM   3348 N  N     . PHE A 1 426 ? 29.564 5.360   -3.542  1.00 26.60  ? 423  PHE A N     1 
ATOM   3349 C  CA    . PHE A 1 426 ? 30.839 5.007   -4.164  1.00 26.43  ? 423  PHE A CA    1 
ATOM   3350 C  C     . PHE A 1 426 ? 30.662 5.031   -5.686  1.00 31.65  ? 423  PHE A C     1 
ATOM   3351 O  O     . PHE A 1 426 ? 29.753 4.388   -6.209  1.00 33.87  ? 423  PHE A O     1 
ATOM   3352 C  CB    . PHE A 1 426 ? 31.281 3.619   -3.670  1.00 31.73  ? 423  PHE A CB    1 
ATOM   3353 C  CG    . PHE A 1 426 ? 32.675 3.209   -4.092  1.00 37.39  ? 423  PHE A CG    1 
ATOM   3354 C  CD1   . PHE A 1 426 ? 33.095 1.899   -3.914  1.00 58.87  ? 423  PHE A CD1   1 
ATOM   3355 C  CD2   . PHE A 1 426 ? 33.566 4.116   -4.638  1.00 35.27  ? 423  PHE A CD2   1 
ATOM   3356 C  CE1   . PHE A 1 426 ? 34.364 1.501   -4.290  1.00 57.97  ? 423  PHE A CE1   1 
ATOM   3357 C  CE2   . PHE A 1 426 ? 34.843 3.726   -5.016  1.00 39.39  ? 423  PHE A CE2   1 
ATOM   3358 C  CZ    . PHE A 1 426 ? 35.241 2.422   -4.845  1.00 48.49  ? 423  PHE A CZ    1 
ATOM   3359 N  N     . LEU A 1 427 ? 31.487 5.801   -6.387  1.00 24.89  ? 424  LEU A N     1 
ATOM   3360 C  CA    . LEU A 1 427 ? 31.524 5.744   -7.847  1.00 28.36  ? 424  LEU A CA    1 
ATOM   3361 C  C     . LEU A 1 427 ? 32.904 5.275   -8.260  1.00 29.81  ? 424  LEU A C     1 
ATOM   3362 O  O     . LEU A 1 427 ? 33.917 5.808   -7.779  1.00 27.76  ? 424  LEU A O     1 
ATOM   3363 C  CB    . LEU A 1 427 ? 31.219 7.099   -8.483  1.00 30.66  ? 424  LEU A CB    1 
ATOM   3364 C  CG    . LEU A 1 427 ? 29.811 7.666   -8.347  1.00 35.22  ? 424  LEU A CG    1 
ATOM   3365 C  CD1   . LEU A 1 427 ? 29.681 8.944   -9.169  1.00 35.16  ? 424  LEU A CD1   1 
ATOM   3366 C  CD2   . LEU A 1 427 ? 28.755 6.636   -8.745  1.00 27.10  ? 424  LEU A CD2   1 
ATOM   3367 N  N     . CYS A 1 428 ? 32.950 4.273   -9.134  1.00 28.06  ? 425  CYS A N     1 
ATOM   3368 C  CA    . CYS A 1 428 ? 34.219 3.721   -9.578  1.00 26.91  ? 425  CYS A CA    1 
ATOM   3369 C  C     . CYS A 1 428 ? 34.222 3.524   -11.094 1.00 33.55  ? 425  CYS A C     1 
ATOM   3370 O  O     . CYS A 1 428 ? 33.336 2.872   -11.640 1.00 34.38  ? 425  CYS A O     1 
ATOM   3371 C  CB    . CYS A 1 428 ? 34.507 2.394   -8.870  1.00 36.10  ? 425  CYS A CB    1 
ATOM   3372 S  SG    . CYS A 1 428 ? 36.159 1.724   -9.191  1.00 44.00  ? 425  CYS A SG    1 
ATOM   3373 N  N     . ALA A 1 429 ? 35.221 4.066   -11.751 1.00 27.76  ? 426  ALA A N     1 
ATOM   3374 C  CA    . ALA A 1 429 ? 35.421 3.854   -13.149 1.00 32.46  ? 426  ALA A CA    1 
ATOM   3375 C  C     . ALA A 1 429 ? 36.336 2.665   -13.369 1.00 35.52  ? 426  ALA A C     1 
ATOM   3376 O  O     . ALA A 1 429 ? 37.360 2.548   -12.740 1.00 31.66  ? 426  ALA A O     1 
ATOM   3377 C  CB    . ALA A 1 429 ? 36.017 5.078   -13.779 1.00 31.28  ? 426  ALA A CB    1 
ATOM   3378 N  N     . THR A 1 430 ? 35.949 1.821   -14.301 1.00 30.40  ? 427  THR A N     1 
ATOM   3379 C  CA    . THR A 1 430 ? 36.647 0.591   -14.525 1.00 34.82  ? 427  THR A CA    1 
ATOM   3380 C  C     . THR A 1 430 ? 36.694 0.199   -15.993 1.00 36.72  ? 427  THR A C     1 
ATOM   3381 O  O     . THR A 1 430 ? 36.225 0.892   -16.834 1.00 35.35  ? 427  THR A O     1 
ATOM   3382 C  CB    . THR A 1 430 ? 36.064 -0.550  -13.682 1.00 40.47  ? 427  THR A CB    1 
ATOM   3383 O  OG1   . THR A 1 430 ? 34.767 -0.865  -14.145 1.00 46.03  ? 427  THR A OG1   1 
ATOM   3384 C  CG2   . THR A 1 430 ? 35.934 -0.158  -12.252 1.00 41.96  ? 427  THR A CG2   1 
ATOM   3385 N  N     . LYS A 1 431 ? 37.327 -0.922  -16.266 1.00 37.98  ? 428  LYS A N     1 
ATOM   3386 C  CA    . LYS A 1 431 ? 37.430 -1.448  -17.610 1.00 39.61  ? 428  LYS A CA    1 
ATOM   3387 C  C     . LYS A 1 431 ? 38.044 -0.493  -18.618 1.00 34.11  ? 428  LYS A C     1 
ATOM   3388 O  O     . LYS A 1 431 ? 37.407 -0.090  -19.539 1.00 36.64  ? 428  LYS A O     1 
ATOM   3389 C  CB    . LYS A 1 431 ? 36.079 -1.921  -18.068 1.00 35.91  ? 428  LYS A CB    1 
ATOM   3390 C  CG    . LYS A 1 431 ? 35.584 -3.134  -17.361 1.00 46.72  ? 428  LYS A CG    1 
ATOM   3391 C  CD    . LYS A 1 431 ? 34.185 -3.419  -17.837 1.00 48.62  ? 428  LYS A CD    1 
ATOM   3392 C  CE    . LYS A 1 431 ? 33.669 -4.791  -17.436 1.00 56.33  ? 428  LYS A CE    1 
ATOM   3393 N  NZ    . LYS A 1 431 ? 34.478 -5.531  -16.439 1.00 54.47  ? 428  LYS A NZ    1 
ATOM   3394 N  N     . PHE A 1 432 ? 39.264 -0.068  -18.348 1.00 33.56  ? 429  PHE A N     1 
ATOM   3395 C  CA    . PHE A 1 432 ? 39.984 0.828   -19.211 1.00 29.66  ? 429  PHE A CA    1 
ATOM   3396 C  C     . PHE A 1 432 ? 40.366 0.212   -20.548 1.00 45.58  ? 429  PHE A C     1 
ATOM   3397 O  O     . PHE A 1 432 ? 40.706 -0.929  -20.612 1.00 40.24  ? 429  PHE A O     1 
ATOM   3398 C  CB    . PHE A 1 432 ? 41.227 1.331   -18.529 1.00 32.99  ? 429  PHE A CB    1 
ATOM   3399 C  CG    . PHE A 1 432 ? 40.954 2.345   -17.484 1.00 33.04  ? 429  PHE A CG    1 
ATOM   3400 C  CD1   . PHE A 1 432 ? 41.036 3.659   -17.763 1.00 35.08  ? 429  PHE A CD1   1 
ATOM   3401 C  CD2   . PHE A 1 432 ? 40.581 1.972   -16.238 1.00 41.13  ? 429  PHE A CD2   1 
ATOM   3402 C  CE1   . PHE A 1 432 ? 40.774 4.601   -16.807 1.00 35.08  ? 429  PHE A CE1   1 
ATOM   3403 C  CE2   . PHE A 1 432 ? 40.316 2.903   -15.271 1.00 41.99  ? 429  PHE A CE2   1 
ATOM   3404 C  CZ    . PHE A 1 432 ? 40.424 4.221   -15.551 1.00 37.00  ? 429  PHE A CZ    1 
ATOM   3405 N  N     . SER A 1 433 ? 40.311 1.021   -21.592 1.00 39.37  ? 430  SER A N     1 
ATOM   3406 C  CA    . SER A 1 433 ? 40.761 0.629   -22.925 1.00 42.95  ? 430  SER A CA    1 
ATOM   3407 C  C     . SER A 1 433 ? 41.715 1.684   -23.459 1.00 46.97  ? 430  SER A C     1 
ATOM   3408 O  O     . SER A 1 433 ? 41.587 2.862   -23.132 1.00 47.14  ? 430  SER A O     1 
ATOM   3409 C  CB    . SER A 1 433 ? 39.575 0.448   -23.874 1.00 46.85  ? 430  SER A CB    1 
ATOM   3410 O  OG    . SER A 1 433 ? 38.610 -0.423  -23.312 1.00 54.90  ? 430  SER A OG    1 
ATOM   3411 N  N     . ALA A 1 434 ? 42.685 1.264   -24.265 1.00 49.44  ? 431  ALA A N     1 
ATOM   3412 C  CA    . ALA A 1 434 ? 43.649 2.199   -24.836 1.00 50.67  ? 431  ALA A CA    1 
ATOM   3413 C  C     . ALA A 1 434 ? 42.947 3.234   -25.724 1.00 57.19  ? 431  ALA A C     1 
ATOM   3414 O  O     . ALA A 1 434 ? 42.062 2.895   -26.517 1.00 59.91  ? 431  ALA A O     1 
ATOM   3415 C  CB    . ALA A 1 434 ? 44.719 1.452   -25.620 1.00 48.55  ? 431  ALA A CB    1 
ATOM   3416 N  N     . SER A 1 435 ? 43.336 4.496   -25.575 1.00 56.41  ? 432  SER A N     1 
ATOM   3417 C  CA    . SER A 1 435 ? 42.708 5.586   -26.316 1.00 59.29  ? 432  SER A CA    1 
ATOM   3418 C  C     . SER A 1 435 ? 43.735 6.609   -26.792 1.00 66.41  ? 432  SER A C     1 
ATOM   3419 O  O     . SER A 1 435 ? 43.392 7.563   -27.490 1.00 75.69  ? 432  SER A O     1 
ATOM   3420 C  CB    . SER A 1 435 ? 41.655 6.282   -25.455 1.00 58.84  ? 432  SER A CB    1 
ATOM   3421 O  OG    . SER A 1 435 ? 42.263 7.153   -24.514 1.00 65.44  ? 432  SER A OG    1 
ATOM   3422 O  OXT   . SER A 1 435 ? 44.923 6.516   -26.486 1.00 70.42  ? 432  SER A OXT   1 
ATOM   3423 O  "O3'" . DC  B 2 1   ? 27.720 4.647   11.484  1.00 81.93  ? 1    DC  T "O3'" 1 
ATOM   3424 P  P     . DA  B 2 2   ? 28.030 4.270   13.048  1.00 103.78 ? 2    DA  T P     1 
ATOM   3425 O  OP1   . DA  B 2 2   ? 28.037 2.790   13.149  1.00 98.80  ? 2    DA  T OP1   1 
ATOM   3426 O  OP2   . DA  B 2 2   ? 27.109 5.070   13.890  1.00 89.20  ? 2    DA  T OP2   1 
ATOM   3427 O  "O5'" . DA  B 2 2   ? 29.509 4.814   13.318  1.00 84.02  ? 2    DA  T "O5'" 1 
ATOM   3428 C  "C5'" . DA  B 2 2   ? 30.563 4.521   12.405  1.00 76.12  ? 2    DA  T "C5'" 1 
ATOM   3429 C  "C4'" . DA  B 2 2   ? 31.840 5.253   12.796  1.00 68.83  ? 2    DA  T "C4'" 1 
ATOM   3430 O  "O4'" . DA  B 2 2   ? 31.702 6.668   12.502  1.00 68.18  ? 2    DA  T "O4'" 1 
ATOM   3431 C  "C3'" . DA  B 2 2   ? 32.203 5.177   14.276  1.00 71.47  ? 2    DA  T "C3'" 1 
ATOM   3432 O  "O3'" . DA  B 2 2   ? 33.606 5.200   14.421  1.00 70.72  ? 2    DA  T "O3'" 1 
ATOM   3433 C  "C2'" . DA  B 2 2   ? 31.578 6.443   14.840  1.00 66.39  ? 2    DA  T "C2'" 1 
ATOM   3434 C  "C1'" . DA  B 2 2   ? 31.819 7.415   13.697  1.00 65.13  ? 2    DA  T "C1'" 1 
ATOM   3435 N  N9    . DA  B 2 2   ? 30.854 8.499   13.657  1.00 59.63  ? 2    DA  T N9    1 
ATOM   3436 C  C8    . DA  B 2 2   ? 29.629 8.537   14.265  1.00 59.86  ? 2    DA  T C8    1 
ATOM   3437 N  N7    . DA  B 2 2   ? 28.974 9.654   14.058  1.00 58.37  ? 2    DA  T N7    1 
ATOM   3438 C  C5    . DA  B 2 2   ? 29.834 10.398  13.263  1.00 57.56  ? 2    DA  T C5    1 
ATOM   3439 C  C6    . DA  B 2 2   ? 29.729 11.681  12.696  1.00 54.71  ? 2    DA  T C6    1 
ATOM   3440 N  N6    . DA  B 2 2   ? 28.663 12.474  12.856  1.00 57.63  ? 2    DA  T N6    1 
ATOM   3441 N  N1    . DA  B 2 2   ? 30.767 12.121  11.956  1.00 53.08  ? 2    DA  T N1    1 
ATOM   3442 C  C2    . DA  B 2 2   ? 31.830 11.322  11.793  1.00 50.36  ? 2    DA  T C2    1 
ATOM   3443 N  N3    . DA  B 2 2   ? 32.040 10.102  12.275  1.00 50.80  ? 2    DA  T N3    1 
ATOM   3444 C  C4    . DA  B 2 2   ? 30.995 9.697   13.009  1.00 54.82  ? 2    DA  T C4    1 
ATOM   3445 P  P     A DT  B 2 3   ? 34.363 3.921   15.016  0.50 69.91  ? 3    DT  T P     1 
ATOM   3446 P  P     B DT  B 2 3   ? 34.172 3.954   15.108  0.50 70.28  ? 3    DT  T P     1 
ATOM   3447 O  OP1   A DT  B 2 3   ? 33.316 2.969   15.459  0.50 72.02  ? 3    DT  T OP1   1 
ATOM   3448 O  OP1   B DT  B 2 3   ? 33.079 3.360   15.890  0.50 72.14  ? 3    DT  T OP1   1 
ATOM   3449 O  OP2   A DT  B 2 3   ? 35.389 4.418   15.964  0.50 64.25  ? 3    DT  T OP2   1 
ATOM   3450 O  OP2   B DT  B 2 3   ? 35.418 4.340   15.769  0.50 64.28  ? 3    DT  T OP2   1 
ATOM   3451 O  "O5'" A DT  B 2 3   ? 35.123 3.295   13.753  0.50 62.01  ? 3    DT  T "O5'" 1 
ATOM   3452 O  "O5'" B DT  B 2 3   ? 34.430 2.956   13.910  0.50 63.34  ? 3    DT  T "O5'" 1 
ATOM   3453 C  "C5'" A DT  B 2 3   ? 36.491 3.613   13.516  0.50 59.13  ? 3    DT  T "C5'" 1 
ATOM   3454 C  "C5'" B DT  B 2 3   ? 34.712 3.439   12.596  0.50 61.05  ? 3    DT  T "C5'" 1 
ATOM   3455 C  "C4'" A DT  B 2 3   ? 36.615 4.842   12.635  0.50 55.23  ? 3    DT  T "C4'" 1 
ATOM   3456 C  "C4'" B DT  B 2 3   ? 35.829 4.453   12.639  0.50 56.36  ? 3    DT  T "C4'" 1 
ATOM   3457 O  "O4'" A DT  B 2 3   ? 38.018 5.102   12.379  0.50 54.61  ? 3    DT  T "O4'" 1 
ATOM   3458 O  "O4'" B DT  B 2 3   ? 36.790 4.066   13.639  0.50 59.39  ? 3    DT  T "O4'" 1 
ATOM   3459 C  "C3'" A DT  B 2 3   ? 35.934 4.715   11.270  0.50 53.43  ? 3    DT  T "C3'" 1 
ATOM   3460 C  "C3'" B DT  B 2 3   ? 36.619 4.571   11.341  0.50 53.11  ? 3    DT  T "C3'" 1 
ATOM   3461 O  "O3'" A DT  B 2 3   ? 35.116 5.830   10.999  0.50 51.97  ? 3    DT  T "O3'" 1 
ATOM   3462 O  "O3'" B DT  B 2 3   ? 36.164 5.691   10.608  0.50 47.21  ? 3    DT  T "O3'" 1 
ATOM   3463 C  "C2'" A DT  B 2 3   ? 37.083 4.623   10.278  0.50 47.37  ? 3    DT  T "C2'" 1 
ATOM   3464 C  "C2'" B DT  B 2 3   ? 38.013 4.886   11.838  0.50 52.82  ? 3    DT  T "C2'" 1 
ATOM   3465 C  "C1'" A DT  B 2 3   ? 38.242 5.290   10.997  0.50 48.02  ? 3    DT  T "C1'" 1 
ATOM   3466 C  "C1'" B DT  B 2 3   ? 38.095 4.021   13.076  0.50 53.78  ? 3    DT  T "C1'" 1 
ATOM   3467 N  N1    A DT  B 2 3   ? 39.544 4.656   10.649  0.50 47.87  ? 3    DT  T N1    1 
ATOM   3468 N  N1    B DT  B 2 3   ? 38.452 2.587   12.874  0.50 53.86  ? 3    DT  T N1    1 
ATOM   3469 C  C2    A DT  B 2 3   ? 40.576 5.427   10.151  0.50 40.81  ? 3    DT  T C2    1 
ATOM   3470 C  C2    B DT  B 2 3   ? 39.248 2.208   11.810  0.50 48.53  ? 3    DT  T C2    1 
ATOM   3471 O  O2    A DT  B 2 3   ? 40.495 6.635   9.986   0.50 42.01  ? 3    DT  T O2    1 
ATOM   3472 O  O2    B DT  B 2 3   ? 39.724 2.993   11.004  0.50 48.78  ? 3    DT  T O2    1 
ATOM   3473 N  N3    A DT  B 2 3   ? 41.723 4.725   9.860   0.50 41.08  ? 3    DT  T N3    1 
ATOM   3474 N  N3    B DT  B 2 3   ? 39.494 0.861   11.742  0.50 53.17  ? 3    DT  T N3    1 
ATOM   3475 C  C4    A DT  B 2 3   ? 41.922 3.355   10.005  0.50 41.69  ? 3    DT  T C4    1 
ATOM   3476 C  C4    B DT  B 2 3   ? 39.037 -0.122  12.595  0.50 57.74  ? 3    DT  T C4    1 
ATOM   3477 O  O4    A DT  B 2 3   ? 42.987 2.812   9.725   0.50 42.13  ? 3    DT  T O4    1 
ATOM   3478 O  O4    B DT  B 2 3   ? 39.340 -1.293  12.394  0.50 58.03  ? 3    DT  T O4    1 
ATOM   3479 C  C5    A DT  B 2 3   ? 40.794 2.613   10.525  0.50 45.72  ? 3    DT  T C5    1 
ATOM   3480 C  C5    B DT  B 2 3   ? 38.212 0.342   13.682  0.50 56.18  ? 3    DT  T C5    1 
ATOM   3481 C  C7    A DT  B 2 3   ? 40.893 1.125   10.731  0.50 44.99  ? 3    DT  T C7    1 
ATOM   3482 C  C7    B DT  B 2 3   ? 37.685 -0.651  14.671  0.50 53.06  ? 3    DT  T C7    1 
ATOM   3483 C  C6    A DT  B 2 3   ? 39.678 3.292   10.818  0.50 47.91  ? 3    DT  T C6    1 
ATOM   3484 C  C6    B DT  B 2 3   ? 37.979 1.655   13.776  0.50 58.87  ? 3    DT  T C6    1 
ATOM   3485 P  P     A DT  B 2 4   ? 34.348 5.902   9.594   0.50 53.39  ? 4    DT  T P     1 
ATOM   3486 P  P     B DT  B 2 4   ? 34.904 5.594   9.737   0.50 48.46  ? 4    DT  T P     1 
ATOM   3487 O  OP1   A DT  B 2 4   ? 33.210 6.848   9.709   0.50 48.26  ? 4    DT  T OP1   1 
ATOM   3488 O  OP1   B DT  B 2 4   ? 33.807 6.233   10.429  0.50 53.27  ? 4    DT  T OP1   1 
ATOM   3489 O  OP2   A DT  B 2 4   ? 34.158 4.508   9.139   0.50 46.62  ? 4    DT  T OP2   1 
ATOM   3490 O  OP2   B DT  B 2 4   ? 34.784 4.238   9.265   0.50 42.49  ? 4    DT  T OP2   1 
ATOM   3491 O  "O5'" A DT  B 2 4   ? 35.425 6.517   8.593   0.50 39.00  ? 4    DT  T "O5'" 1 
ATOM   3492 O  "O5'" B DT  B 2 4   ? 35.267 6.516   8.502   0.50 39.20  ? 4    DT  T "O5'" 1 
ATOM   3493 C  "C5'" A DT  B 2 4   ? 35.762 7.880   8.648   0.50 33.26  ? 4    DT  T "C5'" 1 
ATOM   3494 C  "C5'" B DT  B 2 4   ? 35.760 7.841   8.623   0.50 33.27  ? 4    DT  T "C5'" 1 
ATOM   3495 C  "C4'" A DT  B 2 4   ? 36.449 8.285   7.362   0.50 34.51  ? 4    DT  T "C4'" 1 
ATOM   3496 C  "C4'" B DT  B 2 4   ? 36.442 8.254   7.340   0.50 34.50  ? 4    DT  T "C4'" 1 
ATOM   3497 O  "O4'" A DT  B 2 4   ? 37.698 7.566   7.224   0.50 30.28  ? 4    DT  T "O4'" 1 
ATOM   3498 O  "O4'" B DT  B 2 4   ? 37.699 7.571   7.219   0.50 30.28  ? 4    DT  T "O4'" 1 
ATOM   3499 C  "C3'" A DT  B 2 4   ? 35.663 7.989   6.089   0.50 33.30  ? 4    DT  T "C3'" 1 
ATOM   3500 C  "C3'" B DT  B 2 4   ? 35.688 7.958   6.044   0.50 33.30  ? 4    DT  T "C3'" 1 
ATOM   3501 O  "O3'" A DT  B 2 4   ? 35.932 9.015   5.156   0.50 30.02  ? 4    DT  T "O3'" 1 
ATOM   3502 O  "O3'" B DT  B 2 4   ? 35.934 9.002   5.105   0.50 30.02  ? 4    DT  T "O3'" 1 
ATOM   3503 C  "C2'" A DT  B 2 4   ? 36.229 6.630   5.648   0.50 32.12  ? 4    DT  T "C2'" 1 
ATOM   3504 C  "C2'" B DT  B 2 4   ? 36.287 6.638   5.611   0.50 32.14  ? 4    DT  T "C2'" 1 
ATOM   3505 C  "C1'" A DT  B 2 4   ? 37.689 6.800   6.035   0.50 31.04  ? 4    DT  T "C1'" 1 
ATOM   3506 C  "C1'" B DT  B 2 4   ? 37.728 6.803   6.041   0.50 31.03  ? 4    DT  T "C1'" 1 
ATOM   3507 N  N1    A DT  B 2 4   ? 38.443 5.548   6.306   0.50 28.98  ? 4    DT  T N1    1 
ATOM   3508 N  N1    B DT  B 2 4   ? 38.459 5.567   6.330   0.50 29.00  ? 4    DT  T N1    1 
ATOM   3509 C  C2    A DT  B 2 4   ? 39.742 5.495   5.892   0.50 28.17  ? 4    DT  T C2    1 
ATOM   3510 C  C2    B DT  B 2 4   ? 39.758 5.495   5.902   0.50 28.17  ? 4    DT  T C2    1 
ATOM   3511 O  O2    A DT  B 2 4   ? 40.266 6.397   5.275   0.50 28.69  ? 4    DT  T O2    1 
ATOM   3512 O  O2    B DT  B 2 4   ? 40.294 6.383   5.275   0.50 28.71  ? 4    DT  T O2    1 
ATOM   3513 N  N3    A DT  B 2 4   ? 40.398 4.341   6.188   0.50 28.63  ? 4    DT  T N3    1 
ATOM   3514 N  N3    B DT  B 2 4   ? 40.396 4.326   6.204   0.50 28.63  ? 4    DT  T N3    1 
ATOM   3515 C  C4    A DT  B 2 4   ? 39.918 3.259   6.877   0.50 31.56  ? 4    DT  T C4    1 
ATOM   3516 C  C4    B DT  B 2 4   ? 39.893 3.262   6.913   0.50 31.57  ? 4    DT  T C4    1 
ATOM   3517 O  O4    A DT  B 2 4   ? 40.614 2.275   7.104   0.50 29.42  ? 4    DT  T O4    1 
ATOM   3518 O  O4    B DT  B 2 4   ? 40.596 2.291   7.128   0.50 29.41  ? 4    DT  T O4    1 
ATOM   3519 C  C5    A DT  B 2 4   ? 38.543 3.367   7.315   0.50 34.09  ? 4    DT  T C5    1 
ATOM   3520 C  C5    B DT  B 2 4   ? 38.531 3.413   7.361   0.50 34.06  ? 4    DT  T C5    1 
ATOM   3521 C  C7    A DT  B 2 4   ? 37.902 2.228   8.062   0.50 34.21  ? 4    DT  T C7    1 
ATOM   3522 C  C7    B DT  B 2 4   ? 37.891 2.302   8.129   0.50 34.23  ? 4    DT  T C7    1 
ATOM   3523 C  C6    A DT  B 2 4   ? 37.874 4.504   7.019   0.50 31.96  ? 4    DT  T C6    1 
ATOM   3524 C  C6    B DT  B 2 4   ? 37.893 4.548   7.058   0.50 31.97  ? 4    DT  T C6    1 
ATOM   3525 P  P     . DA  B 2 5   ? 35.247 9.039   3.710   1.00 28.71  ? 5    DA  T P     1 
ATOM   3526 O  OP1   . DA  B 2 5   ? 34.873 10.456  3.442   1.00 31.22  ? 5    DA  T OP1   1 
ATOM   3527 O  OP2   . DA  B 2 5   ? 34.246 7.963   3.617   1.00 24.57  ? 5    DA  T OP2   1 
ATOM   3528 O  "O5'" . DA  B 2 5   ? 36.430 8.584   2.733   1.00 31.94  ? 5    DA  T "O5'" 1 
ATOM   3529 C  "C5'" . DA  B 2 5   ? 37.632 9.367   2.626   1.00 29.12  ? 5    DA  T "C5'" 1 
ATOM   3530 C  "C4'" . DA  B 2 5   ? 38.592 8.719   1.648   1.00 23.68  ? 5    DA  T "C4'" 1 
ATOM   3531 O  "O4'" . DA  B 2 5   ? 39.157 7.519   2.230   1.00 29.89  ? 5    DA  T "O4'" 1 
ATOM   3532 C  "C3'" . DA  B 2 5   ? 37.959 8.280   0.324   1.00 24.64  ? 5    DA  T "C3'" 1 
ATOM   3533 O  "O3'" . DA  B 2 5   ? 38.859 8.557   -0.721  1.00 26.36  ? 5    DA  T "O3'" 1 
ATOM   3534 C  "C2'" . DA  B 2 5   ? 37.786 6.773   0.508   1.00 25.56  ? 5    DA  T "C2'" 1 
ATOM   3535 C  "C1'" . DA  B 2 5   ? 39.036 6.458   1.312   1.00 32.07  ? 5    DA  T "C1'" 1 
ATOM   3536 N  N9    . DA  B 2 5   ? 38.963 5.212   2.061   1.00 26.24  ? 5    DA  T N9    1 
ATOM   3537 C  C8    . DA  B 2 5   ? 37.879 4.699   2.705   1.00 27.51  ? 5    DA  T C8    1 
ATOM   3538 N  N7    . DA  B 2 5   ? 38.117 3.565   3.317   1.00 31.95  ? 5    DA  T N7    1 
ATOM   3539 C  C5    . DA  B 2 5   ? 39.458 3.324   3.057   1.00 23.46  ? 5    DA  T C5    1 
ATOM   3540 C  C6    . DA  B 2 5   ? 40.305 2.273   3.417   1.00 33.92  ? 5    DA  T C6    1 
ATOM   3541 N  N6    . DA  B 2 5   ? 39.901 1.242   4.165   1.00 33.91  ? 5    DA  T N6    1 
ATOM   3542 N  N1    . DA  B 2 5   ? 41.592 2.325   2.997   1.00 35.03  ? 5    DA  T N1    1 
ATOM   3543 C  C2    . DA  B 2 5   ? 41.979 3.372   2.249   1.00 32.70  ? 5    DA  T C2    1 
ATOM   3544 N  N3    . DA  B 2 5   ? 41.260 4.423   1.841   1.00 30.29  ? 5    DA  T N3    1 
ATOM   3545 C  C4    . DA  B 2 5   ? 39.993 4.326   2.279   1.00 25.98  ? 5    DA  T C4    1 
ATOM   3546 P  P     . DT  B 2 6   ? 38.381 8.527   -2.254  1.00 25.92  ? 6    DT  T P     1 
ATOM   3547 O  OP1   . DT  B 2 6   ? 39.565 9.004   -2.997  1.00 26.91  ? 6    DT  T OP1   1 
ATOM   3548 O  OP2   . DT  B 2 6   ? 37.063 9.186   -2.378  1.00 27.82  ? 6    DT  T OP2   1 
ATOM   3549 O  "O5'" . DT  B 2 6   ? 38.084 6.976   -2.525  1.00 29.95  ? 6    DT  T "O5'" 1 
ATOM   3550 C  "C5'" . DT  B 2 6   ? 38.809 6.280   -3.484  1.00 33.31  ? 6    DT  T "C5'" 1 
ATOM   3551 C  "C4'" . DT  B 2 6   ? 39.991 5.551   -2.877  1.00 36.03  ? 6    DT  T "C4'" 1 
ATOM   3552 O  "O4'" . DT  B 2 6   ? 39.589 4.837   -1.693  1.00 31.59  ? 6    DT  T "O4'" 1 
ATOM   3553 C  "C3'" . DT  B 2 6   ? 40.563 4.496   -3.800  1.00 34.05  ? 6    DT  T "C3'" 1 
ATOM   3554 O  "O3'" . DT  B 2 6   ? 41.657 5.025   -4.491  1.00 31.01  ? 6    DT  T "O3'" 1 
ATOM   3555 C  "C2'" . DT  B 2 6   ? 40.968 3.337   -2.882  1.00 36.29  ? 6    DT  T "C2'" 1 
ATOM   3556 C  "C1'" . DT  B 2 6   ? 40.482 3.770   -1.501  1.00 35.15  ? 6    DT  T "C1'" 1 
ATOM   3557 N  N1    . DT  B 2 6   ? 39.786 2.694   -0.748  1.00 30.40  ? 6    DT  T N1    1 
ATOM   3558 C  C2    . DT  B 2 6   ? 40.513 1.609   -0.314  1.00 26.17  ? 6    DT  T C2    1 
ATOM   3559 O  O2    . DT  B 2 6   ? 41.700 1.477   -0.532  1.00 30.67  ? 6    DT  T O2    1 
ATOM   3560 N  N3    . DT  B 2 6   ? 39.799 0.681   0.386   1.00 28.62  ? 6    DT  T N3    1 
ATOM   3561 C  C4    . DT  B 2 6   ? 38.461 0.728   0.704   1.00 31.21  ? 6    DT  T C4    1 
ATOM   3562 O  O4    . DT  B 2 6   ? 37.917 -0.152  1.357   1.00 35.39  ? 6    DT  T O4    1 
ATOM   3563 C  C5    . DT  B 2 6   ? 37.754 1.892   0.224   1.00 34.55  ? 6    DT  T C5    1 
ATOM   3564 C  C7    . DT  B 2 6   ? 36.291 2.045   0.505   1.00 29.49  ? 6    DT  T C7    1 
ATOM   3565 C  C6    . DT  B 2 6   ? 38.444 2.815   -0.466  1.00 30.55  ? 6    DT  T C6    1 
ATOM   3566 P  P     . DG  B 2 7   ? 41.814 4.701   -6.053  1.00 29.98  ? 7    DG  T P     1 
ATOM   3567 O  OP1   . DG  B 2 7   ? 42.982 5.454   -6.551  1.00 33.44  ? 7    DG  T OP1   1 
ATOM   3568 O  OP2   . DG  B 2 7   ? 40.502 4.753   -6.715  1.00 26.89  ? 7    DG  T OP2   1 
ATOM   3569 O  "O5'" . DG  B 2 7   ? 42.187 3.138   -6.077  1.00 31.84  ? 7    DG  T "O5'" 1 
ATOM   3570 C  "C5'" . DG  B 2 7   ? 43.463 2.710   -5.657  1.00 35.14  ? 7    DG  T "C5'" 1 
ATOM   3571 C  "C4'" . DG  B 2 7   ? 43.503 1.195   -5.576  1.00 22.69  ? 7    DG  T "C4'" 1 
ATOM   3572 O  "O4'" . DG  B 2 7   ? 42.759 0.758   -4.427  1.00 29.39  ? 7    DG  T "O4'" 1 
ATOM   3573 C  "C3'" . DG  B 2 7   ? 42.887 0.464   -6.783  1.00 38.26  ? 7    DG  T "C3'" 1 
ATOM   3574 O  "O3'" . DG  B 2 7   ? 43.892 -0.311  -7.430  1.00 36.72  ? 7    DG  T "O3'" 1 
ATOM   3575 C  "C2'" . DG  B 2 7   ? 41.784 -0.414  -6.163  1.00 36.71  ? 7    DG  T "C2'" 1 
ATOM   3576 C  "C1'" . DG  B 2 7   ? 42.245 -0.514  -4.721  1.00 36.38  ? 7    DG  T "C1'" 1 
ATOM   3577 N  N9    . DG  B 2 7   ? 41.179 -0.845  -3.781  1.00 31.39  ? 7    DG  T N9    1 
ATOM   3578 C  C8    . DG  B 2 7   ? 39.962 -0.220  -3.646  1.00 28.36  ? 7    DG  T C8    1 
ATOM   3579 N  N7    . DG  B 2 7   ? 39.206 -0.760  -2.726  1.00 31.04  ? 7    DG  T N7    1 
ATOM   3580 C  C5    . DG  B 2 7   ? 39.973 -1.821  -2.235  1.00 25.56  ? 7    DG  T C5    1 
ATOM   3581 C  C6    . DG  B 2 7   ? 39.670 -2.773  -1.236  1.00 26.40  ? 7    DG  T C6    1 
ATOM   3582 O  O6    . DG  B 2 7   ? 38.639 -2.867  -0.558  1.00 27.48  ? 7    DG  T O6    1 
ATOM   3583 N  N1    . DG  B 2 7   ? 40.719 -3.686  -1.049  1.00 24.39  ? 7    DG  T N1    1 
ATOM   3584 C  C2    . DG  B 2 7   ? 41.903 -3.665  -1.749  1.00 28.37  ? 7    DG  T C2    1 
ATOM   3585 N  N2    . DG  B 2 7   ? 42.801 -4.621  -1.438  1.00 27.87  ? 7    DG  T N2    1 
ATOM   3586 N  N3    . DG  B 2 7   ? 42.189 -2.772  -2.694  1.00 29.43  ? 7    DG  T N3    1 
ATOM   3587 C  C4    . DG  B 2 7   ? 41.178 -1.888  -2.878  1.00 28.83  ? 7    DG  T C4    1 
ATOM   3588 P  P     . DA  B 2 8   ? 43.560 -1.221  -8.713  1.00 35.44  ? 8    DA  T P     1 
ATOM   3589 O  OP1   . DA  B 2 8   ? 44.605 -0.932  -9.692  1.00 34.39  ? 8    DA  T OP1   1 
ATOM   3590 O  OP2   . DA  B 2 8   ? 42.130 -1.225  -9.109  1.00 36.08  ? 8    DA  T OP2   1 
ATOM   3591 O  "O5'" . DA  B 2 8   ? 43.842 -2.704  -8.188  1.00 31.31  ? 8    DA  T "O5'" 1 
ATOM   3592 C  "C5'" . DA  B 2 8   ? 45.085 -2.994  -7.542  1.00 30.76  ? 8    DA  T "C5'" 1 
ATOM   3593 C  "C4'" . DA  B 2 8   ? 45.085 -4.426  -7.057  1.00 29.72  ? 8    DA  T "C4'" 1 
ATOM   3594 O  "O4'" . DA  B 2 8   ? 44.154 -4.530  -5.956  1.00 30.20  ? 8    DA  T "O4'" 1 
ATOM   3595 C  "C3'" . DA  B 2 8   ? 44.640 -5.444  -8.116  1.00 31.21  ? 8    DA  T "C3'" 1 
ATOM   3596 O  "O3'" . DA  B 2 8   ? 45.545 -6.554  -8.161  1.00 32.61  ? 8    DA  T "O3'" 1 
ATOM   3597 C  "C2'" . DA  B 2 8   ? 43.239 -5.860  -7.666  1.00 35.46  ? 8    DA  T "C2'" 1 
ATOM   3598 C  "C1'" . DA  B 2 8   ? 43.268 -5.605  -6.166  1.00 30.01  ? 8    DA  T "C1'" 1 
ATOM   3599 N  N9    . DA  B 2 8   ? 41.963 -5.229  -5.627  1.00 29.73  ? 8    DA  T N9    1 
ATOM   3600 C  C8    . DA  B 2 8   ? 41.156 -4.205  -6.058  1.00 33.28  ? 8    DA  T C8    1 
ATOM   3601 N  N7    . DA  B 2 8   ? 40.031 -4.100  -5.394  1.00 27.37  ? 8    DA  T N7    1 
ATOM   3602 C  C5    . DA  B 2 8   ? 40.103 -5.125  -4.455  1.00 27.15  ? 8    DA  T C5    1 
ATOM   3603 C  C6    . DA  B 2 8   ? 39.216 -5.554  -3.449  1.00 28.30  ? 8    DA  T C6    1 
ATOM   3604 N  N6    . DA  B 2 8   ? 38.039 -4.967  -3.207  1.00 24.96  ? 8    DA  T N6    1 
ATOM   3605 N  N1    . DA  B 2 8   ? 39.590 -6.616  -2.690  1.00 28.98  ? 8    DA  T N1    1 
ATOM   3606 C  C2    . DA  B 2 8   ? 40.771 -7.202  -2.943  1.00 25.24  ? 8    DA  T C2    1 
ATOM   3607 N  N3    . DA  B 2 8   ? 41.693 -6.882  -3.865  1.00 26.56  ? 8    DA  T N3    1 
ATOM   3608 C  C4    . DA  B 2 8   ? 41.289 -5.833  -4.596  1.00 31.10  ? 8    DA  T C4    1 
ATOM   3609 P  P     . DC  B 2 9   ? 45.414 -7.683  -9.309  1.00 37.95  ? 9    DC  T P     1 
ATOM   3610 O  OP1   . DC  B 2 9   ? 46.794 -8.143  -9.569  1.00 38.30  ? 9    DC  T OP1   1 
ATOM   3611 O  OP2   . DC  B 2 9   ? 44.556 -7.203  -10.414 1.00 43.98  ? 9    DC  T OP2   1 
ATOM   3612 O  "O5'" . DC  B 2 9   ? 44.601 -8.857  -8.580  1.00 34.72  ? 9    DC  T "O5'" 1 
ATOM   3613 C  "C5'" . DC  B 2 9   ? 45.030 -9.299  -7.302  1.00 33.99  ? 9    DC  T "C5'" 1 
ATOM   3614 C  "C4'" . DC  B 2 9   ? 44.012 -10.215 -6.697  1.00 31.22  ? 9    DC  T "C4'" 1 
ATOM   3615 O  "O4'" . DC  B 2 9   ? 42.893 -9.440  -6.201  1.00 40.98  ? 9    DC  T "O4'" 1 
ATOM   3616 C  "C3'" . DC  B 2 9   ? 43.420 -11.237 -7.675  1.00 43.23  ? 9    DC  T "C3'" 1 
ATOM   3617 O  "O3'" . DC  B 2 9   ? 43.448 -12.505 -7.077  1.00 53.01  ? 9    DC  T "O3'" 1 
ATOM   3618 C  "C2'" . DC  B 2 9   ? 41.985 -10.745 -7.877  1.00 40.59  ? 9    DC  T "C2'" 1 
ATOM   3619 C  "C1'" . DC  B 2 9   ? 41.711 -10.127 -6.519  1.00 34.78  ? 9    DC  T "C1'" 1 
ATOM   3620 N  N1    . DC  B 2 9   ? 40.572 -9.185  -6.506  1.00 32.77  ? 9    DC  T N1    1 
ATOM   3621 C  C2    . DC  B 2 9   ? 39.652 -9.259  -5.471  1.00 30.53  ? 9    DC  T C2    1 
ATOM   3622 O  O2    . DC  B 2 9   ? 39.826 -10.109 -4.580  1.00 32.04  ? 9    DC  T O2    1 
ATOM   3623 N  N3    . DC  B 2 9   ? 38.595 -8.409  -5.463  1.00 36.40  ? 9    DC  T N3    1 
ATOM   3624 C  C4    . DC  B 2 9   ? 38.454 -7.511  -6.442  1.00 36.49  ? 9    DC  T C4    1 
ATOM   3625 N  N4    . DC  B 2 9   ? 37.402 -6.694  -6.388  1.00 33.00  ? 9    DC  T N4    1 
ATOM   3626 C  C5    . DC  B 2 9   ? 39.384 -7.422  -7.516  1.00 37.64  ? 9    DC  T C5    1 
ATOM   3627 C  C6    . DC  B 2 9   ? 40.419 -8.274  -7.510  1.00 34.64  ? 9    DC  T C6    1 
ATOM   3628 P  P     . DG  B 2 10  ? 43.312 -13.837 -7.961  1.00 44.14  ? 10   DG  T P     1 
ATOM   3629 O  OP1   . DG  B 2 10  ? 44.659 -14.433 -8.017  1.00 55.08  ? 10   DG  T OP1   1 
ATOM   3630 O  OP2   . DG  B 2 10  ? 42.569 -13.531 -9.205  1.00 38.16  ? 10   DG  T OP2   1 
ATOM   3631 O  "O5'" . DG  B 2 10  ? 42.382 -14.753 -7.062  1.00 39.07  ? 10   DG  T "O5'" 1 
ATOM   3632 C  "C5'" . DG  B 2 10  ? 42.393 -14.606 -5.657  1.00 37.30  ? 10   DG  T "C5'" 1 
ATOM   3633 C  "C4'" . DG  B 2 10  ? 41.153 -15.220 -5.065  1.00 34.57  ? 10   DG  T "C4'" 1 
ATOM   3634 O  "O4'" . DG  B 2 10  ? 40.120 -14.209 -4.958  1.00 40.68  ? 10   DG  T "O4'" 1 
ATOM   3635 C  "C3'" . DG  B 2 10  ? 40.554 -16.350 -5.898  1.00 42.80  ? 10   DG  T "C3'" 1 
ATOM   3636 O  "O3'" . DG  B 2 10  ? 40.045 -17.341 -5.043  1.00 46.64  ? 10   DG  T "O3'" 1 
ATOM   3637 C  "C2'" . DG  B 2 10  ? 39.449 -15.654 -6.692  1.00 40.89  ? 10   DG  T "C2'" 1 
ATOM   3638 C  "C1'" . DG  B 2 10  ? 38.983 -14.591 -5.708  1.00 36.02  ? 10   DG  T "C1'" 1 
ATOM   3639 N  N9    . DG  B 2 10  ? 38.442 -13.401 -6.352  1.00 35.01  ? 10   DG  T N9    1 
ATOM   3640 C  C8    . DG  B 2 10  ? 39.019 -12.666 -7.361  1.00 35.23  ? 10   DG  T C8    1 
ATOM   3641 N  N7    . DG  B 2 10  ? 38.303 -11.643 -7.732  1.00 33.17  ? 10   DG  T N7    1 
ATOM   3642 C  C5    . DG  B 2 10  ? 37.173 -11.703 -6.917  1.00 32.59  ? 10   DG  T C5    1 
ATOM   3643 C  C6    . DG  B 2 10  ? 36.037 -10.861 -6.867  1.00 33.55  ? 10   DG  T C6    1 
ATOM   3644 O  O6    . DG  B 2 10  ? 35.791 -9.851  -7.555  1.00 38.37  ? 10   DG  T O6    1 
ATOM   3645 N  N1    . DG  B 2 10  ? 35.129 -11.277 -5.893  1.00 35.27  ? 10   DG  T N1    1 
ATOM   3646 C  C2    . DG  B 2 10  ? 35.294 -12.384 -5.083  1.00 38.43  ? 10   DG  T C2    1 
ATOM   3647 N  N2    . DG  B 2 10  ? 34.308 -12.634 -4.210  1.00 38.57  ? 10   DG  T N2    1 
ATOM   3648 N  N3    . DG  B 2 10  ? 36.354 -13.183 -5.123  1.00 39.07  ? 10   DG  T N3    1 
ATOM   3649 C  C4    . DG  B 2 10  ? 37.254 -12.777 -6.055  1.00 27.86  ? 10   DG  T C4    1 
ATOM   3650 P  P     . DC  B 2 11  ? 39.427 -18.698 -5.646  1.00 48.30  ? 11   DC  T P     1 
ATOM   3651 O  OP1   . DC  B 2 11  ? 39.924 -19.784 -4.787  1.00 44.60  ? 11   DC  T OP1   1 
ATOM   3652 O  OP2   . DC  B 2 11  ? 39.689 -18.797 -7.093  1.00 41.63  ? 11   DC  T OP2   1 
ATOM   3653 O  "O5'" . DC  B 2 11  ? 37.853 -18.496 -5.443  1.00 37.81  ? 11   DC  T "O5'" 1 
ATOM   3654 C  "C5'" . DC  B 2 11  ? 37.344 -18.124 -4.170  1.00 34.08  ? 11   DC  T "C5'" 1 
ATOM   3655 C  "C4'" . DC  B 2 11  ? 35.825 -18.080 -4.189  1.00 33.52  ? 11   DC  T "C4'" 1 
ATOM   3656 O  "O4'" . DC  B 2 11  ? 35.375 -16.819 -4.737  1.00 35.22  ? 11   DC  T "O4'" 1 
ATOM   3657 C  "C3'" . DC  B 2 11  ? 35.153 -19.173 -5.022  1.00 29.72  ? 11   DC  T "C3'" 1 
ATOM   3658 O  "O3'" . DC  B 2 11  ? 34.057 -19.699 -4.295  1.00 30.88  ? 11   DC  T "O3'" 1 
ATOM   3659 C  "C2'" . DC  B 2 11  ? 34.707 -18.440 -6.297  1.00 33.86  ? 11   DC  T "C2'" 1 
ATOM   3660 C  "C1'" . DC  B 2 11  ? 34.438 -17.037 -5.775  1.00 33.28  ? 11   DC  T "C1'" 1 
ATOM   3661 N  N1    . DC  B 2 11  ? 34.624 -15.941 -6.804  1.00 27.34  ? 11   DC  T N1    1 
ATOM   3662 C  C2    . DC  B 2 11  ? 33.615 -14.982 -6.991  1.00 28.23  ? 11   DC  T C2    1 
ATOM   3663 O  O2    . DC  B 2 11  ? 32.578 -15.047 -6.316  1.00 33.67  ? 11   DC  T O2    1 
ATOM   3664 N  N3    . DC  B 2 11  ? 33.802 -14.002 -7.917  1.00 34.56  ? 11   DC  T N3    1 
ATOM   3665 C  C4    . DC  B 2 11  ? 34.930 -13.962 -8.626  1.00 29.00  ? 11   DC  T C4    1 
ATOM   3666 N  N4    . DC  B 2 11  ? 35.071 -12.965 -9.520  1.00 28.18  ? 11   DC  T N4    1 
ATOM   3667 C  C5    . DC  B 2 11  ? 35.966 -14.922 -8.450  1.00 26.38  ? 11   DC  T C5    1 
ATOM   3668 C  C6    . DC  B 2 11  ? 35.773 -15.888 -7.538  1.00 28.64  ? 11   DC  T C6    1 
ATOM   3669 P  P     . DT  B 2 12  ? 33.375 -21.082 -4.749  1.00 29.17  ? 12   DT  T P     1 
ATOM   3670 O  OP1   . DT  B 2 12  ? 32.777 -21.670 -3.530  1.00 29.11  ? 12   DT  T OP1   1 
ATOM   3671 O  OP2   . DT  B 2 12  ? 34.276 -21.884 -5.588  1.00 31.12  ? 12   DT  T OP2   1 
ATOM   3672 O  "O5'" . DT  B 2 12  ? 32.156 -20.591 -5.637  1.00 28.34  ? 12   DT  T "O5'" 1 
ATOM   3673 C  "C5'" . DT  B 2 12  ? 31.080 -19.955 -4.984  1.00 25.78  ? 12   DT  T "C5'" 1 
ATOM   3674 C  "C4'" . DT  B 2 12  ? 30.077 -19.444 -5.981  1.00 35.76  ? 12   DT  T "C4'" 1 
ATOM   3675 O  "O4'" . DT  B 2 12  ? 30.674 -18.342 -6.706  1.00 33.62  ? 12   DT  T "O4'" 1 
ATOM   3676 C  "C3'" . DT  B 2 12  ? 29.647 -20.473 -7.041  1.00 35.04  ? 12   DT  T "C3'" 1 
ATOM   3677 O  "O3'" . DT  B 2 12  ? 28.225 -20.423 -7.225  1.00 38.81  ? 12   DT  T "O3'" 1 
ATOM   3678 C  "C2'" . DT  B 2 12  ? 30.379 -19.999 -8.290  1.00 30.94  ? 12   DT  T "C2'" 1 
ATOM   3679 C  "C1'" . DT  B 2 12  ? 30.354 -18.497 -8.057  1.00 33.01  ? 12   DT  T "C1'" 1 
ATOM   3680 N  N1    . DT  B 2 12  ? 31.319 -17.721 -8.880  1.00 33.44  ? 12   DT  T N1    1 
ATOM   3681 C  C2    . DT  B 2 12  ? 30.944 -16.475 -9.322  1.00 26.83  ? 12   DT  T C2    1 
ATOM   3682 O  O2    . DT  B 2 12  ? 29.868 -15.984 -9.064  1.00 33.15  ? 12   DT  T O2    1 
ATOM   3683 N  N3    . DT  B 2 12  ? 31.874 -15.828 -10.087 1.00 29.37  ? 12   DT  T N3    1 
ATOM   3684 C  C4    . DT  B 2 12  ? 33.122 -16.301 -10.454 1.00 29.23  ? 12   DT  T C4    1 
ATOM   3685 O  O4    . DT  B 2 12  ? 33.891 -15.648 -11.152 1.00 31.05  ? 12   DT  T O4    1 
ATOM   3686 C  C5    . DT  B 2 12  ? 33.459 -17.620 -9.956  1.00 32.28  ? 12   DT  T C5    1 
ATOM   3687 C  C7    . DT  B 2 12  ? 34.782 -18.232 -10.284 1.00 32.24  ? 12   DT  T C7    1 
ATOM   3688 C  C6    . DT  B 2 12  ? 32.548 -18.263 -9.202  1.00 33.08  ? 12   DT  T C6    1 
ATOM   3689 O  "O5'" . DA  C 3 1   ? 29.176 -7.525  -15.396 1.00 49.18  ? 1    DA  P "O5'" 1 
ATOM   3690 C  "C5'" . DA  C 3 1   ? 27.893 -7.946  -15.824 1.00 38.20  ? 1    DA  P "C5'" 1 
ATOM   3691 C  "C4'" . DA  C 3 1   ? 27.028 -8.380  -14.647 1.00 40.18  ? 1    DA  P "C4'" 1 
ATOM   3692 O  "O4'" . DA  C 3 1   ? 27.404 -9.711  -14.236 1.00 43.42  ? 1    DA  P "O4'" 1 
ATOM   3693 C  "C3'" . DA  C 3 1   ? 27.111 -7.500  -13.399 1.00 34.46  ? 1    DA  P "C3'" 1 
ATOM   3694 O  "O3'" A DA  C 3 1   ? 25.827 -7.382  -12.800 0.56 41.71  ? 1    DA  P "O3'" 1 
ATOM   3695 O  "O3'" B DA  C 3 1   ? 25.826 -7.374  -12.798 0.44 41.71  ? 1    DA  P "O3'" 1 
ATOM   3696 C  "C2'" . DA  C 3 1   ? 28.082 -8.239  -12.487 1.00 43.89  ? 1    DA  P "C2'" 1 
ATOM   3697 C  "C1'" . DA  C 3 1   ? 27.962 -9.696  -12.936 1.00 42.10  ? 1    DA  P "C1'" 1 
ATOM   3698 N  N9    . DA  C 3 1   ? 29.253 -10.356 -13.004 1.00 34.91  ? 1    DA  P N9    1 
ATOM   3699 C  C8    . DA  C 3 1   ? 30.294 -10.021 -13.812 1.00 34.00  ? 1    DA  P C8    1 
ATOM   3700 N  N7    . DA  C 3 1   ? 31.350 -10.780 -13.649 1.00 36.72  ? 1    DA  P N7    1 
ATOM   3701 C  C5    . DA  C 3 1   ? 30.966 -11.681 -12.668 1.00 31.89  ? 1    DA  P C5    1 
ATOM   3702 C  C6    . DA  C 3 1   ? 31.639 -12.749 -12.052 1.00 31.76  ? 1    DA  P C6    1 
ATOM   3703 N  N6    . DA  C 3 1   ? 32.889 -13.103 -12.361 1.00 31.45  ? 1    DA  P N6    1 
ATOM   3704 N  N1    . DA  C 3 1   ? 30.972 -13.448 -11.110 1.00 34.48  ? 1    DA  P N1    1 
ATOM   3705 C  C2    . DA  C 3 1   ? 29.717 -13.095 -10.813 1.00 29.54  ? 1    DA  P C2    1 
ATOM   3706 N  N3    . DA  C 3 1   ? 28.984 -12.111 -11.326 1.00 37.56  ? 1    DA  P N3    1 
ATOM   3707 C  C4    . DA  C 3 1   ? 29.680 -11.434 -12.256 1.00 31.94  ? 1    DA  P C4    1 
ATOM   3708 P  P     A DG  C 3 2   ? 25.532 -6.179  -11.777 0.65 45.08  ? 2    DG  P P     1 
ATOM   3709 P  P     B DG  C 3 2   ? 25.535 -6.163  -11.781 0.35 44.97  ? 2    DG  P P     1 
ATOM   3710 O  OP1   A DG  C 3 2   ? 24.091 -5.875  -11.836 0.65 43.22  ? 2    DG  P OP1   1 
ATOM   3711 O  OP1   B DG  C 3 2   ? 24.097 -5.844  -11.846 0.35 43.22  ? 2    DG  P OP1   1 
ATOM   3712 O  OP2   A DG  C 3 2   ? 26.548 -5.132  -12.031 0.65 40.08  ? 2    DG  P OP2   1 
ATOM   3713 O  OP2   B DG  C 3 2   ? 26.544 -5.115  -12.049 0.35 40.15  ? 2    DG  P OP2   1 
ATOM   3714 O  "O5'" A DG  C 3 2   ? 25.852 -6.802  -10.344 0.65 41.10  ? 2    DG  P "O5'" 1 
ATOM   3715 O  "O5'" B DG  C 3 2   ? 25.846 -6.782  -10.342 0.35 41.09  ? 2    DG  P "O5'" 1 
ATOM   3716 C  "C5'" A DG  C 3 2   ? 24.950 -7.718  -9.772  0.65 39.64  ? 2    DG  P "C5'" 1 
ATOM   3717 C  "C5'" B DG  C 3 2   ? 24.949 -7.717  -9.776  0.35 39.70  ? 2    DG  P "C5'" 1 
ATOM   3718 C  "C4'" . DG  C 3 2   ? 25.582 -8.429  -8.601  1.00 37.93  ? 2    DG  P "C4'" 1 
ATOM   3719 O  "O4'" . DG  C 3 2   ? 26.798 -9.080  -9.028  1.00 36.45  ? 2    DG  P "O4'" 1 
ATOM   3720 C  "C3'" . DG  C 3 2   ? 25.959 -7.524  -7.424  1.00 36.27  ? 2    DG  P "C3'" 1 
ATOM   3721 O  "O3'" . DG  C 3 2   ? 25.313 -8.015  -6.283  1.00 42.01  ? 2    DG  P "O3'" 1 
ATOM   3722 C  "C2'" . DG  C 3 2   ? 27.490 -7.646  -7.325  1.00 34.22  ? 2    DG  P "C2'" 1 
ATOM   3723 C  "C1'" . DG  C 3 2   ? 27.741 -8.989  -7.994  1.00 36.08  ? 2    DG  P "C1'" 1 
ATOM   3724 N  N9    . DG  C 3 2   ? 29.075 -9.139  -8.570  1.00 33.01  ? 2    DG  P N9    1 
ATOM   3725 C  C8    . DG  C 3 2   ? 29.735 -8.271  -9.414  1.00 34.86  ? 2    DG  P C8    1 
ATOM   3726 N  N7    . DG  C 3 2   ? 30.919 -8.691  -9.766  1.00 29.48  ? 2    DG  P N7    1 
ATOM   3727 C  C5    . DG  C 3 2   ? 31.044 -9.922  -9.115  1.00 33.88  ? 2    DG  P C5    1 
ATOM   3728 C  C6    . DG  C 3 2   ? 32.110 -10.849 -9.108  1.00 28.91  ? 2    DG  P C6    1 
ATOM   3729 O  O6    . DG  C 3 2   ? 33.187 -10.777 -9.698  1.00 30.14  ? 2    DG  P O6    1 
ATOM   3730 N  N1    . DG  C 3 2   ? 31.828 -11.959 -8.318  1.00 34.44  ? 2    DG  P N1    1 
ATOM   3731 C  C2    . DG  C 3 2   ? 30.659 -12.150 -7.622  1.00 33.03  ? 2    DG  P C2    1 
ATOM   3732 N  N2    . DG  C 3 2   ? 30.563 -13.288 -6.916  1.00 35.41  ? 2    DG  P N2    1 
ATOM   3733 N  N3    . DG  C 3 2   ? 29.654 -11.292 -7.619  1.00 35.13  ? 2    DG  P N3    1 
ATOM   3734 C  C4    . DG  C 3 2   ? 29.917 -10.202 -8.383  1.00 34.48  ? 2    DG  P C4    1 
ATOM   3735 P  P     . DC  C 3 3   ? 25.448 -7.299  -4.857  1.00 45.33  ? 3    DC  P P     1 
ATOM   3736 O  OP1   . DC  C 3 3   ? 24.109 -7.370  -4.234  1.00 50.31  ? 3    DC  P OP1   1 
ATOM   3737 O  OP2   . DC  C 3 3   ? 26.162 -6.017  -4.996  1.00 43.31  ? 3    DC  P OP2   1 
ATOM   3738 O  "O5'" . DC  C 3 3   ? 26.430 -8.264  -4.042  1.00 46.67  ? 3    DC  P "O5'" 1 
ATOM   3739 C  "C5'" . DC  C 3 3   ? 26.220 -9.671  -4.048  1.00 48.21  ? 3    DC  P "C5'" 1 
ATOM   3740 C  "C4'" . DC  C 3 3   ? 27.406 -10.399 -3.432  1.00 43.13  ? 3    DC  P "C4'" 1 
ATOM   3741 O  "O4'" . DC  C 3 3   ? 28.493 -10.431 -4.381  1.00 48.69  ? 3    DC  P "O4'" 1 
ATOM   3742 C  "C3'" . DC  C 3 3   ? 27.963 -9.760  -2.151  1.00 43.47  ? 3    DC  P "C3'" 1 
ATOM   3743 O  "O3'" . DC  C 3 3   ? 27.849 -10.666 -1.054  1.00 47.10  ? 3    DC  P "O3'" 1 
ATOM   3744 C  "C2'" . DC  C 3 3   ? 29.427 -9.433  -2.485  1.00 44.51  ? 3    DC  P "C2'" 1 
ATOM   3745 C  "C1'" . DC  C 3 3   ? 29.711 -10.312 -3.696  1.00 47.23  ? 3    DC  P "C1'" 1 
ATOM   3746 N  N1    . DC  C 3 3   ? 30.723 -9.730  -4.633  1.00 42.69  ? 3    DC  P N1    1 
ATOM   3747 C  C2    . DC  C 3 3   ? 31.912 -10.420 -4.877  1.00 33.45  ? 3    DC  P C2    1 
ATOM   3748 O  O2    . DC  C 3 3   ? 32.102 -11.507 -4.316  1.00 41.71  ? 3    DC  P O2    1 
ATOM   3749 N  N3    . DC  C 3 3   ? 32.823 -9.883  -5.722  1.00 41.68  ? 3    DC  P N3    1 
ATOM   3750 C  C4    . DC  C 3 3   ? 32.584 -8.716  -6.307  1.00 40.87  ? 3    DC  P C4    1 
ATOM   3751 N  N4    . DC  C 3 3   ? 33.516 -8.232  -7.134  1.00 40.84  ? 3    DC  P N4    1 
ATOM   3752 C  C5    . DC  C 3 3   ? 31.377 -7.993  -6.073  1.00 41.81  ? 3    DC  P C5    1 
ATOM   3753 C  C6    . DC  C 3 3   ? 30.485 -8.532  -5.234  1.00 40.66  ? 3    DC  P C6    1 
ATOM   3754 P  P     . DG  C 3 4   ? 28.269 -10.203 0.427   1.00 53.36  ? 4    DG  P P     1 
ATOM   3755 O  OP1   . DG  C 3 4   ? 27.397 -10.939 1.368   1.00 59.94  ? 4    DG  P OP1   1 
ATOM   3756 O  OP2   . DG  C 3 4   ? 28.348 -8.725  0.471   1.00 45.09  ? 4    DG  P OP2   1 
ATOM   3757 O  "O5'" . DG  C 3 4   ? 29.767 -10.746 0.578   1.00 42.87  ? 4    DG  P "O5'" 1 
ATOM   3758 C  "C5'" . DG  C 3 4   ? 30.065 -12.072 0.157   1.00 44.68  ? 4    DG  P "C5'" 1 
ATOM   3759 C  "C4'" . DG  C 3 4   ? 31.535 -12.389 0.356   1.00 51.89  ? 4    DG  P "C4'" 1 
ATOM   3760 O  "O4'" . DG  C 3 4   ? 32.310 -11.867 -0.753  1.00 46.77  ? 4    DG  P "O4'" 1 
ATOM   3761 C  "C3'" . DG  C 3 4   ? 32.149 -11.817 1.632   1.00 47.02  ? 4    DG  P "C3'" 1 
ATOM   3762 O  "O3'" . DG  C 3 4   ? 32.906 -12.829 2.283   1.00 47.43  ? 4    DG  P "O3'" 1 
ATOM   3763 C  "C2'" . DG  C 3 4   ? 33.024 -10.668 1.131   1.00 41.99  ? 4    DG  P "C2'" 1 
ATOM   3764 C  "C1'" . DG  C 3 4   ? 33.404 -11.125 -0.270  1.00 39.25  ? 4    DG  P "C1'" 1 
ATOM   3765 N  N9    . DG  C 3 4   ? 33.643 -10.015 -1.195  1.00 37.55  ? 4    DG  P N9    1 
ATOM   3766 C  C8    . DG  C 3 4   ? 32.820 -8.934  -1.429  1.00 38.32  ? 4    DG  P C8    1 
ATOM   3767 N  N7    . DG  C 3 4   ? 33.290 -8.105  -2.319  1.00 38.71  ? 4    DG  P N7    1 
ATOM   3768 C  C5    . DG  C 3 4   ? 34.506 -8.670  -2.697  1.00 32.86  ? 4    DG  P C5    1 
ATOM   3769 C  C6    . DG  C 3 4   ? 35.460 -8.223  -3.624  1.00 33.04  ? 4    DG  P C6    1 
ATOM   3770 O  O6    . DG  C 3 4   ? 35.432 -7.199  -4.321  1.00 34.10  ? 4    DG  P O6    1 
ATOM   3771 N  N1    . DG  C 3 4   ? 36.548 -9.092  -3.706  1.00 33.79  ? 4    DG  P N1    1 
ATOM   3772 C  C2    . DG  C 3 4   ? 36.683 -10.253 -2.987  1.00 35.59  ? 4    DG  P C2    1 
ATOM   3773 N  N2    . DG  C 3 4   ? 37.808 -10.964 -3.206  1.00 34.20  ? 4    DG  P N2    1 
ATOM   3774 N  N3    . DG  C 3 4   ? 35.791 -10.684 -2.106  1.00 31.49  ? 4    DG  P N3    1 
ATOM   3775 C  C4    . DG  C 3 4   ? 34.733 -9.846  -2.016  1.00 35.52  ? 4    DG  P C4    1 
ATOM   3776 P  P     . DT  C 3 5   ? 33.647 -12.546 3.682   1.00 46.80  ? 5    DT  P P     1 
ATOM   3777 O  OP1   . DT  C 3 5   ? 33.548 -13.800 4.454   1.00 54.93  ? 5    DT  P OP1   1 
ATOM   3778 O  OP2   . DT  C 3 5   ? 33.182 -11.284 4.286   1.00 40.95  ? 5    DT  P OP2   1 
ATOM   3779 O  "O5'" . DT  C 3 5   ? 35.168 -12.339 3.226   1.00 44.26  ? 5    DT  P "O5'" 1 
ATOM   3780 C  "C5'" . DT  C 3 5   ? 35.731 -13.237 2.302   1.00 33.33  ? 5    DT  P "C5'" 1 
ATOM   3781 C  "C4'" . DT  C 3 5   ? 37.188 -12.912 2.033   1.00 33.62  ? 5    DT  P "C4'" 1 
ATOM   3782 O  "O4'" . DT  C 3 5   ? 37.302 -11.908 0.994   1.00 33.67  ? 5    DT  P "O4'" 1 
ATOM   3783 C  "C3'" . DT  C 3 5   ? 37.978 -12.391 3.229   1.00 31.64  ? 5    DT  P "C3'" 1 
ATOM   3784 O  "O3'" . DT  C 3 5   ? 39.226 -13.068 3.269   1.00 27.67  ? 5    DT  P "O3'" 1 
ATOM   3785 C  "C2'" . DT  C 3 5   ? 38.148 -10.893 2.926   1.00 31.82  ? 5    DT  P "C2'" 1 
ATOM   3786 C  "C1'" . DT  C 3 5   ? 38.212 -10.900 1.409   1.00 25.89  ? 5    DT  P "C1'" 1 
ATOM   3787 N  N1    . DT  C 3 5   ? 37.790 -9.611  0.758   1.00 32.51  ? 5    DT  P N1    1 
ATOM   3788 C  C2    . DT  C 3 5   ? 38.600 -9.052  -0.205  1.00 27.35  ? 5    DT  P C2    1 
ATOM   3789 O  O2    . DT  C 3 5   ? 39.661 -9.531  -0.548  1.00 27.55  ? 5    DT  P O2    1 
ATOM   3790 N  N3    . DT  C 3 5   ? 38.121 -7.908  -0.770  1.00 30.09  ? 5    DT  P N3    1 
ATOM   3791 C  C4    . DT  C 3 5   ? 36.943 -7.264  -0.481  1.00 27.86  ? 5    DT  P C4    1 
ATOM   3792 O  O4    . DT  C 3 5   ? 36.609 -6.225  -1.058  1.00 27.56  ? 5    DT  P O4    1 
ATOM   3793 C  C5    . DT  C 3 5   ? 36.125 -7.890  0.538   1.00 29.28  ? 5    DT  P C5    1 
ATOM   3794 C  C7    . DT  C 3 5   ? 34.820 -7.272  0.932   1.00 36.85  ? 5    DT  P C7    1 
ATOM   3795 C  C6    . DT  C 3 5   ? 36.580 -9.032  1.105   1.00 26.87  ? 5    DT  P C6    1 
ATOM   3796 P  P     . DC  C 3 6   ? 40.191 -12.929 4.546   1.00 27.53  ? 6    DC  P P     1 
ATOM   3797 O  OP1   . DC  C 3 6   ? 40.915 -14.213 4.631   1.00 28.59  ? 6    DC  P OP1   1 
ATOM   3798 O  OP2   . DC  C 3 6   ? 39.481 -12.393 5.714   1.00 24.77  ? 6    DC  P OP2   1 
ATOM   3799 O  "O5'" . DC  C 3 6   ? 41.261 -11.840 4.092   1.00 25.00  ? 6    DC  P "O5'" 1 
ATOM   3800 C  "C5'" . DC  C 3 6   ? 42.084 -12.086 2.981   1.00 23.21  ? 6    DC  P "C5'" 1 
ATOM   3801 C  "C4'" . DC  C 3 6   ? 42.862 -10.836 2.642   1.00 26.23  ? 6    DC  P "C4'" 1 
ATOM   3802 O  "O4'" . DC  C 3 6   ? 41.985 -9.885  2.009   1.00 27.59  ? 6    DC  P "O4'" 1 
ATOM   3803 C  "C3'" . DC  C 3 6   ? 43.473 -10.119 3.849   1.00 26.23  ? 6    DC  P "C3'" 1 
ATOM   3804 O  "O3'" . DC  C 3 6   ? 44.895 -10.214 3.758   1.00 28.27  ? 6    DC  P "O3'" 1 
ATOM   3805 C  "C2'" . DC  C 3 6   ? 42.973 -8.663  3.725   1.00 26.59  ? 6    DC  P "C2'" 1 
ATOM   3806 C  "C1'" . DC  C 3 6   ? 42.444 -8.604  2.296   1.00 24.18  ? 6    DC  P "C1'" 1 
ATOM   3807 N  N1    . DC  C 3 6   ? 41.308 -7.652  2.093   1.00 22.15  ? 6    DC  P N1    1 
ATOM   3808 C  C2    . DC  C 3 6   ? 41.365 -6.750  1.024   1.00 27.96  ? 6    DC  P C2    1 
ATOM   3809 O  O2    . DC  C 3 6   ? 42.348 -6.775  0.272   1.00 25.69  ? 6    DC  P O2    1 
ATOM   3810 N  N3    . DC  C 3 6   ? 40.335 -5.889  0.834   1.00 25.82  ? 6    DC  P N3    1 
ATOM   3811 C  C4    . DC  C 3 6   ? 39.287 -5.907  1.667   1.00 24.35  ? 6    DC  P C4    1 
ATOM   3812 N  N4    . DC  C 3 6   ? 38.297 -5.024  1.444   1.00 31.54  ? 6    DC  P N4    1 
ATOM   3813 C  C5    . DC  C 3 6   ? 39.212 -6.808  2.774   1.00 25.60  ? 6    DC  P C5    1 
ATOM   3814 C  C6    . DC  C 3 6   ? 40.235 -7.663  2.942   1.00 27.47  ? 6    DC  P C6    1 
ATOM   3815 P  P     . DA  C 3 7   ? 45.865 -9.518  4.836   1.00 26.04  ? 7    DA  P P     1 
ATOM   3816 O  OP1   . DA  C 3 7   ? 47.049 -10.402 4.963   1.00 25.18  ? 7    DA  P OP1   1 
ATOM   3817 O  OP2   . DA  C 3 7   ? 45.140 -9.158  6.060   1.00 25.41  ? 7    DA  P OP2   1 
ATOM   3818 O  "O5'" . DA  C 3 7   ? 46.215 -8.073  4.214   1.00 27.39  ? 7    DA  P "O5'" 1 
ATOM   3819 C  "C5'" . DA  C 3 7   ? 46.859 -7.942  2.977   1.00 37.83  ? 7    DA  P "C5'" 1 
ATOM   3820 C  "C4'" . DA  C 3 7   ? 46.714 -6.513  2.451   1.00 34.18  ? 7    DA  P "C4'" 1 
ATOM   3821 O  "O4'" . DA  C 3 7   ? 45.325 -6.236  2.166   1.00 32.21  ? 7    DA  P "O4'" 1 
ATOM   3822 C  "C3'" . DA  C 3 7   ? 47.087 -5.392  3.415   1.00 37.43  ? 7    DA  P "C3'" 1 
ATOM   3823 O  "O3'" . DA  C 3 7   ? 48.503 -5.141  3.413   1.00 49.60  ? 7    DA  P "O3'" 1 
ATOM   3824 C  "C2'" . DA  C 3 7   ? 46.326 -4.198  2.830   1.00 36.81  ? 7    DA  P "C2'" 1 
ATOM   3825 C  "C1'" . DA  C 3 7   ? 45.193 -4.842  2.028   1.00 34.11  ? 7    DA  P "C1'" 1 
ATOM   3826 N  N9    . DA  C 3 7   ? 43.874 -4.420  2.471   1.00 26.32  ? 7    DA  P N9    1 
ATOM   3827 C  C8    . DA  C 3 7   ? 43.100 -4.973  3.452   1.00 27.87  ? 7    DA  P C8    1 
ATOM   3828 N  N7    . DA  C 3 7   ? 41.952 -4.360  3.619   1.00 26.94  ? 7    DA  P N7    1 
ATOM   3829 C  C5    . DA  C 3 7   ? 41.990 -3.328  2.690   1.00 30.07  ? 7    DA  P C5    1 
ATOM   3830 C  C6    . DA  C 3 7   ? 41.082 -2.313  2.373   1.00 31.19  ? 7    DA  P C6    1 
ATOM   3831 N  N6    . DA  C 3 7   ? 39.900 -2.175  2.985   1.00 33.04  ? 7    DA  P N6    1 
ATOM   3832 N  N1    . DA  C 3 7   ? 41.433 -1.439  1.398   1.00 30.40  ? 7    DA  P N1    1 
ATOM   3833 C  C2    . DA  C 3 7   ? 42.618 -1.583  0.801   1.00 31.92  ? 7    DA  P C2    1 
ATOM   3834 N  N3    . DA  C 3 7   ? 43.558 -2.505  1.021   1.00 27.40  ? 7    DA  P N3    1 
ATOM   3835 C  C4    . DA  C 3 7   ? 43.169 -3.350  1.985   1.00 29.13  ? 7    DA  P C4    1 
ATOM   3836 P  P     A DT  C 3 8   ? 49.124 -4.045  4.417   0.50 47.30  ? 8    DT  P P     1 
ATOM   3837 P  P     B DT  C 3 8   ? 49.131 -3.984  4.344   0.50 47.30  ? 8    DT  P P     1 
ATOM   3838 O  OP1   A DT  C 3 8   ? 50.578 -4.296  4.571   0.50 42.83  ? 8    DT  P OP1   1 
ATOM   3839 O  OP1   B DT  C 3 8   ? 50.606 -4.127  4.330   0.50 42.06  ? 8    DT  P OP1   1 
ATOM   3840 O  OP2   A DT  C 3 8   ? 48.226 -3.896  5.586   0.50 44.01  ? 8    DT  P OP2   1 
ATOM   3841 O  OP2   B DT  C 3 8   ? 48.383 -3.968  5.620   0.50 44.28  ? 8    DT  P OP2   1 
ATOM   3842 O  "O5'" A DT  C 3 8   ? 48.970 -2.678  3.638   0.50 40.24  ? 8    DT  P "O5'" 1 
ATOM   3843 O  "O5'" B DT  C 3 8   ? 48.762 -2.615  3.607   0.50 40.09  ? 8    DT  P "O5'" 1 
ATOM   3844 C  "C5'" A DT  C 3 8   ? 49.389 -2.554  2.297   0.50 37.44  ? 8    DT  P "C5'" 1 
ATOM   3845 C  "C5'" B DT  C 3 8   ? 49.410 -2.239  2.399   0.50 37.95  ? 8    DT  P "C5'" 1 
ATOM   3846 C  "C4'" A DT  C 3 8   ? 49.028 -1.170  1.852   0.50 32.81  ? 8    DT  P "C4'" 1 
ATOM   3847 C  "C4'" B DT  C 3 8   ? 48.911 -0.876  1.965   0.50 32.06  ? 8    DT  P "C4'" 1 
ATOM   3848 O  "O4'" A DT  C 3 8   ? 47.588 -1.066  1.876   0.50 29.48  ? 8    DT  P "O4'" 1 
ATOM   3849 O  "O4'" B DT  C 3 8   ? 47.493 -0.961  1.730   0.50 30.31  ? 8    DT  P "O4'" 1 
ATOM   3850 C  "C3'" A DT  C 3 8   ? 49.556 -0.110  2.814   0.50 32.71  ? 8    DT  P "C3'" 1 
ATOM   3851 C  "C3'" B DT  C 3 8   ? 49.073 0.208   3.023   0.50 31.96  ? 8    DT  P "C3'" 1 
ATOM   3852 O  "O3'" A DT  C 3 8   ? 50.470 0.747   2.168   0.50 23.44  ? 8    DT  P "O3'" 1 
ATOM   3853 O  "O3'" B DT  C 3 8   ? 50.308 0.900   2.836   0.50 25.11  ? 8    DT  P "O3'" 1 
ATOM   3854 C  "C2'" A DT  C 3 8   ? 48.320 0.637   3.333   0.50 31.39  ? 8    DT  P "C2'" 1 
ATOM   3855 C  "C2'" B DT  C 3 8   ? 47.878 1.138   2.789   0.50 32.50  ? 8    DT  P "C2'" 1 
ATOM   3856 C  "C1'" A DT  C 3 8   ? 47.191 0.174   2.419   0.50 32.18  ? 8    DT  P "C1'" 1 
ATOM   3857 C  "C1'" B DT  C 3 8   ? 46.884 0.288   1.994   0.50 30.45  ? 8    DT  P "C1'" 1 
ATOM   3858 N  N1    A DT  C 3 8   ? 45.886 -0.014  3.144   0.50 33.05  ? 8    DT  P N1    1 
ATOM   3859 N  N1    B DT  C 3 8   ? 45.621 0.056   2.733   0.50 34.24  ? 8    DT  P N1    1 
ATOM   3860 C  C2    A DT  C 3 8   ? 44.826 0.828   2.867   0.50 31.50  ? 8    DT  P C2    1 
ATOM   3861 C  C2    B DT  C 3 8   ? 44.522 0.831   2.446   0.50 32.06  ? 8    DT  P C2    1 
ATOM   3862 O  O2    A DT  C 3 8   ? 44.880 1.724   2.052   0.50 31.10  ? 8    DT  P O2    1 
ATOM   3863 O  O2    B DT  C 3 8   ? 44.522 1.699   1.595   0.50 35.39  ? 8    DT  P O2    1 
ATOM   3864 N  N3    A DT  C 3 8   ? 43.687 0.574   3.587   0.50 31.94  ? 8    DT  P N3    1 
ATOM   3865 N  N3    B DT  C 3 8   ? 43.410 0.546   3.193   0.50 34.39  ? 8    DT  P N3    1 
ATOM   3866 C  C4    A DT  C 3 8   ? 43.502 -0.410  4.533   0.50 32.66  ? 8    DT  P C4    1 
ATOM   3867 C  C4    B DT  C 3 8   ? 43.292 -0.411  4.180   0.50 32.57  ? 8    DT  P C4    1 
ATOM   3868 O  O4    A DT  C 3 8   ? 42.438 -0.559  5.129   0.50 34.07  ? 8    DT  P O4    1 
ATOM   3869 O  O4    B DT  C 3 8   ? 42.247 -0.593  4.798   0.50 35.48  ? 8    DT  P O4    1 
ATOM   3870 C  C5    A DT  C 3 8   ? 44.649 -1.247  4.783   0.50 32.04  ? 8    DT  P C5    1 
ATOM   3871 C  C5    B DT  C 3 8   ? 44.485 -1.181  4.438   0.50 32.67  ? 8    DT  P C5    1 
ATOM   3872 C  C7    A DT  C 3 8   ? 44.561 -2.350  5.792   0.50 35.65  ? 8    DT  P C7    1 
ATOM   3873 C  C7    B DT  C 3 8   ? 44.476 -2.250  5.489   0.50 34.90  ? 8    DT  P C7    1 
ATOM   3874 C  C6    A DT  C 3 8   ? 45.772 -1.011  4.086   0.50 29.80  ? 8    DT  P C6    1 
ATOM   3875 C  C6    B DT  C 3 8   ? 45.580 -0.910  3.714   0.50 29.50  ? 8    DT  P C6    1 
HETATM 3876 P  P     B AS  C 3 9   ? 51.000 1.652   4.066   0.50 29.21  ? 9    AS  P P     1 
HETATM 3877 O  OP1   B AS  C 3 9   ? 52.543 1.542   3.864   0.50 25.04  ? 9    AS  P OP1   1 
HETATM 3878 S  S2P   B AS  C 3 9   ? 50.488 0.775   5.702   0.50 32.21  ? 9    AS  P S2P   1 
HETATM 3879 O  "O5'" B AS  C 3 9   ? 50.403 3.127   4.085   0.50 24.28  ? 9    AS  P "O5'" 1 
HETATM 3880 C  "C5'" B AS  C 3 9   ? 50.767 4.098   3.088   0.50 23.93  ? 9    AS  P "C5'" 1 
HETATM 3881 C  "C4'" B AS  C 3 9   ? 49.885 5.319   3.214   0.50 22.18  ? 9    AS  P "C4'" 1 
HETATM 3882 O  "O4'" B AS  C 3 9   ? 48.515 4.938   2.955   0.50 25.86  ? 9    AS  P "O4'" 1 
HETATM 3883 C  "C3'" B AS  C 3 9   ? 49.863 5.947   4.605   0.50 20.96  ? 9    AS  P "C3'" 1 
HETATM 3884 O  "O3'" B AS  C 3 9   ? 50.909 6.917   4.743   0.50 19.80  ? 9    AS  P "O3'" 1 
HETATM 3885 C  "C2'" B AS  C 3 9   ? 48.495 6.604   4.647   0.50 22.97  ? 9    AS  P "C2'" 1 
HETATM 3886 C  "C1'" B AS  C 3 9   ? 47.632 5.665   3.806   0.50 23.72  ? 9    AS  P "C1'" 1 
HETATM 3887 N  N9    B AS  C 3 9   ? 46.867 4.696   4.590   0.50 25.55  ? 9    AS  P N9    1 
HETATM 3888 C  C8    B AS  C 3 9   ? 47.330 3.565   5.217   0.50 28.02  ? 9    AS  P C8    1 
HETATM 3889 N  N7    B AS  C 3 9   ? 46.401 2.894   5.853   0.50 25.38  ? 9    AS  P N7    1 
HETATM 3890 C  C5    B AS  C 3 9   ? 45.247 3.635   5.631   0.50 27.58  ? 9    AS  P C5    1 
HETATM 3891 C  C6    B AS  C 3 9   ? 43.913 3.453   6.045   0.50 29.08  ? 9    AS  P C6    1 
HETATM 3892 N  N6    B AS  C 3 9   ? 43.503 2.426   6.789   0.50 29.42  ? 9    AS  P N6    1 
HETATM 3893 N  N1    B AS  C 3 9   ? 43.009 4.377   5.654   0.50 27.41  ? 9    AS  P N1    1 
HETATM 3894 C  C2    B AS  C 3 9   ? 43.420 5.405   4.903   0.50 27.49  ? 9    AS  P C2    1 
HETATM 3895 N  N3    B AS  C 3 9   ? 44.643 5.682   4.456   0.50 26.14  ? 9    AS  P N3    1 
HETATM 3896 C  C4    B AS  C 3 9   ? 45.521 4.748   4.861   0.50 25.28  ? 9    AS  P C4    1 
HETATM 3897 MN MN    . MN  D 4 .   ? 52.685 0.459   2.181   0.90 24.14  ? 501  MN  A MN    1 
HETATM 3898 MN MN    B MN  E 4 .   ? 54.692 2.857   3.834   1.00 22.76  ? 502  MN  A MN    1 
HETATM 3899 C  C1    . GOL F 5 .   ? 60.310 -24.635 12.247  1.00 29.15  ? 503  GOL A C1    1 
HETATM 3900 O  O1    . GOL F 5 .   ? 58.926 -24.455 12.401  1.00 29.95  ? 503  GOL A O1    1 
HETATM 3901 C  C2    . GOL F 5 .   ? 60.837 -24.136 10.890  1.00 34.22  ? 503  GOL A C2    1 
HETATM 3902 O  O2    . GOL F 5 .   ? 60.398 -22.834 10.607  1.00 26.62  ? 503  GOL A O2    1 
HETATM 3903 C  C3    . GOL F 5 .   ? 60.556 -25.078 9.715   1.00 39.35  ? 503  GOL A C3    1 
HETATM 3904 O  O3    . GOL F 5 .   ? 61.317 -24.677 8.580   1.00 27.95  ? 503  GOL A O3    1 
HETATM 3905 C  C1    . GOL G 5 .   ? 53.971 16.656  -7.041  1.00 48.07  ? 504  GOL A C1    1 
HETATM 3906 O  O1    . GOL G 5 .   ? 53.872 15.341  -6.539  1.00 31.89  ? 504  GOL A O1    1 
HETATM 3907 C  C2    . GOL G 5 .   ? 54.642 16.574  -8.406  1.00 50.70  ? 504  GOL A C2    1 
HETATM 3908 O  O2    . GOL G 5 .   ? 53.693 16.122  -9.347  1.00 46.62  ? 504  GOL A O2    1 
HETATM 3909 C  C3    . GOL G 5 .   ? 55.190 17.938  -8.819  1.00 47.10  ? 504  GOL A C3    1 
HETATM 3910 O  O3    . GOL G 5 .   ? 55.949 17.778  -10.002 1.00 57.76  ? 504  GOL A O3    1 
HETATM 3911 C  C1    . GOL H 5 .   ? 54.168 28.355  4.848   1.00 46.12  ? 505  GOL A C1    1 
HETATM 3912 O  O1    . GOL H 5 .   ? 52.842 28.061  4.439   1.00 46.63  ? 505  GOL A O1    1 
HETATM 3913 C  C2    . GOL H 5 .   ? 54.655 27.276  5.814   1.00 55.25  ? 505  GOL A C2    1 
HETATM 3914 O  O2    . GOL H 5 .   ? 54.032 26.026  5.567   1.00 55.94  ? 505  GOL A O2    1 
HETATM 3915 C  C3    . GOL H 5 .   ? 56.164 27.108  5.720   1.00 50.98  ? 505  GOL A C3    1 
HETATM 3916 O  O3    . GOL H 5 .   ? 56.596 26.240  6.753   1.00 44.29  ? 505  GOL A O3    1 
HETATM 3917 P  PG    A STP I 6 .   ? 55.227 2.778   7.142   0.50 28.57  ? 506  STP A PG    1 
HETATM 3918 O  O1G   A STP I 6 .   ? 55.109 2.135   5.769   0.50 24.70  ? 506  STP A O1G   1 
HETATM 3919 O  O2G   A STP I 6 .   ? 54.853 1.771   8.224   0.50 30.32  ? 506  STP A O2G   1 
HETATM 3920 O  O3G   A STP I 6 .   ? 56.595 3.352   7.408   0.50 25.81  ? 506  STP A O3G   1 
HETATM 3921 P  PB    A STP I 6 .   ? 53.137 4.269   6.077   0.50 25.43  ? 506  STP A PB    1 
HETATM 3922 O  O1B   A STP I 6 .   ? 53.796 4.501   4.735   0.50 20.20  ? 506  STP A O1B   1 
HETATM 3923 O  O2B   A STP I 6 .   ? 52.314 5.477   6.478   0.50 22.38  ? 506  STP A O2B   1 
HETATM 3924 O  O3B   A STP I 6 .   ? 54.194 3.980   7.250   0.50 27.04  ? 506  STP A O3B   1 
HETATM 3925 P  PA    A STP I 6 .   ? 51.597 2.161   4.922   0.50 20.14  ? 506  STP A PA    1 
HETATM 3926 S  S1A   A STP I 6 .   ? 50.653 0.808   5.922   0.50 31.11  ? 506  STP A S1A   1 
HETATM 3927 O  O2A   A STP I 6 .   ? 52.628 1.581   3.974   0.50 24.96  ? 506  STP A O2A   1 
HETATM 3928 O  O3A   A STP I 6 .   ? 52.256 2.963   6.112   0.50 29.58  ? 506  STP A O3A   1 
HETATM 3929 O  "O5'" A STP I 6 .   ? 50.558 3.073   4.155   0.50 23.95  ? 506  STP A "O5'" 1 
HETATM 3930 C  "C5'" A STP I 6 .   ? 50.987 4.024   3.220   0.50 23.28  ? 506  STP A "C5'" 1 
HETATM 3931 C  "C4'" A STP I 6 .   ? 50.039 5.225   3.146   0.50 22.34  ? 506  STP A "C4'" 1 
HETATM 3932 O  "O4'" A STP I 6 .   ? 48.741 4.805   2.784   0.50 24.52  ? 506  STP A "O4'" 1 
HETATM 3933 C  "C3'" A STP I 6 .   ? 49.944 5.875   4.435   0.50 20.76  ? 506  STP A "C3'" 1 
HETATM 3934 O  "O3'" A STP I 6 .   ? 50.896 6.945   4.491   0.50 19.38  ? 506  STP A "O3'" 1 
HETATM 3935 C  "C2'" A STP I 6 .   ? 48.579 6.398   4.551   0.50 23.25  ? 506  STP A "C2'" 1 
HETATM 3936 C  "C1'" A STP I 6 .   ? 47.805 5.542   3.611   0.50 24.10  ? 506  STP A "C1'" 1 
HETATM 3937 N  N9    A STP I 6 .   ? 47.029 4.622   4.349   0.50 25.39  ? 506  STP A N9    1 
HETATM 3938 C  C8    A STP I 6 .   ? 47.482 3.508   4.964   0.50 27.61  ? 506  STP A C8    1 
HETATM 3939 N  N7    A STP I 6 .   ? 46.477 2.879   5.561   0.50 26.19  ? 506  STP A N7    1 
HETATM 3940 C  C5    A STP I 6 .   ? 45.341 3.562   5.349   0.50 27.35  ? 506  STP A C5    1 
HETATM 3941 C  C6    A STP I 6 .   ? 44.008 3.391   5.722   0.50 29.06  ? 506  STP A C6    1 
HETATM 3942 N  N6    A STP I 6 .   ? 43.632 2.253   6.509   0.50 28.13  ? 506  STP A N6    1 
HETATM 3943 N  N1    A STP I 6 .   ? 43.089 4.282   5.344   0.50 27.05  ? 506  STP A N1    1 
HETATM 3944 C  C2    A STP I 6 .   ? 43.418 5.358   4.594   0.50 27.50  ? 506  STP A C2    1 
HETATM 3945 N  N3    A STP I 6 .   ? 44.713 5.561   4.215   0.50 25.55  ? 506  STP A N3    1 
HETATM 3946 C  C4    A STP I 6 .   ? 45.673 4.689   4.578   0.50 25.33  ? 506  STP A C4    1 
HETATM 3947 P  P1    C DPO J 7 .   ? 52.957 4.233   6.238   0.45 26.80  ? 507  DPO A P1    1 
HETATM 3948 O  O1    C DPO J 7 .   ? 53.614 4.398   4.887   0.45 20.83  ? 507  DPO A O1    1 
HETATM 3949 O  O2    C DPO J 7 .   ? 51.968 3.095   6.201   0.45 30.00  ? 507  DPO A O2    1 
HETATM 3950 O  O3    C DPO J 7 .   ? 52.234 5.509   6.596   0.45 22.39  ? 507  DPO A O3    1 
HETATM 3951 O  O4    C DPO J 7 .   ? 54.021 3.923   7.335   0.45 26.72  ? 507  DPO A O4    1 
HETATM 3952 P  P2    C DPO J 7 .   ? 55.020 2.733   7.181   0.45 30.41  ? 507  DPO A P2    1 
HETATM 3953 O  O5    C DPO J 7 .   ? 54.886 2.103   5.811   0.45 25.13  ? 507  DPO A O5    1 
HETATM 3954 O  O6    C DPO J 7 .   ? 54.708 1.704   8.243   0.45 30.19  ? 507  DPO A O6    1 
HETATM 3955 O  O7    C DPO J 7 .   ? 56.421 3.255   7.380   0.45 25.68  ? 507  DPO A O7    1 
HETATM 3956 O  O     . HOH K 8 .   ? 47.732 0.279   6.403   0.37 33.05  ? 601  HOH A O     1 
HETATM 3957 O  O     . HOH K 8 .   ? 64.594 -34.391 -5.661  1.00 71.52  ? 602  HOH A O     1 
HETATM 3958 O  O     . HOH K 8 .   ? 65.055 -25.124 -0.437  1.00 18.77  ? 603  HOH A O     1 
HETATM 3959 O  O     . HOH K 8 .   ? 50.928 -11.785 -9.967  1.00 39.47  ? 604  HOH A O     1 
HETATM 3960 O  O     . HOH K 8 .   ? 13.717 11.984  5.515   1.00 57.06  ? 605  HOH A O     1 
HETATM 3961 O  O     . HOH K 8 .   ? 71.820 -14.459 13.921  1.00 58.70  ? 606  HOH A O     1 
HETATM 3962 O  O     . HOH K 8 .   ? 43.461 9.924   -10.023 1.00 33.31  ? 607  HOH A O     1 
HETATM 3963 O  O     A HOH K 8 .   ? 49.122 0.068   9.405   0.69 39.83  ? 608  HOH A O     1 
HETATM 3964 O  O     . HOH K 8 .   ? 76.252 0.862   -6.226  1.00 41.32  ? 609  HOH A O     1 
HETATM 3965 O  O     . HOH K 8 .   ? 68.293 -15.862 -7.655  1.00 31.03  ? 610  HOH A O     1 
HETATM 3966 O  O     . HOH K 8 .   ? 52.972 24.457  4.246   1.00 41.17  ? 611  HOH A O     1 
HETATM 3967 O  O     . HOH K 8 .   ? 29.195 10.592  -28.587 1.00 37.88  ? 612  HOH A O     1 
HETATM 3968 O  O     . HOH K 8 .   ? 27.351 20.563  -6.564  1.00 52.34  ? 613  HOH A O     1 
HETATM 3969 O  O     . HOH K 8 .   ? 63.210 -24.081 -8.253  1.00 68.02  ? 614  HOH A O     1 
HETATM 3970 O  O     . HOH K 8 .   ? 65.440 5.762   2.301   1.00 33.46  ? 615  HOH A O     1 
HETATM 3971 O  O     . HOH K 8 .   ? 53.071 19.489  -1.197  1.00 35.66  ? 616  HOH A O     1 
HETATM 3972 O  O     . HOH K 8 .   ? 50.782 28.313  5.559   1.00 66.38  ? 617  HOH A O     1 
HETATM 3973 O  O     . HOH K 8 .   ? 61.051 -17.649 -12.894 1.00 50.13  ? 618  HOH A O     1 
HETATM 3974 O  O     . HOH K 8 .   ? 30.917 1.741   -21.935 1.00 50.61  ? 619  HOH A O     1 
HETATM 3975 O  O     . HOH K 8 .   ? 56.990 -34.358 8.531   1.00 48.74  ? 620  HOH A O     1 
HETATM 3976 O  O     . HOH K 8 .   ? 55.676 -0.380  8.966   1.00 44.21  ? 621  HOH A O     1 
HETATM 3977 O  O     . HOH K 8 .   ? 47.007 -0.427  -8.474  1.00 42.54  ? 622  HOH A O     1 
HETATM 3978 O  O     . HOH K 8 .   ? 36.982 17.357  -6.553  1.00 46.93  ? 623  HOH A O     1 
HETATM 3979 O  O     . HOH K 8 .   ? 48.929 14.440  -22.199 1.00 58.72  ? 624  HOH A O     1 
HETATM 3980 O  O     . HOH K 8 .   ? 81.091 -10.801 -7.833  1.00 51.64  ? 625  HOH A O     1 
HETATM 3981 O  O     . HOH K 8 .   ? 52.673 -19.549 21.897  1.00 51.01  ? 626  HOH A O     1 
HETATM 3982 O  O     . HOH K 8 .   ? 65.324 -6.573  -13.849 1.00 29.20  ? 627  HOH A O     1 
HETATM 3983 O  O     . HOH K 8 .   ? 50.333 -14.731 -2.978  1.00 48.27  ? 628  HOH A O     1 
HETATM 3984 O  O     . HOH K 8 .   ? 50.702 17.711  -5.809  1.00 40.01  ? 629  HOH A O     1 
HETATM 3985 O  O     . HOH K 8 .   ? 41.306 16.811  -14.702 1.00 35.62  ? 630  HOH A O     1 
HETATM 3986 O  O     . HOH K 8 .   ? 37.900 7.631   21.998  1.00 45.99  ? 631  HOH A O     1 
HETATM 3987 O  O     . HOH K 8 .   ? 52.466 1.323   9.199   1.00 35.76  ? 632  HOH A O     1 
HETATM 3988 O  O     . HOH K 8 .   ? 42.393 13.150  -23.157 1.00 46.53  ? 633  HOH A O     1 
HETATM 3989 O  O     . HOH K 8 .   ? 69.535 -12.996 -11.567 1.00 32.87  ? 634  HOH A O     1 
HETATM 3990 O  O     . HOH K 8 .   ? 50.641 14.110  -19.460 1.00 65.68  ? 635  HOH A O     1 
HETATM 3991 O  O     . HOH K 8 .   ? 59.830 14.078  -8.309  1.00 29.92  ? 636  HOH A O     1 
HETATM 3992 O  O     . HOH K 8 .   ? 27.528 6.847   -17.070 1.00 37.94  ? 637  HOH A O     1 
HETATM 3993 O  O     . HOH K 8 .   ? 57.589 -23.293 14.166  1.00 21.78  ? 638  HOH A O     1 
HETATM 3994 O  O     . HOH K 8 .   ? 73.327 -20.544 0.971   1.00 40.01  ? 639  HOH A O     1 
HETATM 3995 O  O     . HOH K 8 .   ? 57.838 12.523  -12.257 1.00 49.06  ? 640  HOH A O     1 
HETATM 3996 O  O     . HOH K 8 .   ? 49.612 -8.686  12.513  1.00 52.62  ? 641  HOH A O     1 
HETATM 3997 O  O     . HOH K 8 .   ? 40.028 8.824   26.769  1.00 32.85  ? 642  HOH A O     1 
HETATM 3998 O  O     . HOH K 8 .   ? 71.350 -18.960 14.036  1.00 48.65  ? 643  HOH A O     1 
HETATM 3999 O  O     . HOH K 8 .   ? 58.217 -12.047 -11.268 1.00 24.72  ? 644  HOH A O     1 
HETATM 4000 O  O     . HOH K 8 .   ? 33.496 7.777   16.962  1.00 58.33  ? 645  HOH A O     1 
HETATM 4001 O  O     . HOH K 8 .   ? 43.094 -1.230  -24.578 1.00 46.39  ? 646  HOH A O     1 
HETATM 4002 O  O     . HOH K 8 .   ? 68.230 -1.274  -14.131 1.00 40.63  ? 647  HOH A O     1 
HETATM 4003 O  O     . HOH K 8 .   ? 71.737 -3.942  -13.980 1.00 32.41  ? 648  HOH A O     1 
HETATM 4004 O  O     . HOH K 8 .   ? 34.228 6.105   -21.858 1.00 47.76  ? 649  HOH A O     1 
HETATM 4005 O  O     . HOH K 8 .   ? 37.237 13.692  21.305  1.00 43.03  ? 650  HOH A O     1 
HETATM 4006 O  O     . HOH K 8 .   ? 48.122 -36.625 2.841   1.00 31.50  ? 651  HOH A O     1 
HETATM 4007 O  O     . HOH K 8 .   ? 32.891 10.804  5.280   1.00 33.90  ? 652  HOH A O     1 
HETATM 4008 O  O     . HOH K 8 .   ? 42.823 -25.521 17.375  1.00 48.46  ? 653  HOH A O     1 
HETATM 4009 O  O     . HOH K 8 .   ? 70.619 -17.106 12.084  1.00 40.64  ? 654  HOH A O     1 
HETATM 4010 O  O     . HOH K 8 .   ? 59.450 12.998  11.474  1.00 33.85  ? 655  HOH A O     1 
HETATM 4011 O  O     . HOH K 8 .   ? 47.667 -27.367 -6.989  1.00 44.91  ? 656  HOH A O     1 
HETATM 4012 O  O     . HOH K 8 .   ? 69.360 9.901   -8.674  1.00 35.61  ? 657  HOH A O     1 
HETATM 4013 O  O     . HOH K 8 .   ? 53.140 -27.962 15.340  1.00 30.58  ? 658  HOH A O     1 
HETATM 4014 O  O     . HOH K 8 .   ? 40.573 -28.568 -9.822  1.00 41.54  ? 659  HOH A O     1 
HETATM 4015 O  O     . HOH K 8 .   ? 51.090 -34.991 7.991   1.00 46.75  ? 660  HOH A O     1 
HETATM 4016 O  O     . HOH K 8 .   ? 62.339 14.814  -8.952  1.00 24.64  ? 661  HOH A O     1 
HETATM 4017 O  O     . HOH K 8 .   ? 51.666 5.705   9.130   1.00 24.48  ? 662  HOH A O     1 
HETATM 4018 O  O     . HOH K 8 .   ? 80.636 -15.630 7.539   1.00 44.05  ? 663  HOH A O     1 
HETATM 4019 O  O     . HOH K 8 .   ? 60.258 -28.036 8.547   1.00 45.06  ? 664  HOH A O     1 
HETATM 4020 O  O     . HOH K 8 .   ? 60.825 -15.562 13.788  1.00 41.72  ? 665  HOH A O     1 
HETATM 4021 O  O     . HOH K 8 .   ? 65.165 -9.337  12.302  1.00 46.44  ? 666  HOH A O     1 
HETATM 4022 O  O     . HOH K 8 .   ? 70.830 3.505   -0.365  1.00 28.81  ? 667  HOH A O     1 
HETATM 4023 O  O     . HOH K 8 .   ? 57.903 -7.523  8.387   1.00 33.43  ? 668  HOH A O     1 
HETATM 4024 O  O     . HOH K 8 .   ? 41.384 15.295  -22.636 1.00 45.99  ? 669  HOH A O     1 
HETATM 4025 O  O     . HOH K 8 .   ? 60.525 -23.274 6.520   1.00 31.26  ? 670  HOH A O     1 
HETATM 4026 O  O     . HOH K 8 .   ? 47.927 -33.094 -3.394  1.00 39.88  ? 671  HOH A O     1 
HETATM 4027 O  O     . HOH K 8 .   ? 55.321 17.520  -0.472  1.00 22.16  ? 672  HOH A O     1 
HETATM 4028 O  O     . HOH K 8 .   ? 49.502 -9.243  -8.255  1.00 36.54  ? 673  HOH A O     1 
HETATM 4029 O  O     . HOH K 8 .   ? 57.055 -16.567 -11.228 1.00 36.98  ? 674  HOH A O     1 
HETATM 4030 O  O     . HOH K 8 .   ? 46.428 -0.315  -14.776 1.00 38.04  ? 675  HOH A O     1 
HETATM 4031 O  O     . HOH K 8 .   ? 67.168 -8.293  10.140  1.00 31.52  ? 676  HOH A O     1 
HETATM 4032 O  O     . HOH K 8 .   ? 62.537 9.531   -13.699 1.00 46.75  ? 677  HOH A O     1 
HETATM 4033 O  O     . HOH K 8 .   ? 50.789 -8.531  -5.153  1.00 39.96  ? 678  HOH A O     1 
HETATM 4034 O  O     . HOH K 8 .   ? 67.151 -20.544 8.738   1.00 22.38  ? 679  HOH A O     1 
HETATM 4035 O  O     . HOH K 8 .   ? 69.000 -17.419 -1.276  1.00 21.74  ? 680  HOH A O     1 
HETATM 4036 O  O     . HOH K 8 .   ? 40.366 11.615  -3.414  1.00 27.44  ? 681  HOH A O     1 
HETATM 4037 O  O     . HOH K 8 .   ? 51.713 17.840  -9.739  1.00 43.51  ? 682  HOH A O     1 
HETATM 4038 O  O     . HOH K 8 .   ? 56.061 1.125   12.974  1.00 42.43  ? 683  HOH A O     1 
HETATM 4039 O  O     . HOH K 8 .   ? 63.182 -17.026 15.346  1.00 44.78  ? 684  HOH A O     1 
HETATM 4040 O  O     . HOH K 8 .   ? 64.959 19.564  6.410   1.00 49.50  ? 685  HOH A O     1 
HETATM 4041 O  O     . HOH K 8 .   ? 52.218 20.306  4.899   1.00 29.25  ? 686  HOH A O     1 
HETATM 4042 O  O     . HOH K 8 .   ? 53.524 -28.327 4.417   1.00 25.68  ? 687  HOH A O     1 
HETATM 4043 O  O     . HOH K 8 .   ? 34.604 5.674   2.025   1.00 29.02  ? 688  HOH A O     1 
HETATM 4044 O  O     . HOH K 8 .   ? 36.665 16.162  -4.316  1.00 39.65  ? 689  HOH A O     1 
HETATM 4045 O  O     . HOH K 8 .   ? 61.311 -31.882 -10.323 1.00 57.18  ? 690  HOH A O     1 
HETATM 4046 O  O     . HOH K 8 .   ? 65.658 -15.011 11.737  1.00 31.33  ? 691  HOH A O     1 
HETATM 4047 O  O     . HOH K 8 .   ? 56.094 -13.876 -5.655  1.00 20.71  ? 692  HOH A O     1 
HETATM 4048 O  O     . HOH K 8 .   ? 35.720 10.957  0.655   1.00 36.70  ? 693  HOH A O     1 
HETATM 4049 O  O     . HOH K 8 .   ? 57.959 -27.214 11.262  1.00 36.47  ? 694  HOH A O     1 
HETATM 4050 O  O     . HOH K 8 .   ? 81.358 -18.868 5.294   1.00 47.98  ? 695  HOH A O     1 
HETATM 4051 O  O     . HOH K 8 .   ? 21.445 13.664  6.648   1.00 51.53  ? 696  HOH A O     1 
HETATM 4052 O  O     . HOH K 8 .   ? 52.716 -26.205 -3.805  1.00 32.55  ? 697  HOH A O     1 
HETATM 4053 O  O     . HOH K 8 .   ? 76.330 2.667   6.564   1.00 34.63  ? 698  HOH A O     1 
HETATM 4054 O  O     . HOH K 8 .   ? 78.064 -0.938  5.222   1.00 31.11  ? 699  HOH A O     1 
HETATM 4055 O  O     . HOH K 8 .   ? 60.283 6.296   -15.578 1.00 36.45  ? 700  HOH A O     1 
HETATM 4056 O  O     . HOH K 8 .   ? 46.749 16.318  25.386  1.00 34.18  ? 701  HOH A O     1 
HETATM 4057 O  O     . HOH K 8 .   ? 56.168 -2.817  4.160   1.00 33.58  ? 702  HOH A O     1 
HETATM 4058 O  O     . HOH K 8 .   ? 40.497 22.388  -2.308  1.00 56.94  ? 703  HOH A O     1 
HETATM 4059 O  O     . HOH K 8 .   ? 59.110 -18.536 -10.354 1.00 49.69  ? 704  HOH A O     1 
HETATM 4060 O  O     . HOH K 8 .   ? 62.886 -23.595 3.180   1.00 38.27  ? 705  HOH A O     1 
HETATM 4061 O  O     . HOH K 8 .   ? 49.861 -16.940 15.458  1.00 26.93  ? 706  HOH A O     1 
HETATM 4062 O  O     . HOH K 8 .   ? 48.362 19.930  4.672   1.00 40.40  ? 707  HOH A O     1 
HETATM 4063 O  O     . HOH K 8 .   ? 62.233 11.914  5.383   1.00 41.98  ? 708  HOH A O     1 
HETATM 4064 O  O     . HOH K 8 .   ? 44.275 10.243  -24.375 1.00 57.95  ? 709  HOH A O     1 
HETATM 4065 O  O     . HOH K 8 .   ? 38.135 -25.173 5.989   1.00 50.14  ? 710  HOH A O     1 
HETATM 4066 O  O     . HOH K 8 .   ? 62.271 7.452   7.094   1.00 24.90  ? 711  HOH A O     1 
HETATM 4067 O  O     . HOH K 8 .   ? 74.935 0.419   -3.823  1.00 34.13  ? 712  HOH A O     1 
HETATM 4068 O  O     . HOH K 8 .   ? 71.264 6.064   -7.089  1.00 26.10  ? 713  HOH A O     1 
HETATM 4069 O  O     . HOH K 8 .   ? 52.212 15.947  -4.469  1.00 26.79  ? 714  HOH A O     1 
HETATM 4070 O  O     . HOH K 8 .   ? 53.470 13.406  -10.026 1.00 31.71  ? 715  HOH A O     1 
HETATM 4071 O  O     . HOH K 8 .   ? 55.416 -1.322  -14.666 1.00 44.18  ? 716  HOH A O     1 
HETATM 4072 O  O     . HOH K 8 .   ? 42.764 17.221  18.337  1.00 50.59  ? 717  HOH A O     1 
HETATM 4073 O  O     . HOH K 8 .   ? 40.869 6.604   18.851  1.00 29.37  ? 718  HOH A O     1 
HETATM 4074 O  O     . HOH K 8 .   ? 67.309 6.535   0.955   1.00 40.43  ? 719  HOH A O     1 
HETATM 4075 O  O     . HOH K 8 .   ? 48.696 13.466  28.189  1.00 43.14  ? 720  HOH A O     1 
HETATM 4076 O  O     . HOH K 8 .   ? 63.098 -7.183  12.998  1.00 43.91  ? 721  HOH A O     1 
HETATM 4077 O  O     . HOH K 8 .   ? 63.890 -3.404  6.053   1.00 19.24  ? 722  HOH A O     1 
HETATM 4078 O  O     . HOH K 8 .   ? 67.855 -14.459 -10.053 1.00 34.90  ? 723  HOH A O     1 
HETATM 4079 O  O     . HOH K 8 .   ? 46.848 -22.439 17.378  1.00 39.23  ? 724  HOH A O     1 
HETATM 4080 O  O     . HOH K 8 .   ? 62.680 -17.009 -7.027  1.00 26.77  ? 725  HOH A O     1 
HETATM 4081 O  O     . HOH K 8 .   ? 14.180 15.015  -1.574  1.00 65.13  ? 726  HOH A O     1 
HETATM 4082 O  O     . HOH K 8 .   ? 45.419 15.955  -1.522  1.00 25.92  ? 727  HOH A O     1 
HETATM 4083 O  O     . HOH K 8 .   ? 66.374 4.001   10.812  1.00 37.07  ? 728  HOH A O     1 
HETATM 4084 O  O     . HOH K 8 .   ? 71.070 0.733   11.128  1.00 47.74  ? 729  HOH A O     1 
HETATM 4085 O  O     . HOH K 8 .   ? 53.490 6.198   -12.222 1.00 35.39  ? 730  HOH A O     1 
HETATM 4086 O  O     . HOH K 8 .   ? 52.388 3.441   17.683  1.00 40.80  ? 731  HOH A O     1 
HETATM 4087 O  O     . HOH K 8 .   ? 46.611 19.436  1.422   1.00 37.58  ? 732  HOH A O     1 
HETATM 4088 O  O     . HOH K 8 .   ? 60.475 13.989  6.412   1.00 44.90  ? 733  HOH A O     1 
HETATM 4089 O  O     . HOH K 8 .   ? 23.937 16.411  3.074   1.00 35.89  ? 734  HOH A O     1 
HETATM 4090 O  O     . HOH K 8 .   ? 54.581 -0.608  5.854   1.00 34.26  ? 735  HOH A O     1 
HETATM 4091 O  O     . HOH K 8 .   ? 39.510 -18.565 14.613  1.00 45.67  ? 736  HOH A O     1 
HETATM 4092 O  O     . HOH K 8 .   ? 40.372 16.635  6.073   1.00 35.26  ? 737  HOH A O     1 
HETATM 4093 O  O     . HOH K 8 .   ? 59.076 26.889  7.693   1.00 48.27  ? 738  HOH A O     1 
HETATM 4094 O  O     . HOH K 8 .   ? 45.204 17.153  -17.895 1.00 52.88  ? 739  HOH A O     1 
HETATM 4095 O  O     . HOH K 8 .   ? 69.162 7.979   3.845   1.00 42.80  ? 740  HOH A O     1 
HETATM 4096 O  O     . HOH K 8 .   ? 41.650 -30.378 -6.173  1.00 36.43  ? 741  HOH A O     1 
HETATM 4097 O  O     . HOH K 8 .   ? 48.337 -22.120 -5.505  1.00 31.75  ? 742  HOH A O     1 
HETATM 4098 O  O     . HOH K 8 .   ? 70.483 -18.954 1.430   1.00 24.60  ? 743  HOH A O     1 
HETATM 4099 O  O     . HOH K 8 .   ? 59.818 11.534  -10.301 1.00 29.97  ? 744  HOH A O     1 
HETATM 4100 O  O     . HOH K 8 .   ? 60.552 21.027  12.257  1.00 50.74  ? 745  HOH A O     1 
HETATM 4101 O  O     . HOH K 8 .   ? 52.218 -5.425  -0.800  1.00 30.66  ? 746  HOH A O     1 
HETATM 4102 O  O     . HOH K 8 .   ? 32.880 2.838   -0.449  1.00 44.86  ? 747  HOH A O     1 
HETATM 4103 O  O     . HOH K 8 .   ? 63.516 -9.429  -14.332 1.00 31.38  ? 748  HOH A O     1 
HETATM 4104 O  O     . HOH K 8 .   ? 62.965 12.834  -10.739 1.00 38.45  ? 749  HOH A O     1 
HETATM 4105 O  O     . HOH K 8 .   ? 57.968 -17.919 19.587  1.00 38.16  ? 750  HOH A O     1 
HETATM 4106 O  O     . HOH K 8 .   ? 67.523 1.395   11.859  1.00 45.03  ? 751  HOH A O     1 
HETATM 4107 O  O     . HOH K 8 .   ? 44.356 -32.741 -3.187  1.00 38.71  ? 752  HOH A O     1 
HETATM 4108 O  O     . HOH K 8 .   ? 66.090 -2.324  12.907  1.00 46.63  ? 753  HOH A O     1 
HETATM 4109 O  O     . HOH K 8 .   ? 43.376 12.277  -7.179  1.00 28.97  ? 754  HOH A O     1 
HETATM 4110 O  O     . HOH K 8 .   ? 43.150 -33.020 -0.419  1.00 30.88  ? 755  HOH A O     1 
HETATM 4111 O  O     . HOH K 8 .   ? 42.441 15.445  23.425  1.00 31.46  ? 756  HOH A O     1 
HETATM 4112 O  O     . HOH K 8 .   ? 48.542 -9.351  10.527  1.00 37.01  ? 757  HOH A O     1 
HETATM 4113 O  O     . HOH K 8 .   ? 51.106 5.862   -18.671 1.00 52.79  ? 758  HOH A O     1 
HETATM 4114 O  O     . HOH K 8 .   ? 52.253 8.505   25.752  1.00 40.88  ? 759  HOH A O     1 
HETATM 4115 O  O     . HOH K 8 .   ? 43.493 -14.260 5.959   1.00 23.84  ? 760  HOH A O     1 
HETATM 4116 O  O     . HOH K 8 .   ? 72.154 -7.593  11.589  1.00 28.81  ? 761  HOH A O     1 
HETATM 4117 O  O     . HOH K 8 .   ? 59.117 11.168  8.583   1.00 30.37  ? 762  HOH A O     1 
HETATM 4118 O  O     . HOH K 8 .   ? 53.842 -9.289  5.330   1.00 32.06  ? 763  HOH A O     1 
HETATM 4119 O  O     . HOH K 8 .   ? 72.891 2.108   7.930   1.00 39.14  ? 764  HOH A O     1 
HETATM 4120 O  O     . HOH K 8 .   ? 55.461 -33.156 2.434   1.00 44.79  ? 765  HOH A O     1 
HETATM 4121 O  O     . HOH K 8 .   ? 51.386 5.229   -10.859 1.00 32.68  ? 766  HOH A O     1 
HETATM 4122 O  O     . HOH K 8 .   ? 68.672 16.266  -3.906  1.00 24.36  ? 767  HOH A O     1 
HETATM 4123 O  O     . HOH K 8 .   ? 70.409 -15.944 7.749   1.00 25.05  ? 768  HOH A O     1 
HETATM 4124 O  O     . HOH K 8 .   ? 67.549 -6.319  12.895  1.00 36.95  ? 769  HOH A O     1 
HETATM 4125 O  O     . HOH K 8 .   ? 66.824 -16.467 9.788   1.00 22.56  ? 770  HOH A O     1 
HETATM 4126 O  O     . HOH K 8 .   ? 53.486 -20.452 -2.409  1.00 26.53  ? 771  HOH A O     1 
HETATM 4127 O  O     . HOH K 8 .   ? 65.352 8.557   8.997   1.00 42.76  ? 772  HOH A O     1 
HETATM 4128 O  O     . HOH K 8 .   ? 60.138 -18.495 -4.562  1.00 20.54  ? 773  HOH A O     1 
HETATM 4129 O  O     . HOH K 8 .   ? 44.750 -14.017 10.564  1.00 28.81  ? 774  HOH A O     1 
HETATM 4130 O  O     . HOH K 8 .   ? 38.898 -1.883  -13.978 1.00 52.38  ? 775  HOH A O     1 
HETATM 4131 O  O     . HOH K 8 .   ? 50.153 -34.593 -0.545  1.00 33.45  ? 776  HOH A O     1 
HETATM 4132 O  O     . HOH K 8 .   ? 44.681 0.604   -18.480 1.00 40.72  ? 777  HOH A O     1 
HETATM 4133 O  O     . HOH K 8 .   ? 56.928 5.869   -15.471 1.00 46.59  ? 778  HOH A O     1 
HETATM 4134 O  O     . HOH K 8 .   ? 65.381 -22.858 3.200   1.00 25.88  ? 779  HOH A O     1 
HETATM 4135 O  O     . HOH K 8 .   ? 49.005 -34.427 10.164  1.00 41.21  ? 780  HOH A O     1 
HETATM 4136 O  O     . HOH K 8 .   ? 21.736 12.119  -9.754  1.00 45.30  ? 781  HOH A O     1 
HETATM 4137 O  O     . HOH K 8 .   ? 48.860 -15.282 13.731  1.00 28.21  ? 782  HOH A O     1 
HETATM 4138 O  O     . HOH K 8 .   ? 46.126 17.959  -10.427 1.00 59.55  ? 783  HOH A O     1 
HETATM 4139 O  O     . HOH K 8 .   ? 59.515 10.435  19.879  1.00 31.48  ? 784  HOH A O     1 
HETATM 4140 O  O     . HOH K 8 .   ? 51.131 5.626   -8.233  1.00 27.56  ? 785  HOH A O     1 
HETATM 4141 O  O     . HOH K 8 .   ? 55.987 18.743  18.407  1.00 35.37  ? 786  HOH A O     1 
HETATM 4142 O  O     . HOH K 8 .   ? 63.011 -18.827 -1.919  1.00 26.30  ? 787  HOH A O     1 
HETATM 4143 O  O     . HOH K 8 .   ? 48.693 2.550   21.098  1.00 33.78  ? 788  HOH A O     1 
HETATM 4144 O  O     . HOH K 8 .   ? 51.212 -33.767 10.376  1.00 50.29  ? 789  HOH A O     1 
HETATM 4145 O  O     . HOH K 8 .   ? 40.966 7.676   -18.348 1.00 33.54  ? 790  HOH A O     1 
HETATM 4146 O  O     . HOH K 8 .   ? 34.454 14.959  11.272  1.00 33.01  ? 791  HOH A O     1 
HETATM 4147 O  O     . HOH K 8 .   ? 62.706 -26.451 6.895   1.00 36.88  ? 792  HOH A O     1 
HETATM 4148 O  O     . HOH K 8 .   ? 48.672 12.434  -11.066 1.00 52.71  ? 793  HOH A O     1 
HETATM 4149 O  O     . HOH K 8 .   ? 69.014 -13.412 5.048   1.00 20.68  ? 794  HOH A O     1 
HETATM 4150 O  O     . HOH K 8 .   ? 65.353 12.972  2.844   1.00 39.57  ? 795  HOH A O     1 
HETATM 4151 O  O     . HOH K 8 .   ? 43.845 -14.905 1.594   1.00 28.78  ? 796  HOH A O     1 
HETATM 4152 O  O     . HOH K 8 .   ? 53.536 7.546   -14.599 1.00 39.63  ? 797  HOH A O     1 
HETATM 4153 O  O     . HOH K 8 .   ? 63.205 -11.627 12.615  1.00 54.83  ? 798  HOH A O     1 
HETATM 4154 O  O     . HOH K 8 .   ? 52.414 -12.528 -3.649  1.00 36.29  ? 799  HOH A O     1 
HETATM 4155 O  O     . HOH K 8 .   ? 36.526 14.772  -20.318 1.00 62.68  ? 800  HOH A O     1 
HETATM 4156 O  O     . HOH K 8 .   ? 43.979 11.140  -12.288 1.00 35.24  ? 801  HOH A O     1 
HETATM 4157 O  O     . HOH K 8 .   ? 44.268 7.404   2.109   1.00 29.44  ? 802  HOH A O     1 
HETATM 4158 O  O     . HOH K 8 .   ? 38.310 -17.867 10.289  1.00 32.95  ? 803  HOH A O     1 
HETATM 4159 O  O     . HOH K 8 .   ? 83.535 -5.333  2.450   1.00 41.00  ? 804  HOH A O     1 
HETATM 4160 O  O     . HOH K 8 .   ? 23.073 14.452  -9.503  1.00 36.50  ? 805  HOH A O     1 
HETATM 4161 O  O     . HOH K 8 .   ? 58.703 4.382   22.783  1.00 38.98  ? 806  HOH A O     1 
HETATM 4162 O  O     . HOH K 8 .   ? 45.935 16.754  1.242   1.00 25.44  ? 807  HOH A O     1 
HETATM 4163 O  O     . HOH K 8 .   ? 33.653 3.201   2.997   1.00 45.82  ? 808  HOH A O     1 
HETATM 4164 O  O     . HOH K 8 .   ? 34.485 17.489  -13.150 1.00 44.63  ? 809  HOH A O     1 
HETATM 4165 O  O     . HOH K 8 .   ? 78.929 3.420   1.757   1.00 43.74  ? 810  HOH A O     1 
HETATM 4166 O  O     . HOH K 8 .   ? 49.665 -15.818 -8.692  1.00 40.22  ? 811  HOH A O     1 
HETATM 4167 O  O     . HOH K 8 .   ? 40.632 -1.524  -15.960 1.00 38.59  ? 812  HOH A O     1 
HETATM 4168 O  O     . HOH K 8 .   ? 42.157 -18.592 15.104  1.00 34.24  ? 813  HOH A O     1 
HETATM 4169 O  O     . HOH K 8 .   ? 51.432 3.115   10.420  1.00 34.38  ? 814  HOH A O     1 
HETATM 4170 O  O     . HOH K 8 .   ? 58.956 4.719   16.555  1.00 31.79  ? 815  HOH A O     1 
HETATM 4171 O  O     . HOH K 8 .   ? 32.134 3.265   -23.248 1.00 55.58  ? 816  HOH A O     1 
HETATM 4172 O  O     . HOH K 8 .   ? 69.592 -18.709 -9.297  1.00 47.00  ? 817  HOH A O     1 
HETATM 4173 O  O     . HOH K 8 .   ? 41.931 -22.345 -2.470  1.00 26.47  ? 818  HOH A O     1 
HETATM 4174 O  O     . HOH K 8 .   ? 26.044 11.371  14.056  1.00 62.10  ? 819  HOH A O     1 
HETATM 4175 O  O     . HOH K 8 .   ? 30.992 19.448  11.025  1.00 48.99  ? 820  HOH A O     1 
HETATM 4176 O  O     . HOH K 8 .   ? 47.170 -16.357 -0.680  1.00 40.05  ? 821  HOH A O     1 
HETATM 4177 O  O     . HOH K 8 .   ? 54.424 -11.164 3.482   1.00 25.74  ? 822  HOH A O     1 
HETATM 4178 O  O     . HOH K 8 .   ? 42.158 -8.826  9.502   1.00 47.77  ? 823  HOH A O     1 
HETATM 4179 O  O     . HOH K 8 .   ? 64.823 -19.431 15.447  1.00 43.59  ? 824  HOH A O     1 
HETATM 4180 O  O     . HOH K 8 .   ? 73.071 -7.344  8.833   1.00 23.68  ? 825  HOH A O     1 
HETATM 4181 O  O     . HOH K 8 .   ? 53.985 15.252  23.208  1.00 39.65  ? 826  HOH A O     1 
HETATM 4182 O  O     . HOH K 8 .   ? 59.207 9.511   10.747  1.00 22.73  ? 827  HOH A O     1 
HETATM 4183 O  O     . HOH K 8 .   ? 50.652 -6.403  -5.287  1.00 40.94  ? 828  HOH A O     1 
HETATM 4184 O  O     . HOH K 8 .   ? 44.513 -16.761 -0.381  1.00 38.78  ? 829  HOH A O     1 
HETATM 4185 O  O     . HOH K 8 .   ? 58.842 -13.310 15.046  1.00 51.83  ? 830  HOH A O     1 
HETATM 4186 O  O     . HOH K 8 .   ? 64.541 6.504   -0.217  1.00 32.03  ? 831  HOH A O     1 
HETATM 4187 O  O     . HOH K 8 .   ? 37.686 10.632  21.211  1.00 51.65  ? 832  HOH A O     1 
HETATM 4188 O  O     . HOH K 8 .   ? 55.336 -32.626 5.178   1.00 41.87  ? 833  HOH A O     1 
HETATM 4189 O  O     . HOH K 8 .   ? 53.363 -32.633 -2.738  1.00 50.12  ? 834  HOH A O     1 
HETATM 4190 O  O     . HOH K 8 .   ? 34.236 19.727  -15.806 1.00 47.70  ? 835  HOH A O     1 
HETATM 4191 O  O     . HOH K 8 .   ? 41.115 21.639  2.592   1.00 35.70  ? 836  HOH A O     1 
HETATM 4192 O  O     . HOH K 8 .   ? 69.752 -8.741  10.649  1.00 40.19  ? 837  HOH A O     1 
HETATM 4193 O  O     . HOH K 8 .   ? 59.787 14.556  3.554   1.00 32.69  ? 838  HOH A O     1 
HETATM 4194 O  O     . HOH K 8 .   ? 31.867 -1.022  -2.902  1.00 48.87  ? 839  HOH A O     1 
HETATM 4195 O  O     . HOH K 8 .   ? 50.240 -12.696 -0.665  1.00 31.58  ? 840  HOH A O     1 
HETATM 4196 O  O     . HOH K 8 .   ? 37.047 18.740  16.874  1.00 43.21  ? 841  HOH A O     1 
HETATM 4197 O  O     . HOH K 8 .   ? 33.789 14.923  18.775  1.00 44.82  ? 842  HOH A O     1 
HETATM 4198 O  O     . HOH K 8 .   ? 48.981 -37.667 0.697   1.00 42.73  ? 843  HOH A O     1 
HETATM 4199 O  O     . HOH K 8 .   ? 41.094 -23.718 -4.968  1.00 31.47  ? 844  HOH A O     1 
HETATM 4200 O  O     . HOH K 8 .   ? 49.622 -3.010  -17.020 1.00 34.58  ? 845  HOH A O     1 
HETATM 4201 O  O     . HOH K 8 .   ? 47.237 21.516  9.881   1.00 42.20  ? 846  HOH A O     1 
HETATM 4202 O  O     . HOH K 8 .   ? 53.302 -8.330  8.835   1.00 37.81  ? 847  HOH A O     1 
HETATM 4203 O  O     . HOH K 8 .   ? 51.143 21.687  7.287   1.00 34.87  ? 848  HOH A O     1 
HETATM 4204 O  O     . HOH K 8 .   ? 61.424 14.399  9.070   1.00 41.04  ? 849  HOH A O     1 
HETATM 4205 O  O     . HOH K 8 .   ? 65.237 3.493   -17.646 1.00 50.44  ? 850  HOH A O     1 
HETATM 4206 O  O     . HOH K 8 .   ? 82.672 -3.667  -4.458  1.00 44.83  ? 851  HOH A O     1 
HETATM 4207 O  O     . HOH K 8 .   ? 45.727 1.792   18.596  1.00 51.61  ? 852  HOH A O     1 
HETATM 4208 O  O     . HOH K 8 .   ? 50.792 5.769   -22.706 1.00 57.18  ? 853  HOH A O     1 
HETATM 4209 O  O     . HOH K 8 .   ? 47.103 2.427   -1.070  1.00 30.47  ? 854  HOH A O     1 
HETATM 4210 O  O     . HOH K 8 .   ? 39.200 18.457  18.094  1.00 44.82  ? 855  HOH A O     1 
HETATM 4211 O  O     . HOH K 8 .   ? 36.407 12.871  11.938  1.00 35.69  ? 856  HOH A O     1 
HETATM 4212 O  O     . HOH K 8 .   ? 33.295 -1.872  -6.188  1.00 64.79  ? 857  HOH A O     1 
HETATM 4213 O  O     . HOH K 8 .   ? 69.123 4.484   4.094   1.00 33.16  ? 858  HOH A O     1 
HETATM 4214 O  O     . HOH K 8 .   ? 61.544 4.229   -16.953 1.00 56.61  ? 859  HOH A O     1 
HETATM 4215 O  O     . HOH K 8 .   ? 58.313 18.964  -8.666  1.00 39.51  ? 860  HOH A O     1 
HETATM 4216 O  O     . HOH K 8 .   ? 42.893 -2.670  -19.619 1.00 43.02  ? 861  HOH A O     1 
HETATM 4217 O  O     . HOH K 8 .   ? 53.088 -33.324 0.257   1.00 32.01  ? 862  HOH A O     1 
HETATM 4218 O  O     . HOH K 8 .   ? 35.430 22.467  -3.656  1.00 42.80  ? 863  HOH A O     1 
HETATM 4219 O  O     . HOH K 8 .   ? 41.274 20.344  4.787   1.00 37.74  ? 864  HOH A O     1 
HETATM 4220 O  O     . HOH K 8 .   ? 80.657 -3.803  13.678  1.00 47.00  ? 865  HOH A O     1 
HETATM 4221 O  O     . HOH K 8 .   ? 49.936 2.762   12.528  1.00 42.79  ? 866  HOH A O     1 
HETATM 4222 O  O     . HOH K 8 .   ? 48.915 7.417   -7.675  1.00 32.08  ? 867  HOH A O     1 
HETATM 4223 O  O     . HOH K 8 .   ? 45.913 7.424   -12.544 1.00 47.86  ? 868  HOH A O     1 
HETATM 4224 O  O     . HOH K 8 .   ? 51.003 8.740   -14.816 1.00 47.78  ? 869  HOH A O     1 
HETATM 4225 O  O     . HOH K 8 .   ? 38.092 10.549  9.475   1.00 34.11  ? 870  HOH A O     1 
HETATM 4226 O  O     . HOH K 8 .   ? 44.851 7.422   -10.227 1.00 30.42  ? 871  HOH A O     1 
HETATM 4227 O  O     . HOH K 8 .   ? 61.983 -13.266 -13.274 1.00 46.12  ? 872  HOH A O     1 
HETATM 4228 O  O     . HOH K 8 .   ? 57.004 -18.988 21.825  1.00 47.02  ? 873  HOH A O     1 
HETATM 4229 O  O     . HOH K 8 .   ? 46.410 -14.096 14.966  1.00 50.07  ? 874  HOH A O     1 
HETATM 4230 O  O     . HOH K 8 .   ? 60.491 9.755   6.872   1.00 46.58  ? 875  HOH A O     1 
HETATM 4231 O  O     . HOH K 8 .   ? 40.441 -29.315 -2.114  1.00 33.98  ? 876  HOH A O     1 
HETATM 4232 O  O     . HOH K 8 .   ? 40.429 -29.469 12.912  1.00 48.61  ? 877  HOH A O     1 
HETATM 4233 O  O     . HOH K 8 .   ? 46.473 -18.567 -2.632  1.00 42.21  ? 878  HOH A O     1 
HETATM 4234 O  O     . HOH K 8 .   ? 64.926 -21.776 -9.153  1.00 65.50  ? 879  HOH A O     1 
HETATM 4235 O  O     . HOH K 8 .   ? 35.391 20.676  0.769   1.00 37.24  ? 880  HOH A O     1 
HETATM 4236 O  O     . HOH K 8 .   ? 41.065 -2.879  -22.970 1.00 40.11  ? 881  HOH A O     1 
HETATM 4237 O  O     . HOH K 8 .   ? 61.799 -2.410  12.415  1.00 46.25  ? 882  HOH A O     1 
HETATM 4238 O  O     . HOH K 8 .   ? 57.401 0.155   10.853  1.00 46.22  ? 883  HOH A O     1 
HETATM 4239 O  O     . HOH K 8 .   ? 45.240 17.988  -3.686  1.00 47.59  ? 884  HOH A O     1 
HETATM 4240 O  O     . HOH K 8 .   ? 57.292 -0.074  -14.620 1.00 38.51  ? 885  HOH A O     1 
HETATM 4241 O  O     . HOH K 8 .   ? 55.483 -35.250 11.019  1.00 39.52  ? 886  HOH A O     1 
HETATM 4242 O  O     . HOH K 8 .   ? 59.843 -18.233 -7.789  1.00 21.61  ? 887  HOH A O     1 
HETATM 4243 O  O     . HOH K 8 .   ? 29.383 3.840   6.473   1.00 55.64  ? 888  HOH A O     1 
HETATM 4244 O  O     . HOH K 8 .   ? 53.618 17.361  -3.019  1.00 30.33  ? 889  HOH A O     1 
HETATM 4245 O  O     . HOH K 8 .   ? 65.354 -4.403  -15.355 1.00 38.23  ? 890  HOH A O     1 
HETATM 4246 O  O     . HOH K 8 .   ? 18.694 14.568  6.195   1.00 58.78  ? 891  HOH A O     1 
HETATM 4247 O  O     . HOH K 8 .   ? 67.071 -25.261 -0.872  1.00 51.92  ? 892  HOH A O     1 
HETATM 4248 O  O     . HOH K 8 .   ? 48.514 -24.017 19.536  1.00 49.92  ? 893  HOH A O     1 
HETATM 4249 O  O     . HOH K 8 .   ? 28.794 8.385   -18.969 1.00 43.27  ? 894  HOH A O     1 
HETATM 4250 O  O     . HOH K 8 .   ? 61.834 16.229  4.837   1.00 55.97  ? 895  HOH A O     1 
HETATM 4251 O  O     . HOH K 8 .   ? 46.792 -8.482  -4.491  1.00 38.99  ? 896  HOH A O     1 
HETATM 4252 O  O     . HOH K 8 .   ? 64.853 -32.103 -12.950 1.00 67.63  ? 897  HOH A O     1 
HETATM 4253 O  O     . HOH K 8 .   ? 46.379 -9.168  11.287  1.00 50.69  ? 898  HOH A O     1 
HETATM 4254 O  O     . HOH K 8 .   ? 46.532 0.587   13.884  1.00 55.26  ? 899  HOH A O     1 
HETATM 4255 O  O     . HOH K 8 .   ? 48.406 21.945  3.275   1.00 44.11  ? 900  HOH A O     1 
HETATM 4256 O  O     . HOH K 8 .   ? 61.662 24.284  9.873   1.00 45.93  ? 901  HOH A O     1 
HETATM 4257 O  O     . HOH K 8 .   ? 49.224 8.436   -13.418 1.00 40.87  ? 902  HOH A O     1 
HETATM 4258 O  O     . HOH K 8 .   ? 40.272 -18.038 1.344   1.00 52.07  ? 903  HOH A O     1 
HETATM 4259 O  O     . HOH K 8 .   ? 51.599 -17.915 -6.008  1.00 45.96  ? 904  HOH A O     1 
HETATM 4260 O  O     . HOH K 8 .   ? 43.454 -28.506 15.989  1.00 52.02  ? 905  HOH A O     1 
HETATM 4261 O  O     . HOH K 8 .   ? 38.817 -3.521  -19.884 1.00 42.29  ? 906  HOH A O     1 
HETATM 4262 O  O     . HOH K 8 .   ? 40.689 7.399   -29.364 1.00 53.59  ? 907  HOH A O     1 
HETATM 4263 O  O     . HOH K 8 .   ? 83.758 -7.859  1.207   1.00 52.49  ? 908  HOH A O     1 
HETATM 4264 O  O     . HOH K 8 .   ? 43.289 19.976  -11.384 1.00 49.32  ? 909  HOH A O     1 
HETATM 4265 O  O     . HOH K 8 .   ? 49.698 21.164  8.669   1.00 44.83  ? 910  HOH A O     1 
HETATM 4266 O  O     . HOH K 8 .   ? 52.910 -20.173 -4.843  1.00 36.20  ? 911  HOH A O     1 
HETATM 4267 O  O     . HOH K 8 .   ? 38.395 -19.469 12.715  1.00 43.22  ? 912  HOH A O     1 
HETATM 4268 O  O     . HOH K 8 .   ? 25.215 14.894  4.933   1.00 39.71  ? 913  HOH A O     1 
HETATM 4269 O  O     . HOH K 8 .   ? 61.255 1.714   14.433  1.00 60.01  ? 914  HOH A O     1 
HETATM 4270 O  O     . HOH K 8 .   ? 61.807 15.991  2.517   1.00 38.75  ? 915  HOH A O     1 
HETATM 4271 O  O     . HOH K 8 .   ? 59.850 -29.077 -8.425  1.00 60.19  ? 916  HOH A O     1 
HETATM 4272 O  O     . HOH K 8 .   ? 38.210 13.376  24.340  1.00 45.87  ? 917  HOH A O     1 
HETATM 4273 O  O     . HOH K 8 .   ? 48.055 -30.805 -6.670  1.00 59.89  ? 918  HOH A O     1 
HETATM 4274 O  O     . HOH K 8 .   ? 54.334 -33.956 12.720  1.00 38.42  ? 919  HOH A O     1 
HETATM 4275 O  O     . HOH K 8 .   ? 50.895 4.353   24.668  1.00 45.74  ? 920  HOH A O     1 
HETATM 4276 O  O     . HOH K 8 .   ? 55.406 -7.118  6.545   1.00 39.42  ? 921  HOH A O     1 
HETATM 4277 O  O     . HOH K 8 .   ? 64.036 -15.431 13.613  1.00 45.26  ? 922  HOH A O     1 
HETATM 4278 O  O     . HOH K 8 .   ? 48.061 10.843  -9.605  1.00 40.58  ? 923  HOH A O     1 
HETATM 4279 O  O     . HOH K 8 .   ? 74.650 -22.441 -6.130  1.00 53.53  ? 924  HOH A O     1 
HETATM 4280 O  O     . HOH K 8 .   ? 38.386 -27.773 6.860   1.00 50.11  ? 925  HOH A O     1 
HETATM 4281 O  O     . HOH K 8 .   ? 39.626 -22.429 2.999   1.00 44.81  ? 926  HOH A O     1 
HETATM 4282 O  O     . HOH K 8 .   ? 42.899 17.180  -16.771 1.00 46.66  ? 927  HOH A O     1 
HETATM 4283 O  O     . HOH K 8 .   ? 81.187 -4.201  22.880  1.00 72.45  ? 928  HOH A O     1 
HETATM 4284 O  O     . HOH K 8 .   ? 43.109 3.120   18.303  1.00 52.60  ? 929  HOH A O     1 
HETATM 4285 O  O     . HOH K 8 .   ? 17.902 -3.109  -6.193  1.00 58.02  ? 930  HOH A O     1 
HETATM 4286 O  O     . HOH K 8 .   ? 33.658 22.391  -0.622  1.00 53.42  ? 931  HOH A O     1 
HETATM 4287 O  O     . HOH K 8 .   ? 42.462 -20.750 16.907  1.00 48.46  ? 932  HOH A O     1 
HETATM 4288 O  O     . HOH K 8 .   ? 51.242 -15.637 17.582  1.00 36.92  ? 933  HOH A O     1 
HETATM 4289 O  O     . HOH K 8 .   ? 61.588 8.014   16.336  1.00 49.88  ? 934  HOH A O     1 
HETATM 4290 O  O     . HOH K 8 .   ? 30.846 21.955  -2.929  1.00 45.51  ? 935  HOH A O     1 
HETATM 4291 O  O     . HOH K 8 .   ? 68.230 -21.211 -8.347  1.00 51.97  ? 936  HOH A O     1 
HETATM 4292 O  O     . HOH K 8 .   ? 38.680 -18.963 5.793   1.00 44.63  ? 937  HOH A O     1 
HETATM 4293 O  O     . HOH K 8 .   ? 40.123 -18.030 -1.339  1.00 43.65  ? 938  HOH A O     1 
HETATM 4294 O  O     . HOH K 8 .   ? 65.663 13.384  -12.872 1.00 36.51  ? 939  HOH A O     1 
HETATM 4295 O  O     . HOH K 8 .   ? 62.630 -29.327 -11.824 1.00 54.62  ? 940  HOH A O     1 
HETATM 4296 O  O     . HOH K 8 .   ? 52.565 -18.162 -11.299 1.00 45.10  ? 941  HOH A O     1 
HETATM 4297 O  O     . HOH K 8 .   ? 47.754 -18.802 -5.481  1.00 43.94  ? 942  HOH A O     1 
HETATM 4298 O  O     . HOH K 8 .   ? 45.601 -10.725 0.043   1.00 31.18  ? 943  HOH A O     1 
HETATM 4299 O  O     . HOH K 8 .   ? 43.911 0.741   -20.845 1.00 52.24  ? 944  HOH A O     1 
HETATM 4300 O  O     . HOH K 8 .   ? 22.754 14.793  -17.574 1.00 56.66  ? 945  HOH A O     1 
HETATM 4301 O  O     . HOH K 8 .   ? 49.796 26.400  3.246   1.00 48.03  ? 946  HOH A O     1 
HETATM 4302 O  O     . HOH K 8 .   ? 51.160 -18.253 -8.669  1.00 45.78  ? 947  HOH A O     1 
HETATM 4303 O  O     . HOH K 8 .   ? 58.397 15.121  -10.782 1.00 48.43  ? 948  HOH A O     1 
HETATM 4304 O  O     . HOH K 8 .   ? 22.010 18.024  -7.432  1.00 48.34  ? 949  HOH A O     1 
HETATM 4305 O  O     . HOH K 8 .   ? 35.249 -1.640  -24.310 1.00 68.58  ? 950  HOH A O     1 
HETATM 4306 O  O     . HOH K 8 .   ? 67.887 -4.687  -16.959 1.00 47.12  ? 951  HOH A O     1 
HETATM 4307 O  O     . HOH K 8 .   ? 71.093 8.932   -6.624  1.00 36.35  ? 952  HOH A O     1 
HETATM 4308 O  O     . HOH K 8 .   ? 53.093 5.325   -16.593 1.00 49.97  ? 953  HOH A O     1 
HETATM 4309 O  O     . HOH K 8 .   ? 51.205 -8.292  4.955   1.00 41.66  ? 954  HOH A O     1 
HETATM 4310 O  O     . HOH K 8 .   ? 49.157 -0.193  -16.341 1.00 33.75  ? 955  HOH A O     1 
HETATM 4311 O  O     . HOH K 8 .   ? 55.443 13.302  -11.542 1.00 39.68  ? 956  HOH A O     1 
HETATM 4312 O  O     . HOH K 8 .   ? 51.552 13.593  -11.309 1.00 40.82  ? 957  HOH A O     1 
HETATM 4313 O  O     . HOH K 8 .   ? 42.173 10.861  -25.550 1.00 62.47  ? 958  HOH A O     1 
HETATM 4314 O  O     . HOH K 8 .   ? 46.316 10.440  -13.170 1.00 51.72  ? 959  HOH A O     1 
HETATM 4315 O  O     . HOH K 8 .   ? 39.052 4.195   17.693  1.00 54.66  ? 960  HOH A O     1 
HETATM 4316 O  O     . HOH K 8 .   ? 54.945 -17.169 -13.230 1.00 42.94  ? 961  HOH A O     1 
HETATM 4317 O  O     . HOH K 8 .   ? 42.535 5.258   20.376  1.00 53.05  ? 962  HOH A O     1 
HETATM 4318 O  O     . HOH K 8 .   ? 73.493 4.513   -1.671  1.00 43.36  ? 963  HOH A O     1 
HETATM 4319 O  O     . HOH K 8 .   ? 69.290 5.399   0.832   1.00 37.63  ? 964  HOH A O     1 
HETATM 4320 O  O     . HOH K 8 .   ? 52.781 -0.041  11.765  1.00 50.90  ? 965  HOH A O     1 
HETATM 4321 O  O     . HOH K 8 .   ? 61.529 12.058  9.442   1.00 54.29  ? 966  HOH A O     1 
HETATM 4322 O  O     . HOH K 8 .   ? 38.344 -22.622 11.052  1.00 48.06  ? 967  HOH A O     1 
HETATM 4323 O  O     . HOH K 8 .   ? 52.969 2.015   16.101  1.00 57.13  ? 968  HOH A O     1 
HETATM 4324 O  O     . HOH K 8 .   ? 61.550 11.796  -12.136 1.00 49.10  ? 969  HOH A O     1 
HETATM 4325 O  O     . HOH K 8 .   ? 27.397 6.660   -26.829 1.00 38.43  ? 970  HOH A O     1 
HETATM 4326 O  O     . HOH K 8 .   ? 46.727 -37.688 4.986   1.00 39.43  ? 971  HOH A O     1 
HETATM 4327 O  O     . HOH K 8 .   ? 59.103 31.060  12.363  1.00 57.16  ? 972  HOH A O     1 
HETATM 4328 O  O     . HOH K 8 .   ? 43.969 12.843  -10.398 1.00 48.92  ? 973  HOH A O     1 
HETATM 4329 O  O     . HOH K 8 .   ? 47.176 -20.096 18.721  1.00 42.78  ? 974  HOH A O     1 
HETATM 4330 O  O     . HOH K 8 .   ? 47.520 8.063   -9.610  1.00 40.62  ? 975  HOH A O     1 
HETATM 4331 O  O     . HOH K 8 .   ? 57.678 -14.241 -12.908 1.00 34.18  ? 976  HOH A O     1 
HETATM 4332 O  O     . HOH K 8 .   ? 45.430 11.681  -9.043  1.00 44.33  ? 977  HOH A O     1 
HETATM 4333 O  O     . HOH K 8 .   ? 78.865 1.849   4.633   1.00 44.03  ? 978  HOH A O     1 
HETATM 4334 O  O     . HOH K 8 .   ? 65.165 5.446   12.979  1.00 55.39  ? 979  HOH A O     1 
HETATM 4335 O  O     . HOH K 8 .   ? 61.469 8.999   18.390  1.00 47.84  ? 980  HOH A O     1 
HETATM 4336 O  O     . HOH K 8 .   ? 43.628 15.515  25.796  1.00 38.75  ? 981  HOH A O     1 
HETATM 4337 O  O     . HOH K 8 .   ? 69.929 1.548   -14.157 1.00 48.50  ? 982  HOH A O     1 
HETATM 4338 O  O     . HOH K 8 .   ? 54.220 -35.190 1.431   1.00 46.92  ? 983  HOH A O     1 
HETATM 4339 O  O     . HOH K 8 .   ? 48.088 -17.616 17.326  1.00 41.53  ? 984  HOH A O     1 
HETATM 4340 O  O     . HOH K 8 .   ? 49.205 0.492   20.252  1.00 54.79  ? 985  HOH A O     1 
HETATM 4341 O  O     . HOH K 8 .   ? 55.677 -3.492  7.800   1.00 50.88  ? 986  HOH A O     1 
HETATM 4342 O  O     . HOH K 8 .   ? 40.237 15.414  24.726  1.00 48.93  ? 987  HOH A O     1 
HETATM 4343 O  O     . HOH K 8 .   ? 37.518 -28.437 9.436   1.00 51.65  ? 988  HOH A O     1 
HETATM 4344 O  O     . HOH K 8 .   ? 57.407 -26.164 -2.765  1.00 51.60  ? 989  HOH A O     1 
HETATM 4345 O  O     . HOH K 8 .   ? 59.272 -27.829 -1.923  1.00 46.59  ? 990  HOH A O     1 
HETATM 4346 O  O     . HOH K 8 .   ? 60.615 4.626   18.710  1.00 46.38  ? 991  HOH A O     1 
HETATM 4347 O  O     . HOH K 8 .   ? 34.397 14.063  21.393  1.00 48.82  ? 992  HOH A O     1 
HETATM 4348 O  O     . HOH K 8 .   ? 48.800 6.722   -11.722 1.00 36.74  ? 993  HOH A O     1 
HETATM 4349 O  O     . HOH K 8 .   ? 55.449 -27.228 -4.185  1.00 50.89  ? 994  HOH A O     1 
HETATM 4350 O  O     . HOH K 8 .   ? 37.969 -15.494 12.036  1.00 42.10  ? 995  HOH A O     1 
HETATM 4351 O  O     . HOH K 8 .   ? 61.276 7.985   9.753   1.00 35.53  ? 996  HOH A O     1 
HETATM 4352 O  O     . HOH K 8 .   ? 58.006 17.892  19.682  1.00 45.11  ? 997  HOH A O     1 
HETATM 4353 O  O     . HOH K 8 .   ? 47.498 16.780  27.960  1.00 38.57  ? 998  HOH A O     1 
HETATM 4354 O  O     . HOH K 8 .   ? 41.624 -29.057 17.916  1.00 60.67  ? 999  HOH A O     1 
HETATM 4355 O  O     . HOH K 8 .   ? 62.282 5.249   14.628  1.00 56.44  ? 1000 HOH A O     1 
HETATM 4356 O  O     . HOH K 8 .   ? 59.943 9.612   22.460  1.00 45.90  ? 1001 HOH A O     1 
HETATM 4357 O  O     . HOH L 8 .   ? 41.265 -19.825 -3.153  1.00 41.64  ? 101  HOH T O     1 
HETATM 4358 O  O     . HOH L 8 .   ? 28.557 4.335   9.407   1.00 70.91  ? 102  HOH T O     1 
HETATM 4359 O  O     . HOH L 8 .   ? 29.153 0.796   13.404  1.00 82.02  ? 103  HOH T O     1 
HETATM 4360 O  O     . HOH L 8 .   ? 43.117 5.440   -8.921  1.00 34.89  ? 104  HOH T O     1 
HETATM 4361 O  O     . HOH L 8 .   ? 38.573 -10.324 -9.789  1.00 46.68  ? 105  HOH T O     1 
HETATM 4362 O  O     . HOH L 8 .   ? 40.022 8.769   8.764   1.00 43.99  ? 106  HOH T O     1 
HETATM 4363 O  O     . HOH L 8 .   ? 42.044 -7.291  -10.320 1.00 44.10  ? 107  HOH T O     1 
HETATM 4364 O  O     . HOH L 8 .   ? 26.015 -19.282 -6.785  1.00 54.99  ? 108  HOH T O     1 
HETATM 4365 O  O     . HOH L 8 .   ? 36.005 2.718   4.434   1.00 39.20  ? 109  HOH T O     1 
HETATM 4366 O  O     . HOH L 8 .   ? 34.653 5.889   17.920  1.00 60.41  ? 110  HOH T O     1 
HETATM 4367 O  O     . HOH L 8 .   ? 36.295 -1.852  -0.972  1.00 39.66  ? 111  HOH T O     1 
HETATM 4368 O  O     . HOH L 8 .   ? 31.514 14.009  10.340  1.00 46.32  ? 112  HOH T O     1 
HETATM 4369 O  O     . HOH L 8 .   ? 38.407 -2.283  -6.319  1.00 35.82  ? 113  HOH T O     1 
HETATM 4370 O  O     . HOH L 8 .   ? 36.659 -22.962 -5.209  1.00 36.92  ? 114  HOH T O     1 
HETATM 4371 O  O     . HOH L 8 .   ? 31.058 -16.271 -4.499  1.00 42.34  ? 115  HOH T O     1 
HETATM 4372 O  O     . HOH L 8 .   ? 39.469 7.043   13.628  1.00 44.84  ? 116  HOH T O     1 
HETATM 4373 O  O     . HOH L 8 .   ? 44.154 1.440   -2.180  1.00 44.62  ? 117  HOH T O     1 
HETATM 4374 O  O     . HOH L 8 .   ? 40.214 -0.354  7.777   1.00 48.98  ? 118  HOH T O     1 
HETATM 4375 O  O     . HOH L 8 .   ? 39.871 -21.993 -6.460  1.00 47.28  ? 119  HOH T O     1 
HETATM 4376 O  O     . HOH L 8 .   ? 37.285 0.359   4.737   1.00 45.12  ? 120  HOH T O     1 
HETATM 4377 O  O     . HOH L 8 .   ? 45.329 5.646   -4.919  1.00 43.84  ? 121  HOH T O     1 
HETATM 4378 O  O     . HOH L 8 .   ? 45.004 -2.503  -3.239  1.00 44.84  ? 122  HOH T O     1 
HETATM 4379 O  O     . HOH L 8 .   ? 41.846 8.145   3.062   1.00 30.63  ? 123  HOH T O     1 
HETATM 4380 O  O     . HOH L 8 .   ? 43.491 5.505   0.359   1.00 44.91  ? 124  HOH T O     1 
HETATM 4381 O  O     . HOH L 8 .   ? 40.576 -3.659  -9.495  1.00 38.10  ? 125  HOH T O     1 
HETATM 4382 O  O     . HOH L 8 .   ? 44.044 -8.588  -3.316  1.00 35.25  ? 126  HOH T O     1 
HETATM 4383 O  O     . HOH L 8 .   ? 45.415 -5.027  -2.907  1.00 44.23  ? 127  HOH T O     1 
HETATM 4384 O  O     . HOH L 8 .   ? 38.681 2.342   -6.428  1.00 45.13  ? 128  HOH T O     1 
HETATM 4385 O  O     . HOH L 8 .   ? 36.292 -2.872  -4.564  1.00 39.77  ? 129  HOH T O     1 
HETATM 4386 O  O     . HOH L 8 .   ? 37.587 -12.527 -11.229 1.00 41.87  ? 130  HOH T O     1 
HETATM 4387 O  O     . HOH L 8 .   ? 37.991 -21.888 -3.323  1.00 47.40  ? 131  HOH T O     1 
HETATM 4388 O  O     . HOH L 8 .   ? 42.539 -11.307 -3.158  1.00 46.93  ? 132  HOH T O     1 
HETATM 4389 O  O     . HOH L 8 .   ? 29.824 15.705  10.899  1.00 52.42  ? 133  HOH T O     1 
HETATM 4390 O  O     . HOH L 8 .   ? 42.862 -15.487 -2.409  1.00 54.31  ? 134  HOH T O     1 
HETATM 4391 O  O     . HOH L 8 .   ? 33.068 10.692  8.260   1.00 50.42  ? 135  HOH T O     1 
HETATM 4392 O  O     . HOH L 8 .   ? 40.614 -10.289 -11.065 1.00 57.22  ? 136  HOH T O     1 
HETATM 4393 O  O     . HOH L 8 .   ? 35.698 11.039  10.194  1.00 40.80  ? 137  HOH T O     1 
HETATM 4394 O  O     . HOH M 8 .   ? 38.340 -10.547 6.479   1.00 42.19  ? 101  HOH P O     1 
HETATM 4395 O  O     . HOH M 8 .   ? 49.087 2.539   1.055   0.50 26.66  ? 102  HOH P O     1 
HETATM 4396 O  O     . HOH M 8 .   ? 46.015 3.771   1.042   1.00 37.18  ? 103  HOH P O     1 
HETATM 4397 O  O     . HOH M 8 .   ? 32.152 -7.297  -11.527 1.00 44.28  ? 104  HOH P O     1 
HETATM 4398 O  O     . HOH M 8 .   ? 36.377 -4.400  3.078   1.00 35.75  ? 105  HOH P O     1 
HETATM 4399 O  O     . HOH M 8 .   ? 34.521 -9.239  -11.324 1.00 48.92  ? 106  HOH P O     1 
HETATM 4400 O  O     . HOH M 8 .   ? 52.641 -1.172  3.695   1.00 26.61  ? 107  HOH P O     1 
HETATM 4401 O  O     . HOH M 8 .   ? 47.879 -1.793  7.309   1.00 41.11  ? 108  HOH P O     1 
HETATM 4402 O  O     . HOH M 8 .   ? 49.056 -9.958  6.826   1.00 27.69  ? 109  HOH P O     1 
HETATM 4403 O  O     . HOH M 8 .   ? 44.533 -7.963  -0.958  1.00 38.32  ? 110  HOH P O     1 
HETATM 4404 O  O     . HOH M 8 .   ? 42.554 -8.737  7.041   1.00 35.74  ? 111  HOH P O     1 
HETATM 4405 O  O     . HOH M 8 .   ? 45.779 -2.436  -0.681  1.00 38.41  ? 112  HOH P O     1 
HETATM 4406 O  O     . HOH M 8 .   ? 40.095 -5.223  5.553   1.00 41.80  ? 113  HOH P O     1 
HETATM 4407 O  O     . HOH M 8 .   ? 46.142 -4.842  7.246   1.00 57.07  ? 114  HOH P O     1 
HETATM 4408 O  O     . HOH M 8 .   ? 46.202 -7.695  8.241   1.00 45.84  ? 115  HOH P O     1 
HETATM 4409 O  O     . HOH M 8 .   ? 41.679 -11.530 -1.072  1.00 40.08  ? 116  HOH P O     1 
HETATM 4410 O  O     . HOH M 8 .   ? 41.282 -15.387 2.012   1.00 32.82  ? 117  HOH P O     1 
HETATM 4411 O  O     . HOH M 8 .   ? 38.454 -3.724  5.029   1.00 45.98  ? 118  HOH P O     1 
HETATM 4412 O  O     . HOH M 8 .   ? 30.252 -5.911  -13.172 1.00 58.10  ? 119  HOH P O     1 
HETATM 4413 O  O     . HOH M 8 .   ? 44.097 -6.417  6.513   1.00 53.77  ? 120  HOH P O     1 
HETATM 4414 O  O     . HOH M 8 .   ? 40.161 -13.727 0.075   1.00 42.92  ? 121  HOH P O     1 
HETATM 4415 O  O     . HOH M 8 .   ? 40.250 -8.810  6.096   1.00 36.08  ? 122  HOH P O     1 
HETATM 4416 O  O     . HOH M 8 .   ? 43.803 -12.649 -0.152  1.00 30.18  ? 123  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   AS  9   9   9   AS  AS  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1   501  501  MN  MN  A . 
E 4 MN  1   502  503  MN  MN  A . 
F 5 GOL 1   503  506  GOL GOL A . 
G 5 GOL 1   504  507  GOL GOL A . 
H 5 GOL 1   505  508  GOL GOL A . 
I 6 STP 1   506  504  STP STP A . 
J 7 DPO 1   507  505  DPO DPO A . 
K 8 HOH 1   601  867  HOH HOH A . 
K 8 HOH 2   602  827  HOH HOH A . 
K 8 HOH 3   603  840  HOH HOH A . 
K 8 HOH 4   604  735  HOH HOH A . 
K 8 HOH 5   605  995  HOH HOH A . 
K 8 HOH 6   606  994  HOH HOH A . 
K 8 HOH 7   607  977  HOH HOH A . 
K 8 HOH 8   608  601  HOH HOH A . 
K 8 HOH 9   609  759  HOH HOH A . 
K 8 HOH 10  610  644  HOH HOH A . 
K 8 HOH 11  611  803  HOH HOH A . 
K 8 HOH 12  612  968  HOH HOH A . 
K 8 HOH 13  613  935  HOH HOH A . 
K 8 HOH 14  614  975  HOH HOH A . 
K 8 HOH 15  615  692  HOH HOH A . 
K 8 HOH 16  616  769  HOH HOH A . 
K 8 HOH 17  617  865  HOH HOH A . 
K 8 HOH 18  618  884  HOH HOH A . 
K 8 HOH 19  619  899  HOH HOH A . 
K 8 HOH 20  620  724  HOH HOH A . 
K 8 HOH 21  621  939  HOH HOH A . 
K 8 HOH 22  622  105  HOH HOH A . 
K 8 HOH 23  623  999  HOH HOH A . 
K 8 HOH 24  624  817  HOH HOH A . 
K 8 HOH 25  625  921  HOH HOH A . 
K 8 HOH 26  626  763  HOH HOH A . 
K 8 HOH 27  627  657  HOH HOH A . 
K 8 HOH 28  628  925  HOH HOH A . 
K 8 HOH 29  629  783  HOH HOH A . 
K 8 HOH 30  630  670  HOH HOH A . 
K 8 HOH 31  631  1002 HOH HOH A . 
K 8 HOH 32  632  653  HOH HOH A . 
K 8 HOH 33  633  846  HOH HOH A . 
K 8 HOH 34  634  742  HOH HOH A . 
K 8 HOH 35  635  980  HOH HOH A . 
K 8 HOH 36  636  678  HOH HOH A . 
K 8 HOH 37  637  890  HOH HOH A . 
K 8 HOH 38  638  609  HOH HOH A . 
K 8 HOH 39  639  852  HOH HOH A . 
K 8 HOH 40  640  797  HOH HOH A . 
K 8 HOH 41  641  733  HOH HOH A . 
K 8 HOH 42  642  668  HOH HOH A . 
K 8 HOH 43  643  806  HOH HOH A . 
K 8 HOH 44  644  617  HOH HOH A . 
K 8 HOH 45  645  848  HOH HOH A . 
K 8 HOH 46  646  677  HOH HOH A . 
K 8 HOH 47  647  863  HOH HOH A . 
K 8 HOH 48  648  728  HOH HOH A . 
K 8 HOH 49  649  819  HOH HOH A . 
K 8 HOH 50  650  855  HOH HOH A . 
K 8 HOH 51  651  658  HOH HOH A . 
K 8 HOH 52  652  646  HOH HOH A . 
K 8 HOH 53  653  990  HOH HOH A . 
K 8 HOH 54  654  808  HOH HOH A . 
K 8 HOH 55  655  705  HOH HOH A . 
K 8 HOH 56  656  679  HOH HOH A . 
K 8 HOH 57  657  776  HOH HOH A . 
K 8 HOH 58  658  667  HOH HOH A . 
K 8 HOH 59  659  885  HOH HOH A . 
K 8 HOH 60  660  801  HOH HOH A . 
K 8 HOH 61  661  626  HOH HOH A . 
K 8 HOH 62  662  611  HOH HOH A . 
K 8 HOH 63  663  831  HOH HOH A . 
K 8 HOH 64  664  824  HOH HOH A . 
K 8 HOH 65  665  778  HOH HOH A . 
K 8 HOH 66  666  825  HOH HOH A . 
K 8 HOH 67  667  638  HOH HOH A . 
K 8 HOH 68  668  689  HOH HOH A . 
K 8 HOH 69  669  712  HOH HOH A . 
K 8 HOH 70  670  627  HOH HOH A . 
K 8 HOH 71  671  842  HOH HOH A . 
K 8 HOH 72  672  625  HOH HOH A . 
K 8 HOH 73  673  704  HOH HOH A . 
K 8 HOH 74  674  722  HOH HOH A . 
K 8 HOH 75  675  682  HOH HOH A . 
K 8 HOH 76  676  687  HOH HOH A . 
K 8 HOH 77  677  760  HOH HOH A . 
K 8 HOH 78  678  739  HOH HOH A . 
K 8 HOH 79  679  607  HOH HOH A . 
K 8 HOH 80  680  608  HOH HOH A . 
K 8 HOH 81  681  622  HOH HOH A . 
K 8 HOH 82  682  972  HOH HOH A . 
K 8 HOH 83  683  815  HOH HOH A . 
K 8 HOH 84  684  805  HOH HOH A . 
K 8 HOH 85  685  923  HOH HOH A . 
K 8 HOH 86  686  645  HOH HOH A . 
K 8 HOH 87  687  618  HOH HOH A . 
K 8 HOH 88  688  640  HOH HOH A . 
K 8 HOH 89  689  686  HOH HOH A . 
K 8 HOH 90  690  758  HOH HOH A . 
K 8 HOH 91  691  655  HOH HOH A . 
K 8 HOH 92  692  605  HOH HOH A . 
K 8 HOH 93  693  107  HOH HOH A . 
K 8 HOH 94  694  703  HOH HOH A . 
K 8 HOH 95  695  919  HOH HOH A . 
K 8 HOH 96  696  813  HOH HOH A . 
K 8 HOH 97  697  721  HOH HOH A . 
K 8 HOH 98  698  729  HOH HOH A . 
K 8 HOH 99  699  660  HOH HOH A . 
K 8 HOH 100 700  768  HOH HOH A . 
K 8 HOH 101 701  715  HOH HOH A . 
K 8 HOH 102 702  886  HOH HOH A . 
K 8 HOH 103 703  944  HOH HOH A . 
K 8 HOH 104 704  773  HOH HOH A . 
K 8 HOH 105 705  814  HOH HOH A . 
K 8 HOH 106 706  656  HOH HOH A . 
K 8 HOH 107 707  775  HOH HOH A . 
K 8 HOH 108 708  740  HOH HOH A . 
K 8 HOH 109 709  745  HOH HOH A . 
K 8 HOH 110 710  830  HOH HOH A . 
K 8 HOH 111 711  634  HOH HOH A . 
K 8 HOH 112 712  707  HOH HOH A . 
K 8 HOH 113 713  643  HOH HOH A . 
K 8 HOH 114 714  647  HOH HOH A . 
K 8 HOH 115 715  642  HOH HOH A . 
K 8 HOH 116 716  822  HOH HOH A . 
K 8 HOH 117 717  912  HOH HOH A . 
K 8 HOH 118 718  635  HOH HOH A . 
K 8 HOH 119 719  888  HOH HOH A . 
K 8 HOH 120 720  730  HOH HOH A . 
K 8 HOH 121 721  877  HOH HOH A . 
K 8 HOH 122 722  606  HOH HOH A . 
K 8 HOH 123 723  723  HOH HOH A . 
K 8 HOH 124 724  896  HOH HOH A . 
K 8 HOH 125 725  727  HOH HOH A . 
K 8 HOH 126 726  936  HOH HOH A . 
K 8 HOH 127 727  630  HOH HOH A . 
K 8 HOH 128 728  782  HOH HOH A . 
K 8 HOH 129 729  725  HOH HOH A . 
K 8 HOH 130 730  743  HOH HOH A . 
K 8 HOH 131 731  788  HOH HOH A . 
K 8 HOH 132 732  708  HOH HOH A . 
K 8 HOH 133 733  904  HOH HOH A . 
K 8 HOH 134 734  209  HOH HOH A . 
K 8 HOH 135 735  889  HOH HOH A . 
K 8 HOH 136 736  927  HOH HOH A . 
K 8 HOH 137 737  661  HOH HOH A . 
K 8 HOH 138 738  771  HOH HOH A . 
K 8 HOH 139 739  761  HOH HOH A . 
K 8 HOH 140 740  926  HOH HOH A . 
K 8 HOH 141 741  714  HOH HOH A . 
K 8 HOH 142 742  649  HOH HOH A . 
K 8 HOH 143 743  650  HOH HOH A . 
K 8 HOH 144 744  632  HOH HOH A . 
K 8 HOH 145 745  834  HOH HOH A . 
K 8 HOH 146 746  853  HOH HOH A . 
K 8 HOH 147 747  794  HOH HOH A . 
K 8 HOH 148 748  659  HOH HOH A . 
K 8 HOH 149 749  671  HOH HOH A . 
K 8 HOH 150 750  701  HOH HOH A . 
K 8 HOH 151 751  843  HOH HOH A . 
K 8 HOH 152 752  838  HOH HOH A . 
K 8 HOH 153 753  998  HOH HOH A . 
K 8 HOH 154 754  633  HOH HOH A . 
K 8 HOH 155 755  639  HOH HOH A . 
K 8 HOH 156 756  663  HOH HOH A . 
K 8 HOH 157 757  684  HOH HOH A . 
K 8 HOH 158 758  737  HOH HOH A . 
K 8 HOH 159 759  786  HOH HOH A . 
K 8 HOH 160 760  610  HOH HOH A . 
K 8 HOH 161 761  752  HOH HOH A . 
K 8 HOH 162 762  665  HOH HOH A . 
K 8 HOH 163 763  623  HOH HOH A . 
K 8 HOH 164 764  719  HOH HOH A . 
K 8 HOH 165 765  958  HOH HOH A . 
K 8 HOH 166 766  674  HOH HOH A . 
K 8 HOH 167 767  616  HOH HOH A . 
K 8 HOH 168 768  629  HOH HOH A . 
K 8 HOH 169 769  717  HOH HOH A . 
K 8 HOH 170 770  619  HOH HOH A . 
K 8 HOH 171 771  621  HOH HOH A . 
K 8 HOH 172 772  796  HOH HOH A . 
K 8 HOH 173 773  620  HOH HOH A . 
K 8 HOH 174 774  628  HOH HOH A . 
K 8 HOH 175 775  913  HOH HOH A . 
K 8 HOH 176 776  681  HOH HOH A . 
K 8 HOH 177 777  749  HOH HOH A . 
K 8 HOH 178 778  1001 HOH HOH A . 
K 8 HOH 179 779  631  HOH HOH A . 
K 8 HOH 180 780  826  HOH HOH A . 
K 8 HOH 181 781  894  HOH HOH A . 
K 8 HOH 182 782  637  HOH HOH A . 
K 8 HOH 183 783  862  HOH HOH A . 
K 8 HOH 184 784  683  HOH HOH A . 
K 8 HOH 185 785  648  HOH HOH A . 
K 8 HOH 186 786  736  HOH HOH A . 
K 8 HOH 187 787  651  HOH HOH A . 
K 8 HOH 188 788  685  HOH HOH A . 
K 8 HOH 189 789  946  HOH HOH A . 
K 8 HOH 190 790  669  HOH HOH A . 
K 8 HOH 191 791  810  HOH HOH A . 
K 8 HOH 192 792  688  HOH HOH A . 
K 8 HOH 193 793  792  HOH HOH A . 
K 8 HOH 194 794  613  HOH HOH A . 
K 8 HOH 195 795  793  HOH HOH A . 
K 8 HOH 196 796  636  HOH HOH A . 
K 8 HOH 197 797  820  HOH HOH A . 
K 8 HOH 198 798  906  HOH HOH A . 
K 8 HOH 199 799  741  HOH HOH A . 
K 8 HOH 200 800  875  HOH HOH A . 
K 8 HOH 201 801  662  HOH HOH A . 
K 8 HOH 202 802  673  HOH HOH A . 
K 8 HOH 203 803  780  HOH HOH A . 
K 8 HOH 204 804  720  HOH HOH A . 
K 8 HOH 205 805  680  HOH HOH A . 
K 8 HOH 206 806  766  HOH HOH A . 
K 8 HOH 207 807  624  HOH HOH A . 
K 8 HOH 208 808  917  HOH HOH A . 
K 8 HOH 209 809  850  HOH HOH A . 
K 8 HOH 210 810  772  HOH HOH A . 
K 8 HOH 211 811  956  HOH HOH A . 
K 8 HOH 212 812  818  HOH HOH A . 
K 8 HOH 213 813  757  HOH HOH A . 
K 8 HOH 214 814  706  HOH HOH A . 
K 8 HOH 215 815  694  HOH HOH A . 
K 8 HOH 216 816  992  HOH HOH A . 
K 8 HOH 217 817  950  HOH HOH A . 
K 8 HOH 218 818  652  HOH HOH A . 
K 8 HOH 219 819  979  HOH HOH A . 
K 8 HOH 220 820  133  HOH HOH A . 
K 8 HOH 221 821  973  HOH HOH A . 
K 8 HOH 222 822  614  HOH HOH A . 
K 8 HOH 223 823  767  HOH HOH A . 
K 8 HOH 224 824  747  HOH HOH A . 
K 8 HOH 225 825  612  HOH HOH A . 
K 8 HOH 226 826  744  HOH HOH A . 
K 8 HOH 227 827  615  HOH HOH A . 
K 8 HOH 228 828  872  HOH HOH A . 
K 8 HOH 229 829  799  HOH HOH A . 
K 8 HOH 230 830  969  HOH HOH A . 
K 8 HOH 231 831  672  HOH HOH A . 
K 8 HOH 232 832  784  HOH HOH A . 
K 8 HOH 233 833  779  HOH HOH A . 
K 8 HOH 234 834  790  HOH HOH A . 
K 8 HOH 235 835  755  HOH HOH A . 
K 8 HOH 236 836  789  HOH HOH A . 
K 8 HOH 237 837  809  HOH HOH A . 
K 8 HOH 238 838  859  HOH HOH A . 
K 8 HOH 239 839  882  HOH HOH A . 
K 8 HOH 240 840  891  HOH HOH A . 
K 8 HOH 241 841  900  HOH HOH A . 
K 8 HOH 242 842  934  HOH HOH A . 
K 8 HOH 243 843  856  HOH HOH A . 
K 8 HOH 244 844  713  HOH HOH A . 
K 8 HOH 245 845  695  HOH HOH A . 
K 8 HOH 246 846  811  HOH HOH A . 
K 8 HOH 247 847  873  HOH HOH A . 
K 8 HOH 248 848  732  HOH HOH A . 
K 8 HOH 249 849  718  HOH HOH A . 
K 8 HOH 250 850  881  HOH HOH A . 
K 8 HOH 251 851  984  HOH HOH A . 
K 8 HOH 252 852  835  HOH HOH A . 
K 8 HOH 253 853  870  HOH HOH A . 
K 8 HOH 254 854  709  HOH HOH A . 
K 8 HOH 255 855  849  HOH HOH A . 
K 8 HOH 256 856  710  HOH HOH A . 
K 8 HOH 257 857  991  HOH HOH A . 
K 8 HOH 258 858  699  HOH HOH A . 
K 8 HOH 259 859  988  HOH HOH A . 
K 8 HOH 260 860  807  HOH HOH A . 
K 8 HOH 261 861  754  HOH HOH A . 
K 8 HOH 262 862  654  HOH HOH A . 
K 8 HOH 263 863  967  HOH HOH A . 
K 8 HOH 264 864  762  HOH HOH A . 
K 8 HOH 265 865  949  HOH HOH A . 
K 8 HOH 266 866  702  HOH HOH A . 
K 8 HOH 267 867  675  HOH HOH A . 
K 8 HOH 268 868  858  HOH HOH A . 
K 8 HOH 269 869  750  HOH HOH A . 
K 8 HOH 270 870  774  HOH HOH A . 
K 8 HOH 271 871  666  HOH HOH A . 
K 8 HOH 272 872  781  HOH HOH A . 
K 8 HOH 273 873  785  HOH HOH A . 
K 8 HOH 274 874  731  HOH HOH A . 
K 8 HOH 275 875  857  HOH HOH A . 
K 8 HOH 276 876  966  HOH HOH A . 
K 8 HOH 277 877  868  HOH HOH A . 
K 8 HOH 278 878  914  HOH HOH A . 
K 8 HOH 279 879  800  HOH HOH A . 
K 8 HOH 280 880  833  HOH HOH A . 
K 8 HOH 281 881  847  HOH HOH A . 
K 8 HOH 282 882  951  HOH HOH A . 
K 8 HOH 283 883  844  HOH HOH A . 
K 8 HOH 284 884  746  HOH HOH A . 
K 8 HOH 285 885  901  HOH HOH A . 
K 8 HOH 286 886  829  HOH HOH A . 
K 8 HOH 287 887  964  HOH HOH A . 
K 8 HOH 288 888  976  HOH HOH A . 
K 8 HOH 289 889  641  HOH HOH A . 
K 8 HOH 290 890  804  HOH HOH A . 
K 8 HOH 291 891  854  HOH HOH A . 
K 8 HOH 292 892  869  HOH HOH A . 
K 8 HOH 293 893  916  HOH HOH A . 
K 8 HOH 294 894  734  HOH HOH A . 
K 8 HOH 295 895  942  HOH HOH A . 
K 8 HOH 296 896  124  HOH HOH A . 
K 8 HOH 297 897  932  HOH HOH A . 
K 8 HOH 298 898  777  HOH HOH A . 
K 8 HOH 299 899  933  HOH HOH A . 
K 8 HOH 300 900  941  HOH HOH A . 
K 8 HOH 301 901  892  HOH HOH A . 
K 8 HOH 302 902  711  HOH HOH A . 
K 8 HOH 303 903  929  HOH HOH A . 
K 8 HOH 304 904  915  HOH HOH A . 
K 8 HOH 305 905  816  HOH HOH A . 
K 8 HOH 306 906  787  HOH HOH A . 
K 8 HOH 307 907  930  HOH HOH A . 
K 8 HOH 308 908  938  HOH HOH A . 
K 8 HOH 309 909  902  HOH HOH A . 
K 8 HOH 310 910  928  HOH HOH A . 
K 8 HOH 311 911  716  HOH HOH A . 
K 8 HOH 312 912  753  HOH HOH A . 
K 8 HOH 313 913  216  HOH HOH A . 
K 8 HOH 314 914  861  HOH HOH A . 
K 8 HOH 315 915  756  HOH HOH A . 
K 8 HOH 316 916  920  HOH HOH A . 
K 8 HOH 317 917  802  HOH HOH A . 
K 8 HOH 318 918  963  HOH HOH A . 
K 8 HOH 319 919  960  HOH HOH A . 
K 8 HOH 320 920  910  HOH HOH A . 
K 8 HOH 321 921  765  HOH HOH A . 
K 8 HOH 322 922  909  HOH HOH A . 
K 8 HOH 323 923  690  HOH HOH A . 
K 8 HOH 324 924  931  HOH HOH A . 
K 8 HOH 325 925  907  HOH HOH A . 
K 8 HOH 326 926  970  HOH HOH A . 
K 8 HOH 327 927  812  HOH HOH A . 
K 8 HOH 328 928  997  HOH HOH A . 
K 8 HOH 329 929  1003 HOH HOH A . 
K 8 HOH 330 930  996  HOH HOH A . 
K 8 HOH 331 931  993  HOH HOH A . 
K 8 HOH 332 932  989  HOH HOH A . 
K 8 HOH 333 933  836  HOH HOH A . 
K 8 HOH 334 934  770  HOH HOH A . 
K 8 HOH 335 935  1000 HOH HOH A . 
K 8 HOH 336 936  965  HOH HOH A . 
K 8 HOH 337 937  971  HOH HOH A . 
K 8 HOH 338 938  798  HOH HOH A . 
K 8 HOH 339 939  860  HOH HOH A . 
K 8 HOH 340 940  821  HOH HOH A . 
K 8 HOH 341 941  764  HOH HOH A . 
K 8 HOH 342 942  943  HOH HOH A . 
K 8 HOH 343 943  208  HOH HOH A . 
K 8 HOH 344 944  866  HOH HOH A . 
K 8 HOH 345 945  937  HOH HOH A . 
K 8 HOH 346 946  878  HOH HOH A . 
K 8 HOH 347 947  983  HOH HOH A . 
K 8 HOH 348 948  693  HOH HOH A . 
K 8 HOH 349 949  952  HOH HOH A . 
K 8 HOH 350 950  957  HOH HOH A . 
K 8 HOH 351 951  981  HOH HOH A . 
K 8 HOH 352 952  903  HOH HOH A . 
K 8 HOH 353 953  978  HOH HOH A . 
K 8 HOH 354 954  698  HOH HOH A . 
K 8 HOH 355 955  897  HOH HOH A . 
K 8 HOH 356 956  751  HOH HOH A . 
K 8 HOH 357 957  837  HOH HOH A . 
K 8 HOH 358 958  908  HOH HOH A . 
K 8 HOH 359 959  947  HOH HOH A . 
K 8 HOH 360 960  874  HOH HOH A . 
K 8 HOH 361 961  924  HOH HOH A . 
K 8 HOH 362 962  953  HOH HOH A . 
K 8 HOH 363 963  893  HOH HOH A . 
K 8 HOH 364 964  726  HOH HOH A . 
K 8 HOH 365 965  974  HOH HOH A . 
K 8 HOH 366 966  922  HOH HOH A . 
K 8 HOH 367 967  876  HOH HOH A . 
K 8 HOH 368 968  898  HOH HOH A . 
K 8 HOH 369 969  823  HOH HOH A . 
K 8 HOH 370 970  748  HOH HOH A . 
K 8 HOH 371 971  887  HOH HOH A . 
K 8 HOH 372 972  945  HOH HOH A . 
K 8 HOH 373 973  955  HOH HOH A . 
K 8 HOH 374 974  795  HOH HOH A . 
K 8 HOH 375 975  697  HOH HOH A . 
K 8 HOH 376 976  664  HOH HOH A . 
K 8 HOH 377 977  905  HOH HOH A . 
K 8 HOH 378 978  961  HOH HOH A . 
K 8 HOH 379 979  985  HOH HOH A . 
K 8 HOH 380 980  839  HOH HOH A . 
K 8 HOH 381 981  696  HOH HOH A . 
K 8 HOH 382 982  962  HOH HOH A . 
K 8 HOH 383 983  880  HOH HOH A . 
K 8 HOH 384 984  738  HOH HOH A . 
K 8 HOH 385 985  895  HOH HOH A . 
K 8 HOH 386 986  948  HOH HOH A . 
K 8 HOH 387 987  883  HOH HOH A . 
K 8 HOH 388 988  959  HOH HOH A . 
K 8 HOH 389 989  954  HOH HOH A . 
K 8 HOH 390 990  982  HOH HOH A . 
K 8 HOH 391 991  987  HOH HOH A . 
K 8 HOH 392 992  851  HOH HOH A . 
K 8 HOH 393 993  691  HOH HOH A . 
K 8 HOH 394 994  911  HOH HOH A . 
K 8 HOH 395 995  940  HOH HOH A . 
K 8 HOH 396 996  700  HOH HOH A . 
K 8 HOH 397 997  879  HOH HOH A . 
K 8 HOH 398 998  845  HOH HOH A . 
K 8 HOH 399 999  918  HOH HOH A . 
K 8 HOH 400 1000 986  HOH HOH A . 
K 8 HOH 401 1001 864  HOH HOH A . 
L 8 HOH 1   101  109  HOH HOH T . 
L 8 HOH 2   102  136  HOH HOH T . 
L 8 HOH 3   103  120  HOH HOH T . 
L 8 HOH 4   104  110  HOH HOH T . 
L 8 HOH 5   105  125  HOH HOH T . 
L 8 HOH 6   106  115  HOH HOH T . 
L 8 HOH 7   107  103  HOH HOH T . 
L 8 HOH 8   108  122  HOH HOH T . 
L 8 HOH 9   109  108  HOH HOH T . 
L 8 HOH 10  110  106  HOH HOH T . 
L 8 HOH 11  111  123  HOH HOH T . 
L 8 HOH 12  112  128  HOH HOH T . 
L 8 HOH 13  113  116  HOH HOH T . 
L 8 HOH 14  114  102  HOH HOH T . 
L 8 HOH 15  115  111  HOH HOH T . 
L 8 HOH 16  116  791  HOH HOH T . 
L 8 HOH 17  117  119  HOH HOH T . 
L 8 HOH 18  118  130  HOH HOH T . 
L 8 HOH 19  119  114  HOH HOH T . 
L 8 HOH 20  120  126  HOH HOH T . 
L 8 HOH 21  121  132  HOH HOH T . 
L 8 HOH 22  122  135  HOH HOH T . 
L 8 HOH 23  123  676  HOH HOH T . 
L 8 HOH 24  124  127  HOH HOH T . 
L 8 HOH 25  125  101  HOH HOH T . 
L 8 HOH 26  126  104  HOH HOH T . 
L 8 HOH 27  127  117  HOH HOH T . 
L 8 HOH 28  128  113  HOH HOH T . 
L 8 HOH 29  129  112  HOH HOH T . 
L 8 HOH 30  130  121  HOH HOH T . 
L 8 HOH 31  131  118  HOH HOH T . 
L 8 HOH 32  132  134  HOH HOH T . 
L 8 HOH 33  133  129  HOH HOH T . 
L 8 HOH 34  134  828  HOH HOH T . 
L 8 HOH 35  135  832  HOH HOH T . 
L 8 HOH 36  136  131  HOH HOH T . 
L 8 HOH 37  137  871  HOH HOH T . 
M 8 HOH 1   101  215  HOH HOH P . 
M 8 HOH 2   102  1    HOH HOH P . 
M 8 HOH 3   103  211  HOH HOH P . 
M 8 HOH 4   104  217  HOH HOH P . 
M 8 HOH 5   105  222  HOH HOH P . 
M 8 HOH 6   106  221  HOH HOH P . 
M 8 HOH 7   107  604  HOH HOH P . 
M 8 HOH 8   108  212  HOH HOH P . 
M 8 HOH 9   109  201  HOH HOH P . 
M 8 HOH 10  110  204  HOH HOH P . 
M 8 HOH 11  111  203  HOH HOH P . 
M 8 HOH 12  112  210  HOH HOH P . 
M 8 HOH 13  113  220  HOH HOH P . 
M 8 HOH 14  114  218  HOH HOH P . 
M 8 HOH 15  115  214  HOH HOH P . 
M 8 HOH 16  116  202  HOH HOH P . 
M 8 HOH 17  117  205  HOH HOH P . 
M 8 HOH 18  118  224  HOH HOH P . 
M 8 HOH 19  119  219  HOH HOH P . 
M 8 HOH 20  120  223  HOH HOH P . 
M 8 HOH 21  121  213  HOH HOH P . 
M 8 HOH 22  122  207  HOH HOH P . 
M 8 HOH 23  123  206  HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6760  ? 
1 MORE         -49   ? 
1 'SSA (A^2)'  21830 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 81.4  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 100.9 ? 
3  O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 82.9  ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C AS  9   ? P AS  9   ? 1_555 99.9  ? 
5  O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C AS  9   ? P AS  9   ? 1_555 171.9 ? 
6  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C AS  9   ? P AS  9   ? 1_555 89.0  ? 
7  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 93.1  ? 
8  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 92.0  ? 
9  OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 94.3  ? 
10 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 175.2 ? 
11 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 86.8  ? 
12 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 83.2  ? 
13 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 168.4 ? 
14 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 93.6  ? 
15 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 96.9  ? 
16 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 15.8  ? 
17 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C AS  9   ? P AS  9   ? 1_555 102.6 ? 
18 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C AS  9   ? P AS  9   ? 1_555 93.8  ? 
19 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C AS  9   ? P AS  9   ? 1_555 162.9 ? 
20 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C AS  9   ? P AS  9   ? 1_555 82.2  ? 
21 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C AS  9   ? P AS  9   ? 1_555 67.6  ? 
22 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? P HOH 107 ? 1_555 86.1  ? 
23 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? P HOH 107 ? 1_555 173.3 ? 
24 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? P HOH 107 ? 1_555 92.4  ? 
25 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? P HOH 107 ? 1_555 94.5  ? 
26 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? P HOH 107 ? 1_555 86.1  ? 
27 OP1   B C AS  9   ? P AS  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? M HOH .   ? P HOH 107 ? 1_555 79.8  ? 
28 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   A I STP .   ? A STP 506 ? 1_555 100.0 ? 
29 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   A I STP .   ? A STP 506 ? 1_555 94.4  ? 
30 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   A I STP .   ? A STP 506 ? 1_555 164.7 ? 
31 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   A I STP .   ? A STP 506 ? 1_555 84.8  ? 
32 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   A I STP .   ? A STP 506 ? 1_555 70.1  ? 
33 OP1   B C AS  9   ? P AS  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   A I STP .   ? A STP 506 ? 1_555 2.6   ? 
34 O     ? M HOH .   ? P HOH 107 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O2A   A I STP .   ? A STP 506 ? 1_555 79.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2017-09-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support    
2 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization'  
2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .        1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG1 A THR 3   ? ? OE1 A GLN 5   ? ? 1.86 
2 1 N   A GLY -2  ? ? O   A HOH 602 ? ? 1.98 
3 1 OG  A SER 409 ? ? O   A ILE 411 ? ? 2.02 
4 1 O   A HOH 848 ? ? O   A HOH 910 ? ? 2.07 
5 1 O   A HOH 603 ? ? O   A HOH 892 ? ? 2.07 
6 1 OP1 T DC  11  ? ? O   T HOH 101 ? ? 2.11 
7 1 O   A HOH 678 ? ? O   A HOH 828 ? ? 2.14 
8 1 NE2 A HIS 240 ? ? O   A HOH 603 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 752 ? ? 1_555 O A HOH 910 ? ? 5_554 2.09 
2 1 O A HOH 884 ? ? 1_555 O A HOH 886 ? ? 5_664 2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" T DA 2 ? ? P T DT 3 ? B 1.531 1.607 -0.076 0.012 Y 
2 1 "O3'" T DT 3 ? B P T DT 4 ? B 1.535 1.607 -0.072 0.012 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 39.13   56.38   
2 1 TYR A 39  ? ? 65.58   -177.24 
3 1 LYS A 40  ? ? -155.15 -34.26  
4 1 GLN A 133 ? ? 86.94   9.48    
5 1 SER A 257 ? ? 93.17   -9.71   
6 1 LYS A 376 ? ? 61.78   -118.02 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASP A 375 ? ? LYS A 376 ? ? 118.92  
2 1 LYS A 376 ? ? ARG A 377 ? ? -136.11 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KFR 'double helix'        
5KFR 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 4  1_555 C AS 9 1_555 -0.088 -0.274 0.383  -7.099 -7.217  2.744 1 T_DT4:AS9_P  T 4  ? P 9 ? 20 1 
1 B DA 5  1_555 C DT 8 1_555 -0.003 -0.094 0.108  -2.842 -10.243 6.724 2 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.023  -0.068 0.370  -3.416 -16.182 4.287 3 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.120 -0.087 -0.430 -6.816 -4.080  0.791 4 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.268  -0.192 -0.012 3.842  -4.221  0.304 5 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.255  -0.228 -0.396 10.921 -10.398 3.235 6 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.266 -0.308 -0.093 0.171  -7.736  3.330 7 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 -0.028 -0.122 0.098  -5.459 -6.781  0.307 8 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 0.037  -0.173 -0.120 14.306 0.312   2.813 9 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 4  1_555 C AS 9 1_555 B DA 5  1_555 C DT 8 1_555 0.504  0.016  3.343 -0.158 7.279 36.756 -0.952 -0.807 3.285 11.405 0.248   
37.446 1 TT_DT4DA5:DT8AS9_PP   T 4  ? P 9 ? T 5  ? P 8 ? 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.775  -0.960 3.447 -2.523 0.936 26.638 -2.325 -2.353 3.326 2.026  5.458   
26.771 2 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.405 -0.984 3.381 7.050  8.849 29.682 -3.396 2.012  2.812 16.536 -13.174 
31.720 3 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.566 -0.355 3.107 -3.393 2.558 34.747 -0.958 0.453  3.114 4.264  5.655   
34.998 4 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.417  -0.636 3.241 4.083  0.591 30.308 -1.322 0.016  3.255 1.123  -7.764  
30.581 5 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.345 -0.242 3.697 -4.696 5.829 35.275 -1.327 -0.197 3.627 9.486  7.643   
36.036 6 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.406 -0.666 3.483 -1.608 1.910 35.672 -1.377 0.414  3.458 3.114  2.621   
35.756 7 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.321  0.091  3.032 -0.474 2.494 28.033 -0.355 -0.763 3.022 5.136  0.977   
28.145 8 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Intramural DK036146-08' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION'                          MN  
5 GLYCEROL                                      GOL 
6 
;2'-DEOXYADENOSINE 5'-O-(1-THIOTRIPHOSPHATE)
;
STP 
7 DIPHOSPHATE                                   DPO 
8 water                                         HOH 
#