data_5KFU
# 
_entry.id   5KFU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KFU         
WWPDB D_1000222137 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5KFA PDB . 
unspecified 5KFB PDB . 
unspecified 5KFC PDB . 
unspecified 5KG0 PDB . 
unspecified 5KG1 PDB . 
unspecified 5KG2 PDB . 
unspecified 5KG3 PDB . 
unspecified 5KG4 PDB . 
unspecified 5KG5 PDB . 
unspecified 5KG6 PDB . 
unspecified 5KG7 PDB . 
unspecified 5KFD PDB . 
unspecified 5KFE PDB . 
unspecified 5KFS PDB . 
unspecified 5KFT PDB . 
unspecified 5KFV PDB . 
unspecified 5KFW PDB . 
unspecified 5KFX PDB . 
unspecified 5KFG PDB . 
unspecified 5KFY PDB . 
unspecified 5KFZ PDB . 
unspecified 5KFH PDB . 
unspecified 5KFK PDB . 
unspecified 5KFL PDB . 
unspecified 5KFI PDB . 
unspecified 5KFJ PDB . 
unspecified 5KFM PDB . 
unspecified 5KFN PDB . 
unspecified 5KFO PDB . 
unspecified 5KFP PDB . 
unspecified 5KFQ PDB . 
unspecified 5KFR PDB . 
unspecified 5KFF PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KFU 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gao, Y.'  1 ? 
primary 'Yang, W.' 2 ? 
# 
_cell.entry_id           5KFU 
_cell.length_a           98.350 
_cell.length_b           98.350 
_cell.length_c           81.940 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5KFU 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48531.590 1   2.7.7.7 R61A ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ?    ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ?    ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    2   ?       ?    ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ?    ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ?    ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ?    ? ? 
8 non-polymer syn 'POTASSIUM ION'                                      39.098    1   ?       ?    ? ? 
9 water       nat water                                                18.015    433 ?       ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTASMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTASMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ALA n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' ? 9606 ? 
3 1 sample 1 8  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5KFU       5KFU   ? 2 ? 1 
3 PDB 5KFU       5KFU   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KFU A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5KFU T 1 ? 12  ? 5KFU   1 ? 12  ? 1 12  
3 3 5KFU P 1 ? 8   ? 5KFU   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KFU GLY A 1  ? UNP Q9Y253 ?   ?  'expression tag'      -2 1 
1 5KFU PRO A 2  ? UNP Q9Y253 ?   ?  'expression tag'      -1 2 
1 5KFU HIS A 3  ? UNP Q9Y253 ?   ?  'expression tag'      0  3 
1 5KFU ALA A 64 ? UNP Q9Y253 ARG 61 'engineered mutation' 61 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'                      ?                               'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KFU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.09 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.21 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5KFU 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.550 
_reflns.number_obs                   65178 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.05500 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.9500 
_reflns.B_iso_Wilson_estimate        24.93 
_reflns.pdbx_redundancy              7.600 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.55 
_reflns_shell.d_res_low              1.59 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.78400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.670 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5KFU 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     65167 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.370 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.92 
_refine.ls_d_res_high                            1.55 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.184 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.181 
_refine.ls_R_factor_R_free                       0.211 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.780 
_refine.ls_number_reflns_R_free                  5069 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               23.74 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4ECQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.170 
_refine.pdbx_overall_phase_error                 20.610 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3360 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             433 
_refine_hist.number_atoms_total               4226 
_refine_hist.d_res_high                       1.55 
_refine_hist.d_res_low                        19.92 
# 
_struct.entry_id                     5KFU 
_struct.title                        'Human DNA polymerase eta R61A-DNA ternary complex: reaction with 1 mM Mg2+ for 80s' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KFU 
_struct_keywords.text            
'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, REPLICATION, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   'REPLICATION, TRANSFERASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 9 ? 
L N N 9 ? 
M N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 AB2 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P12 AB3 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P13 AB4 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P14 AB5 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P15 AB6 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P16 AB7 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P17 AB8 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 AB9 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 AC1 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 AC2 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   A ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc2  metalc ? ? A ASP 16  OD1   B ? ? 1_555 F MG  . MG  B ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.376 ? 
metalc3  metalc ? ? A ASP 16  OD1   B ? ? 1_555 J K   . K   B ? A ASP 13  A K   507 1_555 ? ? ? ? ? ? ?            3.106 ? 
metalc4  metalc ? ? A ASP 16  OD2   A ? ? 1_555 D MG  . MG  A ? A ASP 13  A MG  501 1_555 ? ? ? ? ? ? ?            2.232 ? 
metalc5  metalc ? ? A ASP 16  OD2   A ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            3.014 ? 
metalc6  metalc ? ? A ASP 16  OD2   B ? ? 1_555 J K   . K   B ? A ASP 13  A K   507 1_555 ? ? ? ? ? ? ?            3.127 ? 
metalc7  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.325 ? 
metalc8  metalc ? ? A MET 17  O     ? ? ? 1_555 F MG  . MG  B ? A MET 14  A MG  503 1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc9  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 D MG  . MG  A ? A ASP 115 A MG  501 1_555 ? ? ? ? ? ? ?            2.374 ? 
metalc10 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 J K   . K   B ? A ASP 115 A K   507 1_555 ? ? ? ? ? ? ?            2.374 ? 
metalc11 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc12 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 F MG  . MG  B ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc13 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MG  . MG  A ? A GLU 116 A MG  501 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc14 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 J K   . K   B ? A GLU 116 A K   507 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc15 metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D MG  . MG  A ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc16 metalc ? ? C DT  8   "O3'" ? ? ? 1_555 J K   . K   B ? P DT  8   A K   507 1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc17 metalc ? ? D MG  .   MG    A ? ? 1_555 K HOH . O   ? ? A MG  501 A HOH 819 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc18 metalc ? ? D MG  .   MG    A ? ? 1_555 I DTP . O1A ? ? A MG  501 A DTP 506 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc19 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1B ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.283 ? 
metalc20 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1A ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc21 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1G ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc22 metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O1B ? ? A MG  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.282 ? 
metalc23 metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O1A ? ? A MG  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc24 metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O1G ? ? A MG  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.220 ? 
metalc25 metalc ? ? I DTP .   O1A   ? ? ? 1_555 J K   . K   B ? A DTP 506 A K   507 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc26 metalc ? ? J K   .   K     B ? ? 1_555 K HOH . O   ? ? A K   507 A HOH 819 1_555 ? ? ? ? ? ? ?            2.348 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.92   
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -1.97  
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -10.79 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  501 ? 8  'binding site for residue MG A 501'  
AC2 Software A CA  502 ? 6  'binding site for residue CA A 502'  
AC3 Software A MG  503 ? 6  'binding site for residue MG A 503'  
AC4 Software A GOL 504 ? 8  'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 10 'binding site for residue GOL A 505' 
AC6 Software A DTP 506 ? 27 'binding site for residue DTP A 506' 
AC7 Software A K   507 ? 8  'binding site for residue K A 507'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4  AC1 8  CA  E .   ? CA  A 502 . ? 1_555 ? 
5  AC1 8  MG  F .   ? MG  A 503 . ? 1_555 ? 
6  AC1 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
7  AC1 8  HOH K .   ? HOH A 819 . ? 1_555 ? 
8  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
9  AC2 6  ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 6  MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 6  ASP A 118 ? ASP A 115 . ? 1_555 ? 
12 AC2 6  MG  D .   ? MG  A 501 . ? 1_555 ? 
13 AC2 6  DTP I .   ? DTP A 506 . ? 1_555 ? 
14 AC2 6  K   J .   ? K   A 507 . ? 1_555 ? 
15 AC3 6  ASP A 16  ? ASP A 13  . ? 1_555 ? 
16 AC3 6  MET A 17  ? MET A 14  . ? 1_555 ? 
17 AC3 6  ASP A 118 ? ASP A 115 . ? 1_555 ? 
18 AC3 6  MG  D .   ? MG  A 501 . ? 1_555 ? 
19 AC3 6  DTP I .   ? DTP A 506 . ? 1_555 ? 
20 AC3 6  K   J .   ? K   A 507 . ? 1_555 ? 
21 AC4 8  ARG A 27  ? ARG A 24  . ? 6_545 ? 
22 AC4 8  GLN A 28  ? GLN A 25  . ? 6_545 ? 
23 AC4 8  PRO A 247 ? PRO A 244 . ? 1_555 ? 
24 AC4 8  SER A 251 ? SER A 248 . ? 1_555 ? 
25 AC4 8  GLY A 279 ? GLY A 276 . ? 1_555 ? 
26 AC4 8  HOH K .   ? HOH A 645 . ? 1_555 ? 
27 AC4 8  HOH K .   ? HOH A 695 . ? 1_555 ? 
28 AC4 8  HOH K .   ? HOH A 703 . ? 1_555 ? 
29 AC5 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
30 AC5 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
31 AC5 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
32 AC5 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
33 AC5 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
34 AC5 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
35 AC5 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
36 AC5 10 HOH K .   ? HOH A 618 . ? 1_555 ? 
37 AC5 10 HOH K .   ? HOH A 632 . ? 5_664 ? 
38 AC5 10 HOH K .   ? HOH A 731 . ? 5_664 ? 
39 AC6 27 ASP A 16  ? ASP A 13  . ? 1_555 ? 
40 AC6 27 MET A 17  ? MET A 14  . ? 1_555 ? 
41 AC6 27 ASP A 18  ? ASP A 15  . ? 1_555 ? 
42 AC6 27 CYS A 19  ? CYS A 16  . ? 1_555 ? 
43 AC6 27 PHE A 20  ? PHE A 17  . ? 1_555 ? 
44 AC6 27 PHE A 21  ? PHE A 18  . ? 1_555 ? 
45 AC6 27 ILE A 51  ? ILE A 48  . ? 1_555 ? 
46 AC6 27 ALA A 52  ? ALA A 49  . ? 1_555 ? 
47 AC6 27 TYR A 55  ? TYR A 52  . ? 1_555 ? 
48 AC6 27 ARG A 58  ? ARG A 55  . ? 1_555 ? 
49 AC6 27 ASP A 118 ? ASP A 115 . ? 1_555 ? 
50 AC6 27 LYS A 234 ? LYS A 231 . ? 1_555 ? 
51 AC6 27 MG  D .   ? MG  A 501 . ? 1_555 ? 
52 AC6 27 CA  E .   ? CA  A 502 . ? 1_555 ? 
53 AC6 27 MG  F .   ? MG  A 503 . ? 1_555 ? 
54 AC6 27 K   J .   ? K   A 507 . ? 1_555 ? 
55 AC6 27 HOH K .   ? HOH A 657 . ? 1_555 ? 
56 AC6 27 HOH K .   ? HOH A 680 . ? 1_555 ? 
57 AC6 27 HOH K .   ? HOH A 736 . ? 1_555 ? 
58 AC6 27 HOH K .   ? HOH A 753 . ? 1_555 ? 
59 AC6 27 HOH K .   ? HOH A 767 . ? 1_555 ? 
60 AC6 27 HOH K .   ? HOH A 819 . ? 1_555 ? 
61 AC6 27 DT  C 8   ? DT  P 8   . ? 1_555 ? 
62 AC6 27 HOH M .   ? HOH P 103 . ? 1_555 ? 
63 AC6 27 DT  B 3   ? DT  T 3   . ? 1_555 ? 
64 AC6 27 DT  B 4   ? DT  T 4   . ? 1_555 ? 
65 AC6 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
66 AC7 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
67 AC7 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
68 AC7 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
69 AC7 8  CA  E .   ? CA  A 502 . ? 1_555 ? 
70 AC7 8  MG  F .   ? MG  A 503 . ? 1_555 ? 
71 AC7 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
72 AC7 8  HOH K .   ? HOH A 819 . ? 1_555 ? 
73 AC7 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KFU 
_atom_sites.fract_transf_matrix[1][1]   0.010168 
_atom_sites.fract_transf_matrix[1][2]   0.005870 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011741 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012204 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
K  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.604 -33.999 -3.463  1.00 46.68 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.022 -33.735 -3.640  1.00 43.75 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.324 -32.795 -4.794  1.00 44.50 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.006 -31.605 -4.726  1.00 49.38 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 67.942 -33.327 -5.863  1.00 44.90 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.359 -32.575 -7.057  1.00 44.46 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.192 -32.061 -7.906  1.00 47.72 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.358 -31.100 -8.662  1.00 52.06 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.188 -33.602 -7.841  1.00 41.24 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.669 -34.929 -7.396  1.00 40.52 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.316 -34.751 -5.949  1.00 42.15 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.028 -32.691 -7.782  1.00 42.09 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 64.854 -32.291 -8.557  1.00 43.69 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 63.903 -31.440 -7.721  1.00 44.57 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 62.837 -31.038 -8.194  1.00 44.24 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.120 -33.524 -9.090  1.00 37.55 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.029 -34.535 -9.716  1.00 31.60 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.743 -34.284 -10.869 1.00 32.14 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.350 -35.795 -9.340  1.00 28.41 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.462 -35.349 -11.179 1.00 30.28 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.242 -36.279 -10.268 1.00 30.27 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.290 -31.171 -6.477  1.00 45.49 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.452 -30.393 -5.571  1.00 50.21 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.678 -28.902 -5.791  1.00 43.15 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.693 -28.350 -5.364  1.00 45.96 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.735 -30.768 -4.112  1.00 53.83 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.865 -31.906 -3.589  1.00 58.33 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 62.478 -31.792 -1.827  1.00 75.34 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 64.016 -31.129 -1.187  1.00 53.01 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.730 -28.263 -6.473  1.00 48.51 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.801 -26.829 -6.732  1.00 44.19 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 62.836 -26.065 -5.418  1.00 40.14 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.169 -26.435 -4.452  1.00 39.84 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.630 -26.371 -7.587  1.00 39.99 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.633 -25.005 -5.384  1.00 30.57 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 63.886 -24.282 -4.144  1.00 27.55 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.396 -22.840 -4.207  1.00 20.50 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.608 -22.071 -3.272  1.00 21.69 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.372 -24.281 -3.808  1.00 29.29 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.094 -23.663 -4.885  1.00 25.38 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 65.870 -25.708 -3.596  1.00 27.29 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.746 -22.484 -5.313  1.00 22.02 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.164 -21.157 -5.468  1.00 22.99 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.201 -20.051 -5.390  1.00 21.80 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 62.980 -19.018 -4.743  1.00 21.55 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.341 -20.272 -6.038  1.00 19.09 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.454 -19.335 -5.961  1.00 15.24 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 65.787 -18.774 -7.333  1.00 14.92 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 66.881 -18.264 -7.550  1.00 17.51 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.689 -20.011 -5.362  1.00 17.87 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.629 -20.214 -3.849  1.00 19.69 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 67.857 -20.942 -3.327  1.00 18.48 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.688 -20.382 -2.595  1.00 22.75 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 67.985 -22.197 -3.709  1.00 19.12 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 64.807 -18.861 -8.225  1.00 18.78 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 64.942 -18.512 -9.633  1.00 22.15 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 64.898 -17.008 -9.895  1.00 18.60 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.449 -16.534 -10.879 1.00 21.23 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 63.831 -19.206 -10.444 1.00 23.76 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.438 -19.095 -9.780  1.00 28.98 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.295 -19.441 -8.583  1.00 31.20 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.471 -18.656 -10.455 1.00 35.75 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.233 -16.263 -9.020  1.00 16.98 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.051 -14.824 -9.229  1.00 16.58 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.695 -13.978 -8.145  1.00 14.67 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 64.920 -14.451 -7.033  1.00 16.05 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.561 -14.466 -9.272  1.00 12.13 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 61.775 -15.087 -10.411 1.00 15.71 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.293 -14.729 -10.304 1.00 14.94 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.652 -15.356 -9.149  1.00 14.93 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.590 -14.857 -8.517  1.00 14.81 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.068 -15.498 -7.476  1.00 14.22 ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.053 -13.702 -8.909  1.00 15.15 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 64.954 -12.710 -8.463  1.00 13.20 ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.242 -11.723 -7.426  1.00 10.55 ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.105 -10.708 -7.426  1.00 13.48 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 63.869 -10.074 -8.441  1.00 14.02 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.571 -10.993 -7.642  1.00 12.79 ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 66.823 -10.004 -6.515  1.00 14.82 ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 67.708 -12.003 -7.712  1.00 13.76 ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.403 -10.580 -6.300  1.00 10.89 ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.228 -9.705  -6.205  1.00 11.06 ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.441 -8.742  -5.054  1.00 10.96 ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 62.894 -9.146  -3.976  1.00 11.27 ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 60.933 -10.496 -5.983  1.00 9.49  ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 59.738 -9.559  -5.756  1.00 12.33 ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.651 -11.406 -7.188  1.00 11.34 ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.147 -7.467  -5.272  1.00 10.38 ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.196 -6.514  -4.168  1.00 10.17 ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 60.841 -5.903  -3.954  1.00 10.05 ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.015 -5.871  -4.869  1.00 11.41 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.240 -5.425  -4.418  1.00 11.28 ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.621 -5.434  -2.733  1.00 8.39  ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.435 -4.667  -2.402  1.00 9.72  ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 59.924 -3.379  -1.779  1.00 12.36 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.657 -3.412  -0.787  1.00 11.61 ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.503 -5.438  -1.464  1.00 13.15 ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.176 -4.826  -0.979  1.00 14.46 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.358 -3.885  0.225   1.00 13.17 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.406 -4.124  -2.129  1.00 10.93 ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.549 -2.254  -2.381  1.00 9.98  ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 59.911 -0.945  -1.849  1.00 11.12 ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.674 -0.298  -1.260  1.00 12.23 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.650 -0.225  -1.924  1.00 13.36 ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.494 -0.041  -2.940  1.00 11.50 ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 60.867 1.332   -2.356  1.00 12.45 ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.686 -0.722  -3.589  1.00 14.60 ? 12  VAL A CG2   1 
ATOM   108  N  N     A ASP A 1 16  ? 58.757 0.126   -0.008  0.90 11.33 ? 13  ASP A N     1 
ATOM   109  N  N     B ASP A 1 16  ? 58.857 0.126   -0.008  0.10 11.47 ? 13  ASP A N     1 
ATOM   110  C  CA    A ASP A 1 16  ? 57.642 0.720   0.683   0.90 13.91 ? 13  ASP A CA    1 
ATOM   111  C  CA    B ASP A 1 16  ? 57.742 0.720   0.683   0.10 13.81 ? 13  ASP A CA    1 
ATOM   112  C  C     A ASP A 1 16  ? 58.009 2.042   1.354   0.90 11.19 ? 13  ASP A C     1 
ATOM   113  C  C     B ASP A 1 16  ? 58.109 2.042   1.354   0.10 11.37 ? 13  ASP A C     1 
ATOM   114  O  O     A ASP A 1 16  ? 58.864 2.073   2.156   0.90 12.14 ? 13  ASP A O     1 
ATOM   115  O  O     B ASP A 1 16  ? 58.964 2.073   2.156   0.10 12.18 ? 13  ASP A O     1 
ATOM   116  C  CB    A ASP A 1 16  ? 57.117 -0.188  1.754   0.90 12.86 ? 13  ASP A CB    1 
ATOM   117  C  CB    B ASP A 1 16  ? 57.217 -0.188  1.754   0.10 13.06 ? 13  ASP A CB    1 
ATOM   118  C  CG    A ASP A 1 16  ? 55.923 0.388   2.453   0.90 17.17 ? 13  ASP A CG    1 
ATOM   119  C  CG    B ASP A 1 16  ? 55.996 0.368   2.423   0.10 17.07 ? 13  ASP A CG    1 
ATOM   120  O  OD1   A ASP A 1 16  ? 56.060 0.937   3.420   0.90 20.47 ? 13  ASP A OD1   1 
ATOM   121  O  OD1   B ASP A 1 16  ? 55.580 1.351   2.084   0.10 15.15 ? 13  ASP A OD1   1 
ATOM   122  O  OD2   A ASP A 1 16  ? 54.883 0.259   2.006   0.90 24.21 ? 13  ASP A OD2   1 
ATOM   123  O  OD2   B ASP A 1 16  ? 55.503 -0.204  3.276   0.10 18.02 ? 13  ASP A OD2   1 
ATOM   124  N  N     . MET A 1 17  ? 57.311 3.080   1.012   1.00 11.08 ? 14  MET A N     1 
ATOM   125  C  CA    . MET A 1 17  ? 57.700 4.367   1.559   1.00 11.85 ? 14  MET A CA    1 
ATOM   126  C  C     . MET A 1 17  ? 57.480 4.439   3.075   1.00 10.99 ? 14  MET A C     1 
ATOM   127  O  O     . MET A 1 17  ? 56.573 3.877   3.521   1.00 12.52 ? 14  MET A O     1 
ATOM   128  C  CB    . MET A 1 17  ? 56.912 5.482   0.893   1.00 12.33 ? 14  MET A CB    1 
ATOM   129  C  CG    . MET A 1 17  ? 56.955 5.499   -0.606  1.00 12.88 ? 14  MET A CG    1 
ATOM   130  S  SD    . MET A 1 17  ? 58.638 5.552   -1.338  1.00 13.98 ? 14  MET A SD    1 
ATOM   131  C  CE    . MET A 1 17  ? 59.217 7.167   -0.887  1.00 16.42 ? 14  MET A CE    1 
ATOM   132  N  N     . ASP A 1 18  ? 58.347 5.101   3.816   1.00 8.90  ? 15  ASP A N     1 
ATOM   133  C  CA    . ASP A 1 18  ? 58.142 5.212   5.234   1.00 8.85  ? 15  ASP A CA    1 
ATOM   134  C  C     . ASP A 1 18  ? 57.127 6.318   5.504   1.00 11.42 ? 15  ASP A C     1 
ATOM   135  O  O     . ASP A 1 18  ? 57.172 7.320   4.886   1.00 10.21 ? 15  ASP A O     1 
ATOM   136  C  CB    . ASP A 1 18  ? 59.420 5.618   5.890   1.00 11.21 ? 15  ASP A CB    1 
ATOM   137  C  CG    . ASP A 1 18  ? 60.531 4.595   5.738   1.00 12.94 ? 15  ASP A CG    1 
ATOM   138  O  OD1   . ASP A 1 18  ? 60.269 3.444   5.611   1.00 13.73 ? 15  ASP A OD1   1 
ATOM   139  O  OD2   . ASP A 1 18  ? 61.633 5.016   5.814   1.00 14.89 ? 15  ASP A OD2   1 
ATOM   140  N  N     . CYS A 1 19  ? 56.192 6.013   6.378   1.00 9.57  ? 16  CYS A N     1 
ATOM   141  C  CA    . CYS A 1 19  ? 55.185 6.964   6.873   1.00 8.86  ? 16  CYS A CA    1 
ATOM   142  C  C     . CYS A 1 19  ? 54.711 7.904   5.764   1.00 9.69  ? 16  CYS A C     1 
ATOM   143  O  O     . CYS A 1 19  ? 54.872 9.025   5.879   1.00 10.84 ? 16  CYS A O     1 
ATOM   144  C  CB    . CYS A 1 19  ? 55.506 7.642   8.195   1.00 11.45 ? 16  CYS A CB    1 
ATOM   145  S  SG    . CYS A 1 19  ? 57.032 8.552   8.280   1.00 13.42 ? 16  CYS A SG    1 
ATOM   146  N  N     . PHE A 1 20  ? 54.244 7.364   4.661   1.00 9.72  ? 17  PHE A N     1 
ATOM   147  C  CA    . PHE A 1 20  ? 54.266 8.111   3.413   1.00 8.57  ? 17  PHE A CA    1 
ATOM   148  C  C     . PHE A 1 20  ? 53.495 9.419   3.416   1.00 10.59 ? 17  PHE A C     1 
ATOM   149  O  O     . PHE A 1 20  ? 54.037 10.375  3.088   1.00 9.37  ? 17  PHE A O     1 
ATOM   150  C  CB    . PHE A 1 20  ? 53.677 7.229   2.300   1.00 9.52  ? 17  PHE A CB    1 
ATOM   151  C  CG    . PHE A 1 20  ? 53.726 7.836   0.932   1.00 9.16  ? 17  PHE A CG    1 
ATOM   152  C  CD1   . PHE A 1 20  ? 54.842 8.450   0.483   1.00 10.18 ? 17  PHE A CD1   1 
ATOM   153  C  CD2   . PHE A 1 20  ? 52.634 7.827   0.118   1.00 10.87 ? 17  PHE A CD2   1 
ATOM   154  C  CE1   . PHE A 1 20  ? 54.885 8.999   -0.767  1.00 13.26 ? 17  PHE A CE1   1 
ATOM   155  C  CE2   . PHE A 1 20  ? 52.679 8.402   -1.126  1.00 13.28 ? 17  PHE A CE2   1 
ATOM   156  C  CZ    . PHE A 1 20  ? 53.809 8.968   -1.561  1.00 11.33 ? 17  PHE A CZ    1 
ATOM   157  N  N     . PHE A 1 21  ? 52.265 9.440   3.864   1.00 8.43  ? 18  PHE A N     1 
ATOM   158  C  CA    . PHE A 1 21  ? 51.539 10.711  3.774   1.00 7.77  ? 18  PHE A CA    1 
ATOM   159  C  C     . PHE A 1 21  ? 52.200 11.753  4.677   1.00 10.71 ? 18  PHE A C     1 
ATOM   160  O  O     . PHE A 1 21  ? 52.162 12.939  4.389   1.00 11.16 ? 18  PHE A O     1 
ATOM   161  C  CB    . PHE A 1 21  ? 50.057 10.585  4.170   1.00 7.91  ? 18  PHE A CB    1 
ATOM   162  C  CG    . PHE A 1 21  ? 49.188 9.869   3.178   1.00 9.65  ? 18  PHE A CG    1 
ATOM   163  C  CD1   . PHE A 1 21  ? 49.713 9.115   2.128   1.00 8.51  ? 18  PHE A CD1   1 
ATOM   164  C  CD2   . PHE A 1 21  ? 47.806 9.951   3.310   1.00 10.67 ? 18  PHE A CD2   1 
ATOM   165  C  CE1   . PHE A 1 21  ? 48.864 8.458   1.231   1.00 11.17 ? 18  PHE A CE1   1 
ATOM   166  C  CE2   . PHE A 1 21  ? 46.950 9.294   2.415   1.00 10.32 ? 18  PHE A CE2   1 
ATOM   167  C  CZ    . PHE A 1 21  ? 47.490 8.542   1.377   1.00 12.14 ? 18  PHE A CZ    1 
ATOM   168  N  N     . VAL A 1 22  ? 52.789 11.314  5.794   1.00 8.68  ? 19  VAL A N     1 
ATOM   169  C  CA    . VAL A 1 22  ? 53.492 12.244  6.671   1.00 8.60  ? 19  VAL A CA    1 
ATOM   170  C  C     . VAL A 1 22  ? 54.701 12.841  5.950   1.00 9.44  ? 19  VAL A C     1 
ATOM   171  O  O     . VAL A 1 22  ? 54.942 14.054  6.008   1.00 10.10 ? 19  VAL A O     1 
ATOM   172  C  CB    . VAL A 1 22  ? 53.927 11.556  7.979   1.00 7.45  ? 19  VAL A CB    1 
ATOM   173  C  CG1   . VAL A 1 22  ? 55.002 12.377  8.705   1.00 11.49 ? 19  VAL A CG1   1 
ATOM   174  C  CG2   . VAL A 1 22  ? 52.712 11.337  8.886   1.00 12.32 ? 19  VAL A CG2   1 
ATOM   175  N  N     . GLN A 1 23  ? 55.466 12.010  5.251   1.00 9.34  ? 20  GLN A N     1 
ATOM   176  C  CA    . GLN A 1 23  ? 56.610 12.550  4.515   1.00 8.57  ? 20  GLN A CA    1 
ATOM   177  C  C     . GLN A 1 23  ? 56.196 13.540  3.446   1.00 9.78  ? 20  GLN A C     1 
ATOM   178  O  O     . GLN A 1 23  ? 56.909 14.527  3.205   1.00 10.96 ? 20  GLN A O     1 
ATOM   179  C  CB    . GLN A 1 23  ? 57.413 11.448  3.856   1.00 11.05 ? 20  GLN A CB    1 
ATOM   180  C  CG    . GLN A 1 23  ? 58.256 10.642  4.812   1.00 13.28 ? 20  GLN A CG    1 
ATOM   181  C  CD    . GLN A 1 23  ? 59.327 9.934   4.026   1.00 13.55 ? 20  GLN A CD    1 
ATOM   182  O  OE1   . GLN A 1 23  ? 60.389 10.501  3.782   1.00 13.82 ? 20  GLN A OE1   1 
ATOM   183  N  NE2   . GLN A 1 23  ? 59.044 8.707   3.589   1.00 16.01 ? 20  GLN A NE2   1 
ATOM   184  N  N     . VAL A 1 24  ? 55.096 13.255  2.763   1.00 8.94  ? 21  VAL A N     1 
ATOM   185  C  CA    . VAL A 1 24  ? 54.574 14.183  1.750   1.00 8.41  ? 21  VAL A CA    1 
ATOM   186  C  C     . VAL A 1 24  ? 54.279 15.538  2.412   1.00 10.17 ? 21  VAL A C     1 
ATOM   187  O  O     . VAL A 1 24  ? 54.650 16.596  1.873   1.00 10.57 ? 21  VAL A O     1 
ATOM   188  C  CB    . VAL A 1 24  ? 53.313 13.636  1.056   1.00 9.57  ? 21  VAL A CB    1 
ATOM   189  C  CG1   . VAL A 1 24  ? 52.696 14.700  0.135   1.00 11.43 ? 21  VAL A CG1   1 
ATOM   190  C  CG2   . VAL A 1 24  ? 53.647 12.384  0.255   1.00 9.20  ? 21  VAL A CG2   1 
ATOM   191  N  N     . GLU A 1 25  ? 53.654 15.513  3.585   1.00 9.29  ? 22  GLU A N     1 
ATOM   192  C  CA    . GLU A 1 25  ? 53.335 16.774  4.263   1.00 9.23  ? 22  GLU A CA    1 
ATOM   193  C  C     . GLU A 1 25  ? 54.596 17.443  4.837   1.00 11.97 ? 22  GLU A C     1 
ATOM   194  O  O     . GLU A 1 25  ? 54.688 18.679  4.871   1.00 10.68 ? 22  GLU A O     1 
ATOM   195  C  CB    . GLU A 1 25  ? 52.278 16.542  5.352   1.00 7.72  ? 22  GLU A CB    1 
ATOM   196  C  CG    . GLU A 1 25  ? 50.943 16.080  4.829   1.00 10.38 ? 22  GLU A CG    1 
ATOM   197  C  CD    . GLU A 1 25  ? 50.217 17.116  3.992   1.00 13.98 ? 22  GLU A CD    1 
ATOM   198  O  OE1   . GLU A 1 25  ? 50.487 18.323  4.152   1.00 13.80 ? 22  GLU A OE1   1 
ATOM   199  O  OE2   . GLU A 1 25  ? 49.354 16.717  3.191   1.00 13.96 ? 22  GLU A OE2   1 
ATOM   200  N  N     . GLN A 1 26  ? 55.563 16.640  5.286   1.00 10.44 ? 23  GLN A N     1 
ATOM   201  C  CA    . GLN A 1 26  ? 56.807 17.192  5.834   1.00 9.22  ? 23  GLN A CA    1 
ATOM   202  C  C     . GLN A 1 26  ? 57.694 17.847  4.767   1.00 10.74 ? 23  GLN A C     1 
ATOM   203  O  O     . GLN A 1 26  ? 58.394 18.837  5.033   1.00 11.43 ? 23  GLN A O     1 
ATOM   204  C  CB    . GLN A 1 26  ? 57.597 16.097  6.554   1.00 10.24 ? 23  GLN A CB    1 
ATOM   205  C  CG    . GLN A 1 26  ? 57.001 15.722  7.891   1.00 12.39 ? 23  GLN A CG    1 
ATOM   206  C  CD    . GLN A 1 26  ? 57.733 14.552  8.517   1.00 13.13 ? 23  GLN A CD    1 
ATOM   207  O  OE1   . GLN A 1 26  ? 58.150 13.639  7.816   1.00 12.68 ? 23  GLN A OE1   1 
ATOM   208  N  NE2   . GLN A 1 26  ? 57.879 14.570  9.839   1.00 15.02 ? 23  GLN A NE2   1 
ATOM   209  N  N     . ARG A 1 27  ? 57.674 17.288  3.558   1.00 10.47 ? 24  ARG A N     1 
ATOM   210  C  CA    . ARG A 1 27  ? 58.390 17.917  2.451   1.00 10.55 ? 24  ARG A CA    1 
ATOM   211  C  C     . ARG A 1 27  ? 57.801 19.296  2.207   1.00 12.79 ? 24  ARG A C     1 
ATOM   212  O  O     . ARG A 1 27  ? 58.527 20.275  2.085   1.00 11.48 ? 24  ARG A O     1 
ATOM   213  C  CB    . ARG A 1 27  ? 58.304 17.071  1.182   1.00 9.59  ? 24  ARG A CB    1 
ATOM   214  C  CG    . ARG A 1 27  ? 59.076 17.679  0.009   1.00 11.13 ? 24  ARG A CG    1 
ATOM   215  C  CD    . ARG A 1 27  ? 59.110 16.756  -1.196  1.00 13.35 ? 24  ARG A CD    1 
ATOM   216  N  NE    . ARG A 1 27  ? 57.809 16.660  -1.847  1.00 11.85 ? 24  ARG A NE    1 
ATOM   217  C  CZ    . ARG A 1 27  ? 57.600 16.075  -3.016  1.00 10.21 ? 24  ARG A CZ    1 
ATOM   218  N  NH1   . ARG A 1 27  ? 58.610 15.507  -3.670  1.00 9.77  ? 24  ARG A NH1   1 
ATOM   219  N  NH2   . ARG A 1 27  ? 56.380 16.058  -3.528  1.00 13.89 ? 24  ARG A NH2   1 
ATOM   220  N  N     . GLN A 1 28  ? 56.475 19.364  2.178   1.00 9.19  ? 25  GLN A N     1 
ATOM   221  C  CA    . GLN A 1 28  ? 55.772 20.614  1.877   1.00 11.01 ? 25  GLN A CA    1 
ATOM   222  C  C     . GLN A 1 28  ? 55.952 21.662  2.972   1.00 14.50 ? 25  GLN A C     1 
ATOM   223  O  O     . GLN A 1 28  ? 56.082 22.856  2.687   1.00 12.46 ? 25  GLN A O     1 
ATOM   224  C  CB    . GLN A 1 28  ? 54.275 20.340  1.658   1.00 11.65 ? 25  GLN A CB    1 
ATOM   225  C  CG    . GLN A 1 28  ? 53.496 21.552  1.132   1.00 13.21 ? 25  GLN A CG    1 
ATOM   226  C  CD    . GLN A 1 28  ? 52.010 21.246  1.005   1.00 17.20 ? 25  GLN A CD    1 
ATOM   227  O  OE1   . GLN A 1 28  ? 51.636 20.167  0.567   1.00 17.15 ? 25  GLN A OE1   1 
ATOM   228  N  NE2   . GLN A 1 28  ? 51.168 22.211  1.348   1.00 25.62 ? 25  GLN A NE2   1 
ATOM   229  N  N     . ASN A 1 29  ? 55.930 21.212  4.224   1.00 10.68 ? 26  ASN A N     1 
ATOM   230  C  CA    . ASN A 1 29  ? 55.974 22.100  5.373   1.00 11.80 ? 26  ASN A CA    1 
ATOM   231  C  C     . ASN A 1 29  ? 57.132 21.711  6.263   1.00 11.67 ? 26  ASN A C     1 
ATOM   232  O  O     . ASN A 1 29  ? 57.011 20.821  7.107   1.00 11.67 ? 26  ASN A O     1 
ATOM   233  C  CB    . ASN A 1 29  ? 54.660 22.040  6.154   1.00 12.71 ? 26  ASN A CB    1 
ATOM   234  C  CG    . ASN A 1 29  ? 54.647 22.988  7.349   1.00 14.38 ? 26  ASN A CG    1 
ATOM   235  O  OD1   . ASN A 1 29  ? 55.624 23.670  7.615   1.00 15.17 ? 26  ASN A OD1   1 
ATOM   236  N  ND2   . ASN A 1 29  ? 53.519 23.046  8.054   1.00 17.22 ? 26  ASN A ND2   1 
ATOM   237  N  N     . PRO A 1 30  ? 58.271 22.382  6.087   1.00 11.44 ? 27  PRO A N     1 
ATOM   238  C  CA    . PRO A 1 30  ? 59.477 22.074  6.855   1.00 14.46 ? 27  PRO A CA    1 
ATOM   239  C  C     . PRO A 1 30  ? 59.280 22.144  8.368   1.00 15.14 ? 27  PRO A C     1 
ATOM   240  O  O     . PRO A 1 30  ? 60.011 21.471  9.093   1.00 14.28 ? 27  PRO A O     1 
ATOM   241  C  CB    . PRO A 1 30  ? 60.459 23.147  6.388   1.00 17.50 ? 27  PRO A CB    1 
ATOM   242  C  CG    . PRO A 1 30  ? 60.003 23.444  4.989   1.00 13.99 ? 27  PRO A CG    1 
ATOM   243  C  CD    . PRO A 1 30  ? 58.520 23.392  5.044   1.00 14.29 ? 27  PRO A CD    1 
ATOM   244  N  N     . HIS A 1 31  ? 58.301 22.914  8.834   1.00 13.87 ? 28  HIS A N     1 
ATOM   245  C  CA    . HIS A 1 31  ? 58.023 22.984  10.272  1.00 19.73 ? 28  HIS A CA    1 
ATOM   246  C  C     . HIS A 1 31  ? 57.633 21.638  10.871  1.00 18.32 ? 28  HIS A C     1 
ATOM   247  O  O     . HIS A 1 31  ? 57.705 21.449  12.085  1.00 20.56 ? 28  HIS A O     1 
ATOM   248  C  CB    . HIS A 1 31  ? 56.909 23.984  10.562  1.00 21.34 ? 28  HIS A CB    1 
ATOM   249  C  CG    . HIS A 1 31  ? 57.346 25.408  10.519  1.00 25.43 ? 28  HIS A CG    1 
ATOM   250  N  ND1   . HIS A 1 31  ? 56.571 26.408  9.967   1.00 31.46 ? 28  HIS A ND1   1 
ATOM   251  C  CD2   . HIS A 1 31  ? 58.474 26.010  10.966  1.00 28.82 ? 28  HIS A CD2   1 
ATOM   252  C  CE1   . HIS A 1 31  ? 57.201 27.561  10.081  1.00 31.20 ? 28  HIS A CE1   1 
ATOM   253  N  NE2   . HIS A 1 31  ? 58.362 27.347  10.679  1.00 28.84 ? 28  HIS A NE2   1 
ATOM   254  N  N     . LEU A 1 32  ? 57.199 20.709  10.026  1.00 14.62 ? 29  LEU A N     1 
ATOM   255  C  CA    . LEU A 1 32  ? 56.763 19.392  10.510  1.00 13.99 ? 29  LEU A CA    1 
ATOM   256  C  C     . LEU A 1 32  ? 57.895 18.369  10.537  1.00 16.48 ? 29  LEU A C     1 
ATOM   257  O  O     . LEU A 1 32  ? 57.736 17.265  11.057  1.00 13.27 ? 29  LEU A O     1 
ATOM   258  C  CB    . LEU A 1 32  ? 55.635 18.849  9.634   1.00 12.10 ? 29  LEU A CB    1 
ATOM   259  C  CG    . LEU A 1 32  ? 54.394 19.711  9.459   1.00 12.80 ? 29  LEU A CG    1 
ATOM   260  C  CD1   . LEU A 1 32  ? 53.395 19.007  8.546   1.00 14.35 ? 29  LEU A CD1   1 
ATOM   261  C  CD2   . LEU A 1 32  ? 53.765 20.023  10.812  1.00 20.36 ? 29  LEU A CD2   1 
ATOM   262  N  N     . ARG A 1 33  ? 59.041 18.711  9.955   1.00 12.12 ? 30  ARG A N     1 
ATOM   263  C  CA    . ARG A 1 33  ? 60.127 17.748  9.834   1.00 13.14 ? 30  ARG A CA    1 
ATOM   264  C  C     . ARG A 1 33  ? 60.734 17.398  11.196  1.00 15.32 ? 30  ARG A C     1 
ATOM   265  O  O     . ARG A 1 33  ? 60.846 18.261  12.064  1.00 16.83 ? 30  ARG A O     1 
ATOM   266  C  CB    . ARG A 1 33  ? 61.212 18.287  8.896   1.00 13.73 ? 30  ARG A CB    1 
ATOM   267  C  CG    . ARG A 1 33  ? 60.688 18.595  7.499   1.00 13.67 ? 30  ARG A CG    1 
ATOM   268  C  CD    . ARG A 1 33  ? 61.751 19.143  6.567   1.00 17.92 ? 30  ARG A CD    1 
ATOM   269  N  NE    . ARG A 1 33  ? 61.194 19.396  5.234   1.00 14.76 ? 30  ARG A NE    1 
ATOM   270  C  CZ    . ARG A 1 33  ? 61.894 19.889  4.216   1.00 20.74 ? 30  ARG A CZ    1 
ATOM   271  N  NH1   . ARG A 1 33  ? 63.181 20.172  4.373   1.00 18.07 ? 30  ARG A NH1   1 
ATOM   272  N  NH2   . ARG A 1 33  ? 61.305 20.092  3.045   1.00 16.97 ? 30  ARG A NH2   1 
ATOM   273  N  N     . ASN A 1 34  ? 61.106 16.127  11.363  1.00 18.85 ? 31  ASN A N     1 
ATOM   274  C  CA    . ASN A 1 34  ? 61.735 15.656  12.604  1.00 21.36 ? 31  ASN A CA    1 
ATOM   275  C  C     . ASN A 1 34  ? 60.908 16.023  13.834  1.00 26.15 ? 31  ASN A C     1 
ATOM   276  O  O     . ASN A 1 34  ? 61.426 16.525  14.841  1.00 23.50 ? 31  ASN A O     1 
ATOM   277  C  CB    . ASN A 1 34  ? 63.149 16.222  12.740  1.00 26.55 ? 31  ASN A CB    1 
ATOM   278  C  CG    . ASN A 1 34  ? 64.000 15.954  11.513  1.00 25.07 ? 31  ASN A CG    1 
ATOM   279  O  OD1   . ASN A 1 34  ? 64.307 14.805  11.199  1.00 35.26 ? 31  ASN A OD1   1 
ATOM   280  N  ND2   . ASN A 1 34  ? 64.379 17.019  10.807  1.00 30.48 ? 31  ASN A ND2   1 
ATOM   281  N  N     . LYS A 1 35  ? 59.609 15.785  13.723  1.00 17.89 ? 32  LYS A N     1 
ATOM   282  C  CA    . LYS A 1 35  ? 58.667 16.074  14.792  1.00 17.50 ? 32  LYS A CA    1 
ATOM   283  C  C     . LYS A 1 35  ? 57.702 14.921  14.926  1.00 16.06 ? 32  LYS A C     1 
ATOM   284  O  O     . LYS A 1 35  ? 57.461 14.201  13.951  1.00 15.68 ? 32  LYS A O     1 
ATOM   285  C  CB    . LYS A 1 35  ? 57.876 17.355  14.505  1.00 18.58 ? 32  LYS A CB    1 
ATOM   286  C  CG    . LYS A 1 35  ? 58.711 18.610  14.498  1.00 24.31 ? 32  LYS A CG    1 
ATOM   287  C  CD    . LYS A 1 35  ? 59.026 19.062  15.906  1.00 35.76 ? 32  LYS A CD    1 
ATOM   288  C  CE    . LYS A 1 35  ? 60.115 20.121  15.897  1.00 42.09 ? 32  LYS A CE    1 
ATOM   289  N  NZ    . LYS A 1 35  ? 59.921 21.115  14.804  1.00 42.72 ? 32  LYS A NZ    1 
ATOM   290  N  N     . PRO A 1 36  ? 57.131 14.749  16.130  1.00 14.35 ? 33  PRO A N     1 
ATOM   291  C  CA    . PRO A 1 36  ? 55.966 13.881  16.240  1.00 13.09 ? 33  PRO A CA    1 
ATOM   292  C  C     . PRO A 1 36  ? 54.847 14.531  15.445  1.00 12.64 ? 33  PRO A C     1 
ATOM   293  O  O     . PRO A 1 36  ? 54.395 15.639  15.768  1.00 12.97 ? 33  PRO A O     1 
ATOM   294  C  CB    . PRO A 1 36  ? 55.646 13.869  17.734  1.00 12.22 ? 33  PRO A CB    1 
ATOM   295  C  CG    . PRO A 1 36  ? 56.242 15.143  18.268  1.00 15.57 ? 33  PRO A CG    1 
ATOM   296  C  CD    . PRO A 1 36  ? 57.418 15.484  17.380  1.00 15.82 ? 33  PRO A CD    1 
ATOM   297  N  N     . CYS A 1 37  ? 54.438 13.868  14.383  1.00 12.42 ? 34  CYS A N     1 
ATOM   298  C  CA    A CYS A 1 37  ? 53.522 14.432  13.399  0.42 13.15 ? 34  CYS A CA    1 
ATOM   299  C  CA    B CYS A 1 37  ? 53.365 14.425  13.597  0.58 13.20 ? 34  CYS A CA    1 
ATOM   300  C  C     . CYS A 1 37  ? 52.586 13.338  12.893  1.00 11.77 ? 34  CYS A C     1 
ATOM   301  O  O     . CYS A 1 37  ? 53.011 12.182  12.807  1.00 12.49 ? 34  CYS A O     1 
ATOM   302  C  CB    A CYS A 1 37  ? 54.329 15.048  12.243  0.42 13.91 ? 34  CYS A CB    1 
ATOM   303  C  CB    B CYS A 1 37  ? 53.901 15.448  12.602  0.58 13.99 ? 34  CYS A CB    1 
ATOM   304  S  SG    A CYS A 1 37  ? 53.406 15.751  10.852  0.42 12.10 ? 34  CYS A SG    1 
ATOM   305  S  SG    B CYS A 1 37  ? 54.970 14.748  11.359  0.58 15.31 ? 34  CYS A SG    1 
ATOM   306  N  N     . ALA A 1 38  ? 51.368 13.691  12.506  1.00 10.14 ? 35  ALA A N     1 
ATOM   307  C  CA    . ALA A 1 38  ? 50.471 12.732  11.890  1.00 10.88 ? 35  ALA A CA    1 
ATOM   308  C  C     . ALA A 1 38  ? 49.620 13.431  10.856  1.00 12.00 ? 35  ALA A C     1 
ATOM   309  O  O     . ALA A 1 38  ? 49.493 14.657  10.877  1.00 11.82 ? 35  ALA A O     1 
ATOM   310  C  CB    . ALA A 1 38  ? 49.597 12.056  12.943  1.00 10.73 ? 35  ALA A CB    1 
ATOM   311  N  N     . VAL A 1 39  ? 49.041 12.645  9.958   1.00 9.37  ? 36  VAL A N     1 
ATOM   312  C  CA    . VAL A 1 39  ? 48.102 13.162  8.973   1.00 10.25 ? 36  VAL A CA    1 
ATOM   313  C  C     . VAL A 1 39  ? 46.705 12.724  9.362   1.00 14.04 ? 36  VAL A C     1 
ATOM   314  O  O     . VAL A 1 39  ? 46.479 11.552  9.696   1.00 12.17 ? 36  VAL A O     1 
ATOM   315  C  CB    . VAL A 1 39  ? 48.468 12.679  7.568   1.00 9.45  ? 36  VAL A CB    1 
ATOM   316  C  CG1   . VAL A 1 39  ? 47.389 13.033  6.560   1.00 10.62 ? 36  VAL A CG1   1 
ATOM   317  C  CG2   . VAL A 1 39  ? 49.807 13.294  7.165   1.00 10.87 ? 36  VAL A CG2   1 
ATOM   318  N  N     . VAL A 1 40  ? 45.773 13.676  9.343   1.00 14.80 ? 37  VAL A N     1 
ATOM   319  C  CA    . VAL A 1 40  ? 44.421 13.460  9.848   1.00 12.23 ? 37  VAL A CA    1 
ATOM   320  C  C     . VAL A 1 40  ? 43.416 13.779  8.747   1.00 15.97 ? 37  VAL A C     1 
ATOM   321  O  O     . VAL A 1 40  ? 43.645 14.695  7.955   1.00 15.88 ? 37  VAL A O     1 
ATOM   322  C  CB    . VAL A 1 40  ? 44.149 14.350  11.120  1.00 14.43 ? 37  VAL A CB    1 
ATOM   323  C  CG1   A VAL A 1 40  ? 44.974 13.877  12.292  0.37 15.47 ? 37  VAL A CG1   1 
ATOM   324  C  CG1   B VAL A 1 40  ? 44.150 15.836  10.762  0.63 15.56 ? 37  VAL A CG1   1 
ATOM   325  C  CG2   A VAL A 1 40  ? 44.417 15.823  10.821  0.37 15.40 ? 37  VAL A CG2   1 
ATOM   326  C  CG2   B VAL A 1 40  ? 42.852 13.963  11.805  0.63 12.05 ? 37  VAL A CG2   1 
ATOM   327  N  N     . GLN A 1 41  ? 42.321 13.033  8.657   1.00 14.58 ? 38  GLN A N     1 
ATOM   328  C  CA    . GLN A 1 41  ? 41.282 13.488  7.733   1.00 15.39 ? 38  GLN A CA    1 
ATOM   329  C  C     . GLN A 1 41  ? 40.018 13.818  8.514   1.00 14.20 ? 38  GLN A C     1 
ATOM   330  O  O     . GLN A 1 41  ? 39.615 13.109  9.433   1.00 15.02 ? 38  GLN A O     1 
ATOM   331  C  CB    . GLN A 1 41  ? 41.020 12.496  6.583   1.00 26.41 ? 38  GLN A CB    1 
ATOM   332  C  CG    . GLN A 1 41  ? 40.632 11.107  6.942   1.00 29.02 ? 38  GLN A CG    1 
ATOM   333  C  CD    . GLN A 1 41  ? 40.557 10.161  5.721   1.00 26.57 ? 38  GLN A CD    1 
ATOM   334  O  OE1   . GLN A 1 41  ? 40.864 10.526  4.567   1.00 23.88 ? 38  GLN A OE1   1 
ATOM   335  N  NE2   . GLN A 1 41  ? 40.141 8.943   5.986   1.00 23.00 ? 38  GLN A NE2   1 
ATOM   336  N  N     . TYR A 1 42  ? 39.450 14.957  8.124   1.00 14.28 ? 39  TYR A N     1 
ATOM   337  C  CA    . TYR A 1 42  ? 38.322 15.614  8.787   1.00 15.74 ? 39  TYR A CA    1 
ATOM   338  C  C     . TYR A 1 42  ? 38.775 16.083  10.164  1.00 18.31 ? 39  TYR A C     1 
ATOM   339  O  O     . TYR A 1 42  ? 39.962 15.993  10.487  1.00 16.85 ? 39  TYR A O     1 
ATOM   340  C  CB    . TYR A 1 42  ? 37.114 14.691  8.842   1.00 16.43 ? 39  TYR A CB    1 
ATOM   341  C  CG    . TYR A 1 42  ? 36.710 14.194  7.463   1.00 13.94 ? 39  TYR A CG    1 
ATOM   342  C  CD1   . TYR A 1 42  ? 36.415 15.086  6.439   1.00 17.33 ? 39  TYR A CD1   1 
ATOM   343  C  CD2   . TYR A 1 42  ? 36.649 12.826  7.184   1.00 15.86 ? 39  TYR A CD2   1 
ATOM   344  C  CE1   . TYR A 1 42  ? 36.049 14.633  5.179   1.00 17.96 ? 39  TYR A CE1   1 
ATOM   345  C  CE2   . TYR A 1 42  ? 36.278 12.366  5.927   1.00 16.55 ? 39  TYR A CE2   1 
ATOM   346  C  CZ    . TYR A 1 42  ? 35.977 13.276  4.935   1.00 15.00 ? 39  TYR A CZ    1 
ATOM   347  O  OH    . TYR A 1 42  ? 35.598 12.825  3.685   1.00 14.62 ? 39  TYR A OH    1 
ATOM   348  N  N     . LYS A 1 43  ? 37.859 16.616  10.961  1.00 17.33 ? 40  LYS A N     1 
ATOM   349  C  CA    . LYS A 1 43  ? 38.269 17.314  12.192  1.00 15.60 ? 40  LYS A CA    1 
ATOM   350  C  C     . LYS A 1 43  ? 37.164 17.378  13.237  1.00 24.73 ? 40  LYS A C     1 
ATOM   351  O  O     . LYS A 1 43  ? 37.425 17.262  14.435  1.00 21.60 ? 40  LYS A O     1 
ATOM   352  C  CB    . LYS A 1 43  ? 38.745 18.735  11.864  1.00 21.71 ? 40  LYS A CB    1 
ATOM   353  C  CG    . LYS A 1 43  ? 39.942 19.222  12.699  1.00 36.08 ? 40  LYS A CG    1 
ATOM   354  C  CD    . LYS A 1 43  ? 41.277 18.565  12.308  1.00 29.19 ? 40  LYS A CD    1 
ATOM   355  C  CE    . LYS A 1 43  ? 42.435 19.218  13.072  1.00 32.27 ? 40  LYS A CE    1 
ATOM   356  N  NZ    . LYS A 1 43  ? 43.600 19.621  12.225  1.00 33.82 ? 40  LYS A NZ    1 
ATOM   357  N  N     . SER A 1 44  ? 35.931 17.575  12.789  1.00 20.71 ? 41  SER A N     1 
ATOM   358  C  CA    . SER A 1 44  ? 34.818 17.786  13.707  1.00 23.86 ? 41  SER A CA    1 
ATOM   359  C  C     . SER A 1 44  ? 34.561 16.624  14.665  1.00 26.63 ? 41  SER A C     1 
ATOM   360  O  O     . SER A 1 44  ? 34.312 16.832  15.855  1.00 27.97 ? 41  SER A O     1 
ATOM   361  C  CB    . SER A 1 44  ? 33.552 18.087  12.906  1.00 29.46 ? 41  SER A CB    1 
ATOM   362  O  OG    . SER A 1 44  ? 33.775 19.211  12.075  1.00 39.55 ? 41  SER A OG    1 
ATOM   363  N  N     . TRP A 1 45  ? 34.618 15.402  14.152  1.00 23.31 ? 42  TRP A N     1 
ATOM   364  C  CA    . TRP A 1 45  ? 34.373 14.230  14.983  1.00 18.65 ? 42  TRP A CA    1 
ATOM   365  C  C     . TRP A 1 45  ? 35.658 13.724  15.627  1.00 20.67 ? 42  TRP A C     1 
ATOM   366  O  O     . TRP A 1 45  ? 36.536 13.211  14.942  1.00 19.49 ? 42  TRP A O     1 
ATOM   367  C  CB    . TRP A 1 45  ? 33.729 13.124  14.156  1.00 23.64 ? 42  TRP A CB    1 
ATOM   368  C  CG    . TRP A 1 45  ? 33.310 11.941  14.961  1.00 27.38 ? 42  TRP A CG    1 
ATOM   369  C  CD1   . TRP A 1 45  ? 34.019 10.792  15.171  1.00 28.59 ? 42  TRP A CD1   1 
ATOM   370  C  CD2   . TRP A 1 45  ? 32.076 11.785  15.660  1.00 33.12 ? 42  TRP A CD2   1 
ATOM   371  N  NE1   . TRP A 1 45  ? 33.299 9.930   15.964  1.00 32.04 ? 42  TRP A NE1   1 
ATOM   372  C  CE2   . TRP A 1 45  ? 32.101 10.516  16.277  1.00 36.00 ? 42  TRP A CE2   1 
ATOM   373  C  CE3   . TRP A 1 45  ? 30.948 12.596  15.825  1.00 33.96 ? 42  TRP A CE3   1 
ATOM   374  C  CZ2   . TRP A 1 45  ? 31.041 10.040  17.047  1.00 37.67 ? 42  TRP A CZ2   1 
ATOM   375  C  CZ3   . TRP A 1 45  ? 29.897 12.123  16.589  1.00 38.28 ? 42  TRP A CZ3   1 
ATOM   376  C  CH2   . TRP A 1 45  ? 29.950 10.857  17.191  1.00 36.36 ? 42  TRP A CH2   1 
ATOM   377  N  N     . LYS A 1 46  ? 35.744 13.889  16.946  1.00 24.05 ? 43  LYS A N     1 
ATOM   378  C  CA    . LYS A 1 46  ? 36.870 13.427  17.760  1.00 19.97 ? 43  LYS A CA    1 
ATOM   379  C  C     . LYS A 1 46  ? 38.234 13.885  17.254  1.00 21.23 ? 43  LYS A C     1 
ATOM   380  O  O     . LYS A 1 46  ? 39.245 13.207  17.468  1.00 20.50 ? 43  LYS A O     1 
ATOM   381  C  CB    . LYS A 1 46  ? 36.835 11.905  17.876  1.00 22.49 ? 43  LYS A CB    1 
ATOM   382  C  CG    . LYS A 1 46  ? 35.605 11.405  18.617  1.00 28.32 ? 43  LYS A CG    1 
ATOM   383  C  CD    . LYS A 1 46  ? 35.554 9.899   18.695  1.00 31.32 ? 43  LYS A CD    1 
ATOM   384  C  CE    . LYS A 1 46  ? 34.502 9.467   19.701  1.00 39.56 ? 43  LYS A CE    1 
ATOM   385  N  NZ    . LYS A 1 46  ? 34.840 9.985   21.062  1.00 42.93 ? 43  LYS A NZ    1 
ATOM   386  N  N     . GLY A 1 47  ? 38.254 15.042  16.601  1.00 18.77 ? 44  GLY A N     1 
ATOM   387  C  CA    . GLY A 1 47  ? 39.490 15.659  16.159  1.00 18.21 ? 44  GLY A CA    1 
ATOM   388  C  C     . GLY A 1 47  ? 39.948 15.217  14.783  1.00 13.48 ? 44  GLY A C     1 
ATOM   389  O  O     . GLY A 1 47  ? 40.954 15.708  14.286  1.00 15.89 ? 44  GLY A O     1 
ATOM   390  N  N     . GLY A 1 48  ? 39.198 14.294  14.178  1.00 16.96 ? 45  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 48  ? 39.546 13.739  12.887  1.00 18.05 ? 45  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 48  ? 40.207 12.379  13.032  1.00 15.99 ? 45  GLY A C     1 
ATOM   393  O  O     . GLY A 1 48  ? 40.668 12.016  14.113  1.00 16.12 ? 45  GLY A O     1 
ATOM   394  N  N     . GLY A 1 49  ? 40.290 11.628  11.942  1.00 15.30 ? 46  GLY A N     1 
ATOM   395  C  CA    . GLY A 1 49  ? 40.854 10.288  12.018  1.00 13.75 ? 46  GLY A CA    1 
ATOM   396  C  C     . GLY A 1 49  ? 42.281 10.280  11.511  1.00 13.81 ? 46  GLY A C     1 
ATOM   397  O  O     . GLY A 1 49  ? 42.550 10.771  10.412  1.00 15.99 ? 46  GLY A O     1 
ATOM   398  N  N     . ILE A 1 50  ? 43.198 9.724   12.301  1.00 12.92 ? 47  ILE A N     1 
ATOM   399  C  CA    . ILE A 1 50  ? 44.597 9.683   11.897  1.00 10.74 ? 47  ILE A CA    1 
ATOM   400  C  C     . ILE A 1 50  ? 44.817 8.569   10.879  1.00 12.06 ? 47  ILE A C     1 
ATOM   401  O  O     . ILE A 1 50  ? 44.373 7.440   11.099  1.00 13.90 ? 47  ILE A O     1 
ATOM   402  C  CB    . ILE A 1 50  ? 45.508 9.467   13.107  1.00 12.81 ? 47  ILE A CB    1 
ATOM   403  C  CG1   . ILE A 1 50  ? 45.446 10.704  13.999  1.00 19.96 ? 47  ILE A CG1   1 
ATOM   404  C  CG2   . ILE A 1 50  ? 46.928 9.159   12.661  1.00 14.41 ? 47  ILE A CG2   1 
ATOM   405  C  CD1   . ILE A 1 50  ? 46.389 10.670  15.137  1.00 24.15 ? 47  ILE A CD1   1 
ATOM   406  N  N     . ILE A 1 51  ? 45.484 8.887   9.766   1.00 12.01 ? 48  ILE A N     1 
ATOM   407  C  CA    . ILE A 1 51  ? 45.749 7.867   8.755   1.00 12.45 ? 48  ILE A CA    1 
ATOM   408  C  C     . ILE A 1 51  ? 47.239 7.642   8.479   1.00 11.03 ? 48  ILE A C     1 
ATOM   409  O  O     . ILE A 1 51  ? 47.589 6.711   7.766   1.00 12.91 ? 48  ILE A O     1 
ATOM   410  C  CB    . ILE A 1 51  ? 45.032 8.173   7.426   1.00 13.97 ? 48  ILE A CB    1 
ATOM   411  C  CG1   . ILE A 1 51  ? 45.474 9.512   6.823   1.00 13.01 ? 48  ILE A CG1   1 
ATOM   412  C  CG2   . ILE A 1 51  ? 43.513 8.110   7.637   1.00 17.02 ? 48  ILE A CG2   1 
ATOM   413  C  CD1   . ILE A 1 51  ? 44.939 9.715   5.397   1.00 16.02 ? 48  ILE A CD1   1 
ATOM   414  N  N     . ALA A 1 52  ? 48.111 8.449   9.074   1.00 11.13 ? 49  ALA A N     1 
ATOM   415  C  CA    . ALA A 1 52  ? 49.564 8.221   8.937   1.00 8.95  ? 49  ALA A CA    1 
ATOM   416  C  C     . ALA A 1 52  ? 50.293 8.891   10.090  1.00 9.17  ? 49  ALA A C     1 
ATOM   417  O  O     . ALA A 1 52  ? 49.867 9.954   10.544  1.00 11.10 ? 49  ALA A O     1 
ATOM   418  C  CB    . ALA A 1 52  ? 50.081 8.748   7.586   1.00 10.15 ? 49  ALA A CB    1 
ATOM   419  N  N     . VAL A 1 53  ? 51.386 8.277   10.566  1.00 8.93  ? 50  VAL A N     1 
ATOM   420  C  CA    . VAL A 1 53  ? 52.055 8.710   11.792  1.00 8.44  ? 50  VAL A CA    1 
ATOM   421  C  C     . VAL A 1 53  ? 53.568 8.650   11.654  1.00 8.84  ? 50  VAL A C     1 
ATOM   422  O  O     . VAL A 1 53  ? 54.117 7.608   11.254  1.00 10.55 ? 50  VAL A O     1 
ATOM   423  C  CB    . VAL A 1 53  ? 51.638 7.815   12.991  1.00 10.92 ? 50  VAL A CB    1 
ATOM   424  C  CG1   . VAL A 1 53  ? 52.227 8.341   14.283  1.00 13.63 ? 50  VAL A CG1   1 
ATOM   425  C  CG2   . VAL A 1 53  ? 50.137 7.732   13.098  1.00 14.36 ? 50  VAL A CG2   1 
ATOM   426  N  N     . SER A 1 54  ? 54.242 9.744   11.998  1.00 9.35  ? 51  SER A N     1 
ATOM   427  C  CA    . SER A 1 54  ? 55.701 9.772   11.951  1.00 10.70 ? 51  SER A CA    1 
ATOM   428  C  C     . SER A 1 54  ? 56.279 8.863   13.026  1.00 12.08 ? 51  SER A C     1 
ATOM   429  O  O     . SER A 1 54  ? 55.617 8.563   14.028  1.00 11.17 ? 51  SER A O     1 
ATOM   430  C  CB    . SER A 1 54  ? 56.229 11.202  12.126  1.00 11.33 ? 51  SER A CB    1 
ATOM   431  O  OG    . SER A 1 54  ? 56.300 11.556  13.512  1.00 11.33 ? 51  SER A OG    1 
ATOM   432  N  N     . TYR A 1 55  ? 57.510 8.414   12.814  1.00 11.39 ? 52  TYR A N     1 
ATOM   433  C  CA    . TYR A 1 55  ? 58.107 7.475   13.758  1.00 10.43 ? 52  TYR A CA    1 
ATOM   434  C  C     . TYR A 1 55  ? 58.339 8.122   15.124  1.00 13.26 ? 52  TYR A C     1 
ATOM   435  O  O     . TYR A 1 55  ? 58.217 7.450   16.152  1.00 14.67 ? 52  TYR A O     1 
ATOM   436  C  CB    . TYR A 1 55  ? 59.395 6.891   13.169  1.00 10.70 ? 52  TYR A CB    1 
ATOM   437  C  CG    . TYR A 1 55  ? 59.046 5.814   12.172  1.00 11.90 ? 52  TYR A CG    1 
ATOM   438  C  CD1   . TYR A 1 55  ? 58.681 6.136   10.870  1.00 12.01 ? 52  TYR A CD1   1 
ATOM   439  C  CD2   . TYR A 1 55  ? 58.998 4.484   12.559  1.00 14.74 ? 52  TYR A CD2   1 
ATOM   440  C  CE1   . TYR A 1 55  ? 58.304 5.140   9.963   1.00 14.71 ? 52  TYR A CE1   1 
ATOM   441  C  CE2   . TYR A 1 55  ? 58.639 3.491   11.676  1.00 14.50 ? 52  TYR A CE2   1 
ATOM   442  C  CZ    . TYR A 1 55  ? 58.291 3.810   10.379  1.00 14.82 ? 52  TYR A CZ    1 
ATOM   443  O  OH    . TYR A 1 55  ? 57.927 2.791   9.519   1.00 16.44 ? 52  TYR A OH    1 
ATOM   444  N  N     . GLU A 1 56  ? 58.617 9.421   15.145  1.00 12.42 ? 53  GLU A N     1 
ATOM   445  C  CA    . GLU A 1 56  ? 58.701 10.135  16.419  1.00 15.29 ? 53  GLU A CA    1 
ATOM   446  C  C     . GLU A 1 56  ? 57.389 10.043  17.201  1.00 14.71 ? 53  GLU A C     1 
ATOM   447  O  O     . GLU A 1 56  ? 57.395 9.866   18.426  1.00 15.72 ? 53  GLU A O     1 
ATOM   448  C  CB    . GLU A 1 56  ? 59.065 11.609  16.191  1.00 15.13 ? 53  GLU A CB    1 
ATOM   449  C  CG    . GLU A 1 56  ? 60.448 11.874  15.584  1.00 22.18 ? 53  GLU A CG    1 
ATOM   450  C  CD    . GLU A 1 56  ? 60.540 11.683  14.058  1.00 30.87 ? 53  GLU A CD    1 
ATOM   451  O  OE1   . GLU A 1 56  ? 59.586 11.176  13.415  1.00 23.41 ? 53  GLU A OE1   1 
ATOM   452  O  OE2   . GLU A 1 56  ? 61.589 12.063  13.495  1.00 32.34 ? 53  GLU A OE2   1 
ATOM   453  N  N     . ALA A 1 57  ? 56.257 10.192  16.511  1.00 10.48 ? 54  ALA A N     1 
ATOM   454  C  CA    . ALA A 1 57  ? 54.960 10.129  17.170  1.00 10.97 ? 54  ALA A CA    1 
ATOM   455  C  C     . ALA A 1 57  ? 54.621 8.698   17.578  1.00 11.87 ? 54  ALA A C     1 
ATOM   456  O  O     . ALA A 1 57  ? 53.964 8.482   18.594  1.00 13.40 ? 54  ALA A O     1 
ATOM   457  C  CB    . ALA A 1 57  ? 53.860 10.687  16.257  1.00 12.12 ? 54  ALA A CB    1 
ATOM   458  N  N     . ARG A 1 58  ? 55.062 7.720   16.792  1.00 12.50 ? 55  ARG A N     1 
ATOM   459  C  CA    . ARG A 1 58  ? 54.793 6.321   17.141  1.00 11.87 ? 55  ARG A CA    1 
ATOM   460  C  C     . ARG A 1 58  ? 55.418 5.956   18.481  1.00 12.63 ? 55  ARG A C     1 
ATOM   461  O  O     . ARG A 1 58  ? 54.873 5.122   19.205  1.00 14.64 ? 55  ARG A O     1 
ATOM   462  C  CB    . ARG A 1 58  ? 55.306 5.376   16.058  1.00 13.26 ? 55  ARG A CB    1 
ATOM   463  C  CG    . ARG A 1 58  ? 54.623 5.586   14.746  1.00 14.19 ? 55  ARG A CG    1 
ATOM   464  C  CD    . ARG A 1 58  ? 55.108 4.579   13.724  1.00 12.54 ? 55  ARG A CD    1 
ATOM   465  N  NE    . ARG A 1 58  ? 54.687 4.976   12.383  1.00 11.24 ? 55  ARG A NE    1 
ATOM   466  C  CZ    . ARG A 1 58  ? 54.783 4.219   11.301  1.00 15.57 ? 55  ARG A CZ    1 
ATOM   467  N  NH1   . ARG A 1 58  ? 55.274 2.989   11.387  1.00 15.69 ? 55  ARG A NH1   1 
ATOM   468  N  NH2   . ARG A 1 58  ? 54.363 4.705   10.127  1.00 16.78 ? 55  ARG A NH2   1 
ATOM   469  N  N     . ALA A 1 59  ? 56.534 6.601   18.801  1.00 13.29 ? 56  ALA A N     1 
ATOM   470  C  CA    . ALA A 1 59  ? 57.216 6.370   20.080  1.00 13.52 ? 56  ALA A CA    1 
ATOM   471  C  C     . ALA A 1 59  ? 56.323 6.706   21.275  1.00 17.31 ? 56  ALA A C     1 
ATOM   472  O  O     . ALA A 1 59  ? 56.522 6.163   22.369  1.00 19.40 ? 56  ALA A O     1 
ATOM   473  C  CB    . ALA A 1 59  ? 58.509 7.164   20.142  1.00 15.78 ? 56  ALA A CB    1 
ATOM   474  N  N     . PHE A 1 60  ? 55.339 7.585   21.078  1.00 12.18 ? 57  PHE A N     1 
ATOM   475  C  CA    . PHE A 1 60  ? 54.390 7.937   22.137  1.00 13.40 ? 57  PHE A CA    1 
ATOM   476  C  C     . PHE A 1 60  ? 53.175 7.017   22.158  1.00 15.20 ? 57  PHE A C     1 
ATOM   477  O  O     . PHE A 1 60  ? 52.310 7.136   23.035  1.00 17.82 ? 57  PHE A O     1 
ATOM   478  C  CB    . PHE A 1 60  ? 53.906 9.384   21.981  1.00 14.11 ? 57  PHE A CB    1 
ATOM   479  C  CG    . PHE A 1 60  ? 54.948 10.420  22.278  1.00 14.85 ? 57  PHE A CG    1 
ATOM   480  C  CD1   . PHE A 1 60  ? 55.007 11.030  23.531  1.00 16.38 ? 57  PHE A CD1   1 
ATOM   481  C  CD2   . PHE A 1 60  ? 55.849 10.811  21.308  1.00 15.13 ? 57  PHE A CD2   1 
ATOM   482  C  CE1   . PHE A 1 60  ? 55.955 12.009  23.795  1.00 23.33 ? 57  PHE A CE1   1 
ATOM   483  C  CE2   . PHE A 1 60  ? 56.794 11.780  21.560  1.00 19.88 ? 57  PHE A CE2   1 
ATOM   484  C  CZ    . PHE A 1 60  ? 56.850 12.384  22.806  1.00 23.72 ? 57  PHE A CZ    1 
ATOM   485  N  N     . GLY A 1 61  ? 53.089 6.125   21.176  1.00 14.70 ? 58  GLY A N     1 
ATOM   486  C  CA    . GLY A 1 61  ? 51.970 5.202   21.066  1.00 16.09 ? 58  GLY A CA    1 
ATOM   487  C  C     . GLY A 1 61  ? 50.878 5.635   20.107  1.00 14.09 ? 58  GLY A C     1 
ATOM   488  O  O     . GLY A 1 61  ? 49.815 4.997   20.005  1.00 13.98 ? 58  GLY A O     1 
ATOM   489  N  N     . VAL A 1 62  ? 51.133 6.722   19.384  1.00 13.74 ? 59  VAL A N     1 
ATOM   490  C  CA    . VAL A 1 62  ? 50.188 7.179   18.379  1.00 13.98 ? 59  VAL A CA    1 
ATOM   491  C  C     . VAL A 1 62  ? 50.170 6.192   17.208  1.00 13.90 ? 59  VAL A C     1 
ATOM   492  O  O     . VAL A 1 62  ? 51.222 5.754   16.734  1.00 13.41 ? 59  VAL A O     1 
ATOM   493  C  CB    . VAL A 1 62  ? 50.526 8.609   17.887  1.00 11.81 ? 59  VAL A CB    1 
ATOM   494  C  CG1   . VAL A 1 62  ? 49.495 9.075   16.861  1.00 13.74 ? 59  VAL A CG1   1 
ATOM   495  C  CG2   . VAL A 1 62  ? 50.538 9.563   19.070  1.00 15.01 ? 59  VAL A CG2   1 
ATOM   496  N  N     . THR A 1 63  ? 48.985 5.863   16.729  1.00 15.12 ? 60  THR A N     1 
ATOM   497  C  CA    . THR A 1 63  ? 48.823 4.969   15.608  1.00 14.14 ? 60  THR A CA    1 
ATOM   498  C  C     . THR A 1 63  ? 47.845 5.515   14.613  1.00 14.76 ? 60  THR A C     1 
ATOM   499  O  O     . THR A 1 63  ? 47.098 6.354   14.926  1.00 16.27 ? 60  THR A O     1 
ATOM   500  C  CB    . THR A 1 63  ? 48.274 3.591   16.007  1.00 16.30 ? 60  THR A CB    1 
ATOM   501  O  OG1   . THR A 1 63  ? 46.944 3.736   16.430  1.00 19.66 ? 60  THR A OG1   1 
ATOM   502  C  CG2   . THR A 1 63  ? 49.051 2.998   17.066  1.00 18.38 ? 60  THR A CG2   1 
ATOM   503  N  N     . ALA A 1 64  ? 47.846 4.946   13.425  1.00 13.70 ? 61  ALA A N     1 
ATOM   504  C  CA    . ALA A 1 64  ? 46.774 5.166   12.516  1.00 15.04 ? 61  ALA A CA    1 
ATOM   505  C  C     . ALA A 1 64  ? 45.536 4.445   13.015  1.00 20.65 ? 61  ALA A C     1 
ATOM   506  O  O     . ALA A 1 64  ? 45.610 3.700   13.890  1.00 22.21 ? 61  ALA A O     1 
ATOM   507  C  CB    . ALA A 1 64  ? 47.162 4.750   11.112  1.00 18.62 ? 61  ALA A CB    1 
ATOM   508  N  N     . SER A 1 65  ? 44.384 4.797   12.490  1.00 22.50 ? 62  SER A N     1 
ATOM   509  C  CA    . SER A 1 65  ? 43.124 4.290   13.009  1.00 27.39 ? 62  SER A CA    1 
ATOM   510  C  C     . SER A 1 65  ? 42.806 4.783   14.404  1.00 31.31 ? 62  SER A C     1 
ATOM   511  O  O     . SER A 1 65  ? 42.105 4.144   15.137  1.00 37.93 ? 62  SER A O     1 
ATOM   512  C  CB    . SER A 1 65  ? 43.133 2.782   13.047  1.00 38.21 ? 62  SER A CB    1 
ATOM   513  O  OG    . SER A 1 65  ? 43.755 2.265   14.211  1.00 46.05 ? 62  SER A OG    1 
ATOM   514  N  N     . MET A 1 66  ? 43.379 5.885   14.775  1.00 24.58 ? 63  MET A N     1 
ATOM   515  C  CA    . MET A 1 66  ? 43.194 6.486   16.060  1.00 17.08 ? 63  MET A CA    1 
ATOM   516  C  C     . MET A 1 66  ? 42.555 7.841   15.788  1.00 16.37 ? 63  MET A C     1 
ATOM   517  O  O     . MET A 1 66  ? 42.852 8.449   14.825  1.00 17.30 ? 63  MET A O     1 
ATOM   518  C  CB    . MET A 1 66  ? 44.552 6.681   16.695  1.00 23.77 ? 63  MET A CB    1 
ATOM   519  C  CG    . MET A 1 66  ? 44.581 7.157   18.080  1.00 20.36 ? 63  MET A CG    1 
ATOM   520  S  SD    . MET A 1 66  ? 46.194 6.947   18.891  1.00 19.71 ? 63  MET A SD    1 
ATOM   521  C  CE    . MET A 1 66  ? 46.259 5.282   19.440  1.00 17.91 ? 63  MET A CE    1 
ATOM   522  N  N     . TRP A 1 67  ? 41.655 8.257   16.661  1.00 15.52 ? 64  TRP A N     1 
ATOM   523  C  CA    . TRP A 1 67  ? 41.119 9.620   16.586  1.00 17.46 ? 64  TRP A CA    1 
ATOM   524  C  C     . TRP A 1 67  ? 42.150 10.629  17.072  1.00 15.40 ? 64  TRP A C     1 
ATOM   525  O  O     . TRP A 1 67  ? 42.853 10.366  18.041  1.00 14.13 ? 64  TRP A O     1 
ATOM   526  C  CB    . TRP A 1 67  ? 39.842 9.767   17.423  1.00 17.97 ? 64  TRP A CB    1 
ATOM   527  C  CG    . TRP A 1 67  ? 38.739 8.925   16.942  1.00 18.87 ? 64  TRP A CG    1 
ATOM   528  C  CD1   . TRP A 1 67  ? 38.161 7.875   17.592  1.00 25.99 ? 64  TRP A CD1   1 
ATOM   529  C  CD2   . TRP A 1 67  ? 38.083 9.029   15.675  1.00 20.06 ? 64  TRP A CD2   1 
ATOM   530  N  NE1   . TRP A 1 67  ? 37.173 7.325   16.807  1.00 29.17 ? 64  TRP A NE1   1 
ATOM   531  C  CE2   . TRP A 1 67  ? 37.109 8.015   15.626  1.00 28.44 ? 64  TRP A CE2   1 
ATOM   532  C  CE3   . TRP A 1 67  ? 38.217 9.891   14.582  1.00 17.13 ? 64  TRP A CE3   1 
ATOM   533  C  CZ2   . TRP A 1 67  ? 36.269 7.844   14.526  1.00 29.10 ? 64  TRP A CZ2   1 
ATOM   534  C  CZ3   . TRP A 1 67  ? 37.390 9.709   13.484  1.00 19.06 ? 64  TRP A CZ3   1 
ATOM   535  C  CH2   . TRP A 1 67  ? 36.429 8.699   13.465  1.00 23.18 ? 64  TRP A CH2   1 
ATOM   536  N  N     . ALA A 1 68  ? 42.221 11.795  16.438  1.00 13.69 ? 65  ALA A N     1 
ATOM   537  C  CA    . ALA A 1 68  ? 43.223 12.785  16.839  1.00 14.30 ? 65  ALA A CA    1 
ATOM   538  C  C     . ALA A 1 68  ? 43.092 13.210  18.305  1.00 15.47 ? 65  ALA A C     1 
ATOM   539  O  O     . ALA A 1 68  ? 44.101 13.422  18.968  1.00 14.82 ? 65  ALA A O     1 
ATOM   540  C  CB    . ALA A 1 68  ? 43.161 14.018  15.935  1.00 16.52 ? 65  ALA A CB    1 
ATOM   541  N  N     . ASP A 1 69  ? 41.867 13.336  18.812  1.00 19.85 ? 66  ASP A N     1 
ATOM   542  C  CA    . ASP A 1 69  ? 41.717 13.754  20.206  1.00 16.53 ? 66  ASP A CA    1 
ATOM   543  C  C     . ASP A 1 69  ? 42.371 12.730  21.136  1.00 16.37 ? 66  ASP A C     1 
ATOM   544  O  O     . ASP A 1 69  ? 42.956 13.093  22.172  1.00 16.23 ? 66  ASP A O     1 
ATOM   545  C  CB    . ASP A 1 69  ? 40.253 13.937  20.578  1.00 20.87 ? 66  ASP A CB    1 
ATOM   546  C  CG    . ASP A 1 69  ? 39.633 15.184  19.950  1.00 16.80 ? 66  ASP A CG    1 
ATOM   547  O  OD1   . ASP A 1 69  ? 40.366 16.051  19.432  1.00 24.82 ? 66  ASP A OD1   1 
ATOM   548  O  OD2   . ASP A 1 69  ? 38.402 15.288  20.000  1.00 27.88 ? 66  ASP A OD2   1 
ATOM   549  N  N     . ASP A 1 70  ? 42.284 11.457  20.758  1.00 14.82 ? 67  ASP A N     1 
ATOM   550  C  CA    . ASP A 1 70  ? 42.886 10.396  21.561  1.00 15.46 ? 67  ASP A CA    1 
ATOM   551  C  C     . ASP A 1 70  ? 44.398 10.383  21.409  1.00 14.69 ? 67  ASP A C     1 
ATOM   552  O  O     . ASP A 1 70  ? 45.135 10.202  22.380  1.00 13.12 ? 67  ASP A O     1 
ATOM   553  C  CB    . ASP A 1 70  ? 42.270 9.052   21.175  1.00 19.52 ? 67  ASP A CB    1 
ATOM   554  C  CG    . ASP A 1 70  ? 40.786 8.988   21.512  1.00 29.76 ? 67  ASP A CG    1 
ATOM   555  O  OD1   . ASP A 1 70  ? 40.355 9.694   22.460  1.00 26.63 ? 67  ASP A OD1   1 
ATOM   556  O  OD2   . ASP A 1 70  ? 40.049 8.264   20.815  1.00 28.44 ? 67  ASP A OD2   1 
ATOM   557  N  N     . ALA A 1 71  ? 44.878 10.616  20.191  1.00 12.28 ? 68  ALA A N     1 
ATOM   558  C  CA    . ALA A 1 71  ? 46.313 10.714  19.969  1.00 14.16 ? 68  ALA A CA    1 
ATOM   559  C  C     . ALA A 1 71  ? 46.939 11.840  20.789  1.00 12.95 ? 68  ALA A C     1 
ATOM   560  O  O     . ALA A 1 71  ? 48.034 11.690  21.319  1.00 12.68 ? 68  ALA A O     1 
ATOM   561  C  CB    . ALA A 1 71  ? 46.610 10.924  18.486  1.00 15.20 ? 68  ALA A CB    1 
ATOM   562  N  N     . LYS A 1 72  ? 46.236 12.964  20.891  1.00 12.88 ? 69  LYS A N     1 
ATOM   563  C  CA    . LYS A 1 72  ? 46.726 14.109  21.652  1.00 13.45 ? 69  LYS A CA    1 
ATOM   564  C  C     . LYS A 1 72  ? 46.825 13.783  23.142  1.00 15.68 ? 69  LYS A C     1 
ATOM   565  O  O     . LYS A 1 72  ? 47.623 14.389  23.863  1.00 15.11 ? 69  LYS A O     1 
ATOM   566  C  CB    . LYS A 1 72  ? 45.815 15.324  21.428  1.00 15.19 ? 69  LYS A CB    1 
ATOM   567  C  CG    . LYS A 1 72  ? 46.156 16.123  20.155  1.00 17.25 ? 69  LYS A CG    1 
ATOM   568  C  CD    . LYS A 1 72  ? 47.459 16.907  20.316  1.00 19.06 ? 69  LYS A CD    1 
ATOM   569  C  CE    . LYS A 1 72  ? 47.584 17.998  19.257  1.00 23.35 ? 69  LYS A CE    1 
ATOM   570  N  NZ    . LYS A 1 72  ? 48.800 18.836  19.480  1.00 20.28 ? 69  LYS A NZ    1 
ATOM   571  N  N     . LYS A 1 73  ? 46.044 12.805  23.602  1.00 13.70 ? 70  LYS A N     1 
ATOM   572  C  CA    . LYS A 1 73  ? 46.166 12.391  24.998  1.00 14.42 ? 70  LYS A CA    1 
ATOM   573  C  C     . LYS A 1 73  ? 47.516 11.699  25.222  1.00 16.04 ? 70  LYS A C     1 
ATOM   574  O  O     . LYS A 1 73  ? 48.130 11.863  26.280  1.00 18.86 ? 70  LYS A O     1 
ATOM   575  C  CB    . LYS A 1 73  ? 45.005 11.480  25.400  1.00 12.55 ? 70  LYS A CB    1 
ATOM   576  C  CG    . LYS A 1 73  ? 43.643 12.100  25.168  1.00 12.66 ? 70  LYS A CG    1 
ATOM   577  C  CD    . LYS A 1 73  ? 42.531 11.092  25.404  1.00 16.14 ? 70  LYS A CD    1 
ATOM   578  C  CE    . LYS A 1 73  ? 41.159 11.706  25.166  1.00 19.55 ? 70  LYS A CE    1 
ATOM   579  N  NZ    . LYS A 1 73  ? 40.114 10.647  25.128  1.00 22.10 ? 70  LYS A NZ    1 
ATOM   580  N  N     . LEU A 1 74  ? 47.995 10.964  24.218  1.00 14.13 ? 71  LEU A N     1 
ATOM   581  C  CA    . LEU A 1 74  ? 49.286 10.274  24.334  1.00 13.50 ? 71  LEU A CA    1 
ATOM   582  C  C     . LEU A 1 74  ? 50.457 11.202  24.035  1.00 15.50 ? 71  LEU A C     1 
ATOM   583  O  O     . LEU A 1 74  ? 51.554 11.037  24.565  1.00 19.01 ? 71  LEU A O     1 
ATOM   584  C  CB    . LEU A 1 74  ? 49.341 9.074   23.384  1.00 13.14 ? 71  LEU A CB    1 
ATOM   585  C  CG    . LEU A 1 74  ? 48.316 7.967   23.607  1.00 15.67 ? 71  LEU A CG    1 
ATOM   586  C  CD1   . LEU A 1 74  ? 48.442 6.964   22.465  1.00 16.64 ? 71  LEU A CD1   1 
ATOM   587  C  CD2   . LEU A 1 74  ? 48.552 7.282   24.946  1.00 17.13 ? 71  LEU A CD2   1 
ATOM   588  N  N     . CYS A 1 75  ? 50.201 12.179  23.174  1.00 13.82 ? 72  CYS A N     1 
ATOM   589  C  CA    . CYS A 1 75  ? 51.243 13.041  22.649  1.00 16.38 ? 72  CYS A CA    1 
ATOM   590  C  C     . CYS A 1 75  ? 50.691 14.454  22.496  1.00 16.13 ? 72  CYS A C     1 
ATOM   591  O  O     . CYS A 1 75  ? 50.209 14.844  21.431  1.00 13.99 ? 72  CYS A O     1 
ATOM   592  C  CB    . CYS A 1 75  ? 51.746 12.487  21.320  1.00 15.92 ? 72  CYS A CB    1 
ATOM   593  S  SG    . CYS A 1 75  ? 53.073 13.434  20.565  1.00 17.80 ? 72  CYS A SG    1 
ATOM   594  N  N     . PRO A 1 76  ? 50.732 15.228  23.586  1.00 16.43 ? 73  PRO A N     1 
ATOM   595  C  CA    . PRO A 1 76  ? 50.154 16.574  23.609  1.00 17.06 ? 73  PRO A CA    1 
ATOM   596  C  C     . PRO A 1 76  ? 50.739 17.521  22.550  1.00 15.17 ? 73  PRO A C     1 
ATOM   597  O  O     . PRO A 1 76  ? 50.033 18.417  22.078  1.00 19.52 ? 73  PRO A O     1 
ATOM   598  C  CB    . PRO A 1 76  ? 50.487 17.063  25.027  1.00 19.54 ? 73  PRO A CB    1 
ATOM   599  C  CG    . PRO A 1 76  ? 50.572 15.830  25.833  1.00 22.41 ? 73  PRO A CG    1 
ATOM   600  C  CD    . PRO A 1 76  ? 51.171 14.787  24.922  1.00 22.35 ? 73  PRO A CD    1 
ATOM   601  N  N     . ASP A 1 77  ? 52.004 17.322  22.200  1.00 18.53 ? 74  ASP A N     1 
ATOM   602  C  CA    . ASP A 1 77  ? 52.691 18.192  21.245  1.00 20.78 ? 74  ASP A CA    1 
ATOM   603  C  C     . ASP A 1 77  ? 52.616 17.662  19.813  1.00 17.64 ? 74  ASP A C     1 
ATOM   604  O  O     . ASP A 1 77  ? 53.318 18.168  18.931  1.00 17.11 ? 74  ASP A O     1 
ATOM   605  C  CB    . ASP A 1 77  ? 54.165 18.352  21.624  1.00 21.34 ? 74  ASP A CB    1 
ATOM   606  C  CG    . ASP A 1 77  ? 54.363 18.962  22.998  1.00 28.17 ? 74  ASP A CG    1 
ATOM   607  O  OD1   . ASP A 1 77  ? 55.267 18.486  23.723  1.00 35.89 ? 74  ASP A OD1   1 
ATOM   608  O  OD2   . ASP A 1 77  ? 53.630 19.907  23.353  1.00 30.90 ? 74  ASP A OD2   1 
ATOM   609  N  N     . LEU A 1 78  ? 51.803 16.634  19.589  1.00 14.24 ? 75  LEU A N     1 
ATOM   610  C  CA    . LEU A 1 78  ? 51.657 16.048  18.246  1.00 12.06 ? 75  LEU A CA    1 
ATOM   611  C  C     . LEU A 1 78  ? 51.272 17.102  17.223  1.00 13.03 ? 75  LEU A C     1 
ATOM   612  O  O     . LEU A 1 78  ? 50.315 17.840  17.428  1.00 14.57 ? 75  LEU A O     1 
ATOM   613  C  CB    . LEU A 1 78  ? 50.604 14.944  18.258  1.00 11.23 ? 75  LEU A CB    1 
ATOM   614  C  CG    . LEU A 1 78  ? 50.268 14.207  16.954  1.00 10.73 ? 75  LEU A CG    1 
ATOM   615  C  CD1   . LEU A 1 78  ? 51.448 13.364  16.498  1.00 14.69 ? 75  LEU A CD1   1 
ATOM   616  C  CD2   . LEU A 1 78  ? 49.040 13.357  17.162  1.00 14.23 ? 75  LEU A CD2   1 
ATOM   617  N  N     . LEU A 1 79  ? 52.010 17.167  16.123  1.00 11.64 ? 76  LEU A N     1 
ATOM   618  C  CA    . LEU A 1 79  ? 51.636 18.084  15.059  1.00 11.39 ? 76  LEU A CA    1 
ATOM   619  C  C     . LEU A 1 79  ? 50.740 17.358  14.064  1.00 16.25 ? 76  LEU A C     1 
ATOM   620  O  O     . LEU A 1 79  ? 50.893 16.156  13.827  1.00 15.41 ? 76  LEU A O     1 
ATOM   621  C  CB    . LEU A 1 79  ? 52.876 18.645  14.372  1.00 10.19 ? 76  LEU A CB    1 
ATOM   622  C  CG    . LEU A 1 79  ? 53.824 19.355  15.339  1.00 12.71 ? 76  LEU A CG    1 
ATOM   623  C  CD1   . LEU A 1 79  ? 55.025 19.947  14.616  1.00 13.64 ? 76  LEU A CD1   1 
ATOM   624  C  CD2   . LEU A 1 79  ? 53.075 20.418  16.135  1.00 14.13 ? 76  LEU A CD2   1 
ATOM   625  N  N     . LEU A 1 80  ? 49.808 18.096  13.474  1.00 12.57 ? 77  LEU A N     1 
ATOM   626  C  CA    . LEU A 1 80  ? 48.836 17.490  12.574  1.00 13.42 ? 77  LEU A CA    1 
ATOM   627  C  C     . LEU A 1 80  ? 48.759 18.230  11.258  1.00 20.79 ? 77  LEU A C     1 
ATOM   628  O  O     . LEU A 1 80  ? 48.686 19.456  11.217  1.00 20.51 ? 77  LEU A O     1 
ATOM   629  C  CB    . LEU A 1 80  ? 47.451 17.447  13.212  1.00 13.85 ? 77  LEU A CB    1 
ATOM   630  C  CG    . LEU A 1 80  ? 47.319 16.630  14.486  1.00 15.61 ? 77  LEU A CG    1 
ATOM   631  C  CD1   . LEU A 1 80  ? 45.893 16.754  14.971  1.00 19.78 ? 77  LEU A CD1   1 
ATOM   632  C  CD2   . LEU A 1 80  ? 47.703 15.174  14.213  1.00 16.37 ? 77  LEU A CD2   1 
ATOM   633  N  N     . ALA A 1 81  ? 48.784 17.470  10.179  1.00 11.50 ? 78  ALA A N     1 
ATOM   634  C  CA    . ALA A 1 81  ? 48.504 18.010  8.852   1.00 11.90 ? 78  ALA A CA    1 
ATOM   635  C  C     . ALA A 1 81  ? 47.201 17.407  8.347   1.00 14.33 ? 78  ALA A C     1 
ATOM   636  O  O     . ALA A 1 81  ? 46.981 16.206  8.476   1.00 13.45 ? 78  ALA A O     1 
ATOM   637  C  CB    . ALA A 1 81  ? 49.651 17.710  7.902   1.00 13.88 ? 78  ALA A CB    1 
ATOM   638  N  N     . GLN A 1 82  ? 46.314 18.238  7.806   1.00 14.29 ? 79  GLN A N     1 
ATOM   639  C  CA    . GLN A 1 82  ? 45.005 17.764  7.356   1.00 15.11 ? 79  GLN A CA    1 
ATOM   640  C  C     . GLN A 1 82  ? 44.971 17.400  5.887   1.00 12.12 ? 79  GLN A C     1 
ATOM   641  O  O     . GLN A 1 82  ? 45.512 18.132  5.052   1.00 16.81 ? 79  GLN A O     1 
ATOM   642  C  CB    . GLN A 1 82  ? 43.923 18.826  7.586   1.00 16.11 ? 79  GLN A CB    1 
ATOM   643  C  CG    . GLN A 1 82  ? 43.681 19.204  9.017   1.00 19.62 ? 79  GLN A CG    1 
ATOM   644  C  CD    . GLN A 1 82  ? 42.454 20.080  9.145   1.00 25.37 ? 79  GLN A CD    1 
ATOM   645  O  OE1   . GLN A 1 82  ? 42.551 21.252  9.497   1.00 26.36 ? 79  GLN A OE1   1 
ATOM   646  N  NE2   . GLN A 1 82  ? 41.286 19.513  8.841   1.00 27.36 ? 79  GLN A NE2   1 
ATOM   647  N  N     . VAL A 1 83  ? 44.294 16.297  5.582   1.00 13.81 ? 80  VAL A N     1 
ATOM   648  C  CA    . VAL A 1 83  ? 43.988 15.939  4.200   1.00 12.93 ? 80  VAL A CA    1 
ATOM   649  C  C     . VAL A 1 83  ? 43.109 17.028  3.590   1.00 13.30 ? 80  VAL A C     1 
ATOM   650  O  O     . VAL A 1 83  ? 42.200 17.538  4.237   1.00 12.90 ? 80  VAL A O     1 
ATOM   651  C  CB    . VAL A 1 83  ? 43.272 14.574  4.107   1.00 14.03 ? 80  VAL A CB    1 
ATOM   652  C  CG1   . VAL A 1 83  ? 42.830 14.263  2.683   1.00 13.33 ? 80  VAL A CG1   1 
ATOM   653  C  CG2   . VAL A 1 83  ? 44.165 13.448  4.667   1.00 13.06 ? 80  VAL A CG2   1 
ATOM   654  N  N     . ARG A 1 84  ? 43.414 17.378  2.349   1.00 12.50 ? 81  ARG A N     1 
ATOM   655  C  CA    . ARG A 1 84  ? 42.645 18.382  1.627   1.00 12.90 ? 81  ARG A CA    1 
ATOM   656  C  C     . ARG A 1 84  ? 41.181 17.971  1.524   1.00 15.51 ? 81  ARG A C     1 
ATOM   657  O  O     . ARG A 1 84  ? 40.865 16.786  1.398   1.00 13.12 ? 81  ARG A O     1 
ATOM   658  C  CB    . ARG A 1 84  ? 43.241 18.578  0.235   1.00 18.78 ? 81  ARG A CB    1 
ATOM   659  C  CG    . ARG A 1 84  ? 42.398 19.455  -0.688  1.00 19.61 ? 81  ARG A CG    1 
ATOM   660  C  CD    . ARG A 1 84  ? 43.109 19.680  -2.018  1.00 28.20 ? 81  ARG A CD    1 
ATOM   661  N  NE    . ARG A 1 84  ? 42.180 20.037  -3.087  1.00 38.64 ? 81  ARG A NE    1 
ATOM   662  C  CZ    . ARG A 1 84  ? 42.457 19.934  -4.384  1.00 42.75 ? 81  ARG A CZ    1 
ATOM   663  N  NH1   . ARG A 1 84  ? 43.643 19.491  -4.779  1.00 40.71 ? 81  ARG A NH1   1 
ATOM   664  N  NH2   . ARG A 1 84  ? 41.545 20.275  -5.290  1.00 37.76 ? 81  ARG A NH2   1 
ATOM   665  N  N     . GLU A 1 85  ? 40.285 18.951  1.598   1.00 13.52 ? 82  GLU A N     1 
ATOM   666  C  CA    . GLU A 1 85  ? 38.892 18.695  1.328   1.00 15.37 ? 82  GLU A CA    1 
ATOM   667  C  C     . GLU A 1 85  ? 38.465 19.484  0.108   1.00 14.71 ? 82  GLU A C     1 
ATOM   668  O  O     . GLU A 1 85  ? 38.767 20.677  -0.008  1.00 18.87 ? 82  GLU A O     1 
ATOM   669  C  CB    . GLU A 1 85  ? 38.040 19.033  2.552   1.00 17.86 ? 82  GLU A CB    1 
ATOM   670  C  CG    . GLU A 1 85  ? 38.126 17.927  3.600   1.00 19.64 ? 82  GLU A CG    1 
ATOM   671  C  CD    . GLU A 1 85  ? 37.422 18.259  4.908   1.00 26.58 ? 82  GLU A CD    1 
ATOM   672  O  OE1   . GLU A 1 85  ? 36.217 18.623  4.893   1.00 28.36 ? 82  GLU A OE1   1 
ATOM   673  O  OE2   . GLU A 1 85  ? 38.082 18.129  5.959   1.00 26.11 ? 82  GLU A OE2   1 
ATOM   674  N  N     . SER A 1 86  ? 37.802 18.786  -0.818  1.00 13.85 ? 83  SER A N     1 
ATOM   675  C  CA    . SER A 1 86  ? 37.213 19.387  -2.005  1.00 15.08 ? 83  SER A CA    1 
ATOM   676  C  C     . SER A 1 86  ? 35.847 18.782  -2.253  1.00 17.71 ? 83  SER A C     1 
ATOM   677  O  O     . SER A 1 86  ? 35.655 17.575  -2.067  1.00 16.72 ? 83  SER A O     1 
ATOM   678  C  CB    . SER A 1 86  ? 38.094 19.167  -3.229  1.00 16.37 ? 83  SER A CB    1 
ATOM   679  O  OG    . SER A 1 86  ? 39.395 19.663  -2.993  1.00 27.36 ? 83  SER A OG    1 
ATOM   680  N  N     . ARG A 1 87  ? 34.906 19.624  -2.679  1.00 18.70 ? 84  ARG A N     1 
ATOM   681  C  CA    . ARG A 1 87  ? 33.527 19.199  -2.926  1.00 19.83 ? 84  ARG A CA    1 
ATOM   682  C  C     . ARG A 1 87  ? 32.936 18.421  -1.765  1.00 16.50 ? 84  ARG A C     1 
ATOM   683  O  O     . ARG A 1 87  ? 32.175 17.467  -1.961  1.00 20.26 ? 84  ARG A O     1 
ATOM   684  C  CB    . ARG A 1 87  ? 33.441 18.367  -4.207  1.00 21.28 ? 84  ARG A CB    1 
ATOM   685  C  CG    . ARG A 1 87  ? 34.099 19.026  -5.397  1.00 27.27 ? 84  ARG A CG    1 
ATOM   686  C  CD    . ARG A 1 87  ? 33.944 18.163  -6.638  1.00 25.12 ? 84  ARG A CD    1 
ATOM   687  N  NE    . ARG A 1 87  ? 34.844 18.588  -7.706  1.00 34.42 ? 84  ARG A NE    1 
ATOM   688  C  CZ    . ARG A 1 87  ? 36.142 18.298  -7.745  1.00 34.18 ? 84  ARG A CZ    1 
ATOM   689  N  NH1   . ARG A 1 87  ? 36.711 17.596  -6.761  1.00 32.10 ? 84  ARG A NH1   1 
ATOM   690  N  NH2   . ARG A 1 87  ? 36.881 18.730  -8.758  1.00 36.19 ? 84  ARG A NH2   1 
ATOM   691  N  N     . GLY A 1 88  ? 33.285 18.829  -0.551  1.00 16.04 ? 85  GLY A N     1 
ATOM   692  C  CA    . GLY A 1 88  ? 32.686 18.261  0.645   1.00 17.85 ? 85  GLY A CA    1 
ATOM   693  C  C     . GLY A 1 88  ? 33.298 16.964  1.155   1.00 16.75 ? 85  GLY A C     1 
ATOM   694  O  O     . GLY A 1 88  ? 32.800 16.366  2.107   1.00 17.45 ? 85  GLY A O     1 
ATOM   695  N  N     . LYS A 1 89  ? 34.392 16.535  0.534   1.00 14.57 ? 86  LYS A N     1 
ATOM   696  C  CA    . LYS A 1 89  ? 34.999 15.250  0.878   1.00 12.77 ? 86  LYS A CA    1 
ATOM   697  C  C     . LYS A 1 89  ? 36.528 15.295  0.915   1.00 13.07 ? 86  LYS A C     1 
ATOM   698  O  O     . LYS A 1 89  ? 37.157 16.171  0.338   1.00 12.15 ? 86  LYS A O     1 
ATOM   699  C  CB    . LYS A 1 89  ? 34.537 14.178  -0.113  1.00 15.58 ? 86  LYS A CB    1 
ATOM   700  C  CG    . LYS A 1 89  ? 35.049 14.365  -1.534  1.00 16.83 ? 86  LYS A CG    1 
ATOM   701  C  CD    . LYS A 1 89  ? 34.568 13.252  -2.474  1.00 18.13 ? 86  LYS A CD    1 
ATOM   702  C  CE    . LYS A 1 89  ? 35.117 11.885  -2.074  1.00 20.05 ? 86  LYS A CE    1 
ATOM   703  N  NZ    . LYS A 1 89  ? 36.591 11.796  -2.236  1.00 16.15 ? 86  LYS A NZ    1 
ATOM   704  N  N     . ALA A 1 90  ? 37.121 14.345  1.618   1.00 14.01 ? 87  ALA A N     1 
ATOM   705  C  CA    . ALA A 1 90  ? 38.568 14.204  1.604   1.00 14.47 ? 87  ALA A CA    1 
ATOM   706  C  C     . ALA A 1 90  ? 39.027 13.976  0.175   1.00 16.29 ? 87  ALA A C     1 
ATOM   707  O  O     . ALA A 1 90  ? 38.362 13.274  -0.590  1.00 15.92 ? 87  ALA A O     1 
ATOM   708  C  CB    . ALA A 1 90  ? 39.002 13.059  2.500   1.00 15.90 ? 87  ALA A CB    1 
ATOM   709  N  N     . ASN A 1 91  ? 40.144 14.594  -0.187  1.00 12.61 ? 88  ASN A N     1 
ATOM   710  C  CA    . ASN A 1 91  ? 40.666 14.478  -1.545  1.00 15.60 ? 88  ASN A CA    1 
ATOM   711  C  C     . ASN A 1 91  ? 42.127 14.053  -1.473  1.00 14.49 ? 88  ASN A C     1 
ATOM   712  O  O     . ASN A 1 91  ? 42.944 14.765  -0.899  1.00 14.15 ? 88  ASN A O     1 
ATOM   713  C  CB    . ASN A 1 91  ? 40.526 15.800  -2.301  1.00 17.63 ? 88  ASN A CB    1 
ATOM   714  C  CG    . ASN A 1 91  ? 40.886 15.664  -3.767  1.00 21.22 ? 88  ASN A CG    1 
ATOM   715  O  OD1   . ASN A 1 91  ? 42.017 15.358  -4.096  1.00 15.38 ? 88  ASN A OD1   1 
ATOM   716  N  ND2   . ASN A 1 91  ? 39.919 15.897  -4.655  1.00 24.62 ? 88  ASN A ND2   1 
ATOM   717  N  N     . LEU A 1 92  ? 42.457 12.889  -2.025  1.00 12.69 ? 89  LEU A N     1 
ATOM   718  C  CA    . LEU A 1 92  ? 43.799 12.338  -1.815  1.00 11.56 ? 89  LEU A CA    1 
ATOM   719  C  C     . LEU A 1 92  ? 44.774 12.641  -2.963  1.00 13.24 ? 89  LEU A C     1 
ATOM   720  O  O     . LEU A 1 92  ? 45.809 11.995  -3.079  1.00 12.33 ? 89  LEU A O     1 
ATOM   721  C  CB    . LEU A 1 92  ? 43.717 10.824  -1.585  1.00 13.62 ? 89  LEU A CB    1 
ATOM   722  C  CG    . LEU A 1 92  ? 42.734 10.375  -0.496  1.00 12.94 ? 89  LEU A CG    1 
ATOM   723  C  CD1   . LEU A 1 92  ? 42.590 8.876   -0.469  1.00 14.67 ? 89  LEU A CD1   1 
ATOM   724  C  CD2   . LEU A 1 92  ? 43.211 10.902  0.865   1.00 16.86 ? 89  LEU A CD2   1 
ATOM   725  N  N     . THR A 1 93  ? 44.472 13.648  -3.780  1.00 12.08 ? 90  THR A N     1 
ATOM   726  C  CA    . THR A 1 93  ? 45.282 13.907  -4.972  1.00 11.81 ? 90  THR A CA    1 
ATOM   727  C  C     . THR A 1 93  ? 46.765 14.177  -4.692  1.00 12.95 ? 90  THR A C     1 
ATOM   728  O  O     . THR A 1 93  ? 47.621 13.667  -5.421  1.00 14.09 ? 90  THR A O     1 
ATOM   729  C  CB    . THR A 1 93  ? 44.693 15.078  -5.784  1.00 16.33 ? 90  THR A CB    1 
ATOM   730  O  OG1   . THR A 1 93  ? 43.377 14.715  -6.218  1.00 18.33 ? 90  THR A OG1   1 
ATOM   731  C  CG2   . THR A 1 93  ? 45.554 15.390  -7.005  1.00 16.93 ? 90  THR A CG2   1 
ATOM   732  N  N     . LYS A 1 94  ? 47.086 14.937  -3.640  1.00 11.11 ? 91  LYS A N     1 
ATOM   733  C  CA    . LYS A 1 94  ? 48.480 15.244  -3.345  1.00 11.94 ? 91  LYS A CA    1 
ATOM   734  C  C     . LYS A 1 94  ? 49.315 13.973  -3.158  1.00 12.60 ? 91  LYS A C     1 
ATOM   735  O  O     . LYS A 1 94  ? 50.477 13.913  -3.584  1.00 13.16 ? 91  LYS A O     1 
ATOM   736  C  CB    . LYS A 1 94  ? 48.580 16.131  -2.095  1.00 12.43 ? 91  LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 94  ? 49.986 16.649  -1.796  1.00 13.47 ? 91  LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 94  ? 50.101 17.147  -0.356  1.00 16.65 ? 91  LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 94  ? 49.150 18.298  -0.107  1.00 20.09 ? 91  LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 94  ? 49.304 18.846  1.255   1.00 12.08 ? 91  LYS A NZ    1 
ATOM   741  N  N     . TYR A 1 95  ? 48.711 12.957  -2.553  1.00 11.47 ? 92  TYR A N     1 
ATOM   742  C  CA    . TYR A 1 95  ? 49.422 11.718  -2.225  1.00 10.21 ? 92  TYR A CA    1 
ATOM   743  C  C     . TYR A 1 95  ? 49.485 10.819  -3.435  1.00 13.21 ? 92  TYR A C     1 
ATOM   744  O  O     . TYR A 1 95  ? 50.488 10.133  -3.643  1.00 11.65 ? 92  TYR A O     1 
ATOM   745  C  CB    . TYR A 1 95  ? 48.749 11.000  -1.036  1.00 8.85  ? 92  TYR A CB    1 
ATOM   746  C  CG    . TYR A 1 95  ? 48.433 11.984  0.065   1.00 10.06 ? 92  TYR A CG    1 
ATOM   747  C  CD1   . TYR A 1 95  ? 47.127 12.379  0.300   1.00 12.01 ? 92  TYR A CD1   1 
ATOM   748  C  CD2   . TYR A 1 95  ? 49.454 12.606  0.792   1.00 10.69 ? 92  TYR A CD2   1 
ATOM   749  C  CE1   . TYR A 1 95  ? 46.826 13.332  1.276   1.00 11.82 ? 92  TYR A CE1   1 
ATOM   750  C  CE2   . TYR A 1 95  ? 49.167 13.546  1.769   1.00 10.89 ? 92  TYR A CE2   1 
ATOM   751  C  CZ    . TYR A 1 95  ? 47.843 13.907  1.995   1.00 10.79 ? 92  TYR A CZ    1 
ATOM   752  O  OH    . TYR A 1 95  ? 47.527 14.854  2.943   1.00 12.68 ? 92  TYR A OH    1 
ATOM   753  N  N     . ARG A 1 96  ? 48.436 10.840  -4.255  1.00 11.36 ? 93  ARG A N     1 
ATOM   754  C  CA    . ARG A 1 96  ? 48.486 10.082  -5.507  1.00 13.12 ? 93  ARG A CA    1 
ATOM   755  C  C     . ARG A 1 96  ? 49.566 10.648  -6.426  1.00 14.02 ? 93  ARG A C     1 
ATOM   756  O  O     . ARG A 1 96  ? 50.310 9.891   -7.083  1.00 13.82 ? 93  ARG A O     1 
ATOM   757  C  CB    . ARG A 1 96  ? 47.128 10.094  -6.225  1.00 12.59 ? 93  ARG A CB    1 
ATOM   758  C  CG    . ARG A 1 96  ? 46.060 9.276   -5.544  1.00 14.10 ? 93  ARG A CG    1 
ATOM   759  C  CD    . ARG A 1 96  ? 44.842 9.025   -6.431  1.00 14.16 ? 93  ARG A CD    1 
ATOM   760  N  NE    . ARG A 1 96  ? 43.811 8.332   -5.668  1.00 17.60 ? 93  ARG A NE    1 
ATOM   761  C  CZ    . ARG A 1 96  ? 42.793 8.934   -5.057  1.00 13.99 ? 93  ARG A CZ    1 
ATOM   762  N  NH1   . ARG A 1 96  ? 41.934 8.198   -4.356  1.00 14.66 ? 93  ARG A NH1   1 
ATOM   763  N  NH2   . ARG A 1 96  ? 42.634 10.260  -5.144  1.00 14.80 ? 93  ARG A NH2   1 
ATOM   764  N  N     . GLU A 1 97  ? 49.665 11.977  -6.490  1.00 12.28 ? 94  GLU A N     1 
ATOM   765  C  CA    . GLU A 1 97  ? 50.693 12.606  -7.324  1.00 13.19 ? 94  GLU A CA    1 
ATOM   766  C  C     . GLU A 1 97  ? 52.111 12.341  -6.778  1.00 12.76 ? 94  GLU A C     1 
ATOM   767  O  O     . GLU A 1 97  ? 53.030 12.099  -7.551  1.00 12.19 ? 94  GLU A O     1 
ATOM   768  C  CB    . GLU A 1 97  ? 50.424 14.111  -7.473  1.00 15.89 ? 94  GLU A CB    1 
ATOM   769  C  CG    . GLU A 1 97  ? 49.166 14.376  -8.295  1.00 20.68 ? 94  GLU A CG    1 
ATOM   770  C  CD    . GLU A 1 97  ? 48.811 15.847  -8.462  1.00 26.27 ? 94  GLU A CD    1 
ATOM   771  O  OE1   . GLU A 1 97  ? 49.369 16.715  -7.750  1.00 30.96 ? 94  GLU A OE1   1 
ATOM   772  O  OE2   . GLU A 1 97  ? 47.946 16.128  -9.321  1.00 24.76 ? 94  GLU A OE2   1 
ATOM   773  N  N     . ALA A 1 98  ? 52.278 12.337  -5.454  1.00 11.99 ? 95  ALA A N     1 
ATOM   774  C  CA    . ALA A 1 98  ? 53.577 12.010  -4.867  1.00 11.21 ? 95  ALA A CA    1 
ATOM   775  C  C     . ALA A 1 98  ? 53.937 10.562  -5.163  1.00 11.34 ? 95  ALA A C     1 
ATOM   776  O  O     . ALA A 1 98  ? 55.100 10.256  -5.398  1.00 12.01 ? 95  ALA A O     1 
ATOM   777  C  CB    . ALA A 1 98  ? 53.579 12.255  -3.367  1.00 9.05  ? 95  ALA A CB    1 
ATOM   778  N  N     . SER A 1 99  ? 52.934 9.684   -5.153  1.00 11.00 ? 96  SER A N     1 
ATOM   779  C  CA    . SER A 1 99  ? 53.129 8.281   -5.498  1.00 11.04 ? 96  SER A CA    1 
ATOM   780  C  C     . SER A 1 99  ? 53.680 8.140   -6.915  1.00 12.30 ? 96  SER A C     1 
ATOM   781  O  O     . SER A 1 99  ? 54.615 7.380   -7.152  1.00 12.66 ? 96  SER A O     1 
ATOM   782  C  CB    . SER A 1 99  ? 51.811 7.514   -5.372  1.00 13.87 ? 96  SER A CB    1 
ATOM   783  O  OG    . SER A 1 99  ? 51.966 6.164   -5.750  1.00 15.82 ? 96  SER A OG    1 
ATOM   784  N  N     . VAL A 1 100 ? 53.085 8.871   -7.851  1.00 10.29 ? 97  VAL A N     1 
ATOM   785  C  CA    . VAL A 1 100 ? 53.566 8.833   -9.237  1.00 12.71 ? 97  VAL A CA    1 
ATOM   786  C  C     . VAL A 1 100 ? 55.047 9.247   -9.338  1.00 11.67 ? 97  VAL A C     1 
ATOM   787  O  O     . VAL A 1 100 ? 55.818 8.641   -10.084 1.00 13.68 ? 97  VAL A O     1 
ATOM   788  C  CB    . VAL A 1 100 ? 52.679 9.717   -10.121 1.00 11.44 ? 97  VAL A CB    1 
ATOM   789  C  CG1   . VAL A 1 100 ? 53.324 9.944   -11.504 1.00 14.31 ? 97  VAL A CG1   1 
ATOM   790  C  CG2   . VAL A 1 100 ? 51.300 9.075   -10.268 1.00 14.46 ? 97  VAL A CG2   1 
ATOM   791  N  N     . GLU A 1 101 ? 55.474 10.233  -8.548  1.00 9.44  ? 98  GLU A N     1 
ATOM   792  C  CA    . GLU A 1 101 ? 56.885 10.626  -8.527  1.00 11.56 ? 98  GLU A CA    1 
ATOM   793  C  C     . GLU A 1 101 ? 57.795 9.444   -8.226  1.00 11.99 ? 98  GLU A C     1 
ATOM   794  O  O     . GLU A 1 101 ? 58.834 9.238   -8.863  1.00 13.19 ? 98  GLU A O     1 
ATOM   795  C  CB    . GLU A 1 101 ? 57.155 11.686  -7.458  1.00 12.38 ? 98  GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 101 ? 56.596 13.066  -7.714  1.00 16.03 ? 98  GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 101 ? 57.001 14.052  -6.624  1.00 14.04 ? 98  GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 101 ? 58.200 14.433  -6.557  1.00 14.65 ? 98  GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 101 ? 56.109 14.446  -5.835  1.00 16.68 ? 98  GLU A OE2   1 
ATOM   800  N  N     . VAL A 1 102 ? 57.416 8.688   -7.205  1.00 9.76  ? 99  VAL A N     1 
ATOM   801  C  CA    . VAL A 1 102 ? 58.244 7.583   -6.769  1.00 11.97 ? 99  VAL A CA    1 
ATOM   802  C  C     . VAL A 1 102 ? 58.189 6.427   -7.758  1.00 11.28 ? 99  VAL A C     1 
ATOM   803  O  O     . VAL A 1 102 ? 59.236 5.843   -8.092  1.00 15.16 ? 99  VAL A O     1 
ATOM   804  C  CB    . VAL A 1 102 ? 57.826 7.087   -5.373  1.00 12.09 ? 99  VAL A CB    1 
ATOM   805  C  CG1   . VAL A 1 102 ? 58.615 5.845   -5.012  1.00 18.38 ? 99  VAL A CG1   1 
ATOM   806  C  CG2   . VAL A 1 102 ? 58.040 8.201   -4.331  1.00 11.76 ? 99  VAL A CG2   1 
ATOM   807  N  N     . MET A 1 103 ? 56.982 6.092   -8.219  1.00 10.25 ? 100 MET A N     1 
ATOM   808  C  CA    . MET A 1 103 ? 56.801 5.000   -9.166  1.00 11.00 ? 100 MET A CA    1 
ATOM   809  C  C     . MET A 1 103 ? 57.574 5.254   -10.454 1.00 13.56 ? 100 MET A C     1 
ATOM   810  O  O     . MET A 1 103 ? 58.140 4.321   -11.015 1.00 14.47 ? 100 MET A O     1 
ATOM   811  C  CB    . MET A 1 103 ? 55.315 4.785   -9.478  1.00 17.49 ? 100 MET A CB    1 
ATOM   812  C  CG    . MET A 1 103 ? 54.440 4.517   -8.258  1.00 18.93 ? 100 MET A CG    1 
ATOM   813  S  SD    . MET A 1 103 ? 54.847 2.943   -7.481  1.00 19.12 ? 100 MET A SD    1 
ATOM   814  C  CE    . MET A 1 103 ? 53.955 3.036   -5.898  1.00 15.75 ? 100 MET A CE    1 
ATOM   815  N  N     . GLU A 1 104 ? 57.641 6.508   -10.913 1.00 10.99 ? 101 GLU A N     1 
ATOM   816  C  CA    . GLU A 1 104 ? 58.360 6.764   -12.162 1.00 14.31 ? 101 GLU A CA    1 
ATOM   817  C  C     . GLU A 1 104 ? 59.884 6.589   -12.006 1.00 13.55 ? 101 GLU A C     1 
ATOM   818  O  O     . GLU A 1 104 ? 60.558 6.111   -12.927 1.00 15.86 ? 101 GLU A O     1 
ATOM   819  C  CB    . GLU A 1 104 ? 57.994 8.161   -12.700 1.00 14.55 ? 101 GLU A CB    1 
ATOM   820  C  CG    . GLU A 1 104 ? 56.533 8.207   -13.189 1.00 20.60 ? 101 GLU A CG    1 
ATOM   821  C  CD    . GLU A 1 104 ? 56.161 9.493   -13.922 1.00 28.92 ? 101 GLU A CD    1 
ATOM   822  O  OE1   . GLU A 1 104 ? 56.933 10.474  -13.856 1.00 27.95 ? 101 GLU A OE1   1 
ATOM   823  O  OE2   . GLU A 1 104 ? 55.083 9.517   -14.558 1.00 27.89 ? 101 GLU A OE2   1 
ATOM   824  N  N     . ILE A 1 105 ? 60.424 6.952   -10.850 1.00 11.23 ? 102 ILE A N     1 
ATOM   825  C  CA    . ILE A 1 105 ? 61.848 6.731   -10.568 1.00 12.45 ? 102 ILE A CA    1 
ATOM   826  C  C     . ILE A 1 105 ? 62.144 5.234   -10.506 1.00 13.49 ? 102 ILE A C     1 
ATOM   827  O  O     . ILE A 1 105 ? 63.076 4.741   -11.144 1.00 14.56 ? 102 ILE A O     1 
ATOM   828  C  CB    . ILE A 1 105 ? 62.267 7.422   -9.255  1.00 12.42 ? 102 ILE A CB    1 
ATOM   829  C  CG1   . ILE A 1 105 ? 62.169 8.943   -9.390  1.00 12.30 ? 102 ILE A CG1   1 
ATOM   830  C  CG2   . ILE A 1 105 ? 63.684 7.037   -8.861  1.00 13.27 ? 102 ILE A CG2   1 
ATOM   831  C  CD1   . ILE A 1 105 ? 62.204 9.640   -8.053  1.00 15.66 ? 102 ILE A CD1   1 
ATOM   832  N  N     . MET A 1 106 ? 61.317 4.494   -9.781  1.00 13.16 ? 103 MET A N     1 
ATOM   833  C  CA    . MET A 1 106 ? 61.537 3.054   -9.691  1.00 13.36 ? 103 MET A CA    1 
ATOM   834  C  C     . MET A 1 106 ? 61.515 2.398   -11.059 1.00 14.44 ? 103 MET A C     1 
ATOM   835  O  O     . MET A 1 106 ? 62.308 1.487   -11.327 1.00 16.16 ? 103 MET A O     1 
ATOM   836  C  CB    . MET A 1 106 ? 60.491 2.412   -8.778  1.00 13.05 ? 103 MET A CB    1 
ATOM   837  C  CG    A MET A 1 106 ? 60.556 2.786   -7.316  0.57 12.33 ? 103 MET A CG    1 
ATOM   838  C  CG    B MET A 1 106 ? 60.864 2.664   -7.318  0.43 12.01 ? 103 MET A CG    1 
ATOM   839  S  SD    A MET A 1 106 ? 59.312 1.801   -6.432  0.57 13.70 ? 103 MET A SD    1 
ATOM   840  S  SD    B MET A 1 106 ? 59.842 1.796   -6.126  0.43 16.41 ? 103 MET A SD    1 
ATOM   841  C  CE    A MET A 1 106 ? 59.831 0.131   -6.816  0.57 15.92 ? 103 MET A CE    1 
ATOM   842  C  CE    B MET A 1 106 ? 58.263 2.564   -6.458  0.43 15.65 ? 103 MET A CE    1 
ATOM   843  N  N     . SER A 1 107 ? 60.622 2.867   -11.930 1.00 13.01 ? 104 SER A N     1 
ATOM   844  C  CA    A SER A 1 107 ? 60.454 2.268   -13.252 0.27 16.45 ? 104 SER A CA    1 
ATOM   845  C  CA    B SER A 1 107 ? 60.454 2.270   -13.251 0.73 16.40 ? 104 SER A CA    1 
ATOM   846  C  C     . SER A 1 107 ? 61.698 2.401   -14.132 1.00 18.55 ? 104 SER A C     1 
ATOM   847  O  O     . SER A 1 107 ? 61.822 1.691   -15.137 1.00 19.48 ? 104 SER A O     1 
ATOM   848  C  CB    A SER A 1 107 ? 59.251 2.885   -13.972 0.27 17.17 ? 104 SER A CB    1 
ATOM   849  C  CB    B SER A 1 107 ? 59.248 2.890   -13.963 0.73 17.11 ? 104 SER A CB    1 
ATOM   850  O  OG    A SER A 1 107 ? 59.417 4.279   -14.147 0.27 18.95 ? 104 SER A OG    1 
ATOM   851  O  OG    B SER A 1 107 ? 58.047 2.547   -13.298 0.73 19.56 ? 104 SER A OG    1 
ATOM   852  N  N     . ARG A 1 108 ? 62.614 3.299   -13.765 1.00 14.76 ? 105 ARG A N     1 
ATOM   853  C  CA    . ARG A 1 108 ? 63.873 3.472   -14.517 1.00 17.64 ? 105 ARG A CA    1 
ATOM   854  C  C     . ARG A 1 108 ? 64.782 2.261   -14.339 1.00 23.37 ? 105 ARG A C     1 
ATOM   855  O  O     . ARG A 1 108 ? 65.604 1.947   -15.210 1.00 23.19 ? 105 ARG A O     1 
ATOM   856  C  CB    . ARG A 1 108 ? 64.646 4.719   -14.069 1.00 18.44 ? 105 ARG A CB    1 
ATOM   857  C  CG    . ARG A 1 108 ? 63.955 6.052   -14.292 1.00 17.94 ? 105 ARG A CG    1 
ATOM   858  C  CD    . ARG A 1 108 ? 64.954 7.209   -14.484 1.00 21.32 ? 105 ARG A CD    1 
ATOM   859  N  NE    . ARG A 1 108 ? 65.970 7.338   -13.437 1.00 23.67 ? 105 ARG A NE    1 
ATOM   860  C  CZ    . ARG A 1 108 ? 65.892 8.195   -12.419 1.00 19.99 ? 105 ARG A CZ    1 
ATOM   861  N  NH1   . ARG A 1 108 ? 66.857 8.248   -11.513 1.00 23.83 ? 105 ARG A NH1   1 
ATOM   862  N  NH2   . ARG A 1 108 ? 64.846 8.991   -12.305 1.00 19.17 ? 105 ARG A NH2   1 
ATOM   863  N  N     . PHE A 1 109 ? 64.654 1.602   -13.189 1.00 22.62 ? 106 PHE A N     1 
ATOM   864  C  CA    . PHE A 1 109 ? 65.543 0.492   -12.844 1.00 22.85 ? 106 PHE A CA    1 
ATOM   865  C  C     . PHE A 1 109 ? 65.000 -0.838  -13.327 1.00 26.75 ? 106 PHE A C     1 
ATOM   866  O  O     . PHE A 1 109 ? 65.763 -1.726  -13.715 1.00 31.97 ? 106 PHE A O     1 
ATOM   867  C  CB    . PHE A 1 109 ? 65.764 0.441   -11.334 1.00 16.70 ? 106 PHE A CB    1 
ATOM   868  C  CG    . PHE A 1 109 ? 66.495 1.625   -10.799 1.00 21.27 ? 106 PHE A CG    1 
ATOM   869  C  CD1   . PHE A 1 109 ? 65.833 2.818   -10.567 1.00 18.35 ? 106 PHE A CD1   1 
ATOM   870  C  CD2   . PHE A 1 109 ? 67.850 1.549   -10.514 1.00 15.78 ? 106 PHE A CD2   1 
ATOM   871  C  CE1   . PHE A 1 109 ? 66.501 3.920   -10.071 1.00 17.42 ? 106 PHE A CE1   1 
ATOM   872  C  CE2   . PHE A 1 109 ? 68.527 2.645   -10.013 1.00 20.98 ? 106 PHE A CE2   1 
ATOM   873  C  CZ    . PHE A 1 109 ? 67.856 3.838   -9.792  1.00 18.19 ? 106 PHE A CZ    1 
ATOM   874  N  N     . ALA A 1 110 ? 63.680 -0.972  -13.297 1.00 21.85 ? 107 ALA A N     1 
ATOM   875  C  CA    . ALA A 1 110 ? 63.018 -2.212  -13.672 1.00 21.58 ? 107 ALA A CA    1 
ATOM   876  C  C     . ALA A 1 110 ? 61.521 -2.029  -13.828 1.00 27.15 ? 107 ALA A C     1 
ATOM   877  O  O     . ALA A 1 110 ? 60.954 -1.030  -13.403 1.00 23.93 ? 107 ALA A O     1 
ATOM   878  C  CB    . ALA A 1 110 ? 63.303 -3.301  -12.640 1.00 26.39 ? 107 ALA A CB    1 
ATOM   879  N  N     . VAL A 1 111 ? 60.892 -3.008  -14.462 1.00 25.04 ? 108 VAL A N     1 
ATOM   880  C  CA    . VAL A 1 111 ? 59.443 -3.087  -14.557 1.00 28.04 ? 108 VAL A CA    1 
ATOM   881  C  C     . VAL A 1 111 ? 58.846 -3.262  -13.151 1.00 24.52 ? 108 VAL A C     1 
ATOM   882  O  O     . VAL A 1 111 ? 59.306 -4.108  -12.388 1.00 27.65 ? 108 VAL A O     1 
ATOM   883  C  CB    . VAL A 1 111 ? 59.030 -4.257  -15.475 1.00 37.41 ? 108 VAL A CB    1 
ATOM   884  C  CG1   . VAL A 1 111 ? 57.699 -4.860  -15.043 1.00 30.84 ? 108 VAL A CG1   1 
ATOM   885  C  CG2   . VAL A 1 111 ? 59.001 -3.803  -16.933 1.00 42.33 ? 108 VAL A CG2   1 
ATOM   886  N  N     . ILE A 1 112 ? 57.848 -2.451  -12.796 1.00 23.10 ? 109 ILE A N     1 
ATOM   887  C  CA    . ILE A 1 112 ? 57.293 -2.535  -11.442 1.00 18.18 ? 109 ILE A CA    1 
ATOM   888  C  C     . ILE A 1 112 ? 55.816 -2.915  -11.399 1.00 15.81 ? 109 ILE A C     1 
ATOM   889  O  O     . ILE A 1 112 ? 55.080 -2.741  -12.367 1.00 17.80 ? 109 ILE A O     1 
ATOM   890  C  CB    . ILE A 1 112 ? 57.480 -1.197  -10.661 1.00 19.30 ? 109 ILE A CB    1 
ATOM   891  C  CG1   . ILE A 1 112 ? 56.485 -0.130  -11.126 1.00 24.19 ? 109 ILE A CG1   1 
ATOM   892  C  CG2   . ILE A 1 112 ? 58.936 -0.747  -10.712 1.00 21.81 ? 109 ILE A CG2   1 
ATOM   893  C  CD1   . ILE A 1 112 ? 56.542 1.166   -10.308 1.00 20.11 ? 109 ILE A CD1   1 
ATOM   894  N  N     . GLU A 1 113 ? 55.402 -3.485  -10.271 1.00 12.74 ? 110 GLU A N     1 
ATOM   895  C  CA    . GLU A 1 113 ? 53.988 -3.724  -9.979  1.00 12.03 ? 110 GLU A CA    1 
ATOM   896  C  C     . GLU A 1 113 ? 53.551 -2.786  -8.860  1.00 13.48 ? 110 GLU A C     1 
ATOM   897  O  O     . GLU A 1 113 ? 54.033 -2.905  -7.740  1.00 13.87 ? 110 GLU A O     1 
ATOM   898  C  CB    . GLU A 1 113 ? 53.722 -5.181  -9.550  1.00 11.53 ? 110 GLU A CB    1 
ATOM   899  C  CG    . GLU A 1 113 ? 52.268 -5.435  -9.158  1.00 12.96 ? 110 GLU A CG    1 
ATOM   900  C  CD    . GLU A 1 113 ? 51.971 -6.880  -8.758  1.00 20.29 ? 110 GLU A CD    1 
ATOM   901  O  OE1   . GLU A 1 113 ? 50.865 -7.120  -8.215  1.00 23.59 ? 110 GLU A OE1   1 
ATOM   902  O  OE2   . GLU A 1 113 ? 52.817 -7.772  -8.998  1.00 17.62 ? 110 GLU A OE2   1 
ATOM   903  N  N     . ARG A 1 114 ? 52.652 -1.854  -9.159  1.00 13.15 ? 111 ARG A N     1 
ATOM   904  C  CA    . ARG A 1 114 ? 52.118 -0.963  -8.127  1.00 12.08 ? 111 ARG A CA    1 
ATOM   905  C  C     . ARG A 1 114 ? 51.214 -1.762  -7.201  1.00 15.37 ? 111 ARG A C     1 
ATOM   906  O  O     . ARG A 1 114 ? 50.146 -2.224  -7.606  1.00 22.41 ? 111 ARG A O     1 
ATOM   907  C  CB    . ARG A 1 114 ? 51.351 0.202   -8.762  1.00 13.82 ? 111 ARG A CB    1 
ATOM   908  C  CG    . ARG A 1 114 ? 50.733 1.185   -7.763  1.00 14.31 ? 111 ARG A CG    1 
ATOM   909  C  CD    . ARG A 1 114 ? 49.694 2.061   -8.467  1.00 14.21 ? 111 ARG A CD    1 
ATOM   910  N  NE    . ARG A 1 114 ? 49.342 3.258   -7.707  1.00 17.77 ? 111 ARG A NE    1 
ATOM   911  C  CZ    . ARG A 1 114 ? 48.389 3.322   -6.781  1.00 20.19 ? 111 ARG A CZ    1 
ATOM   912  N  NH1   . ARG A 1 114 ? 47.667 2.250   -6.465  1.00 23.64 ? 111 ARG A NH1   1 
ATOM   913  N  NH2   . ARG A 1 114 ? 48.162 4.475   -6.164  1.00 18.90 ? 111 ARG A NH2   1 
ATOM   914  N  N     . ALA A 1 115 ? 51.650 -1.953  -5.963  1.00 11.97 ? 112 ALA A N     1 
ATOM   915  C  CA    . ALA A 1 115 ? 50.906 -2.760  -5.015  1.00 11.32 ? 112 ALA A CA    1 
ATOM   916  C  C     . ALA A 1 115 ? 49.977 -1.924  -4.125  1.00 15.08 ? 112 ALA A C     1 
ATOM   917  O  O     . ALA A 1 115 ? 48.977 -2.426  -3.600  1.00 17.67 ? 112 ALA A O     1 
ATOM   918  C  CB    . ALA A 1 115 ? 51.864 -3.558  -4.162  1.00 14.04 ? 112 ALA A CB    1 
ATOM   919  N  N     . SER A 1 116 ? 50.331 -0.660  -3.942  1.00 13.04 ? 113 SER A N     1 
ATOM   920  C  CA    . SER A 1 116 ? 49.523 0.276   -3.171  1.00 15.44 ? 113 SER A CA    1 
ATOM   921  C  C     . SER A 1 116 ? 49.947 1.693   -3.533  1.00 12.74 ? 113 SER A C     1 
ATOM   922  O  O     . SER A 1 116 ? 50.818 1.883   -4.374  1.00 13.26 ? 113 SER A O     1 
ATOM   923  C  CB    . SER A 1 116 ? 49.685 0.061   -1.666  1.00 16.88 ? 113 SER A CB    1 
ATOM   924  O  OG    . SER A 1 116 ? 50.902 0.624   -1.213  1.00 18.10 ? 113 SER A OG    1 
ATOM   925  N  N     . ILE A 1 117 ? 49.371 2.690   -2.871  1.00 12.98 ? 114 ILE A N     1 
ATOM   926  C  CA    . ILE A 1 117 ? 49.756 4.064   -3.147  1.00 10.63 ? 114 ILE A CA    1 
ATOM   927  C  C     . ILE A 1 117 ? 51.246 4.317   -2.827  1.00 11.28 ? 114 ILE A C     1 
ATOM   928  O  O     . ILE A 1 117 ? 51.850 5.235   -3.363  1.00 13.04 ? 114 ILE A O     1 
ATOM   929  C  CB    . ILE A 1 117 ? 48.859 5.051   -2.362  1.00 10.96 ? 114 ILE A CB    1 
ATOM   930  C  CG1   . ILE A 1 117 ? 48.976 6.453   -2.963  1.00 11.40 ? 114 ILE A CG1   1 
ATOM   931  C  CG2   . ILE A 1 117 ? 49.205 5.034   -0.879  1.00 14.32 ? 114 ILE A CG2   1 
ATOM   932  C  CD1   . ILE A 1 117 ? 47.871 7.395   -2.513  1.00 12.97 ? 114 ILE A CD1   1 
ATOM   933  N  N     . ASP A 1 118 ? 51.848 3.505   -1.956  1.00 10.56 ? 115 ASP A N     1 
ATOM   934  C  CA    . ASP A 1 118 ? 53.218 3.816   -1.560  1.00 12.97 ? 115 ASP A CA    1 
ATOM   935  C  C     . ASP A 1 118 ? 54.161 2.623   -1.628  1.00 12.69 ? 115 ASP A C     1 
ATOM   936  O  O     . ASP A 1 118 ? 55.234 2.634   -0.999  1.00 14.02 ? 115 ASP A O     1 
ATOM   937  C  CB    . ASP A 1 118 ? 53.235 4.415   -0.152  1.00 11.44 ? 115 ASP A CB    1 
ATOM   938  C  CG    . ASP A 1 118 ? 53.285 3.367   0.933   1.00 13.14 ? 115 ASP A CG    1 
ATOM   939  O  OD1   . ASP A 1 118 ? 52.648 2.292   0.788   1.00 14.41 ? 115 ASP A OD1   1 
ATOM   940  O  OD2   . ASP A 1 118 ? 54.017 3.613   1.918   1.00 13.88 ? 115 ASP A OD2   1 
ATOM   941  N  N     . GLU A 1 119 ? 53.795 1.605   -2.395  1.00 11.34 ? 116 GLU A N     1 
ATOM   942  C  CA    . GLU A 1 119 ? 54.725 0.503   -2.529  1.00 14.25 ? 116 GLU A CA    1 
ATOM   943  C  C     . GLU A 1 119 ? 54.615 -0.223  -3.844  1.00 11.09 ? 116 GLU A C     1 
ATOM   944  O  O     . GLU A 1 119 ? 53.571 -0.229  -4.509  1.00 13.04 ? 116 GLU A O     1 
ATOM   945  C  CB    . GLU A 1 119 ? 54.554 -0.473  -1.384  1.00 20.43 ? 116 GLU A CB    1 
ATOM   946  C  CG    . GLU A 1 119 ? 53.426 -1.426  -1.525  1.00 16.38 ? 116 GLU A CG    1 
ATOM   947  C  CD    . GLU A 1 119 ? 52.998 -1.957  -0.166  1.00 27.47 ? 116 GLU A CD    1 
ATOM   948  O  OE1   . GLU A 1 119 ? 53.396 -3.081  0.199   1.00 27.40 ? 116 GLU A OE1   1 
ATOM   949  O  OE2   . GLU A 1 119 ? 52.276 -1.233  0.545   1.00 27.19 ? 116 GLU A OE2   1 
ATOM   950  N  N     . ALA A 1 120 ? 55.747 -0.787  -4.242  1.00 11.26 ? 117 ALA A N     1 
ATOM   951  C  CA    . ALA A 1 120 ? 55.818 -1.471  -5.512  1.00 10.84 ? 117 ALA A CA    1 
ATOM   952  C  C     . ALA A 1 120 ? 56.777 -2.643  -5.441  1.00 12.20 ? 117 ALA A C     1 
ATOM   953  O  O     . ALA A 1 120 ? 57.813 -2.569  -4.772  1.00 11.65 ? 117 ALA A O     1 
ATOM   954  C  CB    . ALA A 1 120 ? 56.249 -0.501  -6.619  1.00 15.54 ? 117 ALA A CB    1 
ATOM   955  N  N     . TYR A 1 121 ? 56.433 -3.706  -6.157  1.00 11.28 ? 118 TYR A N     1 
ATOM   956  C  CA    . TYR A 1 121 ? 57.349 -4.828  -6.341  1.00 10.38 ? 118 TYR A CA    1 
ATOM   957  C  C     . TYR A 1 121 ? 58.188 -4.596  -7.574  1.00 12.58 ? 118 TYR A C     1 
ATOM   958  O  O     . TYR A 1 121 ? 57.721 -4.008  -8.552  1.00 15.29 ? 118 TYR A O     1 
ATOM   959  C  CB    . TYR A 1 121 ? 56.588 -6.152  -6.462  1.00 10.38 ? 118 TYR A CB    1 
ATOM   960  C  CG    . TYR A 1 121 ? 55.891 -6.538  -5.178  1.00 11.20 ? 118 TYR A CG    1 
ATOM   961  C  CD1   . TYR A 1 121 ? 54.565 -6.195  -4.956  1.00 11.76 ? 118 TYR A CD1   1 
ATOM   962  C  CD2   . TYR A 1 121 ? 56.568 -7.219  -4.184  1.00 12.52 ? 118 TYR A CD2   1 
ATOM   963  C  CE1   . TYR A 1 121 ? 53.918 -6.533  -3.773  1.00 13.03 ? 118 TYR A CE1   1 
ATOM   964  C  CE2   . TYR A 1 121 ? 55.929 -7.566  -2.995  1.00 14.36 ? 118 TYR A CE2   1 
ATOM   965  C  CZ    . TYR A 1 121 ? 54.608 -7.218  -2.800  1.00 12.87 ? 118 TYR A CZ    1 
ATOM   966  O  OH    . TYR A 1 121 ? 53.956 -7.555  -1.644  1.00 14.92 ? 118 TYR A OH    1 
ATOM   967  N  N     . VAL A 1 122 ? 59.414 -5.117  -7.527  1.00 11.56 ? 119 VAL A N     1 
ATOM   968  C  CA    . VAL A 1 122 ? 60.406 -5.008  -8.581  1.00 16.53 ? 119 VAL A CA    1 
ATOM   969  C  C     . VAL A 1 122 ? 60.900 -6.413  -8.925  1.00 16.95 ? 119 VAL A C     1 
ATOM   970  O  O     . VAL A 1 122 ? 61.353 -7.111  -8.024  1.00 13.97 ? 119 VAL A O     1 
ATOM   971  C  CB    . VAL A 1 122 ? 61.620 -4.161  -8.098  1.00 19.68 ? 119 VAL A CB    1 
ATOM   972  C  CG1   . VAL A 1 122 ? 62.339 -3.548  -9.258  1.00 28.92 ? 119 VAL A CG1   1 
ATOM   973  C  CG2   . VAL A 1 122 ? 61.176 -3.108  -7.084  1.00 24.68 ? 119 VAL A CG2   1 
ATOM   974  N  N     . ASP A 1 123 ? 60.843 -6.850  -10.182 1.00 18.85 ? 120 ASP A N     1 
ATOM   975  C  CA    . ASP A 1 123 ? 61.558 -8.086  -10.547 1.00 16.24 ? 120 ASP A CA    1 
ATOM   976  C  C     . ASP A 1 123 ? 62.927 -7.719  -11.095 1.00 17.85 ? 120 ASP A C     1 
ATOM   977  O  O     . ASP A 1 123 ? 63.051 -7.209  -12.211 1.00 19.69 ? 120 ASP A O     1 
ATOM   978  C  CB    . ASP A 1 123 ? 60.783 -8.951  -11.558 1.00 22.32 ? 120 ASP A CB    1 
ATOM   979  C  CG    . ASP A 1 123 ? 61.430 -10.330 -11.773 1.00 23.01 ? 120 ASP A CG    1 
ATOM   980  O  OD1   . ASP A 1 123 ? 62.650 -10.375 -11.978 1.00 19.73 ? 120 ASP A OD1   1 
ATOM   981  O  OD2   . ASP A 1 123 ? 60.735 -11.379 -11.727 1.00 25.02 ? 120 ASP A OD2   1 
ATOM   982  N  N     . LEU A 1 124 ? 63.952 -7.992  -10.296 1.00 13.27 ? 121 LEU A N     1 
ATOM   983  C  CA    . LEU A 1 124 ? 65.312 -7.563  -10.579 1.00 13.03 ? 121 LEU A CA    1 
ATOM   984  C  C     . LEU A 1 124 ? 66.186 -8.653  -11.191 1.00 11.92 ? 121 LEU A C     1 
ATOM   985  O  O     . LEU A 1 124 ? 67.399 -8.457  -11.342 1.00 15.10 ? 121 LEU A O     1 
ATOM   986  C  CB    . LEU A 1 124 ? 65.981 -7.059  -9.295  1.00 15.69 ? 121 LEU A CB    1 
ATOM   987  C  CG    . LEU A 1 124 ? 65.395 -5.812  -8.636  1.00 15.20 ? 121 LEU A CG    1 
ATOM   988  C  CD1   . LEU A 1 124 ? 65.918 -5.653  -7.226  1.00 19.51 ? 121 LEU A CD1   1 
ATOM   989  C  CD2   . LEU A 1 124 ? 65.737 -4.607  -9.495  1.00 22.88 ? 121 LEU A CD2   1 
ATOM   990  N  N     . THR A 1 125 ? 65.582 -9.791  -11.520 1.00 14.31 ? 122 THR A N     1 
ATOM   991  C  CA    . THR A 1 125 ? 66.354 -10.921 -12.034 1.00 16.15 ? 122 THR A CA    1 
ATOM   992  C  C     . THR A 1 125 ? 67.276 -10.518 -13.205 1.00 15.60 ? 122 THR A C     1 
ATOM   993  O  O     . THR A 1 125 ? 68.481 -10.783 -13.160 1.00 16.54 ? 122 THR A O     1 
ATOM   994  C  CB    . THR A 1 125 ? 65.426 -12.050 -12.455 1.00 19.03 ? 122 THR A CB    1 
ATOM   995  O  OG1   . THR A 1 125 ? 64.549 -12.360 -11.363 1.00 16.44 ? 122 THR A OG1   1 
ATOM   996  C  CG2   . THR A 1 125 ? 66.232 -13.290 -12.836 1.00 20.38 ? 122 THR A CG2   1 
ATOM   997  N  N     . SER A 1 126 ? 66.724 -9.845  -14.214 1.00 19.13 ? 123 SER A N     1 
ATOM   998  C  CA    . SER A 1 126 ? 67.518 -9.457  -15.385 1.00 17.00 ? 123 SER A CA    1 
ATOM   999  C  C     . SER A 1 126 ? 68.565 -8.395  -15.054 1.00 20.46 ? 123 SER A C     1 
ATOM   1000 O  O     . SER A 1 126 ? 69.714 -8.502  -15.482 1.00 21.46 ? 123 SER A O     1 
ATOM   1001 C  CB    . SER A 1 126 ? 66.607 -8.958  -16.506 1.00 21.82 ? 123 SER A CB    1 
ATOM   1002 O  OG    A SER A 1 126 ? 65.694 -9.952  -16.922 0.44 23.06 ? 123 SER A OG    1 
ATOM   1003 O  OG    B SER A 1 126 ? 65.862 -7.830  -16.103 0.56 21.85 ? 123 SER A OG    1 
ATOM   1004 N  N     . ALA A 1 127 ? 68.173 -7.379  -14.287 1.00 17.58 ? 124 ALA A N     1 
ATOM   1005 C  CA    . ALA A 1 127 ? 69.103 -6.341  -13.865 1.00 18.26 ? 124 ALA A CA    1 
ATOM   1006 C  C     . ALA A 1 127 ? 70.282 -6.929  -13.091 1.00 18.86 ? 124 ALA A C     1 
ATOM   1007 O  O     . ALA A 1 127 ? 71.406 -6.445  -13.198 1.00 18.56 ? 124 ALA A O     1 
ATOM   1008 C  CB    . ALA A 1 127 ? 68.390 -5.282  -13.009 1.00 19.28 ? 124 ALA A CB    1 
ATOM   1009 N  N     . VAL A 1 128 ? 70.014 -7.968  -12.299 1.00 17.98 ? 125 VAL A N     1 
ATOM   1010 C  CA    . VAL A 1 128 ? 71.062 -8.601  -11.515 1.00 17.94 ? 125 VAL A CA    1 
ATOM   1011 C  C     . VAL A 1 128 ? 72.036 -9.351  -12.419 1.00 21.58 ? 125 VAL A C     1 
ATOM   1012 O  O     . VAL A 1 128 ? 73.246 -9.284  -12.222 1.00 22.23 ? 125 VAL A O     1 
ATOM   1013 C  CB    . VAL A 1 128 ? 70.468 -9.558  -10.459 1.00 19.20 ? 125 VAL A CB    1 
ATOM   1014 C  CG1   . VAL A 1 128 ? 71.511 -10.577 -10.002 1.00 18.29 ? 125 VAL A CG1   1 
ATOM   1015 C  CG2   . VAL A 1 128 ? 69.969 -8.757  -9.277  1.00 17.35 ? 125 VAL A CG2   1 
ATOM   1016 N  N     . GLN A 1 129 ? 71.502 -10.048 -13.412 1.00 17.44 ? 126 GLN A N     1 
ATOM   1017 C  CA    . GLN A 1 129 ? 72.354 -10.743 -14.374 1.00 26.25 ? 126 GLN A CA    1 
ATOM   1018 C  C     . GLN A 1 129 ? 73.280 -9.758  -15.072 1.00 27.82 ? 126 GLN A C     1 
ATOM   1019 O  O     . GLN A 1 129 ? 74.467 -10.026 -15.235 1.00 28.40 ? 126 GLN A O     1 
ATOM   1020 C  CB    . GLN A 1 129 ? 71.515 -11.513 -15.392 1.00 25.80 ? 126 GLN A CB    1 
ATOM   1021 C  CG    . GLN A 1 129 ? 70.691 -12.634 -14.770 1.00 29.96 ? 126 GLN A CG    1 
ATOM   1022 C  CD    . GLN A 1 129 ? 71.556 -13.718 -14.125 1.00 41.28 ? 126 GLN A CD    1 
ATOM   1023 O  OE1   . GLN A 1 129 ? 71.155 -14.346 -13.144 1.00 38.11 ? 126 GLN A OE1   1 
ATOM   1024 N  NE2   . GLN A 1 129 ? 72.737 -13.953 -14.690 1.00 44.51 ? 126 GLN A NE2   1 
ATOM   1025 N  N     . GLU A 1 130 ? 72.738 -8.608  -15.460 1.00 25.02 ? 127 GLU A N     1 
ATOM   1026 C  CA    . GLU A 1 130 ? 73.541 -7.565  -16.089 1.00 28.07 ? 127 GLU A CA    1 
ATOM   1027 C  C     . GLU A 1 130 ? 74.664 -7.044  -15.205 1.00 33.33 ? 127 GLU A C     1 
ATOM   1028 O  O     . GLU A 1 130 ? 75.815 -6.968  -15.639 1.00 28.97 ? 127 GLU A O     1 
ATOM   1029 C  CB    . GLU A 1 130 ? 72.655 -6.393  -16.506 1.00 29.52 ? 127 GLU A CB    1 
ATOM   1030 C  CG    . GLU A 1 130 ? 71.611 -6.763  -17.514 1.00 34.05 ? 127 GLU A CG    1 
ATOM   1031 C  CD    . GLU A 1 130 ? 71.693 -5.893  -18.751 1.00 55.68 ? 127 GLU A CD    1 
ATOM   1032 O  OE1   . GLU A 1 130 ? 72.442 -4.889  -18.722 1.00 56.52 ? 127 GLU A OE1   1 
ATOM   1033 O  OE2   . GLU A 1 130 ? 71.025 -6.224  -19.755 1.00 63.18 ? 127 GLU A OE2   1 
ATOM   1034 N  N     . ARG A 1 131 ? 74.332 -6.671  -13.975 1.00 23.27 ? 128 ARG A N     1 
ATOM   1035 C  CA    . ARG A 1 131 ? 75.323 -6.097  -13.081 1.00 28.24 ? 128 ARG A CA    1 
ATOM   1036 C  C     . ARG A 1 131 ? 76.410 -7.113  -12.751 1.00 30.98 ? 128 ARG A C     1 
ATOM   1037 O  O     . ARG A 1 131 ? 77.573 -6.752  -12.569 1.00 30.17 ? 128 ARG A O     1 
ATOM   1038 C  CB    . ARG A 1 131 ? 74.664 -5.588  -11.797 1.00 21.77 ? 128 ARG A CB    1 
ATOM   1039 C  CG    . ARG A 1 131 ? 75.656 -5.055  -10.778 1.00 26.89 ? 128 ARG A CG    1 
ATOM   1040 C  CD    . ARG A 1 131 ? 76.248 -3.737  -11.236 1.00 24.05 ? 128 ARG A CD    1 
ATOM   1041 N  NE    . ARG A 1 131 ? 75.171 -2.796  -11.489 1.00 32.18 ? 128 ARG A NE    1 
ATOM   1042 C  CZ    . ARG A 1 131 ? 74.727 -1.932  -10.583 1.00 30.75 ? 128 ARG A CZ    1 
ATOM   1043 N  NH1   . ARG A 1 131 ? 75.298 -1.882  -9.391  1.00 26.26 ? 128 ARG A NH1   1 
ATOM   1044 N  NH2   . ARG A 1 131 ? 73.728 -1.113  -10.878 1.00 44.37 ? 128 ARG A NH2   1 
ATOM   1045 N  N     . LEU A 1 132 ? 76.020 -8.383  -12.688 1.00 27.46 ? 129 LEU A N     1 
ATOM   1046 C  CA    . LEU A 1 132 ? 76.952 -9.467  -12.375 1.00 24.50 ? 129 LEU A CA    1 
ATOM   1047 C  C     . LEU A 1 132 ? 78.059 -9.555  -13.420 1.00 35.02 ? 129 LEU A C     1 
ATOM   1048 O  O     . LEU A 1 132 ? 79.214 -9.832  -13.095 1.00 38.09 ? 129 LEU A O     1 
ATOM   1049 C  CB    . LEU A 1 132 ? 76.201 -10.796 -12.267 1.00 28.02 ? 129 LEU A CB    1 
ATOM   1050 C  CG    . LEU A 1 132 ? 75.767 -11.144 -10.838 1.00 25.28 ? 129 LEU A CG    1 
ATOM   1051 C  CD1   . LEU A 1 132 ? 74.845 -12.351 -10.815 1.00 26.45 ? 129 LEU A CD1   1 
ATOM   1052 C  CD2   . LEU A 1 132 ? 76.986 -11.380 -9.962  1.00 23.94 ? 129 LEU A CD2   1 
ATOM   1053 N  N     . GLN A 1 133 ? 77.706 -9.303  -14.675 1.00 37.44 ? 130 GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 133 ? 78.699 -9.310  -15.741 1.00 40.16 ? 130 GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 133 ? 79.622 -8.091  -15.657 1.00 44.65 ? 130 GLN A C     1 
ATOM   1056 O  O     . GLN A 1 133 ? 80.814 -8.199  -15.934 1.00 51.95 ? 130 GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 133 ? 78.026 -9.362  -17.105 1.00 42.07 ? 130 GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 133 ? 78.992 -9.693  -18.228 1.00 56.14 ? 130 GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 133 ? 78.807 -8.795  -19.429 1.00 62.13 ? 130 GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 133 ? 78.395 -7.642  -19.296 1.00 66.99 ? 130 GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 133 ? 79.122 -9.313  -20.611 1.00 66.39 ? 130 GLN A NE2   1 
ATOM   1062 N  N     . LYS A 1 134 ? 79.078 -6.938  -15.272 1.00 44.53 ? 131 LYS A N     1 
ATOM   1063 C  CA    . LYS A 1 134 ? 79.906 -5.747  -15.061 1.00 49.34 ? 131 LYS A CA    1 
ATOM   1064 C  C     . LYS A 1 134 ? 80.946 -5.992  -13.976 1.00 52.63 ? 131 LYS A C     1 
ATOM   1065 O  O     . LYS A 1 134 ? 82.107 -5.603  -14.112 1.00 55.45 ? 131 LYS A O     1 
ATOM   1066 C  CB    . LYS A 1 134 ? 79.058 -4.527  -14.678 1.00 47.11 ? 131 LYS A CB    1 
ATOM   1067 C  CG    . LYS A 1 134 ? 78.457 -3.765  -15.847 1.00 48.77 ? 131 LYS A CG    1 
ATOM   1068 C  CD    . LYS A 1 134 ? 77.900 -2.415  -15.393 1.00 45.98 ? 131 LYS A CD    1 
ATOM   1069 C  CE    . LYS A 1 134 ? 76.629 -2.568  -14.572 1.00 48.39 ? 131 LYS A CE    1 
ATOM   1070 N  NZ    . LYS A 1 134 ? 76.082 -1.255  -14.107 1.00 45.68 ? 131 LYS A NZ    1 
ATOM   1071 N  N     . LEU A 1 135 ? 80.515 -6.640  -12.898 1.00 44.25 ? 132 LEU A N     1 
ATOM   1072 C  CA    . LEU A 1 135 ? 81.379 -6.892  -11.755 1.00 52.68 ? 132 LEU A CA    1 
ATOM   1073 C  C     . LEU A 1 135 ? 82.588 -7.742  -12.138 1.00 55.65 ? 132 LEU A C     1 
ATOM   1074 O  O     . LEU A 1 135 ? 83.680 -7.537  -11.612 1.00 56.87 ? 132 LEU A O     1 
ATOM   1075 C  CB    . LEU A 1 135 ? 80.587 -7.566  -10.634 1.00 51.04 ? 132 LEU A CB    1 
ATOM   1076 C  CG    . LEU A 1 135 ? 79.644 -6.621  -9.886  1.00 43.83 ? 132 LEU A CG    1 
ATOM   1077 C  CD1   . LEU A 1 135 ? 79.017 -7.318  -8.694  1.00 43.41 ? 132 LEU A CD1   1 
ATOM   1078 C  CD2   . LEU A 1 135 ? 80.388 -5.368  -9.452  1.00 47.31 ? 132 LEU A CD2   1 
ATOM   1079 N  N     . GLN A 1 136 ? 82.387 -8.678  -13.064 1.00 53.21 ? 133 GLN A N     1 
ATOM   1080 C  CA    . GLN A 1 136 ? 83.462 -9.553  -13.538 1.00 59.07 ? 133 GLN A CA    1 
ATOM   1081 C  C     . GLN A 1 136 ? 84.135 -10.315 -12.408 1.00 58.74 ? 133 GLN A C     1 
ATOM   1082 O  O     . GLN A 1 136 ? 85.357 -10.268 -12.273 1.00 59.59 ? 133 GLN A O     1 
ATOM   1083 C  CB    . GLN A 1 136 ? 84.527 -8.754  -14.294 1.00 56.29 ? 133 GLN A CB    1 
ATOM   1084 C  CG    . GLN A 1 136 ? 83.998 -7.936  -15.440 1.00 55.50 ? 133 GLN A CG    1 
ATOM   1085 C  CD    . GLN A 1 136 ? 84.140 -8.664  -16.755 1.00 60.13 ? 133 GLN A CD    1 
ATOM   1086 O  OE1   . GLN A 1 136 ? 84.510 -9.839  -16.790 1.00 64.70 ? 133 GLN A OE1   1 
ATOM   1087 N  NE2   . GLN A 1 136 ? 83.848 -7.972  -17.850 1.00 56.21 ? 133 GLN A NE2   1 
ATOM   1088 N  N     . GLY A 1 137 ? 83.343 -11.011 -11.601 1.00 52.77 ? 134 GLY A N     1 
ATOM   1089 C  CA    . GLY A 1 137 ? 83.874 -11.737 -10.466 1.00 50.93 ? 134 GLY A CA    1 
ATOM   1090 C  C     . GLY A 1 137 ? 84.679 -10.843 -9.543  1.00 55.11 ? 134 GLY A C     1 
ATOM   1091 O  O     . GLY A 1 137 ? 85.734 -11.240 -9.053  1.00 60.28 ? 134 GLY A O     1 
ATOM   1092 N  N     . GLN A 1 138 ? 84.199 -9.624  -9.332  1.00 48.92 ? 135 GLN A N     1 
ATOM   1093 C  CA    . GLN A 1 138 ? 84.758 -8.763  -8.304  1.00 54.66 ? 135 GLN A CA    1 
ATOM   1094 C  C     . GLN A 1 138 ? 83.843 -8.831  -7.094  1.00 52.30 ? 135 GLN A C     1 
ATOM   1095 O  O     . GLN A 1 138 ? 82.621 -8.745  -7.237  1.00 44.31 ? 135 GLN A O     1 
ATOM   1096 C  CB    . GLN A 1 138 ? 84.906 -7.326  -8.803  1.00 53.49 ? 135 GLN A CB    1 
ATOM   1097 C  CG    . GLN A 1 138 ? 85.048 -6.286  -7.699  1.00 56.42 ? 135 GLN A CG    1 
ATOM   1098 C  CD    . GLN A 1 138 ? 85.149 -4.873  -8.241  1.00 63.58 ? 135 GLN A CD    1 
ATOM   1099 O  OE1   . GLN A 1 138 ? 86.007 -4.577  -9.075  1.00 67.58 ? 135 GLN A OE1   1 
ATOM   1100 N  NE2   . GLN A 1 138 ? 84.270 -3.994  -7.774  1.00 58.63 ? 135 GLN A NE2   1 
ATOM   1101 N  N     . PRO A 1 139 ? 84.430 -9.001  -5.900  1.00 49.66 ? 136 PRO A N     1 
ATOM   1102 C  CA    . PRO A 1 139 ? 83.644 -9.116  -4.670  1.00 44.95 ? 136 PRO A CA    1 
ATOM   1103 C  C     . PRO A 1 139 ? 82.792 -7.881  -4.412  1.00 40.14 ? 136 PRO A C     1 
ATOM   1104 O  O     . PRO A 1 139 ? 83.083 -6.802  -4.922  1.00 39.43 ? 136 PRO A O     1 
ATOM   1105 C  CB    . PRO A 1 139 ? 84.714 -9.285  -3.589  1.00 47.10 ? 136 PRO A CB    1 
ATOM   1106 C  CG    . PRO A 1 139 ? 85.930 -8.648  -4.166  1.00 49.34 ? 136 PRO A CG    1 
ATOM   1107 C  CD    . PRO A 1 139 ? 85.876 -9.008  -5.622  1.00 52.18 ? 136 PRO A CD    1 
ATOM   1108 N  N     . ILE A 1 140 ? 81.729 -8.052  -3.638  1.00 35.54 ? 137 ILE A N     1 
ATOM   1109 C  CA    . ILE A 1 140 ? 80.866 -6.937  -3.295  1.00 26.17 ? 137 ILE A CA    1 
ATOM   1110 C  C     . ILE A 1 140 ? 81.328 -6.346  -1.979  1.00 26.16 ? 137 ILE A C     1 
ATOM   1111 O  O     . ILE A 1 140 ? 81.372 -7.026  -0.955  1.00 27.16 ? 137 ILE A O     1 
ATOM   1112 C  CB    . ILE A 1 140 ? 79.398 -7.377  -3.222  1.00 27.66 ? 137 ILE A CB    1 
ATOM   1113 C  CG1   . ILE A 1 140 ? 78.979 -7.899  -4.600  1.00 33.28 ? 137 ILE A CG1   1 
ATOM   1114 C  CG2   . ILE A 1 140 ? 78.516 -6.220  -2.776  1.00 24.58 ? 137 ILE A CG2   1 
ATOM   1115 C  CD1   . ILE A 1 140 ? 77.628 -8.528  -4.653  1.00 32.92 ? 137 ILE A CD1   1 
ATOM   1116 N  N     . SER A 1 141 ? 81.706 -5.077  -2.025  1.00 22.99 ? 138 SER A N     1 
ATOM   1117 C  CA    . SER A 1 141 ? 82.180 -4.373  -0.844  1.00 27.48 ? 138 SER A CA    1 
ATOM   1118 C  C     . SER A 1 141 ? 81.002 -4.013  0.055   1.00 23.12 ? 138 SER A C     1 
ATOM   1119 O  O     . SER A 1 141 ? 79.912 -3.714  -0.441  1.00 22.29 ? 138 SER A O     1 
ATOM   1120 C  CB    . SER A 1 141 ? 82.960 -3.119  -1.257  1.00 23.07 ? 138 SER A CB    1 
ATOM   1121 O  OG    . SER A 1 141 ? 83.054 -2.181  -0.196  1.00 32.00 ? 138 SER A OG    1 
ATOM   1122 N  N     . ALA A 1 142 ? 81.217 -4.056  1.366   1.00 21.97 ? 139 ALA A N     1 
ATOM   1123 C  CA    . ALA A 1 142 ? 80.203 -3.647  2.332   1.00 21.82 ? 139 ALA A CA    1 
ATOM   1124 C  C     . ALA A 1 142 ? 79.757 -2.210  2.080   1.00 25.99 ? 139 ALA A C     1 
ATOM   1125 O  O     . ALA A 1 142 ? 78.636 -1.829  2.426   1.00 21.35 ? 139 ALA A O     1 
ATOM   1126 C  CB    . ALA A 1 142 ? 80.724 -3.795  3.749   1.00 25.72 ? 139 ALA A CB    1 
ATOM   1127 N  N     . ASP A 1 143 ? 80.638 -1.418  1.471   1.00 21.81 ? 140 ASP A N     1 
ATOM   1128 C  CA    . ASP A 1 143 ? 80.344 -0.013  1.206   1.00 24.66 ? 140 ASP A CA    1 
ATOM   1129 C  C     . ASP A 1 143 ? 79.230 0.160   0.188   1.00 25.15 ? 140 ASP A C     1 
ATOM   1130 O  O     . ASP A 1 143 ? 78.619 1.230   0.106   1.00 25.09 ? 140 ASP A O     1 
ATOM   1131 C  CB    . ASP A 1 143 ? 81.594 0.713   0.720   1.00 25.43 ? 140 ASP A CB    1 
ATOM   1132 C  CG    . ASP A 1 143 ? 82.684 0.747   1.766   1.00 40.63 ? 140 ASP A CG    1 
ATOM   1133 O  OD1   . ASP A 1 143 ? 82.359 0.622   2.968   1.00 35.62 ? 140 ASP A OD1   1 
ATOM   1134 O  OD2   . ASP A 1 143 ? 83.864 0.911   1.386   1.00 45.42 ? 140 ASP A OD2   1 
ATOM   1135 N  N     . LEU A 1 144 ? 78.958 -0.891  -0.583  1.00 20.57 ? 141 LEU A N     1 
ATOM   1136 C  CA    . LEU A 1 144 ? 77.890 -0.839  -1.571  1.00 20.05 ? 141 LEU A CA    1 
ATOM   1137 C  C     . LEU A 1 144 ? 76.535 -1.151  -0.946  1.00 17.92 ? 141 LEU A C     1 
ATOM   1138 O  O     . LEU A 1 144 ? 75.508 -0.966  -1.586  1.00 18.98 ? 141 LEU A O     1 
ATOM   1139 C  CB    . LEU A 1 144 ? 78.164 -1.804  -2.706  1.00 21.30 ? 141 LEU A CB    1 
ATOM   1140 C  CG    . LEU A 1 144 ? 79.437 -1.496  -3.490  1.00 23.39 ? 141 LEU A CG    1 
ATOM   1141 C  CD1   . LEU A 1 144 ? 79.605 -2.505  -4.602  1.00 27.18 ? 141 LEU A CD1   1 
ATOM   1142 C  CD2   . LEU A 1 144 ? 79.358 -0.087  -4.052  1.00 26.87 ? 141 LEU A CD2   1 
ATOM   1143 N  N     . LEU A 1 145 ? 76.550 -1.600  0.307   1.00 18.36 ? 142 LEU A N     1 
ATOM   1144 C  CA    . LEU A 1 145 ? 75.336 -1.957  1.041   1.00 15.46 ? 142 LEU A CA    1 
ATOM   1145 C  C     . LEU A 1 145 ? 75.217 -1.208  2.370   1.00 15.79 ? 142 LEU A C     1 
ATOM   1146 O  O     . LEU A 1 145 ? 75.078 -1.817  3.427   1.00 15.87 ? 142 LEU A O     1 
ATOM   1147 C  CB    . LEU A 1 145 ? 75.309 -3.474  1.281   1.00 15.22 ? 142 LEU A CB    1 
ATOM   1148 C  CG    . LEU A 1 145 ? 75.250 -4.306  0.005   1.00 15.46 ? 142 LEU A CG    1 
ATOM   1149 C  CD1   . LEU A 1 145 ? 75.687 -5.762  0.257   1.00 17.42 ? 142 LEU A CD1   1 
ATOM   1150 C  CD2   . LEU A 1 145 ? 73.858 -4.263  -0.584  1.00 16.77 ? 142 LEU A CD2   1 
ATOM   1151 N  N     . PRO A 1 146 ? 75.230 0.134   2.315   1.00 19.08 ? 143 PRO A N     1 
ATOM   1152 C  CA    . PRO A 1 146 ? 75.312 0.916   3.550   1.00 16.05 ? 143 PRO A CA    1 
ATOM   1153 C  C     . PRO A 1 146 ? 74.051 0.937   4.405   1.00 18.05 ? 143 PRO A C     1 
ATOM   1154 O  O     . PRO A 1 146 ? 74.137 1.383   5.537   1.00 18.14 ? 143 PRO A O     1 
ATOM   1155 C  CB    . PRO A 1 146 ? 75.620 2.329   3.035   1.00 18.76 ? 143 PRO A CB    1 
ATOM   1156 C  CG    . PRO A 1 146 ? 74.970 2.376   1.705   1.00 18.71 ? 143 PRO A CG    1 
ATOM   1157 C  CD    . PRO A 1 146 ? 75.188 0.996   1.124   1.00 18.61 ? 143 PRO A CD    1 
ATOM   1158 N  N     . SER A 1 147 ? 72.909 0.473   3.894   1.00 18.20 ? 144 SER A N     1 
ATOM   1159 C  CA    . SER A 1 147 ? 71.692 0.470   4.709   1.00 16.16 ? 144 SER A CA    1 
ATOM   1160 C  C     . SER A 1 147 ? 71.025 -0.906  4.742   1.00 15.54 ? 144 SER A C     1 
ATOM   1161 O  O     . SER A 1 147 ? 69.857 -1.030  5.100   1.00 14.70 ? 144 SER A O     1 
ATOM   1162 C  CB    . SER A 1 147 ? 70.692 1.527   4.207   1.00 17.55 ? 144 SER A CB    1 
ATOM   1163 O  OG    . SER A 1 147 ? 70.184 1.222   2.919   1.00 16.62 ? 144 SER A OG    1 
ATOM   1164 N  N     . THR A 1 148 ? 71.801 -1.935  4.424   1.00 13.45 ? 145 THR A N     1 
ATOM   1165 C  CA    . THR A 1 148 ? 71.276 -3.299  4.283   1.00 14.37 ? 145 THR A CA    1 
ATOM   1166 C  C     . THR A 1 148 ? 71.488 -4.157  5.526   1.00 13.27 ? 145 THR A C     1 
ATOM   1167 O  O     . THR A 1 148 ? 72.597 -4.220  6.076   1.00 15.75 ? 145 THR A O     1 
ATOM   1168 C  CB    . THR A 1 148 ? 71.933 -4.010  3.081   1.00 10.73 ? 145 THR A CB    1 
ATOM   1169 O  OG1   . THR A 1 148 ? 71.577 -3.344  1.866   1.00 12.77 ? 145 THR A OG1   1 
ATOM   1170 C  CG2   . THR A 1 148 ? 71.489 -5.489  3.004   1.00 12.21 ? 145 THR A CG2   1 
ATOM   1171 N  N     . TYR A 1 149 ? 70.414 -4.817  5.947   1.00 11.83 ? 146 TYR A N     1 
ATOM   1172 C  CA    . TYR A 1 149 ? 70.437 -5.863  6.977   1.00 12.03 ? 146 TYR A CA    1 
ATOM   1173 C  C     . TYR A 1 149 ? 70.358 -7.221  6.315   1.00 16.96 ? 146 TYR A C     1 
ATOM   1174 O  O     . TYR A 1 149 ? 69.605 -7.398  5.361   1.00 14.66 ? 146 TYR A O     1 
ATOM   1175 C  CB    . TYR A 1 149 ? 69.255 -5.731  7.936   1.00 12.73 ? 146 TYR A CB    1 
ATOM   1176 C  CG    . TYR A 1 149 ? 69.436 -4.700  8.998   1.00 14.03 ? 146 TYR A CG    1 
ATOM   1177 C  CD1   . TYR A 1 149 ? 69.848 -5.071  10.264  1.00 16.71 ? 146 TYR A CD1   1 
ATOM   1178 C  CD2   . TYR A 1 149 ? 69.189 -3.353  8.743   1.00 14.41 ? 146 TYR A CD2   1 
ATOM   1179 C  CE1   . TYR A 1 149 ? 70.026 -4.139  11.250  1.00 15.68 ? 146 TYR A CE1   1 
ATOM   1180 C  CE2   . TYR A 1 149 ? 69.355 -2.408  9.735   1.00 16.68 ? 146 TYR A CE2   1 
ATOM   1181 C  CZ    . TYR A 1 149 ? 69.776 -2.814  10.989  1.00 17.55 ? 146 TYR A CZ    1 
ATOM   1182 O  OH    . TYR A 1 149 ? 69.967 -1.905  12.011  1.00 24.55 ? 146 TYR A OH    1 
ATOM   1183 N  N     . ILE A 1 150 ? 71.126 -8.180  6.825   1.00 11.47 ? 147 ILE A N     1 
ATOM   1184 C  CA    . ILE A 1 150 ? 71.000 -9.571  6.387   1.00 12.10 ? 147 ILE A CA    1 
ATOM   1185 C  C     . ILE A 1 150 ? 70.256 -10.343 7.466   1.00 12.29 ? 147 ILE A C     1 
ATOM   1186 O  O     . ILE A 1 150 ? 70.790 -10.556 8.560   1.00 14.02 ? 147 ILE A O     1 
ATOM   1187 C  CB    . ILE A 1 150 ? 72.375 -10.238 6.141   1.00 10.74 ? 147 ILE A CB    1 
ATOM   1188 C  CG1   . ILE A 1 150 ? 73.276 -9.354  5.265   1.00 12.10 ? 147 ILE A CG1   1 
ATOM   1189 C  CG2   . ILE A 1 150 ? 72.193 -11.629 5.520   1.00 13.17 ? 147 ILE A CG2   1 
ATOM   1190 C  CD1   . ILE A 1 150 ? 72.737 -9.136  3.847   1.00 14.31 ? 147 ILE A CD1   1 
ATOM   1191 N  N     . GLU A 1 151 ? 69.020 -10.742 7.181   1.00 10.98 ? 148 GLU A N     1 
ATOM   1192 C  CA    . GLU A 1 151 ? 68.197 -11.372 8.206   1.00 11.73 ? 148 GLU A CA    1 
ATOM   1193 C  C     . GLU A 1 151 ? 68.798 -12.705 8.663   1.00 13.39 ? 148 GLU A C     1 
ATOM   1194 O  O     . GLU A 1 151 ? 69.207 -13.518 7.832   1.00 13.83 ? 148 GLU A O     1 
ATOM   1195 C  CB    . GLU A 1 151 ? 66.764 -11.584 7.698   1.00 12.34 ? 148 GLU A CB    1 
ATOM   1196 C  CG    . GLU A 1 151 ? 65.874 -12.406 8.656   1.00 16.07 ? 148 GLU A CG    1 
ATOM   1197 C  CD    . GLU A 1 151 ? 65.660 -11.765 10.016  1.00 16.76 ? 148 GLU A CD    1 
ATOM   1198 O  OE1   . GLU A 1 151 ? 65.390 -12.507 10.982  1.00 19.11 ? 148 GLU A OE1   1 
ATOM   1199 O  OE2   . GLU A 1 151 ? 65.739 -10.526 10.134  1.00 20.11 ? 148 GLU A OE2   1 
ATOM   1200 N  N     . GLY A 1 152 ? 68.868 -12.888 9.984   1.00 13.57 ? 149 GLY A N     1 
ATOM   1201 C  CA    . GLY A 1 152 ? 69.467 -14.076 10.575  1.00 15.69 ? 149 GLY A CA    1 
ATOM   1202 C  C     . GLY A 1 152 ? 70.913 -13.907 11.010  1.00 19.54 ? 149 GLY A C     1 
ATOM   1203 O  O     . GLY A 1 152 ? 71.455 -14.751 11.736  1.00 20.53 ? 149 GLY A O     1 
ATOM   1204 N  N     . LEU A 1 153 ? 71.547 -12.822 10.573  1.00 14.03 ? 150 LEU A N     1 
ATOM   1205 C  CA    . LEU A 1 153 ? 72.946 -12.585 10.904  1.00 14.75 ? 150 LEU A CA    1 
ATOM   1206 C  C     . LEU A 1 153 ? 73.076 -11.276 11.686  1.00 18.15 ? 150 LEU A C     1 
ATOM   1207 O  O     . LEU A 1 153 ? 72.269 -10.369 11.520  1.00 17.93 ? 150 LEU A O     1 
ATOM   1208 C  CB    . LEU A 1 153 ? 73.803 -12.564 9.635   1.00 13.17 ? 150 LEU A CB    1 
ATOM   1209 C  CG    . LEU A 1 153 ? 73.865 -13.851 8.812   1.00 17.54 ? 150 LEU A CG    1 
ATOM   1210 C  CD1   . LEU A 1 153 ? 74.725 -13.677 7.585   1.00 16.73 ? 150 LEU A CD1   1 
ATOM   1211 C  CD2   . LEU A 1 153 ? 74.383 -15.004 9.680   1.00 22.49 ? 150 LEU A CD2   1 
ATOM   1212 N  N     . PRO A 1 154 ? 74.084 -11.178 12.567  1.00 18.48 ? 151 PRO A N     1 
ATOM   1213 C  CA    . PRO A 1 154 ? 75.132 -12.170 12.836  1.00 16.21 ? 151 PRO A CA    1 
ATOM   1214 C  C     . PRO A 1 154 ? 74.661 -13.327 13.698  1.00 16.37 ? 151 PRO A C     1 
ATOM   1215 O  O     . PRO A 1 154 ? 73.675 -13.209 14.413  1.00 21.31 ? 151 PRO A O     1 
ATOM   1216 C  CB    . PRO A 1 154 ? 76.194 -11.355 13.585  1.00 17.78 ? 151 PRO A CB    1 
ATOM   1217 C  CG    . PRO A 1 154 ? 75.399 -10.304 14.301  1.00 18.75 ? 151 PRO A CG    1 
ATOM   1218 C  CD    . PRO A 1 154 ? 74.247 -9.959  13.377  1.00 19.94 ? 151 PRO A CD    1 
ATOM   1219 N  N     . GLN A 1 155 ? 75.396 -14.431 13.635  1.00 20.38 ? 152 GLN A N     1 
ATOM   1220 C  CA    . GLN A 1 155 ? 75.125 -15.597 14.467  1.00 28.01 ? 152 GLN A CA    1 
ATOM   1221 C  C     . GLN A 1 155 ? 76.444 -16.093 15.084  1.00 36.65 ? 152 GLN A C     1 
ATOM   1222 O  O     . GLN A 1 155 ? 77.516 -15.759 14.582  1.00 39.55 ? 152 GLN A O     1 
ATOM   1223 C  CB    . GLN A 1 155 ? 74.485 -16.711 13.644  1.00 31.21 ? 152 GLN A CB    1 
ATOM   1224 C  CG    . GLN A 1 155 ? 75.504 -17.771 13.254  1.00 39.22 ? 152 GLN A CG    1 
ATOM   1225 C  CD    . GLN A 1 155 ? 74.935 -18.889 12.431  1.00 35.68 ? 152 GLN A CD    1 
ATOM   1226 O  OE1   . GLN A 1 155 ? 73.770 -19.270 12.581  1.00 36.76 ? 152 GLN A OE1   1 
ATOM   1227 N  NE2   . GLN A 1 155 ? 75.759 -19.427 11.540  1.00 26.07 ? 152 GLN A NE2   1 
ATOM   1228 N  N     . GLY A 1 156 ? 76.345 -16.893 16.145  1.00 40.73 ? 153 GLY A N     1 
ATOM   1229 C  CA    . GLY A 1 156 ? 77.496 -17.461 16.804  1.00 50.15 ? 153 GLY A CA    1 
ATOM   1230 C  C     . GLY A 1 156 ? 78.299 -16.430 17.570  1.00 54.67 ? 153 GLY A C     1 
ATOM   1231 O  O     . GLY A 1 156 ? 77.736 -15.487 18.123  1.00 61.57 ? 153 GLY A O     1 
ATOM   1232 N  N     . PRO A 1 157 ? 79.634 -16.622 17.654  1.00 62.63 ? 154 PRO A N     1 
ATOM   1233 C  CA    . PRO A 1 157 ? 80.538 -15.621 18.252  1.00 64.97 ? 154 PRO A CA    1 
ATOM   1234 C  C     . PRO A 1 157 ? 80.541 -14.344 17.402  1.00 60.28 ? 154 PRO A C     1 
ATOM   1235 O  O     . PRO A 1 157 ? 81.263 -13.378 17.697  1.00 63.99 ? 154 PRO A O     1 
ATOM   1236 C  CB    . PRO A 1 157 ? 81.901 -16.304 18.225  1.00 50.20 ? 154 PRO A CB    1 
ATOM   1237 C  CG    . PRO A 1 157 ? 81.743 -17.306 17.120  1.00 46.75 ? 154 PRO A CG    1 
ATOM   1238 C  CD    . PRO A 1 157 ? 80.377 -17.795 17.173  1.00 53.56 ? 154 PRO A CD    1 
ATOM   1239 N  N     . THR A 1 163 ? 78.809 -5.132  19.434  1.00 71.06 ? 160 THR A N     1 
ATOM   1240 C  CA    . THR A 1 163 ? 77.653 -5.990  19.681  1.00 69.39 ? 160 THR A CA    1 
ATOM   1241 C  C     . THR A 1 163 ? 76.578 -5.243  20.462  1.00 65.46 ? 160 THR A C     1 
ATOM   1242 O  O     . THR A 1 163 ? 75.463 -5.737  20.644  1.00 66.95 ? 160 THR A O     1 
ATOM   1243 C  CB    . THR A 1 163 ? 78.037 -7.251  20.467  1.00 66.63 ? 160 THR A CB    1 
ATOM   1244 O  OG1   . THR A 1 163 ? 78.904 -6.886  21.548  1.00 72.81 ? 160 THR A OG1   1 
ATOM   1245 C  CG2   . THR A 1 163 ? 78.752 -8.249  19.573  1.00 63.16 ? 160 THR A CG2   1 
ATOM   1246 N  N     . VAL A 1 164 ? 76.931 -4.046  20.917  1.00 62.74 ? 161 VAL A N     1 
ATOM   1247 C  CA    . VAL A 1 164 ? 76.056 -3.227  21.750  1.00 63.42 ? 161 VAL A CA    1 
ATOM   1248 C  C     . VAL A 1 164 ? 75.111 -2.363  20.917  1.00 56.23 ? 161 VAL A C     1 
ATOM   1249 O  O     . VAL A 1 164 ? 73.973 -2.102  21.307  1.00 53.74 ? 161 VAL A O     1 
ATOM   1250 C  CB    . VAL A 1 164 ? 76.887 -2.307  22.667  1.00 64.45 ? 161 VAL A CB    1 
ATOM   1251 C  CG1   . VAL A 1 164 ? 76.138 -2.015  23.950  1.00 51.25 ? 161 VAL A CG1   1 
ATOM   1252 C  CG2   . VAL A 1 164 ? 78.236 -2.943  22.973  1.00 63.86 ? 161 VAL A CG2   1 
ATOM   1253 N  N     . GLN A 1 165 ? 75.611 -1.943  19.759  1.00 47.91 ? 162 GLN A N     1 
ATOM   1254 C  CA    . GLN A 1 165 ? 75.007 -0.910  18.919  1.00 50.70 ? 162 GLN A CA    1 
ATOM   1255 C  C     . GLN A 1 165 ? 74.137 -1.532  17.830  1.00 43.15 ? 162 GLN A C     1 
ATOM   1256 O  O     . GLN A 1 165 ? 74.349 -2.690  17.478  1.00 44.66 ? 162 GLN A O     1 
ATOM   1257 C  CB    . GLN A 1 165 ? 76.130 -0.086  18.299  1.00 52.14 ? 162 GLN A CB    1 
ATOM   1258 C  CG    . GLN A 1 165 ? 77.421 -0.216  19.104  1.00 59.48 ? 162 GLN A CG    1 
ATOM   1259 C  CD    . GLN A 1 165 ? 78.624 0.408   18.425  1.00 62.66 ? 162 GLN A CD    1 
ATOM   1260 O  OE1   . GLN A 1 165 ? 78.566 0.793   17.257  1.00 58.04 ? 162 GLN A OE1   1 
ATOM   1261 N  NE2   . GLN A 1 165 ? 79.736 0.481   19.149  1.00 70.63 ? 162 GLN A NE2   1 
ATOM   1262 N  N     . LYS A 1 166 ? 73.164 -0.799  17.289  1.00 38.35 ? 163 LYS A N     1 
ATOM   1263 C  CA    . LYS A 1 166 ? 72.375 -1.380  16.200  1.00 38.46 ? 163 LYS A CA    1 
ATOM   1264 C  C     . LYS A 1 166 ? 73.142 -1.345  14.884  1.00 29.87 ? 163 LYS A C     1 
ATOM   1265 O  O     . LYS A 1 166 ? 73.157 -2.333  14.143  1.00 25.35 ? 163 LYS A O     1 
ATOM   1266 C  CB    . LYS A 1 166 ? 71.017 -0.687  16.022  1.00 38.18 ? 163 LYS A CB    1 
ATOM   1267 C  CG    . LYS A 1 166 ? 69.844 -1.655  16.210  1.00 45.26 ? 163 LYS A CG    1 
ATOM   1268 C  CD    . LYS A 1 166 ? 68.495 -1.051  15.830  1.00 48.28 ? 163 LYS A CD    1 
ATOM   1269 C  CE    . LYS A 1 166 ? 67.973 -1.620  14.501  1.00 39.60 ? 163 LYS A CE    1 
ATOM   1270 N  NZ    . LYS A 1 166 ? 67.821 -3.121  14.500  1.00 35.54 ? 163 LYS A NZ    1 
ATOM   1271 N  N     . GLU A 1 167 ? 73.772 -0.213  14.585  1.00 29.95 ? 164 GLU A N     1 
ATOM   1272 C  CA    . GLU A 1 167 ? 74.565 -0.102  13.366  1.00 29.60 ? 164 GLU A CA    1 
ATOM   1273 C  C     . GLU A 1 167 ? 75.738 -1.076  13.395  1.00 29.16 ? 164 GLU A C     1 
ATOM   1274 O  O     . GLU A 1 167 ? 76.128 -1.625  12.363  1.00 26.18 ? 164 GLU A O     1 
ATOM   1275 C  CB    . GLU A 1 167 ? 75.061 1.334   13.168  1.00 30.06 ? 164 GLU A CB    1 
ATOM   1276 C  CG    . GLU A 1 167 ? 76.034 1.527   11.997  1.00 25.84 ? 164 GLU A CG    1 
ATOM   1277 C  CD    . GLU A 1 167 ? 75.430 1.240   10.623  1.00 29.97 ? 164 GLU A CD    1 
ATOM   1278 O  OE1   . GLU A 1 167 ? 76.218 1.131   9.658   1.00 31.53 ? 164 GLU A OE1   1 
ATOM   1279 O  OE2   . GLU A 1 167 ? 74.187 1.126   10.499  1.00 29.75 ? 164 GLU A OE2   1 
ATOM   1280 N  N     . GLY A 1 168 ? 76.295 -1.287  14.581  1.00 32.94 ? 165 GLY A N     1 
ATOM   1281 C  CA    . GLY A 1 168 ? 77.399 -2.209  14.750  1.00 33.89 ? 165 GLY A CA    1 
ATOM   1282 C  C     . GLY A 1 168 ? 76.979 -3.636  14.470  1.00 26.58 ? 165 GLY A C     1 
ATOM   1283 O  O     . GLY A 1 168 ? 77.707 -4.385  13.816  1.00 28.08 ? 165 GLY A O     1 
ATOM   1284 N  N     . MET A 1 169 ? 75.805 -4.008  14.973  1.00 29.31 ? 166 MET A N     1 
ATOM   1285 C  CA    . MET A 1 169 ? 75.235 -5.330  14.739  1.00 27.37 ? 166 MET A CA    1 
ATOM   1286 C  C     . MET A 1 169 ? 74.899 -5.506  13.257  1.00 25.40 ? 166 MET A C     1 
ATOM   1287 O  O     . MET A 1 169 ? 75.114 -6.583  12.687  1.00 25.47 ? 166 MET A O     1 
ATOM   1288 C  CB    . MET A 1 169 ? 73.983 -5.545  15.599  1.00 35.05 ? 166 MET A CB    1 
ATOM   1289 C  CG    . MET A 1 169 ? 74.239 -6.031  17.030  1.00 49.61 ? 166 MET A CG    1 
ATOM   1290 S  SD    . MET A 1 169 ? 74.611 -7.788  17.175  1.00 67.95 ? 166 MET A SD    1 
ATOM   1291 C  CE    . MET A 1 169 ? 72.984 -8.512  16.945  1.00 43.21 ? 166 MET A CE    1 
ATOM   1292 N  N     . ARG A 1 170 ? 74.392 -4.449  12.623  1.00 22.26 ? 167 ARG A N     1 
ATOM   1293 C  CA    . ARG A 1 170 ? 74.083 -4.520  11.195  1.00 20.95 ? 167 ARG A CA    1 
ATOM   1294 C  C     . ARG A 1 170 ? 75.329 -4.873  10.398  1.00 19.00 ? 167 ARG A C     1 
ATOM   1295 O  O     . ARG A 1 170 ? 75.297 -5.764  9.549   1.00 18.66 ? 167 ARG A O     1 
ATOM   1296 C  CB    . ARG A 1 170 ? 73.491 -3.200  10.670  1.00 18.83 ? 167 ARG A CB    1 
ATOM   1297 C  CG    . ARG A 1 170 ? 73.118 -3.243  9.170   1.00 17.60 ? 167 ARG A CG    1 
ATOM   1298 C  CD    . ARG A 1 170 ? 72.898 -1.850  8.573   1.00 20.53 ? 167 ARG A CD    1 
ATOM   1299 N  NE    . ARG A 1 170 ? 74.150 -1.128  8.355   1.00 18.27 ? 167 ARG A NE    1 
ATOM   1300 C  CZ    . ARG A 1 170 ? 74.949 -1.297  7.304   1.00 17.79 ? 167 ARG A CZ    1 
ATOM   1301 N  NH1   . ARG A 1 170 ? 74.650 -2.163  6.349   1.00 16.40 ? 167 ARG A NH1   1 
ATOM   1302 N  NH2   . ARG A 1 170 ? 76.052 -0.582  7.202   1.00 20.13 ? 167 ARG A NH2   1 
ATOM   1303 N  N     . LYS A 1 171 ? 76.425 -4.168  10.673  1.00 21.08 ? 168 LYS A N     1 
ATOM   1304 C  CA    . LYS A 1 171 ? 77.672 -4.396  9.957   1.00 22.43 ? 168 LYS A CA    1 
ATOM   1305 C  C     . LYS A 1 171 ? 78.251 -5.773  10.248  1.00 19.06 ? 168 LYS A C     1 
ATOM   1306 O  O     . LYS A 1 171 ? 78.819 -6.397  9.354   1.00 18.89 ? 168 LYS A O     1 
ATOM   1307 C  CB    . LYS A 1 171 ? 78.699 -3.322  10.304  1.00 24.43 ? 168 LYS A CB    1 
ATOM   1308 C  CG    . LYS A 1 171 ? 78.532 -2.041  9.515   1.00 31.28 ? 168 LYS A CG    1 
ATOM   1309 C  CD    . LYS A 1 171 ? 79.740 -1.141  9.709   1.00 34.76 ? 168 LYS A CD    1 
ATOM   1310 C  CE    . LYS A 1 171 ? 79.659 0.093   8.833   1.00 40.69 ? 168 LYS A CE    1 
ATOM   1311 N  NZ    . LYS A 1 171 ? 80.935 0.856   8.864   1.00 47.68 ? 168 LYS A NZ    1 
ATOM   1312 N  N     . GLN A 1 172 ? 78.107 -6.237  11.488  1.00 25.24 ? 169 GLN A N     1 
ATOM   1313 C  CA    . GLN A 1 172 ? 78.597 -7.561  11.860  1.00 21.37 ? 169 GLN A CA    1 
ATOM   1314 C  C     . GLN A 1 172 ? 77.933 -8.601  10.974  1.00 19.67 ? 169 GLN A C     1 
ATOM   1315 O  O     . GLN A 1 172 ? 78.593 -9.452  10.377  1.00 20.74 ? 169 GLN A O     1 
ATOM   1316 C  CB    . GLN A 1 172 ? 78.308 -7.877  13.323  1.00 26.12 ? 169 GLN A CB    1 
ATOM   1317 C  CG    . GLN A 1 172 ? 79.278 -7.280  14.319  1.00 35.43 ? 169 GLN A CG    1 
ATOM   1318 C  CD    . GLN A 1 172 ? 78.726 -7.291  15.730  1.00 40.26 ? 169 GLN A CD    1 
ATOM   1319 O  OE1   . GLN A 1 172 ? 77.553 -7.594  15.952  1.00 42.89 ? 169 GLN A OE1   1 
ATOM   1320 N  NE2   . GLN A 1 172 ? 79.571 -6.954  16.694  1.00 50.79 ? 169 GLN A NE2   1 
ATOM   1321 N  N     . GLY A 1 173 ? 76.609 -8.517  10.890  1.00 19.12 ? 170 GLY A N     1 
ATOM   1322 C  CA    . GLY A 1 173 ? 75.847 -9.434  10.062  1.00 16.43 ? 170 GLY A CA    1 
ATOM   1323 C  C     . GLY A 1 173 ? 76.207 -9.340  8.596   1.00 17.61 ? 170 GLY A C     1 
ATOM   1324 O  O     . GLY A 1 173 ? 76.355 -10.356 7.911   1.00 15.96 ? 170 GLY A O     1 
ATOM   1325 N  N     . LEU A 1 174 ? 76.353 -8.112  8.104   1.00 14.43 ? 171 LEU A N     1 
ATOM   1326 C  CA    . LEU A 1 174 ? 76.702 -7.899  6.707   1.00 14.84 ? 171 LEU A CA    1 
ATOM   1327 C  C     . LEU A 1 174 ? 78.075 -8.480  6.394   1.00 19.03 ? 171 LEU A C     1 
ATOM   1328 O  O     . LEU A 1 174 ? 78.279 -9.093  5.350   1.00 18.08 ? 171 LEU A O     1 
ATOM   1329 C  CB    . LEU A 1 174 ? 76.662 -6.402  6.362   1.00 17.83 ? 171 LEU A CB    1 
ATOM   1330 C  CG    . LEU A 1 174 ? 77.007 -6.037  4.921   1.00 16.24 ? 171 LEU A CG    1 
ATOM   1331 C  CD1   . LEU A 1 174 ? 76.079 -6.751  3.943   1.00 16.48 ? 171 LEU A CD1   1 
ATOM   1332 C  CD2   . LEU A 1 174 ? 76.947 -4.529  4.720   1.00 21.38 ? 171 LEU A CD2   1 
ATOM   1333 N  N     . PHE A 1 175 ? 79.011 -8.318  7.318   1.00 18.90 ? 172 PHE A N     1 
ATOM   1334 C  CA    . PHE A 1 175 ? 80.341 -8.854  7.085   1.00 22.21 ? 172 PHE A CA    1 
ATOM   1335 C  C     . PHE A 1 175 ? 80.325 -10.388 7.055   1.00 17.70 ? 172 PHE A C     1 
ATOM   1336 O  O     . PHE A 1 175 ? 80.963 -10.985 6.185   1.00 22.32 ? 172 PHE A O     1 
ATOM   1337 C  CB    . PHE A 1 175 ? 81.315 -8.322  8.129   1.00 20.26 ? 172 PHE A CB    1 
ATOM   1338 C  CG    . PHE A 1 175 ? 81.801 -6.931  7.830   1.00 33.18 ? 172 PHE A CG    1 
ATOM   1339 C  CD1   . PHE A 1 175 ? 82.328 -6.629  6.583   1.00 38.49 ? 172 PHE A CD1   1 
ATOM   1340 C  CD2   . PHE A 1 175 ? 81.729 -5.927  8.780   1.00 32.62 ? 172 PHE A CD2   1 
ATOM   1341 C  CE1   . PHE A 1 175 ? 82.774 -5.353  6.287   1.00 36.52 ? 172 PHE A CE1   1 
ATOM   1342 C  CE2   . PHE A 1 175 ? 82.177 -4.643  8.488   1.00 38.78 ? 172 PHE A CE2   1 
ATOM   1343 C  CZ    . PHE A 1 175 ? 82.698 -4.359  7.240   1.00 41.21 ? 172 PHE A CZ    1 
ATOM   1344 N  N     . GLN A 1 176 ? 79.583 -11.024 7.964   1.00 18.47 ? 173 GLN A N     1 
ATOM   1345 C  CA    . GLN A 1 176 ? 79.486 -12.494 7.946   1.00 18.04 ? 173 GLN A CA    1 
ATOM   1346 C  C     . GLN A 1 176 ? 78.911 -12.975 6.619   1.00 24.31 ? 173 GLN A C     1 
ATOM   1347 O  O     . GLN A 1 176 ? 79.398 -13.941 6.022   1.00 19.89 ? 173 GLN A O     1 
ATOM   1348 C  CB    . GLN A 1 176 ? 78.626 -13.020 9.108   1.00 19.81 ? 173 GLN A CB    1 
ATOM   1349 C  CG    . GLN A 1 176 ? 79.258 -12.823 10.490  1.00 22.90 ? 173 GLN A CG    1 
ATOM   1350 C  CD    . GLN A 1 176 ? 78.496 -13.517 11.608  1.00 25.02 ? 173 GLN A CD    1 
ATOM   1351 O  OE1   . GLN A 1 176 ? 77.386 -14.010 11.417  1.00 24.43 ? 173 GLN A OE1   1 
ATOM   1352 N  NE2   . GLN A 1 176 ? 79.108 -13.571 12.790  1.00 29.05 ? 173 GLN A NE2   1 
ATOM   1353 N  N     . TRP A 1 177 ? 77.872 -12.287 6.157   1.00 18.59 ? 174 TRP A N     1 
ATOM   1354 C  CA    . TRP A 1 177 ? 77.235 -12.621 4.892   1.00 17.06 ? 174 TRP A CA    1 
ATOM   1355 C  C     . TRP A 1 177 ? 78.221 -12.521 3.736   1.00 17.06 ? 174 TRP A C     1 
ATOM   1356 O  O     . TRP A 1 177 ? 78.383 -13.460 2.954   1.00 18.76 ? 174 TRP A O     1 
ATOM   1357 C  CB    . TRP A 1 177 ? 76.029 -11.698 4.654   1.00 12.88 ? 174 TRP A CB    1 
ATOM   1358 C  CG    . TRP A 1 177 ? 75.373 -11.867 3.315   1.00 16.00 ? 174 TRP A CG    1 
ATOM   1359 C  CD1   . TRP A 1 177 ? 75.484 -11.030 2.236   1.00 14.03 ? 174 TRP A CD1   1 
ATOM   1360 C  CD2   . TRP A 1 177 ? 74.489 -12.924 2.909   1.00 14.64 ? 174 TRP A CD2   1 
ATOM   1361 N  NE1   . TRP A 1 177 ? 74.732 -11.500 1.195   1.00 14.65 ? 174 TRP A NE1   1 
ATOM   1362 C  CE2   . TRP A 1 177 ? 74.106 -12.659 1.580   1.00 12.38 ? 174 TRP A CE2   1 
ATOM   1363 C  CE3   . TRP A 1 177 ? 73.981 -14.062 3.541   1.00 14.23 ? 174 TRP A CE3   1 
ATOM   1364 C  CZ2   . TRP A 1 177 ? 73.244 -13.497 0.866   1.00 13.61 ? 174 TRP A CZ2   1 
ATOM   1365 C  CZ3   . TRP A 1 177 ? 73.118 -14.898 2.829   1.00 16.23 ? 174 TRP A CZ3   1 
ATOM   1366 C  CH2   . TRP A 1 177 ? 72.757 -14.608 1.509   1.00 17.07 ? 174 TRP A CH2   1 
ATOM   1367 N  N     . LEU A 1 178 ? 78.879 -11.377 3.630   1.00 18.54 ? 175 LEU A N     1 
ATOM   1368 C  CA    . LEU A 1 178 ? 79.786 -11.149 2.518   1.00 16.22 ? 175 LEU A CA    1 
ATOM   1369 C  C     . LEU A 1 178 ? 80.991 -12.085 2.569   1.00 25.07 ? 175 LEU A C     1 
ATOM   1370 O  O     . LEU A 1 178 ? 81.471 -12.536 1.529   1.00 27.02 ? 175 LEU A O     1 
ATOM   1371 C  CB    . LEU A 1 178 ? 80.252 -9.696  2.506   1.00 19.23 ? 175 LEU A CB    1 
ATOM   1372 C  CG    . LEU A 1 178 ? 79.155 -8.664  2.222   1.00 19.63 ? 175 LEU A CG    1 
ATOM   1373 C  CD1   . LEU A 1 178 ? 79.732 -7.270  2.286   1.00 20.84 ? 175 LEU A CD1   1 
ATOM   1374 C  CD2   . LEU A 1 178 ? 78.522 -8.912  0.856   1.00 14.94 ? 175 LEU A CD2   1 
ATOM   1375 N  N     . ASP A 1 179 ? 81.464 -12.377 3.778   1.00 23.59 ? 176 ASP A N     1 
ATOM   1376 C  CA    . ASP A 1 179 ? 82.625 -13.251 3.956   1.00 32.55 ? 176 ASP A CA    1 
ATOM   1377 C  C     . ASP A 1 179 ? 82.350 -14.652 3.447   1.00 32.52 ? 176 ASP A C     1 
ATOM   1378 O  O     . ASP A 1 179 ? 83.265 -15.359 3.029   1.00 36.45 ? 176 ASP A O     1 
ATOM   1379 C  CB    . ASP A 1 179 ? 83.042 -13.322 5.427   1.00 27.45 ? 176 ASP A CB    1 
ATOM   1380 C  CG    . ASP A 1 179 ? 83.691 -12.045 5.913   1.00 36.77 ? 176 ASP A CG    1 
ATOM   1381 O  OD1   . ASP A 1 179 ? 84.100 -11.222 5.067   1.00 45.49 ? 176 ASP A OD1   1 
ATOM   1382 O  OD2   . ASP A 1 179 ? 83.776 -11.853 7.146   1.00 45.70 ? 176 ASP A OD2   1 
ATOM   1383 N  N     . SER A 1 180 ? 81.080 -15.036 3.475   1.00 27.05 ? 177 SER A N     1 
ATOM   1384 C  CA    A SER A 1 180 ? 80.669 -16.382 3.099   0.53 30.33 ? 177 SER A CA    1 
ATOM   1385 C  CA    B SER A 1 180 ? 80.669 -16.382 3.097   0.47 30.33 ? 177 SER A CA    1 
ATOM   1386 C  C     . SER A 1 180 ? 80.272 -16.494 1.630   1.00 33.22 ? 177 SER A C     1 
ATOM   1387 O  O     . SER A 1 180 ? 80.054 -17.593 1.121   1.00 41.42 ? 177 SER A O     1 
ATOM   1388 C  CB    A SER A 1 180 ? 79.503 -16.829 3.981   0.53 28.70 ? 177 SER A CB    1 
ATOM   1389 C  CB    B SER A 1 180 ? 79.503 -16.835 3.976   0.47 28.71 ? 177 SER A CB    1 
ATOM   1390 O  OG    A SER A 1 180 ? 79.843 -16.738 5.352   0.53 28.63 ? 177 SER A OG    1 
ATOM   1391 O  OG    B SER A 1 180 ? 78.923 -18.023 3.468   0.47 35.11 ? 177 SER A OG    1 
ATOM   1392 N  N     . LEU A 1 181 ? 80.170 -15.359 0.953   1.00 24.96 ? 178 LEU A N     1 
ATOM   1393 C  CA    . LEU A 1 181 ? 79.706 -15.347 -0.431  1.00 24.21 ? 178 LEU A CA    1 
ATOM   1394 C  C     . LEU A 1 181 ? 80.681 -15.997 -1.397  1.00 39.16 ? 178 LEU A C     1 
ATOM   1395 O  O     . LEU A 1 181 ? 81.879 -15.728 -1.352  1.00 38.47 ? 178 LEU A O     1 
ATOM   1396 C  CB    . LEU A 1 181 ? 79.435 -13.912 -0.886  1.00 30.74 ? 178 LEU A CB    1 
ATOM   1397 C  CG    . LEU A 1 181 ? 77.996 -13.400 -0.810  1.00 28.13 ? 178 LEU A CG    1 
ATOM   1398 C  CD1   . LEU A 1 181 ? 77.899 -12.065 -1.557  1.00 19.69 ? 178 LEU A CD1   1 
ATOM   1399 C  CD2   . LEU A 1 181 ? 77.003 -14.419 -1.374  1.00 22.62 ? 178 LEU A CD2   1 
ATOM   1400 N  N     . GLN A 1 182 ? 80.166 -16.858 -2.270  1.00 39.54 ? 179 GLN A N     1 
ATOM   1401 C  CA    . GLN A 1 182 ? 80.977 -17.338 -3.379  1.00 51.81 ? 179 GLN A CA    1 
ATOM   1402 C  C     . GLN A 1 182 ? 80.592 -16.499 -4.606  1.00 53.18 ? 179 GLN A C     1 
ATOM   1403 O  O     . GLN A 1 182 ? 79.528 -16.649 -5.207  1.00 55.17 ? 179 GLN A O     1 
ATOM   1404 C  CB    . GLN A 1 182 ? 80.817 -18.860 -3.586  1.00 55.47 ? 179 GLN A CB    1 
ATOM   1405 C  CG    . GLN A 1 182 ? 79.757 -19.326 -4.569  1.00 57.18 ? 179 GLN A CG    1 
ATOM   1406 C  CD    . GLN A 1 182 ? 79.266 -20.723 -4.286  1.00 62.05 ? 179 GLN A CD    1 
ATOM   1407 O  OE1   . GLN A 1 182 ? 80.026 -21.580 -3.833  1.00 70.16 ? 179 GLN A OE1   1 
ATOM   1408 N  NE2   . GLN A 1 182 ? 77.988 -20.967 -4.554  1.00 59.71 ? 179 GLN A NE2   1 
ATOM   1409 N  N     . ILE A 1 183 ? 81.463 -15.554 -4.929  1.00 51.52 ? 180 ILE A N     1 
ATOM   1410 C  CA    . ILE A 1 183 ? 81.177 -14.575 -5.960  1.00 53.00 ? 180 ILE A CA    1 
ATOM   1411 C  C     . ILE A 1 183 ? 81.500 -15.057 -7.392  1.00 56.87 ? 180 ILE A C     1 
ATOM   1412 O  O     . ILE A 1 183 ? 80.978 -14.498 -8.358  1.00 55.28 ? 180 ILE A O     1 
ATOM   1413 C  CB    . ILE A 1 183 ? 81.889 -13.232 -5.594  1.00 48.47 ? 180 ILE A CB    1 
ATOM   1414 C  CG1   . ILE A 1 183 ? 83.419 -13.300 -5.776  1.00 51.77 ? 180 ILE A CG1   1 
ATOM   1415 C  CG2   . ILE A 1 183 ? 81.469 -12.783 -4.193  1.00 44.49 ? 180 ILE A CG2   1 
ATOM   1416 C  CD1   . ILE A 1 183 ? 83.946 -13.032 -7.167  1.00 54.11 ? 180 ILE A CD1   1 
ATOM   1417 N  N     . ASP A 1 184 ? 82.305 -16.114 -7.527  1.00 57.76 ? 181 ASP A N     1 
ATOM   1418 C  CA    . ASP A 1 184 ? 82.668 -16.627 -8.854  1.00 56.22 ? 181 ASP A CA    1 
ATOM   1419 C  C     . ASP A 1 184 ? 81.603 -17.543 -9.471  1.00 58.35 ? 181 ASP A C     1 
ATOM   1420 O  O     . ASP A 1 184 ? 81.678 -17.869 -10.665 1.00 58.75 ? 181 ASP A O     1 
ATOM   1421 C  CB    . ASP A 1 184 ? 84.033 -17.345 -8.808  1.00 62.52 ? 181 ASP A CB    1 
ATOM   1422 C  CG    . ASP A 1 184 ? 84.055 -18.561 -7.873  1.00 66.88 ? 181 ASP A CG    1 
ATOM   1423 O  OD1   . ASP A 1 184 ? 83.316 -18.576 -6.863  1.00 65.36 ? 181 ASP A OD1   1 
ATOM   1424 O  OD2   . ASP A 1 184 ? 84.818 -19.510 -8.166  1.00 70.82 ? 181 ASP A OD2   1 
ATOM   1425 N  N     . ASN A 1 185 ? 80.604 -17.931 -8.681  1.00 56.62 ? 182 ASN A N     1 
ATOM   1426 C  CA    . ASN A 1 185 ? 79.424 -18.594 -9.238  1.00 54.55 ? 182 ASN A CA    1 
ATOM   1427 C  C     . ASN A 1 185 ? 78.387 -17.538 -9.614  1.00 50.52 ? 182 ASN A C     1 
ATOM   1428 O  O     . ASN A 1 185 ? 77.805 -16.893 -8.735  1.00 45.59 ? 182 ASN A O     1 
ATOM   1429 C  CB    . ASN A 1 185 ? 78.833 -19.591 -8.239  1.00 47.85 ? 182 ASN A CB    1 
ATOM   1430 C  CG    . ASN A 1 185 ? 77.645 -20.375 -8.806  1.00 47.46 ? 182 ASN A CG    1 
ATOM   1431 O  OD1   . ASN A 1 185 ? 77.226 -20.176 -9.946  1.00 43.40 ? 182 ASN A OD1   1 
ATOM   1432 N  ND2   . ASN A 1 185 ? 77.092 -21.267 -7.993  1.00 46.80 ? 182 ASN A ND2   1 
ATOM   1433 N  N     . LEU A 1 186 ? 78.180 -17.343 -10.914 1.00 45.15 ? 183 LEU A N     1 
ATOM   1434 C  CA    . LEU A 1 186 ? 77.267 -16.307 -11.387 1.00 45.69 ? 183 LEU A CA    1 
ATOM   1435 C  C     . LEU A 1 186 ? 75.793 -16.706 -11.266 1.00 40.33 ? 183 LEU A C     1 
ATOM   1436 O  O     . LEU A 1 186 ? 74.900 -15.894 -11.526 1.00 41.50 ? 183 LEU A O     1 
ATOM   1437 C  CB    . LEU A 1 186 ? 77.583 -15.943 -12.840 1.00 44.15 ? 183 LEU A CB    1 
ATOM   1438 C  CG    . LEU A 1 186 ? 78.705 -14.922 -13.043 1.00 47.70 ? 183 LEU A CG    1 
ATOM   1439 C  CD1   . LEU A 1 186 ? 80.023 -15.604 -13.418 1.00 49.21 ? 183 LEU A CD1   1 
ATOM   1440 C  CD2   . LEU A 1 186 ? 78.303 -13.894 -14.087 1.00 43.96 ? 183 LEU A CD2   1 
ATOM   1441 N  N     . THR A 1 187 ? 75.531 -17.952 -10.887 1.00 37.44 ? 184 THR A N     1 
ATOM   1442 C  CA    . THR A 1 187 ? 74.150 -18.382 -10.687 1.00 36.37 ? 184 THR A CA    1 
ATOM   1443 C  C     . THR A 1 187 ? 73.850 -18.718 -9.225  1.00 31.63 ? 184 THR A C     1 
ATOM   1444 O  O     . THR A 1 187 ? 72.797 -19.281 -8.933  1.00 36.28 ? 184 THR A O     1 
ATOM   1445 C  CB    . THR A 1 187 ? 73.792 -19.615 -11.550 1.00 42.00 ? 184 THR A CB    1 
ATOM   1446 O  OG1   . THR A 1 187 ? 74.621 -20.727 -11.183 1.00 46.98 ? 184 THR A OG1   1 
ATOM   1447 C  CG2   . THR A 1 187 ? 73.983 -19.305 -13.032 1.00 44.35 ? 184 THR A CG2   1 
ATOM   1448 N  N     . SER A 1 188 ? 74.775 -18.403 -8.318  1.00 32.08 ? 185 SER A N     1 
ATOM   1449 C  CA    . SER A 1 188 ? 74.511 -18.540 -6.880  1.00 24.95 ? 185 SER A CA    1 
ATOM   1450 C  C     . SER A 1 188 ? 73.351 -17.641 -6.476  1.00 19.59 ? 185 SER A C     1 
ATOM   1451 O  O     . SER A 1 188 ? 73.440 -16.420 -6.623  1.00 17.76 ? 185 SER A O     1 
ATOM   1452 C  CB    . SER A 1 188 ? 75.740 -18.179 -6.048  1.00 28.58 ? 185 SER A CB    1 
ATOM   1453 O  OG    . SER A 1 188 ? 75.416 -18.147 -4.662  1.00 30.71 ? 185 SER A OG    1 
ATOM   1454 N  N     . PRO A 1 189 ? 72.254 -18.232 -5.980  1.00 18.40 ? 186 PRO A N     1 
ATOM   1455 C  CA    . PRO A 1 189 ? 71.113 -17.390 -5.579  1.00 14.74 ? 186 PRO A CA    1 
ATOM   1456 C  C     . PRO A 1 189 ? 71.476 -16.354 -4.522  1.00 15.98 ? 186 PRO A C     1 
ATOM   1457 O  O     . PRO A 1 189 ? 70.956 -15.233 -4.563  1.00 14.01 ? 186 PRO A O     1 
ATOM   1458 C  CB    . PRO A 1 189 ? 70.112 -18.404 -5.019  1.00 16.22 ? 186 PRO A CB    1 
ATOM   1459 C  CG    . PRO A 1 189 ? 70.451 -19.686 -5.747  1.00 19.45 ? 186 PRO A CG    1 
ATOM   1460 C  CD    . PRO A 1 189 ? 71.942 -19.668 -5.886  1.00 18.21 ? 186 PRO A CD    1 
ATOM   1461 N  N     . ASP A 1 190 ? 72.356 -16.718 -3.589  1.00 14.59 ? 187 ASP A N     1 
ATOM   1462 C  CA    . ASP A 1 190 ? 72.750 -15.807 -2.528  1.00 10.77 ? 187 ASP A CA    1 
ATOM   1463 C  C     . ASP A 1 190 ? 73.473 -14.608 -3.126  1.00 12.57 ? 187 ASP A C     1 
ATOM   1464 O  O     . ASP A 1 190 ? 73.262 -13.469 -2.702  1.00 14.50 ? 187 ASP A O     1 
ATOM   1465 C  CB    . ASP A 1 190 ? 73.645 -16.514 -1.495  1.00 14.27 ? 187 ASP A CB    1 
ATOM   1466 C  CG    . ASP A 1 190 ? 72.860 -17.414 -0.549  1.00 18.53 ? 187 ASP A CG    1 
ATOM   1467 O  OD1   . ASP A 1 190 ? 71.614 -17.366 -0.535  1.00 13.45 ? 187 ASP A OD1   1 
ATOM   1468 O  OD2   . ASP A 1 190 ? 73.495 -18.193 0.188   1.00 19.48 ? 187 ASP A OD2   1 
ATOM   1469 N  N     . LEU A 1 191 ? 74.337 -14.871 -4.101  1.00 14.45 ? 188 LEU A N     1 
ATOM   1470 C  CA    . LEU A 1 191 ? 75.062 -13.790 -4.763  1.00 14.03 ? 188 LEU A CA    1 
ATOM   1471 C  C     . LEU A 1 191 ? 74.084 -12.911 -5.521  1.00 14.72 ? 188 LEU A C     1 
ATOM   1472 O  O     . LEU A 1 191 ? 74.204 -11.687 -5.502  1.00 14.54 ? 188 LEU A O     1 
ATOM   1473 C  CB    . LEU A 1 191 ? 76.126 -14.340 -5.718  1.00 18.80 ? 188 LEU A CB    1 
ATOM   1474 C  CG    . LEU A 1 191 ? 76.871 -13.275 -6.535  1.00 19.35 ? 188 LEU A CG    1 
ATOM   1475 C  CD1   . LEU A 1 191 ? 77.559 -12.253 -5.655  1.00 18.30 ? 188 LEU A CD1   1 
ATOM   1476 C  CD2   . LEU A 1 191 ? 77.868 -13.949 -7.469  1.00 21.13 ? 188 LEU A CD2   1 
ATOM   1477 N  N     . GLN A 1 192 ? 73.130 -13.547 -6.188  1.00 13.73 ? 189 GLN A N     1 
ATOM   1478 C  CA    . GLN A 1 192 ? 72.121 -12.824 -6.959  1.00 14.58 ? 189 GLN A CA    1 
ATOM   1479 C  C     . GLN A 1 192 ? 71.321 -11.892 -6.047  1.00 13.54 ? 189 GLN A C     1 
ATOM   1480 O  O     . GLN A 1 192 ? 71.078 -10.732 -6.389  1.00 12.32 ? 189 GLN A O     1 
ATOM   1481 C  CB    . GLN A 1 192 ? 71.209 -13.803 -7.685  1.00 14.00 ? 189 GLN A CB    1 
ATOM   1482 C  CG    . GLN A 1 192 ? 71.917 -14.479 -8.871  1.00 15.99 ? 189 GLN A CG    1 
ATOM   1483 C  CD    . GLN A 1 192 ? 71.145 -15.634 -9.460  1.00 26.07 ? 189 GLN A CD    1 
ATOM   1484 O  OE1   . GLN A 1 192 ? 70.189 -16.129 -8.865  1.00 30.30 ? 189 GLN A OE1   1 
ATOM   1485 N  NE2   . GLN A 1 192 ? 71.558 -16.074 -10.646 1.00 32.59 ? 189 GLN A NE2   1 
ATOM   1486 N  N     . LEU A 1 193 ? 70.915 -12.388 -4.883  1.00 12.73 ? 190 LEU A N     1 
ATOM   1487 C  CA    . LEU A 1 193 ? 70.191 -11.538 -3.935  1.00 10.38 ? 190 LEU A CA    1 
ATOM   1488 C  C     . LEU A 1 193 ? 71.041 -10.344 -3.503  1.00 12.05 ? 190 LEU A C     1 
ATOM   1489 O  O     . LEU A 1 193 ? 70.536 -9.240  -3.314  1.00 14.39 ? 190 LEU A O     1 
ATOM   1490 C  CB    . LEU A 1 193 ? 69.771 -12.331 -2.702  1.00 11.74 ? 190 LEU A CB    1 
ATOM   1491 C  CG    . LEU A 1 193 ? 68.667 -13.364 -2.838  1.00 10.74 ? 190 LEU A CG    1 
ATOM   1492 C  CD1   . LEU A 1 193 ? 68.361 -13.953 -1.460  1.00 14.48 ? 190 LEU A CD1   1 
ATOM   1493 C  CD2   . LEU A 1 193 ? 67.420 -12.748 -3.434  1.00 12.39 ? 190 LEU A CD2   1 
ATOM   1494 N  N     . THR A 1 194 ? 72.332 -10.588 -3.300  1.00 13.82 ? 191 THR A N     1 
ATOM   1495 C  CA    . THR A 1 194 ? 73.236 -9.555  -2.823  1.00 12.46 ? 191 THR A CA    1 
ATOM   1496 C  C     . THR A 1 194 ? 73.371 -8.443  -3.859  1.00 12.39 ? 191 THR A C     1 
ATOM   1497 O  O     . THR A 1 194 ? 73.360 -7.269  -3.511  1.00 13.78 ? 191 THR A O     1 
ATOM   1498 C  CB    . THR A 1 194 ? 74.626 -10.127 -2.517  1.00 14.17 ? 191 THR A CB    1 
ATOM   1499 O  OG1   . THR A 1 194 ? 74.497 -11.197 -1.572  1.00 14.06 ? 191 THR A OG1   1 
ATOM   1500 C  CG2   . THR A 1 194 ? 75.521 -9.049  -1.924  1.00 14.11 ? 191 THR A CG2   1 
ATOM   1501 N  N     . VAL A 1 195 ? 73.491 -8.834  -5.122  1.00 14.77 ? 192 VAL A N     1 
ATOM   1502 C  CA    . VAL A 1 195 ? 73.584 -7.853  -6.194  1.00 14.72 ? 192 VAL A CA    1 
ATOM   1503 C  C     . VAL A 1 195 ? 72.235 -7.129  -6.277  1.00 14.96 ? 192 VAL A C     1 
ATOM   1504 O  O     . VAL A 1 195 ? 72.192 -5.908  -6.475  1.00 13.90 ? 192 VAL A O     1 
ATOM   1505 C  CB    . VAL A 1 195 ? 73.959 -8.512  -7.515  1.00 13.26 ? 192 VAL A CB    1 
ATOM   1506 C  CG1   . VAL A 1 195 ? 73.860 -7.506  -8.672  1.00 16.11 ? 192 VAL A CG1   1 
ATOM   1507 C  CG2   . VAL A 1 195 ? 75.369 -9.100  -7.406  1.00 14.47 ? 192 VAL A CG2   1 
ATOM   1508 N  N     . GLY A 1 196 ? 71.150 -7.866  -6.085  1.00 12.35 ? 193 GLY A N     1 
ATOM   1509 C  CA    . GLY A 1 196 ? 69.823 -7.255  -6.026  1.00 11.97 ? 193 GLY A CA    1 
ATOM   1510 C  C     . GLY A 1 196 ? 69.798 -6.166  -4.969  1.00 11.48 ? 193 GLY A C     1 
ATOM   1511 O  O     . GLY A 1 196 ? 69.279 -5.064  -5.205  1.00 14.08 ? 193 GLY A O     1 
ATOM   1512 N  N     . ALA A 1 197 ? 70.357 -6.453  -3.799  1.00 12.74 ? 194 ALA A N     1 
ATOM   1513 C  CA    . ALA A 1 197 ? 70.405 -5.476  -2.716  1.00 9.53  ? 194 ALA A CA    1 
ATOM   1514 C  C     . ALA A 1 197 ? 71.234 -4.239  -3.084  1.00 13.47 ? 194 ALA A C     1 
ATOM   1515 O  O     . ALA A 1 197 ? 70.886 -3.121  -2.701  1.00 12.66 ? 194 ALA A O     1 
ATOM   1516 C  CB    . ALA A 1 197 ? 70.942 -6.115  -1.451  1.00 13.59 ? 194 ALA A CB    1 
ATOM   1517 N  N     . VAL A 1 198 ? 72.319 -4.438  -3.828  1.00 13.40 ? 195 VAL A N     1 
ATOM   1518 C  CA    . VAL A 1 198 ? 73.127 -3.306  -4.303  1.00 11.20 ? 195 VAL A CA    1 
ATOM   1519 C  C     . VAL A 1 198 ? 72.301 -2.384  -5.197  1.00 15.30 ? 195 VAL A C     1 
ATOM   1520 O  O     . VAL A 1 198 ? 72.355 -1.144  -5.065  1.00 15.94 ? 195 VAL A O     1 
ATOM   1521 C  CB    . VAL A 1 198 ? 74.368 -3.785  -5.076  1.00 13.94 ? 195 VAL A CB    1 
ATOM   1522 C  CG1   . VAL A 1 198 ? 75.128 -2.586  -5.670  1.00 15.58 ? 195 VAL A CG1   1 
ATOM   1523 C  CG2   . VAL A 1 198 ? 75.277 -4.570  -4.162  1.00 16.92 ? 195 VAL A CG2   1 
ATOM   1524 N  N     . ILE A 1 199 ? 71.518 -2.996  -6.079  1.00 11.23 ? 196 ILE A N     1 
ATOM   1525 C  CA    . ILE A 1 199 ? 70.669 -2.234  -6.993  1.00 12.81 ? 196 ILE A CA    1 
ATOM   1526 C  C     . ILE A 1 199 ? 69.586 -1.494  -6.202  1.00 14.71 ? 196 ILE A C     1 
ATOM   1527 O  O     . ILE A 1 199 ? 69.290 -0.335  -6.490  1.00 14.35 ? 196 ILE A O     1 
ATOM   1528 C  CB    . ILE A 1 199 ? 70.039 -3.131  -8.064  1.00 14.05 ? 196 ILE A CB    1 
ATOM   1529 C  CG1   . ILE A 1 199 ? 71.123 -3.615  -9.039  1.00 14.32 ? 196 ILE A CG1   1 
ATOM   1530 C  CG2   . ILE A 1 199 ? 68.998 -2.361  -8.853  1.00 13.67 ? 196 ILE A CG2   1 
ATOM   1531 C  CD1   . ILE A 1 199 ? 70.680 -4.726  -9.963  1.00 15.99 ? 196 ILE A CD1   1 
ATOM   1532 N  N     . VAL A 1 200 ? 69.021 -2.148  -5.188  1.00 11.68 ? 197 VAL A N     1 
ATOM   1533 C  CA    . VAL A 1 200 ? 67.970 -1.507  -4.404  1.00 10.88 ? 197 VAL A CA    1 
ATOM   1534 C  C     . VAL A 1 200 ? 68.525 -0.348  -3.568  1.00 14.81 ? 197 VAL A C     1 
ATOM   1535 O  O     . VAL A 1 200 ? 67.835 0.652   -3.369  1.00 12.77 ? 197 VAL A O     1 
ATOM   1536 C  CB    . VAL A 1 200 ? 67.232 -2.540  -3.515  1.00 11.27 ? 197 VAL A CB    1 
ATOM   1537 C  CG1   . VAL A 1 200 ? 66.245 -1.835  -2.588  1.00 13.65 ? 197 VAL A CG1   1 
ATOM   1538 C  CG2   . VAL A 1 200 ? 66.496 -3.513  -4.414  1.00 12.07 ? 197 VAL A CG2   1 
ATOM   1539 N  N     . GLU A 1 201 ? 69.770 -0.442  -3.102  1.00 13.07 ? 198 GLU A N     1 
ATOM   1540 C  CA    . GLU A 1 201 ? 70.407 0.717   -2.465  1.00 13.60 ? 198 GLU A CA    1 
ATOM   1541 C  C     . GLU A 1 201 ? 70.403 1.893   -3.443  1.00 14.08 ? 198 GLU A C     1 
ATOM   1542 O  O     . GLU A 1 201 ? 70.082 3.032   -3.073  1.00 15.48 ? 198 GLU A O     1 
ATOM   1543 C  CB    . GLU A 1 201 ? 71.854 0.416   -2.036  1.00 16.10 ? 198 GLU A CB    1 
ATOM   1544 C  CG    . GLU A 1 201 ? 72.026 -0.599  -0.889  1.00 17.47 ? 198 GLU A CG    1 
ATOM   1545 C  CD    . GLU A 1 201 ? 71.922 -0.011  0.513   1.00 17.05 ? 198 GLU A CD    1 
ATOM   1546 O  OE1   . GLU A 1 201 ? 71.554 1.183   0.676   1.00 16.98 ? 198 GLU A OE1   1 
ATOM   1547 O  OE2   . GLU A 1 201 ? 72.193 -0.753  1.486   1.00 15.54 ? 198 GLU A OE2   1 
ATOM   1548 N  N     . GLU A 1 202 ? 70.765 1.603   -4.689  1.00 13.47 ? 199 GLU A N     1 
ATOM   1549 C  CA    . GLU A 1 202 ? 70.872 2.638   -5.715  1.00 14.84 ? 199 GLU A CA    1 
ATOM   1550 C  C     . GLU A 1 202 ? 69.481 3.217   -5.995  1.00 15.06 ? 199 GLU A C     1 
ATOM   1551 O  O     . GLU A 1 202 ? 69.320 4.441   -6.064  1.00 15.68 ? 199 GLU A O     1 
ATOM   1552 C  CB    . GLU A 1 202 ? 71.518 2.074   -6.989  1.00 16.78 ? 199 GLU A CB    1 
ATOM   1553 C  CG    . GLU A 1 202 ? 73.008 1.765   -6.801  1.00 16.15 ? 199 GLU A CG    1 
ATOM   1554 C  CD    . GLU A 1 202 ? 73.578 0.816   -7.857  1.00 24.04 ? 199 GLU A CD    1 
ATOM   1555 O  OE1   . GLU A 1 202 ? 74.797 0.531   -7.802  1.00 28.16 ? 199 GLU A OE1   1 
ATOM   1556 O  OE2   . GLU A 1 202 ? 72.823 0.357   -8.735  1.00 27.66 ? 199 GLU A OE2   1 
ATOM   1557 N  N     . MET A 1 203 ? 68.483 2.338   -6.109  1.00 13.70 ? 200 MET A N     1 
ATOM   1558 C  CA    . MET A 1 203 ? 67.087 2.766   -6.295  1.00 13.88 ? 200 MET A CA    1 
ATOM   1559 C  C     . MET A 1 203 ? 66.617 3.650   -5.166  1.00 13.91 ? 200 MET A C     1 
ATOM   1560 O  O     . MET A 1 203 ? 66.004 4.708   -5.400  1.00 13.35 ? 200 MET A O     1 
ATOM   1561 C  CB    . MET A 1 203 ? 66.142 1.565   -6.396  1.00 14.06 ? 200 MET A CB    1 
ATOM   1562 C  CG    A MET A 1 203 ? 66.410 0.638   -7.547  0.55 15.07 ? 200 MET A CG    1 
ATOM   1563 C  CG    B MET A 1 203 ? 64.753 1.942   -6.826  0.45 15.59 ? 200 MET A CG    1 
ATOM   1564 S  SD    A MET A 1 203 ? 65.177 -0.668  -7.593  0.55 18.22 ? 200 MET A SD    1 
ATOM   1565 S  SD    B MET A 1 203 ? 63.616 0.545   -6.923  0.45 19.37 ? 200 MET A SD    1 
ATOM   1566 C  CE    A MET A 1 203 ? 63.708 0.310   -7.878  0.55 9.69  ? 200 MET A CE    1 
ATOM   1567 C  CE    B MET A 1 203 ? 64.269 -0.421  -8.272  0.45 17.91 ? 200 MET A CE    1 
ATOM   1568 N  N     . ARG A 1 204 ? 66.893 3.236   -3.931  1.00 10.27 ? 201 ARG A N     1 
ATOM   1569 C  CA    . ARG A 1 204 ? 66.416 3.981   -2.776  1.00 10.19 ? 201 ARG A CA    1 
ATOM   1570 C  C     . ARG A 1 204 ? 67.136 5.327   -2.670  1.00 15.15 ? 201 ARG A C     1 
ATOM   1571 O  O     . ARG A 1 204 ? 66.527 6.326   -2.309  1.00 13.18 ? 201 ARG A O     1 
ATOM   1572 C  CB    . ARG A 1 204 ? 66.576 3.155   -1.495  1.00 13.44 ? 201 ARG A CB    1 
ATOM   1573 C  CG    . ARG A 1 204 ? 65.609 1.963   -1.467  1.00 13.23 ? 201 ARG A CG    1 
ATOM   1574 C  CD    . ARG A 1 204 ? 65.712 1.159   -0.198  1.00 14.08 ? 201 ARG A CD    1 
ATOM   1575 N  NE    . ARG A 1 204 ? 65.713 2.005   0.979   1.00 12.87 ? 201 ARG A NE    1 
ATOM   1576 C  CZ    . ARG A 1 204 ? 66.769 2.148   1.775   1.00 14.48 ? 201 ARG A CZ    1 
ATOM   1577 N  NH1   . ARG A 1 204 ? 66.721 2.968   2.815   1.00 14.23 ? 201 ARG A NH1   1 
ATOM   1578 N  NH2   . ARG A 1 204 ? 67.881 1.475   1.523   1.00 15.86 ? 201 ARG A NH2   1 
ATOM   1579 N  N     . ALA A 1 205 ? 68.415 5.351   -3.034  1.00 13.78 ? 202 ALA A N     1 
ATOM   1580 C  CA    . ALA A 1 205 ? 69.175 6.599   -3.046  1.00 15.24 ? 202 ALA A CA    1 
ATOM   1581 C  C     . ALA A 1 205 ? 68.570 7.567   -4.063  1.00 12.72 ? 202 ALA A C     1 
ATOM   1582 O  O     . ALA A 1 205 ? 68.448 8.774   -3.787  1.00 14.30 ? 202 ALA A O     1 
ATOM   1583 C  CB    . ALA A 1 205 ? 70.656 6.325   -3.374  1.00 14.65 ? 202 ALA A CB    1 
ATOM   1584 N  N     . ALA A 1 206 ? 68.176 7.034   -5.222  1.00 11.37 ? 203 ALA A N     1 
ATOM   1585 C  CA    . ALA A 1 206 ? 67.592 7.854   -6.279  1.00 14.00 ? 203 ALA A CA    1 
ATOM   1586 C  C     . ALA A 1 206 ? 66.254 8.417   -5.834  1.00 12.76 ? 203 ALA A C     1 
ATOM   1587 O  O     . ALA A 1 206 ? 65.951 9.585   -6.058  1.00 14.93 ? 203 ALA A O     1 
ATOM   1588 C  CB    . ALA A 1 206 ? 67.435 7.060   -7.565  1.00 18.47 ? 203 ALA A CB    1 
ATOM   1589 N  N     . ILE A 1 207 ? 65.438 7.591   -5.189  1.00 11.32 ? 204 ILE A N     1 
ATOM   1590 C  CA    . ILE A 1 207 ? 64.151 8.088   -4.728  1.00 11.50 ? 204 ILE A CA    1 
ATOM   1591 C  C     . ILE A 1 207 ? 64.361 9.233   -3.739  1.00 14.49 ? 204 ILE A C     1 
ATOM   1592 O  O     . ILE A 1 207 ? 63.714 10.277  -3.841  1.00 11.96 ? 204 ILE A O     1 
ATOM   1593 C  CB    . ILE A 1 207 ? 63.325 6.966   -4.080  1.00 9.81  ? 204 ILE A CB    1 
ATOM   1594 C  CG1   . ILE A 1 207 ? 62.910 5.948   -5.137  1.00 12.79 ? 204 ILE A CG1   1 
ATOM   1595 C  CG2   . ILE A 1 207 ? 62.109 7.540   -3.337  1.00 10.12 ? 204 ILE A CG2   1 
ATOM   1596 C  CD1   . ILE A 1 207 ? 62.336 4.640   -4.514  1.00 13.27 ? 204 ILE A CD1   1 
ATOM   1597 N  N     . GLU A 1 208 ? 65.274 9.061   -2.788  1.00 12.43 ? 205 GLU A N     1 
ATOM   1598 C  CA    . GLU A 1 208 ? 65.465 10.098  -1.781  1.00 10.95 ? 205 GLU A CA    1 
ATOM   1599 C  C     . GLU A 1 208 ? 66.083 11.351  -2.404  1.00 13.18 ? 205 GLU A C     1 
ATOM   1600 O  O     . GLU A 1 208 ? 65.648 12.472  -2.110  1.00 13.50 ? 205 GLU A O     1 
ATOM   1601 C  CB    . GLU A 1 208 ? 66.333 9.606   -0.624  1.00 14.00 ? 205 GLU A CB    1 
ATOM   1602 C  CG    . GLU A 1 208 ? 66.484 10.669  0.468   1.00 15.46 ? 205 GLU A CG    1 
ATOM   1603 C  CD    . GLU A 1 208 ? 67.213 10.181  1.725   1.00 15.38 ? 205 GLU A CD    1 
ATOM   1604 O  OE1   . GLU A 1 208 ? 67.203 10.924  2.730   1.00 19.60 ? 205 GLU A OE1   1 
ATOM   1605 O  OE2   . GLU A 1 208 ? 67.783 9.070   1.712   1.00 19.28 ? 205 GLU A OE2   1 
ATOM   1606 N  N     . ARG A 1 209 ? 67.071 11.169  -3.281  1.00 13.59 ? 206 ARG A N     1 
ATOM   1607 C  CA    . ARG A 1 209 ? 67.693 12.334  -3.922  1.00 15.32 ? 206 ARG A CA    1 
ATOM   1608 C  C     . ARG A 1 209 ? 66.663 13.152  -4.689  1.00 15.40 ? 206 ARG A C     1 
ATOM   1609 O  O     . ARG A 1 209 ? 66.667 14.385  -4.605  1.00 16.56 ? 206 ARG A O     1 
ATOM   1610 C  CB    . ARG A 1 209 ? 68.824 11.919  -4.870  1.00 15.39 ? 206 ARG A CB    1 
ATOM   1611 C  CG    . ARG A 1 209 ? 69.598 13.132  -5.449  1.00 19.67 ? 206 ARG A CG    1 
ATOM   1612 C  CD    . ARG A 1 209 ? 70.629 12.765  -6.522  1.00 21.93 ? 206 ARG A CD    1 
ATOM   1613 N  NE    . ARG A 1 209 ? 70.035 12.572  -7.851  1.00 26.10 ? 206 ARG A NE    1 
ATOM   1614 C  CZ    . ARG A 1 209 ? 69.689 13.559  -8.681  1.00 23.48 ? 206 ARG A CZ    1 
ATOM   1615 N  NH1   . ARG A 1 209 ? 69.161 13.281  -9.870  1.00 22.66 ? 206 ARG A NH1   1 
ATOM   1616 N  NH2   . ARG A 1 209 ? 69.862 14.827  -8.329  1.00 20.94 ? 206 ARG A NH2   1 
ATOM   1617 N  N     . GLU A 1 210 ? 65.773 12.475  -5.412  1.00 11.22 ? 207 GLU A N     1 
ATOM   1618 C  CA    . GLU A 1 210 ? 64.939 13.141  -6.412  1.00 10.91 ? 207 GLU A CA    1 
ATOM   1619 C  C     . GLU A 1 210 ? 63.572 13.541  -5.885  1.00 12.54 ? 207 GLU A C     1 
ATOM   1620 O  O     . GLU A 1 210 ? 62.849 14.300  -6.550  1.00 11.37 ? 207 GLU A O     1 
ATOM   1621 C  CB    . GLU A 1 210 ? 64.782 12.264  -7.653  1.00 13.56 ? 207 GLU A CB    1 
ATOM   1622 C  CG    . GLU A 1 210 ? 66.102 11.961  -8.326  1.00 10.70 ? 207 GLU A CG    1 
ATOM   1623 C  CD    . GLU A 1 210 ? 65.979 11.097  -9.554  1.00 20.94 ? 207 GLU A CD    1 
ATOM   1624 O  OE1   . GLU A 1 210 ? 64.931 11.144  -10.234 1.00 21.91 ? 207 GLU A OE1   1 
ATOM   1625 O  OE2   . GLU A 1 210 ? 66.959 10.378  -9.855  1.00 27.27 ? 207 GLU A OE2   1 
ATOM   1626 N  N     . THR A 1 211 ? 63.205 13.054  -4.695  1.00 12.74 ? 208 THR A N     1 
ATOM   1627 C  CA    . THR A 1 211 ? 61.898 13.405  -4.135  1.00 11.52 ? 208 THR A CA    1 
ATOM   1628 C  C     . THR A 1 211 ? 61.977 13.932  -2.712  1.00 12.08 ? 208 THR A C     1 
ATOM   1629 O  O     . THR A 1 211 ? 61.058 14.610  -2.263  1.00 13.40 ? 208 THR A O     1 
ATOM   1630 C  CB    . THR A 1 211 ? 60.908 12.203  -4.117  1.00 11.66 ? 208 THR A CB    1 
ATOM   1631 O  OG1   . THR A 1 211 ? 61.326 11.242  -3.136  1.00 11.62 ? 208 THR A OG1   1 
ATOM   1632 C  CG2   . THR A 1 211 ? 60.788 11.555  -5.487  1.00 11.65 ? 208 THR A CG2   1 
ATOM   1633 N  N     . GLY A 1 212 ? 63.048 13.604  -1.988  1.00 11.15 ? 209 GLY A N     1 
ATOM   1634 C  CA    . GLY A 1 212 ? 63.138 13.923  -0.574  1.00 13.10 ? 209 GLY A CA    1 
ATOM   1635 C  C     . GLY A 1 212 ? 62.559 12.847  0.330   1.00 14.58 ? 209 GLY A C     1 
ATOM   1636 O  O     . GLY A 1 212 ? 62.664 12.951  1.549   1.00 17.41 ? 209 GLY A O     1 
ATOM   1637 N  N     . PHE A 1 213 ? 61.954 11.819  -0.264  1.00 13.31 ? 210 PHE A N     1 
ATOM   1638 C  CA    . PHE A 1 213 ? 61.279 10.775  0.516   1.00 11.32 ? 210 PHE A CA    1 
ATOM   1639 C  C     . PHE A 1 213 ? 62.191 9.584   0.807   1.00 14.09 ? 210 PHE A C     1 
ATOM   1640 O  O     . PHE A 1 213 ? 62.886 9.084   -0.080  1.00 14.54 ? 210 PHE A O     1 
ATOM   1641 C  CB    . PHE A 1 213 ? 60.038 10.261  -0.218  1.00 10.86 ? 210 PHE A CB    1 
ATOM   1642 C  CG    . PHE A 1 213 ? 59.021 11.324  -0.585  1.00 9.87  ? 210 PHE A CG    1 
ATOM   1643 C  CD1   . PHE A 1 213 ? 58.318 11.221  -1.780  1.00 12.32 ? 210 PHE A CD1   1 
ATOM   1644 C  CD2   . PHE A 1 213 ? 58.740 12.388  0.267   1.00 12.24 ? 210 PHE A CD2   1 
ATOM   1645 C  CE1   . PHE A 1 213 ? 57.372 12.172  -2.133  1.00 10.75 ? 210 PHE A CE1   1 
ATOM   1646 C  CE2   . PHE A 1 213 ? 57.805 13.342  -0.088  1.00 11.16 ? 210 PHE A CE2   1 
ATOM   1647 C  CZ    . PHE A 1 213 ? 57.116 13.224  -1.278  1.00 10.14 ? 210 PHE A CZ    1 
ATOM   1648 N  N     . GLN A 1 214 ? 62.146 9.117   2.047   1.00 11.36 ? 211 GLN A N     1 
ATOM   1649 C  CA    . GLN A 1 214 ? 62.831 7.893   2.450   1.00 13.24 ? 211 GLN A CA    1 
ATOM   1650 C  C     . GLN A 1 214 ? 61.915 6.683   2.386   1.00 11.03 ? 211 GLN A C     1 
ATOM   1651 O  O     . GLN A 1 214 ? 60.694 6.804   2.473   1.00 11.66 ? 211 GLN A O     1 
ATOM   1652 C  CB    . GLN A 1 214 ? 63.386 8.046   3.862   1.00 14.50 ? 211 GLN A CB    1 
ATOM   1653 C  CG    . GLN A 1 214 ? 64.586 8.982   3.896   1.00 13.02 ? 211 GLN A CG    1 
ATOM   1654 C  CD    . GLN A 1 214 ? 65.165 9.156   5.276   1.00 15.66 ? 211 GLN A CD    1 
ATOM   1655 O  OE1   . GLN A 1 214 ? 64.581 8.742   6.273   1.00 15.39 ? 211 GLN A OE1   1 
ATOM   1656 N  NE2   . GLN A 1 214 ? 66.342 9.772   5.336   1.00 18.71 ? 211 GLN A NE2   1 
ATOM   1657 N  N     . CYS A 1 215 ? 62.513 5.509   2.241   1.00 10.19 ? 212 CYS A N     1 
ATOM   1658 C  CA    . CYS A 1 215 ? 61.728 4.286   2.155   1.00 10.35 ? 212 CYS A CA    1 
ATOM   1659 C  C     . CYS A 1 215 ? 62.517 3.127   2.707   1.00 12.58 ? 212 CYS A C     1 
ATOM   1660 O  O     . CYS A 1 215 ? 63.723 3.232   2.944   1.00 13.22 ? 212 CYS A O     1 
ATOM   1661 C  CB    . CYS A 1 215 ? 61.317 3.984   0.713   1.00 10.98 ? 212 CYS A CB    1 
ATOM   1662 S  SG    . CYS A 1 215 ? 62.725 3.697   -0.356  1.00 16.40 ? 212 CYS A SG    1 
ATOM   1663 N  N     . SER A 1 216 ? 61.812 2.029   2.919   1.00 11.13 ? 213 SER A N     1 
ATOM   1664 C  CA    . SER A 1 216 ? 62.437 0.769   3.263   1.00 10.96 ? 213 SER A CA    1 
ATOM   1665 C  C     . SER A 1 216 ? 62.251 -0.203  2.120   1.00 11.30 ? 213 SER A C     1 
ATOM   1666 O  O     . SER A 1 216 ? 61.470 0.052   1.202   1.00 12.12 ? 213 SER A O     1 
ATOM   1667 C  CB    . SER A 1 216 ? 61.831 0.231   4.544   1.00 13.24 ? 213 SER A CB    1 
ATOM   1668 O  OG    . SER A 1 216 ? 61.995 1.187   5.579   1.00 15.25 ? 213 SER A OG    1 
ATOM   1669 N  N     . ALA A 1 217 ? 62.986 -1.310  2.138   1.00 10.29 ? 214 ALA A N     1 
ATOM   1670 C  CA    . ALA A 1 217 ? 62.800 -2.305  1.101   1.00 9.56  ? 214 ALA A CA    1 
ATOM   1671 C  C     . ALA A 1 217 ? 63.163 -3.683  1.580   1.00 10.63 ? 214 ALA A C     1 
ATOM   1672 O  O     . ALA A 1 217 ? 63.959 -3.832  2.504   1.00 9.86  ? 214 ALA A O     1 
ATOM   1673 C  CB    . ALA A 1 217 ? 63.627 -1.974  -0.141  1.00 11.16 ? 214 ALA A CB    1 
ATOM   1674 N  N     . GLY A 1 218 ? 62.563 -4.682  0.942   1.00 10.35 ? 215 GLY A N     1 
ATOM   1675 C  CA    . GLY A 1 218 ? 62.917 -6.078  1.180   1.00 10.05 ? 215 GLY A CA    1 
ATOM   1676 C  C     . GLY A 1 218 ? 63.440 -6.671  -0.111  1.00 11.01 ? 215 GLY A C     1 
ATOM   1677 O  O     . GLY A 1 218 ? 62.935 -6.348  -1.187  1.00 10.15 ? 215 GLY A O     1 
ATOM   1678 N  N     . ILE A 1 219 ? 64.461 -7.519  -0.014  1.00 9.51  ? 216 ILE A N     1 
ATOM   1679 C  CA    . ILE A 1 219 ? 64.998 -8.232  -1.166  1.00 8.60  ? 216 ILE A CA    1 
ATOM   1680 C  C     . ILE A 1 219 ? 64.980 -9.719  -0.857  1.00 11.30 ? 216 ILE A C     1 
ATOM   1681 O  O     . ILE A 1 219 ? 65.557 -10.156 0.149   1.00 10.48 ? 216 ILE A O     1 
ATOM   1682 C  CB    . ILE A 1 219 ? 66.437 -7.793  -1.514  1.00 11.09 ? 216 ILE A CB    1 
ATOM   1683 C  CG1   . ILE A 1 219 ? 66.510 -6.270  -1.734  1.00 11.85 ? 216 ILE A CG1   1 
ATOM   1684 C  CG2   . ILE A 1 219 ? 66.931 -8.509  -2.764  1.00 13.05 ? 216 ILE A CG2   1 
ATOM   1685 C  CD1   . ILE A 1 219 ? 66.957 -5.492  -0.535  1.00 14.07 ? 216 ILE A CD1   1 
ATOM   1686 N  N     . SER A 1 220 ? 64.294 -10.482 -1.701  1.00 9.87  ? 217 SER A N     1 
ATOM   1687 C  CA    . SER A 1 220 ? 64.281 -11.930 -1.574  1.00 8.25  ? 217 SER A CA    1 
ATOM   1688 C  C     . SER A 1 220 ? 63.995 -12.579 -2.925  1.00 10.72 ? 217 SER A C     1 
ATOM   1689 O  O     . SER A 1 220 ? 64.244 -11.974 -3.980  1.00 9.89  ? 217 SER A O     1 
ATOM   1690 C  CB    . SER A 1 220 ? 63.254 -12.351 -0.520  1.00 11.59 ? 217 SER A CB    1 
ATOM   1691 O  OG    . SER A 1 220 ? 63.451 -13.710 -0.175  1.00 11.61 ? 217 SER A OG    1 
ATOM   1692 N  N     . HIS A 1 221 ? 63.499 -13.813 -2.905  1.00 12.45 ? 218 HIS A N     1 
ATOM   1693 C  CA    . HIS A 1 221 ? 63.283 -14.554 -4.143  1.00 11.70 ? 218 HIS A CA    1 
ATOM   1694 C  C     . HIS A 1 221 ? 61.836 -14.526 -4.636  1.00 12.78 ? 218 HIS A C     1 
ATOM   1695 O  O     . HIS A 1 221 ? 61.530 -15.092 -5.691  1.00 12.40 ? 218 HIS A O     1 
ATOM   1696 C  CB    . HIS A 1 221 ? 63.726 -16.020 -3.969  1.00 11.89 ? 218 HIS A CB    1 
ATOM   1697 C  CG    . HIS A 1 221 ? 65.207 -16.195 -3.864  1.00 15.04 ? 218 HIS A CG    1 
ATOM   1698 N  ND1   . HIS A 1 221 ? 66.071 -15.868 -4.890  1.00 12.67 ? 218 HIS A ND1   1 
ATOM   1699 C  CD2   . HIS A 1 221 ? 65.977 -16.692 -2.866  1.00 12.71 ? 218 HIS A CD2   1 
ATOM   1700 C  CE1   . HIS A 1 221 ? 67.309 -16.148 -4.521  1.00 15.02 ? 218 HIS A CE1   1 
ATOM   1701 N  NE2   . HIS A 1 221 ? 67.280 -16.648 -3.300  1.00 13.99 ? 218 HIS A NE2   1 
ATOM   1702 N  N     . ASN A 1 222 ? 60.953 -13.879 -3.891  1.00 8.93  ? 219 ASN A N     1 
ATOM   1703 C  CA    . ASN A 1 222 ? 59.550 -13.775 -4.290  1.00 9.67  ? 219 ASN A CA    1 
ATOM   1704 C  C     . ASN A 1 222 ? 58.863 -12.618 -3.560  1.00 10.45 ? 219 ASN A C     1 
ATOM   1705 O  O     . ASN A 1 222 ? 59.455 -11.986 -2.673  1.00 11.46 ? 219 ASN A O     1 
ATOM   1706 C  CB    . ASN A 1 222 ? 58.800 -15.092 -4.020  1.00 10.72 ? 219 ASN A CB    1 
ATOM   1707 C  CG    . ASN A 1 222 ? 58.943 -15.555 -2.588  1.00 12.80 ? 219 ASN A CG    1 
ATOM   1708 O  OD1   . ASN A 1 222 ? 58.467 -14.893 -1.670  1.00 11.59 ? 219 ASN A OD1   1 
ATOM   1709 N  ND2   . ASN A 1 222 ? 59.545 -16.735 -2.395  1.00 12.11 ? 219 ASN A ND2   1 
ATOM   1710 N  N     . LYS A 1 223 ? 57.624 -12.335 -3.943  1.00 9.68  ? 220 LYS A N     1 
ATOM   1711 C  CA    . LYS A 1 223 ? 56.923 -11.173 -3.400  1.00 10.70 ? 220 LYS A CA    1 
ATOM   1712 C  C     . LYS A 1 223 ? 56.620 -11.298 -1.914  1.00 10.16 ? 220 LYS A C     1 
ATOM   1713 O  O     . LYS A 1 223 ? 56.795 -10.337 -1.162  1.00 10.28 ? 220 LYS A O     1 
ATOM   1714 C  CB    . LYS A 1 223 ? 55.624 -10.923 -4.183  1.00 12.07 ? 220 LYS A CB    1 
ATOM   1715 C  CG    . LYS A 1 223 ? 55.854 -10.451 -5.616  1.00 14.12 ? 220 LYS A CG    1 
ATOM   1716 C  CD    . LYS A 1 223 ? 54.633 -9.706  -6.204  1.00 23.32 ? 220 LYS A CD    1 
ATOM   1717 C  CE    . LYS A 1 223 ? 53.504 -10.620 -6.504  1.00 25.79 ? 220 LYS A CE    1 
ATOM   1718 N  NZ    . LYS A 1 223 ? 52.352 -9.901  -7.164  1.00 17.03 ? 220 LYS A NZ    1 
ATOM   1719 N  N     . VAL A 1 224 ? 56.145 -12.459 -1.470  1.00 10.72 ? 221 VAL A N     1 
ATOM   1720 C  CA    . VAL A 1 224 ? 55.788 -12.584 -0.054  1.00 11.85 ? 221 VAL A CA    1 
ATOM   1721 C  C     . VAL A 1 224 ? 57.004 -12.403 0.849   1.00 10.21 ? 221 VAL A C     1 
ATOM   1722 O  O     . VAL A 1 224 ? 56.934 -11.673 1.852   1.00 11.35 ? 221 VAL A O     1 
ATOM   1723 C  CB    . VAL A 1 224 ? 55.119 -13.934 0.261   1.00 11.96 ? 221 VAL A CB    1 
ATOM   1724 C  CG1   . VAL A 1 224 ? 55.141 -14.207 1.764   1.00 17.80 ? 221 VAL A CG1   1 
ATOM   1725 C  CG2   . VAL A 1 224 ? 53.699 -13.917 -0.229  1.00 13.85 ? 221 VAL A CG2   1 
ATOM   1726 N  N     . LEU A 1 225 ? 58.129 -13.022 0.490   1.00 10.76 ? 222 LEU A N     1 
ATOM   1727 C  CA    . LEU A 1 225 ? 59.329 -12.856 1.311   1.00 10.45 ? 222 LEU A CA    1 
ATOM   1728 C  C     . LEU A 1 225 ? 59.891 -11.440 1.213   1.00 10.32 ? 222 LEU A C     1 
ATOM   1729 O  O     . LEU A 1 225 ? 60.401 -10.907 2.190   1.00 10.22 ? 222 LEU A O     1 
ATOM   1730 C  CB    . LEU A 1 225 ? 60.407 -13.870 0.930   1.00 10.07 ? 222 LEU A CB    1 
ATOM   1731 C  CG    . LEU A 1 225 ? 60.102 -15.319 1.315   1.00 10.50 ? 222 LEU A CG    1 
ATOM   1732 C  CD1   . LEU A 1 225 ? 61.282 -16.198 0.943   1.00 11.10 ? 222 LEU A CD1   1 
ATOM   1733 C  CD2   . LEU A 1 225 ? 59.767 -15.444 2.792   1.00 13.05 ? 222 LEU A CD2   1 
ATOM   1734 N  N     . ALA A 1 226 ? 59.800 -10.824 0.039   1.00 8.46  ? 223 ALA A N     1 
ATOM   1735 C  CA    . ALA A 1 226 ? 60.279 -9.454  -0.078  1.00 9.86  ? 223 ALA A CA    1 
ATOM   1736 C  C     . ALA A 1 226 ? 59.463 -8.495  0.789   1.00 10.18 ? 223 ALA A C     1 
ATOM   1737 O  O     . ALA A 1 226 ? 60.028 -7.596  1.424   1.00 9.16  ? 223 ALA A O     1 
ATOM   1738 C  CB    . ALA A 1 226 ? 60.258 -9.010  -1.525  1.00 11.18 ? 223 ALA A CB    1 
ATOM   1739 N  N     . LYS A 1 227 ? 58.146 -8.689  0.824   1.00 10.41 ? 224 LYS A N     1 
ATOM   1740 C  CA    . LYS A 1 227 ? 57.268 -7.876  1.650   1.00 9.42  ? 224 LYS A CA    1 
ATOM   1741 C  C     . LYS A 1 227 ? 57.588 -8.064  3.127   1.00 11.04 ? 224 LYS A C     1 
ATOM   1742 O  O     . LYS A 1 227 ? 57.702 -7.092  3.885   1.00 12.37 ? 224 LYS A O     1 
ATOM   1743 C  CB    . LYS A 1 227 ? 55.793 -8.223  1.379   1.00 11.53 ? 224 LYS A CB    1 
ATOM   1744 C  CG    A LYS A 1 227 ? 54.822 -7.475  2.289   0.75 12.81 ? 224 LYS A CG    1 
ATOM   1745 C  CG    B LYS A 1 227 ? 54.803 -7.560  2.325   0.25 12.93 ? 224 LYS A CG    1 
ATOM   1746 C  CD    A LYS A 1 227 ? 54.950 -5.965  2.127   0.75 16.35 ? 224 LYS A CD    1 
ATOM   1747 C  CD    B LYS A 1 227 ? 54.690 -6.069  2.063   0.25 16.71 ? 224 LYS A CD    1 
ATOM   1748 C  CE    A LYS A 1 227 ? 53.965 -5.235  3.030   0.75 21.88 ? 224 LYS A CE    1 
ATOM   1749 C  CE    B LYS A 1 227 ? 53.610 -5.442  2.935   0.25 20.98 ? 224 LYS A CE    1 
ATOM   1750 N  NZ    A LYS A 1 227 ? 53.934 -3.774  2.778   0.75 20.30 ? 224 LYS A NZ    1 
ATOM   1751 N  NZ    B LYS A 1 227 ? 52.301 -6.134  2.786   0.25 22.28 ? 224 LYS A NZ    1 
ATOM   1752 N  N     . LEU A 1 228 ? 57.729 -9.316  3.536   1.00 11.63 ? 225 LEU A N     1 
ATOM   1753 C  CA    . LEU A 1 228 ? 58.035 -9.622  4.921   1.00 14.30 ? 225 LEU A CA    1 
ATOM   1754 C  C     . LEU A 1 228 ? 59.373 -9.007  5.315   1.00 13.70 ? 225 LEU A C     1 
ATOM   1755 O  O     . LEU A 1 228 ? 59.494 -8.355  6.361   1.00 12.93 ? 225 LEU A O     1 
ATOM   1756 C  CB    . LEU A 1 228 ? 58.055 -11.132 5.124   1.00 14.83 ? 225 LEU A CB    1 
ATOM   1757 C  CG    . LEU A 1 228 ? 58.177 -11.578 6.575   1.00 18.39 ? 225 LEU A CG    1 
ATOM   1758 C  CD1   . LEU A 1 228 ? 56.928 -11.174 7.360   1.00 22.02 ? 225 LEU A CD1   1 
ATOM   1759 C  CD2   . LEU A 1 228 ? 58.387 -13.074 6.602   1.00 16.20 ? 225 LEU A CD2   1 
ATOM   1760 N  N     . ALA A 1 229 ? 60.376 -9.220  4.464   1.00 11.37 ? 226 ALA A N     1 
ATOM   1761 C  CA    . ALA A 1 229 ? 61.711 -8.646  4.660   1.00 11.69 ? 226 ALA A CA    1 
ATOM   1762 C  C     . ALA A 1 229 ? 61.666 -7.134  4.867   1.00 11.68 ? 226 ALA A C     1 
ATOM   1763 O  O     . ALA A 1 229 ? 62.341 -6.599  5.734   1.00 12.57 ? 226 ALA A O     1 
ATOM   1764 C  CB    . ALA A 1 229 ? 62.612 -8.965  3.477   1.00 10.43 ? 226 ALA A CB    1 
ATOM   1765 N  N     . CYS A 1 230 ? 60.883 -6.447  4.036   1.00 10.67 ? 227 CYS A N     1 
ATOM   1766 C  CA    . CYS A 1 230 ? 60.832 -4.995  4.063   1.00 12.79 ? 227 CYS A CA    1 
ATOM   1767 C  C     . CYS A 1 230 ? 60.478 -4.467  5.455   1.00 13.23 ? 227 CYS A C     1 
ATOM   1768 O  O     . CYS A 1 230 ? 61.108 -3.526  5.955   1.00 15.33 ? 227 CYS A O     1 
ATOM   1769 C  CB    . CYS A 1 230 ? 59.819 -4.505  3.035   1.00 9.09  ? 227 CYS A CB    1 
ATOM   1770 S  SG    . CYS A 1 230 ? 59.707 -2.698  2.939   1.00 13.08 ? 227 CYS A SG    1 
ATOM   1771 N  N     . GLY A 1 231 ? 59.509 -5.116  6.098   1.00 11.91 ? 228 GLY A N     1 
ATOM   1772 C  CA    . GLY A 1 231 ? 59.081 -4.701  7.425   1.00 15.66 ? 228 GLY A CA    1 
ATOM   1773 C  C     . GLY A 1 231 ? 60.034 -4.981  8.581   1.00 16.47 ? 228 GLY A C     1 
ATOM   1774 O  O     . GLY A 1 231 ? 59.867 -4.432  9.669   1.00 19.61 ? 228 GLY A O     1 
ATOM   1775 N  N     . LEU A 1 232 ? 61.040 -5.819  8.361   1.00 13.97 ? 229 LEU A N     1 
ATOM   1776 C  CA    . LEU A 1 232 ? 61.899 -6.254  9.470   1.00 13.44 ? 229 LEU A CA    1 
ATOM   1777 C  C     . LEU A 1 232 ? 62.794 -5.140  10.005  1.00 15.13 ? 229 LEU A C     1 
ATOM   1778 O  O     . LEU A 1 232 ? 63.160 -5.135  11.197  1.00 16.27 ? 229 LEU A O     1 
ATOM   1779 C  CB    . LEU A 1 232 ? 62.750 -7.437  9.023   1.00 14.57 ? 229 LEU A CB    1 
ATOM   1780 C  CG    . LEU A 1 232 ? 61.948 -8.707  8.748   1.00 16.93 ? 229 LEU A CG    1 
ATOM   1781 C  CD1   . LEU A 1 232 ? 62.860 -9.825  8.289   1.00 15.09 ? 229 LEU A CD1   1 
ATOM   1782 C  CD2   . LEU A 1 232 ? 61.116 -9.128  9.966   1.00 18.31 ? 229 LEU A CD2   1 
ATOM   1783 N  N     . ASN A 1 233 ? 63.161 -4.202  9.135   1.00 13.36 ? 230 ASN A N     1 
ATOM   1784 C  CA    . ASN A 1 233 ? 64.003 -3.098  9.553   1.00 13.49 ? 230 ASN A CA    1 
ATOM   1785 C  C     . ASN A 1 233 ? 63.485 -1.833  8.889   1.00 19.15 ? 230 ASN A C     1 
ATOM   1786 O  O     . ASN A 1 233 ? 63.998 -1.395  7.870   1.00 33.13 ? 230 ASN A O     1 
ATOM   1787 C  CB    . ASN A 1 233 ? 65.473 -3.359  9.207   1.00 14.40 ? 230 ASN A CB    1 
ATOM   1788 C  CG    . ASN A 1 233 ? 66.038 -4.568  9.942   1.00 16.08 ? 230 ASN A CG    1 
ATOM   1789 O  OD1   . ASN A 1 233 ? 66.358 -4.490  11.132  1.00 17.26 ? 230 ASN A OD1   1 
ATOM   1790 N  ND2   . ASN A 1 233 ? 66.177 -5.685  9.232   1.00 14.17 ? 230 ASN A ND2   1 
ATOM   1791 N  N     . LYS A 1 234 ? 62.400 -1.311  9.435   1.00 26.03 ? 231 LYS A N     1 
ATOM   1792 C  CA    . LYS A 1 234 ? 61.881 0.001   9.061   1.00 18.08 ? 231 LYS A CA    1 
ATOM   1793 C  C     . LYS A 1 234 ? 62.221 0.932   10.199  1.00 23.67 ? 231 LYS A C     1 
ATOM   1794 O  O     . LYS A 1 234 ? 62.293 0.494   11.351  1.00 27.47 ? 231 LYS A O     1 
ATOM   1795 C  CB    . LYS A 1 234 ? 60.365 -0.022  8.845   1.00 26.13 ? 231 LYS A CB    1 
ATOM   1796 C  CG    . LYS A 1 234 ? 59.904 -0.357  7.458   1.00 26.16 ? 231 LYS A CG    1 
ATOM   1797 C  CD    . LYS A 1 234 ? 58.459 0.130   7.239   1.00 23.82 ? 231 LYS A CD    1 
ATOM   1798 C  CE    . LYS A 1 234 ? 58.094 0.182   5.746   1.00 22.79 ? 231 LYS A CE    1 
ATOM   1799 N  NZ    . LYS A 1 234 ? 58.034 1.594   5.217   1.00 15.09 ? 231 LYS A NZ    1 
ATOM   1800 N  N     . PRO A 1 235 ? 62.402 2.224   9.915   1.00 16.74 ? 232 PRO A N     1 
ATOM   1801 C  CA    . PRO A 1 235 ? 62.355 2.889   8.612   1.00 13.41 ? 232 PRO A CA    1 
ATOM   1802 C  C     . PRO A 1 235 ? 63.726 3.076   8.001   1.00 13.66 ? 232 PRO A C     1 
ATOM   1803 O  O     . PRO A 1 235 ? 64.730 2.853   8.679   1.00 14.26 ? 232 PRO A O     1 
ATOM   1804 C  CB    . PRO A 1 235 ? 61.759 4.252   8.959   1.00 15.24 ? 232 PRO A CB    1 
ATOM   1805 C  CG    . PRO A 1 235 ? 62.383 4.546   10.304  1.00 18.57 ? 232 PRO A CG    1 
ATOM   1806 C  CD    . PRO A 1 235 ? 62.466 3.208   11.012  1.00 20.43 ? 232 PRO A CD    1 
ATOM   1807 N  N     . ASN A 1 236 ? 63.760 3.484   6.733   1.00 11.68 ? 233 ASN A N     1 
ATOM   1808 C  CA    . ASN A 1 236 ? 64.994 3.915   6.075   1.00 11.82 ? 233 ASN A CA    1 
ATOM   1809 C  C     . ASN A 1 236 ? 66.092 2.854   6.052   1.00 10.04 ? 233 ASN A C     1 
ATOM   1810 O  O     . ASN A 1 236 ? 67.271 3.182   6.121   1.00 13.38 ? 233 ASN A O     1 
ATOM   1811 C  CB    . ASN A 1 236 ? 65.523 5.191   6.742   1.00 13.59 ? 233 ASN A CB    1 
ATOM   1812 C  CG    . ASN A 1 236 ? 66.524 5.923   5.875   1.00 14.72 ? 233 ASN A CG    1 
ATOM   1813 O  OD1   . ASN A 1 236 ? 66.453 5.868   4.653   1.00 17.32 ? 233 ASN A OD1   1 
ATOM   1814 N  ND2   . ASN A 1 236 ? 67.486 6.589   6.514   1.00 17.52 ? 233 ASN A ND2   1 
ATOM   1815 N  N     . ARG A 1 237 ? 65.692 1.588   5.936   1.00 10.49 ? 234 ARG A N     1 
ATOM   1816 C  CA    . ARG A 1 237 ? 66.654 0.490   5.843   1.00 13.31 ? 234 ARG A CA    1 
ATOM   1817 C  C     . ARG A 1 237 ? 66.103 -0.558  4.906   1.00 11.62 ? 234 ARG A C     1 
ATOM   1818 O  O     . ARG A 1 237 ? 64.904 -0.574  4.615   1.00 12.51 ? 234 ARG A O     1 
ATOM   1819 C  CB    . ARG A 1 237 ? 66.940 -0.145  7.217   1.00 14.21 ? 234 ARG A CB    1 
ATOM   1820 C  CG    . ARG A 1 237 ? 67.622 0.758   8.242   1.00 14.56 ? 234 ARG A CG    1 
ATOM   1821 C  CD    . ARG A 1 237 ? 69.031 1.109   7.827   1.00 18.46 ? 234 ARG A CD    1 
ATOM   1822 N  NE    . ARG A 1 237 ? 69.748 1.849   8.867   1.00 21.14 ? 234 ARG A NE    1 
ATOM   1823 C  CZ    . ARG A 1 237 ? 69.856 3.176   8.899   1.00 23.26 ? 234 ARG A CZ    1 
ATOM   1824 N  NH1   . ARG A 1 237 ? 69.294 3.920   7.952   1.00 25.79 ? 234 ARG A NH1   1 
ATOM   1825 N  NH2   . ARG A 1 237 ? 70.531 3.764   9.877   1.00 23.29 ? 234 ARG A NH2   1 
ATOM   1826 N  N     . GLN A 1 238 ? 66.964 -1.440  4.422   1.00 11.77 ? 235 GLN A N     1 
ATOM   1827 C  CA    . GLN A 1 238 ? 66.489 -2.530  3.588   1.00 9.04  ? 235 GLN A CA    1 
ATOM   1828 C  C     . GLN A 1 238 ? 67.015 -3.853  4.122   1.00 11.59 ? 235 GLN A C     1 
ATOM   1829 O  O     . GLN A 1 238 ? 68.043 -3.909  4.794   1.00 12.36 ? 235 GLN A O     1 
ATOM   1830 C  CB    . GLN A 1 238 ? 66.907 -2.338  2.129   1.00 12.18 ? 235 GLN A CB    1 
ATOM   1831 C  CG    . GLN A 1 238 ? 68.412 -2.180  1.934   1.00 13.51 ? 235 GLN A CG    1 
ATOM   1832 C  CD    . GLN A 1 238 ? 68.770 -1.919  0.480   1.00 12.44 ? 235 GLN A CD    1 
ATOM   1833 O  OE1   . GLN A 1 238 ? 68.366 -0.912  -0.104  1.00 14.49 ? 235 GLN A OE1   1 
ATOM   1834 N  NE2   . GLN A 1 238 ? 69.497 -2.847  -0.129  1.00 10.60 ? 235 GLN A NE2   1 
ATOM   1835 N  N     . THR A 1 239 ? 66.286 -4.918  3.829   1.00 10.11 ? 236 THR A N     1 
ATOM   1836 C  CA    . THR A 1 239 ? 66.592 -6.212  4.432   1.00 10.64 ? 236 THR A CA    1 
ATOM   1837 C  C     . THR A 1 239 ? 66.619 -7.292  3.376   1.00 11.70 ? 236 THR A C     1 
ATOM   1838 O  O     . THR A 1 239 ? 65.716 -7.391  2.551   1.00 11.88 ? 236 THR A O     1 
ATOM   1839 C  CB    . THR A 1 239 ? 65.568 -6.581  5.516   1.00 10.92 ? 236 THR A CB    1 
ATOM   1840 O  OG1   . THR A 1 239 ? 65.489 -5.520  6.467   1.00 12.03 ? 236 THR A OG1   1 
ATOM   1841 C  CG2   . THR A 1 239 ? 65.987 -7.867  6.255   1.00 14.70 ? 236 THR A CG2   1 
ATOM   1842 N  N     . LEU A 1 240 ? 67.672 -8.105  3.411   1.00 10.42 ? 237 LEU A N     1 
ATOM   1843 C  CA    . LEU A 1 240 ? 67.814 -9.235  2.521   1.00 9.41  ? 237 LEU A CA    1 
ATOM   1844 C  C     . LEU A 1 240 ? 67.393 -10.502 3.278   1.00 11.17 ? 237 LEU A C     1 
ATOM   1845 O  O     . LEU A 1 240 ? 67.959 -10.822 4.333   1.00 12.21 ? 237 LEU A O     1 
ATOM   1846 C  CB    . LEU A 1 240 ? 69.265 -9.331  2.011   1.00 10.91 ? 237 LEU A CB    1 
ATOM   1847 C  CG    . LEU A 1 240 ? 69.630 -10.362 0.940   1.00 11.15 ? 237 LEU A CG    1 
ATOM   1848 C  CD1   . LEU A 1 240 ? 70.960 -9.978  0.278   1.00 13.23 ? 237 LEU A CD1   1 
ATOM   1849 C  CD2   . LEU A 1 240 ? 69.754 -11.785 1.484   1.00 12.26 ? 237 LEU A CD2   1 
ATOM   1850 N  N     . VAL A 1 241 ? 66.391 -11.209 2.748   1.00 9.31  ? 238 VAL A N     1 
ATOM   1851 C  CA    . VAL A 1 241 ? 65.964 -12.497 3.313   1.00 9.39  ? 238 VAL A CA    1 
ATOM   1852 C  C     . VAL A 1 241 ? 66.346 -13.573 2.313   1.00 8.91  ? 238 VAL A C     1 
ATOM   1853 O  O     . VAL A 1 241 ? 65.775 -13.670 1.221   1.00 11.44 ? 238 VAL A O     1 
ATOM   1854 C  CB    . VAL A 1 241 ? 64.442 -12.511 3.625   1.00 9.85  ? 238 VAL A CB    1 
ATOM   1855 C  CG1   . VAL A 1 241 ? 63.911 -13.939 3.836   1.00 10.55 ? 238 VAL A CG1   1 
ATOM   1856 C  CG2   . VAL A 1 241 ? 64.159 -11.677 4.865   1.00 11.34 ? 238 VAL A CG2   1 
ATOM   1857 N  N     . SER A 1 242 ? 67.359 -14.354 2.682   1.00 9.09  ? 239 SER A N     1 
ATOM   1858 C  CA    . SER A 1 242 ? 67.829 -15.416 1.816   1.00 9.89  ? 239 SER A CA    1 
ATOM   1859 C  C     . SER A 1 242 ? 66.951 -16.666 1.937   1.00 9.17  ? 239 SER A C     1 
ATOM   1860 O  O     . SER A 1 242 ? 66.177 -16.819 2.877   1.00 10.41 ? 239 SER A O     1 
ATOM   1861 C  CB    . SER A 1 242 ? 69.268 -15.774 2.162   1.00 13.84 ? 239 SER A CB    1 
ATOM   1862 O  OG    . SER A 1 242 ? 69.307 -16.294 3.479   1.00 15.11 ? 239 SER A OG    1 
ATOM   1863 N  N     . HIS A 1 243 ? 67.081 -17.573 0.977   1.00 9.58  ? 240 HIS A N     1 
ATOM   1864 C  CA    . HIS A 1 243 ? 66.350 -18.825 1.081   1.00 10.15 ? 240 HIS A CA    1 
ATOM   1865 C  C     . HIS A 1 243 ? 66.741 -19.558 2.366   1.00 11.75 ? 240 HIS A C     1 
ATOM   1866 O  O     . HIS A 1 243 ? 65.878 -20.093 3.077   1.00 11.69 ? 240 HIS A O     1 
ATOM   1867 C  CB    . HIS A 1 243 ? 66.614 -19.707 -0.135  1.00 12.75 ? 240 HIS A CB    1 
ATOM   1868 C  CG    . HIS A 1 243 ? 65.819 -20.980 -0.119  1.00 11.88 ? 240 HIS A CG    1 
ATOM   1869 N  ND1   . HIS A 1 243 ? 64.467 -21.001 -0.339  1.00 16.68 ? 240 HIS A ND1   1 
ATOM   1870 C  CD2   . HIS A 1 243 ? 66.198 -22.258 0.116   1.00 19.17 ? 240 HIS A CD2   1 
ATOM   1871 C  CE1   . HIS A 1 243 ? 64.035 -22.254 -0.259  1.00 20.04 ? 240 HIS A CE1   1 
ATOM   1872 N  NE2   . HIS A 1 243 ? 65.060 -23.029 0.013   1.00 16.28 ? 240 HIS A NE2   1 
ATOM   1873 N  N     . GLY A 1 244 ? 68.037 -19.538 2.669   1.00 11.70 ? 241 GLY A N     1 
ATOM   1874 C  CA    . GLY A 1 244 ? 68.545 -20.218 3.853   1.00 12.00 ? 241 GLY A CA    1 
ATOM   1875 C  C     . GLY A 1 244 ? 68.037 -19.674 5.172   1.00 11.26 ? 241 GLY A C     1 
ATOM   1876 O  O     . GLY A 1 244 ? 67.966 -20.405 6.153   1.00 12.92 ? 241 GLY A O     1 
ATOM   1877 N  N     . SER A 1 245 ? 67.674 -18.396 5.205   1.00 10.77 ? 242 SER A N     1 
ATOM   1878 C  CA    . SER A 1 245 ? 67.168 -17.768 6.428   1.00 12.71 ? 242 SER A CA    1 
ATOM   1879 C  C     . SER A 1 245 ? 65.732 -18.161 6.760   1.00 10.78 ? 242 SER A C     1 
ATOM   1880 O  O     . SER A 1 245 ? 65.245 -17.876 7.857   1.00 11.15 ? 242 SER A O     1 
ATOM   1881 C  CB    . SER A 1 245 ? 67.237 -16.238 6.320   1.00 12.60 ? 242 SER A CB    1 
ATOM   1882 O  OG    . SER A 1 245 ? 66.219 -15.752 5.445   1.00 11.30 ? 242 SER A OG    1 
ATOM   1883 N  N     . VAL A 1 246 ? 65.049 -18.795 5.818   1.00 10.66 ? 243 VAL A N     1 
ATOM   1884 C  CA    . VAL A 1 246 ? 63.620 -19.043 6.007   1.00 10.30 ? 243 VAL A CA    1 
ATOM   1885 C  C     . VAL A 1 246 ? 63.258 -19.996 7.181   1.00 11.37 ? 243 VAL A C     1 
ATOM   1886 O  O     . VAL A 1 246 ? 62.389 -19.646 7.978   1.00 12.10 ? 243 VAL A O     1 
ATOM   1887 C  CB    . VAL A 1 246 ? 62.988 -19.539 4.688   1.00 10.31 ? 243 VAL A CB    1 
ATOM   1888 C  CG1   . VAL A 1 246 ? 61.558 -20.028 4.915   1.00 11.90 ? 243 VAL A CG1   1 
ATOM   1889 C  CG2   . VAL A 1 246 ? 63.002 -18.406 3.655   1.00 12.66 ? 243 VAL A CG2   1 
ATOM   1890 N  N     . PRO A 1 247 ? 63.926 -21.163 7.336   1.00 10.58 ? 244 PRO A N     1 
ATOM   1891 C  CA    . PRO A 1 247 ? 63.506 -22.019 8.468   1.00 9.67  ? 244 PRO A CA    1 
ATOM   1892 C  C     . PRO A 1 247 ? 63.548 -21.314 9.830   1.00 9.99  ? 244 PRO A C     1 
ATOM   1893 O  O     . PRO A 1 247 ? 62.586 -21.411 10.601  1.00 12.81 ? 244 PRO A O     1 
ATOM   1894 C  CB    . PRO A 1 247 ? 64.514 -23.185 8.419   1.00 12.37 ? 244 PRO A CB    1 
ATOM   1895 C  CG    . PRO A 1 247 ? 64.795 -23.319 6.922   1.00 12.40 ? 244 PRO A CG    1 
ATOM   1896 C  CD    . PRO A 1 247 ? 64.921 -21.846 6.480   1.00 10.71 ? 244 PRO A CD    1 
ATOM   1897 N  N     . GLN A 1 248 ? 64.629 -20.592 10.125  1.00 11.05 ? 245 GLN A N     1 
ATOM   1898 C  CA    . GLN A 1 248 ? 64.705 -19.918 11.410  1.00 13.47 ? 245 GLN A CA    1 
ATOM   1899 C  C     . GLN A 1 248 ? 63.695 -18.771 11.485  1.00 13.60 ? 245 GLN A C     1 
ATOM   1900 O  O     . GLN A 1 248 ? 62.997 -18.612 12.492  1.00 14.53 ? 245 GLN A O     1 
ATOM   1901 C  CB    . GLN A 1 248 ? 66.121 -19.414 11.667  1.00 14.08 ? 245 GLN A CB    1 
ATOM   1902 C  CG    . GLN A 1 248 ? 67.006 -20.503 12.252  1.00 22.35 ? 245 GLN A CG    1 
ATOM   1903 C  CD    . GLN A 1 248 ? 68.158 -19.966 13.085  1.00 28.95 ? 245 GLN A CD    1 
ATOM   1904 O  OE1   . GLN A 1 248 ? 67.959 -19.574 14.237  1.00 40.83 ? 245 GLN A OE1   1 
ATOM   1905 N  NE2   . GLN A 1 248 ? 69.372 -19.987 12.527  1.00 25.48 ? 245 GLN A NE2   1 
ATOM   1906 N  N     . LEU A 1 249 ? 63.588 -18.006 10.400  1.00 10.65 ? 246 LEU A N     1 
ATOM   1907 C  CA    . LEU A 1 249 ? 62.660 -16.878 10.363  1.00 11.03 ? 246 LEU A CA    1 
ATOM   1908 C  C     . LEU A 1 249 ? 61.233 -17.339 10.582  1.00 9.09  ? 246 LEU A C     1 
ATOM   1909 O  O     . LEU A 1 249 ? 60.476 -16.736 11.360  1.00 13.55 ? 246 LEU A O     1 
ATOM   1910 C  CB    . LEU A 1 249 ? 62.777 -16.144 9.026   1.00 10.60 ? 246 LEU A CB    1 
ATOM   1911 C  CG    . LEU A 1 249 ? 61.860 -14.931 8.827   1.00 12.68 ? 246 LEU A CG    1 
ATOM   1912 C  CD1   . LEU A 1 249 ? 62.133 -13.875 9.900   1.00 16.16 ? 246 LEU A CD1   1 
ATOM   1913 C  CD2   . LEU A 1 249 ? 62.061 -14.367 7.435   1.00 15.25 ? 246 LEU A CD2   1 
ATOM   1914 N  N     . PHE A 1 250 ? 60.867 -18.428 9.921   1.00 10.92 ? 247 PHE A N     1 
ATOM   1915 C  CA    . PHE A 1 250 ? 59.484 -18.879 9.993   1.00 10.49 ? 247 PHE A CA    1 
ATOM   1916 C  C     . PHE A 1 250 ? 59.170 -19.652 11.279  1.00 10.83 ? 247 PHE A C     1 
ATOM   1917 O  O     . PHE A 1 250 ? 58.001 -19.842 11.620  1.00 10.45 ? 247 PHE A O     1 
ATOM   1918 C  CB    . PHE A 1 250 ? 59.139 -19.737 8.774   1.00 9.61  ? 247 PHE A CB    1 
ATOM   1919 C  CG    . PHE A 1 250 ? 58.722 -18.948 7.552   1.00 10.97 ? 247 PHE A CG    1 
ATOM   1920 C  CD1   . PHE A 1 250 ? 58.187 -19.615 6.460   1.00 12.51 ? 247 PHE A CD1   1 
ATOM   1921 C  CD2   . PHE A 1 250 ? 58.862 -17.568 7.492   1.00 11.93 ? 247 PHE A CD2   1 
ATOM   1922 C  CE1   . PHE A 1 250 ? 57.785 -18.934 5.334   1.00 13.73 ? 247 PHE A CE1   1 
ATOM   1923 C  CE2   . PHE A 1 250 ? 58.473 -16.880 6.344   1.00 13.06 ? 247 PHE A CE2   1 
ATOM   1924 C  CZ    . PHE A 1 250 ? 57.934 -17.572 5.274   1.00 13.73 ? 247 PHE A CZ    1 
ATOM   1925 N  N     . SER A 1 251 ? 60.207 -20.083 12.005  1.00 10.10 ? 248 SER A N     1 
ATOM   1926 C  CA    . SER A 1 251 ? 59.992 -20.961 13.157  1.00 11.33 ? 248 SER A CA    1 
ATOM   1927 C  C     . SER A 1 251 ? 59.289 -20.234 14.293  1.00 12.38 ? 248 SER A C     1 
ATOM   1928 O  O     . SER A 1 251 ? 58.645 -20.867 15.110  1.00 11.17 ? 248 SER A O     1 
ATOM   1929 C  CB    . SER A 1 251 ? 61.314 -21.550 13.665  1.00 12.02 ? 248 SER A CB    1 
ATOM   1930 O  OG    . SER A 1 251 ? 62.111 -20.563 14.294  1.00 13.29 ? 248 SER A OG    1 
ATOM   1931 N  N     . GLN A 1 252 ? 59.383 -18.909 14.320  1.00 12.45 ? 249 GLN A N     1 
ATOM   1932 C  CA    . GLN A 1 252 ? 58.662 -18.141 15.331  1.00 12.83 ? 249 GLN A CA    1 
ATOM   1933 C  C     . GLN A 1 252 ? 57.784 -17.047 14.732  1.00 14.19 ? 249 GLN A C     1 
ATOM   1934 O  O     . GLN A 1 252 ? 57.461 -16.077 15.417  1.00 17.13 ? 249 GLN A O     1 
ATOM   1935 C  CB    . GLN A 1 252 ? 59.631 -17.504 16.308  1.00 18.67 ? 249 GLN A CB    1 
ATOM   1936 C  CG    . GLN A 1 252 ? 60.444 -18.467 17.105  1.00 19.93 ? 249 GLN A CG    1 
ATOM   1937 C  CD    . GLN A 1 252 ? 61.250 -17.738 18.154  1.00 21.42 ? 249 GLN A CD    1 
ATOM   1938 O  OE1   . GLN A 1 252 ? 60.818 -17.603 19.301  1.00 23.59 ? 249 GLN A OE1   1 
ATOM   1939 N  NE2   . GLN A 1 252 ? 62.406 -17.216 17.752  1.00 22.99 ? 249 GLN A NE2   1 
ATOM   1940 N  N     . MET A 1 253 ? 57.417 -17.201 13.464  1.00 11.86 ? 250 MET A N     1 
ATOM   1941 C  CA    . MET A 1 253 ? 56.683 -16.163 12.726  1.00 13.28 ? 250 MET A CA    1 
ATOM   1942 C  C     . MET A 1 253 ? 55.209 -16.477 12.773  1.00 11.86 ? 250 MET A C     1 
ATOM   1943 O  O     . MET A 1 253 ? 54.781 -17.470 12.204  1.00 12.03 ? 250 MET A O     1 
ATOM   1944 C  CB    . MET A 1 253 ? 57.172 -16.084 11.269  1.00 14.61 ? 250 MET A CB    1 
ATOM   1945 C  CG    . MET A 1 253 ? 56.495 -15.013 10.409  1.00 19.78 ? 250 MET A CG    1 
ATOM   1946 S  SD    . MET A 1 253 ? 56.869 -13.329 10.929  1.00 18.79 ? 250 MET A SD    1 
ATOM   1947 C  CE    . MET A 1 253 ? 58.656 -13.263 10.750  1.00 17.44 ? 250 MET A CE    1 
ATOM   1948 N  N     . PRO A 1 254 ? 54.418 -15.648 13.468  1.00 13.38 ? 251 PRO A N     1 
ATOM   1949 C  CA    . PRO A 1 254 ? 52.970 -15.872 13.483  1.00 11.90 ? 251 PRO A CA    1 
ATOM   1950 C  C     . PRO A 1 254 ? 52.428 -15.918 12.069  1.00 13.21 ? 251 PRO A C     1 
ATOM   1951 O  O     . PRO A 1 254 ? 52.833 -15.121 11.235  1.00 12.45 ? 251 PRO A O     1 
ATOM   1952 C  CB    . PRO A 1 254 ? 52.423 -14.661 14.240  1.00 15.66 ? 251 PRO A CB    1 
ATOM   1953 C  CG    . PRO A 1 254 ? 53.584 -14.201 15.077  1.00 13.43 ? 251 PRO A CG    1 
ATOM   1954 C  CD    . PRO A 1 254 ? 54.794 -14.429 14.196  1.00 13.20 ? 251 PRO A CD    1 
ATOM   1955 N  N     . ILE A 1 255 ? 51.548 -16.873 11.813  1.00 12.82 ? 252 ILE A N     1 
ATOM   1956 C  CA    . ILE A 1 255 ? 50.965 -17.065 10.501  1.00 11.90 ? 252 ILE A CA    1 
ATOM   1957 C  C     . ILE A 1 255 ? 50.349 -15.761 9.945   1.00 10.91 ? 252 ILE A C     1 
ATOM   1958 O  O     . ILE A 1 255 ? 50.491 -15.467 8.760   1.00 11.90 ? 252 ILE A O     1 
ATOM   1959 C  CB    . ILE A 1 255 ? 49.944 -18.224 10.571  1.00 13.82 ? 252 ILE A CB    1 
ATOM   1960 C  CG1   . ILE A 1 255 ? 50.720 -19.559 10.625  1.00 16.54 ? 252 ILE A CG1   1 
ATOM   1961 C  CG2   . ILE A 1 255 ? 48.985 -18.199 9.394   1.00 14.88 ? 252 ILE A CG2   1 
ATOM   1962 C  CD1   . ILE A 1 255 ? 49.940 -20.716 11.156  1.00 17.59 ? 252 ILE A CD1   1 
ATOM   1963 N  N     . ARG A 1 256 ? 49.740 -14.952 10.813  1.00 12.61 ? 253 ARG A N     1 
ATOM   1964 C  CA    . ARG A 1 256 ? 49.042 -13.752 10.356  1.00 10.70 ? 253 ARG A CA    1 
ATOM   1965 C  C     . ARG A 1 256 ? 49.977 -12.705 9.757   1.00 13.70 ? 253 ARG A C     1 
ATOM   1966 O  O     . ARG A 1 256 ? 49.519 -11.755 9.104   1.00 15.25 ? 253 ARG A O     1 
ATOM   1967 C  CB    . ARG A 1 256 ? 48.251 -13.124 11.509  1.00 13.62 ? 253 ARG A CB    1 
ATOM   1968 C  CG    . ARG A 1 256 ? 49.146 -12.559 12.591  1.00 14.05 ? 253 ARG A CG    1 
ATOM   1969 C  CD    . ARG A 1 256 ? 48.339 -11.864 13.683  1.00 18.57 ? 253 ARG A CD    1 
ATOM   1970 N  NE    . ARG A 1 256 ? 49.229 -11.410 14.746  1.00 19.23 ? 253 ARG A NE    1 
ATOM   1971 C  CZ    . ARG A 1 256 ? 49.667 -12.176 15.745  1.00 20.32 ? 253 ARG A CZ    1 
ATOM   1972 N  NH1   . ARG A 1 256 ? 49.281 -13.450 15.854  1.00 17.31 ? 253 ARG A NH1   1 
ATOM   1973 N  NH2   . ARG A 1 256 ? 50.494 -11.660 16.648  1.00 18.95 ? 253 ARG A NH2   1 
ATOM   1974 N  N     . LYS A 1 257 ? 51.282 -12.856 9.963   1.00 11.55 ? 254 LYS A N     1 
ATOM   1975 C  CA    . LYS A 1 257 ? 52.219 -11.863 9.440   1.00 13.11 ? 254 LYS A CA    1 
ATOM   1976 C  C     . LYS A 1 257 ? 52.443 -11.977 7.943   1.00 14.77 ? 254 LYS A C     1 
ATOM   1977 O  O     . LYS A 1 257 ? 52.969 -11.049 7.323   1.00 16.49 ? 254 LYS A O     1 
ATOM   1978 C  CB    . LYS A 1 257 ? 53.571 -11.957 10.151  1.00 13.55 ? 254 LYS A CB    1 
ATOM   1979 C  CG    . LYS A 1 257 ? 53.502 -11.744 11.648  1.00 18.48 ? 254 LYS A CG    1 
ATOM   1980 C  CD    . LYS A 1 257 ? 52.804 -10.449 11.999  1.00 18.39 ? 254 LYS A CD    1 
ATOM   1981 C  CE    . LYS A 1 257 ? 52.853 -10.193 13.502  1.00 29.18 ? 254 LYS A CE    1 
ATOM   1982 N  NZ    . LYS A 1 257 ? 52.359 -8.824  13.854  1.00 28.28 ? 254 LYS A NZ    1 
ATOM   1983 N  N     . ILE A 1 258 ? 52.081 -13.118 7.363   1.00 12.46 ? 255 ILE A N     1 
ATOM   1984 C  CA    . ILE A 1 258 ? 52.362 -13.362 5.955   1.00 12.03 ? 255 ILE A CA    1 
ATOM   1985 C  C     . ILE A 1 258 ? 51.216 -12.797 5.134   1.00 14.01 ? 255 ILE A C     1 
ATOM   1986 O  O     . ILE A 1 258 ? 50.044 -13.016 5.460   1.00 13.94 ? 255 ILE A O     1 
ATOM   1987 C  CB    . ILE A 1 258 ? 52.554 -14.870 5.674   1.00 15.16 ? 255 ILE A CB    1 
ATOM   1988 C  CG1   . ILE A 1 258 ? 54.001 -15.275 5.973   1.00 20.52 ? 255 ILE A CG1   1 
ATOM   1989 C  CG2   . ILE A 1 258 ? 52.283 -15.188 4.213   1.00 15.10 ? 255 ILE A CG2   1 
ATOM   1990 C  CD1   . ILE A 1 258 ? 54.404 -15.157 7.413   1.00 26.18 ? 255 ILE A CD1   1 
ATOM   1991 N  N     . ARG A 1 259 ? 51.554 -12.065 4.075   1.00 15.37 ? 256 ARG A N     1 
ATOM   1992 C  CA    . ARG A 1 259 ? 50.552 -11.372 3.279   1.00 15.01 ? 256 ARG A CA    1 
ATOM   1993 C  C     . ARG A 1 259 ? 49.531 -12.357 2.709   1.00 15.73 ? 256 ARG A C     1 
ATOM   1994 O  O     . ARG A 1 259 ? 49.919 -13.359 2.099   1.00 16.47 ? 256 ARG A O     1 
ATOM   1995 C  CB    . ARG A 1 259 ? 51.231 -10.575 2.161   1.00 14.76 ? 256 ARG A CB    1 
ATOM   1996 C  CG    . ARG A 1 259 ? 50.309 -9.591  1.459   1.00 22.89 ? 256 ARG A CG    1 
ATOM   1997 C  CD    . ARG A 1 259 ? 50.060 -10.029 0.038   1.00 36.88 ? 256 ARG A CD    1 
ATOM   1998 N  NE    . ARG A 1 259 ? 51.195 -9.745  -0.836  1.00 38.27 ? 256 ARG A NE    1 
ATOM   1999 C  CZ    . ARG A 1 259 ? 51.331 -10.228 -2.071  1.00 41.84 ? 256 ARG A CZ    1 
ATOM   2000 N  NH1   . ARG A 1 259 ? 50.402 -11.029 -2.582  1.00 45.69 ? 256 ARG A NH1   1 
ATOM   2001 N  NH2   . ARG A 1 259 ? 52.396 -9.906  -2.799  1.00 24.42 ? 256 ARG A NH2   1 
ATOM   2002 N  N     . SER A 1 260 ? 48.247 -12.045 2.951   1.00 15.30 ? 257 SER A N     1 
ATOM   2003 C  CA    . SER A 1 260 ? 47.033 -12.823 2.608   1.00 14.87 ? 257 SER A CA    1 
ATOM   2004 C  C     . SER A 1 260 ? 46.564 -13.738 3.740   1.00 15.96 ? 257 SER A C     1 
ATOM   2005 O  O     . SER A 1 260 ? 45.456 -14.267 3.673   1.00 14.31 ? 257 SER A O     1 
ATOM   2006 C  CB    . SER A 1 260 ? 47.197 -13.664 1.333   1.00 14.98 ? 257 SER A CB    1 
ATOM   2007 O  OG    . SER A 1 260 ? 47.815 -14.919 1.600   1.00 15.75 ? 257 SER A OG    1 
ATOM   2008 N  N     . LEU A 1 261 ? 47.377 -13.890 4.783   1.00 12.31 ? 258 LEU A N     1 
ATOM   2009 C  CA    . LEU A 1 261 ? 46.994 -14.722 5.925   1.00 12.43 ? 258 LEU A CA    1 
ATOM   2010 C  C     . LEU A 1 261 ? 46.595 -13.923 7.165   1.00 13.57 ? 258 LEU A C     1 
ATOM   2011 O  O     . LEU A 1 261 ? 46.444 -14.489 8.244   1.00 12.50 ? 258 LEU A O     1 
ATOM   2012 C  CB    . LEU A 1 261 ? 48.140 -15.681 6.286   1.00 11.24 ? 258 LEU A CB    1 
ATOM   2013 C  CG    . LEU A 1 261 ? 48.499 -16.674 5.174   1.00 12.19 ? 258 LEU A CG    1 
ATOM   2014 C  CD1   . LEU A 1 261 ? 49.566 -17.636 5.659   1.00 12.48 ? 258 LEU A CD1   1 
ATOM   2015 C  CD2   . LEU A 1 261 ? 47.279 -17.444 4.657   1.00 15.80 ? 258 LEU A CD2   1 
ATOM   2016 N  N     . GLY A 1 262 ? 46.411 -12.610 7.023   1.00 13.83 ? 259 GLY A N     1 
ATOM   2017 C  CA    . GLY A 1 262 ? 46.093 -11.774 8.171   1.00 14.13 ? 259 GLY A CA    1 
ATOM   2018 C  C     . GLY A 1 262 ? 44.618 -11.727 8.538   1.00 14.82 ? 259 GLY A C     1 
ATOM   2019 O  O     . GLY A 1 262 ? 44.242 -11.036 9.482   1.00 18.12 ? 259 GLY A O     1 
ATOM   2020 N  N     . GLY A 1 263 ? 43.789 -12.448 7.785   1.00 15.55 ? 260 GLY A N     1 
ATOM   2021 C  CA    . GLY A 1 263 ? 42.350 -12.450 7.993   1.00 15.75 ? 260 GLY A CA    1 
ATOM   2022 C  C     . GLY A 1 263 ? 41.763 -13.813 8.327   1.00 17.50 ? 260 GLY A C     1 
ATOM   2023 O  O     . GLY A 1 263 ? 42.367 -14.593 9.054   1.00 15.99 ? 260 GLY A O     1 
ATOM   2024 N  N     . LYS A 1 264 ? 40.584 -14.109 7.784   1.00 16.94 ? 261 LYS A N     1 
ATOM   2025 C  CA    . LYS A 1 264 ? 39.857 -15.324 8.149   1.00 16.65 ? 261 LYS A CA    1 
ATOM   2026 C  C     . LYS A 1 264 ? 40.596 -16.611 7.769   1.00 16.09 ? 261 LYS A C     1 
ATOM   2027 O  O     . LYS A 1 264 ? 40.614 -17.576 8.557   1.00 18.06 ? 261 LYS A O     1 
ATOM   2028 C  CB    . LYS A 1 264 ? 38.464 -15.314 7.505   1.00 20.14 ? 261 LYS A CB    1 
ATOM   2029 C  CG    . LYS A 1 264 ? 37.535 -14.290 8.138   1.00 22.16 ? 261 LYS A CG    1 
ATOM   2030 C  CD    . LYS A 1 264 ? 36.197 -14.218 7.384   1.00 22.93 ? 261 LYS A CD    1 
ATOM   2031 C  CE    . LYS A 1 264 ? 35.328 -13.081 7.907   1.00 37.01 ? 261 LYS A CE    1 
ATOM   2032 N  NZ    . LYS A 1 264 ? 33.987 -13.053 7.249   1.00 39.06 ? 261 LYS A NZ    1 
ATOM   2033 N  N     . LEU A 1 265 ? 41.189 -16.643 6.574   1.00 15.16 ? 262 LEU A N     1 
ATOM   2034 C  CA    . LEU A 1 265 ? 41.936 -17.829 6.164   1.00 13.53 ? 262 LEU A CA    1 
ATOM   2035 C  C     . LEU A 1 265 ? 43.052 -18.143 7.151   1.00 12.67 ? 262 LEU A C     1 
ATOM   2036 O  O     . LEU A 1 265 ? 43.197 -19.278 7.577   1.00 13.71 ? 262 LEU A O     1 
ATOM   2037 C  CB    . LEU A 1 265 ? 42.539 -17.665 4.770   1.00 13.86 ? 262 LEU A CB    1 
ATOM   2038 C  CG    . LEU A 1 265 ? 43.415 -18.833 4.306   1.00 17.32 ? 262 LEU A CG    1 
ATOM   2039 C  CD1   . LEU A 1 265 ? 42.597 -20.130 4.244   1.00 20.16 ? 262 LEU A CD1   1 
ATOM   2040 C  CD2   . LEU A 1 265 ? 44.058 -18.560 2.959   1.00 15.28 ? 262 LEU A CD2   1 
ATOM   2041 N  N     . GLY A 1 266 ? 43.847 -17.141 7.495   1.00 14.05 ? 263 GLY A N     1 
ATOM   2042 C  CA    . GLY A 1 266 ? 44.913 -17.345 8.464   1.00 12.07 ? 263 GLY A CA    1 
ATOM   2043 C  C     . GLY A 1 266 ? 44.406 -17.822 9.816   1.00 13.70 ? 263 GLY A C     1 
ATOM   2044 O  O     . GLY A 1 266 ? 45.018 -18.693 10.443  1.00 13.52 ? 263 GLY A O     1 
ATOM   2045 N  N     . ALA A 1 267 ? 43.285 -17.262 10.276  1.00 14.26 ? 264 ALA A N     1 
ATOM   2046 C  CA    . ALA A 1 267 ? 42.704 -17.721 11.528  1.00 16.09 ? 264 ALA A CA    1 
ATOM   2047 C  C     . ALA A 1 267 ? 42.272 -19.177 11.410  1.00 13.84 ? 264 ALA A C     1 
ATOM   2048 O  O     . ALA A 1 267 ? 42.374 -19.941 12.368  1.00 16.71 ? 264 ALA A O     1 
ATOM   2049 C  CB    . ALA A 1 267 ? 41.522 -16.835 11.926  1.00 17.80 ? 264 ALA A CB    1 
ATOM   2050 N  N     . SER A 1 268 ? 41.817 -19.574 10.227  1.00 13.30 ? 265 SER A N     1 
ATOM   2051 C  CA    . SER A 1 268 ? 41.346 -20.945 10.045  1.00 16.08 ? 265 SER A CA    1 
ATOM   2052 C  C     . SER A 1 268 ? 42.536 -21.913 10.032  1.00 14.15 ? 265 SER A C     1 
ATOM   2053 O  O     . SER A 1 268 ? 42.432 -23.029 10.538  1.00 14.77 ? 265 SER A O     1 
ATOM   2054 C  CB    . SER A 1 268 ? 40.519 -21.069 8.760   1.00 16.15 ? 265 SER A CB    1 
ATOM   2055 O  OG    A SER A 1 268 ? 39.679 -19.942 8.570   0.19 16.93 ? 265 SER A OG    1 
ATOM   2056 O  OG    B SER A 1 268 ? 41.326 -21.168 7.609   0.45 16.63 ? 265 SER A OG    1 
ATOM   2057 O  OG    C SER A 1 268 ? 40.086 -22.401 8.560   0.36 17.43 ? 265 SER A OG    1 
ATOM   2058 N  N     . VAL A 1 269 ? 43.663 -21.484 9.462   1.00 13.11 ? 266 VAL A N     1 
ATOM   2059 C  CA    . VAL A 1 269 ? 44.869 -22.305 9.451   1.00 14.10 ? 266 VAL A CA    1 
ATOM   2060 C  C     . VAL A 1 269 ? 45.245 -22.627 10.896  1.00 17.00 ? 266 VAL A C     1 
ATOM   2061 O  O     . VAL A 1 269 ? 45.486 -23.786 11.266  1.00 13.84 ? 266 VAL A O     1 
ATOM   2062 C  CB    . VAL A 1 269 ? 46.032 -21.597 8.724   1.00 14.12 ? 266 VAL A CB    1 
ATOM   2063 C  CG1   . VAL A 1 269 ? 47.320 -22.377 8.912   1.00 17.84 ? 266 VAL A CG1   1 
ATOM   2064 C  CG2   . VAL A 1 269 ? 45.712 -21.446 7.229   1.00 14.65 ? 266 VAL A CG2   1 
ATOM   2065 N  N     . ILE A 1 270 ? 45.242 -21.592 11.723  1.00 13.95 ? 267 ILE A N     1 
ATOM   2066 C  CA    . ILE A 1 270 ? 45.594 -21.716 13.133  1.00 13.91 ? 267 ILE A CA    1 
ATOM   2067 C  C     . ILE A 1 270 ? 44.632 -22.646 13.865  1.00 15.34 ? 267 ILE A C     1 
ATOM   2068 O  O     . ILE A 1 270 ? 45.057 -23.553 14.594  1.00 18.15 ? 267 ILE A O     1 
ATOM   2069 C  CB    . ILE A 1 270 ? 45.603 -20.323 13.789  1.00 14.48 ? 267 ILE A CB    1 
ATOM   2070 C  CG1   . ILE A 1 270 ? 46.763 -19.493 13.230  1.00 16.53 ? 267 ILE A CG1   1 
ATOM   2071 C  CG2   . ILE A 1 270 ? 45.660 -20.419 15.310  1.00 19.46 ? 267 ILE A CG2   1 
ATOM   2072 C  CD1   . ILE A 1 270 ? 46.666 -18.020 13.539  1.00 19.44 ? 267 ILE A CD1   1 
ATOM   2073 N  N     . GLU A 1 271 ? 43.336 -22.440 13.645  1.00 15.38 ? 268 GLU A N     1 
ATOM   2074 C  CA    . GLU A 1 271 ? 42.310 -23.184 14.373  1.00 18.51 ? 268 GLU A CA    1 
ATOM   2075 C  C     . GLU A 1 271 ? 42.277 -24.643 13.953  1.00 15.39 ? 268 GLU A C     1 
ATOM   2076 O  O     . GLU A 1 271 ? 42.285 -25.544 14.797  1.00 18.64 ? 268 GLU A O     1 
ATOM   2077 C  CB    . GLU A 1 271 ? 40.934 -22.555 14.151  1.00 23.19 ? 268 GLU A CB    1 
ATOM   2078 C  CG    . GLU A 1 271 ? 39.782 -23.286 14.842  1.00 35.71 ? 268 GLU A CG    1 
ATOM   2079 C  CD    . GLU A 1 271 ? 38.522 -22.438 14.909  1.00 42.78 ? 268 GLU A CD    1 
ATOM   2080 O  OE1   . GLU A 1 271 ? 38.610 -21.219 14.639  1.00 55.62 ? 268 GLU A OE1   1 
ATOM   2081 O  OE2   . GLU A 1 271 ? 37.446 -22.985 15.232  1.00 47.04 ? 268 GLU A OE2   1 
ATOM   2082 N  N     . ILE A 1 272 ? 42.222 -24.871 12.646  1.00 16.61 ? 269 ILE A N     1 
ATOM   2083 C  CA    . ILE A 1 272 ? 42.042 -26.209 12.108  1.00 15.61 ? 269 ILE A CA    1 
ATOM   2084 C  C     . ILE A 1 272 ? 43.262 -27.084 12.361  1.00 17.67 ? 269 ILE A C     1 
ATOM   2085 O  O     . ILE A 1 272 ? 43.139 -28.265 12.699  1.00 19.69 ? 269 ILE A O     1 
ATOM   2086 C  CB    . ILE A 1 272 ? 41.722 -26.164 10.587  1.00 15.32 ? 269 ILE A CB    1 
ATOM   2087 C  CG1   . ILE A 1 272 ? 40.317 -25.592 10.361  1.00 20.29 ? 269 ILE A CG1   1 
ATOM   2088 C  CG2   . ILE A 1 272 ? 41.838 -27.546 9.964   1.00 17.59 ? 269 ILE A CG2   1 
ATOM   2089 C  CD1   . ILE A 1 272 ? 39.884 -25.558 8.912   1.00 22.77 ? 269 ILE A CD1   1 
ATOM   2090 N  N     . LEU A 1 273 ? 44.451 -26.514 12.216  1.00 17.45 ? 270 LEU A N     1 
ATOM   2091 C  CA    . LEU A 1 273 ? 45.661 -27.320 12.325  1.00 16.44 ? 270 LEU A CA    1 
ATOM   2092 C  C     . LEU A 1 273 ? 46.263 -27.296 13.725  1.00 16.34 ? 270 LEU A C     1 
ATOM   2093 O  O     . LEU A 1 273 ? 47.132 -28.119 14.049  1.00 16.14 ? 270 LEU A O     1 
ATOM   2094 C  CB    . LEU A 1 273 ? 46.687 -26.845 11.309  1.00 16.62 ? 270 LEU A CB    1 
ATOM   2095 C  CG    . LEU A 1 273 ? 46.271 -26.944 9.841   1.00 14.79 ? 270 LEU A CG    1 
ATOM   2096 C  CD1   . LEU A 1 273 ? 47.390 -26.403 8.952   1.00 17.37 ? 270 LEU A CD1   1 
ATOM   2097 C  CD2   . LEU A 1 273 ? 45.919 -28.388 9.486   1.00 21.50 ? 270 LEU A CD2   1 
ATOM   2098 N  N     . GLY A 1 274 ? 45.810 -26.353 14.550  1.00 15.50 ? 271 GLY A N     1 
ATOM   2099 C  CA    . GLY A 1 274 ? 46.310 -26.228 15.911  1.00 15.89 ? 271 GLY A CA    1 
ATOM   2100 C  C     . GLY A 1 274 ? 47.768 -25.824 15.973  1.00 18.12 ? 271 GLY A C     1 
ATOM   2101 O  O     . GLY A 1 274 ? 48.540 -26.342 16.795  1.00 21.42 ? 271 GLY A O     1 
ATOM   2102 N  N     . ILE A 1 275 ? 48.143 -24.883 15.109  1.00 15.34 ? 272 ILE A N     1 
ATOM   2103 C  CA    . ILE A 1 275 ? 49.508 -24.353 15.059  1.00 13.97 ? 272 ILE A CA    1 
ATOM   2104 C  C     . ILE A 1 275 ? 49.509 -22.824 15.218  1.00 13.61 ? 272 ILE A C     1 
ATOM   2105 O  O     . ILE A 1 275 ? 48.450 -22.189 15.170  1.00 16.46 ? 272 ILE A O     1 
ATOM   2106 C  CB    . ILE A 1 275 ? 50.207 -24.735 13.735  1.00 13.76 ? 272 ILE A CB    1 
ATOM   2107 C  CG1   . ILE A 1 275 ? 49.465 -24.149 12.533  1.00 17.04 ? 272 ILE A CG1   1 
ATOM   2108 C  CG2   . ILE A 1 275 ? 50.285 -26.248 13.585  1.00 12.79 ? 272 ILE A CG2   1 
ATOM   2109 C  CD1   . ILE A 1 275 ? 50.164 -24.472 11.185  1.00 14.94 ? 272 ILE A CD1   1 
ATOM   2110 N  N     . GLU A 1 276 ? 50.689 -22.238 15.405  1.00 14.08 ? 273 GLU A N     1 
ATOM   2111 C  CA    . GLU A 1 276 ? 50.823 -20.788 15.571  1.00 14.83 ? 273 GLU A CA    1 
ATOM   2112 C  C     . GLU A 1 276 ? 51.751 -20.134 14.546  1.00 13.79 ? 273 GLU A C     1 
ATOM   2113 O  O     . GLU A 1 276 ? 51.549 -18.984 14.179  1.00 14.05 ? 273 GLU A O     1 
ATOM   2114 C  CB    . GLU A 1 276 ? 51.347 -20.446 16.968  1.00 14.30 ? 273 GLU A CB    1 
ATOM   2115 C  CG    . GLU A 1 276 ? 50.436 -20.880 18.119  1.00 21.18 ? 273 GLU A CG    1 
ATOM   2116 C  CD    . GLU A 1 276 ? 51.065 -20.640 19.488  1.00 33.35 ? 273 GLU A CD    1 
ATOM   2117 O  OE1   . GLU A 1 276 ? 50.824 -21.454 20.406  1.00 43.36 ? 273 GLU A OE1   1 
ATOM   2118 O  OE2   . GLU A 1 276 ? 51.799 -19.639 19.645  1.00 39.23 ? 273 GLU A OE2   1 
ATOM   2119 N  N     . TYR A 1 277 ? 52.781 -20.858 14.113  1.00 14.15 ? 274 TYR A N     1 
ATOM   2120 C  CA    . TYR A 1 277 ? 53.864 -20.258 13.329  1.00 13.62 ? 274 TYR A CA    1 
ATOM   2121 C  C     . TYR A 1 277 ? 53.958 -20.821 11.915  1.00 12.95 ? 274 TYR A C     1 
ATOM   2122 O  O     . TYR A 1 277 ? 53.644 -21.994 11.677  1.00 12.40 ? 274 TYR A O     1 
ATOM   2123 C  CB    . TYR A 1 277 ? 55.207 -20.465 14.042  1.00 14.53 ? 274 TYR A CB    1 
ATOM   2124 C  CG    . TYR A 1 277 ? 55.212 -19.949 15.469  1.00 12.22 ? 274 TYR A CG    1 
ATOM   2125 C  CD1   . TYR A 1 277 ? 55.453 -20.802 16.538  1.00 15.74 ? 274 TYR A CD1   1 
ATOM   2126 C  CD2   . TYR A 1 277 ? 54.945 -18.618 15.738  1.00 13.69 ? 274 TYR A CD2   1 
ATOM   2127 C  CE1   . TYR A 1 277 ? 55.440 -20.345 17.835  1.00 15.32 ? 274 TYR A CE1   1 
ATOM   2128 C  CE2   . TYR A 1 277 ? 54.922 -18.139 17.044  1.00 15.75 ? 274 TYR A CE2   1 
ATOM   2129 C  CZ    . TYR A 1 277 ? 55.172 -19.018 18.090  1.00 18.75 ? 274 TYR A CZ    1 
ATOM   2130 O  OH    . TYR A 1 277 ? 55.158 -18.577 19.396  1.00 21.80 ? 274 TYR A OH    1 
ATOM   2131 N  N     . MET A 1 278 ? 54.434 -19.994 10.990  1.00 10.48 ? 275 MET A N     1 
ATOM   2132 C  CA    . MET A 1 278 ? 54.501 -20.376 9.598   1.00 11.77 ? 275 MET A CA    1 
ATOM   2133 C  C     . MET A 1 278 ? 55.274 -21.679 9.422   1.00 12.98 ? 275 MET A C     1 
ATOM   2134 O  O     . MET A 1 278 ? 54.876 -22.539 8.637   1.00 12.49 ? 275 MET A O     1 
ATOM   2135 C  CB    . MET A 1 278 ? 55.151 -19.254 8.781   1.00 15.01 ? 275 MET A CB    1 
ATOM   2136 C  CG    . MET A 1 278 ? 54.791 -19.266 7.318   1.00 18.11 ? 275 MET A CG    1 
ATOM   2137 S  SD    . MET A 1 278 ? 53.026 -18.982 7.023   1.00 17.94 ? 275 MET A SD    1 
ATOM   2138 C  CE    . MET A 1 278 ? 52.959 -19.492 5.309   1.00 24.84 ? 275 MET A CE    1 
ATOM   2139 N  N     . GLY A 1 279 ? 56.368 -21.829 10.168  1.00 11.17 ? 276 GLY A N     1 
ATOM   2140 C  CA    . GLY A 1 279 ? 57.234 -22.985 9.990   1.00 12.73 ? 276 GLY A CA    1 
ATOM   2141 C  C     . GLY A 1 279 ? 56.535 -24.299 10.313  1.00 12.94 ? 276 GLY A C     1 
ATOM   2142 O  O     . GLY A 1 279 ? 56.874 -25.355 9.756   1.00 14.29 ? 276 GLY A O     1 
ATOM   2143 N  N     . GLU A 1 280 ? 55.555 -24.250 11.216  1.00 10.72 ? 277 GLU A N     1 
ATOM   2144 C  CA    . GLU A 1 280 ? 54.820 -25.458 11.585  1.00 10.36 ? 277 GLU A CA    1 
ATOM   2145 C  C     . GLU A 1 280 ? 54.022 -26.054 10.429  1.00 12.24 ? 277 GLU A C     1 
ATOM   2146 O  O     . GLU A 1 280 ? 53.621 -27.217 10.488  1.00 12.19 ? 277 GLU A O     1 
ATOM   2147 C  CB    . GLU A 1 280 ? 53.871 -25.177 12.754  1.00 12.61 ? 277 GLU A CB    1 
ATOM   2148 C  CG    . GLU A 1 280 ? 54.566 -24.856 14.052  1.00 14.24 ? 277 GLU A CG    1 
ATOM   2149 C  CD    . GLU A 1 280 ? 53.567 -24.613 15.155  1.00 15.80 ? 277 GLU A CD    1 
ATOM   2150 O  OE1   . GLU A 1 280 ? 53.251 -23.438 15.390  1.00 14.90 ? 277 GLU A OE1   1 
ATOM   2151 O  OE2   . GLU A 1 280 ? 53.098 -25.589 15.771  1.00 18.33 ? 277 GLU A OE2   1 
ATOM   2152 N  N     . LEU A 1 281 ? 53.764 -25.275 9.385   1.00 10.73 ? 278 LEU A N     1 
ATOM   2153 C  CA    . LEU A 1 281 ? 53.041 -25.799 8.227   1.00 9.86  ? 278 LEU A CA    1 
ATOM   2154 C  C     . LEU A 1 281 ? 53.805 -26.883 7.480   1.00 10.46 ? 278 LEU A C     1 
ATOM   2155 O  O     . LEU A 1 281 ? 53.191 -27.656 6.727   1.00 11.28 ? 278 LEU A O     1 
ATOM   2156 C  CB    . LEU A 1 281 ? 52.705 -24.672 7.250   1.00 10.90 ? 278 LEU A CB    1 
ATOM   2157 C  CG    . LEU A 1 281 ? 51.517 -23.804 7.668   1.00 12.19 ? 278 LEU A CG    1 
ATOM   2158 C  CD1   . LEU A 1 281 ? 51.534 -22.446 6.921   1.00 13.58 ? 278 LEU A CD1   1 
ATOM   2159 C  CD2   . LEU A 1 281 ? 50.221 -24.550 7.422   1.00 13.45 ? 278 LEU A CD2   1 
ATOM   2160 N  N     . THR A 1 282 ? 55.128 -26.941 7.642   1.00 10.85 ? 279 THR A N     1 
ATOM   2161 C  CA    . THR A 1 282 ? 55.908 -27.876 6.826   1.00 13.96 ? 279 THR A CA    1 
ATOM   2162 C  C     . THR A 1 282 ? 55.556 -29.332 7.136   1.00 12.68 ? 279 THR A C     1 
ATOM   2163 O  O     . THR A 1 282 ? 55.811 -30.214 6.340   1.00 14.87 ? 279 THR A O     1 
ATOM   2164 C  CB    . THR A 1 282 ? 57.436 -27.711 7.013   1.00 13.19 ? 279 THR A CB    1 
ATOM   2165 O  OG1   . THR A 1 282 ? 57.802 -28.015 8.372   1.00 14.04 ? 279 THR A OG1   1 
ATOM   2166 C  CG2   . THR A 1 282 ? 57.897 -26.300 6.658   1.00 12.64 ? 279 THR A CG2   1 
ATOM   2167 N  N     . GLN A 1 283 ? 54.972 -29.581 8.299   1.00 13.30 ? 280 GLN A N     1 
ATOM   2168 C  CA    . GLN A 1 283 ? 54.668 -30.960 8.680   1.00 15.20 ? 280 GLN A CA    1 
ATOM   2169 C  C     . GLN A 1 283 ? 53.408 -31.547 8.045   1.00 19.92 ? 280 GLN A C     1 
ATOM   2170 O  O     . GLN A 1 283 ? 53.049 -32.686 8.325   1.00 25.10 ? 280 GLN A O     1 
ATOM   2171 C  CB    . GLN A 1 283 ? 54.562 -31.033 10.195  1.00 16.73 ? 280 GLN A CB    1 
ATOM   2172 C  CG    A GLN A 1 283 ? 53.314 -30.435 10.735  0.48 13.95 ? 280 GLN A CG    1 
ATOM   2173 C  CG    B GLN A 1 283 ? 55.898 -30.740 10.820  0.52 13.60 ? 280 GLN A CG    1 
ATOM   2174 C  CD    A GLN A 1 283 ? 53.387 -30.231 12.226  0.48 24.67 ? 280 GLN A CD    1 
ATOM   2175 C  CD    B GLN A 1 283 ? 56.973 -31.589 10.181  0.52 15.45 ? 280 GLN A CD    1 
ATOM   2176 O  OE1   A GLN A 1 283 ? 53.709 -31.155 12.981  0.48 24.57 ? 280 GLN A OE1   1 
ATOM   2177 O  OE1   B GLN A 1 283 ? 56.946 -32.812 10.297  0.52 15.40 ? 280 GLN A OE1   1 
ATOM   2178 N  NE2   A GLN A 1 283 ? 53.102 -29.012 12.662  0.48 14.57 ? 280 GLN A NE2   1 
ATOM   2179 N  NE2   B GLN A 1 283 ? 57.896 -30.953 9.462   0.52 17.83 ? 280 GLN A NE2   1 
ATOM   2180 N  N     . PHE A 1 284 ? 52.735 -30.785 7.193   1.00 13.94 ? 281 PHE A N     1 
ATOM   2181 C  CA    . PHE A 1 284 ? 51.526 -31.278 6.541   1.00 13.60 ? 281 PHE A CA    1 
ATOM   2182 C  C     . PHE A 1 284 ? 51.800 -31.583 5.076   1.00 15.81 ? 281 PHE A C     1 
ATOM   2183 O  O     . PHE A 1 284 ? 52.625 -30.923 4.446   1.00 17.01 ? 281 PHE A O     1 
ATOM   2184 C  CB    . PHE A 1 284 ? 50.396 -30.265 6.690   1.00 12.58 ? 281 PHE A CB    1 
ATOM   2185 C  CG    . PHE A 1 284 ? 50.058 -29.985 8.125   1.00 13.72 ? 281 PHE A CG    1 
ATOM   2186 C  CD1   . PHE A 1 284 ? 49.177 -30.808 8.810   1.00 17.47 ? 281 PHE A CD1   1 
ATOM   2187 C  CD2   . PHE A 1 284 ? 50.670 -28.951 8.808   1.00 13.25 ? 281 PHE A CD2   1 
ATOM   2188 C  CE1   . PHE A 1 284 ? 48.884 -30.573 10.145  1.00 18.81 ? 281 PHE A CE1   1 
ATOM   2189 C  CE2   . PHE A 1 284 ? 50.384 -28.719 10.129  1.00 12.79 ? 281 PHE A CE2   1 
ATOM   2190 C  CZ    . PHE A 1 284 ? 49.497 -29.531 10.807  1.00 15.74 ? 281 PHE A CZ    1 
ATOM   2191 N  N     . THR A 1 285 ? 51.135 -32.599 4.533   1.00 15.14 ? 282 THR A N     1 
ATOM   2192 C  CA    . THR A 1 285 ? 51.308 -32.866 3.112   1.00 15.08 ? 282 THR A CA    1 
ATOM   2193 C  C     . THR A 1 285 ? 50.578 -31.819 2.304   1.00 11.72 ? 282 THR A C     1 
ATOM   2194 O  O     . THR A 1 285 ? 49.685 -31.150 2.817   1.00 12.81 ? 282 THR A O     1 
ATOM   2195 C  CB    . THR A 1 285 ? 50.784 -34.246 2.695   1.00 13.07 ? 282 THR A CB    1 
ATOM   2196 O  OG1   . THR A 1 285 ? 49.364 -34.281 2.844   1.00 15.77 ? 282 THR A OG1   1 
ATOM   2197 C  CG2   . THR A 1 285 ? 51.410 -35.321 3.551   1.00 18.60 ? 282 THR A CG2   1 
ATOM   2198 N  N     . GLU A 1 286 ? 50.946 -31.701 1.032   1.00 14.06 ? 283 GLU A N     1 
ATOM   2199 C  CA    . GLU A 1 286 ? 50.246 -30.780 0.149   1.00 15.32 ? 283 GLU A CA    1 
ATOM   2200 C  C     . GLU A 1 286 ? 48.768 -31.158 0.099   1.00 13.34 ? 283 GLU A C     1 
ATOM   2201 O  O     . GLU A 1 286 ? 47.892 -30.291 0.192   1.00 12.26 ? 283 GLU A O     1 
ATOM   2202 C  CB    . GLU A 1 286 ? 50.862 -30.779 -1.253  1.00 14.77 ? 283 GLU A CB    1 
ATOM   2203 C  CG    . GLU A 1 286 ? 50.308 -29.665 -2.117  1.00 13.70 ? 283 GLU A CG    1 
ATOM   2204 C  CD    . GLU A 1 286 ? 51.038 -29.526 -3.432  1.00 21.00 ? 283 GLU A CD    1 
ATOM   2205 O  OE1   . GLU A 1 286 ? 51.968 -30.310 -3.690  1.00 22.39 ? 283 GLU A OE1   1 
ATOM   2206 O  OE2   . GLU A 1 286 ? 50.682 -28.615 -4.206  1.00 20.10 ? 283 GLU A OE2   1 
ATOM   2207 N  N     . SER A 1 287 ? 48.490 -32.459 0.009   1.00 13.09 ? 284 SER A N     1 
ATOM   2208 C  CA    . SER A 1 287 ? 47.105 -32.911 -0.048  1.00 14.73 ? 284 SER A CA    1 
ATOM   2209 C  C     . SER A 1 287 ? 46.346 -32.574 1.231   1.00 13.23 ? 284 SER A C     1 
ATOM   2210 O  O     . SER A 1 287 ? 45.161 -32.222 1.174   1.00 14.77 ? 284 SER A O     1 
ATOM   2211 C  CB    . SER A 1 287 ? 47.036 -34.419 -0.316  1.00 17.47 ? 284 SER A CB    1 
ATOM   2212 O  OG    A SER A 1 287 ? 47.689 -34.752 -1.527  0.79 20.38 ? 284 SER A OG    1 
ATOM   2213 O  OG    B SER A 1 287 ? 47.788 -35.139 0.644   0.21 15.03 ? 284 SER A OG    1 
ATOM   2214 N  N     . GLN A 1 288 ? 47.019 -32.655 2.384   1.00 14.53 ? 285 GLN A N     1 
ATOM   2215 C  CA    . GLN A 1 288 ? 46.364 -32.300 3.639   1.00 13.10 ? 285 GLN A CA    1 
ATOM   2216 C  C     . GLN A 1 288 ? 45.962 -30.827 3.635   1.00 11.83 ? 285 GLN A C     1 
ATOM   2217 O  O     . GLN A 1 288 ? 44.842 -30.453 4.002   1.00 14.77 ? 285 GLN A O     1 
ATOM   2218 C  CB    . GLN A 1 288 ? 47.279 -32.570 4.840   1.00 12.97 ? 285 GLN A CB    1 
ATOM   2219 C  CG    . GLN A 1 288 ? 47.259 -33.982 5.351   1.00 20.72 ? 285 GLN A CG    1 
ATOM   2220 C  CD    . GLN A 1 288 ? 48.231 -34.174 6.503   1.00 20.91 ? 285 GLN A CD    1 
ATOM   2221 O  OE1   . GLN A 1 288 ? 49.408 -33.825 6.408   1.00 17.95 ? 285 GLN A OE1   1 
ATOM   2222 N  NE2   . GLN A 1 288 ? 47.733 -34.722 7.611   1.00 27.88 ? 285 GLN A NE2   1 
ATOM   2223 N  N     . LEU A 1 289 ? 46.889 -29.977 3.216   1.00 13.56 ? 286 LEU A N     1 
ATOM   2224 C  CA    . LEU A 1 289 ? 46.580 -28.555 3.206   1.00 12.53 ? 286 LEU A CA    1 
ATOM   2225 C  C     . LEU A 1 289 ? 45.472 -28.232 2.195   1.00 12.74 ? 286 LEU A C     1 
ATOM   2226 O  O     . LEU A 1 289 ? 44.594 -27.410 2.473   1.00 14.54 ? 286 LEU A O     1 
ATOM   2227 C  CB    . LEU A 1 289 ? 47.837 -27.739 2.913   1.00 12.14 ? 286 LEU A CB    1 
ATOM   2228 C  CG    . LEU A 1 289 ? 48.936 -27.830 3.978   1.00 12.64 ? 286 LEU A CG    1 
ATOM   2229 C  CD1   . LEU A 1 289 ? 50.165 -27.039 3.525   1.00 11.68 ? 286 LEU A CD1   1 
ATOM   2230 C  CD2   . LEU A 1 289 ? 48.433 -27.397 5.371   1.00 14.01 ? 286 LEU A CD2   1 
ATOM   2231 N  N     . GLN A 1 290 ? 45.517 -28.882 1.030   1.00 14.67 ? 287 GLN A N     1 
ATOM   2232 C  CA    . GLN A 1 290 ? 44.468 -28.694 0.028   1.00 15.92 ? 287 GLN A CA    1 
ATOM   2233 C  C     . GLN A 1 290 ? 43.115 -29.144 0.561   1.00 14.90 ? 287 GLN A C     1 
ATOM   2234 O  O     . GLN A 1 290 ? 42.070 -28.540 0.272   1.00 15.74 ? 287 GLN A O     1 
ATOM   2235 C  CB    . GLN A 1 290 ? 44.809 -29.463 -1.251  1.00 16.24 ? 287 GLN A CB    1 
ATOM   2236 C  CG    . GLN A 1 290 ? 45.957 -28.877 -2.038  1.00 16.55 ? 287 GLN A CG    1 
ATOM   2237 C  CD    . GLN A 1 290 ? 46.343 -29.747 -3.205  1.00 17.34 ? 287 GLN A CD    1 
ATOM   2238 O  OE1   . GLN A 1 290 ? 46.290 -30.976 -3.125  1.00 19.17 ? 287 GLN A OE1   1 
ATOM   2239 N  NE2   . GLN A 1 290 ? 46.765 -29.117 -4.292  1.00 21.60 ? 287 GLN A NE2   1 
ATOM   2240 N  N     . SER A 1 291 ? 43.126 -30.196 1.366   1.00 14.28 ? 288 SER A N     1 
ATOM   2241 C  CA    . SER A 1 291 ? 41.871 -30.713 1.911   1.00 13.71 ? 288 SER A CA    1 
ATOM   2242 C  C     . SER A 1 291 ? 41.179 -29.714 2.843   1.00 18.75 ? 288 SER A C     1 
ATOM   2243 O  O     . SER A 1 291 ? 39.951 -29.667 2.908   1.00 24.62 ? 288 SER A O     1 
ATOM   2244 C  CB    . SER A 1 291 ? 42.098 -32.039 2.641   1.00 15.79 ? 288 SER A CB    1 
ATOM   2245 O  OG    . SER A 1 291 ? 42.621 -31.850 3.952   1.00 21.42 ? 288 SER A OG    1 
ATOM   2246 N  N     . HIS A 1 292 ? 41.950 -28.907 3.563   1.00 16.73 ? 289 HIS A N     1 
ATOM   2247 C  CA    . HIS A 1 292 ? 41.347 -27.945 4.470   1.00 16.88 ? 289 HIS A CA    1 
ATOM   2248 C  C     . HIS A 1 292 ? 41.065 -26.594 3.823   1.00 16.67 ? 289 HIS A C     1 
ATOM   2249 O  O     . HIS A 1 292 ? 40.087 -25.938 4.165   1.00 20.94 ? 289 HIS A O     1 
ATOM   2250 C  CB    . HIS A 1 292 ? 42.241 -27.711 5.681   1.00 17.95 ? 289 HIS A CB    1 
ATOM   2251 C  CG    . HIS A 1 292 ? 42.470 -28.925 6.523   1.00 16.57 ? 289 HIS A CG    1 
ATOM   2252 N  ND1   . HIS A 1 292 ? 41.466 -29.530 7.251   1.00 26.40 ? 289 HIS A ND1   1 
ATOM   2253 C  CD2   . HIS A 1 292 ? 43.600 -29.617 6.791   1.00 21.39 ? 289 HIS A CD2   1 
ATOM   2254 C  CE1   . HIS A 1 292 ? 41.967 -30.555 7.914   1.00 21.25 ? 289 HIS A CE1   1 
ATOM   2255 N  NE2   . HIS A 1 292 ? 43.260 -30.630 7.655   1.00 27.11 ? 289 HIS A NE2   1 
ATOM   2256 N  N     . PHE A 1 293 ? 41.940 -26.161 2.917   1.00 14.83 ? 290 PHE A N     1 
ATOM   2257 C  CA    . PHE A 1 293 ? 41.947 -24.760 2.497   1.00 17.76 ? 290 PHE A CA    1 
ATOM   2258 C  C     . PHE A 1 293 ? 41.690 -24.596 1.007   1.00 17.95 ? 290 PHE A C     1 
ATOM   2259 O  O     . PHE A 1 293 ? 41.698 -23.478 0.486   1.00 17.65 ? 290 PHE A O     1 
ATOM   2260 C  CB    . PHE A 1 293 ? 43.280 -24.130 2.922   1.00 14.17 ? 290 PHE A CB    1 
ATOM   2261 C  CG    . PHE A 1 293 ? 43.593 -24.379 4.377   1.00 14.32 ? 290 PHE A CG    1 
ATOM   2262 C  CD1   . PHE A 1 293 ? 42.758 -23.869 5.376   1.00 14.49 ? 290 PHE A CD1   1 
ATOM   2263 C  CD2   . PHE A 1 293 ? 44.686 -25.146 4.752   1.00 12.77 ? 290 PHE A CD2   1 
ATOM   2264 C  CE1   . PHE A 1 293 ? 43.010 -24.131 6.716   1.00 16.54 ? 290 PHE A CE1   1 
ATOM   2265 C  CE2   . PHE A 1 293 ? 44.951 -25.397 6.099   1.00 15.03 ? 290 PHE A CE2   1 
ATOM   2266 C  CZ    . PHE A 1 293 ? 44.110 -24.891 7.071   1.00 14.07 ? 290 PHE A CZ    1 
ATOM   2267 N  N     . GLY A 1 294 ? 41.432 -25.717 0.338   1.00 17.45 ? 291 GLY A N     1 
ATOM   2268 C  CA    . GLY A 1 294 ? 41.186 -25.714 -1.086  1.00 18.65 ? 291 GLY A CA    1 
ATOM   2269 C  C     . GLY A 1 294 ? 42.443 -25.975 -1.881  1.00 15.74 ? 291 GLY A C     1 
ATOM   2270 O  O     . GLY A 1 294 ? 43.568 -25.796 -1.390  1.00 15.60 ? 291 GLY A O     1 
ATOM   2271 N  N     . GLU A 1 295 ? 42.256 -26.382 -3.130  1.00 16.64 ? 292 GLU A N     1 
ATOM   2272 C  CA    . GLU A 1 295 ? 43.361 -26.718 -4.005  1.00 16.50 ? 292 GLU A CA    1 
ATOM   2273 C  C     . GLU A 1 295 ? 44.394 -25.599 -4.140  1.00 17.88 ? 292 GLU A C     1 
ATOM   2274 O  O     . GLU A 1 295 ? 45.590 -25.835 -3.984  1.00 15.96 ? 292 GLU A O     1 
ATOM   2275 C  CB    . GLU A 1 295 ? 42.826 -27.101 -5.389  1.00 18.37 ? 292 GLU A CB    1 
ATOM   2276 C  CG    . GLU A 1 295 ? 43.878 -27.672 -6.307  1.00 21.74 ? 292 GLU A CG    1 
ATOM   2277 C  CD    . GLU A 1 295 ? 43.289 -28.274 -7.572  1.00 40.97 ? 292 GLU A CD    1 
ATOM   2278 O  OE1   . GLU A 1 295 ? 44.051 -28.902 -8.341  1.00 47.04 ? 292 GLU A OE1   1 
ATOM   2279 O  OE2   . GLU A 1 295 ? 42.065 -28.139 -7.787  1.00 29.83 ? 292 GLU A OE2   1 
ATOM   2280 N  N     . LYS A 1 296 ? 43.936 -24.382 -4.421  1.00 15.28 ? 293 LYS A N     1 
ATOM   2281 C  CA    . LYS A 1 296 ? 44.862 -23.285 -4.688  1.00 15.31 ? 293 LYS A CA    1 
ATOM   2282 C  C     . LYS A 1 296 ? 45.592 -22.854 -3.417  1.00 15.12 ? 293 LYS A C     1 
ATOM   2283 O  O     . LYS A 1 296 ? 46.825 -22.757 -3.396  1.00 15.83 ? 293 LYS A O     1 
ATOM   2284 C  CB    . LYS A 1 296 ? 44.099 -22.099 -5.311  1.00 17.76 ? 293 LYS A CB    1 
ATOM   2285 C  CG    . LYS A 1 296 ? 44.949 -20.904 -5.665  1.00 27.14 ? 293 LYS A CG    1 
ATOM   2286 C  CD    . LYS A 1 296 ? 44.171 -19.920 -6.536  1.00 29.18 ? 293 LYS A CD    1 
ATOM   2287 C  CE    . LYS A 1 296 ? 44.535 -18.474 -6.199  1.00 35.19 ? 293 LYS A CE    1 
ATOM   2288 N  NZ    . LYS A 1 296 ? 43.979 -18.072 -4.869  1.00 40.39 ? 293 LYS A NZ    1 
ATOM   2289 N  N     . ASN A 1 297 ? 44.830 -22.604 -2.362  1.00 15.41 ? 294 ASN A N     1 
ATOM   2290 C  CA    . ASN A 1 297 ? 45.433 -22.188 -1.089  1.00 13.21 ? 294 ASN A CA    1 
ATOM   2291 C  C     . ASN A 1 297 ? 46.353 -23.254 -0.526  1.00 15.32 ? 294 ASN A C     1 
ATOM   2292 O  O     . ASN A 1 297 ? 47.394 -22.941 0.054   1.00 13.81 ? 294 ASN A O     1 
ATOM   2293 C  CB    . ASN A 1 297 ? 44.366 -21.891 -0.045  1.00 17.03 ? 294 ASN A CB    1 
ATOM   2294 C  CG    . ASN A 1 297 ? 43.664 -20.589 -0.275  1.00 20.25 ? 294 ASN A CG    1 
ATOM   2295 O  OD1   . ASN A 1 297 ? 44.215 -19.666 -0.874  1.00 22.21 ? 294 ASN A OD1   1 
ATOM   2296 N  ND2   . ASN A 1 297 ? 42.430 -20.498 0.213   1.00 22.78 ? 294 ASN A ND2   1 
ATOM   2297 N  N     . GLY A 1 298 ? 45.946 -24.515 -0.638  1.00 15.54 ? 295 GLY A N     1 
ATOM   2298 C  CA    . GLY A 1 298 ? 46.737 -25.606 -0.078  1.00 14.00 ? 295 GLY A CA    1 
ATOM   2299 C  C     . GLY A 1 298 ? 48.098 -25.726 -0.745  1.00 12.66 ? 295 GLY A C     1 
ATOM   2300 O  O     . GLY A 1 298 ? 49.125 -25.900 -0.086  1.00 13.24 ? 295 GLY A O     1 
ATOM   2301 N  N     . SER A 1 299 ? 48.119 -25.627 -2.070  1.00 12.90 ? 296 SER A N     1 
ATOM   2302 C  CA    . SER A 1 299 ? 49.370 -25.638 -2.810  1.00 11.19 ? 296 SER A CA    1 
ATOM   2303 C  C     . SER A 1 299 ? 50.204 -24.401 -2.485  1.00 13.48 ? 296 SER A C     1 
ATOM   2304 O  O     . SER A 1 299 ? 51.417 -24.496 -2.323  1.00 14.16 ? 296 SER A O     1 
ATOM   2305 C  CB    . SER A 1 299 ? 49.102 -25.703 -4.317  1.00 16.69 ? 296 SER A CB    1 
ATOM   2306 O  OG    . SER A 1 299 ? 48.716 -27.017 -4.688  1.00 15.78 ? 296 SER A OG    1 
ATOM   2307 N  N     . TRP A 1 300 ? 49.543 -23.251 -2.374  1.00 13.95 ? 297 TRP A N     1 
ATOM   2308 C  CA    . TRP A 1 300 ? 50.245 -22.019 -2.040  1.00 11.99 ? 297 TRP A CA    1 
ATOM   2309 C  C     . TRP A 1 300 ? 50.892 -22.134 -0.658  1.00 11.98 ? 297 TRP A C     1 
ATOM   2310 O  O     . TRP A 1 300 ? 52.081 -21.837 -0.506  1.00 12.98 ? 297 TRP A O     1 
ATOM   2311 C  CB    . TRP A 1 300 ? 49.292 -20.825 -2.110  1.00 14.16 ? 297 TRP A CB    1 
ATOM   2312 C  CG    . TRP A 1 300 ? 49.984 -19.521 -1.894  1.00 14.14 ? 297 TRP A CG    1 
ATOM   2313 C  CD1   . TRP A 1 300 ? 50.631 -18.768 -2.837  1.00 17.07 ? 297 TRP A CD1   1 
ATOM   2314 C  CD2   . TRP A 1 300 ? 50.092 -18.801 -0.658  1.00 13.07 ? 297 TRP A CD2   1 
ATOM   2315 N  NE1   . TRP A 1 300 ? 51.137 -17.629 -2.259  1.00 20.50 ? 297 TRP A NE1   1 
ATOM   2316 C  CE2   . TRP A 1 300 ? 50.822 -17.627 -0.926  1.00 16.14 ? 297 TRP A CE2   1 
ATOM   2317 C  CE3   . TRP A 1 300 ? 49.640 -19.034 0.641   1.00 15.78 ? 297 TRP A CE3   1 
ATOM   2318 C  CZ2   . TRP A 1 300 ? 51.110 -16.686 0.069   1.00 15.68 ? 297 TRP A CZ2   1 
ATOM   2319 C  CZ3   . TRP A 1 300 ? 49.932 -18.103 1.621   1.00 20.04 ? 297 TRP A CZ3   1 
ATOM   2320 C  CH2   . TRP A 1 300 ? 50.661 -16.949 1.331   1.00 18.34 ? 297 TRP A CH2   1 
ATOM   2321 N  N     . LEU A 1 301 ? 50.131 -22.609 0.330   1.00 11.73 ? 298 LEU A N     1 
ATOM   2322 C  CA    . LEU A 1 301 ? 50.687 -22.782 1.680   1.00 12.02 ? 298 LEU A CA    1 
ATOM   2323 C  C     . LEU A 1 301 ? 51.833 -23.795 1.752   1.00 13.73 ? 298 LEU A C     1 
ATOM   2324 O  O     . LEU A 1 301 ? 52.832 -23.575 2.455   1.00 11.39 ? 298 LEU A O     1 
ATOM   2325 C  CB    . LEU A 1 301 ? 49.595 -23.206 2.655   1.00 10.12 ? 298 LEU A CB    1 
ATOM   2326 C  CG    . LEU A 1 301 ? 48.492 -22.176 2.942   1.00 13.05 ? 298 LEU A CG    1 
ATOM   2327 C  CD1   . LEU A 1 301 ? 47.302 -22.816 3.618   1.00 13.85 ? 298 LEU A CD1   1 
ATOM   2328 C  CD2   . LEU A 1 301 ? 49.038 -21.057 3.806   1.00 15.26 ? 298 LEU A CD2   1 
ATOM   2329 N  N     . TYR A 1 302 ? 51.695 -24.904 1.039   1.00 11.30 ? 299 TYR A N     1 
ATOM   2330 C  CA    . TYR A 1 302 ? 52.735 -25.932 1.040   1.00 10.80 ? 299 TYR A CA    1 
ATOM   2331 C  C     . TYR A 1 302 ? 54.087 -25.369 0.565   1.00 12.29 ? 299 TYR A C     1 
ATOM   2332 O  O     . TYR A 1 302 ? 55.135 -25.587 1.197   1.00 11.02 ? 299 TYR A O     1 
ATOM   2333 C  CB    . TYR A 1 302 ? 52.296 -27.118 0.162   1.00 13.33 ? 299 TYR A CB    1 
ATOM   2334 C  CG    . TYR A 1 302 ? 53.299 -28.238 0.163   1.00 12.25 ? 299 TYR A CG    1 
ATOM   2335 C  CD1   . TYR A 1 302 ? 53.280 -29.202 1.163   1.00 15.13 ? 299 TYR A CD1   1 
ATOM   2336 C  CD2   . TYR A 1 302 ? 54.289 -28.312 -0.803  1.00 13.57 ? 299 TYR A CD2   1 
ATOM   2337 C  CE1   . TYR A 1 302 ? 54.212 -30.227 1.194   1.00 16.27 ? 299 TYR A CE1   1 
ATOM   2338 C  CE2   . TYR A 1 302 ? 55.236 -29.326 -0.779  1.00 18.25 ? 299 TYR A CE2   1 
ATOM   2339 C  CZ    . TYR A 1 302 ? 55.185 -30.285 0.218   1.00 19.96 ? 299 TYR A CZ    1 
ATOM   2340 O  OH    . TYR A 1 302 ? 56.127 -31.298 0.244   1.00 23.84 ? 299 TYR A OH    1 
ATOM   2341 N  N     . ALA A 1 303 ? 54.056 -24.610 -0.521  1.00 12.10 ? 300 ALA A N     1 
ATOM   2342 C  CA    . ALA A 1 303 ? 55.256 -23.972 -1.021  1.00 10.85 ? 300 ALA A CA    1 
ATOM   2343 C  C     . ALA A 1 303 ? 55.683 -22.785 -0.146  1.00 8.80  ? 300 ALA A C     1 
ATOM   2344 O  O     . ALA A 1 303 ? 56.874 -22.609 0.132   1.00 11.42 ? 300 ALA A O     1 
ATOM   2345 C  CB    . ALA A 1 303 ? 55.044 -23.526 -2.474  1.00 14.89 ? 300 ALA A CB    1 
ATOM   2346 N  N     . MET A 1 304 ? 54.719 -21.975 0.289   1.00 10.41 ? 301 MET A N     1 
ATOM   2347 C  CA    . MET A 1 304 ? 55.073 -20.753 0.998   1.00 11.08 ? 301 MET A CA    1 
ATOM   2348 C  C     . MET A 1 304 ? 55.795 -21.015 2.303   1.00 10.07 ? 301 MET A C     1 
ATOM   2349 O  O     . MET A 1 304 ? 56.726 -20.276 2.649   1.00 10.77 ? 301 MET A O     1 
ATOM   2350 C  CB    . MET A 1 304 ? 53.840 -19.899 1.285   1.00 10.75 ? 301 MET A CB    1 
ATOM   2351 C  CG    . MET A 1 304 ? 54.210 -18.474 1.709   1.00 12.94 ? 301 MET A CG    1 
ATOM   2352 S  SD    . MET A 1 304 ? 54.962 -17.523 0.372   1.00 16.32 ? 301 MET A SD    1 
ATOM   2353 C  CE    . MET A 1 304 ? 56.671 -17.462 0.933   1.00 16.62 ? 301 MET A CE    1 
ATOM   2354 N  N     . CYS A 1 305 ? 55.378 -22.056 3.026   1.00 9.46  ? 302 CYS A N     1 
ATOM   2355 C  CA    . CYS A 1 305 ? 56.015 -22.319 4.319   1.00 12.27 ? 302 CYS A CA    1 
ATOM   2356 C  C     . CYS A 1 305 ? 57.454 -22.836 4.143   1.00 11.17 ? 302 CYS A C     1 
ATOM   2357 O  O     . CYS A 1 305 ? 58.222 -22.877 5.115   1.00 13.53 ? 302 CYS A O     1 
ATOM   2358 C  CB    . CYS A 1 305 ? 55.194 -23.301 5.154   1.00 12.23 ? 302 CYS A CB    1 
ATOM   2359 S  SG    . CYS A 1 305 ? 55.187 -24.989 4.546   1.00 11.27 ? 302 CYS A SG    1 
ATOM   2360 N  N     . ARG A 1 306 ? 57.822 -23.186 2.917   1.00 10.27 ? 303 ARG A N     1 
ATOM   2361 C  CA    . ARG A 1 306 ? 59.207 -23.541 2.578   1.00 9.44  ? 303 ARG A CA    1 
ATOM   2362 C  C     . ARG A 1 306 ? 59.964 -22.371 1.910   1.00 11.72 ? 303 ARG A C     1 
ATOM   2363 O  O     . ARG A 1 306 ? 61.105 -22.529 1.453   1.00 14.69 ? 303 ARG A O     1 
ATOM   2364 C  CB    . ARG A 1 306 ? 59.219 -24.784 1.671   1.00 12.99 ? 303 ARG A CB    1 
ATOM   2365 C  CG    . ARG A 1 306 ? 58.658 -26.019 2.360   1.00 12.15 ? 303 ARG A CG    1 
ATOM   2366 C  CD    . ARG A 1 306 ? 58.339 -27.166 1.397   1.00 12.46 ? 303 ARG A CD    1 
ATOM   2367 N  NE    . ARG A 1 306 ? 58.128 -28.390 2.174   1.00 15.64 ? 303 ARG A NE    1 
ATOM   2368 C  CZ    . ARG A 1 306 ? 57.029 -28.664 2.873   1.00 13.11 ? 303 ARG A CZ    1 
ATOM   2369 N  NH1   . ARG A 1 306 ? 56.956 -29.796 3.565   1.00 14.31 ? 303 ARG A NH1   1 
ATOM   2370 N  NH2   . ARG A 1 306 ? 55.988 -27.832 2.870   1.00 11.04 ? 303 ARG A NH2   1 
ATOM   2371 N  N     . GLY A 1 307 ? 59.336 -21.198 1.876   1.00 11.95 ? 304 GLY A N     1 
ATOM   2372 C  CA    . GLY A 1 307 ? 59.955 -20.009 1.315   1.00 13.26 ? 304 GLY A CA    1 
ATOM   2373 C  C     . GLY A 1 307 ? 59.759 -19.861 -0.187  1.00 11.92 ? 304 GLY A C     1 
ATOM   2374 O  O     . GLY A 1 307 ? 60.429 -19.057 -0.829  1.00 12.05 ? 304 GLY A O     1 
ATOM   2375 N  N     . ILE A 1 308 ? 58.838 -20.632 -0.746  1.00 11.73 ? 305 ILE A N     1 
ATOM   2376 C  CA    . ILE A 1 308 ? 58.658 -20.715 -2.196  1.00 11.48 ? 305 ILE A CA    1 
ATOM   2377 C  C     . ILE A 1 308 ? 57.317 -20.147 -2.627  1.00 11.87 ? 305 ILE A C     1 
ATOM   2378 O  O     . ILE A 1 308 ? 56.285 -20.514 -2.092  1.00 12.65 ? 305 ILE A O     1 
ATOM   2379 C  CB    . ILE A 1 308 ? 58.759 -22.172 -2.671  1.00 13.83 ? 305 ILE A CB    1 
ATOM   2380 C  CG1   . ILE A 1 308 ? 60.140 -22.730 -2.318  1.00 16.49 ? 305 ILE A CG1   1 
ATOM   2381 C  CG2   . ILE A 1 308 ? 58.464 -22.279 -4.150  1.00 13.22 ? 305 ILE A CG2   1 
ATOM   2382 C  CD1   . ILE A 1 308 ? 60.292 -24.206 -2.640  1.00 22.36 ? 305 ILE A CD1   1 
ATOM   2383 N  N     . GLU A 1 309 ? 57.339 -19.259 -3.614  1.00 11.44 ? 306 GLU A N     1 
ATOM   2384 C  CA    . GLU A 1 309 ? 56.107 -18.652 -4.107  1.00 17.39 ? 306 GLU A CA    1 
ATOM   2385 C  C     . GLU A 1 309 ? 56.321 -18.234 -5.543  1.00 18.17 ? 306 GLU A C     1 
ATOM   2386 O  O     . GLU A 1 309 ? 57.401 -17.787 -5.895  1.00 17.48 ? 306 GLU A O     1 
ATOM   2387 C  CB    . GLU A 1 309 ? 55.698 -17.437 -3.275  1.00 20.17 ? 306 GLU A CB    1 
ATOM   2388 C  CG    . GLU A 1 309 ? 54.274 -17.042 -3.557  1.00 25.93 ? 306 GLU A CG    1 
ATOM   2389 C  CD    . GLU A 1 309 ? 53.976 -15.574 -3.377  1.00 22.31 ? 306 GLU A CD    1 
ATOM   2390 O  OE1   . GLU A 1 309 ? 54.892 -14.715 -3.449  1.00 17.15 ? 306 GLU A OE1   1 
ATOM   2391 O  OE2   . GLU A 1 309 ? 52.787 -15.281 -3.161  1.00 28.54 ? 306 GLU A OE2   1 
ATOM   2392 N  N     . HIS A 1 310 ? 55.300 -18.353 -6.383  1.00 18.67 ? 307 HIS A N     1 
ATOM   2393 C  CA    . HIS A 1 310 ? 55.556 -18.125 -7.798  1.00 19.22 ? 307 HIS A CA    1 
ATOM   2394 C  C     . HIS A 1 310 ? 54.832 -16.921 -8.384  1.00 16.06 ? 307 HIS A C     1 
ATOM   2395 O  O     . HIS A 1 310 ? 55.036 -16.608 -9.555  1.00 22.18 ? 307 HIS A O     1 
ATOM   2396 C  CB    . HIS A 1 310 ? 55.213 -19.392 -8.577  1.00 28.20 ? 307 HIS A CB    1 
ATOM   2397 C  CG    . HIS A 1 310 ? 56.150 -20.527 -8.294  1.00 34.86 ? 307 HIS A CG    1 
ATOM   2398 N  ND1   . HIS A 1 310 ? 57.517 -20.357 -8.210  1.00 36.35 ? 307 HIS A ND1   1 
ATOM   2399 C  CD2   . HIS A 1 310 ? 55.916 -21.834 -8.032  1.00 35.94 ? 307 HIS A CD2   1 
ATOM   2400 C  CE1   . HIS A 1 310 ? 58.086 -21.517 -7.934  1.00 37.08 ? 307 HIS A CE1   1 
ATOM   2401 N  NE2   . HIS A 1 310 ? 57.137 -22.430 -7.819  1.00 34.89 ? 307 HIS A NE2   1 
ATOM   2402 N  N     . ASP A 1 311 ? 54.022 -16.243 -7.576  1.00 16.20 ? 308 ASP A N     1 
ATOM   2403 C  CA    . ASP A 1 311 ? 53.244 -15.091 -8.054  1.00 16.66 ? 308 ASP A CA    1 
ATOM   2404 C  C     . ASP A 1 311 ? 54.143 -14.080 -8.760  1.00 17.87 ? 308 ASP A C     1 
ATOM   2405 O  O     . ASP A 1 311 ? 55.104 -13.598 -8.188  1.00 15.73 ? 308 ASP A O     1 
ATOM   2406 C  CB    . ASP A 1 311 ? 52.521 -14.420 -6.895  1.00 16.92 ? 308 ASP A CB    1 
ATOM   2407 C  CG    . ASP A 1 311 ? 51.529 -13.371 -7.359  1.00 21.83 ? 308 ASP A CG    1 
ATOM   2408 O  OD1   . ASP A 1 311 ? 51.225 -12.453 -6.581  1.00 32.64 ? 308 ASP A OD1   1 
ATOM   2409 O  OD2   . ASP A 1 311 ? 51.029 -13.475 -8.495  1.00 31.73 ? 308 ASP A OD2   1 
ATOM   2410 N  N     . PRO A 1 312 ? 53.864 -13.783 -10.035 1.00 15.45 ? 309 PRO A N     1 
ATOM   2411 C  CA    . PRO A 1 312 ? 54.792 -12.906 -10.748 1.00 14.08 ? 309 PRO A CA    1 
ATOM   2412 C  C     . PRO A 1 312 ? 54.637 -11.453 -10.364 1.00 11.45 ? 309 PRO A C     1 
ATOM   2413 O  O     . PRO A 1 312 ? 53.566 -11.035 -9.917  1.00 13.84 ? 309 PRO A O     1 
ATOM   2414 C  CB    . PRO A 1 312 ? 54.405 -13.106 -12.222 1.00 17.48 ? 309 PRO A CB    1 
ATOM   2415 C  CG    . PRO A 1 312 ? 53.001 -13.532 -12.169 1.00 17.44 ? 309 PRO A CG    1 
ATOM   2416 C  CD    . PRO A 1 312 ? 52.877 -14.388 -10.940 1.00 20.18 ? 309 PRO A CD    1 
ATOM   2417 N  N     . VAL A 1 313 ? 55.686 -10.687 -10.570 1.00 14.17 ? 310 VAL A N     1 
ATOM   2418 C  CA    . VAL A 1 313 ? 55.579 -9.270  -10.455 1.00 12.19 ? 310 VAL A CA    1 
ATOM   2419 C  C     . VAL A 1 313 ? 54.897 -8.814  -11.738 1.00 14.97 ? 310 VAL A C     1 
ATOM   2420 O  O     . VAL A 1 313 ? 55.421 -8.970  -12.767 1.00 15.91 ? 310 VAL A O     1 
ATOM   2421 C  CB    . VAL A 1 313 ? 56.963 -8.658  -10.376 1.00 12.81 ? 310 VAL A CB    1 
ATOM   2422 C  CG1   . VAL A 1 313 ? 56.871 -7.155  -10.325 1.00 13.99 ? 310 VAL A CG1   1 
ATOM   2423 C  CG2   . VAL A 1 313 ? 57.649 -9.145  -9.125  1.00 15.00 ? 310 VAL A CG2   1 
ATOM   2424 N  N     . LYS A 1 314 ? 53.698 -8.302  -11.609 1.00 15.29 ? 311 LYS A N     1 
ATOM   2425 C  CA    . LYS A 1 314 ? 52.964 -7.863  -12.742 1.00 14.68 ? 311 LYS A CA    1 
ATOM   2426 C  C     . LYS A 1 314 ? 53.438 -6.513  -13.249 1.00 16.32 ? 311 LYS A C     1 
ATOM   2427 O  O     . LYS A 1 314 ? 53.650 -5.602  -12.555 1.00 16.62 ? 311 LYS A O     1 
ATOM   2428 C  CB    . LYS A 1 314 ? 51.478 -7.876  -12.450 1.00 17.75 ? 311 LYS A CB    1 
ATOM   2429 C  CG    . LYS A 1 314 ? 51.032 -9.295  -12.197 1.00 20.65 ? 311 LYS A CG    1 
ATOM   2430 C  CD    . LYS A 1 314 ? 49.702 -9.437  -11.534 1.00 34.74 ? 311 LYS A CD    1 
ATOM   2431 C  CE    . LYS A 1 314 ? 49.539 -10.898 -11.081 1.00 32.62 ? 311 LYS A CE    1 
ATOM   2432 N  NZ    . LYS A 1 314 ? 50.655 -11.462 -10.238 1.00 28.08 ? 311 LYS A NZ    1 
ATOM   2433 N  N     . PRO A 1 315 ? 53.552 -6.503  -14.634 1.00 13.40 ? 312 PRO A N     1 
ATOM   2434 C  CA    . PRO A 1 315 ? 53.964 -5.228  -15.200 1.00 14.44 ? 312 PRO A CA    1 
ATOM   2435 C  C     . PRO A 1 315 ? 52.770 -4.275  -15.243 1.00 19.54 ? 312 PRO A C     1 
ATOM   2436 O  O     . PRO A 1 315 ? 52.057 -4.167  -16.181 1.00 19.19 ? 312 PRO A O     1 
ATOM   2437 C  CB    . PRO A 1 315 ? 54.408 -5.593  -16.610 1.00 16.29 ? 312 PRO A CB    1 
ATOM   2438 C  CG    . PRO A 1 315 ? 53.567 -6.723  -17.007 1.00 16.97 ? 312 PRO A CG    1 
ATOM   2439 C  CD    . PRO A 1 315 ? 53.515 -7.543  -15.789 1.00 14.64 ? 312 PRO A CD    1 
ATOM   2440 N  N     . ARG A 1 316 ? 52.576 -3.598  -14.132 1.00 15.93 ? 313 ARG A N     1 
ATOM   2441 C  CA    . ARG A 1 316 ? 51.464 -2.665  -13.993 1.00 15.79 ? 313 ARG A CA    1 
ATOM   2442 C  C     . ARG A 1 316 ? 51.826 -1.523  -13.026 1.00 16.45 ? 313 ARG A C     1 
ATOM   2443 O  O     . ARG A 1 316 ? 51.883 -1.719  -11.861 1.00 17.30 ? 313 ARG A O     1 
ATOM   2444 C  CB    . ARG A 1 316 ? 50.218 -3.379  -13.499 1.00 16.16 ? 313 ARG A CB    1 
ATOM   2445 C  CG    . ARG A 1 316 ? 49.014 -2.484  -13.558 1.00 18.68 ? 313 ARG A CG    1 
ATOM   2446 C  CD    . ARG A 1 316 ? 47.796 -3.054  -12.923 1.00 20.51 ? 313 ARG A CD    1 
ATOM   2447 N  NE    . ARG A 1 316 ? 48.088 -3.613  -11.645 1.00 22.99 ? 313 ARG A NE    1 
ATOM   2448 C  CZ    . ARG A 1 316 ? 48.136 -2.929  -10.522 1.00 25.13 ? 313 ARG A CZ    1 
ATOM   2449 N  NH1   . ARG A 1 316 ? 47.925 -1.618  -10.516 1.00 26.61 ? 313 ARG A NH1   1 
ATOM   2450 N  NH2   . ARG A 1 316 ? 48.431 -3.546  -9.384  1.00 28.77 ? 313 ARG A NH2   1 
ATOM   2451 N  N     . GLN A 1 317 ? 52.024 -0.343  -13.579 1.00 16.86 ? 314 GLN A N     1 
ATOM   2452 C  CA    . GLN A 1 317 ? 52.452 0.824   -12.814 1.00 20.93 ? 314 GLN A CA    1 
ATOM   2453 C  C     . GLN A 1 317 ? 51.272 1.718   -12.426 1.00 17.83 ? 314 GLN A C     1 
ATOM   2454 O  O     . GLN A 1 317 ? 51.338 2.489   -11.457 1.00 19.92 ? 314 GLN A O     1 
ATOM   2455 C  CB    . GLN A 1 317 ? 53.462 1.617   -13.638 1.00 30.50 ? 314 GLN A CB    1 
ATOM   2456 C  CG    . GLN A 1 317 ? 54.156 2.689   -12.872 1.00 32.72 ? 314 GLN A CG    1 
ATOM   2457 C  CD    . GLN A 1 317 ? 55.138 3.439   -13.722 1.00 29.24 ? 314 GLN A CD    1 
ATOM   2458 O  OE1   . GLN A 1 317 ? 55.528 2.980   -14.804 1.00 32.35 ? 314 GLN A OE1   1 
ATOM   2459 N  NE2   . GLN A 1 317 ? 55.545 4.604   -13.250 1.00 30.82 ? 314 GLN A NE2   1 
ATOM   2460 N  N     . LEU A 1 318 ? 50.199 1.603   -13.172 1.00 15.65 ? 315 LEU A N     1 
ATOM   2461 C  CA    . LEU A 1 318 ? 49.011 2.380   -12.971 1.00 17.10 ? 315 LEU A CA    1 
ATOM   2462 C  C     . LEU A 1 318 ? 47.853 1.583   -12.352 1.00 15.99 ? 315 LEU A C     1 
ATOM   2463 O  O     . LEU A 1 318 ? 47.619 0.461   -12.633 1.00 16.77 ? 315 LEU A O     1 
ATOM   2464 C  CB    . LEU A 1 318 ? 48.521 2.936   -14.311 1.00 15.50 ? 315 LEU A CB    1 
ATOM   2465 C  CG    . LEU A 1 318 ? 49.505 3.690   -15.170 1.00 18.86 ? 315 LEU A CG    1 
ATOM   2466 C  CD1   . LEU A 1 318 ? 48.911 3.868   -16.542 1.00 19.93 ? 315 LEU A CD1   1 
ATOM   2467 C  CD2   . LEU A 1 318 ? 49.964 4.998   -14.574 1.00 19.15 ? 315 LEU A CD2   1 
ATOM   2468 N  N     . PRO A 1 319 ? 47.070 2.267   -11.538 1.00 13.72 ? 316 PRO A N     1 
ATOM   2469 C  CA    . PRO A 1 319 ? 45.876 1.664   -10.953 1.00 14.29 ? 316 PRO A CA    1 
ATOM   2470 C  C     . PRO A 1 319 ? 44.887 1.221   -12.031 1.00 15.60 ? 316 PRO A C     1 
ATOM   2471 O  O     . PRO A 1 319 ? 44.774 1.834   -13.005 1.00 18.77 ? 316 PRO A O     1 
ATOM   2472 C  CB    . PRO A 1 319 ? 45.268 2.777   -10.124 1.00 20.55 ? 316 PRO A CB    1 
ATOM   2473 C  CG    . PRO A 1 319 ? 46.265 3.842   -10.070 1.00 23.19 ? 316 PRO A CG    1 
ATOM   2474 C  CD    . PRO A 1 319 ? 47.331 3.625   -11.047 1.00 16.87 ? 316 PRO A CD    1 
ATOM   2475 N  N     . LYS A 1 320 ? 44.217 0.098   -11.818 1.00 16.46 ? 317 LYS A N     1 
ATOM   2476 C  CA    . LYS A 1 320 ? 43.249 -0.438  -12.763 1.00 16.63 ? 317 LYS A CA    1 
ATOM   2477 C  C     . LYS A 1 320 ? 41.844 0.146   -12.620 1.00 19.04 ? 317 LYS A C     1 
ATOM   2478 O  O     . LYS A 1 320 ? 40.979 -0.115  -13.394 1.00 19.59 ? 317 LYS A O     1 
ATOM   2479 C  CB    . LYS A 1 320 ? 43.081 -1.932  -12.531 1.00 27.53 ? 317 LYS A CB    1 
ATOM   2480 C  CG    . LYS A 1 320 ? 44.266 -2.803  -12.707 1.00 30.43 ? 317 LYS A CG    1 
ATOM   2481 C  CD    . LYS A 1 320 ? 43.778 -4.239  -12.750 1.00 30.89 ? 317 LYS A CD    1 
ATOM   2482 C  CE    . LYS A 1 320 ? 44.893 -5.214  -12.681 1.00 38.21 ? 317 LYS A CE    1 
ATOM   2483 N  NZ    . LYS A 1 320 ? 44.435 -6.471  -13.284 1.00 35.86 ? 317 LYS A NZ    1 
ATOM   2484 N  N     . THR A 1 321 ? 41.634 0.898   -11.564 1.00 15.84 ? 318 THR A N     1 
ATOM   2485 C  CA    . THR A 1 321 ? 40.351 1.506   -11.310 1.00 16.71 ? 318 THR A CA    1 
ATOM   2486 C  C     . THR A 1 321 ? 40.589 2.878   -10.749 1.00 18.03 ? 318 THR A C     1 
ATOM   2487 O  O     . THR A 1 321 ? 41.611 3.105   -10.231 1.00 21.23 ? 318 THR A O     1 
ATOM   2488 C  CB    . THR A 1 321 ? 39.484 0.671   -10.333 1.00 19.74 ? 318 THR A CB    1 
ATOM   2489 O  OG1   . THR A 1 321 ? 40.211 0.444   -9.143  1.00 18.81 ? 318 THR A OG1   1 
ATOM   2490 C  CG2   . THR A 1 321 ? 39.117 -0.590  -10.895 1.00 19.76 ? 318 THR A CG2   1 
ATOM   2491 N  N     . ILE A 1 322 ? 39.629 3.767   -10.897 1.00 14.82 ? 319 ILE A N     1 
ATOM   2492 C  CA    . ILE A 1 322 ? 39.679 5.099   -10.323 1.00 14.29 ? 319 ILE A CA    1 
ATOM   2493 C  C     . ILE A 1 322 ? 38.348 5.295   -9.609  1.00 14.56 ? 319 ILE A C     1 
ATOM   2494 O  O     . ILE A 1 322 ? 37.294 5.272   -10.248 1.00 15.45 ? 319 ILE A O     1 
ATOM   2495 C  CB    . ILE A 1 322 ? 39.907 6.174   -11.403 1.00 12.86 ? 319 ILE A CB    1 
ATOM   2496 C  CG1   . ILE A 1 322 ? 41.266 5.960   -12.077 1.00 17.30 ? 319 ILE A CG1   1 
ATOM   2497 C  CG2   . ILE A 1 322 ? 39.794 7.588   -10.814 1.00 18.04 ? 319 ILE A CG2   1 
ATOM   2498 C  CD1   . ILE A 1 322 ? 41.647 7.042   -13.060 1.00 19.54 ? 319 ILE A CD1   1 
ATOM   2499 N  N     . GLY A 1 323 ? 38.392 5.423   -8.289  1.00 14.85 ? 320 GLY A N     1 
ATOM   2500 C  CA    . GLY A 1 323 ? 37.173 5.465   -7.495  1.00 13.85 ? 320 GLY A CA    1 
ATOM   2501 C  C     . GLY A 1 323 ? 37.082 6.630   -6.529  1.00 13.16 ? 320 GLY A C     1 
ATOM   2502 O  O     . GLY A 1 323 ? 38.088 7.219   -6.142  1.00 17.11 ? 320 GLY A O     1 
ATOM   2503 N  N     . CYS A 1 324 ? 35.847 6.930   -6.131  1.00 16.00 ? 321 CYS A N     1 
ATOM   2504 C  CA    . CYS A 1 324 ? 35.507 8.054   -5.256  1.00 16.56 ? 321 CYS A CA    1 
ATOM   2505 C  C     . CYS A 1 324 ? 34.474 7.528   -4.275  1.00 17.86 ? 321 CYS A C     1 
ATOM   2506 O  O     . CYS A 1 324 ? 33.452 6.997   -4.702  1.00 17.25 ? 321 CYS A O     1 
ATOM   2507 C  CB    . CYS A 1 324 ? 34.943 9.252   -6.057  1.00 16.94 ? 321 CYS A CB    1 
ATOM   2508 S  SG    A CYS A 1 324 ? 36.093 10.046  -7.188  0.63 21.86 ? 321 CYS A SG    1 
ATOM   2509 S  SG    B CYS A 1 324 ? 35.313 10.867  -5.400  0.37 24.18 ? 321 CYS A SG    1 
ATOM   2510 N  N     . SER A 1 325 ? 34.710 7.670   -2.977  1.00 16.03 ? 322 SER A N     1 
ATOM   2511 C  CA    A SER A 1 325 ? 33.748 7.159   -2.012  0.49 16.57 ? 322 SER A CA    1 
ATOM   2512 C  CA    B SER A 1 325 ? 33.839 7.090   -1.962  0.51 16.58 ? 322 SER A CA    1 
ATOM   2513 C  C     . SER A 1 325 ? 33.621 8.050   -0.790  1.00 17.02 ? 322 SER A C     1 
ATOM   2514 O  O     . SER A 1 325 ? 34.563 8.740   -0.377  1.00 19.67 ? 322 SER A O     1 
ATOM   2515 C  CB    A SER A 1 325 ? 34.119 5.741   -1.578  0.49 19.02 ? 322 SER A CB    1 
ATOM   2516 C  CB    B SER A 1 325 ? 34.449 5.770   -1.473  0.51 18.97 ? 322 SER A CB    1 
ATOM   2517 O  OG    A SER A 1 325 ? 35.334 5.733   -0.855  0.49 16.20 ? 322 SER A OG    1 
ATOM   2518 O  OG    B SER A 1 325 ? 33.866 5.311   -0.268  0.51 18.49 ? 322 SER A OG    1 
ATOM   2519 N  N     . LYS A 1 326 ? 32.418 8.060   -0.230  1.00 15.76 ? 323 LYS A N     1 
ATOM   2520 C  CA    . LYS A 1 326 ? 32.195 8.808   1.003   1.00 15.93 ? 323 LYS A CA    1 
ATOM   2521 C  C     . LYS A 1 326 ? 31.206 8.116   1.919   1.00 19.71 ? 323 LYS A C     1 
ATOM   2522 O  O     . LYS A 1 326 ? 30.133 7.699   1.496   1.00 16.37 ? 323 LYS A O     1 
ATOM   2523 C  CB    . LYS A 1 326 ? 31.716 10.229  0.706   1.00 14.96 ? 323 LYS A CB    1 
ATOM   2524 C  CG    . LYS A 1 326 ? 31.585 11.062  1.987   1.00 17.51 ? 323 LYS A CG    1 
ATOM   2525 C  CD    . LYS A 1 326 ? 31.599 12.541  1.699   1.00 25.03 ? 323 LYS A CD    1 
ATOM   2526 C  CE    . LYS A 1 326 ? 31.416 13.320  2.987   1.00 25.07 ? 323 LYS A CE    1 
ATOM   2527 N  NZ    . LYS A 1 326 ? 32.297 12.767  4.039   1.00 29.02 ? 323 LYS A NZ    1 
ATOM   2528 N  N     . ASN A 1 327 ? 31.601 7.981   3.179   1.00 16.18 ? 324 ASN A N     1 
ATOM   2529 C  CA    . ASN A 1 327 ? 30.721 7.539   4.248   1.00 18.89 ? 324 ASN A CA    1 
ATOM   2530 C  C     . ASN A 1 327 ? 29.850 8.673   4.761   1.00 18.81 ? 324 ASN A C     1 
ATOM   2531 O  O     . ASN A 1 327 ? 30.259 9.834   4.764   1.00 17.88 ? 324 ASN A O     1 
ATOM   2532 C  CB    . ASN A 1 327 ? 31.525 6.985   5.425   1.00 24.34 ? 324 ASN A CB    1 
ATOM   2533 C  CG    . ASN A 1 327 ? 32.140 5.640   5.137   1.00 20.01 ? 324 ASN A CG    1 
ATOM   2534 O  OD1   . ASN A 1 327 ? 31.939 5.060   4.070   1.00 24.46 ? 324 ASN A OD1   1 
ATOM   2535 N  ND2   . ASN A 1 327 ? 32.890 5.122   6.106   1.00 24.54 ? 324 ASN A ND2   1 
ATOM   2536 N  N     . PHE A 1 328 ? 28.653 8.339   5.217   1.00 21.75 ? 325 PHE A N     1 
ATOM   2537 C  CA    . PHE A 1 328 ? 27.727 9.291   5.803   1.00 23.43 ? 325 PHE A CA    1 
ATOM   2538 C  C     . PHE A 1 328 ? 27.249 8.660   7.088   1.00 31.55 ? 325 PHE A C     1 
ATOM   2539 O  O     . PHE A 1 328 ? 26.241 8.054   7.167   1.00 29.64 ? 325 PHE A O     1 
ATOM   2540 C  CB    . PHE A 1 328 ? 26.589 9.631   4.839   1.00 24.82 ? 325 PHE A CB    1 
ATOM   2541 C  CG    . PHE A 1 328 ? 27.062 10.179  3.548   1.00 21.63 ? 325 PHE A CG    1 
ATOM   2542 C  CD1   . PHE A 1 328 ? 27.231 9.354   2.476   1.00 24.99 ? 325 PHE A CD1   1 
ATOM   2543 C  CD2   . PHE A 1 328 ? 27.346 11.486  3.409   1.00 21.62 ? 325 PHE A CD2   1 
ATOM   2544 C  CE1   . PHE A 1 328 ? 27.708 9.842   1.320   1.00 17.41 ? 325 PHE A CE1   1 
ATOM   2545 C  CE2   . PHE A 1 328 ? 27.785 11.988  2.231   1.00 21.55 ? 325 PHE A CE2   1 
ATOM   2546 C  CZ    . PHE A 1 328 ? 27.970 11.149  1.177   1.00 22.13 ? 325 PHE A CZ    1 
ATOM   2547 N  N     . PRO A 1 329 ? 28.074 8.731   8.107   1.00 26.65 ? 326 PRO A N     1 
ATOM   2548 C  CA    . PRO A 1 329 ? 27.803 8.017   9.337   1.00 34.67 ? 326 PRO A CA    1 
ATOM   2549 C  C     . PRO A 1 329 ? 26.791 8.635   10.230  1.00 38.16 ? 326 PRO A C     1 
ATOM   2550 O  O     . PRO A 1 329 ? 26.537 9.799   10.187  1.00 32.82 ? 326 PRO A O     1 
ATOM   2551 C  CB    . PRO A 1 329 ? 29.118 8.084   10.066  1.00 36.19 ? 326 PRO A CB    1 
ATOM   2552 C  CG    . PRO A 1 329 ? 29.665 9.362   9.627   1.00 33.34 ? 326 PRO A CG    1 
ATOM   2553 C  CD    . PRO A 1 329 ? 29.368 9.387   8.169   1.00 30.51 ? 326 PRO A CD    1 
ATOM   2554 N  N     . GLY A 1 330 ? 26.290 7.771   11.087  1.00 45.33 ? 327 GLY A N     1 
ATOM   2555 C  CA    . GLY A 1 330 ? 25.543 8.183   12.251  1.00 49.66 ? 327 GLY A CA    1 
ATOM   2556 C  C     . GLY A 1 330 ? 24.373 8.951   11.776  1.00 43.00 ? 327 GLY A C     1 
ATOM   2557 O  O     . GLY A 1 330 ? 23.520 8.445   11.084  1.00 46.06 ? 327 GLY A O     1 
ATOM   2558 N  N     . LYS A 1 331 ? 24.314 10.176  12.217  1.00 45.52 ? 328 LYS A N     1 
ATOM   2559 C  CA    . LYS A 1 331 ? 23.202 10.996  11.907  1.00 39.03 ? 328 LYS A CA    1 
ATOM   2560 C  C     . LYS A 1 331 ? 23.350 11.715  10.622  1.00 43.22 ? 328 LYS A C     1 
ATOM   2561 O  O     . LYS A 1 331 ? 22.437 12.352  10.209  1.00 45.06 ? 328 LYS A O     1 
ATOM   2562 C  CB    . LYS A 1 331 ? 22.876 11.905  13.082  1.00 51.16 ? 328 LYS A CB    1 
ATOM   2563 C  CG    . LYS A 1 331 ? 21.551 11.508  13.709  1.00 56.12 ? 328 LYS A CG    1 
ATOM   2564 C  CD    . LYS A 1 331 ? 21.467 11.842  15.192  1.00 58.12 ? 328 LYS A CD    1 
ATOM   2565 C  CE    . LYS A 1 331 ? 20.042 12.184  15.584  1.00 56.92 ? 328 LYS A CE    1 
ATOM   2566 N  NZ    . LYS A 1 331 ? 19.874 13.654  15.403  1.00 55.82 ? 328 LYS A NZ    1 
ATOM   2567 N  N     . THR A 1 332 ? 24.499 11.636  9.974   1.00 40.84 ? 329 THR A N     1 
ATOM   2568 C  CA    . THR A 1 332 ? 24.679 12.388  8.730   1.00 38.20 ? 329 THR A CA    1 
ATOM   2569 C  C     . THR A 1 332 ? 24.183 11.603  7.509   1.00 34.19 ? 329 THR A C     1 
ATOM   2570 O  O     . THR A 1 332 ? 24.320 12.066  6.375   1.00 30.98 ? 329 THR A O     1 
ATOM   2571 C  CB    . THR A 1 332 ? 26.158 12.776  8.491   1.00 36.13 ? 329 THR A CB    1 
ATOM   2572 O  OG1   . THR A 1 332 ? 26.921 11.607  8.169   1.00 34.51 ? 329 THR A OG1   1 
ATOM   2573 C  CG2   . THR A 1 332 ? 26.754 13.444  9.727   1.00 36.11 ? 329 THR A CG2   1 
ATOM   2574 N  N     . ALA A 1 333 ? 23.612 10.424  7.752   1.00 33.26 ? 330 ALA A N     1 
ATOM   2575 C  CA    . ALA A 1 333 ? 23.132 9.550   6.681   1.00 31.18 ? 330 ALA A CA    1 
ATOM   2576 C  C     . ALA A 1 333 ? 22.088 10.233  5.801   1.00 37.67 ? 330 ALA A C     1 
ATOM   2577 O  O     . ALA A 1 333 ? 21.204 10.934  6.292   1.00 39.33 ? 330 ALA A O     1 
ATOM   2578 C  CB    . ALA A 1 333 ? 22.570 8.268   7.266   1.00 32.17 ? 330 ALA A CB    1 
ATOM   2579 N  N     . LEU A 1 334 ? 22.192 10.008  4.497   1.00 30.08 ? 331 LEU A N     1 
ATOM   2580 C  CA    . LEU A 1 334 ? 21.377 10.713  3.516   1.00 29.55 ? 331 LEU A CA    1 
ATOM   2581 C  C     . LEU A 1 334 ? 19.938 10.194  3.512   1.00 31.96 ? 331 LEU A C     1 
ATOM   2582 O  O     . LEU A 1 334 ? 19.682 9.059   3.126   1.00 32.89 ? 331 LEU A O     1 
ATOM   2583 C  CB    . LEU A 1 334 ? 21.989 10.564  2.125   1.00 27.96 ? 331 LEU A CB    1 
ATOM   2584 C  CG    . LEU A 1 334 ? 23.496 10.793  2.067   1.00 24.35 ? 331 LEU A CG    1 
ATOM   2585 C  CD1   . LEU A 1 334 ? 23.978 10.635  0.638   1.00 23.93 ? 331 LEU A CD1   1 
ATOM   2586 C  CD2   . LEU A 1 334 ? 23.825 12.180  2.607   1.00 23.22 ? 331 LEU A CD2   1 
ATOM   2587 N  N     . ALA A 1 335 ? 19.001 11.035  3.933   1.00 37.76 ? 332 ALA A N     1 
ATOM   2588 C  CA    . ALA A 1 335 ? 17.622 10.589  4.092   1.00 34.59 ? 332 ALA A CA    1 
ATOM   2589 C  C     . ALA A 1 335 ? 16.677 11.275  3.110   1.00 38.51 ? 332 ALA A C     1 
ATOM   2590 O  O     . ALA A 1 335 ? 15.470 11.039  3.143   1.00 35.02 ? 332 ALA A O     1 
ATOM   2591 C  CB    . ALA A 1 335 ? 17.159 10.817  5.520   1.00 37.87 ? 332 ALA A CB    1 
ATOM   2592 N  N     . THR A 1 336 ? 17.222 12.125  2.246   1.00 30.96 ? 333 THR A N     1 
ATOM   2593 C  CA    . THR A 1 336 ? 16.423 12.778  1.217   1.00 33.70 ? 333 THR A CA    1 
ATOM   2594 C  C     . THR A 1 336 ? 16.996 12.552  -0.176  1.00 40.79 ? 333 THR A C     1 
ATOM   2595 O  O     . THR A 1 336 ? 18.210 12.444  -0.356  1.00 36.90 ? 333 THR A O     1 
ATOM   2596 C  CB    . THR A 1 336 ? 16.290 14.303  1.458   1.00 40.88 ? 333 THR A CB    1 
ATOM   2597 O  OG1   . THR A 1 336 ? 17.461 14.992  0.993   1.00 34.71 ? 333 THR A OG1   1 
ATOM   2598 C  CG2   . THR A 1 336 ? 16.062 14.599  2.931   1.00 37.96 ? 333 THR A CG2   1 
ATOM   2599 N  N     . ARG A 1 337 ? 16.106 12.483  -1.159  1.00 41.95 ? 334 ARG A N     1 
ATOM   2600 C  CA    . ARG A 1 337 ? 16.500 12.282  -2.546  1.00 41.74 ? 334 ARG A CA    1 
ATOM   2601 C  C     . ARG A 1 337 ? 17.478 13.364  -3.002  1.00 39.42 ? 334 ARG A C     1 
ATOM   2602 O  O     . ARG A 1 337 ? 18.476 13.071  -3.656  1.00 41.04 ? 334 ARG A O     1 
ATOM   2603 C  CB    . ARG A 1 337 ? 15.259 12.263  -3.445  1.00 49.45 ? 334 ARG A CB    1 
ATOM   2604 C  CG    . ARG A 1 337 ? 15.523 12.591  -4.901  1.00 49.81 ? 334 ARG A CG    1 
ATOM   2605 C  CD    . ARG A 1 337 ? 14.231 12.620  -5.702  1.00 53.88 ? 334 ARG A CD    1 
ATOM   2606 N  NE    . ARG A 1 337 ? 13.881 13.992  -6.060  1.00 55.47 ? 334 ARG A NE    1 
ATOM   2607 C  CZ    . ARG A 1 337 ? 12.705 14.366  -6.552  1.00 64.80 ? 334 ARG A CZ    1 
ATOM   2608 N  NH1   . ARG A 1 337 ? 11.752 13.467  -6.760  1.00 62.43 ? 334 ARG A NH1   1 
ATOM   2609 N  NH2   . ARG A 1 337 ? 12.482 15.643  -6.841  1.00 66.64 ? 334 ARG A NH2   1 
ATOM   2610 N  N     . GLU A 1 338 ? 17.199 14.611  -2.638  1.00 40.43 ? 335 GLU A N     1 
ATOM   2611 C  CA    . GLU A 1 338 ? 18.049 15.738  -3.025  1.00 39.24 ? 335 GLU A CA    1 
ATOM   2612 C  C     . GLU A 1 338 ? 19.443 15.658  -2.412  1.00 29.29 ? 335 GLU A C     1 
ATOM   2613 O  O     . GLU A 1 338 ? 20.424 16.071  -3.025  1.00 29.09 ? 335 GLU A O     1 
ATOM   2614 C  CB    . GLU A 1 338 ? 17.397 17.061  -2.629  1.00 37.61 ? 335 GLU A CB    1 
ATOM   2615 C  CG    . GLU A 1 338 ? 16.106 17.342  -3.367  1.00 50.17 ? 335 GLU A CG    1 
ATOM   2616 C  CD    . GLU A 1 338 ? 16.336 17.763  -4.806  1.00 54.79 ? 335 GLU A CD    1 
ATOM   2617 O  OE1   . GLU A 1 338 ? 17.509 17.860  -5.224  1.00 56.80 ? 335 GLU A OE1   1 
ATOM   2618 O  OE2   . GLU A 1 338 ? 15.340 17.983  -5.526  1.00 63.53 ? 335 GLU A OE2   1 
ATOM   2619 N  N     . GLN A 1 339 ? 19.519 15.147  -1.190  1.00 34.05 ? 336 GLN A N     1 
ATOM   2620 C  CA    . GLN A 1 339 ? 20.804 14.898  -0.552  1.00 32.14 ? 336 GLN A CA    1 
ATOM   2621 C  C     . GLN A 1 339 ? 21.605 13.897  -1.368  1.00 31.83 ? 336 GLN A C     1 
ATOM   2622 O  O     . GLN A 1 339 ? 22.776 14.123  -1.698  1.00 24.43 ? 336 GLN A O     1 
ATOM   2623 C  CB    . GLN A 1 339 ? 20.610 14.358  0.858   1.00 32.35 ? 336 GLN A CB    1 
ATOM   2624 C  CG    . GLN A 1 339 ? 20.921 15.327  1.959   1.00 32.24 ? 336 GLN A CG    1 
ATOM   2625 C  CD    . GLN A 1 339 ? 20.892 14.644  3.302   1.00 34.97 ? 336 GLN A CD    1 
ATOM   2626 O  OE1   . GLN A 1 339 ? 19.955 13.904  3.615   1.00 34.83 ? 336 GLN A OE1   1 
ATOM   2627 N  NE2   . GLN A 1 339 ? 21.924 14.868  4.100   1.00 34.60 ? 336 GLN A NE2   1 
ATOM   2628 N  N     . VAL A 1 340 ? 20.954 12.781  -1.672  1.00 31.13 ? 337 VAL A N     1 
ATOM   2629 C  CA    . VAL A 1 340 ? 21.572 11.698  -2.418  1.00 27.57 ? 337 VAL A CA    1 
ATOM   2630 C  C     . VAL A 1 340 ? 22.094 12.213  -3.744  1.00 28.83 ? 337 VAL A C     1 
ATOM   2631 O  O     . VAL A 1 340 ? 23.218 11.907  -4.141  1.00 28.92 ? 337 VAL A O     1 
ATOM   2632 C  CB    . VAL A 1 340 ? 20.578 10.543  -2.659  1.00 29.57 ? 337 VAL A CB    1 
ATOM   2633 C  CG1   . VAL A 1 340 ? 21.173 9.502   -3.604  1.00 23.62 ? 337 VAL A CG1   1 
ATOM   2634 C  CG2   . VAL A 1 340 ? 20.194 9.902   -1.342  1.00 27.26 ? 337 VAL A CG2   1 
ATOM   2635 N  N     . GLN A 1 341 ? 21.286 13.019  -4.417  1.00 29.15 ? 338 GLN A N     1 
ATOM   2636 C  CA    . GLN A 1 341 ? 21.653 13.524  -5.728  1.00 25.51 ? 338 GLN A CA    1 
ATOM   2637 C  C     . GLN A 1 341 ? 22.783 14.540  -5.653  1.00 30.31 ? 338 GLN A C     1 
ATOM   2638 O  O     . GLN A 1 341 ? 23.626 14.606  -6.548  1.00 27.70 ? 338 GLN A O     1 
ATOM   2639 C  CB    . GLN A 1 341 ? 20.439 14.132  -6.424  1.00 34.09 ? 338 GLN A CB    1 
ATOM   2640 C  CG    . GLN A 1 341 ? 19.438 13.081  -6.867  1.00 35.85 ? 338 GLN A CG    1 
ATOM   2641 C  CD    . GLN A 1 341 ? 18.153 13.678  -7.406  1.00 40.81 ? 338 GLN A CD    1 
ATOM   2642 O  OE1   . GLN A 1 341 ? 17.941 14.889  -7.349  1.00 45.98 ? 338 GLN A OE1   1 
ATOM   2643 N  NE2   . GLN A 1 341 ? 17.290 12.823  -7.944  1.00 45.97 ? 338 GLN A NE2   1 
ATOM   2644 N  N     . TRP A 1 342 ? 22.810 15.331  -4.586  1.00 25.60 ? 339 TRP A N     1 
ATOM   2645 C  CA    . TRP A 1 342 ? 23.863 16.323  -4.444  1.00 22.90 ? 339 TRP A CA    1 
ATOM   2646 C  C     . TRP A 1 342 ? 25.211 15.627  -4.227  1.00 20.01 ? 339 TRP A C     1 
ATOM   2647 O  O     . TRP A 1 342 ? 26.211 16.005  -4.833  1.00 20.71 ? 339 TRP A O     1 
ATOM   2648 C  CB    . TRP A 1 342 ? 23.552 17.291  -3.294  1.00 22.57 ? 339 TRP A CB    1 
ATOM   2649 C  CG    . TRP A 1 342 ? 24.517 18.442  -3.215  1.00 24.66 ? 339 TRP A CG    1 
ATOM   2650 C  CD1   . TRP A 1 342 ? 24.486 19.589  -3.950  1.00 28.52 ? 339 TRP A CD1   1 
ATOM   2651 C  CD2   . TRP A 1 342 ? 25.662 18.539  -2.367  1.00 25.76 ? 339 TRP A CD2   1 
ATOM   2652 N  NE1   . TRP A 1 342 ? 25.536 20.399  -3.608  1.00 31.66 ? 339 TRP A NE1   1 
ATOM   2653 C  CE2   . TRP A 1 342 ? 26.273 19.779  -2.634  1.00 26.84 ? 339 TRP A CE2   1 
ATOM   2654 C  CE3   . TRP A 1 342 ? 26.223 17.702  -1.401  1.00 26.68 ? 339 TRP A CE3   1 
ATOM   2655 C  CZ2   . TRP A 1 342 ? 27.429 20.200  -1.976  1.00 29.24 ? 339 TRP A CZ2   1 
ATOM   2656 C  CZ3   . TRP A 1 342 ? 27.366 18.125  -0.739  1.00 24.81 ? 339 TRP A CZ3   1 
ATOM   2657 C  CH2   . TRP A 1 342 ? 27.960 19.359  -1.034  1.00 24.99 ? 339 TRP A CH2   1 
ATOM   2658 N  N     . TRP A 1 343 ? 25.226 14.606  -3.382  1.00 22.52 ? 340 TRP A N     1 
ATOM   2659 C  CA    . TRP A 1 343 ? 26.475 13.909  -3.084  1.00 17.71 ? 340 TRP A CA    1 
ATOM   2660 C  C     . TRP A 1 343 ? 26.933 13.040  -4.250  1.00 22.25 ? 340 TRP A C     1 
ATOM   2661 O  O     . TRP A 1 343 ? 28.132 12.919  -4.492  1.00 20.48 ? 340 TRP A O     1 
ATOM   2662 C  CB    . TRP A 1 343 ? 26.339 13.075  -1.817  1.00 20.11 ? 340 TRP A CB    1 
ATOM   2663 C  CG    . TRP A 1 343 ? 26.477 13.920  -0.593  1.00 19.66 ? 340 TRP A CG    1 
ATOM   2664 C  CD1   . TRP A 1 343 ? 25.490 14.283  0.277   1.00 27.59 ? 340 TRP A CD1   1 
ATOM   2665 C  CD2   . TRP A 1 343 ? 27.678 14.541  -0.125  1.00 18.35 ? 340 TRP A CD2   1 
ATOM   2666 N  NE1   . TRP A 1 343 ? 26.013 15.082  1.273   1.00 24.18 ? 340 TRP A NE1   1 
ATOM   2667 C  CE2   . TRP A 1 343 ? 27.353 15.250  1.048   1.00 22.83 ? 340 TRP A CE2   1 
ATOM   2668 C  CE3   . TRP A 1 343 ? 29.003 14.551  -0.577  1.00 19.42 ? 340 TRP A CE3   1 
ATOM   2669 C  CZ2   . TRP A 1 343 ? 28.305 15.965  1.775   1.00 20.58 ? 340 TRP A CZ2   1 
ATOM   2670 C  CZ3   . TRP A 1 343 ? 29.942 15.266  0.142   1.00 20.98 ? 340 TRP A CZ3   1 
ATOM   2671 C  CH2   . TRP A 1 343 ? 29.589 15.961  1.306   1.00 25.84 ? 340 TRP A CH2   1 
ATOM   2672 N  N     . LEU A 1 344 ? 25.991 12.462  -4.991  1.00 18.65 ? 341 LEU A N     1 
ATOM   2673 C  CA    . LEU A 1 344 ? 26.381 11.709  -6.181  1.00 20.74 ? 341 LEU A CA    1 
ATOM   2674 C  C     . LEU A 1 344 ? 27.077 12.646  -7.154  1.00 19.21 ? 341 LEU A C     1 
ATOM   2675 O  O     . LEU A 1 344 ? 28.071 12.279  -7.795  1.00 20.61 ? 341 LEU A O     1 
ATOM   2676 C  CB    . LEU A 1 344 ? 25.174 11.042  -6.847  1.00 18.15 ? 341 LEU A CB    1 
ATOM   2677 C  CG    . LEU A 1 344 ? 24.643 9.769   -6.189  1.00 26.18 ? 341 LEU A CG    1 
ATOM   2678 C  CD1   . LEU A 1 344 ? 23.389 9.302   -6.911  1.00 26.34 ? 341 LEU A CD1   1 
ATOM   2679 C  CD2   . LEU A 1 344 ? 25.692 8.653   -6.161  1.00 24.26 ? 341 LEU A CD2   1 
ATOM   2680 N  N     . LEU A 1 345 ? 26.583 13.874  -7.250  1.00 20.22 ? 342 LEU A N     1 
ATOM   2681 C  CA    . LEU A 1 345 ? 27.200 14.847  -8.127  1.00 15.95 ? 342 LEU A CA    1 
ATOM   2682 C  C     . LEU A 1 345 ? 28.598 15.241  -7.642  1.00 18.17 ? 342 LEU A C     1 
ATOM   2683 O  O     . LEU A 1 345 ? 29.522 15.365  -8.443  1.00 19.28 ? 342 LEU A O     1 
ATOM   2684 C  CB    . LEU A 1 345 ? 26.315 16.094  -8.266  1.00 19.32 ? 342 LEU A CB    1 
ATOM   2685 C  CG    . LEU A 1 345 ? 26.870 17.213  -9.144  1.00 21.12 ? 342 LEU A CG    1 
ATOM   2686 C  CD1   . LEU A 1 345 ? 27.166 16.721  -10.573 1.00 22.06 ? 342 LEU A CD1   1 
ATOM   2687 C  CD2   . LEU A 1 345 ? 25.906 18.394  -9.179  1.00 28.94 ? 342 LEU A CD2   1 
ATOM   2688 N  N     . GLN A 1 346 ? 28.759 15.428  -6.337  1.00 17.17 ? 343 GLN A N     1 
ATOM   2689 C  CA    . GLN A 1 346 ? 30.073 15.792  -5.805  1.00 16.63 ? 343 GLN A CA    1 
ATOM   2690 C  C     . GLN A 1 346 ? 31.107 14.712  -6.135  1.00 15.21 ? 343 GLN A C     1 
ATOM   2691 O  O     . GLN A 1 346 ? 32.200 15.021  -6.608  1.00 16.33 ? 343 GLN A O     1 
ATOM   2692 C  CB    . GLN A 1 346 ? 30.030 16.000  -4.289  1.00 22.29 ? 343 GLN A CB    1 
ATOM   2693 C  CG    . GLN A 1 346 ? 29.089 17.113  -3.819  1.00 18.81 ? 343 GLN A CG    1 
ATOM   2694 C  CD    . GLN A 1 346 ? 29.077 18.324  -4.729  1.00 20.87 ? 343 GLN A CD    1 
ATOM   2695 O  OE1   . GLN A 1 346 ? 30.040 19.098  -4.790  1.00 23.93 ? 343 GLN A OE1   1 
ATOM   2696 N  NE2   . GLN A 1 346 ? 27.971 18.501  -5.448  1.00 22.24 ? 343 GLN A NE2   1 
ATOM   2697 N  N     . LEU A 1 347 ? 30.744 13.465  -5.857  1.00 16.31 ? 344 LEU A N     1 
ATOM   2698 C  CA    . LEU A 1 347 ? 31.595 12.319  -6.173  1.00 15.38 ? 344 LEU A CA    1 
ATOM   2699 C  C     . LEU A 1 347 ? 31.880 12.253  -7.670  1.00 17.36 ? 344 LEU A C     1 
ATOM   2700 O  O     . LEU A 1 347 ? 33.015 12.000  -8.074  1.00 15.65 ? 344 LEU A O     1 
ATOM   2701 C  CB    . LEU A 1 347 ? 30.949 11.013  -5.702  1.00 14.97 ? 344 LEU A CB    1 
ATOM   2702 C  CG    . LEU A 1 347 ? 30.947 10.711  -4.203  1.00 24.50 ? 344 LEU A CG    1 
ATOM   2703 C  CD1   . LEU A 1 347 ? 30.289 9.377   -3.909  1.00 24.21 ? 344 LEU A CD1   1 
ATOM   2704 C  CD2   . LEU A 1 347 ? 32.344 10.686  -3.707  1.00 25.42 ? 344 LEU A CD2   1 
ATOM   2705 N  N     . ALA A 1 348 ? 30.859 12.498  -8.493  1.00 17.04 ? 345 ALA A N     1 
ATOM   2706 C  CA    . ALA A 1 348 ? 31.022 12.383  -9.941  1.00 15.69 ? 345 ALA A CA    1 
ATOM   2707 C  C     . ALA A 1 348 ? 31.923 13.479  -10.485 1.00 12.92 ? 345 ALA A C     1 
ATOM   2708 O  O     . ALA A 1 348 ? 32.621 13.293  -11.479 1.00 16.89 ? 345 ALA A O     1 
ATOM   2709 C  CB    . ALA A 1 348 ? 29.665 12.435  -10.640 1.00 14.81 ? 345 ALA A CB    1 
ATOM   2710 N  N     . GLN A 1 349 ? 31.878 14.646  -9.848  1.00 15.84 ? 346 GLN A N     1 
ATOM   2711 C  CA    . GLN A 1 349 ? 32.713 15.745  -10.272 1.00 15.80 ? 346 GLN A CA    1 
ATOM   2712 C  C     . GLN A 1 349 ? 34.181 15.472  -9.941  1.00 14.60 ? 346 GLN A C     1 
ATOM   2713 O  O     . GLN A 1 349 ? 35.057 15.788  -10.738 1.00 16.26 ? 346 GLN A O     1 
ATOM   2714 C  CB    . GLN A 1 349 ? 32.245 17.053  -9.635  1.00 18.62 ? 346 GLN A CB    1 
ATOM   2715 C  CG    . GLN A 1 349 ? 31.015 17.644  -10.338 1.00 22.32 ? 346 GLN A CG    1 
ATOM   2716 C  CD    . GLN A 1 349 ? 30.444 18.850  -9.609  1.00 30.73 ? 346 GLN A CD    1 
ATOM   2717 O  OE1   . GLN A 1 349 ? 30.890 19.198  -8.519  1.00 35.49 ? 346 GLN A OE1   1 
ATOM   2718 N  NE2   . GLN A 1 349 ? 29.457 19.496  -10.217 1.00 40.70 ? 346 GLN A NE2   1 
ATOM   2719 N  N     . GLU A 1 350 ? 34.445 14.872  -8.783  1.00 16.85 ? 347 GLU A N     1 
ATOM   2720 C  CA    . GLU A 1 350 ? 35.825 14.500  -8.486  1.00 16.75 ? 347 GLU A CA    1 
ATOM   2721 C  C     . GLU A 1 350 ? 36.265 13.398  -9.445  1.00 14.24 ? 347 GLU A C     1 
ATOM   2722 O  O     . GLU A 1 350 ? 37.376 13.443  -9.964  1.00 17.08 ? 347 GLU A O     1 
ATOM   2723 C  CB    . GLU A 1 350 ? 36.019 14.037  -7.038  1.00 15.90 ? 347 GLU A CB    1 
ATOM   2724 C  CG    . GLU A 1 350 ? 37.487 13.623  -6.796  1.00 18.24 ? 347 GLU A CG    1 
ATOM   2725 C  CD    . GLU A 1 350 ? 37.754 13.020  -5.424  1.00 22.97 ? 347 GLU A CD    1 
ATOM   2726 O  OE1   . GLU A 1 350 ? 37.116 13.439  -4.438  1.00 22.26 ? 347 GLU A OE1   1 
ATOM   2727 O  OE2   . GLU A 1 350 ? 38.609 12.116  -5.333  1.00 17.81 ? 347 GLU A OE2   1 
ATOM   2728 N  N     . LEU A 1 351 ? 35.394 12.420  -9.669  1.00 14.31 ? 348 LEU A N     1 
ATOM   2729 C  CA    . LEU A 1 351 ? 35.697 11.321  -10.579 1.00 15.88 ? 348 LEU A CA    1 
ATOM   2730 C  C     . LEU A 1 351 ? 35.997 11.836  -11.987 1.00 15.65 ? 348 LEU A C     1 
ATOM   2731 O  O     . LEU A 1 351 ? 36.970 11.419  -12.608 1.00 16.80 ? 348 LEU A O     1 
ATOM   2732 C  CB    . LEU A 1 351 ? 34.547 10.320  -10.612 1.00 16.07 ? 348 LEU A CB    1 
ATOM   2733 C  CG    . LEU A 1 351 ? 34.835 9.010   -11.360 1.00 18.49 ? 348 LEU A CG    1 
ATOM   2734 C  CD1   . LEU A 1 351 ? 36.076 8.322   -10.775 1.00 21.52 ? 348 LEU A CD1   1 
ATOM   2735 C  CD2   . LEU A 1 351 ? 33.635 8.073   -11.323 1.00 17.70 ? 348 LEU A CD2   1 
ATOM   2736 N  N     . GLU A 1 352 ? 35.174 12.754  -12.495 1.00 15.89 ? 349 GLU A N     1 
ATOM   2737 C  CA    . GLU A 1 352 ? 35.414 13.305  -13.827 1.00 16.24 ? 349 GLU A CA    1 
ATOM   2738 C  C     . GLU A 1 352 ? 36.771 13.983  -13.914 1.00 15.35 ? 349 GLU A C     1 
ATOM   2739 O  O     . GLU A 1 352 ? 37.491 13.845  -14.900 1.00 16.81 ? 349 GLU A O     1 
ATOM   2740 C  CB    . GLU A 1 352 ? 34.329 14.317  -14.215 1.00 20.12 ? 349 GLU A CB    1 
ATOM   2741 C  CG    . GLU A 1 352 ? 34.683 15.088  -15.484 1.00 22.39 ? 349 GLU A CG    1 
ATOM   2742 C  CD    . GLU A 1 352 ? 33.630 16.111  -15.888 1.00 36.23 ? 349 GLU A CD    1 
ATOM   2743 O  OE1   . GLU A 1 352 ? 33.910 16.924  -16.792 1.00 40.56 ? 349 GLU A OE1   1 
ATOM   2744 O  OE2   . GLU A 1 352 ? 32.524 16.104  -15.311 1.00 31.88 ? 349 GLU A OE2   1 
ATOM   2745 N  N     . GLU A 1 353 ? 37.124 14.716  -12.864 1.00 17.58 ? 350 GLU A N     1 
ATOM   2746 C  CA    . GLU A 1 353 ? 38.389 15.426  -12.822 1.00 15.69 ? 350 GLU A CA    1 
ATOM   2747 C  C     . GLU A 1 353 ? 39.549 14.442  -12.933 1.00 18.77 ? 350 GLU A C     1 
ATOM   2748 O  O     . GLU A 1 353 ? 40.468 14.601  -13.741 1.00 17.79 ? 350 GLU A O     1 
ATOM   2749 C  CB    . GLU A 1 353 ? 38.490 16.226  -11.524 1.00 21.12 ? 350 GLU A CB    1 
ATOM   2750 C  CG    . GLU A 1 353 ? 39.668 17.167  -11.432 1.00 31.26 ? 350 GLU A CG    1 
ATOM   2751 C  CD    . GLU A 1 353 ? 39.495 18.167  -10.297 1.00 39.27 ? 350 GLU A CD    1 
ATOM   2752 O  OE1   . GLU A 1 353 ? 39.295 17.723  -9.145  1.00 44.32 ? 350 GLU A OE1   1 
ATOM   2753 O  OE2   . GLU A 1 353 ? 39.538 19.389  -10.559 1.00 46.27 ? 350 GLU A OE2   1 
ATOM   2754 N  N     . ARG A 1 354 ? 39.480 13.404  -12.116 1.00 15.91 ? 351 ARG A N     1 
ATOM   2755 C  CA    . ARG A 1 354 ? 40.547 12.423  -12.096 1.00 15.74 ? 351 ARG A CA    1 
ATOM   2756 C  C     . ARG A 1 354 ? 40.575 11.626  -13.387 1.00 15.64 ? 351 ARG A C     1 
ATOM   2757 O  O     . ARG A 1 354 ? 41.649 11.320  -13.883 1.00 15.27 ? 351 ARG A O     1 
ATOM   2758 C  CB    . ARG A 1 354 ? 40.403 11.514  -10.875 1.00 15.79 ? 351 ARG A CB    1 
ATOM   2759 C  CG    . ARG A 1 354 ? 40.773 12.244  -9.586  1.00 15.65 ? 351 ARG A CG    1 
ATOM   2760 C  CD    . ARG A 1 354 ? 40.329 11.495  -8.359  1.00 17.83 ? 351 ARG A CD    1 
ATOM   2761 N  NE    . ARG A 1 354 ? 40.836 10.130  -8.305  1.00 16.85 ? 351 ARG A NE    1 
ATOM   2762 C  CZ    . ARG A 1 354 ? 40.383 9.220   -7.450  1.00 18.79 ? 351 ARG A CZ    1 
ATOM   2763 N  NH1   . ARG A 1 354 ? 39.425 9.537   -6.570  1.00 16.82 ? 351 ARG A NH1   1 
ATOM   2764 N  NH2   . ARG A 1 354 ? 40.886 7.998   -7.472  1.00 16.76 ? 351 ARG A NH2   1 
ATOM   2765 N  N     . LEU A 1 355 ? 39.404 11.309  -13.937 1.00 15.23 ? 352 LEU A N     1 
ATOM   2766 C  CA    . LEU A 1 355 ? 39.326 10.554  -15.187 1.00 16.30 ? 352 LEU A CA    1 
ATOM   2767 C  C     . LEU A 1 355 ? 39.894 11.358  -16.350 1.00 18.91 ? 352 LEU A C     1 
ATOM   2768 O  O     . LEU A 1 355 ? 40.607 10.817  -17.189 1.00 17.30 ? 352 LEU A O     1 
ATOM   2769 C  CB    . LEU A 1 355 ? 37.888 10.161  -15.491 1.00 15.40 ? 352 LEU A CB    1 
ATOM   2770 C  CG    . LEU A 1 355 ? 37.328 8.967   -14.734 1.00 18.37 ? 352 LEU A CG    1 
ATOM   2771 C  CD1   . LEU A 1 355 ? 35.869 8.762   -15.078 1.00 18.62 ? 352 LEU A CD1   1 
ATOM   2772 C  CD2   . LEU A 1 355 ? 38.124 7.714   -15.065 1.00 17.82 ? 352 LEU A CD2   1 
ATOM   2773 N  N     . THR A 1 356 ? 39.569 12.648  -16.412 1.00 16.58 ? 353 THR A N     1 
ATOM   2774 C  CA    . THR A 1 356 ? 40.045 13.466  -17.521 1.00 17.87 ? 353 THR A CA    1 
ATOM   2775 C  C     . THR A 1 356 ? 41.560 13.586  -17.479 1.00 18.61 ? 353 THR A C     1 
ATOM   2776 O  O     . THR A 1 356 ? 42.228 13.464  -18.504 1.00 19.65 ? 353 THR A O     1 
ATOM   2777 C  CB    . THR A 1 356 ? 39.385 14.856  -17.516 1.00 21.70 ? 353 THR A CB    1 
ATOM   2778 O  OG1   . THR A 1 356 ? 37.984 14.694  -17.758 1.00 23.12 ? 353 THR A OG1   1 
ATOM   2779 C  CG2   . THR A 1 356 ? 39.966 15.732  -18.594 1.00 22.96 ? 353 THR A CG2   1 
ATOM   2780 N  N     . LYS A 1 357 ? 42.113 13.785  -16.290 1.00 16.61 ? 354 LYS A N     1 
ATOM   2781 C  CA    . LYS A 1 357 ? 43.562 13.807  -16.162 1.00 14.25 ? 354 LYS A CA    1 
ATOM   2782 C  C     . LYS A 1 357 ? 44.170 12.451  -16.539 1.00 15.87 ? 354 LYS A C     1 
ATOM   2783 O  O     . LYS A 1 357 ? 45.207 12.390  -17.207 1.00 18.51 ? 354 LYS A O     1 
ATOM   2784 C  CB    . LYS A 1 357 ? 43.971 14.192  -14.741 1.00 19.66 ? 354 LYS A CB    1 
ATOM   2785 C  CG    . LYS A 1 357 ? 45.472 14.310  -14.579 1.00 25.15 ? 354 LYS A CG    1 
ATOM   2786 C  CD    . LYS A 1 357 ? 45.830 15.338  -13.515 1.00 38.47 ? 354 LYS A CD    1 
ATOM   2787 C  CE    . LYS A 1 357 ? 47.242 15.855  -13.733 1.00 38.87 ? 354 LYS A CE    1 
ATOM   2788 N  NZ    . LYS A 1 357 ? 48.199 14.728  -13.883 1.00 30.33 ? 354 LYS A NZ    1 
ATOM   2789 N  N     . ASP A 1 358 ? 43.527 11.368  -16.118 1.00 14.95 ? 355 ASP A N     1 
ATOM   2790 C  CA    . ASP A 1 358 ? 44.047 10.033  -16.419 1.00 17.18 ? 355 ASP A CA    1 
ATOM   2791 C  C     . ASP A 1 358 ? 44.085 9.791   -17.923 1.00 18.75 ? 355 ASP A C     1 
ATOM   2792 O  O     . ASP A 1 358 ? 45.055 9.239   -18.429 1.00 17.20 ? 355 ASP A O     1 
ATOM   2793 C  CB    . ASP A 1 358 ? 43.210 8.948   -15.732 1.00 16.76 ? 355 ASP A CB    1 
ATOM   2794 C  CG    . ASP A 1 358 ? 43.728 7.550   -16.012 1.00 19.08 ? 355 ASP A CG    1 
ATOM   2795 O  OD1   . ASP A 1 358 ? 44.717 7.143   -15.355 1.00 17.97 ? 355 ASP A OD1   1 
ATOM   2796 O  OD2   . ASP A 1 358 ? 43.146 6.858   -16.879 1.00 17.26 ? 355 ASP A OD2   1 
ATOM   2797 N  N     . ARG A 1 359 ? 43.036 10.214  -18.630 1.00 15.42 ? 356 ARG A N     1 
ATOM   2798 C  CA    . ARG A 1 359 ? 42.960 10.010  -20.078 1.00 17.86 ? 356 ARG A CA    1 
ATOM   2799 C  C     . ARG A 1 359 ? 44.093 10.751  -20.788 1.00 15.74 ? 356 ARG A C     1 
ATOM   2800 O  O     . ARG A 1 359 ? 44.738 10.211  -21.700 1.00 17.75 ? 356 ARG A O     1 
ATOM   2801 C  CB    . ARG A 1 359 ? 41.592 10.475  -20.609 1.00 17.82 ? 356 ARG A CB    1 
ATOM   2802 C  CG    . ARG A 1 359 ? 41.299 10.119  -22.076 1.00 17.35 ? 356 ARG A CG    1 
ATOM   2803 C  CD    . ARG A 1 359 ? 39.891 10.579  -22.462 1.00 22.75 ? 356 ARG A CD    1 
ATOM   2804 N  NE    . ARG A 1 359 ? 39.739 12.025  -22.318 1.00 28.02 ? 356 ARG A NE    1 
ATOM   2805 C  CZ    . ARG A 1 359 ? 38.575 12.668  -22.192 1.00 26.81 ? 356 ARG A CZ    1 
ATOM   2806 N  NH1   . ARG A 1 359 ? 37.424 12.002  -22.189 1.00 33.05 ? 356 ARG A NH1   1 
ATOM   2807 N  NH2   . ARG A 1 359 ? 38.569 13.990  -22.071 1.00 32.40 ? 356 ARG A NH2   1 
ATOM   2808 N  N     . ASN A 1 360 ? 44.352 11.981  -20.353 1.00 14.74 ? 357 ASN A N     1 
ATOM   2809 C  CA    . ASN A 1 360 ? 45.428 12.784  -20.922 1.00 13.61 ? 357 ASN A CA    1 
ATOM   2810 C  C     . ASN A 1 360 ? 46.814 12.221  -20.618 1.00 18.32 ? 357 ASN A C     1 
ATOM   2811 O  O     . ASN A 1 360 ? 47.692 12.233  -21.472 1.00 19.12 ? 357 ASN A O     1 
ATOM   2812 C  CB    . ASN A 1 360 ? 45.357 14.219  -20.412 1.00 17.37 ? 357 ASN A CB    1 
ATOM   2813 C  CG    . ASN A 1 360 ? 44.259 15.011  -21.070 1.00 21.83 ? 357 ASN A CG    1 
ATOM   2814 O  OD1   . ASN A 1 360 ? 43.911 14.766  -22.227 1.00 26.62 ? 357 ASN A OD1   1 
ATOM   2815 N  ND2   . ASN A 1 360 ? 43.737 16.002  -20.359 1.00 24.43 ? 357 ASN A ND2   1 
ATOM   2816 N  N     . ASP A 1 361 ? 47.001 11.731  -19.394 1.00 17.15 ? 358 ASP A N     1 
ATOM   2817 C  CA    . ASP A 1 361 ? 48.313 11.239  -18.975 1.00 19.60 ? 358 ASP A CA    1 
ATOM   2818 C  C     . ASP A 1 361 ? 48.640 9.864   -19.517 1.00 18.59 ? 358 ASP A C     1 
ATOM   2819 O  O     . ASP A 1 361 ? 49.796 9.576   -19.847 1.00 17.52 ? 358 ASP A O     1 
ATOM   2820 C  CB    . ASP A 1 361 ? 48.418 11.184  -17.444 1.00 17.26 ? 358 ASP A CB    1 
ATOM   2821 C  CG    . ASP A 1 361 ? 48.527 12.557  -16.811 1.00 32.09 ? 358 ASP A CG    1 
ATOM   2822 O  OD1   . ASP A 1 361 ? 48.768 13.544  -17.548 1.00 27.49 ? 358 ASP A OD1   1 
ATOM   2823 O  OD2   . ASP A 1 361 ? 48.393 12.636  -15.569 1.00 27.49 ? 358 ASP A OD2   1 
ATOM   2824 N  N     . ASN A 1 362 ? 47.629 9.008   -19.582 1.00 17.83 ? 359 ASN A N     1 
ATOM   2825 C  CA    . ASN A 1 362 ? 47.880 7.582   -19.707 1.00 16.44 ? 359 ASN A CA    1 
ATOM   2826 C  C     . ASN A 1 362 ? 47.263 6.929   -20.935 1.00 19.60 ? 359 ASN A C     1 
ATOM   2827 O  O     . ASN A 1 362 ? 47.353 5.720   -21.079 1.00 18.07 ? 359 ASN A O     1 
ATOM   2828 C  CB    . ASN A 1 362 ? 47.401 6.871   -18.425 1.00 16.31 ? 359 ASN A CB    1 
ATOM   2829 C  CG    . ASN A 1 362 ? 48.161 7.342   -17.178 1.00 16.40 ? 359 ASN A CG    1 
ATOM   2830 O  OD1   . ASN A 1 362 ? 49.380 7.502   -17.209 1.00 17.09 ? 359 ASN A OD1   1 
ATOM   2831 N  ND2   . ASN A 1 362 ? 47.436 7.564   -16.079 1.00 16.42 ? 359 ASN A ND2   1 
ATOM   2832 N  N     . ASP A 1 363 ? 46.665 7.724   -21.821 1.00 18.84 ? 360 ASP A N     1 
ATOM   2833 C  CA    . ASP A 1 363 ? 46.139 7.215   -23.097 1.00 19.35 ? 360 ASP A CA    1 
ATOM   2834 C  C     . ASP A 1 363 ? 45.199 6.042   -22.931 1.00 22.02 ? 360 ASP A C     1 
ATOM   2835 O  O     . ASP A 1 363 ? 45.380 4.979   -23.545 1.00 21.16 ? 360 ASP A O     1 
ATOM   2836 C  CB    . ASP A 1 363 ? 47.290 6.811   -24.016 1.00 24.67 ? 360 ASP A CB    1 
ATOM   2837 C  CG    . ASP A 1 363 ? 48.185 7.972   -24.343 1.00 28.18 ? 360 ASP A CG    1 
ATOM   2838 O  OD1   . ASP A 1 363 ? 47.641 9.023   -24.737 1.00 28.98 ? 360 ASP A OD1   1 
ATOM   2839 O  OD2   . ASP A 1 363 ? 49.418 7.838   -24.179 1.00 32.54 ? 360 ASP A OD2   1 
ATOM   2840 N  N     . ARG A 1 364 ? 44.193 6.226   -22.089 1.00 19.67 ? 361 ARG A N     1 
ATOM   2841 C  CA    . ARG A 1 364 ? 43.203 5.187   -21.882 1.00 20.04 ? 361 ARG A CA    1 
ATOM   2842 C  C     . ARG A 1 364 ? 41.889 5.811   -21.465 1.00 17.53 ? 361 ARG A C     1 
ATOM   2843 O  O     . ARG A 1 364 ? 41.860 6.958   -20.998 1.00 19.02 ? 361 ARG A O     1 
ATOM   2844 C  CB    . ARG A 1 364 ? 43.679 4.198   -20.825 1.00 20.47 ? 361 ARG A CB    1 
ATOM   2845 C  CG    . ARG A 1 364 ? 44.005 4.860   -19.491 1.00 16.86 ? 361 ARG A CG    1 
ATOM   2846 C  CD    . ARG A 1 364 ? 44.413 3.824   -18.478 1.00 15.78 ? 361 ARG A CD    1 
ATOM   2847 N  NE    . ARG A 1 364 ? 44.500 4.385   -17.139 1.00 16.85 ? 361 ARG A NE    1 
ATOM   2848 C  CZ    . ARG A 1 364 ? 44.757 3.669   -16.049 1.00 19.62 ? 361 ARG A CZ    1 
ATOM   2849 N  NH1   . ARG A 1 364 ? 44.809 4.264   -14.867 1.00 14.83 ? 361 ARG A NH1   1 
ATOM   2850 N  NH2   . ARG A 1 364 ? 44.946 2.367   -16.138 1.00 18.26 ? 361 ARG A NH2   1 
ATOM   2851 N  N     . VAL A 1 365 ? 40.815 5.052   -21.622 1.00 18.15 ? 362 VAL A N     1 
ATOM   2852 C  CA    . VAL A 1 365 ? 39.484 5.501   -21.233 1.00 19.86 ? 362 VAL A CA    1 
ATOM   2853 C  C     . VAL A 1 365 ? 38.735 4.399   -20.483 1.00 24.35 ? 362 VAL A C     1 
ATOM   2854 O  O     . VAL A 1 365 ? 38.723 3.235   -20.894 1.00 21.22 ? 362 VAL A O     1 
ATOM   2855 C  CB    . VAL A 1 365 ? 38.651 5.956   -22.468 1.00 22.79 ? 362 VAL A CB    1 
ATOM   2856 C  CG1   A VAL A 1 365 ? 39.221 7.222   -23.064 0.46 22.74 ? 362 VAL A CG1   1 
ATOM   2857 C  CG1   B VAL A 1 365 ? 38.684 4.896   -23.564 0.54 25.86 ? 362 VAL A CG1   1 
ATOM   2858 C  CG2   A VAL A 1 365 ? 38.588 4.853   -23.516 0.46 25.84 ? 362 VAL A CG2   1 
ATOM   2859 C  CG2   B VAL A 1 365 ? 37.229 6.313   -22.074 0.54 20.88 ? 362 VAL A CG2   1 
ATOM   2860 N  N     . ALA A 1 366 ? 38.133 4.765   -19.361 1.00 18.84 ? 363 ALA A N     1 
ATOM   2861 C  CA    . ALA A 1 366 ? 37.289 3.842   -18.617 1.00 18.96 ? 363 ALA A CA    1 
ATOM   2862 C  C     . ALA A 1 366 ? 35.958 3.620   -19.343 1.00 20.84 ? 363 ALA A C     1 
ATOM   2863 O  O     . ALA A 1 366 ? 35.414 4.550   -19.949 1.00 24.05 ? 363 ALA A O     1 
ATOM   2864 C  CB    . ALA A 1 366 ? 37.049 4.373   -17.215 1.00 20.09 ? 363 ALA A CB    1 
ATOM   2865 N  N     . THR A 1 367 ? 35.432 2.402   -19.296 1.00 19.03 ? 364 THR A N     1 
ATOM   2866 C  CA    . THR A 1 367 ? 34.199 2.111   -20.024 1.00 17.57 ? 364 THR A CA    1 
ATOM   2867 C  C     . THR A 1 367 ? 33.046 1.632   -19.158 1.00 18.88 ? 364 THR A C     1 
ATOM   2868 O  O     . THR A 1 367 ? 31.930 1.450   -19.648 1.00 20.33 ? 364 THR A O     1 
ATOM   2869 C  CB    . THR A 1 367 ? 34.437 1.053   -21.119 1.00 20.05 ? 364 THR A CB    1 
ATOM   2870 O  OG1   . THR A 1 367 ? 34.654 -0.228  -20.516 1.00 22.18 ? 364 THR A OG1   1 
ATOM   2871 C  CG2   . THR A 1 367 ? 35.655 1.445   -21.965 1.00 21.81 ? 364 THR A CG2   1 
ATOM   2872 N  N     . GLN A 1 368 ? 33.301 1.428   -17.872 1.00 19.80 ? 365 GLN A N     1 
ATOM   2873 C  CA    . GLN A 1 368 ? 32.269 0.921   -16.986 1.00 19.95 ? 365 GLN A CA    1 
ATOM   2874 C  C     . GLN A 1 368 ? 32.246 1.747   -15.711 1.00 19.25 ? 365 GLN A C     1 
ATOM   2875 O  O     . GLN A 1 368 ? 33.291 2.048   -15.149 1.00 21.68 ? 365 GLN A O     1 
ATOM   2876 C  CB    . GLN A 1 368 ? 32.508 -0.555  -16.668 1.00 24.47 ? 365 GLN A CB    1 
ATOM   2877 C  CG    . GLN A 1 368 ? 31.436 -1.196  -15.817 1.00 31.43 ? 365 GLN A CG    1 
ATOM   2878 C  CD    . GLN A 1 368 ? 31.668 -2.685  -15.622 1.00 35.59 ? 365 GLN A CD    1 
ATOM   2879 O  OE1   . GLN A 1 368 ? 32.471 -3.093  -14.783 1.00 44.88 ? 365 GLN A OE1   1 
ATOM   2880 N  NE2   . GLN A 1 368 ? 30.959 -3.502  -16.391 1.00 44.60 ? 365 GLN A NE2   1 
ATOM   2881 N  N     . LEU A 1 369 ? 31.049 2.127   -15.285 1.00 18.11 ? 366 LEU A N     1 
ATOM   2882 C  CA    . LEU A 1 369 ? 30.867 2.849   -14.026 1.00 21.91 ? 366 LEU A CA    1 
ATOM   2883 C  C     . LEU A 1 369 ? 30.237 1.918   -13.003 1.00 22.03 ? 366 LEU A C     1 
ATOM   2884 O  O     . LEU A 1 369 ? 29.183 1.327   -13.253 1.00 22.53 ? 366 LEU A O     1 
ATOM   2885 C  CB    . LEU A 1 369 ? 29.989 4.093   -14.229 1.00 18.11 ? 366 LEU A CB    1 
ATOM   2886 C  CG    . LEU A 1 369 ? 29.680 4.913   -12.973 1.00 22.30 ? 366 LEU A CG    1 
ATOM   2887 C  CD1   . LEU A 1 369 ? 30.898 5.746   -12.591 1.00 20.18 ? 366 LEU A CD1   1 
ATOM   2888 C  CD2   . LEU A 1 369 ? 28.444 5.798   -13.193 1.00 24.95 ? 366 LEU A CD2   1 
ATOM   2889 N  N     . VAL A 1 370 ? 30.887 1.762   -11.855 1.00 19.07 ? 367 VAL A N     1 
ATOM   2890 C  CA    . VAL A 1 370 ? 30.329 0.940   -10.790 1.00 17.32 ? 367 VAL A CA    1 
ATOM   2891 C  C     . VAL A 1 370 ? 29.792 1.838   -9.689  1.00 21.23 ? 367 VAL A C     1 
ATOM   2892 O  O     . VAL A 1 370 ? 30.488 2.743   -9.230  1.00 20.64 ? 367 VAL A O     1 
ATOM   2893 C  CB    . VAL A 1 370 ? 31.377 -0.027  -10.201 1.00 20.33 ? 367 VAL A CB    1 
ATOM   2894 C  CG1   . VAL A 1 370 ? 30.774 -0.827  -9.052  1.00 23.50 ? 367 VAL A CG1   1 
ATOM   2895 C  CG2   . VAL A 1 370 ? 31.907 -0.943  -11.290 1.00 23.88 ? 367 VAL A CG2   1 
ATOM   2896 N  N     . VAL A 1 371 ? 28.557 1.582   -9.275  1.00 18.97 ? 368 VAL A N     1 
ATOM   2897 C  CA    . VAL A 1 371 ? 27.907 2.377   -8.243  1.00 17.41 ? 368 VAL A CA    1 
ATOM   2898 C  C     . VAL A 1 371 ? 27.645 1.494   -7.039  1.00 23.43 ? 368 VAL A C     1 
ATOM   2899 O  O     . VAL A 1 371 ? 27.051 0.425   -7.164  1.00 23.46 ? 368 VAL A O     1 
ATOM   2900 C  CB    . VAL A 1 371 ? 26.587 2.987   -8.753  1.00 24.14 ? 368 VAL A CB    1 
ATOM   2901 C  CG1   . VAL A 1 371 ? 26.015 3.954   -7.731  1.00 22.12 ? 368 VAL A CG1   1 
ATOM   2902 C  CG2   . VAL A 1 371 ? 26.815 3.684   -10.091 1.00 21.66 ? 368 VAL A CG2   1 
ATOM   2903 N  N     . SER A 1 372 ? 28.109 1.918   -5.869  1.00 22.05 ? 369 SER A N     1 
ATOM   2904 C  CA    . SER A 1 372 ? 27.899 1.122   -4.677  1.00 22.13 ? 369 SER A CA    1 
ATOM   2905 C  C     . SER A 1 372 ? 27.351 1.996   -3.555  1.00 21.71 ? 369 SER A C     1 
ATOM   2906 O  O     . SER A 1 372 ? 27.713 3.167   -3.433  1.00 21.57 ? 369 SER A O     1 
ATOM   2907 C  CB    . SER A 1 372 ? 29.198 0.440   -4.247  1.00 24.50 ? 369 SER A CB    1 
ATOM   2908 O  OG    . SER A 1 372 ? 28.983 -0.419  -3.142  1.00 31.07 ? 369 SER A OG    1 
ATOM   2909 N  N     . ILE A 1 373 ? 26.435 1.437   -2.776  1.00 24.83 ? 370 ILE A N     1 
ATOM   2910 C  CA    . ILE A 1 373 ? 25.910 2.138   -1.612  1.00 26.98 ? 370 ILE A CA    1 
ATOM   2911 C  C     . ILE A 1 373 ? 25.872 1.226   -0.394  1.00 32.53 ? 370 ILE A C     1 
ATOM   2912 O  O     . ILE A 1 373 ? 25.968 0.000   -0.504  1.00 31.06 ? 370 ILE A O     1 
ATOM   2913 C  CB    . ILE A 1 373 ? 24.486 2.697   -1.855  1.00 28.65 ? 370 ILE A CB    1 
ATOM   2914 C  CG1   . ILE A 1 373 ? 23.483 1.557   -2.011  1.00 31.62 ? 370 ILE A CG1   1 
ATOM   2915 C  CG2   . ILE A 1 373 ? 24.454 3.618   -3.069  1.00 21.40 ? 370 ILE A CG2   1 
ATOM   2916 C  CD1   . ILE A 1 373 ? 22.123 2.026   -2.466  1.00 34.97 ? 370 ILE A CD1   1 
ATOM   2917 N  N     . ARG A 1 374 ? 25.748 1.845   0.775   1.00 26.88 ? 371 ARG A N     1 
ATOM   2918 C  CA    . ARG A 1 374 ? 25.494 1.117   2.002   1.00 34.33 ? 371 ARG A CA    1 
ATOM   2919 C  C     . ARG A 1 374 ? 24.238 1.699   2.612   1.00 32.12 ? 371 ARG A C     1 
ATOM   2920 O  O     . ARG A 1 374 ? 23.978 2.903   2.503   1.00 29.12 ? 371 ARG A O     1 
ATOM   2921 C  CB    . ARG A 1 374 ? 26.673 1.207   2.970   1.00 34.39 ? 371 ARG A CB    1 
ATOM   2922 C  CG    . ARG A 1 374 ? 26.600 0.278   4.183   1.00 37.08 ? 371 ARG A CG    1 
ATOM   2923 C  CD    . ARG A 1 374 ? 27.864 0.432   5.015   1.00 47.01 ? 371 ARG A CD    1 
ATOM   2924 N  NE    . ARG A 1 374 ? 27.867 -0.340  6.254   1.00 57.57 ? 371 ARG A NE    1 
ATOM   2925 C  CZ    . ARG A 1 374 ? 28.712 -0.110  7.257   1.00 58.90 ? 371 ARG A CZ    1 
ATOM   2926 N  NH1   . ARG A 1 374 ? 29.608 0.862   7.155   1.00 53.45 ? 371 ARG A NH1   1 
ATOM   2927 N  NH2   . ARG A 1 374 ? 28.663 -0.839  8.362   1.00 64.11 ? 371 ARG A NH2   1 
ATOM   2928 N  N     . VAL A 1 375 ? 23.416 0.863   3.223   1.00 38.97 ? 372 VAL A N     1 
ATOM   2929 C  CA    . VAL A 1 375 ? 22.192 1.355   3.854   1.00 41.33 ? 372 VAL A CA    1 
ATOM   2930 C  C     . VAL A 1 375 ? 22.299 1.141   5.344   1.00 36.40 ? 372 VAL A C     1 
ATOM   2931 O  O     . VAL A 1 375 ? 22.880 0.212   5.782   1.00 42.18 ? 372 VAL A O     1 
ATOM   2932 C  CB    . VAL A 1 375 ? 20.975 0.598   3.381   1.00 46.55 ? 372 VAL A CB    1 
ATOM   2933 C  CG1   . VAL A 1 375 ? 20.582 1.011   1.982   1.00 42.21 ? 372 VAL A CG1   1 
ATOM   2934 C  CG2   . VAL A 1 375 ? 21.312 -0.853  3.449   1.00 49.66 ? 372 VAL A CG2   1 
ATOM   2935 N  N     . GLN A 1 376 ? 21.738 2.039   6.102   1.00 41.54 ? 373 GLN A N     1 
ATOM   2936 C  CA    . GLN A 1 376 ? 21.913 2.016   7.526   1.00 46.82 ? 373 GLN A CA    1 
ATOM   2937 C  C     . GLN A 1 376 ? 21.419 0.685   8.037   1.00 47.69 ? 373 GLN A C     1 
ATOM   2938 O  O     . GLN A 1 376 ? 20.358 0.288   7.701   1.00 49.98 ? 373 GLN A O     1 
ATOM   2939 C  CB    . GLN A 1 376 ? 21.075 3.129   8.097   1.00 46.83 ? 373 GLN A CB    1 
ATOM   2940 C  CG    . GLN A 1 376 ? 21.310 3.431   9.559   1.00 53.11 ? 373 GLN A CG    1 
ATOM   2941 C  CD    . GLN A 1 376 ? 20.967 4.852   9.864   1.00 53.08 ? 373 GLN A CD    1 
ATOM   2942 O  OE1   . GLN A 1 376 ? 19.834 5.240   9.747   1.00 54.16 ? 373 GLN A OE1   1 
ATOM   2943 N  NE2   . GLN A 1 376 ? 21.975 5.652   10.208  1.00 62.02 ? 373 GLN A NE2   1 
ATOM   2944 N  N     . GLY A 1 377 ? 22.188 0.000   8.851   1.00 48.19 ? 374 GLY A N     1 
ATOM   2945 C  CA    . GLY A 1 377 ? 21.834 -1.341  9.276   1.00 53.63 ? 374 GLY A CA    1 
ATOM   2946 C  C     . GLY A 1 377 ? 22.882 -2.422  8.961   1.00 61.85 ? 374 GLY A C     1 
ATOM   2947 O  O     . GLY A 1 377 ? 23.314 -3.165  9.838   1.00 56.40 ? 374 GLY A O     1 
ATOM   2948 N  N     . ASP A 1 378 ? 23.330 -2.441  7.718   1.00 52.27 ? 375 ASP A N     1 
ATOM   2949 C  CA    . ASP A 1 378 ? 24.256 -3.405  7.241   1.00 54.96 ? 375 ASP A CA    1 
ATOM   2950 C  C     . ASP A 1 378 ? 25.649 -3.134  7.775   1.00 62.11 ? 375 ASP A C     1 
ATOM   2951 O  O     . ASP A 1 378 ? 26.071 -2.003  7.863   1.00 63.44 ? 375 ASP A O     1 
ATOM   2952 C  CB    . ASP A 1 378 ? 24.221 -3.367  5.717   1.00 55.52 ? 375 ASP A CB    1 
ATOM   2953 C  CG    . ASP A 1 378 ? 24.817 -4.606  5.077   1.00 55.80 ? 375 ASP A CG    1 
ATOM   2954 O  OD1   . ASP A 1 378 ? 25.656 -5.245  5.685   1.00 57.85 ? 375 ASP A OD1   1 
ATOM   2955 O  OD2   . ASP A 1 378 ? 24.462 -4.898  3.961   1.00 52.82 ? 375 ASP A OD2   1 
ATOM   2956 N  N     . LYS A 1 379 ? 26.420 -4.155  8.085   1.00 63.91 ? 376 LYS A N     1 
ATOM   2957 C  CA    . LYS A 1 379 ? 27.770 -3.828  8.540   1.00 67.48 ? 376 LYS A CA    1 
ATOM   2958 C  C     . LYS A 1 379 ? 28.770 -4.451  7.545   1.00 70.67 ? 376 LYS A C     1 
ATOM   2959 O  O     . LYS A 1 379 ? 29.990 -4.422  7.731   1.00 70.19 ? 376 LYS A O     1 
ATOM   2960 C  CB    . LYS A 1 379 ? 27.992 -4.252  10.017  1.00 71.95 ? 376 LYS A CB    1 
ATOM   2961 C  CG    . LYS A 1 379 ? 29.453 -4.476  10.477  1.00 74.73 ? 376 LYS A CG    1 
ATOM   2962 C  CD    . LYS A 1 379 ? 29.621 -5.102  11.867  1.00 77.19 ? 376 LYS A CD    1 
ATOM   2963 C  CE    . LYS A 1 379 ? 31.082 -4.994  12.321  1.00 68.61 ? 376 LYS A CE    1 
ATOM   2964 N  NZ    . LYS A 1 379 ? 31.312 -3.867  13.275  1.00 62.25 ? 376 LYS A NZ    1 
ATOM   2965 N  N     . ARG A 1 380 ? 28.244 -4.962  6.437   1.00 65.09 ? 377 ARG A N     1 
ATOM   2966 C  CA    . ARG A 1 380 ? 29.093 -5.184  5.272   1.00 64.79 ? 377 ARG A CA    1 
ATOM   2967 C  C     . ARG A 1 380 ? 29.513 -3.816  4.731   1.00 61.90 ? 377 ARG A C     1 
ATOM   2968 O  O     . ARG A 1 380 ? 28.752 -2.851  4.833   1.00 61.54 ? 377 ARG A O     1 
ATOM   2969 C  CB    . ARG A 1 380 ? 28.370 -5.996  4.197   1.00 60.21 ? 377 ARG A CB    1 
ATOM   2970 C  CG    . ARG A 1 380 ? 27.946 -7.385  4.647   1.00 60.71 ? 377 ARG A CG    1 
ATOM   2971 C  CD    . ARG A 1 380 ? 27.170 -8.095  3.556   1.00 52.92 ? 377 ARG A CD    1 
ATOM   2972 N  NE    . ARG A 1 380 ? 25.948 -7.381  3.195   1.00 52.14 ? 377 ARG A NE    1 
ATOM   2973 C  CZ    . ARG A 1 380 ? 25.198 -7.687  2.142   1.00 48.94 ? 377 ARG A CZ    1 
ATOM   2974 N  NH1   . ARG A 1 380 ? 25.552 -8.690  1.351   1.00 47.28 ? 377 ARG A NH1   1 
ATOM   2975 N  NH2   . ARG A 1 380 ? 24.099 -6.994  1.877   1.00 47.38 ? 377 ARG A NH2   1 
ATOM   2976 N  N     . LEU A 1 381 ? 30.721 -3.727  4.181   1.00 58.78 ? 378 LEU A N     1 
ATOM   2977 C  CA    . LEU A 1 381 ? 31.199 -2.473  3.606   1.00 56.20 ? 378 LEU A CA    1 
ATOM   2978 C  C     . LEU A 1 381 ? 30.224 -2.006  2.529   1.00 55.97 ? 378 LEU A C     1 
ATOM   2979 O  O     . LEU A 1 381 ? 29.740 -0.871  2.558   1.00 52.05 ? 378 LEU A O     1 
ATOM   2980 C  CB    . LEU A 1 381 ? 32.618 -2.637  3.037   1.00 55.83 ? 378 LEU A CB    1 
ATOM   2981 C  CG    . LEU A 1 381 ? 33.196 -1.585  2.075   1.00 54.84 ? 378 LEU A CG    1 
ATOM   2982 C  CD1   . LEU A 1 381 ? 34.680 -1.352  2.369   1.00 48.82 ? 378 LEU A CD1   1 
ATOM   2983 C  CD2   . LEU A 1 381 ? 33.015 -1.985  0.611   1.00 54.13 ? 378 LEU A CD2   1 
ATOM   2984 N  N     . SER A 1 382 ? 29.920 -2.899  1.594   1.00 55.89 ? 379 SER A N     1 
ATOM   2985 C  CA    . SER A 1 382 ? 28.954 -2.597  0.550   1.00 50.96 ? 379 SER A CA    1 
ATOM   2986 C  C     . SER A 1 382 ? 27.672 -3.381  0.760   1.00 47.46 ? 379 SER A C     1 
ATOM   2987 O  O     . SER A 1 382 ? 27.704 -4.568  1.089   1.00 49.43 ? 379 SER A O     1 
ATOM   2988 C  CB    . SER A 1 382 ? 29.527 -2.905  -0.834  1.00 43.13 ? 379 SER A CB    1 
ATOM   2989 O  OG    . SER A 1 382 ? 28.509 -2.841  -1.825  1.00 42.91 ? 379 SER A OG    1 
ATOM   2990 N  N     . SER A 1 383 ? 26.545 -2.707  0.564   1.00 41.37 ? 380 SER A N     1 
ATOM   2991 C  CA    . SER A 1 383 ? 25.243 -3.351  0.630   1.00 45.89 ? 380 SER A CA    1 
ATOM   2992 C  C     . SER A 1 383 ? 24.797 -3.769  -0.760  1.00 50.43 ? 380 SER A C     1 
ATOM   2993 O  O     . SER A 1 383 ? 24.127 -4.788  -0.927  1.00 47.06 ? 380 SER A O     1 
ATOM   2994 C  CB    . SER A 1 383 ? 24.204 -2.419  1.259   1.00 49.10 ? 380 SER A CB    1 
ATOM   2995 O  OG    . SER A 1 383 ? 24.568 -2.061  2.583   1.00 47.55 ? 380 SER A OG    1 
ATOM   2996 N  N     . LEU A 1 384 ? 25.181 -2.975  -1.757  1.00 44.89 ? 381 LEU A N     1 
ATOM   2997 C  CA    . LEU A 1 384 ? 24.758 -3.203  -3.133  1.00 40.03 ? 381 LEU A CA    1 
ATOM   2998 C  C     . LEU A 1 384 ? 25.736 -2.597  -4.130  1.00 39.08 ? 381 LEU A C     1 
ATOM   2999 O  O     . LEU A 1 384 ? 26.141 -1.446  -3.989  1.00 30.26 ? 381 LEU A O     1 
ATOM   3000 C  CB    . LEU A 1 384 ? 23.364 -2.621  -3.363  1.00 39.50 ? 381 LEU A CB    1 
ATOM   3001 C  CG    . LEU A 1 384 ? 22.863 -2.537  -4.807  1.00 41.06 ? 381 LEU A CG    1 
ATOM   3002 C  CD1   . LEU A 1 384 ? 21.443 -3.060  -4.904  1.00 49.56 ? 381 LEU A CD1   1 
ATOM   3003 C  CD2   . LEU A 1 384 ? 22.924 -1.108  -5.313  1.00 42.59 ? 381 LEU A CD2   1 
ATOM   3004 N  N     . ARG A 1 385 ? 26.092 -3.377  -5.145  1.00 36.82 ? 382 ARG A N     1 
ATOM   3005 C  CA    . ARG A 1 385 ? 27.018 -2.936  -6.178  1.00 26.82 ? 382 ARG A CA    1 
ATOM   3006 C  C     . ARG A 1 385 ? 26.379 -3.162  -7.547  1.00 28.59 ? 382 ARG A C     1 
ATOM   3007 O  O     . ARG A 1 385 ? 25.968 -4.279  -7.867  1.00 32.86 ? 382 ARG A O     1 
ATOM   3008 C  CB    . ARG A 1 385 ? 28.343 -3.700  -6.064  1.00 37.91 ? 382 ARG A CB    1 
ATOM   3009 C  CG    . ARG A 1 385 ? 29.595 -2.849  -6.196  1.00 40.50 ? 382 ARG A CG    1 
ATOM   3010 C  CD    . ARG A 1 385 ? 30.839 -3.654  -5.826  1.00 42.31 ? 382 ARG A CD    1 
ATOM   3011 N  NE    . ARG A 1 385 ? 32.042 -3.197  -6.523  1.00 43.88 ? 382 ARG A NE    1 
ATOM   3012 C  CZ    . ARG A 1 385 ? 32.900 -2.303  -6.038  1.00 41.88 ? 382 ARG A CZ    1 
ATOM   3013 N  NH1   . ARG A 1 385 ? 32.694 -1.758  -4.847  1.00 40.32 ? 382 ARG A NH1   1 
ATOM   3014 N  NH2   . ARG A 1 385 ? 33.968 -1.954  -6.745  1.00 40.70 ? 382 ARG A NH2   1 
ATOM   3015 N  N     . ARG A 1 386 ? 26.266 -2.104  -8.342  1.00 25.44 ? 383 ARG A N     1 
ATOM   3016 C  CA    . ARG A 1 386 ? 25.659 -2.210  -9.664  1.00 27.36 ? 383 ARG A CA    1 
ATOM   3017 C  C     . ARG A 1 386 ? 26.500 -1.492  -10.712 1.00 22.98 ? 383 ARG A C     1 
ATOM   3018 O  O     . ARG A 1 386 ? 27.004 -0.402  -10.465 1.00 22.75 ? 383 ARG A O     1 
ATOM   3019 C  CB    . ARG A 1 386 ? 24.246 -1.634  -9.645  1.00 27.63 ? 383 ARG A CB    1 
ATOM   3020 C  CG    . ARG A 1 386 ? 23.292 -2.375  -8.736  1.00 35.78 ? 383 ARG A CG    1 
ATOM   3021 C  CD    . ARG A 1 386 ? 22.706 -3.568  -9.449  1.00 32.33 ? 383 ARG A CD    1 
ATOM   3022 N  NE    . ARG A 1 386 ? 21.470 -4.022  -8.826  1.00 31.22 ? 383 ARG A NE    1 
ATOM   3023 C  CZ    . ARG A 1 386 ? 21.412 -4.946  -7.875  1.00 37.64 ? 383 ARG A CZ    1 
ATOM   3024 N  NH1   . ARG A 1 386 ? 22.526 -5.527  -7.443  1.00 38.68 ? 383 ARG A NH1   1 
ATOM   3025 N  NH2   . ARG A 1 386 ? 20.237 -5.300  -7.369  1.00 39.49 ? 383 ARG A NH2   1 
ATOM   3026 N  N     . CYS A 1 387 ? 26.660 -2.103  -11.882 1.00 26.24 ? 384 CYS A N     1 
ATOM   3027 C  CA    . CYS A 1 387 ? 27.420 -1.454  -12.949 1.00 28.69 ? 384 CYS A CA    1 
ATOM   3028 C  C     . CYS A 1 387 ? 26.508 -0.894  -14.027 1.00 31.28 ? 384 CYS A C     1 
ATOM   3029 O  O     . CYS A 1 387 ? 25.413 -1.410  -14.265 1.00 27.52 ? 384 CYS A O     1 
ATOM   3030 C  CB    . CYS A 1 387 ? 28.422 -2.429  -13.581 1.00 32.42 ? 384 CYS A CB    1 
ATOM   3031 S  SG    A CYS A 1 387 ? 27.683 -3.754  -14.584 0.65 29.62 ? 384 CYS A SG    1 
ATOM   3032 S  SG    B CYS A 1 387 ? 29.471 -3.291  -12.399 0.35 36.91 ? 384 CYS A SG    1 
ATOM   3033 N  N     . CYS A 1 388 ? 26.970 0.171   -14.673 1.00 25.45 ? 385 CYS A N     1 
ATOM   3034 C  CA    . CYS A 1 388 ? 26.324 0.684   -15.876 1.00 31.23 ? 385 CYS A CA    1 
ATOM   3035 C  C     . CYS A 1 388 ? 27.393 1.186   -16.845 1.00 28.59 ? 385 CYS A C     1 
ATOM   3036 O  O     . CYS A 1 388 ? 28.567 1.252   -16.494 1.00 24.89 ? 385 CYS A O     1 
ATOM   3037 C  CB    . CYS A 1 388 ? 25.329 1.788   -15.527 1.00 30.99 ? 385 CYS A CB    1 
ATOM   3038 S  SG    . CYS A 1 388 ? 26.078 3.323   -14.961 1.00 29.95 ? 385 CYS A SG    1 
ATOM   3039 N  N     . ALA A 1 389 ? 27.004 1.529   -18.068 1.00 27.77 ? 386 ALA A N     1 
ATOM   3040 C  CA    . ALA A 1 389 ? 28.000 1.940   -19.056 1.00 23.03 ? 386 ALA A CA    1 
ATOM   3041 C  C     . ALA A 1 389 ? 28.541 3.339   -18.769 1.00 25.48 ? 386 ALA A C     1 
ATOM   3042 O  O     . ALA A 1 389 ? 27.793 4.248   -18.407 1.00 29.17 ? 386 ALA A O     1 
ATOM   3043 C  CB    . ALA A 1 389 ? 27.413 1.874   -20.467 1.00 24.18 ? 386 ALA A CB    1 
ATOM   3044 N  N     . LEU A 1 390 ? 29.848 3.507   -18.922 1.00 20.81 ? 387 LEU A N     1 
ATOM   3045 C  CA    . LEU A 1 390 ? 30.470 4.817   -18.812 1.00 21.82 ? 387 LEU A CA    1 
ATOM   3046 C  C     . LEU A 1 390 ? 30.905 5.241   -20.205 1.00 21.36 ? 387 LEU A C     1 
ATOM   3047 O  O     . LEU A 1 390 ? 31.956 4.819   -20.685 1.00 25.33 ? 387 LEU A O     1 
ATOM   3048 C  CB    . LEU A 1 390 ? 31.665 4.782   -17.856 1.00 21.83 ? 387 LEU A CB    1 
ATOM   3049 C  CG    . LEU A 1 390 ? 32.056 6.051   -17.087 1.00 19.39 ? 387 LEU A CG    1 
ATOM   3050 C  CD1   . LEU A 1 390 ? 33.274 5.754   -16.219 1.00 18.93 ? 387 LEU A CD1   1 
ATOM   3051 C  CD2   . LEU A 1 390 ? 32.335 7.247   -17.976 1.00 25.42 ? 387 LEU A CD2   1 
ATOM   3052 N  N     . THR A 1 391 ? 30.094 6.073   -20.853 1.00 27.30 ? 388 THR A N     1 
ATOM   3053 C  CA    . THR A 1 391 ? 30.309 6.410   -22.255 1.00 29.83 ? 388 THR A CA    1 
ATOM   3054 C  C     . THR A 1 391 ? 30.875 7.816   -22.470 1.00 31.21 ? 388 THR A C     1 
ATOM   3055 O  O     . THR A 1 391 ? 31.440 8.108   -23.522 1.00 30.04 ? 388 THR A O     1 
ATOM   3056 C  CB    . THR A 1 391 ? 28.998 6.286   -23.056 1.00 35.51 ? 388 THR A CB    1 
ATOM   3057 O  OG1   . THR A 1 391 ? 28.049 7.239   -22.566 1.00 40.27 ? 388 THR A OG1   1 
ATOM   3058 C  CG2   . THR A 1 391 ? 28.416 4.876   -22.922 1.00 30.67 ? 388 THR A CG2   1 
ATOM   3059 N  N     . ARG A 1 392 ? 30.699 8.687   -21.482 1.00 28.22 ? 389 ARG A N     1 
ATOM   3060 C  CA    . ARG A 1 392 ? 31.260 10.035  -21.528 1.00 25.61 ? 389 ARG A CA    1 
ATOM   3061 C  C     . ARG A 1 392 ? 31.782 10.472  -20.174 1.00 21.37 ? 389 ARG A C     1 
ATOM   3062 O  O     . ARG A 1 392 ? 31.172 10.198  -19.149 1.00 27.04 ? 389 ARG A O     1 
ATOM   3063 C  CB    . ARG A 1 392 ? 30.225 11.051  -22.007 1.00 32.38 ? 389 ARG A CB    1 
ATOM   3064 C  CG    . ARG A 1 392 ? 30.004 11.027  -23.491 1.00 36.83 ? 389 ARG A CG    1 
ATOM   3065 C  CD    . ARG A 1 392 ? 28.855 11.921  -23.878 1.00 44.52 ? 389 ARG A CD    1 
ATOM   3066 N  NE    . ARG A 1 392 ? 28.330 11.539  -25.181 1.00 48.61 ? 389 ARG A NE    1 
ATOM   3067 C  CZ    . ARG A 1 392 ? 27.759 12.384  -26.030 1.00 39.93 ? 389 ARG A CZ    1 
ATOM   3068 N  NH1   . ARG A 1 392 ? 27.644 13.669  -25.716 1.00 40.67 ? 389 ARG A NH1   1 
ATOM   3069 N  NH2   . ARG A 1 392 ? 27.316 11.945  -27.197 1.00 36.65 ? 389 ARG A NH2   1 
ATOM   3070 N  N     . TYR A 1 393 ? 32.907 11.168  -20.190 1.00 25.69 ? 390 TYR A N     1 
ATOM   3071 C  CA    . TYR A 1 393 ? 33.464 11.750  -18.980 1.00 22.09 ? 390 TYR A CA    1 
ATOM   3072 C  C     . TYR A 1 393 ? 32.705 13.023  -18.628 1.00 29.44 ? 390 TYR A C     1 
ATOM   3073 O  O     . TYR A 1 393 ? 33.194 14.137  -18.840 1.00 28.44 ? 390 TYR A O     1 
ATOM   3074 C  CB    . TYR A 1 393 ? 34.948 12.041  -19.170 1.00 21.93 ? 390 TYR A CB    1 
ATOM   3075 C  CG    . TYR A 1 393 ? 35.836 10.819  -19.087 1.00 21.66 ? 390 TYR A CG    1 
ATOM   3076 C  CD1   . TYR A 1 393 ? 37.214 10.944  -19.143 1.00 21.88 ? 390 TYR A CD1   1 
ATOM   3077 C  CD2   . TYR A 1 393 ? 35.296 9.547   -18.937 1.00 26.18 ? 390 TYR A CD2   1 
ATOM   3078 C  CE1   . TYR A 1 393 ? 38.036 9.834   -19.053 1.00 17.23 ? 390 TYR A CE1   1 
ATOM   3079 C  CE2   . TYR A 1 393 ? 36.112 8.424   -18.847 1.00 24.92 ? 390 TYR A CE2   1 
ATOM   3080 C  CZ    . TYR A 1 393 ? 37.478 8.580   -18.911 1.00 23.94 ? 390 TYR A CZ    1 
ATOM   3081 O  OH    . TYR A 1 393 ? 38.298 7.478   -18.809 1.00 22.12 ? 390 TYR A OH    1 
ATOM   3082 N  N     . ASP A 1 394 ? 31.495 12.848  -18.112 1.00 23.83 ? 391 ASP A N     1 
ATOM   3083 C  CA    . ASP A 1 394 ? 30.672 13.980  -17.735 1.00 25.16 ? 391 ASP A CA    1 
ATOM   3084 C  C     . ASP A 1 394 ? 30.033 13.726  -16.387 1.00 18.89 ? 391 ASP A C     1 
ATOM   3085 O  O     . ASP A 1 394 ? 29.298 12.749  -16.209 1.00 22.52 ? 391 ASP A O     1 
ATOM   3086 C  CB    . ASP A 1 394 ? 29.600 14.246  -18.789 1.00 29.57 ? 391 ASP A CB    1 
ATOM   3087 C  CG    . ASP A 1 394 ? 28.771 15.454  -18.456 1.00 32.85 ? 391 ASP A CG    1 
ATOM   3088 O  OD1   . ASP A 1 394 ? 27.717 15.286  -17.812 1.00 30.65 ? 391 ASP A OD1   1 
ATOM   3089 O  OD2   . ASP A 1 394 ? 29.196 16.574  -18.806 1.00 41.15 ? 391 ASP A OD2   1 
ATOM   3090 N  N     . ALA A 1 395 ? 30.323 14.605  -15.432 1.00 20.27 ? 392 ALA A N     1 
ATOM   3091 C  CA    . ALA A 1 395 ? 29.874 14.408  -14.060 1.00 21.41 ? 392 ALA A CA    1 
ATOM   3092 C  C     . ALA A 1 395 ? 28.354 14.373  -13.905 1.00 20.27 ? 392 ALA A C     1 
ATOM   3093 O  O     . ALA A 1 395 ? 27.829 13.557  -13.153 1.00 19.99 ? 392 ALA A O     1 
ATOM   3094 C  CB    . ALA A 1 395 ? 30.468 15.488  -13.159 1.00 19.35 ? 392 ALA A CB    1 
ATOM   3095 N  N     . HIS A 1 396 ? 27.646 15.264  -14.594 1.00 25.77 ? 393 HIS A N     1 
ATOM   3096 C  CA    . HIS A 1 396 ? 26.190 15.284  -14.472 1.00 28.32 ? 393 HIS A CA    1 
ATOM   3097 C  C     . HIS A 1 396 ? 25.588 14.022  -15.070 1.00 19.09 ? 393 HIS A C     1 
ATOM   3098 O  O     . HIS A 1 396 ? 24.668 13.440  -14.496 1.00 23.92 ? 393 HIS A O     1 
ATOM   3099 C  CB    . HIS A 1 396 ? 25.600 16.541  -15.125 1.00 26.08 ? 393 HIS A CB    1 
ATOM   3100 C  CG    . HIS A 1 396 ? 25.873 17.798  -14.360 1.00 31.75 ? 393 HIS A CG    1 
ATOM   3101 N  ND1   . HIS A 1 396 ? 26.905 18.657  -14.676 1.00 37.38 ? 393 HIS A ND1   1 
ATOM   3102 C  CD2   . HIS A 1 396 ? 25.264 18.335  -13.274 1.00 32.14 ? 393 HIS A CD2   1 
ATOM   3103 C  CE1   . HIS A 1 396 ? 26.913 19.669  -13.828 1.00 31.35 ? 393 HIS A CE1   1 
ATOM   3104 N  NE2   . HIS A 1 396 ? 25.926 19.496  -12.965 1.00 35.63 ? 393 HIS A NE2   1 
ATOM   3105 N  N     . LYS A 1 397 ? 26.116 13.578  -16.206 1.00 21.54 ? 394 LYS A N     1 
ATOM   3106 C  CA    . LYS A 1 397 ? 25.668 12.304  -16.766 1.00 24.79 ? 394 LYS A CA    1 
ATOM   3107 C  C     . LYS A 1 397 ? 25.976 11.130  -15.844 1.00 22.62 ? 394 LYS A C     1 
ATOM   3108 O  O     . LYS A 1 397 ? 25.109 10.291  -15.589 1.00 24.53 ? 394 LYS A O     1 
ATOM   3109 C  CB    . LYS A 1 397 ? 26.287 12.046  -18.142 1.00 26.48 ? 394 LYS A CB    1 
ATOM   3110 C  CG    . LYS A 1 397 ? 26.075 10.603  -18.615 1.00 33.17 ? 394 LYS A CG    1 
ATOM   3111 C  CD    . LYS A 1 397 ? 26.425 10.406  -20.080 1.00 35.92 ? 394 LYS A CD    1 
ATOM   3112 C  CE    . LYS A 1 397 ? 26.137 8.970   -20.517 1.00 38.98 ? 394 LYS A CE    1 
ATOM   3113 N  NZ    . LYS A 1 397 ? 24.728 8.551   -20.241 1.00 44.14 ? 394 LYS A NZ    1 
ATOM   3114 N  N     . MET A 1 398 ? 27.204 11.063  -15.336 1.00 22.99 ? 395 MET A N     1 
ATOM   3115 C  CA    . MET A 1 398 ? 27.560 9.955   -14.461 1.00 22.59 ? 395 MET A CA    1 
ATOM   3116 C  C     . MET A 1 398 ? 26.716 9.945   -13.188 1.00 21.60 ? 395 MET A C     1 
ATOM   3117 O  O     . MET A 1 398 ? 26.272 8.890   -12.744 1.00 21.84 ? 395 MET A O     1 
ATOM   3118 C  CB    . MET A 1 398 ? 29.053 9.993   -14.114 1.00 22.72 ? 395 MET A CB    1 
ATOM   3119 C  CG    . MET A 1 398 ? 29.945 9.640   -15.287 1.00 19.44 ? 395 MET A CG    1 
ATOM   3120 S  SD    . MET A 1 398 ? 31.667 9.352   -14.804 1.00 25.89 ? 395 MET A SD    1 
ATOM   3121 C  CE    . MET A 1 398 ? 32.242 11.040  -14.636 1.00 26.56 ? 395 MET A CE    1 
ATOM   3122 N  N     . SER A 1 399 ? 26.469 11.116  -12.612 1.00 24.76 ? 396 SER A N     1 
ATOM   3123 C  CA    . SER A 1 399 ? 25.705 11.154  -11.367 1.00 23.28 ? 396 SER A CA    1 
ATOM   3124 C  C     . SER A 1 399 ? 24.230 10.835  -11.623 1.00 18.66 ? 396 SER A C     1 
ATOM   3125 O  O     . SER A 1 399 ? 23.565 10.226  -10.789 1.00 21.85 ? 396 SER A O     1 
ATOM   3126 C  CB    . SER A 1 399 ? 25.864 12.508  -10.662 1.00 23.04 ? 396 SER A CB    1 
ATOM   3127 O  OG    . SER A 1 399 ? 25.282 13.580  -11.385 1.00 25.74 ? 396 SER A OG    1 
ATOM   3128 N  N     . HIS A 1 400 ? 23.730 11.217  -12.791 1.00 24.52 ? 397 HIS A N     1 
ATOM   3129 C  CA    . HIS A 1 400 ? 22.362 10.863  -13.147 1.00 29.90 ? 397 HIS A CA    1 
ATOM   3130 C  C     . HIS A 1 400 ? 22.241 9.356   -13.372 1.00 26.10 ? 397 HIS A C     1 
ATOM   3131 O  O     . HIS A 1 400 ? 21.302 8.727   -12.903 1.00 30.08 ? 397 HIS A O     1 
ATOM   3132 C  CB    . HIS A 1 400 ? 21.909 11.631  -14.384 1.00 30.71 ? 397 HIS A CB    1 
ATOM   3133 C  CG    . HIS A 1 400 ? 20.506 11.323  -14.797 1.00 39.01 ? 397 HIS A CG    1 
ATOM   3134 N  ND1   . HIS A 1 400 ? 20.191 10.282  -15.644 1.00 41.24 ? 397 HIS A ND1   1 
ATOM   3135 C  CD2   . HIS A 1 400 ? 19.330 11.908  -14.467 1.00 43.55 ? 397 HIS A CD2   1 
ATOM   3136 C  CE1   . HIS A 1 400 ? 18.883 10.246  -15.828 1.00 44.77 ? 397 HIS A CE1   1 
ATOM   3137 N  NE2   . HIS A 1 400 ? 18.338 11.222  -15.124 1.00 41.52 ? 397 HIS A NE2   1 
ATOM   3138 N  N     . ASP A 1 401 ? 23.215 8.777   -14.069 1.00 30.26 ? 398 ASP A N     1 
ATOM   3139 C  CA    . ASP A 1 401 ? 23.241 7.333   -14.284 1.00 25.78 ? 398 ASP A CA    1 
ATOM   3140 C  C     . ASP A 1 401 ? 23.347 6.544   -12.990 1.00 28.01 ? 398 ASP A C     1 
ATOM   3141 O  O     . ASP A 1 401 ? 22.694 5.514   -12.838 1.00 31.81 ? 398 ASP A O     1 
ATOM   3142 C  CB    . ASP A 1 401 ? 24.395 6.945   -15.204 1.00 27.14 ? 398 ASP A CB    1 
ATOM   3143 C  CG    . ASP A 1 401 ? 24.192 7.428   -16.625 1.00 33.88 ? 398 ASP A CG    1 
ATOM   3144 O  OD1   . ASP A 1 401 ? 23.045 7.784   -16.975 1.00 32.81 ? 398 ASP A OD1   1 
ATOM   3145 O  OD2   . ASP A 1 401 ? 25.171 7.429   -17.398 1.00 29.20 ? 398 ASP A OD2   1 
ATOM   3146 N  N     . ALA A 1 402 ? 24.177 7.019   -12.062 1.00 23.98 ? 399 ALA A N     1 
ATOM   3147 C  CA    . ALA A 1 402 ? 24.322 6.365   -10.771 1.00 29.03 ? 399 ALA A CA    1 
ATOM   3148 C  C     . ALA A 1 402 ? 22.997 6.361   -10.036 1.00 20.97 ? 399 ALA A C     1 
ATOM   3149 O  O     . ALA A 1 402 ? 22.610 5.355   -9.441  1.00 24.39 ? 399 ALA A O     1 
ATOM   3150 C  CB    . ALA A 1 402 ? 25.390 7.062   -9.925  1.00 24.20 ? 399 ALA A CB    1 
ATOM   3151 N  N     . PHE A 1 403 ? 22.308 7.498   -10.073 1.00 25.45 ? 400 PHE A N     1 
ATOM   3152 C  CA    . PHE A 1 403 ? 21.041 7.622   -9.370  1.00 27.41 ? 400 PHE A CA    1 
ATOM   3153 C  C     . PHE A 1 403 ? 20.021 6.638   -9.927  1.00 31.75 ? 400 PHE A C     1 
ATOM   3154 O  O     . PHE A 1 403 ? 19.255 6.035   -9.183  1.00 34.17 ? 400 PHE A O     1 
ATOM   3155 C  CB    . PHE A 1 403 ? 20.497 9.043   -9.470  1.00 27.24 ? 400 PHE A CB    1 
ATOM   3156 C  CG    . PHE A 1 403 ? 19.232 9.245   -8.702  1.00 39.56 ? 400 PHE A CG    1 
ATOM   3157 C  CD1   . PHE A 1 403 ? 18.023 9.395   -9.362  1.00 34.53 ? 400 PHE A CD1   1 
ATOM   3158 C  CD2   . PHE A 1 403 ? 19.247 9.259   -7.316  1.00 34.30 ? 400 PHE A CD2   1 
ATOM   3159 C  CE1   . PHE A 1 403 ? 16.849 9.570   -8.650  1.00 43.92 ? 400 PHE A CE1   1 
ATOM   3160 C  CE2   . PHE A 1 403 ? 18.079 9.438   -6.599  1.00 43.57 ? 400 PHE A CE2   1 
ATOM   3161 C  CZ    . PHE A 1 403 ? 16.877 9.593   -7.267  1.00 45.11 ? 400 PHE A CZ    1 
ATOM   3162 N  N     . THR A 1 404 ? 20.034 6.478   -11.243 1.00 33.48 ? 401 THR A N     1 
ATOM   3163 C  CA    . THR A 1 404 ? 19.131 5.554   -11.916 1.00 34.12 ? 401 THR A CA    1 
ATOM   3164 C  C     . THR A 1 404 ? 19.324 4.106   -11.457 1.00 35.01 ? 401 THR A C     1 
ATOM   3165 O  O     . THR A 1 404 ? 18.347 3.384   -11.242 1.00 40.82 ? 401 THR A O     1 
ATOM   3166 C  CB    . THR A 1 404 ? 19.310 5.635   -13.444 1.00 30.04 ? 401 THR A CB    1 
ATOM   3167 O  OG1   . THR A 1 404 ? 18.966 6.951   -13.891 1.00 33.55 ? 401 THR A OG1   1 
ATOM   3168 C  CG2   . THR A 1 404 ? 18.421 4.618   -14.152 1.00 38.44 ? 401 THR A CG2   1 
ATOM   3169 N  N     . VAL A 1 405 ? 20.570 3.674   -11.287 1.00 27.24 ? 402 VAL A N     1 
ATOM   3170 C  CA    . VAL A 1 405 ? 20.800 2.274   -10.958 1.00 30.36 ? 402 VAL A CA    1 
ATOM   3171 C  C     . VAL A 1 405 ? 20.552 1.978   -9.478  1.00 31.56 ? 402 VAL A C     1 
ATOM   3172 O  O     . VAL A 1 405 ? 20.420 0.818   -9.105  1.00 39.27 ? 402 VAL A O     1 
ATOM   3173 C  CB    . VAL A 1 405 ? 22.231 1.817   -11.337 1.00 37.13 ? 402 VAL A CB    1 
ATOM   3174 C  CG1   . VAL A 1 405 ? 22.603 2.344   -12.713 1.00 34.10 ? 402 VAL A CG1   1 
ATOM   3175 C  CG2   . VAL A 1 405 ? 23.236 2.255   -10.301 1.00 37.02 ? 402 VAL A CG2   1 
ATOM   3176 N  N     . ILE A 1 406 ? 20.479 3.014   -8.640  1.00 33.88 ? 403 ILE A N     1 
ATOM   3177 C  CA    . ILE A 1 406 ? 20.286 2.802   -7.204  1.00 38.54 ? 403 ILE A CA    1 
ATOM   3178 C  C     . ILE A 1 406 ? 18.901 3.189   -6.689  1.00 40.26 ? 403 ILE A C     1 
ATOM   3179 O  O     . ILE A 1 406 ? 18.515 2.790   -5.588  1.00 42.87 ? 403 ILE A O     1 
ATOM   3180 C  CB    . ILE A 1 406 ? 21.320 3.587   -6.366  1.00 31.30 ? 403 ILE A CB    1 
ATOM   3181 C  CG1   . ILE A 1 406 ? 21.039 5.090   -6.438  1.00 30.49 ? 403 ILE A CG1   1 
ATOM   3182 C  CG2   . ILE A 1 406 ? 22.715 3.265   -6.825  1.00 25.46 ? 403 ILE A CG2   1 
ATOM   3183 C  CD1   . ILE A 1 406 ? 21.727 5.896   -5.358  1.00 35.46 ? 403 ILE A CD1   1 
ATOM   3184 N  N     . LYS A 1 407 ? 18.159 3.957   -7.481  1.00 36.63 ? 404 LYS A N     1 
ATOM   3185 C  CA    . LYS A 1 407 ? 16.900 4.552   -7.028  1.00 43.60 ? 404 LYS A CA    1 
ATOM   3186 C  C     . LYS A 1 407 ? 15.867 3.530   -6.546  1.00 50.31 ? 404 LYS A C     1 
ATOM   3187 O  O     . LYS A 1 407 ? 14.936 3.880   -5.816  1.00 49.52 ? 404 LYS A O     1 
ATOM   3188 C  CB    . LYS A 1 407 ? 16.294 5.392   -8.149  1.00 42.56 ? 404 LYS A CB    1 
ATOM   3189 C  CG    . LYS A 1 407 ? 15.933 4.573   -9.371  1.00 41.33 ? 404 LYS A CG    1 
ATOM   3190 C  CD    . LYS A 1 407 ? 15.394 5.444   -10.485 1.00 49.90 ? 404 LYS A CD    1 
ATOM   3191 C  CE    . LYS A 1 407 ? 15.064 4.606   -11.707 1.00 48.25 ? 404 LYS A CE    1 
ATOM   3192 N  NZ    . LYS A 1 407 ? 14.560 5.447   -12.822 1.00 53.03 ? 404 LYS A NZ    1 
ATOM   3193 N  N     . ASN A 1 408 ? 16.036 2.274   -6.949  1.00 48.04 ? 405 ASN A N     1 
ATOM   3194 C  CA    . ASN A 1 408 ? 15.110 1.212   -6.572  1.00 50.24 ? 405 ASN A CA    1 
ATOM   3195 C  C     . ASN A 1 408 ? 15.365 0.665   -5.174  1.00 51.14 ? 405 ASN A C     1 
ATOM   3196 O  O     . ASN A 1 408 ? 14.579 -0.129  -4.660  1.00 48.71 ? 405 ASN A O     1 
ATOM   3197 C  CB    . ASN A 1 408 ? 15.179 0.068   -7.583  1.00 53.72 ? 405 ASN A CB    1 
ATOM   3198 C  CG    . ASN A 1 408 ? 14.586 0.443   -8.925  1.00 60.52 ? 405 ASN A CG    1 
ATOM   3199 O  OD1   . ASN A 1 408 ? 13.367 0.491   -9.086  1.00 64.00 ? 405 ASN A OD1   1 
ATOM   3200 N  ND2   . ASN A 1 408 ? 15.448 0.718   -9.896  1.00 59.87 ? 405 ASN A ND2   1 
ATOM   3201 N  N     . CYS A 1 409 ? 16.470 1.078   -4.563  1.00 44.34 ? 406 CYS A N     1 
ATOM   3202 C  CA    . CYS A 1 409 ? 16.792 0.629   -3.215  1.00 46.96 ? 406 CYS A CA    1 
ATOM   3203 C  C     . CYS A 1 409 ? 15.993 1.412   -2.190  1.00 46.60 ? 406 CYS A C     1 
ATOM   3204 O  O     . CYS A 1 409 ? 15.904 1.025   -1.026  1.00 55.12 ? 406 CYS A O     1 
ATOM   3205 C  CB    . CYS A 1 409 ? 18.287 0.770   -2.941  1.00 48.17 ? 406 CYS A CB    1 
ATOM   3206 S  SG    . CYS A 1 409 ? 19.294 -0.229  -4.031  1.00 55.57 ? 406 CYS A SG    1 
ATOM   3207 N  N     . ASN A 1 410 ? 15.411 2.517   -2.635  1.00 42.40 ? 407 ASN A N     1 
ATOM   3208 C  CA    . ASN A 1 410 ? 14.596 3.355   -1.776  1.00 48.28 ? 407 ASN A CA    1 
ATOM   3209 C  C     . ASN A 1 410 ? 13.284 2.671   -1.383  1.00 51.21 ? 407 ASN A C     1 
ATOM   3210 O  O     . ASN A 1 410 ? 12.366 2.560   -2.194  1.00 52.94 ? 407 ASN A O     1 
ATOM   3211 C  CB    . ASN A 1 410 ? 14.315 4.687   -2.470  1.00 40.24 ? 407 ASN A CB    1 
ATOM   3212 C  CG    . ASN A 1 410 ? 13.757 5.720   -1.530  1.00 44.13 ? 407 ASN A CG    1 
ATOM   3213 O  OD1   . ASN A 1 410 ? 13.626 5.470   -0.332  1.00 45.78 ? 407 ASN A OD1   1 
ATOM   3214 N  ND2   . ASN A 1 410 ? 13.427 6.895   -2.061  1.00 42.50 ? 407 ASN A ND2   1 
ATOM   3215 N  N     . THR A 1 411 ? 13.208 2.213   -0.136  1.00 51.22 ? 408 THR A N     1 
ATOM   3216 C  CA    . THR A 1 411 ? 12.014 1.539   0.369   1.00 54.57 ? 408 THR A CA    1 
ATOM   3217 C  C     . THR A 1 411 ? 10.887 2.528   0.624   1.00 54.36 ? 408 THR A C     1 
ATOM   3218 O  O     . THR A 1 411 ? 9.719  2.146   0.663   1.00 59.34 ? 408 THR A O     1 
ATOM   3219 C  CB    . THR A 1 411 ? 12.294 0.766   1.682   1.00 51.40 ? 408 THR A CB    1 
ATOM   3220 O  OG1   . THR A 1 411 ? 12.771 1.671   2.686   1.00 59.46 ? 408 THR A OG1   1 
ATOM   3221 C  CG2   . THR A 1 411 ? 13.326 -0.335  1.462   1.00 57.66 ? 408 THR A CG2   1 
ATOM   3222 N  N     . SER A 1 412 ? 11.244 3.798   0.797   1.00 53.08 ? 409 SER A N     1 
ATOM   3223 C  CA    . SER A 1 412 ? 10.277 4.835   1.138   1.00 55.28 ? 409 SER A CA    1 
ATOM   3224 C  C     . SER A 1 412 ? 9.170  4.937   0.101   1.00 60.02 ? 409 SER A C     1 
ATOM   3225 O  O     . SER A 1 412 ? 9.437  5.066   -1.093  1.00 62.47 ? 409 SER A O     1 
ATOM   3226 C  CB    . SER A 1 412 ? 10.978 6.188   1.292   1.00 58.60 ? 409 SER A CB    1 
ATOM   3227 O  OG    . SER A 1 412 ? 10.121 7.256   0.942   1.00 59.67 ? 409 SER A OG    1 
ATOM   3228 N  N     . GLY A 1 413 ? 7.927  4.868   0.569   1.00 64.75 ? 410 GLY A N     1 
ATOM   3229 C  CA    . GLY A 1 413 ? 6.771  5.021   -0.293  1.00 64.48 ? 410 GLY A CA    1 
ATOM   3230 C  C     . GLY A 1 413 ? 6.722  6.402   -0.908  1.00 66.83 ? 410 GLY A C     1 
ATOM   3231 O  O     . GLY A 1 413 ? 6.303  6.558   -2.048  1.00 65.51 ? 410 GLY A O     1 
ATOM   3232 N  N     . ILE A 1 414 ? 7.141  7.402   -0.136  1.00 66.41 ? 411 ILE A N     1 
ATOM   3233 C  CA    . ILE A 1 414 ? 7.325  8.759   -0.642  1.00 65.97 ? 411 ILE A CA    1 
ATOM   3234 C  C     . ILE A 1 414 ? 8.705  8.828   -1.297  1.00 67.47 ? 411 ILE A C     1 
ATOM   3235 O  O     . ILE A 1 414 ? 9.659  8.205   -0.829  1.00 62.79 ? 411 ILE A O     1 
ATOM   3236 C  CB    . ILE A 1 414 ? 7.177  9.830   0.484   1.00 68.46 ? 411 ILE A CB    1 
ATOM   3237 C  CG1   . ILE A 1 414 ? 7.713  11.200  0.036   1.00 64.92 ? 411 ILE A CG1   1 
ATOM   3238 C  CG2   . ILE A 1 414 ? 7.825  9.354   1.777   1.00 64.43 ? 411 ILE A CG2   1 
ATOM   3239 C  CD1   . ILE A 1 414 ? 6.992  12.375  0.664   1.00 64.07 ? 411 ILE A CD1   1 
ATOM   3240 N  N     . GLN A 1 415 ? 8.816  9.569   -2.391  1.00 70.53 ? 412 GLN A N     1 
ATOM   3241 C  CA    . GLN A 1 415 ? 10.031 9.497   -3.191  1.00 66.51 ? 412 GLN A CA    1 
ATOM   3242 C  C     . GLN A 1 415 ? 10.995 10.655  -2.955  1.00 66.64 ? 412 GLN A C     1 
ATOM   3243 O  O     . GLN A 1 415 ? 12.137 10.618  -3.418  1.00 62.77 ? 412 GLN A O     1 
ATOM   3244 C  CB    . GLN A 1 415 ? 9.674  9.398   -4.672  1.00 69.00 ? 412 GLN A CB    1 
ATOM   3245 C  CG    . GLN A 1 415 ? 10.004 8.025   -5.233  1.00 75.37 ? 412 GLN A CG    1 
ATOM   3246 C  CD    . GLN A 1 415 ? 9.850  7.942   -6.735  1.00 79.77 ? 412 GLN A CD    1 
ATOM   3247 O  OE1   . GLN A 1 415 ? 9.845  8.958   -7.433  1.00 75.37 ? 412 GLN A OE1   1 
ATOM   3248 N  NE2   . GLN A 1 415 ? 9.732  6.721   -7.246  1.00 82.49 ? 412 GLN A NE2   1 
ATOM   3249 N  N     . THR A 1 416 ? 10.546 11.672  -2.227  1.00 64.81 ? 413 THR A N     1 
ATOM   3250 C  CA    . THR A 1 416 ? 11.458 12.714  -1.768  1.00 62.76 ? 413 THR A CA    1 
ATOM   3251 C  C     . THR A 1 416 ? 12.324 12.157  -0.644  1.00 57.37 ? 413 THR A C     1 
ATOM   3252 O  O     . THR A 1 416 ? 13.512 12.459  -0.550  1.00 54.30 ? 413 THR A O     1 
ATOM   3253 C  CB    . THR A 1 416 ? 10.710 13.963  -1.273  1.00 64.83 ? 413 THR A CB    1 
ATOM   3254 O  OG1   . THR A 1 416 ? 9.943  14.515  -2.349  1.00 68.81 ? 413 THR A OG1   1 
ATOM   3255 C  CG2   . THR A 1 416 ? 11.690 15.016  -0.762  1.00 62.87 ? 413 THR A CG2   1 
ATOM   3256 N  N     . GLU A 1 417 ? 11.718 11.329  0.200   1.00 56.39 ? 414 GLU A N     1 
ATOM   3257 C  CA    . GLU A 1 417 ? 12.437 10.699  1.296   1.00 54.27 ? 414 GLU A CA    1 
ATOM   3258 C  C     . GLU A 1 417 ? 13.235 9.497   0.816   1.00 52.94 ? 414 GLU A C     1 
ATOM   3259 O  O     . GLU A 1 417 ? 12.918 8.894   -0.211  1.00 53.14 ? 414 GLU A O     1 
ATOM   3260 C  CB    . GLU A 1 417 ? 11.468 10.270  2.397   1.00 54.24 ? 414 GLU A CB    1 
ATOM   3261 C  CG    . GLU A 1 417 ? 10.614 11.396  2.922   1.00 58.29 ? 414 GLU A CG    1 
ATOM   3262 C  CD    . GLU A 1 417 ? 11.414 12.656  3.147   1.00 56.74 ? 414 GLU A CD    1 
ATOM   3263 O  OE1   . GLU A 1 417 ? 12.229 12.685  4.095   1.00 49.19 ? 414 GLU A OE1   1 
ATOM   3264 O  OE2   . GLU A 1 417 ? 11.225 13.617  2.372   1.00 59.38 ? 414 GLU A OE2   1 
ATOM   3265 N  N     . TRP A 1 418 ? 14.271 9.152   1.571   1.00 43.11 ? 415 TRP A N     1 
ATOM   3266 C  CA    . TRP A 1 418 ? 15.066 7.973   1.277   1.00 40.30 ? 415 TRP A CA    1 
ATOM   3267 C  C     . TRP A 1 418 ? 15.163 7.070   2.501   1.00 42.96 ? 415 TRP A C     1 
ATOM   3268 O  O     . TRP A 1 418 ? 15.676 7.488   3.541   1.00 37.38 ? 415 TRP A O     1 
ATOM   3269 C  CB    . TRP A 1 418 ? 16.468 8.368   0.805   1.00 40.81 ? 415 TRP A CB    1 
ATOM   3270 C  CG    . TRP A 1 418 ? 17.125 7.269   0.066   1.00 37.41 ? 415 TRP A CG    1 
ATOM   3271 C  CD1   . TRP A 1 418 ? 17.633 6.123   0.593   1.00 36.91 ? 415 TRP A CD1   1 
ATOM   3272 C  CD2   . TRP A 1 418 ? 17.320 7.186   -1.348  1.00 35.55 ? 415 TRP A CD2   1 
ATOM   3273 N  NE1   . TRP A 1 418 ? 18.139 5.330   -0.405  1.00 38.81 ? 415 TRP A NE1   1 
ATOM   3274 C  CE2   . TRP A 1 418 ? 17.961 5.961   -1.607  1.00 34.64 ? 415 TRP A CE2   1 
ATOM   3275 C  CE3   . TRP A 1 418 ? 17.019 8.031   -2.418  1.00 34.57 ? 415 TRP A CE3   1 
ATOM   3276 C  CZ2   . TRP A 1 418 ? 18.311 5.558   -2.894  1.00 40.86 ? 415 TRP A CZ2   1 
ATOM   3277 C  CZ3   . TRP A 1 418 ? 17.368 7.629   -3.698  1.00 43.52 ? 415 TRP A CZ3   1 
ATOM   3278 C  CH2   . TRP A 1 418 ? 18.010 6.404   -3.923  1.00 33.95 ? 415 TRP A CH2   1 
ATOM   3279 N  N     . SER A 1 419 ? 14.664 5.841   2.385   1.00 43.87 ? 416 SER A N     1 
ATOM   3280 C  CA    . SER A 1 419 ? 14.832 4.868   3.460   1.00 44.25 ? 416 SER A CA    1 
ATOM   3281 C  C     . SER A 1 419 ? 15.282 3.513   2.918   1.00 46.52 ? 416 SER A C     1 
ATOM   3282 O  O     . SER A 1 419 ? 14.917 3.133   1.807   1.00 47.14 ? 416 SER A O     1 
ATOM   3283 C  CB    . SER A 1 419 ? 13.547 4.685   4.270   1.00 53.35 ? 416 SER A CB    1 
ATOM   3284 O  OG    . SER A 1 419 ? 12.412 4.614   3.434   1.00 55.52 ? 416 SER A OG    1 
ATOM   3285 N  N     . PRO A 1 420 ? 16.112 2.795   3.695   1.00 48.02 ? 417 PRO A N     1 
ATOM   3286 C  CA    . PRO A 1 420 ? 16.754 3.365   4.886   1.00 48.71 ? 417 PRO A CA    1 
ATOM   3287 C  C     . PRO A 1 420 ? 17.795 4.383   4.440   1.00 40.47 ? 417 PRO A C     1 
ATOM   3288 O  O     . PRO A 1 420 ? 18.199 4.324   3.277   1.00 46.18 ? 417 PRO A O     1 
ATOM   3289 C  CB    . PRO A 1 420 ? 17.395 2.151   5.566   1.00 44.44 ? 417 PRO A CB    1 
ATOM   3290 C  CG    . PRO A 1 420 ? 17.593 1.166   4.467   1.00 49.08 ? 417 PRO A CG    1 
ATOM   3291 C  CD    . PRO A 1 420 ? 16.449 1.372   3.511   1.00 45.84 ? 417 PRO A CD    1 
ATOM   3292 N  N     . PRO A 1 421 ? 18.168 5.333   5.311   1.00 43.34 ? 418 PRO A N     1 
ATOM   3293 C  CA    . PRO A 1 421 ? 19.145 6.342   4.890   1.00 42.23 ? 418 PRO A CA    1 
ATOM   3294 C  C     . PRO A 1 421 ? 20.435 5.700   4.391   1.00 33.62 ? 418 PRO A C     1 
ATOM   3295 O  O     . PRO A 1 421 ? 20.793 4.610   4.838   1.00 34.93 ? 418 PRO A O     1 
ATOM   3296 C  CB    . PRO A 1 421 ? 19.389 7.153   6.165   1.00 40.76 ? 418 PRO A CB    1 
ATOM   3297 C  CG    . PRO A 1 421 ? 18.162 6.941   6.990   1.00 46.34 ? 418 PRO A CG    1 
ATOM   3298 C  CD    . PRO A 1 421 ? 17.714 5.541   6.696   1.00 45.16 ? 418 PRO A CD    1 
ATOM   3299 N  N     . LEU A 1 422 ? 21.101 6.367   3.454   1.00 36.65 ? 419 LEU A N     1 
ATOM   3300 C  CA    . LEU A 1 422 ? 22.353 5.872   2.895   1.00 32.09 ? 419 LEU A CA    1 
ATOM   3301 C  C     . LEU A 1 422 ? 23.532 6.301   3.759   1.00 28.21 ? 419 LEU A C     1 
ATOM   3302 O  O     . LEU A 1 422 ? 23.661 7.477   4.105   1.00 31.83 ? 419 LEU A O     1 
ATOM   3303 C  CB    . LEU A 1 422 ? 22.531 6.370   1.455   1.00 25.78 ? 419 LEU A CB    1 
ATOM   3304 C  CG    . LEU A 1 422 ? 21.420 5.963   0.483   1.00 33.95 ? 419 LEU A CG    1 
ATOM   3305 C  CD1   . LEU A 1 422 ? 21.745 6.368   -0.959  1.00 27.83 ? 419 LEU A CD1   1 
ATOM   3306 C  CD2   . LEU A 1 422 ? 21.180 4.470   0.588   1.00 33.67 ? 419 LEU A CD2   1 
ATOM   3307 N  N     . THR A 1 423 ? 24.381 5.342   4.112   1.00 29.55 ? 420 THR A N     1 
ATOM   3308 C  CA    . THR A 1 423 ? 25.537 5.615   4.963   1.00 26.58 ? 420 THR A CA    1 
ATOM   3309 C  C     . THR A 1 423 ? 26.838 5.553   4.157   1.00 24.88 ? 420 THR A C     1 
ATOM   3310 O  O     . THR A 1 423 ? 27.930 5.732   4.702   1.00 22.84 ? 420 THR A O     1 
ATOM   3311 C  CB    . THR A 1 423 ? 25.607 4.630   6.141   1.00 35.02 ? 420 THR A CB    1 
ATOM   3312 O  OG1   . THR A 1 423 ? 25.472 3.291   5.650   1.00 35.47 ? 420 THR A OG1   1 
ATOM   3313 C  CG2   . THR A 1 423 ? 24.479 4.911   7.133   1.00 35.10 ? 420 THR A CG2   1 
ATOM   3314 N  N     . MET A 1 424 ? 26.710 5.294   2.858   1.00 21.94 ? 421 MET A N     1 
ATOM   3315 C  CA    . MET A 1 424 ? 27.867 5.296   1.966   1.00 19.93 ? 421 MET A CA    1 
ATOM   3316 C  C     . MET A 1 424 ? 27.458 5.419   0.502   1.00 22.52 ? 421 MET A C     1 
ATOM   3317 O  O     . MET A 1 424 ? 26.478 4.814   0.070   1.00 22.37 ? 421 MET A O     1 
ATOM   3318 C  CB    . MET A 1 424 ? 28.699 4.025   2.160   1.00 24.03 ? 421 MET A CB    1 
ATOM   3319 C  CG    . MET A 1 424 ? 29.999 3.992   1.365   1.00 25.37 ? 421 MET A CG    1 
ATOM   3320 S  SD    . MET A 1 424 ? 29.772 3.296   -0.292  1.00 24.77 ? 421 MET A SD    1 
ATOM   3321 C  CE    . MET A 1 424 ? 29.420 1.584   0.106   1.00 29.43 ? 421 MET A CE    1 
ATOM   3322 N  N     . LEU A 1 425 ? 28.215 6.218   -0.244  1.00 18.81 ? 422 LEU A N     1 
ATOM   3323 C  CA    . LEU A 1 425 ? 28.143 6.252   -1.700  1.00 16.51 ? 422 LEU A CA    1 
ATOM   3324 C  C     . LEU A 1 425 ? 29.533 5.991   -2.276  1.00 18.18 ? 422 LEU A C     1 
ATOM   3325 O  O     . LEU A 1 425 ? 30.542 6.371   -1.679  1.00 18.98 ? 422 LEU A O     1 
ATOM   3326 C  CB    . LEU A 1 425 ? 27.638 7.602   -2.205  1.00 17.50 ? 422 LEU A CB    1 
ATOM   3327 C  CG    . LEU A 1 425 ? 26.268 8.092   -1.757  1.00 23.45 ? 422 LEU A CG    1 
ATOM   3328 C  CD1   . LEU A 1 425 ? 26.030 9.478   -2.331  1.00 22.29 ? 422 LEU A CD1   1 
ATOM   3329 C  CD2   . LEU A 1 425 ? 25.199 7.119   -2.219  1.00 23.17 ? 422 LEU A CD2   1 
ATOM   3330 N  N     . PHE A 1 426 ? 29.581 5.392   -3.457  1.00 16.34 ? 423 PHE A N     1 
ATOM   3331 C  CA    . PHE A 1 426 ? 30.843 4.967   -4.052  1.00 16.76 ? 423 PHE A CA    1 
ATOM   3332 C  C     . PHE A 1 426 ? 30.659 4.966   -5.563  1.00 19.78 ? 423 PHE A C     1 
ATOM   3333 O  O     . PHE A 1 426 ? 29.710 4.362   -6.067  1.00 20.53 ? 423 PHE A O     1 
ATOM   3334 C  CB    . PHE A 1 426 ? 31.234 3.580   -3.513  1.00 21.07 ? 423 PHE A CB    1 
ATOM   3335 C  CG    A PHE A 1 426 ? 32.646 3.137   -3.862  0.42 21.01 ? 423 PHE A CG    1 
ATOM   3336 C  CG    B PHE A 1 426 ? 32.342 2.918   -4.263  0.58 20.53 ? 423 PHE A CG    1 
ATOM   3337 C  CD1   A PHE A 1 426 ? 33.105 1.889   -3.461  0.42 24.29 ? 423 PHE A CD1   1 
ATOM   3338 C  CD1   B PHE A 1 426 ? 33.664 3.197   -3.957  0.58 19.94 ? 423 PHE A CD1   1 
ATOM   3339 C  CD2   A PHE A 1 426 ? 33.510 3.954   -4.576  0.42 19.23 ? 423 PHE A CD2   1 
ATOM   3340 C  CD2   B PHE A 1 426 ? 32.066 1.985   -5.249  0.58 19.09 ? 423 PHE A CD2   1 
ATOM   3341 C  CE1   A PHE A 1 426 ? 34.386 1.465   -3.770  0.42 24.46 ? 423 PHE A CE1   1 
ATOM   3342 C  CE1   B PHE A 1 426 ? 34.693 2.573   -4.642  0.58 22.87 ? 423 PHE A CE1   1 
ATOM   3343 C  CE2   A PHE A 1 426 ? 34.795 3.537   -4.889  0.42 20.31 ? 423 PHE A CE2   1 
ATOM   3344 C  CE2   B PHE A 1 426 ? 33.088 1.354   -5.926  0.58 23.64 ? 423 PHE A CE2   1 
ATOM   3345 C  CZ    A PHE A 1 426 ? 35.234 2.292   -4.487  0.42 23.99 ? 423 PHE A CZ    1 
ATOM   3346 C  CZ    B PHE A 1 426 ? 34.401 1.647   -5.618  0.58 24.47 ? 423 PHE A CZ    1 
ATOM   3347 N  N     . LEU A 1 427 ? 31.520 5.688   -6.271  1.00 15.16 ? 424 LEU A N     1 
ATOM   3348 C  CA    . LEU A 1 427 ? 31.544 5.633   -7.728  1.00 16.20 ? 424 LEU A CA    1 
ATOM   3349 C  C     . LEU A 1 427 ? 32.905 5.174   -8.181  1.00 16.84 ? 424 LEU A C     1 
ATOM   3350 O  O     . LEU A 1 427 ? 33.916 5.707   -7.732  1.00 18.98 ? 424 LEU A O     1 
ATOM   3351 C  CB    . LEU A 1 427 ? 31.238 6.993   -8.348  1.00 15.62 ? 424 LEU A CB    1 
ATOM   3352 C  CG    . LEU A 1 427 ? 29.834 7.560   -8.134  1.00 20.28 ? 424 LEU A CG    1 
ATOM   3353 C  CD1   . LEU A 1 427 ? 29.707 8.914   -8.811  1.00 19.25 ? 424 LEU A CD1   1 
ATOM   3354 C  CD2   . LEU A 1 427 ? 28.788 6.578   -8.654  1.00 21.82 ? 424 LEU A CD2   1 
ATOM   3355 N  N     . CYS A 1 428 ? 32.947 4.205   -9.091  1.00 15.64 ? 425 CYS A N     1 
ATOM   3356 C  CA    . CYS A 1 428 ? 34.231 3.680   -9.541  1.00 16.78 ? 425 CYS A CA    1 
ATOM   3357 C  C     . CYS A 1 428 ? 34.232 3.449   -11.038 1.00 20.29 ? 425 CYS A C     1 
ATOM   3358 O  O     . CYS A 1 428 ? 33.326 2.804   -11.570 1.00 21.42 ? 425 CYS A O     1 
ATOM   3359 C  CB    . CYS A 1 428 ? 34.564 2.380   -8.820  1.00 20.71 ? 425 CYS A CB    1 
ATOM   3360 S  SG    . CYS A 1 428 ? 36.228 1.740   -9.172  1.00 24.76 ? 425 CYS A SG    1 
ATOM   3361 N  N     . ALA A 1 429 ? 35.269 3.923   -11.693 1.00 16.29 ? 426 ALA A N     1 
ATOM   3362 C  CA    . ALA A 1 429 ? 35.448 3.769   -13.090 1.00 16.46 ? 426 ALA A CA    1 
ATOM   3363 C  C     . ALA A 1 429 ? 36.399 2.599   -13.314 1.00 16.41 ? 426 ALA A C     1 
ATOM   3364 O  O     . ALA A 1 429 ? 37.419 2.512   -12.705 1.00 18.53 ? 426 ALA A O     1 
ATOM   3365 C  CB    . ALA A 1 429 ? 35.992 5.032   -13.696 1.00 18.31 ? 426 ALA A CB    1 
ATOM   3366 N  N     . THR A 1 430 ? 35.988 1.712   -14.206 1.00 17.04 ? 427 THR A N     1 
ATOM   3367 C  CA    . THR A 1 430 ? 36.701 0.475   -14.455 1.00 19.34 ? 427 THR A CA    1 
ATOM   3368 C  C     . THR A 1 430 ? 36.708 0.159   -15.943 1.00 20.42 ? 427 THR A C     1 
ATOM   3369 O  O     . THR A 1 430 ? 36.180 0.850   -16.716 1.00 17.92 ? 427 THR A O     1 
ATOM   3370 C  CB    . THR A 1 430 ? 36.064 -0.674  -13.655 1.00 23.06 ? 427 THR A CB    1 
ATOM   3371 O  OG1   . THR A 1 430 ? 34.782 -0.954  -14.174 1.00 26.75 ? 427 THR A OG1   1 
ATOM   3372 C  CG2   . THR A 1 430 ? 35.861 -0.246  -12.255 1.00 26.65 ? 427 THR A CG2   1 
ATOM   3373 N  N     . LYS A 1 431 ? 37.348 -0.952  -16.255 1.00 19.75 ? 428 LYS A N     1 
ATOM   3374 C  CA    . LYS A 1 431 ? 37.412 -1.489  -17.601 1.00 23.80 ? 428 LYS A CA    1 
ATOM   3375 C  C     . LYS A 1 431 ? 38.011 -0.557  -18.659 1.00 20.82 ? 428 LYS A C     1 
ATOM   3376 O  O     . LYS A 1 431 ? 37.365 -0.128  -19.537 1.00 19.27 ? 428 LYS A O     1 
ATOM   3377 C  CB    . LYS A 1 431 ? 36.065 -2.023  -18.025 1.00 22.64 ? 428 LYS A CB    1 
ATOM   3378 C  CG    . LYS A 1 431 ? 35.641 -3.136  -17.110 1.00 32.09 ? 428 LYS A CG    1 
ATOM   3379 C  CD    . LYS A 1 431 ? 34.429 -3.938  -17.581 1.00 38.65 ? 428 LYS A CD    1 
ATOM   3380 C  CE    . LYS A 1 431 ? 34.368 -5.281  -16.877 1.00 41.16 ? 428 LYS A CE    1 
ATOM   3381 N  NZ    . LYS A 1 431 ? 33.069 -5.960  -17.083 1.00 42.64 ? 428 LYS A NZ    1 
ATOM   3382 N  N     . PHE A 1 432 ? 39.252 -0.201  -18.451 1.00 19.84 ? 429 PHE A N     1 
ATOM   3383 C  CA    . PHE A 1 432 ? 39.952 0.688   -19.318 1.00 19.79 ? 429 PHE A CA    1 
ATOM   3384 C  C     . PHE A 1 432 ? 40.254 0.063   -20.662 1.00 23.80 ? 429 PHE A C     1 
ATOM   3385 O  O     . PHE A 1 432 ? 40.536 -1.102  -20.752 1.00 22.94 ? 429 PHE A O     1 
ATOM   3386 C  CB    . PHE A 1 432 ? 41.239 1.190   -18.656 1.00 18.10 ? 429 PHE A CB    1 
ATOM   3387 C  CG    . PHE A 1 432 ? 41.007 2.173   -17.551 1.00 22.56 ? 429 PHE A CG    1 
ATOM   3388 C  CD1   . PHE A 1 432 ? 40.852 3.472   -17.820 1.00 19.53 ? 429 PHE A CD1   1 
ATOM   3389 C  CD2   . PHE A 1 432 ? 40.939 1.777   -16.248 1.00 25.13 ? 429 PHE A CD2   1 
ATOM   3390 C  CE1   . PHE A 1 432 ? 40.627 4.374   -16.837 1.00 18.91 ? 429 PHE A CE1   1 
ATOM   3391 C  CE2   . PHE A 1 432 ? 40.715 2.687   -15.250 1.00 25.20 ? 429 PHE A CE2   1 
ATOM   3392 C  CZ    . PHE A 1 432 ? 40.568 3.990   -15.553 1.00 22.52 ? 429 PHE A CZ    1 
ATOM   3393 N  N     . SER A 1 433 ? 40.196 0.905   -21.689 1.00 20.77 ? 430 SER A N     1 
ATOM   3394 C  CA    . SER A 1 433 ? 40.647 0.553   -23.030 1.00 20.39 ? 430 SER A CA    1 
ATOM   3395 C  C     . SER A 1 433 ? 41.612 1.617   -23.511 1.00 20.89 ? 430 SER A C     1 
ATOM   3396 O  O     . SER A 1 433 ? 41.511 2.781   -23.115 1.00 21.65 ? 430 SER A O     1 
ATOM   3397 C  CB    . SER A 1 433 ? 39.474 0.425   -24.001 1.00 25.93 ? 430 SER A CB    1 
ATOM   3398 O  OG    . SER A 1 433 ? 38.555 -0.556  -23.567 1.00 39.43 ? 430 SER A OG    1 
ATOM   3399 N  N     . ALA A 1 434 ? 42.554 1.217   -24.355 1.00 22.24 ? 431 ALA A N     1 
ATOM   3400 C  CA    . ALA A 1 434 ? 43.538 2.146   -24.871 1.00 23.46 ? 431 ALA A CA    1 
ATOM   3401 C  C     . ALA A 1 434 ? 42.833 3.198   -25.710 1.00 29.02 ? 431 ALA A C     1 
ATOM   3402 O  O     . ALA A 1 434 ? 41.828 2.915   -26.367 1.00 31.44 ? 431 ALA A O     1 
ATOM   3403 C  CB    . ALA A 1 434 ? 44.595 1.418   -25.689 1.00 26.48 ? 431 ALA A CB    1 
ATOM   3404 N  N     . SER A 1 435 ? 43.345 4.420   -25.660 1.00 24.17 ? 432 SER A N     1 
ATOM   3405 C  CA    . SER A 1 435 ? 42.753 5.519   -26.416 1.00 23.52 ? 432 SER A CA    1 
ATOM   3406 C  C     . SER A 1 435 ? 43.834 6.483   -26.866 1.00 29.97 ? 432 SER A C     1 
ATOM   3407 O  O     . SER A 1 435 ? 43.546 7.552   -27.398 1.00 32.83 ? 432 SER A O     1 
ATOM   3408 C  CB    . SER A 1 435 ? 41.706 6.250   -25.582 1.00 30.37 ? 432 SER A CB    1 
ATOM   3409 O  OG    . SER A 1 435 ? 42.308 6.954   -24.513 1.00 38.20 ? 432 SER A OG    1 
ATOM   3410 O  OXT   . SER A 1 435 ? 45.020 6.209   -26.700 1.00 37.99 ? 432 SER A OXT   1 
ATOM   3411 O  "O3'" . DC  B 2 1   ? 27.680 4.584   11.521  1.00 64.73 ? 1   DC  T "O3'" 1 
ATOM   3412 P  P     . DA  B 2 2   ? 28.072 4.292   13.053  1.00 81.74 ? 2   DA  T P     1 
ATOM   3413 O  OP1   . DA  B 2 2   ? 28.236 2.827   13.222  1.00 77.53 ? 2   DA  T OP1   1 
ATOM   3414 O  OP2   . DA  B 2 2   ? 27.121 5.041   13.908  1.00 70.03 ? 2   DA  T OP2   1 
ATOM   3415 O  "O5'" . DA  B 2 2   ? 29.497 4.991   13.226  1.00 62.70 ? 2   DA  T "O5'" 1 
ATOM   3416 C  "C5'" . DA  B 2 2   ? 30.600 4.597   12.415  1.00 53.51 ? 2   DA  T "C5'" 1 
ATOM   3417 C  "C4'" . DA  B 2 2   ? 31.864 5.311   12.860  1.00 49.84 ? 2   DA  T "C4'" 1 
ATOM   3418 O  "O4'" . DA  B 2 2   ? 31.742 6.728   12.577  1.00 50.40 ? 2   DA  T "O4'" 1 
ATOM   3419 C  "C3'" . DA  B 2 2   ? 32.165 5.208   14.354  1.00 51.52 ? 2   DA  T "C3'" 1 
ATOM   3420 O  "O3'" . DA  B 2 2   ? 33.563 5.187   14.566  1.00 51.56 ? 2   DA  T "O3'" 1 
ATOM   3421 C  "C2'" . DA  B 2 2   ? 31.539 6.479   14.918  1.00 50.05 ? 2   DA  T "C2'" 1 
ATOM   3422 C  "C1'" . DA  B 2 2   ? 31.778 7.467   13.784  1.00 47.94 ? 2   DA  T "C1'" 1 
ATOM   3423 N  N9    . DA  B 2 2   ? 30.770 8.517   13.714  1.00 43.80 ? 2   DA  T N9    1 
ATOM   3424 C  C8    . DA  B 2 2   ? 29.522 8.507   14.276  1.00 45.77 ? 2   DA  T C8    1 
ATOM   3425 N  N7    . DA  B 2 2   ? 28.832 9.602   14.051  1.00 44.33 ? 2   DA  T N7    1 
ATOM   3426 C  C5    . DA  B 2 2   ? 29.693 10.383  13.295  1.00 40.25 ? 2   DA  T C5    1 
ATOM   3427 C  C6    . DA  B 2 2   ? 29.566 11.667  12.732  1.00 39.85 ? 2   DA  T C6    1 
ATOM   3428 N  N6    . DA  B 2 2   ? 28.469 12.423  12.852  1.00 42.34 ? 2   DA  T N6    1 
ATOM   3429 N  N1    . DA  B 2 2   ? 30.615 12.147  12.034  1.00 38.82 ? 2   DA  T N1    1 
ATOM   3430 C  C2    . DA  B 2 2   ? 31.710 11.389  11.907  1.00 35.00 ? 2   DA  T C2    1 
ATOM   3431 N  N3    . DA  B 2 2   ? 31.948 10.174  12.387  1.00 37.05 ? 2   DA  T N3    1 
ATOM   3432 C  C4    . DA  B 2 2   ? 30.890 9.724   13.080  1.00 39.85 ? 2   DA  T C4    1 
ATOM   3433 P  P     A DT  B 2 3   ? 34.255 3.850   15.128  0.57 51.56 ? 3   DT  T P     1 
ATOM   3434 P  P     B DT  B 2 3   ? 34.311 3.830   14.991  0.43 51.47 ? 3   DT  T P     1 
ATOM   3435 O  OP1   A DT  B 2 3   ? 33.296 2.736   14.938  0.57 50.80 ? 3   DT  T OP1   1 
ATOM   3436 O  OP1   B DT  B 2 3   ? 33.309 2.917   15.584  0.43 51.27 ? 3   DT  T OP1   1 
ATOM   3437 O  OP2   A DT  B 2 3   ? 34.798 4.159   16.470  0.57 47.73 ? 3   DT  T OP2   1 
ATOM   3438 O  OP2   B DT  B 2 3   ? 35.514 4.224   15.764  0.43 45.43 ? 3   DT  T OP2   1 
ATOM   3439 O  "O5'" A DT  B 2 3   ? 35.492 3.616   14.147  0.57 46.87 ? 3   DT  T "O5'" 1 
ATOM   3440 O  "O5'" B DT  B 2 3   ? 34.824 3.218   13.602  0.43 46.08 ? 3   DT  T "O5'" 1 
ATOM   3441 C  "C5'" A DT  B 2 3   ? 36.466 4.623   14.007  0.57 42.32 ? 3   DT  T "C5'" 1 
ATOM   3442 C  "C5'" B DT  B 2 3   ? 36.155 3.484   13.154  0.43 40.51 ? 3   DT  T "C5'" 1 
ATOM   3443 C  "C4'" A DT  B 2 3   ? 37.240 4.446   12.724  0.57 38.85 ? 3   DT  T "C4'" 1 
ATOM   3444 C  "C4'" B DT  B 2 3   ? 36.227 4.816   12.430  0.43 38.98 ? 3   DT  T "C4'" 1 
ATOM   3445 O  "O4'" A DT  B 2 3   ? 38.361 3.568   12.960  0.57 40.46 ? 3   DT  T "O4'" 1 
ATOM   3446 O  "O4'" B DT  B 2 3   ? 37.623 5.174   12.206  0.43 39.74 ? 3   DT  T "O4'" 1 
ATOM   3447 C  "C3'" A DT  B 2 3   ? 36.432 3.838   11.583  0.57 39.38 ? 3   DT  T "C3'" 1 
ATOM   3448 C  "C3'" B DT  B 2 3   ? 35.553 4.832   11.059  0.43 35.96 ? 3   DT  T "C3'" 1 
ATOM   3449 O  "O3'" A DT  B 2 3   ? 36.468 4.701   10.448  0.57 36.98 ? 3   DT  T "O3'" 1 
ATOM   3450 O  "O3'" B DT  B 2 3   ? 34.824 6.047   10.877  0.43 37.34 ? 3   DT  T "O3'" 1 
ATOM   3451 C  "C2'" A DT  B 2 3   ? 37.095 2.479   11.321  0.57 39.24 ? 3   DT  T "C2'" 1 
ATOM   3452 C  "C2'" B DT  B 2 3   ? 36.731 4.713   10.094  0.43 35.31 ? 3   DT  T "C2'" 1 
ATOM   3453 C  "C1'" A DT  B 2 3   ? 38.495 2.675   11.886  0.57 40.48 ? 3   DT  T "C1'" 1 
ATOM   3454 C  "C1'" B DT  B 2 3   ? 37.830 5.456   10.838  0.43 33.43 ? 3   DT  T "C1'" 1 
ATOM   3455 N  N1    A DT  B 2 3   ? 39.105 1.431   12.416  0.57 42.32 ? 3   DT  T N1    1 
ATOM   3456 N  N1    B DT  B 2 3   ? 39.215 5.012   10.459  0.43 35.00 ? 3   DT  T N1    1 
ATOM   3457 C  C2    A DT  B 2 3   ? 40.346 1.048   11.969  0.57 43.44 ? 3   DT  T C2    1 
ATOM   3458 C  C2    B DT  B 2 3   ? 40.134 5.945   10.027  0.43 31.79 ? 3   DT  T C2    1 
ATOM   3459 O  O2    A DT  B 2 3   ? 40.978 1.674   11.134  0.57 40.64 ? 3   DT  T O2    1 
ATOM   3460 O  O2    B DT  B 2 3   ? 39.889 7.135   9.939   0.43 34.23 ? 3   DT  T O2    1 
ATOM   3461 N  N3    A DT  B 2 3   ? 40.823 -0.106  12.529  0.57 44.86 ? 3   DT  T N3    1 
ATOM   3462 N  N3    B DT  B 2 3   ? 41.363 5.432   9.706   0.43 30.44 ? 3   DT  T N3    1 
ATOM   3463 C  C4    A DT  B 2 3   ? 40.199 -0.893  13.479  0.57 48.02 ? 3   DT  T C4    1 
ATOM   3464 C  C4    B DT  B 2 3   ? 41.760 4.108   9.767   0.43 30.32 ? 3   DT  T C4    1 
ATOM   3465 O  O4    A DT  B 2 3   ? 40.710 -1.916  13.924  0.57 49.27 ? 3   DT  T O4    1 
ATOM   3466 O  O4    B DT  B 2 3   ? 42.893 3.749   9.455   0.43 31.95 ? 3   DT  T O4    1 
ATOM   3467 C  C5    A DT  B 2 3   ? 38.902 -0.430  13.909  0.57 45.62 ? 3   DT  T C5    1 
ATOM   3468 C  C5    B DT  B 2 3   ? 40.750 3.182   10.225  0.43 33.79 ? 3   DT  T C5    1 
ATOM   3469 C  C7    A DT  B 2 3   ? 38.130 -1.202  14.935  0.57 44.23 ? 3   DT  T C7    1 
ATOM   3470 C  C7    B DT  B 2 3   ? 41.060 1.717   10.333  0.43 35.90 ? 3   DT  T C7    1 
ATOM   3471 C  C6    A DT  B 2 3   ? 38.424 0.698   13.366  0.57 43.67 ? 3   DT  T C6    1 
ATOM   3472 C  C6    B DT  B 2 3   ? 39.542 3.674   10.546  0.43 34.86 ? 3   DT  T C6    1 
ATOM   3473 P  P     A DT  B 2 4   ? 35.088 5.231   9.822   0.71 27.32 ? 4   DT  T P     1 
ATOM   3474 P  P     B DT  B 2 4   ? 33.815 6.217   9.635   0.29 31.83 ? 4   DT  T P     1 
ATOM   3475 O  OP1   A DT  B 2 4   ? 34.364 6.056   10.815  0.71 37.68 ? 4   DT  T OP1   1 
ATOM   3476 O  OP1   B DT  B 2 4   ? 32.875 7.317   9.939   0.29 36.39 ? 4   DT  T OP1   1 
ATOM   3477 O  OP2   A DT  B 2 4   ? 34.448 4.025   9.259   0.71 29.22 ? 4   DT  T OP2   1 
ATOM   3478 O  OP2   B DT  B 2 4   ? 33.297 4.881   9.266   0.29 33.62 ? 4   DT  T OP2   1 
ATOM   3479 O  "O5'" A DT  B 2 4   ? 35.532 6.133   8.571   0.71 22.80 ? 4   DT  T "O5'" 1 
ATOM   3480 O  "O5'" B DT  B 2 4   ? 34.769 6.691   8.453   0.29 26.24 ? 4   DT  T "O5'" 1 
ATOM   3481 C  "C5'" A DT  B 2 4   ? 35.783 7.536   8.703   0.71 23.80 ? 4   DT  T "C5'" 1 
ATOM   3482 C  "C5'" B DT  B 2 4   ? 35.768 7.648   8.715   0.29 23.96 ? 4   DT  T "C5'" 1 
ATOM   3483 C  "C4'" . DT  B 2 4   ? 36.453 8.069   7.437   1.00 20.73 ? 4   DT  T "C4'" 1 
ATOM   3484 O  "O4'" . DT  B 2 4   ? 37.715 7.379   7.269   1.00 20.50 ? 4   DT  T "O4'" 1 
ATOM   3485 C  "C3'" . DT  B 2 4   ? 35.675 7.827   6.149   1.00 19.89 ? 4   DT  T "C3'" 1 
ATOM   3486 O  "O3'" A DT  B 2 4   ? 35.954 8.880   5.253   0.71 17.34 ? 4   DT  T "O3'" 1 
ATOM   3487 O  "O3'" B DT  B 2 4   ? 35.954 8.882   5.253   0.29 17.42 ? 4   DT  T "O3'" 1 
ATOM   3488 C  "C2'" . DT  B 2 4   ? 36.248 6.489   5.654   1.00 19.00 ? 4   DT  T "C2'" 1 
ATOM   3489 C  "C1'" . DT  B 2 4   ? 37.711 6.648   6.055   1.00 16.76 ? 4   DT  T "C1'" 1 
ATOM   3490 N  N1    . DT  B 2 4   ? 38.462 5.389   6.308   1.00 17.36 ? 4   DT  T N1    1 
ATOM   3491 C  C2    . DT  B 2 4   ? 39.774 5.358   5.940   1.00 17.10 ? 4   DT  T C2    1 
ATOM   3492 O  O2    . DT  B 2 4   ? 40.317 6.284   5.364   1.00 16.26 ? 4   DT  T O2    1 
ATOM   3493 N  N3    . DT  B 2 4   ? 40.431 4.200   6.241   1.00 19.67 ? 4   DT  T N3    1 
ATOM   3494 C  C4    . DT  B 2 4   ? 39.931 3.096   6.885   1.00 18.40 ? 4   DT  T C4    1 
ATOM   3495 O  O4    . DT  B 2 4   ? 40.623 2.101   7.111   1.00 21.04 ? 4   DT  T O4    1 
ATOM   3496 C  C5    . DT  B 2 4   ? 38.542 3.196   7.282   1.00 21.21 ? 4   DT  T C5    1 
ATOM   3497 C  C7    . DT  B 2 4   ? 37.876 2.047   7.981   1.00 24.21 ? 4   DT  T C7    1 
ATOM   3498 C  C6    . DT  B 2 4   ? 37.881 4.334   6.989   1.00 20.52 ? 4   DT  T C6    1 
ATOM   3499 P  P     . DA  B 2 5   ? 35.304 8.922   3.788   1.00 18.03 ? 5   DA  T P     1 
ATOM   3500 O  OP1   . DA  B 2 5   ? 35.010 10.343  3.504   1.00 19.23 ? 5   DA  T OP1   1 
ATOM   3501 O  OP2   . DA  B 2 5   ? 34.247 7.895   3.693   1.00 19.82 ? 5   DA  T OP2   1 
ATOM   3502 O  "O5'" . DA  B 2 5   ? 36.497 8.461   2.843   1.00 16.50 ? 5   DA  T "O5'" 1 
ATOM   3503 C  "C5'" . DA  B 2 5   ? 37.681 9.252   2.752   1.00 16.21 ? 5   DA  T "C5'" 1 
ATOM   3504 C  "C4'" . DA  B 2 5   ? 38.645 8.632   1.769   1.00 16.26 ? 5   DA  T "C4'" 1 
ATOM   3505 O  "O4'" . DA  B 2 5   ? 39.228 7.419   2.345   1.00 17.50 ? 5   DA  T "O4'" 1 
ATOM   3506 C  "C3'" . DA  B 2 5   ? 38.010 8.198   0.448   1.00 13.78 ? 5   DA  T "C3'" 1 
ATOM   3507 O  "O3'" . DA  B 2 5   ? 38.934 8.432   -0.606  1.00 15.00 ? 5   DA  T "O3'" 1 
ATOM   3508 C  "C2'" . DA  B 2 5   ? 37.796 6.705   0.667   1.00 15.25 ? 5   DA  T "C2'" 1 
ATOM   3509 C  "C1'" . DA  B 2 5   ? 39.070 6.361   1.422   1.00 18.11 ? 5   DA  T "C1'" 1 
ATOM   3510 N  N9    . DA  B 2 5   ? 39.003 5.105   2.153   1.00 15.55 ? 5   DA  T N9    1 
ATOM   3511 C  C8    . DA  B 2 5   ? 37.920 4.581   2.795   1.00 17.42 ? 5   DA  T C8    1 
ATOM   3512 N  N7    . DA  B 2 5   ? 38.165 3.434   3.388   1.00 20.02 ? 5   DA  T N7    1 
ATOM   3513 C  C5    . DA  B 2 5   ? 39.507 3.200   3.123   1.00 19.19 ? 5   DA  T C5    1 
ATOM   3514 C  C6    . DA  B 2 5   ? 40.368 2.140   3.467   1.00 21.70 ? 5   DA  T C6    1 
ATOM   3515 N  N6    . DA  B 2 5   ? 39.985 1.095   4.199   1.00 24.29 ? 5   DA  T N6    1 
ATOM   3516 N  N1    . DA  B 2 5   ? 41.649 2.209   3.043   1.00 21.06 ? 5   DA  T N1    1 
ATOM   3517 C  C2    . DA  B 2 5   ? 42.029 3.268   2.310   1.00 17.70 ? 5   DA  T C2    1 
ATOM   3518 N  N3    . DA  B 2 5   ? 41.308 4.325   1.925   1.00 19.83 ? 5   DA  T N3    1 
ATOM   3519 C  C4    . DA  B 2 5   ? 40.038 4.219   2.366   1.00 15.80 ? 5   DA  T C4    1 
ATOM   3520 P  P     . DT  B 2 6   ? 38.469 8.417   -2.142  1.00 16.34 ? 6   DT  T P     1 
ATOM   3521 O  OP1   . DT  B 2 6   ? 39.633 8.874   -2.917  1.00 16.75 ? 6   DT  T OP1   1 
ATOM   3522 O  OP2   . DT  B 2 6   ? 37.174 9.149   -2.236  1.00 15.39 ? 6   DT  T OP2   1 
ATOM   3523 O  "O5'" . DT  B 2 6   ? 38.126 6.882   -2.413  1.00 19.92 ? 6   DT  T "O5'" 1 
ATOM   3524 C  "C5'" . DT  B 2 6   ? 38.861 6.143   -3.360  1.00 18.72 ? 6   DT  T "C5'" 1 
ATOM   3525 C  "C4'" . DT  B 2 6   ? 40.066 5.459   -2.741  1.00 18.28 ? 6   DT  T "C4'" 1 
ATOM   3526 O  "O4'" . DT  B 2 6   ? 39.685 4.746   -1.556  1.00 21.77 ? 6   DT  T "O4'" 1 
ATOM   3527 C  "C3'" . DT  B 2 6   ? 40.663 4.408   -3.652  1.00 19.99 ? 6   DT  T "C3'" 1 
ATOM   3528 O  "O3'" . DT  B 2 6   ? 41.706 4.978   -4.370  1.00 16.88 ? 6   DT  T "O3'" 1 
ATOM   3529 C  "C2'" . DT  B 2 6   ? 41.159 3.301   -2.715  1.00 23.89 ? 6   DT  T "C2'" 1 
ATOM   3530 C  "C1'" . DT  B 2 6   ? 40.606 3.705   -1.350  1.00 21.18 ? 6   DT  T "C1'" 1 
ATOM   3531 N  N1    . DT  B 2 6   ? 39.918 2.627   -0.648  1.00 18.47 ? 6   DT  T N1    1 
ATOM   3532 C  C2    . DT  B 2 6   ? 40.633 1.531   -0.229  1.00 17.51 ? 6   DT  T C2    1 
ATOM   3533 O  O2    . DT  B 2 6   ? 41.825 1.386   -0.428  1.00 21.82 ? 6   DT  T O2    1 
ATOM   3534 N  N3    . DT  B 2 6   ? 39.900 0.607   0.450   1.00 17.54 ? 6   DT  T N3    1 
ATOM   3535 C  C4    . DT  B 2 6   ? 38.555 0.651   0.743   1.00 23.00 ? 6   DT  T C4    1 
ATOM   3536 O  O4    . DT  B 2 6   ? 37.990 -0.243  1.368   1.00 25.26 ? 6   DT  T O4    1 
ATOM   3537 C  C5    . DT  B 2 6   ? 37.862 1.823   0.278   1.00 23.52 ? 6   DT  T C5    1 
ATOM   3538 C  C7    . DT  B 2 6   ? 36.393 1.985   0.545   1.00 25.94 ? 6   DT  T C7    1 
ATOM   3539 C  C6    . DT  B 2 6   ? 38.570 2.748   -0.381  1.00 21.90 ? 6   DT  T C6    1 
ATOM   3540 P  P     . DG  B 2 7   ? 41.882 4.628   -5.923  1.00 17.20 ? 7   DG  T P     1 
ATOM   3541 O  OP1   . DG  B 2 7   ? 43.049 5.392   -6.399  1.00 17.72 ? 7   DG  T OP1   1 
ATOM   3542 O  OP2   . DG  B 2 7   ? 40.601 4.702   -6.632  1.00 16.92 ? 7   DG  T OP2   1 
ATOM   3543 O  "O5'" . DG  B 2 7   ? 42.233 3.055   -5.929  1.00 17.63 ? 7   DG  T "O5'" 1 
ATOM   3544 C  "C5'" . DG  B 2 7   ? 43.530 2.604   -5.630  1.00 25.27 ? 7   DG  T "C5'" 1 
ATOM   3545 C  "C4'" . DG  B 2 7   ? 43.546 1.086   -5.547  1.00 15.44 ? 7   DG  T "C4'" 1 
ATOM   3546 O  "O4'" . DG  B 2 7   ? 42.806 0.659   -4.391  1.00 18.00 ? 7   DG  T "O4'" 1 
ATOM   3547 C  "C3'" . DG  B 2 7   ? 42.912 0.348   -6.738  1.00 23.98 ? 7   DG  T "C3'" 1 
ATOM   3548 O  "O3'" . DG  B 2 7   ? 43.910 -0.373  -7.424  1.00 25.13 ? 7   DG  T "O3'" 1 
ATOM   3549 C  "C2'" . DG  B 2 7   ? 41.880 -0.590  -6.093  1.00 22.93 ? 7   DG  T "C2'" 1 
ATOM   3550 C  "C1'" . DG  B 2 7   ? 42.348 -0.634  -4.651  1.00 23.55 ? 7   DG  T "C1'" 1 
ATOM   3551 N  N9    . DG  B 2 7   ? 41.288 -0.976  -3.718  1.00 20.61 ? 7   DG  T N9    1 
ATOM   3552 C  C8    . DG  B 2 7   ? 40.080 -0.339  -3.550  1.00 20.09 ? 7   DG  T C8    1 
ATOM   3553 N  N7    . DG  B 2 7   ? 39.321 -0.902  -2.648  1.00 21.18 ? 7   DG  T N7    1 
ATOM   3554 C  C5    . DG  B 2 7   ? 40.072 -1.988  -2.205  1.00 19.66 ? 7   DG  T C5    1 
ATOM   3555 C  C6    . DG  B 2 7   ? 39.771 -2.967  -1.233  1.00 20.32 ? 7   DG  T C6    1 
ATOM   3556 O  O6    . DG  B 2 7   ? 38.740 -3.075  -0.538  1.00 20.08 ? 7   DG  T O6    1 
ATOM   3557 N  N1    . DG  B 2 7   ? 40.809 -3.890  -1.100  1.00 17.66 ? 7   DG  T N1    1 
ATOM   3558 C  C2    . DG  B 2 7   ? 41.994 -3.854  -1.802  1.00 16.46 ? 7   DG  T C2    1 
ATOM   3559 N  N2    . DG  B 2 7   ? 42.880 -4.828  -1.537  1.00 18.52 ? 7   DG  T N2    1 
ATOM   3560 N  N3    . DG  B 2 7   ? 42.285 -2.938  -2.716  1.00 18.40 ? 7   DG  T N3    1 
ATOM   3561 C  C4    . DG  B 2 7   ? 41.280 -2.044  -2.861  1.00 19.46 ? 7   DG  T C4    1 
ATOM   3562 P  P     . DA  B 2 8   ? 43.552 -1.330  -8.667  1.00 20.07 ? 8   DA  T P     1 
ATOM   3563 O  OP1   . DA  B 2 8   ? 44.613 -1.077  -9.645  1.00 20.46 ? 8   DA  T OP1   1 
ATOM   3564 O  OP2   . DA  B 2 8   ? 42.118 -1.292  -9.050  1.00 22.16 ? 8   DA  T OP2   1 
ATOM   3565 O  "O5'" . DA  B 2 8   ? 43.831 -2.796  -8.092  1.00 20.84 ? 8   DA  T "O5'" 1 
ATOM   3566 C  "C5'" . DA  B 2 8   ? 45.113 -3.097  -7.571  1.00 20.34 ? 8   DA  T "C5'" 1 
ATOM   3567 C  "C4'" . DA  B 2 8   ? 45.162 -4.544  -7.159  1.00 18.02 ? 8   DA  T "C4'" 1 
ATOM   3568 O  "O4'" . DA  B 2 8   ? 44.271 -4.733  -6.032  1.00 19.52 ? 8   DA  T "O4'" 1 
ATOM   3569 C  "C3'" . DA  B 2 8   ? 44.703 -5.507  -8.251  1.00 22.74 ? 8   DA  T "C3'" 1 
ATOM   3570 O  "O3'" . DA  B 2 8   ? 45.558 -6.637  -8.287  1.00 21.41 ? 8   DA  T "O3'" 1 
ATOM   3571 C  "C2'" . DA  B 2 8   ? 43.284 -5.878  -7.827  1.00 20.82 ? 8   DA  T "C2'" 1 
ATOM   3572 C  "C1'" . DA  B 2 8   ? 43.354 -5.766  -6.307  1.00 21.87 ? 8   DA  T "C1'" 1 
ATOM   3573 N  N9    . DA  B 2 8   ? 42.072 -5.413  -5.714  1.00 21.90 ? 8   DA  T N9    1 
ATOM   3574 C  C8    . DA  B 2 8   ? 41.261 -4.376  -6.086  1.00 20.65 ? 8   DA  T C8    1 
ATOM   3575 N  N7    . DA  B 2 8   ? 40.158 -4.295  -5.399  1.00 19.12 ? 8   DA  T N7    1 
ATOM   3576 C  C5    . DA  B 2 8   ? 40.239 -5.353  -4.510  1.00 16.73 ? 8   DA  T C5    1 
ATOM   3577 C  C6    . DA  B 2 8   ? 39.367 -5.813  -3.506  1.00 15.59 ? 8   DA  T C6    1 
ATOM   3578 N  N6    . DA  B 2 8   ? 38.193 -5.234  -3.220  1.00 16.19 ? 8   DA  T N6    1 
ATOM   3579 N  N1    . DA  B 2 8   ? 39.746 -6.905  -2.801  1.00 16.74 ? 8   DA  T N1    1 
ATOM   3580 C  C2    . DA  B 2 8   ? 40.918 -7.478  -3.086  1.00 14.10 ? 8   DA  T C2    1 
ATOM   3581 N  N3    . DA  B 2 8   ? 41.823 -7.141  -4.011  1.00 14.69 ? 8   DA  T N3    1 
ATOM   3582 C  C4    . DA  B 2 8   ? 41.416 -6.056  -4.694  1.00 18.95 ? 8   DA  T C4    1 
ATOM   3583 P  P     . DC  B 2 9   ? 45.434 -7.726  -9.463  1.00 23.00 ? 9   DC  T P     1 
ATOM   3584 O  OP1   . DC  B 2 9   ? 46.824 -8.100  -9.782  1.00 26.39 ? 9   DC  T OP1   1 
ATOM   3585 O  OP2   . DC  B 2 9   ? 44.508 -7.251  -10.515 1.00 28.59 ? 9   DC  T OP2   1 
ATOM   3586 O  "O5'" . DC  B 2 9   ? 44.694 -8.945  -8.744  1.00 20.49 ? 9   DC  T "O5'" 1 
ATOM   3587 C  "C5'" . DC  B 2 9   ? 45.198 -9.424  -7.523  1.00 20.34 ? 9   DC  T "C5'" 1 
ATOM   3588 C  "C4'" . DC  B 2 9   ? 44.242 -10.413 -6.915  1.00 23.64 ? 9   DC  T "C4'" 1 
ATOM   3589 O  "O4'" . DC  B 2 9   ? 43.117 -9.714  -6.323  1.00 24.71 ? 9   DC  T "O4'" 1 
ATOM   3590 C  "C3'" . DC  B 2 9   ? 43.640 -11.405 -7.911  1.00 26.94 ? 9   DC  T "C3'" 1 
ATOM   3591 O  "O3'" . DC  B 2 9   ? 43.575 -12.648 -7.292  1.00 33.51 ? 9   DC  T "O3'" 1 
ATOM   3592 C  "C2'" . DC  B 2 9   ? 42.244 -10.836 -8.154  1.00 26.20 ? 9   DC  T "C2'" 1 
ATOM   3593 C  "C1'" . DC  B 2 9   ? 41.927 -10.333 -6.761  1.00 27.46 ? 9   DC  T "C1'" 1 
ATOM   3594 N  N1    . DC  B 2 9   ? 40.812 -9.358  -6.702  1.00 21.95 ? 9   DC  T N1    1 
ATOM   3595 C  C2    . DC  B 2 9   ? 39.877 -9.473  -5.683  1.00 22.21 ? 9   DC  T C2    1 
ATOM   3596 O  O2    . DC  B 2 9   ? 40.014 -10.378 -4.846  1.00 20.73 ? 9   DC  T O2    1 
ATOM   3597 N  N3    . DC  B 2 9   ? 38.846 -8.599  -5.632  1.00 20.44 ? 9   DC  T N3    1 
ATOM   3598 C  C4    . DC  B 2 9   ? 38.739 -7.631  -6.548  1.00 24.05 ? 9   DC  T C4    1 
ATOM   3599 N  N4    . DC  B 2 9   ? 37.701 -6.785  -6.450  1.00 22.52 ? 9   DC  T N4    1 
ATOM   3600 C  C5    . DC  B 2 9   ? 39.682 -7.500  -7.608  1.00 24.12 ? 9   DC  T C5    1 
ATOM   3601 C  C6    . DC  B 2 9   ? 40.696 -8.379  -7.647  1.00 24.69 ? 9   DC  T C6    1 
ATOM   3602 P  P     . DG  B 2 10  ? 43.337 -13.982 -8.145  1.00 32.73 ? 10  DG  T P     1 
ATOM   3603 O  OP1   . DG  B 2 10  ? 44.611 -14.719 -8.109  1.00 35.71 ? 10  DG  T OP1   1 
ATOM   3604 O  OP2   . DG  B 2 10  ? 42.643 -13.665 -9.419  1.00 33.26 ? 10  DG  T OP2   1 
ATOM   3605 O  "O5'" . DG  B 2 10  ? 42.308 -14.776 -7.262  1.00 27.62 ? 10  DG  T "O5'" 1 
ATOM   3606 C  "C5'" . DG  B 2 10  ? 42.431 -14.783 -5.865  1.00 27.91 ? 10  DG  T "C5'" 1 
ATOM   3607 C  "C4'" . DG  B 2 10  ? 41.184 -15.376 -5.275  1.00 29.49 ? 10  DG  T "C4'" 1 
ATOM   3608 O  "O4'" . DG  B 2 10  ? 40.182 -14.335 -5.135  1.00 32.59 ? 10  DG  T "O4'" 1 
ATOM   3609 C  "C3'" . DG  B 2 10  ? 40.558 -16.460 -6.150  1.00 33.02 ? 10  DG  T "C3'" 1 
ATOM   3610 O  "O3'" . DG  B 2 10  ? 40.081 -17.511 -5.339  1.00 33.94 ? 10  DG  T "O3'" 1 
ATOM   3611 C  "C2'" . DG  B 2 10  ? 39.429 -15.723 -6.875  1.00 34.01 ? 10  DG  T "C2'" 1 
ATOM   3612 C  "C1'" . DG  B 2 10  ? 39.016 -14.681 -5.850  1.00 27.80 ? 10  DG  T "C1'" 1 
ATOM   3613 N  N9    . DG  B 2 10  ? 38.468 -13.463 -6.447  1.00 24.19 ? 10  DG  T N9    1 
ATOM   3614 C  C8    . DG  B 2 10  ? 39.055 -12.674 -7.412  1.00 24.63 ? 10  DG  T C8    1 
ATOM   3615 N  N7    . DG  B 2 10  ? 38.329 -11.642 -7.755  1.00 23.86 ? 10  DG  T N7    1 
ATOM   3616 C  C5    . DG  B 2 10  ? 37.187 -11.752 -6.969  1.00 20.51 ? 10  DG  T C5    1 
ATOM   3617 C  C6    . DG  B 2 10  ? 36.041 -10.924 -6.908  1.00 23.16 ? 10  DG  T C6    1 
ATOM   3618 O  O6    . DG  B 2 10  ? 35.806 -9.892  -7.555  1.00 27.87 ? 10  DG  T O6    1 
ATOM   3619 N  N1    . DG  B 2 10  ? 35.111 -11.394 -5.978  1.00 25.97 ? 10  DG  T N1    1 
ATOM   3620 C  C2    . DG  B 2 10  ? 35.270 -12.535 -5.212  1.00 25.02 ? 10  DG  T C2    1 
ATOM   3621 N  N2    . DG  B 2 10  ? 34.265 -12.835 -4.379  1.00 28.15 ? 10  DG  T N2    1 
ATOM   3622 N  N3    . DG  B 2 10  ? 36.343 -13.321 -5.257  1.00 22.77 ? 10  DG  T N3    1 
ATOM   3623 C  C4    . DG  B 2 10  ? 37.259 -12.869 -6.154  1.00 20.97 ? 10  DG  T C4    1 
ATOM   3624 P  P     . DC  B 2 11  ? 39.418 -18.820 -5.996  1.00 30.63 ? 11  DC  T P     1 
ATOM   3625 O  OP1   . DC  B 2 11  ? 39.957 -19.974 -5.254  1.00 30.92 ? 11  DC  T OP1   1 
ATOM   3626 O  OP2   . DC  B 2 11  ? 39.555 -18.812 -7.467  1.00 28.87 ? 11  DC  T OP2   1 
ATOM   3627 O  "O5'" . DC  B 2 11  ? 37.864 -18.625 -5.685  1.00 29.41 ? 11  DC  T "O5'" 1 
ATOM   3628 C  "C5'" . DC  B 2 11  ? 37.432 -18.215 -4.407  1.00 22.57 ? 11  DC  T "C5'" 1 
ATOM   3629 C  "C4'" . DC  B 2 11  ? 35.912 -18.218 -4.342  1.00 22.36 ? 11  DC  T "C4'" 1 
ATOM   3630 O  "O4'" . DC  B 2 11  ? 35.393 -16.975 -4.878  1.00 22.80 ? 11  DC  T "O4'" 1 
ATOM   3631 C  "C3'" . DC  B 2 11  ? 35.229 -19.337 -5.129  1.00 18.60 ? 11  DC  T "C3'" 1 
ATOM   3632 O  "O3'" . DC  B 2 11  ? 34.130 -19.837 -4.360  1.00 17.39 ? 11  DC  T "O3'" 1 
ATOM   3633 C  "C2'" . DC  B 2 11  ? 34.774 -18.632 -6.422  1.00 20.89 ? 11  DC  T "C2'" 1 
ATOM   3634 C  "C1'" . DC  B 2 11  ? 34.463 -17.229 -5.922  1.00 22.27 ? 11  DC  T "C1'" 1 
ATOM   3635 N  N1    . DC  B 2 11  ? 34.634 -16.122 -6.940  1.00 19.24 ? 11  DC  T N1    1 
ATOM   3636 C  C2    . DC  B 2 11  ? 33.613 -15.168 -7.121  1.00 18.11 ? 11  DC  T C2    1 
ATOM   3637 O  O2    . DC  B 2 11  ? 32.559 -15.272 -6.492  1.00 21.91 ? 11  DC  T O2    1 
ATOM   3638 N  N3    . DC  B 2 11  ? 33.806 -14.152 -8.002  1.00 20.35 ? 11  DC  T N3    1 
ATOM   3639 C  C4    . DC  B 2 11  ? 34.940 -14.057 -8.675  1.00 18.23 ? 11  DC  T C4    1 
ATOM   3640 N  N4    . DC  B 2 11  ? 35.067 -13.024 -9.531  1.00 18.83 ? 11  DC  T N4    1 
ATOM   3641 C  C5    . DC  B 2 11  ? 35.999 -15.003 -8.508  1.00 16.24 ? 11  DC  T C5    1 
ATOM   3642 C  C6    . DC  B 2 11  ? 35.809 -16.005 -7.625  1.00 21.93 ? 11  DC  T C6    1 
ATOM   3643 P  P     . DT  B 2 12  ? 33.388 -21.204 -4.770  1.00 17.73 ? 12  DT  T P     1 
ATOM   3644 O  OP1   . DT  B 2 12  ? 32.829 -21.779 -3.525  1.00 19.27 ? 12  DT  T OP1   1 
ATOM   3645 O  OP2   . DT  B 2 12  ? 34.272 -22.019 -5.616  1.00 18.15 ? 12  DT  T OP2   1 
ATOM   3646 O  "O5'" . DT  B 2 12  ? 32.176 -20.682 -5.646  1.00 18.77 ? 12  DT  T "O5'" 1 
ATOM   3647 C  "C5'" . DT  B 2 12  ? 31.061 -20.100 -5.008  1.00 18.24 ? 12  DT  T "C5'" 1 
ATOM   3648 C  "C4'" . DT  B 2 12  ? 30.051 -19.680 -6.036  1.00 21.65 ? 12  DT  T "C4'" 1 
ATOM   3649 O  "O4'" . DT  B 2 12  ? 30.587 -18.557 -6.779  1.00 22.87 ? 12  DT  T "O4'" 1 
ATOM   3650 C  "C3'" . DT  B 2 12  ? 29.722 -20.758 -7.082  1.00 24.67 ? 12  DT  T "C3'" 1 
ATOM   3651 O  "O3'" . DT  B 2 12  ? 28.324 -20.737 -7.374  1.00 26.42 ? 12  DT  T "O3'" 1 
ATOM   3652 C  "C2'" . DT  B 2 12  ? 30.545 -20.317 -8.289  1.00 18.22 ? 12  DT  T "C2'" 1 
ATOM   3653 C  "C1'" . DT  B 2 12  ? 30.396 -18.817 -8.150  1.00 22.13 ? 12  DT  T "C1'" 1 
ATOM   3654 N  N1    . DT  B 2 12  ? 31.352 -18.012 -8.944  1.00 22.74 ? 12  DT  T N1    1 
ATOM   3655 C  C2    . DT  B 2 12  ? 30.949 -16.768 -9.357  1.00 21.86 ? 12  DT  T C2    1 
ATOM   3656 O  O2    . DT  B 2 12  ? 29.859 -16.306 -9.090  1.00 24.90 ? 12  DT  T O2    1 
ATOM   3657 N  N3    . DT  B 2 12  ? 31.860 -16.083 -10.087 1.00 20.00 ? 12  DT  T N3    1 
ATOM   3658 C  C4    . DT  B 2 12  ? 33.118 -16.503 -10.462 1.00 16.49 ? 12  DT  T C4    1 
ATOM   3659 O  O4    . DT  B 2 12  ? 33.864 -15.797 -11.138 1.00 22.00 ? 12  DT  T O4    1 
ATOM   3660 C  C5    . DT  B 2 12  ? 33.494 -17.826 -10.001 1.00 18.95 ? 12  DT  T C5    1 
ATOM   3661 C  C7    . DT  B 2 12  ? 34.845 -18.389 -10.339 1.00 22.97 ? 12  DT  T C7    1 
ATOM   3662 C  C6    . DT  B 2 12  ? 32.599 -18.513 -9.267  1.00 19.86 ? 12  DT  T C6    1 
ATOM   3663 O  "O5'" . DA  C 3 1   ? 29.278 -7.830  -15.288 1.00 37.62 ? 1   DA  P "O5'" 1 
ATOM   3664 C  "C5'" . DA  C 3 1   ? 27.943 -8.039  -15.703 1.00 27.78 ? 1   DA  P "C5'" 1 
ATOM   3665 C  "C4'" . DA  C 3 1   ? 27.077 -8.511  -14.547 1.00 24.77 ? 1   DA  P "C4'" 1 
ATOM   3666 O  "O4'" . DA  C 3 1   ? 27.452 -9.857  -14.169 1.00 31.24 ? 1   DA  P "O4'" 1 
ATOM   3667 C  "C3'" . DA  C 3 1   ? 27.145 -7.663  -13.280 1.00 26.79 ? 1   DA  P "C3'" 1 
ATOM   3668 O  "O3'" . DA  C 3 1   ? 25.853 -7.538  -12.714 1.00 27.13 ? 1   DA  P "O3'" 1 
ATOM   3669 C  "C2'" . DA  C 3 1   ? 28.083 -8.435  -12.359 1.00 30.59 ? 1   DA  P "C2'" 1 
ATOM   3670 C  "C1'" . DA  C 3 1   ? 27.998 -9.880  -12.867 1.00 28.16 ? 1   DA  P "C1'" 1 
ATOM   3671 N  N9    . DA  C 3 1   ? 29.304 -10.523 -12.937 1.00 25.62 ? 1   DA  P N9    1 
ATOM   3672 C  C8    . DA  C 3 1   ? 30.361 -10.160 -13.725 1.00 28.15 ? 1   DA  P C8    1 
ATOM   3673 N  N7    . DA  C 3 1   ? 31.427 -10.913 -13.564 1.00 27.32 ? 1   DA  P N7    1 
ATOM   3674 C  C5    . DA  C 3 1   ? 31.038 -11.834 -12.603 1.00 22.50 ? 1   DA  P C5    1 
ATOM   3675 C  C6    . DA  C 3 1   ? 31.712 -12.915 -11.991 1.00 21.46 ? 1   DA  P C6    1 
ATOM   3676 N  N6    . DA  C 3 1   ? 32.971 -13.263 -12.276 1.00 22.75 ? 1   DA  P N6    1 
ATOM   3677 N  N1    . DA  C 3 1   ? 31.031 -13.631 -11.072 1.00 22.89 ? 1   DA  P N1    1 
ATOM   3678 C  C2    . DA  C 3 1   ? 29.763 -13.293 -10.789 1.00 18.99 ? 1   DA  P C2    1 
ATOM   3679 N  N3    . DA  C 3 1   ? 29.029 -12.304 -11.293 1.00 22.21 ? 1   DA  P N3    1 
ATOM   3680 C  C4    . DA  C 3 1   ? 29.735 -11.605 -12.202 1.00 22.82 ? 1   DA  P C4    1 
ATOM   3681 P  P     . DG  C 3 2   ? 25.530 -6.322  -11.707 1.00 31.77 ? 2   DG  P P     1 
ATOM   3682 O  OP1   . DG  C 3 2   ? 24.076 -6.086  -11.783 1.00 29.78 ? 2   DG  P OP1   1 
ATOM   3683 O  OP2   . DG  C 3 2   ? 26.526 -5.242  -11.914 1.00 32.56 ? 2   DG  P OP2   1 
ATOM   3684 O  "O5'" . DG  C 3 2   ? 25.850 -6.929  -10.278 1.00 26.52 ? 2   DG  P "O5'" 1 
ATOM   3685 C  "C5'" . DG  C 3 2   ? 24.930 -7.798  -9.692  1.00 28.42 ? 2   DG  P "C5'" 1 
ATOM   3686 C  "C4'" . DG  C 3 2   ? 25.574 -8.505  -8.541  1.00 24.36 ? 2   DG  P "C4'" 1 
ATOM   3687 O  "O4'" . DG  C 3 2   ? 26.793 -9.126  -8.990  1.00 25.81 ? 2   DG  P "O4'" 1 
ATOM   3688 C  "C3'" . DG  C 3 2   ? 25.964 -7.581  -7.388  1.00 27.36 ? 2   DG  P "C3'" 1 
ATOM   3689 O  "O3'" . DG  C 3 2   ? 25.322 -8.031  -6.224  1.00 27.22 ? 2   DG  P "O3'" 1 
ATOM   3690 C  "C2'" . DG  C 3 2   ? 27.493 -7.714  -7.301  1.00 25.58 ? 2   DG  P "C2'" 1 
ATOM   3691 C  "C1'" . DG  C 3 2   ? 27.729 -9.063  -7.956  1.00 24.20 ? 2   DG  P "C1'" 1 
ATOM   3692 N  N9    . DG  C 3 2   ? 29.066 -9.234  -8.522  1.00 21.69 ? 2   DG  P N9    1 
ATOM   3693 C  C8    . DG  C 3 2   ? 29.743 -8.369  -9.353  1.00 23.15 ? 2   DG  P C8    1 
ATOM   3694 N  N7    . DG  C 3 2   ? 30.930 -8.797  -9.695  1.00 27.75 ? 2   DG  P N7    1 
ATOM   3695 C  C5    . DG  C 3 2   ? 31.039 -10.034 -9.060  1.00 22.82 ? 2   DG  P C5    1 
ATOM   3696 C  C6    . DG  C 3 2   ? 32.105 -10.965 -9.051  1.00 19.66 ? 2   DG  P C6    1 
ATOM   3697 O  O6    . DG  C 3 2   ? 33.188 -10.891 -9.638  1.00 21.26 ? 2   DG  P O6    1 
ATOM   3698 N  N1    . DG  C 3 2   ? 31.808 -12.085 -8.272  1.00 25.60 ? 2   DG  P N1    1 
ATOM   3699 C  C2    . DG  C 3 2   ? 30.628 -12.271 -7.588  1.00 24.40 ? 2   DG  P C2    1 
ATOM   3700 N  N2    . DG  C 3 2   ? 30.513 -13.415 -6.891  1.00 22.22 ? 2   DG  P N2    1 
ATOM   3701 N  N3    . DG  C 3 2   ? 29.626 -11.405 -7.590  1.00 26.81 ? 2   DG  P N3    1 
ATOM   3702 C  C4    . DG  C 3 2   ? 29.902 -10.311 -8.337  1.00 26.72 ? 2   DG  P C4    1 
ATOM   3703 P  P     . DC  C 3 3   ? 25.570 -7.321  -4.808  1.00 34.25 ? 3   DC  P P     1 
ATOM   3704 O  OP1   . DC  C 3 3   ? 24.268 -7.345  -4.111  1.00 42.12 ? 3   DC  P OP1   1 
ATOM   3705 O  OP2   . DC  C 3 3   ? 26.302 -6.052  -4.981  1.00 36.97 ? 3   DC  P OP2   1 
ATOM   3706 O  "O5'" . DC  C 3 3   ? 26.584 -8.310  -4.066  1.00 37.27 ? 3   DC  P "O5'" 1 
ATOM   3707 C  "C5'" . DC  C 3 3   ? 26.259 -9.684  -3.907  1.00 36.07 ? 3   DC  P "C5'" 1 
ATOM   3708 C  "C4'" . DC  C 3 3   ? 27.442 -10.442 -3.331  1.00 38.73 ? 3   DC  P "C4'" 1 
ATOM   3709 O  "O4'" . DC  C 3 3   ? 28.485 -10.512 -4.326  1.00 35.90 ? 3   DC  P "O4'" 1 
ATOM   3710 C  "C3'" . DC  C 3 3   ? 28.067 -9.798  -2.085  1.00 33.92 ? 3   DC  P "C3'" 1 
ATOM   3711 O  "O3'" . DC  C 3 3   ? 27.887 -10.637 -0.950  1.00 41.11 ? 3   DC  P "O3'" 1 
ATOM   3712 C  "C2'" . DC  C 3 3   ? 29.552 -9.622  -2.426  1.00 38.35 ? 3   DC  P "C2'" 1 
ATOM   3713 C  "C1'" . DC  C 3 3   ? 29.740 -10.441 -3.698  1.00 38.61 ? 3   DC  P "C1'" 1 
ATOM   3714 N  N1    . DC  C 3 3   ? 30.701 -9.806  -4.635  1.00 34.88 ? 3   DC  P N1    1 
ATOM   3715 C  C2    . DC  C 3 3   ? 31.895 -10.455 -4.947  1.00 25.95 ? 3   DC  P C2    1 
ATOM   3716 O  O2    . DC  C 3 3   ? 32.120 -11.569 -4.460  1.00 34.61 ? 3   DC  P O2    1 
ATOM   3717 N  N3    . DC  C 3 3   ? 32.770 -9.848  -5.786  1.00 31.09 ? 3   DC  P N3    1 
ATOM   3718 C  C4    . DC  C 3 3   ? 32.490 -8.646  -6.287  1.00 28.28 ? 3   DC  P C4    1 
ATOM   3719 N  N4    . DC  C 3 3   ? 33.383 -8.092  -7.116  1.00 31.97 ? 3   DC  P N4    1 
ATOM   3720 C  C5    . DC  C 3 3   ? 31.278 -7.965  -5.974  1.00 30.97 ? 3   DC  P C5    1 
ATOM   3721 C  C6    . DC  C 3 3   ? 30.426 -8.571  -5.146  1.00 25.74 ? 3   DC  P C6    1 
ATOM   3722 P  P     . DG  C 3 4   ? 28.470 -10.198 0.482   1.00 37.30 ? 4   DG  P P     1 
ATOM   3723 O  OP1   . DG  C 3 4   ? 27.685 -10.922 1.505   1.00 48.21 ? 4   DG  P OP1   1 
ATOM   3724 O  OP2   . DG  C 3 4   ? 28.600 -8.721  0.534   1.00 37.62 ? 4   DG  P OP2   1 
ATOM   3725 O  "O5'" . DG  C 3 4   ? 29.947 -10.792 0.483   1.00 31.12 ? 4   DG  P "O5'" 1 
ATOM   3726 C  "C5'" . DG  C 3 4   ? 30.138 -12.168 0.216   1.00 30.87 ? 4   DG  P "C5'" 1 
ATOM   3727 C  "C4'" . DG  C 3 4   ? 31.611 -12.515 0.264   1.00 37.23 ? 4   DG  P "C4'" 1 
ATOM   3728 O  "O4'" . DG  C 3 4   ? 32.284 -11.928 -0.877  1.00 36.91 ? 4   DG  P "O4'" 1 
ATOM   3729 C  "C3'" . DG  C 3 4   ? 32.340 -12.006 1.511   1.00 33.81 ? 4   DG  P "C3'" 1 
ATOM   3730 O  "O3'" . DG  C 3 4   ? 33.070 -13.065 2.097   1.00 38.28 ? 4   DG  P "O3'" 1 
ATOM   3731 C  "C2'" . DG  C 3 4   ? 33.256 -10.903 0.984   1.00 30.23 ? 4   DG  P "C2'" 1 
ATOM   3732 C  "C1'" . DG  C 3 4   ? 33.484 -11.327 -0.459  1.00 28.69 ? 4   DG  P "C1'" 1 
ATOM   3733 N  N9    . DG  C 3 4   ? 33.764 -10.206 -1.349  1.00 27.82 ? 4   DG  P N9    1 
ATOM   3734 C  C8    . DG  C 3 4   ? 32.962 -9.116  -1.586  1.00 25.41 ? 4   DG  P C8    1 
ATOM   3735 N  N7    . DG  C 3 4   ? 33.466 -8.275  -2.442  1.00 26.48 ? 4   DG  P N7    1 
ATOM   3736 C  C5    . DG  C 3 4   ? 34.683 -8.841  -2.790  1.00 23.18 ? 4   DG  P C5    1 
ATOM   3737 C  C6    . DG  C 3 4   ? 35.671 -8.383  -3.683  1.00 23.22 ? 4   DG  P C6    1 
ATOM   3738 O  O6    . DG  C 3 4   ? 35.676 -7.344  -4.352  1.00 27.03 ? 4   DG  P O6    1 
ATOM   3739 N  N1    . DG  C 3 4   ? 36.754 -9.267  -3.750  1.00 22.61 ? 4   DG  P N1    1 
ATOM   3740 C  C2    . DG  C 3 4   ? 36.850 -10.442 -3.042  1.00 22.93 ? 4   DG  P C2    1 
ATOM   3741 N  N2    . DG  C 3 4   ? 37.966 -11.164 -3.231  1.00 22.67 ? 4   DG  P N2    1 
ATOM   3742 N  N3    . DG  C 3 4   ? 35.918 -10.886 -2.207  1.00 21.34 ? 4   DG  P N3    1 
ATOM   3743 C  C4    . DG  C 3 4   ? 34.872 -10.036 -2.132  1.00 25.57 ? 4   DG  P C4    1 
ATOM   3744 P  P     . DT  C 3 5   ? 33.735 -12.891 3.549   1.00 39.22 ? 5   DT  P P     1 
ATOM   3745 O  OP1   . DT  C 3 5   ? 33.554 -14.172 4.264   1.00 38.86 ? 5   DT  P OP1   1 
ATOM   3746 O  OP2   . DT  C 3 5   ? 33.297 -11.615 4.142   1.00 31.73 ? 5   DT  P OP2   1 
ATOM   3747 O  "O5'" . DT  C 3 5   ? 35.282 -12.713 3.220   1.00 33.02 ? 5   DT  P "O5'" 1 
ATOM   3748 C  "C5'" . DT  C 3 5   ? 35.908 -13.624 2.362   1.00 27.93 ? 5   DT  P "C5'" 1 
ATOM   3749 C  "C4'" . DT  C 3 5   ? 37.288 -13.132 2.001   1.00 22.38 ? 5   DT  P "C4'" 1 
ATOM   3750 O  "O4'" . DT  C 3 5   ? 37.190 -12.063 1.042   1.00 21.46 ? 5   DT  P "O4'" 1 
ATOM   3751 C  "C3'" . DT  C 3 5   ? 38.104 -12.582 3.172   1.00 20.45 ? 5   DT  P "C3'" 1 
ATOM   3752 O  "O3'" . DT  C 3 5   ? 39.298 -13.322 3.256   1.00 17.82 ? 5   DT  P "O3'" 1 
ATOM   3753 C  "C2'" . DT  C 3 5   ? 38.371 -11.110 2.793   1.00 18.21 ? 5   DT  P "C2'" 1 
ATOM   3754 C  "C1'" . DT  C 3 5   ? 38.233 -11.147 1.289   1.00 17.96 ? 5   DT  P "C1'" 1 
ATOM   3755 N  N1    . DT  C 3 5   ? 37.834 -9.866  0.672   1.00 17.76 ? 5   DT  P N1    1 
ATOM   3756 C  C2    . DT  C 3 5   ? 38.652 -9.297  -0.276  1.00 17.32 ? 5   DT  P C2    1 
ATOM   3757 O  O2    . DT  C 3 5   ? 39.727 -9.770  -0.607  1.00 18.67 ? 5   DT  P O2    1 
ATOM   3758 N  N3    . DT  C 3 5   ? 38.175 -8.137  -0.824  1.00 18.39 ? 5   DT  P N3    1 
ATOM   3759 C  C4    . DT  C 3 5   ? 36.983 -7.508  -0.538  1.00 18.62 ? 5   DT  P C4    1 
ATOM   3760 O  O4    . DT  C 3 5   ? 36.649 -6.459  -1.094  1.00 21.07 ? 5   DT  P O4    1 
ATOM   3761 C  C5    . DT  C 3 5   ? 36.163 -8.160  0.462   1.00 20.26 ? 5   DT  P C5    1 
ATOM   3762 C  C7    . DT  C 3 5   ? 34.850 -7.567  0.868   1.00 23.52 ? 5   DT  P C7    1 
ATOM   3763 C  C6    . DT  C 3 5   ? 36.620 -9.300  1.011   1.00 20.28 ? 5   DT  P C6    1 
ATOM   3764 P  P     . DC  C 3 6   ? 40.275 -13.185 4.521   1.00 17.41 ? 6   DC  P P     1 
ATOM   3765 O  OP1   . DC  C 3 6   ? 40.981 -14.496 4.589   1.00 16.66 ? 6   DC  P OP1   1 
ATOM   3766 O  OP2   . DC  C 3 6   ? 39.565 -12.636 5.690   1.00 18.33 ? 6   DC  P OP2   1 
ATOM   3767 O  "O5'" . DC  C 3 6   ? 41.306 -12.062 4.070   1.00 15.88 ? 6   DC  P "O5'" 1 
ATOM   3768 C  "C5'" . DC  C 3 6   ? 42.161 -12.297 2.979   1.00 13.07 ? 6   DC  P "C5'" 1 
ATOM   3769 C  "C4'" . DC  C 3 6   ? 42.880 -11.022 2.636   1.00 16.30 ? 6   DC  P "C4'" 1 
ATOM   3770 O  "O4'" . DC  C 3 6   ? 41.959 -10.109 2.019   1.00 17.50 ? 6   DC  P "O4'" 1 
ATOM   3771 C  "C3'" . DC  C 3 6   ? 43.466 -10.277 3.839   1.00 13.27 ? 6   DC  P "C3'" 1 
ATOM   3772 O  "O3'" . DC  C 3 6   ? 44.884 -10.440 3.800   1.00 14.19 ? 6   DC  P "O3'" 1 
ATOM   3773 C  "C2'" . DC  C 3 6   ? 43.038 -8.806  3.617   1.00 16.29 ? 6   DC  P "C2'" 1 
ATOM   3774 C  "C1'" . DC  C 3 6   ? 42.464 -8.821  2.198   1.00 15.17 ? 6   DC  P "C1'" 1 
ATOM   3775 N  N1    . DC  C 3 6   ? 41.356 -7.858  1.994   1.00 12.74 ? 6   DC  P N1    1 
ATOM   3776 C  C2    . DC  C 3 6   ? 41.437 -6.921  0.962   1.00 14.38 ? 6   DC  P C2    1 
ATOM   3777 O  O2    . DC  C 3 6   ? 42.433 -6.923  0.229   1.00 14.99 ? 6   DC  P O2    1 
ATOM   3778 N  N3    . DC  C 3 6   ? 40.408 -6.039  0.791   1.00 16.44 ? 6   DC  P N3    1 
ATOM   3779 C  C4    . DC  C 3 6   ? 39.352 -6.075  1.606   1.00 18.00 ? 6   DC  P C4    1 
ATOM   3780 N  N4    . DC  C 3 6   ? 38.366 -5.186  1.402   1.00 20.86 ? 6   DC  P N4    1 
ATOM   3781 C  C5    . DC  C 3 6   ? 39.252 -7.022  2.665   1.00 15.40 ? 6   DC  P C5    1 
ATOM   3782 C  C6    . DC  C 3 6   ? 40.267 -7.891  2.821   1.00 14.80 ? 6   DC  P C6    1 
ATOM   3783 P  P     . DA  C 3 7   ? 45.855 -9.700  4.840   1.00 15.72 ? 7   DA  P P     1 
ATOM   3784 O  OP1   . DA  C 3 7   ? 47.088 -10.511 4.958   1.00 15.73 ? 7   DA  P OP1   1 
ATOM   3785 O  OP2   . DA  C 3 7   ? 45.092 -9.342  6.053   1.00 17.20 ? 7   DA  P OP2   1 
ATOM   3786 O  "O5'" . DA  C 3 7   ? 46.170 -8.300  4.139   1.00 16.58 ? 7   DA  P "O5'" 1 
ATOM   3787 C  "C5'" . DA  C 3 7   ? 46.831 -8.235  2.896   1.00 20.78 ? 7   DA  P "C5'" 1 
ATOM   3788 C  "C4'" . DA  C 3 7   ? 46.740 -6.818  2.345   1.00 20.18 ? 7   DA  P "C4'" 1 
ATOM   3789 O  "O4'" . DA  C 3 7   ? 45.373 -6.533  1.968   1.00 18.69 ? 7   DA  P "O4'" 1 
ATOM   3790 C  "C3'" . DA  C 3 7   ? 47.011 -5.704  3.345   1.00 24.17 ? 7   DA  P "C3'" 1 
ATOM   3791 O  "O3'" . DA  C 3 7   ? 48.444 -5.561  3.693   1.00 32.45 ? 7   DA  P "O3'" 1 
ATOM   3792 C  "C2'" . DA  C 3 7   ? 46.411 -4.502  2.636   1.00 23.93 ? 7   DA  P "C2'" 1 
ATOM   3793 C  "C1'" . DA  C 3 7   ? 45.250 -5.117  1.875   1.00 21.97 ? 7   DA  P "C1'" 1 
ATOM   3794 N  N9    . DA  C 3 7   ? 43.952 -4.676  2.359   1.00 16.69 ? 7   DA  P N9    1 
ATOM   3795 C  C8    . DA  C 3 7   ? 43.173 -5.238  3.333   1.00 18.00 ? 7   DA  P C8    1 
ATOM   3796 N  N7    . DA  C 3 7   ? 42.030 -4.605  3.522   1.00 19.14 ? 7   DA  P N7    1 
ATOM   3797 C  C5    . DA  C 3 7   ? 42.084 -3.548  2.619   1.00 19.17 ? 7   DA  P C5    1 
ATOM   3798 C  C6    . DA  C 3 7   ? 41.190 -2.496  2.328   1.00 23.09 ? 7   DA  P C6    1 
ATOM   3799 N  N6    . DA  C 3 7   ? 40.014 -2.344  2.939   1.00 25.45 ? 7   DA  P N6    1 
ATOM   3800 N  N1    . DA  C 3 7   ? 41.555 -1.611  1.369   1.00 18.81 ? 7   DA  P N1    1 
ATOM   3801 C  C2    . DA  C 3 7   ? 42.739 -1.771  0.759   1.00 17.95 ? 7   DA  P C2    1 
ATOM   3802 N  N3    . DA  C 3 7   ? 43.662 -2.720  0.957   1.00 18.91 ? 7   DA  P N3    1 
ATOM   3803 C  C4    . DA  C 3 7   ? 43.263 -3.578  1.906   1.00 19.02 ? 7   DA  P C4    1 
ATOM   3804 P  P     A DT  C 3 8   ? 49.577 -5.021  2.689   0.46 29.35 ? 8   DT  P P     1 
ATOM   3805 P  P     B DT  C 3 8   ? 49.034 -4.187  4.321   0.54 25.24 ? 8   DT  P P     1 
ATOM   3806 O  OP1   A DT  C 3 8   ? 49.393 -5.515  1.319   0.46 25.48 ? 8   DT  P OP1   1 
ATOM   3807 O  OP1   B DT  C 3 8   ? 50.507 -4.300  4.376   0.54 21.55 ? 8   DT  P OP1   1 
ATOM   3808 O  OP2   A DT  C 3 8   ? 50.840 -5.307  3.401   0.46 28.49 ? 8   DT  P OP2   1 
ATOM   3809 O  OP2   B DT  C 3 8   ? 48.274 -3.856  5.554   0.54 17.05 ? 8   DT  P OP2   1 
ATOM   3810 O  "O5'" A DT  C 3 8   ? 49.364 -3.450  2.712   0.46 24.34 ? 8   DT  P "O5'" 1 
ATOM   3811 O  "O5'" B DT  C 3 8   ? 48.645 -3.014  3.293   0.54 28.24 ? 8   DT  P "O5'" 1 
ATOM   3812 C  "C5'" A DT  C 3 8   ? 49.546 -2.750  1.554   0.46 24.63 ? 8   DT  P "C5'" 1 
ATOM   3813 C  "C5'" B DT  C 3 8   ? 49.343 -2.760  2.040   0.54 25.12 ? 8   DT  P "C5'" 1 
ATOM   3814 C  "C4'" . DT  C 3 8   ? 49.017 -1.330  1.651   1.00 19.90 ? 8   DT  P "C4'" 1 
ATOM   3815 O  "O4'" . DT  C 3 8   ? 47.582 -1.246  1.748   1.00 19.69 ? 8   DT  P "O4'" 1 
ATOM   3816 C  "C3'" . DT  C 3 8   ? 49.589 -0.385  2.704   1.00 23.62 ? 8   DT  P "C3'" 1 
ATOM   3817 O  "O3'" . DT  C 3 8   ? 50.317 0.624   2.073   1.00 17.87 ? 8   DT  P "O3'" 1 
ATOM   3818 C  "C2'" . DT  C 3 8   ? 48.355 0.171   3.441   1.00 22.63 ? 8   DT  P "C2'" 1 
ATOM   3819 C  "C1'" . DT  C 3 8   ? 47.230 -0.066  2.446   1.00 24.08 ? 8   DT  P "C1'" 1 
ATOM   3820 N  N1    . DT  C 3 8   ? 45.893 -0.265  3.102   1.00 19.96 ? 8   DT  P N1    1 
ATOM   3821 C  C2    . DT  C 3 8   ? 44.849 0.589   2.796   1.00 16.40 ? 8   DT  P C2    1 
ATOM   3822 O  O2    . DT  C 3 8   ? 44.946 1.507   2.010   1.00 23.89 ? 8   DT  P O2    1 
ATOM   3823 N  N3    . DT  C 3 8   ? 43.675 0.321   3.456   1.00 21.63 ? 8   DT  P N3    1 
ATOM   3824 C  C4    . DT  C 3 8   ? 43.443 -0.682  4.369   1.00 21.75 ? 8   DT  P C4    1 
ATOM   3825 O  O4    . DT  C 3 8   ? 42.354 -0.840  4.907   1.00 23.49 ? 8   DT  P O4    1 
ATOM   3826 C  C5    . DT  C 3 8   ? 44.575 -1.532  4.654   1.00 19.44 ? 8   DT  P C5    1 
ATOM   3827 C  C7    . DT  C 3 8   ? 44.436 -2.664  5.630   1.00 23.32 ? 8   DT  P C7    1 
ATOM   3828 C  C6    . DT  C 3 8   ? 45.730 -1.284  4.011   1.00 19.70 ? 8   DT  P C6    1 
HETATM 3829 MG MG    A MG  D 4 .   ? 52.653 0.311   2.096   0.90 18.27 ? 501 MG  A MG    1 
HETATM 3830 CA CA    A CA  E 5 .   ? 54.630 2.640   3.837   0.55 10.74 ? 502 CA  A CA    1 
HETATM 3831 MG MG    B MG  F 4 .   ? 54.630 2.639   3.840   0.45 10.81 ? 503 MG  A MG    1 
HETATM 3832 C  C1    . GOL G 6 .   ? 60.400 -24.858 12.035  1.00 22.65 ? 504 GOL A C1    1 
HETATM 3833 O  O1    . GOL G 6 .   ? 59.072 -24.707 12.399  1.00 17.75 ? 504 GOL A O1    1 
HETATM 3834 C  C2    . GOL G 6 .   ? 60.422 -24.506 10.559  1.00 24.69 ? 504 GOL A C2    1 
HETATM 3835 O  O2    . GOL G 6 .   ? 60.523 -23.113 10.482  1.00 17.29 ? 504 GOL A O2    1 
HETATM 3836 C  C3    . GOL G 6 .   ? 61.521 -25.223 9.781   1.00 31.23 ? 504 GOL A C3    1 
HETATM 3837 O  O3    . GOL G 6 .   ? 61.427 -24.866 8.419   1.00 18.28 ? 504 GOL A O3    1 
HETATM 3838 C  C1    . GOL H 6 .   ? 54.159 28.099  4.629   1.00 30.16 ? 505 GOL A C1    1 
HETATM 3839 O  O1    . GOL H 6 .   ? 52.798 27.852  4.324   1.00 27.24 ? 505 GOL A O1    1 
HETATM 3840 C  C2    . GOL H 6 .   ? 54.659 27.078  5.649   1.00 37.22 ? 505 GOL A C2    1 
HETATM 3841 O  O2    . GOL H 6 .   ? 53.942 25.866  5.515   1.00 38.67 ? 505 GOL A O2    1 
HETATM 3842 C  C3    . GOL H 6 .   ? 56.143 26.813  5.433   1.00 33.87 ? 505 GOL A C3    1 
HETATM 3843 O  O3    . GOL H 6 .   ? 56.684 26.054  6.503   1.00 27.54 ? 505 GOL A O3    1 
HETATM 3844 P  PG    . DTP I 7 .   ? 55.136 2.690   7.269   1.00 11.81 ? 506 DTP A PG    1 
HETATM 3845 O  O1G   . DTP I 7 .   ? 55.048 2.013   5.929   1.00 12.20 ? 506 DTP A O1G   1 
HETATM 3846 O  O2G   . DTP I 7 .   ? 56.459 3.387   7.470   1.00 13.31 ? 506 DTP A O2G   1 
HETATM 3847 O  O3G   . DTP I 7 .   ? 54.838 1.746   8.430   1.00 12.81 ? 506 DTP A O3G   1 
HETATM 3848 P  PB    . DTP I 7 .   ? 52.958 4.223   6.214   1.00 11.52 ? 506 DTP A PB    1 
HETATM 3849 O  O1B   . DTP I 7 .   ? 53.673 4.421   4.897   1.00 10.99 ? 506 DTP A O1B   1 
HETATM 3850 O  O2B   . DTP I 7 .   ? 52.242 5.476   6.673   1.00 12.28 ? 506 DTP A O2B   1 
HETATM 3851 O  O3B   . DTP I 7 .   ? 54.002 3.818   7.369   1.00 10.09 ? 506 DTP A O3B   1 
HETATM 3852 P  PA    . DTP I 7 .   ? 51.389 2.178   4.929   1.00 12.30 ? 506 DTP A PA    1 
HETATM 3853 O  O1A   . DTP I 7 .   ? 52.509 1.664   4.088   1.00 12.86 ? 506 DTP A O1A   1 
HETATM 3854 O  O2A   . DTP I 7 .   ? 50.556 1.075   5.550   1.00 16.61 ? 506 DTP A O2A   1 
HETATM 3855 O  O3A   . DTP I 7 .   ? 51.914 3.029   6.170   1.00 12.23 ? 506 DTP A O3A   1 
HETATM 3856 O  "O5'" . DTP I 7 .   ? 50.382 3.068   4.097   1.00 11.22 ? 506 DTP A "O5'" 1 
HETATM 3857 C  "C5'" . DTP I 7 .   ? 50.838 4.036   3.193   1.00 13.38 ? 506 DTP A "C5'" 1 
HETATM 3858 C  "C4'" . DTP I 7 .   ? 49.921 5.253   3.255   1.00 11.20 ? 506 DTP A "C4'" 1 
HETATM 3859 O  "O4'" . DTP I 7 .   ? 48.646 4.853   2.829   1.00 13.58 ? 506 DTP A "O4'" 1 
HETATM 3860 C  "C3'" . DTP I 7 .   ? 49.790 5.828   4.587   1.00 9.50  ? 506 DTP A "C3'" 1 
HETATM 3861 O  "O3'" . DTP I 7 .   ? 50.805 6.840   4.788   1.00 11.07 ? 506 DTP A "O3'" 1 
HETATM 3862 C  "C2'" . DTP I 7 .   ? 48.425 6.395   4.603   1.00 11.02 ? 506 DTP A "C2'" 1 
HETATM 3863 C  "C1'" . DTP I 7 .   ? 47.678 5.513   3.660   1.00 12.52 ? 506 DTP A "C1'" 1 
HETATM 3864 N  N9    . DTP I 7 .   ? 46.930 4.517   4.356   1.00 12.78 ? 506 DTP A N9    1 
HETATM 3865 C  C8    . DTP I 7 .   ? 47.360 3.327   4.844   1.00 14.86 ? 506 DTP A C8    1 
HETATM 3866 N  N7    . DTP I 7 .   ? 46.362 2.675   5.431   1.00 16.39 ? 506 DTP A N7    1 
HETATM 3867 C  C5    . DTP I 7 .   ? 45.247 3.410   5.315   1.00 14.22 ? 506 DTP A C5    1 
HETATM 3868 C  C6    . DTP I 7 .   ? 43.924 3.266   5.713   1.00 15.78 ? 506 DTP A C6    1 
HETATM 3869 N  N6    . DTP I 7 .   ? 43.506 2.098   6.415   1.00 18.49 ? 506 DTP A N6    1 
HETATM 3870 N  N1    . DTP I 7 .   ? 43.049 4.226   5.442   1.00 13.94 ? 506 DTP A N1    1 
HETATM 3871 C  C2    . DTP I 7 .   ? 43.392 5.348   4.776   1.00 12.33 ? 506 DTP A C2    1 
HETATM 3872 N  N3    . DTP I 7 .   ? 44.674 5.529   4.369   1.00 13.74 ? 506 DTP A N3    1 
HETATM 3873 C  C4    . DTP I 7 .   ? 45.595 4.588   4.639   1.00 11.21 ? 506 DTP A C4    1 
HETATM 3874 K  K     B K   J 8 .   ? 52.653 0.311   2.096   0.10 17.79 ? 507 K   A K     1 
HETATM 3875 O  O     . HOH K 9 .   ? 80.363 -15.981 7.398   1.00 36.41 ? 601 HOH A O     1 
HETATM 3876 O  O     . HOH K 9 .   ? 57.568 11.960  -12.240 1.00 32.84 ? 602 HOH A O     1 
HETATM 3877 O  O     . HOH K 9 .   ? 68.181 -15.732 -7.758  1.00 24.43 ? 603 HOH A O     1 
HETATM 3878 O  O     . HOH K 9 .   ? 31.596 -1.450  -2.808  1.00 35.71 ? 604 HOH A O     1 
HETATM 3879 O  O     . HOH K 9 .   ? 43.755 -33.122 5.663   1.00 33.36 ? 605 HOH A O     1 
HETATM 3880 O  O     . HOH K 9 .   ? 30.442 1.297   3.372   1.00 39.49 ? 606 HOH A O     1 
HETATM 3881 O  O     . HOH K 9 .   ? 60.157 6.106   -15.575 1.00 25.72 ? 607 HOH A O     1 
HETATM 3882 O  O     . HOH K 9 .   ? 45.744 20.526  11.501  1.00 24.70 ? 608 HOH A O     1 
HETATM 3883 O  O     . HOH K 9 .   ? 24.578 -7.959  -0.768  1.00 50.90 ? 609 HOH A O     1 
HETATM 3884 O  O     . HOH K 9 .   ? 37.312 15.018  -20.228 1.00 37.88 ? 610 HOH A O     1 
HETATM 3885 O  O     . HOH K 9 .   ? 29.035 9.675   -26.624 1.00 45.16 ? 611 HOH A O     1 
HETATM 3886 O  O     . HOH K 9 .   ? 48.194 -36.645 2.547   1.00 24.30 ? 612 HOH A O     1 
HETATM 3887 O  O     . HOH K 9 .   ? 70.141 0.503   11.508  1.00 27.31 ? 613 HOH A O     1 
HETATM 3888 O  O     . HOH K 9 .   ? 57.079 -34.678 8.644   1.00 32.44 ? 614 HOH A O     1 
HETATM 3889 O  O     . HOH K 9 .   ? 50.573 17.576  -5.727  1.00 28.58 ? 615 HOH A O     1 
HETATM 3890 O  O     . HOH K 9 .   ? 62.640 9.555   -13.367 1.00 31.20 ? 616 HOH A O     1 
HETATM 3891 O  O     . HOH K 9 .   ? 32.847 10.751  5.445   1.00 22.35 ? 617 HOH A O     1 
HETATM 3892 O  O     . HOH K 9 .   ? 52.869 24.046  4.143   1.00 30.19 ? 618 HOH A O     1 
HETATM 3893 O  O     . HOH K 9 .   ? 40.938 14.050  -6.283  1.00 34.26 ? 619 HOH A O     1 
HETATM 3894 O  O     . HOH K 9 .   ? 34.158 5.884   -21.693 1.00 28.60 ? 620 HOH A O     1 
HETATM 3895 O  O     . HOH K 9 .   ? 45.312 18.050  -3.539  1.00 28.83 ? 621 HOH A O     1 
HETATM 3896 O  O     . HOH K 9 .   ? 65.251 -6.756  -13.894 1.00 20.70 ? 622 HOH A O     1 
HETATM 3897 O  O     . HOH K 9 .   ? 52.704 -19.617 22.021  1.00 33.81 ? 623 HOH A O     1 
HETATM 3898 O  O     . HOH K 9 .   ? 60.454 -0.219  -16.120 1.00 40.08 ? 624 HOH A O     1 
HETATM 3899 O  O     . HOH K 9 .   ? 60.324 -27.936 8.750   1.00 31.58 ? 625 HOH A O     1 
HETATM 3900 O  O     . HOH K 9 .   ? 27.588 6.741   -16.950 1.00 26.02 ? 626 HOH A O     1 
HETATM 3901 O  O     . HOH K 9 .   ? 65.376 5.728   2.339   1.00 19.42 ? 627 HOH A O     1 
HETATM 3902 O  O     . HOH K 9 .   ? 34.684 5.680   2.131   1.00 21.51 ? 628 HOH A O     1 
HETATM 3903 O  O     . HOH K 9 .   ? 60.832 -15.767 13.705  1.00 27.99 ? 629 HOH A O     1 
HETATM 3904 O  O     . HOH K 9 .   ? 47.951 10.968  -13.670 1.00 29.81 ? 630 HOH A O     1 
HETATM 3905 O  O     . HOH K 9 .   ? 65.188 -9.181  12.254  1.00 37.62 ? 631 HOH A O     1 
HETATM 3906 O  O     . HOH K 9 .   ? 49.900 -27.610 18.587  1.00 21.54 ? 632 HOH A O     1 
HETATM 3907 O  O     . HOH K 9 .   ? 69.583 -13.014 -11.586 1.00 27.64 ? 633 HOH A O     1 
HETATM 3908 O  O     . HOH K 9 .   ? 53.796 15.279  -6.672  1.00 19.44 ? 634 HOH A O     1 
HETATM 3909 O  O     . HOH K 9 .   ? 48.036 -33.173 -3.567  1.00 27.30 ? 635 HOH A O     1 
HETATM 3910 O  O     . HOH K 9 .   ? 36.867 16.014  -4.146  1.00 21.88 ? 636 HOH A O     1 
HETATM 3911 O  O     . HOH K 9 .   ? 48.321 -6.202  -11.830 1.00 40.11 ? 637 HOH A O     1 
HETATM 3912 O  O     . HOH K 9 .   ? 41.143 16.929  -14.706 1.00 23.38 ? 638 HOH A O     1 
HETATM 3913 O  O     . HOH K 9 .   ? 75.037 0.312   -3.816  1.00 31.04 ? 639 HOH A O     1 
HETATM 3914 O  O     . HOH K 9 .   ? 53.193 19.482  -1.424  1.00 24.47 ? 640 HOH A O     1 
HETATM 3915 O  O     . HOH K 9 .   ? 62.468 -17.053 -7.155  1.00 26.40 ? 641 HOH A O     1 
HETATM 3916 O  O     . HOH K 9 .   ? 64.934 -34.642 -5.916  1.00 34.49 ? 642 HOH A O     1 
HETATM 3917 O  O     . HOH K 9 .   ? 59.647 13.949  -8.691  1.00 19.07 ? 643 HOH A O     1 
HETATM 3918 O  O     . HOH K 9 .   ? 71.860 -3.977  -13.964 1.00 27.32 ? 644 HOH A O     1 
HETATM 3919 O  O     . HOH K 9 .   ? 57.685 -23.355 14.169  1.00 11.80 ? 645 HOH A O     1 
HETATM 3920 O  O     . HOH K 9 .   ? 77.701 3.294   -1.230  1.00 44.28 ? 646 HOH A O     1 
HETATM 3921 O  O     . HOH K 9 .   ? 56.169 -13.947 -5.807  1.00 14.95 ? 647 HOH A O     1 
HETATM 3922 O  O     . HOH K 9 .   ? 53.208 -28.177 15.302  1.00 19.00 ? 648 HOH A O     1 
HETATM 3923 O  O     . HOH K 9 .   ? 49.479 -9.356  -8.314  1.00 22.96 ? 649 HOH A O     1 
HETATM 3924 O  O     . HOH K 9 .   ? 50.235 -12.913 -0.750  1.00 24.11 ? 650 HOH A O     1 
HETATM 3925 O  O     . HOH K 9 .   ? 52.175 20.168  4.981   1.00 19.05 ? 651 HOH A O     1 
HETATM 3926 O  O     . HOH K 9 .   ? 48.969 2.798   21.185  1.00 22.01 ? 652 HOH A O     1 
HETATM 3927 O  O     . HOH K 9 .   ? 42.478 13.070  -23.657 1.00 27.79 ? 653 HOH A O     1 
HETATM 3928 O  O     . HOH K 9 .   ? 36.089 -0.769  -24.496 1.00 44.68 ? 654 HOH A O     1 
HETATM 3929 O  O     . HOH K 9 .   ? 40.920 7.610   -18.459 1.00 18.05 ? 655 HOH A O     1 
HETATM 3930 O  O     . HOH K 9 .   ? 21.937 -4.337  3.374   1.00 49.15 ? 656 HOH A O     1 
HETATM 3931 O  O     . HOH K 9 .   ? 54.620 -0.617  5.862   1.00 24.15 ? 657 HOH A O     1 
HETATM 3932 O  O     . HOH K 9 .   ? 57.055 -16.461 -11.297 1.00 24.26 ? 658 HOH A O     1 
HETATM 3933 O  O     . HOH K 9 .   ? 30.703 1.698   -22.008 1.00 27.88 ? 659 HOH A O     1 
HETATM 3934 O  O     . HOH K 9 .   ? 53.607 -28.441 4.205   1.00 15.48 ? 660 HOH A O     1 
HETATM 3935 O  O     . HOH K 9 .   ? 37.232 13.568  21.682  1.00 33.13 ? 661 HOH A O     1 
HETATM 3936 O  O     . HOH K 9 .   ? 45.602 2.035   18.001  1.00 30.87 ? 662 HOH A O     1 
HETATM 3937 O  O     . HOH K 9 .   ? 67.304 -6.434  12.710  1.00 26.50 ? 663 HOH A O     1 
HETATM 3938 O  O     . HOH K 9 .   ? 57.702 -7.485  8.151   1.00 23.64 ? 664 HOH A O     1 
HETATM 3939 O  O     . HOH K 9 .   ? 34.610 17.579  -12.679 1.00 30.62 ? 665 HOH A O     1 
HETATM 3940 O  O     . HOH K 9 .   ? 52.342 -5.572  -0.844  1.00 21.93 ? 666 HOH A O     1 
HETATM 3941 O  O     . HOH K 9 .   ? 41.014 6.547   18.995  1.00 20.41 ? 667 HOH A O     1 
HETATM 3942 O  O     . HOH K 9 .   ? 52.477 3.768   18.032  1.00 26.01 ? 668 HOH A O     1 
HETATM 3943 O  O     . HOH K 9 .   ? 70.921 3.568   -0.384  1.00 18.06 ? 669 HOH A O     1 
HETATM 3944 O  O     . HOH K 9 .   ? 67.234 -8.318  9.786   1.00 22.85 ? 670 HOH A O     1 
HETATM 3945 O  O     . HOH K 9 .   ? 46.973 -0.374  -8.328  1.00 25.18 ? 671 HOH A O     1 
HETATM 3946 O  O     . HOH K 9 .   ? 52.135 15.753  -4.636  1.00 16.00 ? 672 HOH A O     1 
HETATM 3947 O  O     . HOH K 9 .   ? 58.171 -12.141 -11.429 1.00 15.71 ? 673 HOH A O     1 
HETATM 3948 O  O     . HOH K 9 .   ? 43.813 11.038  -12.307 1.00 21.54 ? 674 HOH A O     1 
HETATM 3949 O  O     . HOH K 9 .   ? 61.469 -17.671 -12.961 1.00 37.25 ? 675 HOH A O     1 
HETATM 3950 O  O     . HOH K 9 .   ? 72.153 -7.680  11.599  1.00 19.36 ? 676 HOH A O     1 
HETATM 3951 O  O     . HOH K 9 .   ? 39.407 -2.140  -14.218 1.00 26.64 ? 677 HOH A O     1 
HETATM 3952 O  O     . HOH K 9 .   ? 58.189 -17.998 19.731  1.00 25.53 ? 678 HOH A O     1 
HETATM 3953 O  O     . HOH K 9 .   ? 62.237 14.759  -9.134  1.00 15.20 ? 679 HOH A O     1 
HETATM 3954 O  O     . HOH K 9 .   ? 51.841 5.809   9.320   1.00 14.52 ? 680 HOH A O     1 
HETATM 3955 O  O     . HOH K 9 .   ? 55.255 17.447  -0.615  1.00 14.44 ? 681 HOH A O     1 
HETATM 3956 O  O     . HOH K 9 .   ? 72.969 2.199   7.829   1.00 27.90 ? 682 HOH A O     1 
HETATM 3957 O  O     . HOH K 9 .   ? 61.343 -31.705 -10.341 1.00 38.88 ? 683 HOH A O     1 
HETATM 3958 O  O     . HOH K 9 .   ? 77.891 -0.940  5.255   1.00 24.79 ? 684 HOH A O     1 
HETATM 3959 O  O     . HOH K 9 .   ? 62.918 12.868  -10.763 1.00 25.06 ? 685 HOH A O     1 
HETATM 3960 O  O     . HOH K 9 .   ? 43.265 -33.133 -0.526  1.00 19.08 ? 686 HOH A O     1 
HETATM 3961 O  O     . HOH K 9 .   ? 43.052 -25.558 17.392  1.00 32.48 ? 687 HOH A O     1 
HETATM 3962 O  O     . HOH K 9 .   ? 47.450 15.903  -17.759 1.00 37.09 ? 688 HOH A O     1 
HETATM 3963 O  O     . HOH K 9 .   ? 64.300 -24.385 -7.937  1.00 42.26 ? 689 HOH A O     1 
HETATM 3964 O  O     . HOH K 9 .   ? 40.942 -29.807 13.080  1.00 32.89 ? 690 HOH A O     1 
HETATM 3965 O  O     . HOH K 9 .   ? 78.837 3.346   1.787   1.00 32.61 ? 691 HOH A O     1 
HETATM 3966 O  O     . HOH K 9 .   ? 50.282 -34.645 -0.737  1.00 20.17 ? 692 HOH A O     1 
HETATM 3967 O  O     . HOH K 9 .   ? 63.883 -3.344  5.986   1.00 13.22 ? 693 HOH A O     1 
HETATM 3968 O  O     . HOH K 9 .   ? 40.454 11.427  -3.465  1.00 15.67 ? 694 HOH A O     1 
HETATM 3969 O  O     . HOH K 9 .   ? 62.995 -26.508 6.931   1.00 19.25 ? 695 HOH A O     1 
HETATM 3970 O  O     . HOH K 9 .   ? 38.697 -19.842 12.301  1.00 30.86 ? 696 HOH A O     1 
HETATM 3971 O  O     . HOH K 9 .   ? 52.719 -26.306 -3.875  1.00 22.59 ? 697 HOH A O     1 
HETATM 3972 O  O     . HOH K 9 .   ? 40.337 8.766   27.083  1.00 23.42 ? 698 HOH A O     1 
HETATM 3973 O  O     . HOH K 9 .   ? 68.565 16.232  -3.973  1.00 16.29 ? 699 HOH A O     1 
HETATM 3974 O  O     . HOH K 9 .   ? 49.223 17.452  -11.330 1.00 34.01 ? 700 HOH A O     1 
HETATM 3975 O  O     . HOH K 9 .   ? 49.637 -15.786 -8.873  1.00 30.15 ? 701 HOH A O     1 
HETATM 3976 O  O     . HOH K 9 .   ? 50.970 0.529   -15.936 1.00 25.87 ? 702 HOH A O     1 
HETATM 3977 O  O     . HOH K 9 .   ? 60.660 -23.446 6.222   1.00 18.80 ? 703 HOH A O     1 
HETATM 3978 O  O     . HOH K 9 .   ? 61.050 20.972  11.860  1.00 28.73 ? 704 HOH A O     1 
HETATM 3979 O  O     . HOH K 9 .   ? 49.981 -17.198 15.518  1.00 17.18 ? 705 HOH A O     1 
HETATM 3980 O  O     . HOH K 9 .   ? 41.641 -30.408 -6.333  1.00 21.52 ? 706 HOH A O     1 
HETATM 3981 O  O     . HOH K 9 .   ? 42.087 -18.993 14.910  1.00 23.96 ? 707 HOH A O     1 
HETATM 3982 O  O     . HOH K 9 .   ? 67.223 -20.687 8.763   1.00 12.57 ? 708 HOH A O     1 
HETATM 3983 O  O     . HOH K 9 .   ? 47.042 -22.677 17.456  1.00 25.98 ? 709 HOH A O     1 
HETATM 3984 O  O     . HOH K 9 .   ? 53.441 6.029   -12.254 1.00 22.18 ? 710 HOH A O     1 
HETATM 3985 O  O     . HOH K 9 .   ? 51.149 5.149   -10.860 1.00 21.22 ? 711 HOH A O     1 
HETATM 3986 O  O     . HOH K 9 .   ? 47.718 -27.129 -7.230  1.00 28.25 ? 712 HOH A O     1 
HETATM 3987 O  O     . HOH K 9 .   ? 69.391 9.936   -8.685  1.00 27.54 ? 713 HOH A O     1 
HETATM 3988 O  O     . HOH K 9 .   ? 40.656 16.866  6.392   1.00 23.11 ? 714 HOH A O     1 
HETATM 3989 O  O     . HOH K 9 .   ? 33.583 3.148   2.994   1.00 33.96 ? 715 HOH A O     1 
HETATM 3990 O  O     . HOH K 9 .   ? 70.501 -19.024 1.345   1.00 16.27 ? 716 HOH A O     1 
HETATM 3991 O  O     . HOH K 9 .   ? 41.394 15.716  -22.778 1.00 27.14 ? 717 HOH A O     1 
HETATM 3992 O  O     . HOH K 9 .   ? 23.232 14.496  -9.264  1.00 27.00 ? 718 HOH A O     1 
HETATM 3993 O  O     . HOH K 9 .   ? 49.775 -8.950  12.931  1.00 27.93 ? 719 HOH A O     1 
HETATM 3994 O  O     . HOH K 9 .   ? 68.925 -17.567 -1.296  1.00 12.77 ? 720 HOH A O     1 
HETATM 3995 O  O     . HOH K 9 .   ? 48.811 -9.459  10.444  1.00 25.06 ? 721 HOH A O     1 
HETATM 3996 O  O     . HOH K 9 .   ? 45.391 15.885  -1.471  1.00 14.73 ? 722 HOH A O     1 
HETATM 3997 O  O     . HOH K 9 .   ? 59.651 13.021  11.374  1.00 25.46 ? 723 HOH A O     1 
HETATM 3998 O  O     . HOH K 9 .   ? 65.633 -15.154 11.696  1.00 20.18 ? 724 HOH A O     1 
HETATM 3999 O  O     . HOH K 9 .   ? 56.273 1.304   13.323  1.00 31.57 ? 725 HOH A O     1 
HETATM 4000 O  O     . HOH K 9 .   ? 69.464 -18.720 -9.454  1.00 33.66 ? 726 HOH A O     1 
HETATM 4001 O  O     . HOH K 9 .   ? 48.228 19.833  4.604   1.00 27.20 ? 727 HOH A O     1 
HETATM 4002 O  O     . HOH K 9 .   ? 55.922 18.826  18.305  1.00 20.82 ? 728 HOH A O     1 
HETATM 4003 O  O     . HOH K 9 .   ? 63.153 -18.957 -1.644  1.00 20.76 ? 729 HOH A O     1 
HETATM 4004 O  O     . HOH K 9 .   ? 76.370 2.639   6.563   1.00 28.13 ? 730 HOH A O     1 
HETATM 4005 O  O     . HOH K 9 .   ? 55.134 -20.557 21.320  1.00 27.56 ? 731 HOH A O     1 
HETATM 4006 O  O     . HOH K 9 .   ? 83.439 -7.891  0.661   1.00 39.07 ? 732 HOH A O     1 
HETATM 4007 O  O     . HOH K 9 .   ? 70.517 -15.950 7.728   1.00 17.28 ? 733 HOH A O     1 
HETATM 4008 O  O     . HOH K 9 .   ? 53.317 7.393   -14.682 1.00 27.27 ? 734 HOH A O     1 
HETATM 4009 O  O     . HOH K 9 .   ? 40.254 -28.445 -9.854  1.00 30.94 ? 735 HOH A O     1 
HETATM 4010 O  O     . HOH K 9 .   ? 52.415 1.296   9.684   1.00 16.12 ? 736 HOH A O     1 
HETATM 4011 O  O     . HOH K 9 .   ? 33.472 7.462   17.203  1.00 40.49 ? 737 HOH A O     1 
HETATM 4012 O  O     . HOH K 9 .   ? 53.823 15.484  23.185  1.00 29.35 ? 738 HOH A O     1 
HETATM 4013 O  O     . HOH K 9 .   ? 51.197 6.239   -18.871 1.00 30.40 ? 739 HOH A O     1 
HETATM 4014 O  O     . HOH K 9 .   ? 54.008 -9.406  5.350   1.00 18.64 ? 740 HOH A O     1 
HETATM 4015 O  O     . HOH K 9 .   ? 40.430 7.575   24.243  1.00 33.36 ? 741 HOH A O     1 
HETATM 4016 O  O     . HOH K 9 .   ? 66.896 -16.580 9.667   1.00 15.64 ? 742 HOH A O     1 
HETATM 4017 O  O     . HOH K 9 .   ? 42.375 15.387  23.623  1.00 23.34 ? 743 HOH A O     1 
HETATM 4018 O  O     . HOH K 9 .   ? 76.236 1.317   -5.559  1.00 36.02 ? 744 HOH A O     1 
HETATM 4019 O  O     . HOH K 9 .   ? 70.354 -17.217 12.392  1.00 28.97 ? 745 HOH A O     1 
HETATM 4020 O  O     . HOH K 9 .   ? 43.606 -14.405 5.745   1.00 14.92 ? 746 HOH A O     1 
HETATM 4021 O  O     . HOH K 9 .   ? 36.931 18.516  16.868  1.00 35.00 ? 747 HOH A O     1 
HETATM 4022 O  O     . HOH K 9 .   ? 50.931 -8.808  -5.035  1.00 23.60 ? 748 HOH A O     1 
HETATM 4023 O  O     . HOH K 9 .   ? 53.435 13.529  -9.906  1.00 18.47 ? 749 HOH A O     1 
HETATM 4024 O  O     . HOH K 9 .   ? 51.164 8.656   -15.406 1.00 26.64 ? 750 HOH A O     1 
HETATM 4025 O  O     . HOH K 9 .   ? 65.240 12.887  2.974   1.00 29.77 ? 751 HOH A O     1 
HETATM 4026 O  O     . HOH K 9 .   ? 59.721 11.443  -10.319 1.00 18.10 ? 752 HOH A O     1 
HETATM 4027 O  O     . HOH K 9 .   ? 44.269 7.264   2.224   1.00 15.42 ? 753 HOH A O     1 
HETATM 4028 O  O     . HOH K 9 .   ? 53.520 -32.466 -2.838  1.00 31.86 ? 754 HOH A O     1 
HETATM 4029 O  O     . HOH K 9 .   ? 46.523 16.336  25.531  1.00 25.41 ? 755 HOH A O     1 
HETATM 4030 O  O     . HOH K 9 .   ? 59.163 4.901   16.793  1.00 20.48 ? 756 HOH A O     1 
HETATM 4031 O  O     . HOH K 9 .   ? 60.482 13.878  6.291   1.00 26.37 ? 757 HOH A O     1 
HETATM 4032 O  O     . HOH K 9 .   ? 65.331 -22.830 3.259   1.00 14.46 ? 758 HOH A O     1 
HETATM 4033 O  O     . HOH K 9 .   ? 62.210 7.433   7.102   1.00 15.10 ? 759 HOH A O     1 
HETATM 4034 O  O     . HOH K 9 .   ? 58.770 4.632   23.035  1.00 24.33 ? 760 HOH A O     1 
HETATM 4035 O  O     . HOH K 9 .   ? 21.415 13.696  6.707   1.00 41.04 ? 761 HOH A O     1 
HETATM 4036 O  O     . HOH K 9 .   ? 49.692 -3.049  -17.184 1.00 22.37 ? 762 HOH A O     1 
HETATM 4037 O  O     . HOH K 9 .   ? 51.486 -35.203 7.687   1.00 37.56 ? 763 HOH A O     1 
HETATM 4038 O  O     . HOH K 9 .   ? 62.744 -23.378 3.562   1.00 24.16 ? 764 HOH A O     1 
HETATM 4039 O  O     . HOH K 9 .   ? 48.789 -34.463 10.196  1.00 28.97 ? 765 HOH A O     1 
HETATM 4040 O  O     . HOH K 9 .   ? 48.385 -22.208 -5.663  1.00 21.25 ? 766 HOH A O     1 
HETATM 4041 O  O     . HOH K 9 .   ? 46.102 0.447   7.122   1.00 27.20 ? 767 HOH A O     1 
HETATM 4042 O  O     . HOH K 9 .   ? 71.271 6.041   -7.302  1.00 21.06 ? 768 HOH A O     1 
HETATM 4043 O  O     . HOH K 9 .   ? 64.323 6.494   -0.571  1.00 19.06 ? 769 HOH A O     1 
HETATM 4044 O  O     . HOH K 9 .   ? 49.841 3.109   12.681  1.00 20.22 ? 770 HOH A O     1 
HETATM 4045 O  O     . HOH K 9 .   ? 50.023 -14.755 -3.191  1.00 40.38 ? 771 HOH A O     1 
HETATM 4046 O  O     . HOH K 9 .   ? 63.197 -7.374  12.901  1.00 30.22 ? 772 HOH A O     1 
HETATM 4047 O  O     . HOH K 9 .   ? 45.003 16.911  -18.016 1.00 30.89 ? 773 HOH A O     1 
HETATM 4048 O  O     . HOH K 9 .   ? 52.905 -33.333 -0.159  1.00 22.79 ? 774 HOH A O     1 
HETATM 4049 O  O     . HOH K 9 .   ? 52.367 8.598   25.710  1.00 29.95 ? 775 HOH A O     1 
HETATM 4050 O  O     . HOH K 9 .   ? 50.925 5.513   -8.288  1.00 18.24 ? 776 HOH A O     1 
HETATM 4051 O  O     . HOH K 9 .   ? 66.438 3.967   10.621  1.00 29.74 ? 777 HOH A O     1 
HETATM 4052 O  O     . HOH K 9 .   ? 57.414 23.404  14.092  1.00 28.13 ? 778 HOH A O     1 
HETATM 4053 O  O     . HOH K 9 .   ? 69.002 -13.494 5.022   1.00 12.52 ? 779 HOH A O     1 
HETATM 4054 O  O     . HOH K 9 .   ? 59.657 10.564  19.962  1.00 21.20 ? 780 HOH A O     1 
HETATM 4055 O  O     . HOH K 9 .   ? 46.405 -0.318  -15.059 1.00 19.49 ? 781 HOH A O     1 
HETATM 4056 O  O     . HOH K 9 .   ? 57.871 -27.427 11.394  1.00 20.86 ? 782 HOH A O     1 
HETATM 4057 O  O     . HOH K 9 .   ? 77.717 -16.713 10.665  1.00 35.02 ? 783 HOH A O     1 
HETATM 4058 O  O     . HOH K 9 .   ? 45.830 7.403   -12.771 1.00 31.65 ? 784 HOH A O     1 
HETATM 4059 O  O     . HOH K 9 .   ? 59.174 11.122  8.591   1.00 18.34 ? 785 HOH A O     1 
HETATM 4060 O  O     . HOH K 9 .   ? 80.460 -3.762  13.681  1.00 35.54 ? 786 HOH A O     1 
HETATM 4061 O  O     . HOH K 9 .   ? 67.386 6.443   0.748   1.00 25.82 ? 787 HOH A O     1 
HETATM 4062 O  O     . HOH K 9 .   ? 44.785 -14.230 10.521  1.00 16.06 ? 788 HOH A O     1 
HETATM 4063 O  O     . HOH K 9 .   ? 65.656 8.724   8.891   1.00 28.80 ? 789 HOH A O     1 
HETATM 4064 O  O     . HOH K 9 .   ? 51.290 -33.806 10.242  1.00 36.53 ? 790 HOH A O     1 
HETATM 4065 O  O     . HOH K 9 .   ? 38.211 -22.641 10.672  1.00 30.47 ? 791 HOH A O     1 
HETATM 4066 O  O     . HOH K 9 .   ? 52.604 -12.532 -3.849  1.00 27.68 ? 792 HOH A O     1 
HETATM 4067 O  O     . HOH K 9 .   ? 63.320 -11.629 12.711  1.00 38.76 ? 793 HOH A O     1 
HETATM 4068 O  O     . HOH K 9 .   ? 83.649 -5.191  2.304   1.00 30.04 ? 794 HOH A O     1 
HETATM 4069 O  O     . HOH K 9 .   ? 63.752 -9.441  -14.428 1.00 22.01 ? 795 HOH A O     1 
HETATM 4070 O  O     . HOH K 9 .   ? 42.900 -1.573  -24.799 1.00 23.28 ? 796 HOH A O     1 
HETATM 4071 O  O     . HOH K 9 .   ? 29.172 3.941   6.534   1.00 36.15 ? 797 HOH A O     1 
HETATM 4072 O  O     . HOH K 9 .   ? 46.516 19.394  1.441   1.00 25.21 ? 798 HOH A O     1 
HETATM 4073 O  O     . HOH K 9 .   ? 43.442 12.047  -7.214  1.00 18.87 ? 799 HOH A O     1 
HETATM 4074 O  O     . HOH K 9 .   ? 63.320 -17.173 15.050  1.00 33.13 ? 800 HOH A O     1 
HETATM 4075 O  O     . HOH K 9 .   ? 65.305 -22.328 -7.766  1.00 29.86 ? 801 HOH A O     1 
HETATM 4076 O  O     . HOH K 9 .   ? 34.494 14.894  11.346  1.00 21.37 ? 802 HOH A O     1 
HETATM 4077 O  O     . HOH K 9 .   ? 43.879 -15.041 1.419   1.00 18.01 ? 803 HOH A O     1 
HETATM 4078 O  O     . HOH K 9 .   ? 38.385 -17.986 10.300  1.00 21.83 ? 804 HOH A O     1 
HETATM 4079 O  O     . HOH K 9 .   ? 60.161 -18.435 -4.611  1.00 13.57 ? 805 HOH A O     1 
HETATM 4080 O  O     . HOH K 9 .   ? 41.225 21.579  2.246   1.00 24.42 ? 806 HOH A O     1 
HETATM 4081 O  O     . HOH K 9 .   ? 53.451 -20.272 -2.479  1.00 17.84 ? 807 HOH A O     1 
HETATM 4082 O  O     . HOH K 9 .   ? 64.981 19.906  6.591   1.00 30.78 ? 808 HOH A O     1 
HETATM 4083 O  O     . HOH K 9 .   ? 70.891 6.295   7.749   1.00 31.08 ? 809 HOH A O     1 
HETATM 4084 O  O     . HOH K 9 .   ? 55.236 2.810   20.865  1.00 27.29 ? 810 HOH A O     1 
HETATM 4085 O  O     . HOH K 9 .   ? 20.378 17.935  -5.283  1.00 34.59 ? 811 HOH A O     1 
HETATM 4086 O  O     . HOH K 9 .   ? 81.049 -10.886 -8.328  1.00 44.95 ? 812 HOH A O     1 
HETATM 4087 O  O     . HOH K 9 .   ? 53.320 -8.548  8.693   1.00 28.00 ? 813 HOH A O     1 
HETATM 4088 O  O     . HOH K 9 .   ? 68.909 -10.878 12.040  1.00 29.07 ? 814 HOH A O     1 
HETATM 4089 O  O     . HOH K 9 .   ? 47.255 -16.595 -0.677  1.00 24.22 ? 815 HOH A O     1 
HETATM 4090 O  O     . HOH K 9 .   ? 72.965 -7.334  8.912   1.00 14.03 ? 816 HOH A O     1 
HETATM 4091 O  O     . HOH K 9 .   ? 41.147 -23.860 -4.931  1.00 22.97 ? 817 HOH A O     1 
HETATM 4092 O  O     . HOH K 9 .   ? 41.420 20.253  4.817   1.00 21.96 ? 818 HOH A O     1 
HETATM 4093 O  O     . HOH K 9 .   ? 52.751 -1.203  3.888   1.00 22.46 ? 819 HOH A O     1 
HETATM 4094 O  O     . HOH K 9 .   ? 55.083 -1.160  -14.780 1.00 28.51 ? 820 HOH A O     1 
HETATM 4095 O  O     . HOH K 9 .   ? 72.069 2.076   12.218  1.00 34.04 ? 821 HOH A O     1 
HETATM 4096 O  O     . HOH K 9 .   ? 46.132 -9.576  11.107  1.00 33.23 ? 822 HOH A O     1 
HETATM 4097 O  O     . HOH K 9 .   ? 45.046 0.537   -18.371 1.00 23.30 ? 823 HOH A O     1 
HETATM 4098 O  O     . HOH K 9 .   ? 61.778 -13.305 -13.612 1.00 30.71 ? 824 HOH A O     1 
HETATM 4099 O  O     . HOH K 9 .   ? 46.452 -18.629 -2.385  1.00 33.41 ? 825 HOH A O     1 
HETATM 4100 O  O     . HOH K 9 .   ? 42.344 15.520  -8.799  1.00 32.53 ? 826 HOH A O     1 
HETATM 4101 O  O     . HOH K 9 .   ? 46.019 16.719  1.270   1.00 13.33 ? 827 HOH A O     1 
HETATM 4102 O  O     . HOH K 9 .   ? 48.848 -29.465 15.955  1.00 35.11 ? 828 HOH A O     1 
HETATM 4103 O  O     . HOH K 9 .   ? 61.773 -6.764  -14.775 1.00 39.56 ? 829 HOH A O     1 
HETATM 4104 O  O     . HOH K 9 .   ? 48.995 7.358   -7.611  1.00 19.76 ? 830 HOH A O     1 
HETATM 4105 O  O     . HOH K 9 .   ? 36.403 12.912  12.054  1.00 19.94 ? 831 HOH A O     1 
HETATM 4106 O  O     . HOH K 9 .   ? 44.163 10.003  -24.544 1.00 33.06 ? 832 HOH A O     1 
HETATM 4107 O  O     . HOH K 9 .   ? 62.378 11.820  5.455   1.00 28.60 ? 833 HOH A O     1 
HETATM 4108 O  O     . HOH K 9 .   ? 47.069 2.399   -1.107  1.00 20.67 ? 834 HOH A O     1 
HETATM 4109 O  O     . HOH K 9 .   ? 69.661 -8.853  10.646  1.00 29.90 ? 835 HOH A O     1 
HETATM 4110 O  O     . HOH K 9 .   ? 55.192 1.545   -17.329 1.00 39.04 ? 836 HOH A O     1 
HETATM 4111 O  O     . HOH K 9 .   ? 58.604 -30.409 -1.030  1.00 38.33 ? 837 HOH A O     1 
HETATM 4112 O  O     . HOH K 9 .   ? 41.153 -3.050  -22.851 1.00 22.24 ? 838 HOH A O     1 
HETATM 4113 O  O     . HOH K 9 .   ? 41.913 -22.458 -2.615  1.00 18.36 ? 839 HOH A O     1 
HETATM 4114 O  O     . HOH K 9 .   ? 55.377 -32.786 4.978   1.00 28.71 ? 840 HOH A O     1 
HETATM 4115 O  O     . HOH K 9 .   ? 54.491 -11.338 3.460   1.00 15.44 ? 841 HOH A O     1 
HETATM 4116 O  O     . HOH K 9 .   ? 11.701 0.556   -4.252  1.00 49.34 ? 842 HOH A O     1 
HETATM 4117 O  O     . HOH K 9 .   ? 57.219 0.069   -14.668 1.00 25.72 ? 843 HOH A O     1 
HETATM 4118 O  O     . HOH K 9 .   ? 59.863 14.509  3.357   1.00 23.91 ? 844 HOH A O     1 
HETATM 4119 O  O     . HOH K 9 .   ? 45.202 -32.629 8.647   1.00 40.79 ? 845 HOH A O     1 
HETATM 4120 O  O     . HOH K 9 .   ? 47.254 13.886  -11.125 1.00 33.65 ? 846 HOH A O     1 
HETATM 4121 O  O     . HOH K 9 .   ? 59.952 -17.838 -7.563  1.00 24.26 ? 847 HOH A O     1 
HETATM 4122 O  O     . HOH K 9 .   ? 50.637 -6.520  -5.324  1.00 26.32 ? 848 HOH A O     1 
HETATM 4123 O  O     . HOH K 9 .   ? 50.999 21.648  7.361   1.00 27.56 ? 849 HOH A O     1 
HETATM 4124 O  O     . HOH K 9 .   ? 69.063 4.432   3.894   1.00 21.50 ? 850 HOH A O     1 
HETATM 4125 O  O     . HOH K 9 .   ? 61.427 14.626  8.824   1.00 26.94 ? 851 HOH A O     1 
HETATM 4126 O  O     . HOH K 9 .   ? 47.314 21.583  9.663   1.00 31.70 ? 852 HOH A O     1 
HETATM 4127 O  O     . HOH K 9 .   ? 56.365 -3.230  4.399   1.00 29.76 ? 853 HOH A O     1 
HETATM 4128 O  O     . HOH K 9 .   ? 73.157 -19.478 -2.823  1.00 24.10 ? 854 HOH A O     1 
HETATM 4129 O  O     . HOH K 9 .   ? 49.248 -14.773 18.519  1.00 31.04 ? 855 HOH A O     1 
HETATM 4130 O  O     . HOH K 9 .   ? 61.550 -2.413  12.067  1.00 34.26 ? 856 HOH A O     1 
HETATM 4131 O  O     . HOH K 9 .   ? 42.157 -8.916  9.644   1.00 36.94 ? 857 HOH A O     1 
HETATM 4132 O  O     . HOH K 9 .   ? 53.702 17.299  -3.107  1.00 18.28 ? 858 HOH A O     1 
HETATM 4133 O  O     . HOH K 9 .   ? 68.240 -16.966 -11.849 1.00 41.15 ? 859 HOH A O     1 
HETATM 4134 O  O     . HOH K 9 .   ? 40.717 -1.828  -16.415 1.00 30.74 ? 860 HOH A O     1 
HETATM 4135 O  O     . HOH K 9 .   ? 59.389 9.583   10.803  1.00 14.38 ? 861 HOH A O     1 
HETATM 4136 O  O     . HOH K 9 .   ? 19.747 10.248  8.816   1.00 39.68 ? 862 HOH A O     1 
HETATM 4137 O  O     . HOH K 9 .   ? 43.349 9.653   -9.868  1.00 20.34 ? 863 HOH A O     1 
HETATM 4138 O  O     . HOH K 9 .   ? 37.723 10.764  21.324  1.00 38.67 ? 864 HOH A O     1 
HETATM 4139 O  O     . HOH K 9 .   ? 61.751 -18.832 21.875  1.00 37.16 ? 865 HOH A O     1 
HETATM 4140 O  O     . HOH K 9 .   ? 59.438 -31.421 4.068   1.00 27.25 ? 866 HOH A O     1 
HETATM 4141 O  O     . HOH K 9 .   ? 48.936 -15.585 13.645  1.00 17.40 ? 867 HOH A O     1 
HETATM 4142 O  O     . HOH K 9 .   ? 35.235 22.527  -3.412  1.00 32.93 ? 868 HOH A O     1 
HETATM 4143 O  O     . HOH K 9 .   ? 32.925 2.447   -0.259  1.00 30.51 ? 869 HOH A O     1 
HETATM 4144 O  O     . HOH K 9 .   ? 43.637 -28.798 15.633  1.00 34.89 ? 870 HOH A O     1 
HETATM 4145 O  O     . HOH K 9 .   ? 18.756 14.527  6.320   1.00 40.76 ? 871 HOH A O     1 
HETATM 4146 O  O     . HOH K 9 .   ? 38.184 10.444  9.467   1.00 25.23 ? 872 HOH A O     1 
HETATM 4147 O  O     . HOH K 9 .   ? 31.273 -5.604  1.713   1.00 47.00 ? 873 HOH A O     1 
HETATM 4148 O  O     . HOH K 9 .   ? 74.660 -22.332 -6.531  1.00 34.71 ? 874 HOH A O     1 
HETATM 4149 O  O     . HOH K 9 .   ? 64.789 19.463  1.903   1.00 25.53 ? 875 HOH A O     1 
HETATM 4150 O  O     . HOH K 9 .   ? 35.252 20.787  0.699   1.00 26.43 ? 876 HOH A O     1 
HETATM 4151 O  O     . HOH K 9 .   ? 46.605 -14.547 14.901  1.00 29.33 ? 877 HOH A O     1 
HETATM 4152 O  O     . HOH K 9 .   ? 65.629 -25.991 0.560   1.00 27.75 ? 878 HOH A O     1 
HETATM 4153 O  O     . HOH K 9 .   ? 28.907 8.144   -18.920 1.00 25.81 ? 879 HOH A O     1 
HETATM 4154 O  O     . HOH K 9 .   ? 11.980 3.177   -5.359  1.00 53.22 ? 880 HOH A O     1 
HETATM 4155 O  O     . HOH K 9 .   ? 67.585 -25.833 -6.481  1.00 41.24 ? 881 HOH A O     1 
HETATM 4156 O  O     . HOH K 9 .   ? 34.634 19.853  -16.163 1.00 28.06 ? 882 HOH A O     1 
HETATM 4157 O  O     . HOH K 9 .   ? 43.171 -30.927 -10.508 1.00 33.92 ? 883 HOH A O     1 
HETATM 4158 O  O     . HOH K 9 .   ? 61.781 1.885   14.067  1.00 36.76 ? 884 HOH A O     1 
HETATM 4159 O  O     . HOH K 9 .   ? 61.603 15.770  2.262   1.00 30.31 ? 885 HOH A O     1 
HETATM 4160 O  O     . HOH K 9 .   ? 49.118 8.364   -13.587 1.00 24.74 ? 886 HOH A O     1 
HETATM 4161 O  O     . HOH K 9 .   ? 63.169 -4.733  -15.714 1.00 40.13 ? 887 HOH A O     1 
HETATM 4162 O  O     . HOH K 9 .   ? 71.481 1.322   18.841  1.00 39.23 ? 888 HOH A O     1 
HETATM 4163 O  O     . HOH K 9 .   ? 65.305 -4.383  -15.317 1.00 27.81 ? 889 HOH A O     1 
HETATM 4164 O  O     . HOH K 9 .   ? 39.326 18.648  17.961  1.00 28.77 ? 890 HOH A O     1 
HETATM 4165 O  O     . HOH K 9 .   ? 25.589 14.695  5.159   1.00 30.07 ? 891 HOH A O     1 
HETATM 4166 O  O     . HOH K 9 .   ? 38.681 -3.570  -20.066 1.00 25.98 ? 892 HOH A O     1 
HETATM 4167 O  O     . HOH K 9 .   ? 67.839 -14.388 -10.122 1.00 25.67 ? 893 HOH A O     1 
HETATM 4168 O  O     . HOH K 9 .   ? 65.120 -21.528 14.702  1.00 33.30 ? 894 HOH A O     1 
HETATM 4169 O  O     . HOH K 9 .   ? 68.535 -15.127 -14.803 1.00 43.64 ? 895 HOH A O     1 
HETATM 4170 O  O     . HOH K 9 .   ? 50.808 15.773  -12.352 1.00 39.92 ? 896 HOH A O     1 
HETATM 4171 O  O     . HOH K 9 .   ? 52.819 30.851  5.469   1.00 35.26 ? 897 HOH A O     1 
HETATM 4172 O  O     . HOH K 9 .   ? 38.921 21.292  5.893   1.00 26.83 ? 898 HOH A O     1 
HETATM 4173 O  O     . HOH K 9 .   ? 52.900 -20.101 -4.981  1.00 21.38 ? 899 HOH A O     1 
HETATM 4174 O  O     . HOH K 9 .   ? 61.684 24.200  9.855   1.00 31.03 ? 900 HOH A O     1 
HETATM 4175 O  O     . HOH K 9 .   ? 51.396 -8.534  4.867   1.00 26.48 ? 901 HOH A O     1 
HETATM 4176 O  O     . HOH K 9 .   ? 51.104 4.587   24.773  1.00 26.52 ? 902 HOH A O     1 
HETATM 4177 O  O     . HOH K 9 .   ? 50.509 10.966  -13.629 1.00 40.00 ? 903 HOH A O     1 
HETATM 4178 O  O     . HOH K 9 .   ? 67.578 -5.182  -17.168 1.00 38.15 ? 904 HOH A O     1 
HETATM 4179 O  O     . HOH K 9 .   ? 36.780 21.905  4.610   1.00 32.86 ? 905 HOH A O     1 
HETATM 4180 O  O     . HOH K 9 .   ? 57.164 -18.927 22.086  1.00 30.22 ? 906 HOH A O     1 
HETATM 4181 O  O     . HOH K 9 .   ? 35.736 21.947  12.362  1.00 40.33 ? 907 HOH A O     1 
HETATM 4182 O  O     . HOH K 9 .   ? 60.948 9.899   7.089   1.00 25.21 ? 908 HOH A O     1 
HETATM 4183 O  O     . HOH K 9 .   ? 38.542 13.645  24.415  1.00 39.50 ? 909 HOH A O     1 
HETATM 4184 O  O     . HOH K 9 .   ? 69.924 -21.750 0.774   1.00 24.77 ? 910 HOH A O     1 
HETATM 4185 O  O     . HOH K 9 .   ? 55.449 -7.356  6.516   1.00 26.47 ? 911 HOH A O     1 
HETATM 4186 O  O     . HOH K 9 .   ? 64.177 -15.538 13.690  1.00 32.42 ? 912 HOH A O     1 
HETATM 4187 O  O     . HOH K 9 .   ? 61.707 7.969   16.169  1.00 33.77 ? 913 HOH A O     1 
HETATM 4188 O  O     . HOH K 9 .   ? 46.985 16.037  -23.413 1.00 30.00 ? 914 HOH A O     1 
HETATM 4189 O  O     . HOH K 9 .   ? 42.759 17.180  -17.161 1.00 34.69 ? 915 HOH A O     1 
HETATM 4190 O  O     . HOH K 9 .   ? 50.846 -22.734 -5.645  1.00 33.40 ? 916 HOH A O     1 
HETATM 4191 O  O     . HOH K 9 .   ? 48.845 12.168  -11.480 1.00 28.52 ? 917 HOH A O     1 
HETATM 4192 O  O     . HOH K 9 .   ? 68.004 -27.703 -7.703  1.00 40.61 ? 918 HOH A O     1 
HETATM 4193 O  O     . HOH K 9 .   ? 47.773 10.767  -9.470  1.00 21.81 ? 919 HOH A O     1 
HETATM 4194 O  O     . HOH K 9 .   ? 43.871 0.364   -20.922 1.00 28.86 ? 920 HOH A O     1 
HETATM 4195 O  O     . HOH K 9 .   ? 59.714 -29.187 -8.575  1.00 40.55 ? 921 HOH A O     1 
HETATM 4196 O  O     . HOH K 9 .   ? 68.346 -21.579 -8.050  1.00 37.21 ? 922 HOH A O     1 
HETATM 4197 O  O     . HOH K 9 .   ? 30.854 -4.918  -9.536  1.00 43.90 ? 923 HOH A O     1 
HETATM 4198 O  O     . HOH K 9 .   ? 40.052 -18.201 -1.528  1.00 31.91 ? 924 HOH A O     1 
HETATM 4199 O  O     . HOH K 9 .   ? 52.816 0.270   12.136  1.00 21.77 ? 925 HOH A O     1 
HETATM 4200 O  O     . HOH K 9 .   ? 70.981 8.954   -6.813  1.00 31.75 ? 926 HOH A O     1 
HETATM 4201 O  O     . HOH K 9 .   ? 55.101 -17.315 -13.247 1.00 33.00 ? 927 HOH A O     1 
HETATM 4202 O  O     . HOH K 9 .   ? 42.470 5.377   20.894  1.00 41.28 ? 928 HOH A O     1 
HETATM 4203 O  O     . HOH K 9 .   ? 77.514 -17.288 8.310   1.00 37.29 ? 929 HOH A O     1 
HETATM 4204 O  O     . HOH K 9 .   ? 49.605 26.177  3.022   1.00 27.22 ? 930 HOH A O     1 
HETATM 4205 O  O     . HOH K 9 .   ? 33.704 22.642  -0.553  1.00 39.84 ? 931 HOH A O     1 
HETATM 4206 O  O     . HOH K 9 .   ? 62.087 -25.599 4.674   1.00 33.43 ? 932 HOH A O     1 
HETATM 4207 O  O     . HOH K 9 .   ? 39.669 4.521   18.124  1.00 38.27 ? 933 HOH A O     1 
HETATM 4208 O  O     . HOH K 9 .   ? 61.636 11.486  -12.249 1.00 25.72 ? 934 HOH A O     1 
HETATM 4209 O  O     . HOH K 9 .   ? 67.652 1.844   12.148  1.00 30.71 ? 935 HOH A O     1 
HETATM 4210 O  O     . HOH K 9 .   ? 50.693 3.386   10.136  1.00 15.91 ? 936 HOH A O     1 
HETATM 4211 O  O     . HOH K 9 .   ? 43.150 20.065  -11.941 1.00 33.33 ? 937 HOH A O     1 
HETATM 4212 O  O     . HOH K 9 .   ? 44.102 -1.466  -16.312 1.00 37.96 ? 938 HOH A O     1 
HETATM 4213 O  O     . HOH K 9 .   ? 47.767 -18.997 -5.376  1.00 32.30 ? 939 HOH A O     1 
HETATM 4214 O  O     . HOH K 9 .   ? 69.383 5.258   1.038   1.00 31.41 ? 940 HOH A O     1 
HETATM 4215 O  O     . HOH K 9 .   ? 73.279 4.677   -1.366  1.00 31.41 ? 941 HOH A O     1 
HETATM 4216 O  O     . HOH K 9 .   ? 61.677 12.143  9.483   1.00 33.16 ? 942 HOH A O     1 
HETATM 4217 O  O     . HOH K 9 .   ? 34.714 13.959  21.776  1.00 35.59 ? 943 HOH A O     1 
HETATM 4218 O  O     . HOH K 9 .   ? 44.699 -14.697 13.140  1.00 35.18 ? 944 HOH A O     1 
HETATM 4219 O  O     . HOH K 9 .   ? 55.732 13.568  -11.445 1.00 24.73 ? 945 HOH A O     1 
HETATM 4220 O  O     . HOH K 9 .   ? 58.190 15.252  -10.580 1.00 23.07 ? 946 HOH A O     1 
HETATM 4221 O  O     . HOH K 9 .   ? 47.669 0.948   -18.866 1.00 27.13 ? 947 HOH A O     1 
HETATM 4222 O  O     . HOH K 9 .   ? 48.905 -0.359  -16.549 1.00 28.47 ? 948 HOH A O     1 
HETATM 4223 O  O     . HOH K 9 .   ? 47.344 -20.141 18.566  1.00 29.69 ? 949 HOH A O     1 
HETATM 4224 O  O     . HOH K 9 .   ? 59.236 -27.931 -1.964  1.00 34.41 ? 950 HOH A O     1 
HETATM 4225 O  O     . HOH K 9 .   ? 52.318 2.523   -17.372 1.00 37.87 ? 951 HOH A O     1 
HETATM 4226 O  O     . HOH K 9 .   ? 57.547 -14.366 -12.963 1.00 25.20 ? 952 HOH A O     1 
HETATM 4227 O  O     . HOH K 9 .   ? 51.334 13.474  -11.465 1.00 28.54 ? 953 HOH A O     1 
HETATM 4228 O  O     . HOH K 9 .   ? 50.203 0.809   19.926  1.00 31.07 ? 954 HOH A O     1 
HETATM 4229 O  O     . HOH K 9 .   ? 54.247 -34.925 1.324   1.00 29.25 ? 955 HOH A O     1 
HETATM 4230 O  O     . HOH K 9 .   ? 61.503 8.988   19.042  1.00 31.90 ? 956 HOH A O     1 
HETATM 4231 O  O     . HOH K 9 .   ? 43.899 15.610  26.132  1.00 28.11 ? 957 HOH A O     1 
HETATM 4232 O  O     . HOH K 9 .   ? 47.403 7.843   -9.592  1.00 20.63 ? 958 HOH A O     1 
HETATM 4233 O  O     . HOH K 9 .   ? 67.920 -26.279 -0.516  1.00 31.71 ? 959 HOH A O     1 
HETATM 4234 O  O     . HOH K 9 .   ? 62.323 -29.336 -12.207 1.00 32.12 ? 960 HOH A O     1 
HETATM 4235 O  O     . HOH K 9 .   ? 53.613 16.175  -9.213  1.00 23.12 ? 961 HOH A O     1 
HETATM 4236 O  O     . HOH K 9 .   ? 43.454 16.055  -10.772 1.00 40.06 ? 962 HOH A O     1 
HETATM 4237 O  O     . HOH K 9 .   ? 38.870 18.510  -15.177 1.00 38.64 ? 963 HOH A O     1 
HETATM 4238 O  O     . HOH K 9 .   ? 37.104 -7.577  -18.189 1.00 43.26 ? 964 HOH A O     1 
HETATM 4239 O  O     . HOH K 9 .   ? 56.342 21.515  18.164  1.00 24.59 ? 965 HOH A O     1 
HETATM 4240 O  O     . HOH K 9 .   ? 46.153 2.022   20.607  1.00 37.11 ? 966 HOH A O     1 
HETATM 4241 O  O     . HOH K 9 .   ? 48.712 6.667   -11.724 1.00 19.58 ? 967 HOH A O     1 
HETATM 4242 O  O     . HOH K 9 .   ? 44.380 13.295  -10.508 1.00 36.80 ? 968 HOH A O     1 
HETATM 4243 O  O     . HOH K 9 .   ? 48.155 -17.976 17.306  1.00 30.91 ? 969 HOH A O     1 
HETATM 4244 O  O     . HOH K 9 .   ? 57.863 17.752  19.940  1.00 24.89 ? 970 HOH A O     1 
HETATM 4245 O  O     . HOH K 9 .   ? 38.085 -15.645 12.022  1.00 35.00 ? 971 HOH A O     1 
HETATM 4246 O  O     . HOH K 9 .   ? 48.328 0.093   9.677   1.00 41.92 ? 972 HOH A O     1 
HETATM 4247 O  O     . HOH K 9 .   ? 61.385 8.040   9.792   1.00 22.14 ? 973 HOH A O     1 
HETATM 4248 O  O     . HOH K 9 .   ? 37.160 -28.587 9.195   1.00 47.20 ? 974 HOH A O     1 
HETATM 4249 O  O     . HOH K 9 .   ? 59.976 9.837   22.520  1.00 30.90 ? 975 HOH A O     1 
HETATM 4250 O  O     . HOH L 9 .   ? 37.774 -18.444 -8.701  1.00 39.60 ? 101 HOH T O     1 
HETATM 4251 O  O     . HOH L 9 .   ? 34.979 5.794   18.012  1.00 45.15 ? 102 HOH T O     1 
HETATM 4252 O  O     . HOH L 9 .   ? 33.676 8.958   11.529  1.00 41.20 ? 103 HOH T O     1 
HETATM 4253 O  O     . HOH L 9 .   ? 41.465 -19.863 -3.391  1.00 27.03 ? 104 HOH T O     1 
HETATM 4254 O  O     . HOH L 9 .   ? 37.157 0.160   -3.009  1.00 31.84 ? 105 HOH T O     1 
HETATM 4255 O  O     . HOH L 9 .   ? 42.042 -7.386  -10.518 1.00 35.72 ? 106 HOH T O     1 
HETATM 4256 O  O     . HOH L 9 .   ? 43.088 5.489   -8.905  1.00 21.53 ? 107 HOH T O     1 
HETATM 4257 O  O     . HOH L 9 .   ? 36.051 2.558   4.623   1.00 28.80 ? 108 HOH T O     1 
HETATM 4258 O  O     . HOH L 9 .   ? 38.796 -10.241 -9.917  1.00 34.70 ? 109 HOH T O     1 
HETATM 4259 O  O     . HOH L 9 .   ? 36.310 -2.175  -1.166  1.00 31.04 ? 110 HOH T O     1 
HETATM 4260 O  O     . HOH L 9 .   ? 45.110 -4.875  -3.041  1.00 35.37 ? 111 HOH T O     1 
HETATM 4261 O  O     . HOH L 9 .   ? 31.848 14.131  10.646  1.00 34.71 ? 112 HOH T O     1 
HETATM 4262 O  O     . HOH L 9 .   ? 40.058 -0.528  7.748   1.00 45.72 ? 113 HOH T O     1 
HETATM 4263 O  O     . HOH L 9 .   ? 38.500 -2.302  -6.398  1.00 30.56 ? 114 HOH T O     1 
HETATM 4264 O  O     . HOH L 9 .   ? 35.684 10.968  0.875   1.00 21.89 ? 115 HOH T O     1 
HETATM 4265 O  O     . HOH L 9 .   ? 41.829 8.127   3.135   1.00 16.75 ? 116 HOH T O     1 
HETATM 4266 O  O     . HOH L 9 .   ? 30.574 5.219   8.663   1.00 41.21 ? 117 HOH T O     1 
HETATM 4267 O  O     . HOH L 9 .   ? 44.132 -8.675  -3.468  1.00 26.09 ? 118 HOH T O     1 
HETATM 4268 O  O     . HOH L 9 .   ? 37.477 -12.921 -11.038 1.00 33.88 ? 119 HOH T O     1 
HETATM 4269 O  O     . HOH L 9 .   ? 36.845 -23.126 -5.112  1.00 23.13 ? 120 HOH T O     1 
HETATM 4270 O  O     . HOH L 9 .   ? 45.454 5.326   -4.874  1.00 28.47 ? 121 HOH T O     1 
HETATM 4271 O  O     . HOH L 9 .   ? 43.502 5.329   0.391   1.00 24.85 ? 122 HOH T O     1 
HETATM 4272 O  O     . HOH L 9 .   ? 40.565 -3.682  -9.394  1.00 26.11 ? 123 HOH T O     1 
HETATM 4273 O  O     . HOH L 9 .   ? 39.006 4.710   15.666  1.00 37.21 ? 124 HOH T O     1 
HETATM 4274 O  O     . HOH L 9 .   ? 37.203 -0.020  4.657   1.00 36.37 ? 125 HOH T O     1 
HETATM 4275 O  O     . HOH L 9 .   ? 34.195 -15.765 -14.169 1.00 39.05 ? 126 HOH T O     1 
HETATM 4276 O  O     . HOH L 9 .   ? 36.371 -3.057  -4.353  1.00 29.21 ? 127 HOH T O     1 
HETATM 4277 O  O     . HOH L 9 .   ? 38.072 -21.638 -3.406  1.00 30.09 ? 128 HOH T O     1 
HETATM 4278 O  O     . HOH L 9 .   ? 38.781 -0.887  10.254  1.00 43.64 ? 129 HOH T O     1 
HETATM 4279 O  O     . HOH L 9 .   ? 39.890 6.987   13.519  1.00 28.47 ? 130 HOH T O     1 
HETATM 4280 O  O     . HOH L 9 .   ? 42.560 -11.355 -11.627 1.00 41.92 ? 131 HOH T O     1 
HETATM 4281 O  O     . HOH L 9 .   ? 37.794 -4.141  -8.366  1.00 39.62 ? 132 HOH T O     1 
HETATM 4282 O  O     . HOH L 9 .   ? 33.168 10.333  8.223   1.00 38.17 ? 133 HOH T O     1 
HETATM 4283 O  O     . HOH L 9 .   ? 46.657 -8.674  -4.457  1.00 26.93 ? 134 HOH T O     1 
HETATM 4284 O  O     . HOH L 9 .   ? 35.819 10.928  10.339  1.00 28.19 ? 135 HOH T O     1 
HETATM 4285 O  O     . HOH L 9 .   ? 40.835 -9.963  -11.217 1.00 42.87 ? 136 HOH T O     1 
HETATM 4286 O  O     . HOH L 9 .   ? 44.832 7.411   -10.267 1.00 17.56 ? 137 HOH T O     1 
HETATM 4287 O  O     . HOH M 9 .   ? 38.142 -10.775 6.468   1.00 32.21 ? 101 HOH P O     1 
HETATM 4288 O  O     . HOH M 9 .   ? 28.282 -4.998  -10.162 1.00 37.75 ? 102 HOH P O     1 
HETATM 4289 O  O     . HOH M 9 .   ? 48.806 2.405   1.155   0.80 21.77 ? 103 HOH P O     1 
HETATM 4290 O  O     . HOH M 9 .   ? 45.935 3.718   1.208   1.00 26.03 ? 104 HOH P O     1 
HETATM 4291 O  O     . HOH M 9 .   ? 32.349 -7.223  -11.201 1.00 43.08 ? 105 HOH P O     1 
HETATM 4292 O  O     . HOH M 9 .   ? 41.413 -11.773 -0.772  1.00 22.00 ? 106 HOH P O     1 
HETATM 4293 O  O     . HOH M 9 .   ? 26.428 -12.635 -10.560 1.00 24.90 ? 107 HOH P O     1 
HETATM 4294 O  O     . HOH M 9 .   ? 44.590 -8.149  -0.970  1.00 24.16 ? 108 HOH P O     1 
HETATM 4295 O  O     . HOH M 9 .   ? 42.635 -8.913  7.231   1.00 21.59 ? 109 HOH P O     1 
HETATM 4296 O  O     . HOH M 9 .   ? 49.151 -10.096 6.761   1.00 20.99 ? 110 HOH P O     1 
HETATM 4297 O  O     . HOH M 9 .   ? 45.963 -2.589  -0.632  1.00 24.07 ? 111 HOH P O     1 
HETATM 4298 O  O     . HOH M 9 .   ? 35.029 -9.308  -11.096 1.00 41.84 ? 112 HOH P O     1 
HETATM 4299 O  O     . HOH M 9 .   ? 40.198 -5.271  5.595   1.00 30.16 ? 113 HOH P O     1 
HETATM 4300 O  O     . HOH M 9 .   ? 31.139 -13.853 -3.007  1.00 36.88 ? 114 HOH P O     1 
HETATM 4301 O  O     . HOH M 9 .   ? 41.327 -15.675 1.916   1.00 18.93 ? 115 HOH P O     1 
HETATM 4302 O  O     . HOH M 9 .   ? 30.433 -6.133  -13.037 1.00 43.95 ? 116 HOH P O     1 
HETATM 4303 O  O     . HOH M 9 .   ? 50.529 -7.190  6.519   1.00 37.02 ? 117 HOH P O     1 
HETATM 4304 O  O     . HOH M 9 .   ? 38.329 -1.871  6.144   1.00 37.06 ? 118 HOH P O     1 
HETATM 4305 O  O     . HOH M 9 .   ? 40.238 -8.902  5.888   1.00 25.85 ? 119 HOH P O     1 
HETATM 4306 O  O     . HOH M 9 .   ? 43.836 -12.767 -0.163  1.00 23.49 ? 120 HOH P O     1 
HETATM 4307 O  O     . HOH M 9 .   ? 45.709 -10.721 -0.031  1.00 20.44 ? 121 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   501 501 MG  MG  A . 
E 5 CA  1   502 502 CA  CA  A . 
F 4 MG  1   503 503 MG  MG  A . 
G 6 GOL 1   504 504 GOL GOL A . 
H 6 GOL 1   505 505 GOL GOL A . 
I 7 DTP 1   506 506 DTP DTP A . 
J 8 K   1   507 507 K   K   A . 
K 9 HOH 1   601 601 HOH HOH A . 
K 9 HOH 2   602 602 HOH HOH A . 
K 9 HOH 3   603 603 HOH HOH A . 
K 9 HOH 4   604 604 HOH HOH A . 
K 9 HOH 5   605 605 HOH HOH A . 
K 9 HOH 6   606 606 HOH HOH A . 
K 9 HOH 7   607 607 HOH HOH A . 
K 9 HOH 8   608 608 HOH HOH A . 
K 9 HOH 9   609 609 HOH HOH A . 
K 9 HOH 10  610 610 HOH HOH A . 
K 9 HOH 11  611 611 HOH HOH A . 
K 9 HOH 12  612 612 HOH HOH A . 
K 9 HOH 13  613 613 HOH HOH A . 
K 9 HOH 14  614 614 HOH HOH A . 
K 9 HOH 15  615 615 HOH HOH A . 
K 9 HOH 16  616 616 HOH HOH A . 
K 9 HOH 17  617 617 HOH HOH A . 
K 9 HOH 18  618 618 HOH HOH A . 
K 9 HOH 19  619 619 HOH HOH A . 
K 9 HOH 20  620 620 HOH HOH A . 
K 9 HOH 21  621 621 HOH HOH A . 
K 9 HOH 22  622 622 HOH HOH A . 
K 9 HOH 23  623 623 HOH HOH A . 
K 9 HOH 24  624 624 HOH HOH A . 
K 9 HOH 25  625 625 HOH HOH A . 
K 9 HOH 26  626 626 HOH HOH A . 
K 9 HOH 27  627 627 HOH HOH A . 
K 9 HOH 28  628 628 HOH HOH A . 
K 9 HOH 29  629 629 HOH HOH A . 
K 9 HOH 30  630 630 HOH HOH A . 
K 9 HOH 31  631 631 HOH HOH A . 
K 9 HOH 32  632 632 HOH HOH A . 
K 9 HOH 33  633 633 HOH HOH A . 
K 9 HOH 34  634 634 HOH HOH A . 
K 9 HOH 35  635 635 HOH HOH A . 
K 9 HOH 36  636 636 HOH HOH A . 
K 9 HOH 37  637 637 HOH HOH A . 
K 9 HOH 38  638 638 HOH HOH A . 
K 9 HOH 39  639 639 HOH HOH A . 
K 9 HOH 40  640 640 HOH HOH A . 
K 9 HOH 41  641 641 HOH HOH A . 
K 9 HOH 42  642 642 HOH HOH A . 
K 9 HOH 43  643 643 HOH HOH A . 
K 9 HOH 44  644 644 HOH HOH A . 
K 9 HOH 45  645 645 HOH HOH A . 
K 9 HOH 46  646 646 HOH HOH A . 
K 9 HOH 47  647 647 HOH HOH A . 
K 9 HOH 48  648 648 HOH HOH A . 
K 9 HOH 49  649 649 HOH HOH A . 
K 9 HOH 50  650 650 HOH HOH A . 
K 9 HOH 51  651 651 HOH HOH A . 
K 9 HOH 52  652 652 HOH HOH A . 
K 9 HOH 53  653 653 HOH HOH A . 
K 9 HOH 54  654 654 HOH HOH A . 
K 9 HOH 55  655 655 HOH HOH A . 
K 9 HOH 56  656 656 HOH HOH A . 
K 9 HOH 57  657 657 HOH HOH A . 
K 9 HOH 58  658 658 HOH HOH A . 
K 9 HOH 59  659 659 HOH HOH A . 
K 9 HOH 60  660 660 HOH HOH A . 
K 9 HOH 61  661 661 HOH HOH A . 
K 9 HOH 62  662 662 HOH HOH A . 
K 9 HOH 63  663 663 HOH HOH A . 
K 9 HOH 64  664 664 HOH HOH A . 
K 9 HOH 65  665 665 HOH HOH A . 
K 9 HOH 66  666 666 HOH HOH A . 
K 9 HOH 67  667 667 HOH HOH A . 
K 9 HOH 68  668 668 HOH HOH A . 
K 9 HOH 69  669 669 HOH HOH A . 
K 9 HOH 70  670 670 HOH HOH A . 
K 9 HOH 71  671 671 HOH HOH A . 
K 9 HOH 72  672 672 HOH HOH A . 
K 9 HOH 73  673 673 HOH HOH A . 
K 9 HOH 74  674 674 HOH HOH A . 
K 9 HOH 75  675 675 HOH HOH A . 
K 9 HOH 76  676 676 HOH HOH A . 
K 9 HOH 77  677 677 HOH HOH A . 
K 9 HOH 78  678 678 HOH HOH A . 
K 9 HOH 79  679 679 HOH HOH A . 
K 9 HOH 80  680 680 HOH HOH A . 
K 9 HOH 81  681 681 HOH HOH A . 
K 9 HOH 82  682 682 HOH HOH A . 
K 9 HOH 83  683 683 HOH HOH A . 
K 9 HOH 84  684 684 HOH HOH A . 
K 9 HOH 85  685 685 HOH HOH A . 
K 9 HOH 86  686 686 HOH HOH A . 
K 9 HOH 87  687 687 HOH HOH A . 
K 9 HOH 88  688 688 HOH HOH A . 
K 9 HOH 89  689 689 HOH HOH A . 
K 9 HOH 90  690 690 HOH HOH A . 
K 9 HOH 91  691 691 HOH HOH A . 
K 9 HOH 92  692 692 HOH HOH A . 
K 9 HOH 93  693 693 HOH HOH A . 
K 9 HOH 94  694 694 HOH HOH A . 
K 9 HOH 95  695 695 HOH HOH A . 
K 9 HOH 96  696 696 HOH HOH A . 
K 9 HOH 97  697 697 HOH HOH A . 
K 9 HOH 98  698 698 HOH HOH A . 
K 9 HOH 99  699 699 HOH HOH A . 
K 9 HOH 100 700 700 HOH HOH A . 
K 9 HOH 101 701 701 HOH HOH A . 
K 9 HOH 102 702 702 HOH HOH A . 
K 9 HOH 103 703 703 HOH HOH A . 
K 9 HOH 104 704 704 HOH HOH A . 
K 9 HOH 105 705 705 HOH HOH A . 
K 9 HOH 106 706 706 HOH HOH A . 
K 9 HOH 107 707 707 HOH HOH A . 
K 9 HOH 108 708 708 HOH HOH A . 
K 9 HOH 109 709 709 HOH HOH A . 
K 9 HOH 110 710 710 HOH HOH A . 
K 9 HOH 111 711 711 HOH HOH A . 
K 9 HOH 112 712 712 HOH HOH A . 
K 9 HOH 113 713 713 HOH HOH A . 
K 9 HOH 114 714 714 HOH HOH A . 
K 9 HOH 115 715 715 HOH HOH A . 
K 9 HOH 116 716 716 HOH HOH A . 
K 9 HOH 117 717 717 HOH HOH A . 
K 9 HOH 118 718 718 HOH HOH A . 
K 9 HOH 119 719 719 HOH HOH A . 
K 9 HOH 120 720 720 HOH HOH A . 
K 9 HOH 121 721 721 HOH HOH A . 
K 9 HOH 122 722 722 HOH HOH A . 
K 9 HOH 123 723 723 HOH HOH A . 
K 9 HOH 124 724 724 HOH HOH A . 
K 9 HOH 125 725 725 HOH HOH A . 
K 9 HOH 126 726 726 HOH HOH A . 
K 9 HOH 127 727 727 HOH HOH A . 
K 9 HOH 128 728 728 HOH HOH A . 
K 9 HOH 129 729 729 HOH HOH A . 
K 9 HOH 130 730 730 HOH HOH A . 
K 9 HOH 131 731 731 HOH HOH A . 
K 9 HOH 132 732 732 HOH HOH A . 
K 9 HOH 133 733 733 HOH HOH A . 
K 9 HOH 134 734 734 HOH HOH A . 
K 9 HOH 135 735 735 HOH HOH A . 
K 9 HOH 136 736 736 HOH HOH A . 
K 9 HOH 137 737 737 HOH HOH A . 
K 9 HOH 138 738 738 HOH HOH A . 
K 9 HOH 139 739 739 HOH HOH A . 
K 9 HOH 140 740 740 HOH HOH A . 
K 9 HOH 141 741 741 HOH HOH A . 
K 9 HOH 142 742 742 HOH HOH A . 
K 9 HOH 143 743 743 HOH HOH A . 
K 9 HOH 144 744 744 HOH HOH A . 
K 9 HOH 145 745 745 HOH HOH A . 
K 9 HOH 146 746 746 HOH HOH A . 
K 9 HOH 147 747 747 HOH HOH A . 
K 9 HOH 148 748 748 HOH HOH A . 
K 9 HOH 149 749 749 HOH HOH A . 
K 9 HOH 150 750 750 HOH HOH A . 
K 9 HOH 151 751 751 HOH HOH A . 
K 9 HOH 152 752 752 HOH HOH A . 
K 9 HOH 153 753 753 HOH HOH A . 
K 9 HOH 154 754 754 HOH HOH A . 
K 9 HOH 155 755 755 HOH HOH A . 
K 9 HOH 156 756 756 HOH HOH A . 
K 9 HOH 157 757 757 HOH HOH A . 
K 9 HOH 158 758 758 HOH HOH A . 
K 9 HOH 159 759 759 HOH HOH A . 
K 9 HOH 160 760 760 HOH HOH A . 
K 9 HOH 161 761 761 HOH HOH A . 
K 9 HOH 162 762 762 HOH HOH A . 
K 9 HOH 163 763 763 HOH HOH A . 
K 9 HOH 164 764 764 HOH HOH A . 
K 9 HOH 165 765 765 HOH HOH A . 
K 9 HOH 166 766 766 HOH HOH A . 
K 9 HOH 167 767 767 HOH HOH A . 
K 9 HOH 168 768 768 HOH HOH A . 
K 9 HOH 169 769 769 HOH HOH A . 
K 9 HOH 170 770 770 HOH HOH A . 
K 9 HOH 171 771 771 HOH HOH A . 
K 9 HOH 172 772 772 HOH HOH A . 
K 9 HOH 173 773 773 HOH HOH A . 
K 9 HOH 174 774 774 HOH HOH A . 
K 9 HOH 175 775 775 HOH HOH A . 
K 9 HOH 176 776 776 HOH HOH A . 
K 9 HOH 177 777 777 HOH HOH A . 
K 9 HOH 178 778 778 HOH HOH A . 
K 9 HOH 179 779 779 HOH HOH A . 
K 9 HOH 180 780 780 HOH HOH A . 
K 9 HOH 181 781 781 HOH HOH A . 
K 9 HOH 182 782 782 HOH HOH A . 
K 9 HOH 183 783 783 HOH HOH A . 
K 9 HOH 184 784 784 HOH HOH A . 
K 9 HOH 185 785 785 HOH HOH A . 
K 9 HOH 186 786 786 HOH HOH A . 
K 9 HOH 187 787 787 HOH HOH A . 
K 9 HOH 188 788 788 HOH HOH A . 
K 9 HOH 189 789 789 HOH HOH A . 
K 9 HOH 190 790 790 HOH HOH A . 
K 9 HOH 191 791 791 HOH HOH A . 
K 9 HOH 192 792 792 HOH HOH A . 
K 9 HOH 193 793 793 HOH HOH A . 
K 9 HOH 194 794 794 HOH HOH A . 
K 9 HOH 195 795 795 HOH HOH A . 
K 9 HOH 196 796 796 HOH HOH A . 
K 9 HOH 197 797 797 HOH HOH A . 
K 9 HOH 198 798 798 HOH HOH A . 
K 9 HOH 199 799 799 HOH HOH A . 
K 9 HOH 200 800 800 HOH HOH A . 
K 9 HOH 201 801 801 HOH HOH A . 
K 9 HOH 202 802 802 HOH HOH A . 
K 9 HOH 203 803 803 HOH HOH A . 
K 9 HOH 204 804 804 HOH HOH A . 
K 9 HOH 205 805 805 HOH HOH A . 
K 9 HOH 206 806 806 HOH HOH A . 
K 9 HOH 207 807 807 HOH HOH A . 
K 9 HOH 208 808 808 HOH HOH A . 
K 9 HOH 209 809 809 HOH HOH A . 
K 9 HOH 210 810 810 HOH HOH A . 
K 9 HOH 211 811 811 HOH HOH A . 
K 9 HOH 212 812 812 HOH HOH A . 
K 9 HOH 213 813 813 HOH HOH A . 
K 9 HOH 214 814 814 HOH HOH A . 
K 9 HOH 215 815 815 HOH HOH A . 
K 9 HOH 216 816 816 HOH HOH A . 
K 9 HOH 217 817 817 HOH HOH A . 
K 9 HOH 218 818 818 HOH HOH A . 
K 9 HOH 219 819 819 HOH HOH A . 
K 9 HOH 220 820 820 HOH HOH A . 
K 9 HOH 221 821 821 HOH HOH A . 
K 9 HOH 222 822 822 HOH HOH A . 
K 9 HOH 223 823 823 HOH HOH A . 
K 9 HOH 224 824 824 HOH HOH A . 
K 9 HOH 225 825 825 HOH HOH A . 
K 9 HOH 226 826 826 HOH HOH A . 
K 9 HOH 227 827 827 HOH HOH A . 
K 9 HOH 228 828 828 HOH HOH A . 
K 9 HOH 229 829 829 HOH HOH A . 
K 9 HOH 230 830 830 HOH HOH A . 
K 9 HOH 231 831 831 HOH HOH A . 
K 9 HOH 232 832 832 HOH HOH A . 
K 9 HOH 233 833 833 HOH HOH A . 
K 9 HOH 234 834 834 HOH HOH A . 
K 9 HOH 235 835 835 HOH HOH A . 
K 9 HOH 236 836 836 HOH HOH A . 
K 9 HOH 237 837 837 HOH HOH A . 
K 9 HOH 238 838 838 HOH HOH A . 
K 9 HOH 239 839 839 HOH HOH A . 
K 9 HOH 240 840 840 HOH HOH A . 
K 9 HOH 241 841 841 HOH HOH A . 
K 9 HOH 242 842 842 HOH HOH A . 
K 9 HOH 243 843 843 HOH HOH A . 
K 9 HOH 244 844 844 HOH HOH A . 
K 9 HOH 245 845 845 HOH HOH A . 
K 9 HOH 246 846 846 HOH HOH A . 
K 9 HOH 247 847 847 HOH HOH A . 
K 9 HOH 248 848 848 HOH HOH A . 
K 9 HOH 249 849 849 HOH HOH A . 
K 9 HOH 250 850 850 HOH HOH A . 
K 9 HOH 251 851 851 HOH HOH A . 
K 9 HOH 252 852 852 HOH HOH A . 
K 9 HOH 253 853 853 HOH HOH A . 
K 9 HOH 254 854 854 HOH HOH A . 
K 9 HOH 255 855 855 HOH HOH A . 
K 9 HOH 256 856 856 HOH HOH A . 
K 9 HOH 257 857 857 HOH HOH A . 
K 9 HOH 258 858 858 HOH HOH A . 
K 9 HOH 259 859 859 HOH HOH A . 
K 9 HOH 260 860 860 HOH HOH A . 
K 9 HOH 261 861 861 HOH HOH A . 
K 9 HOH 262 862 862 HOH HOH A . 
K 9 HOH 263 863 863 HOH HOH A . 
K 9 HOH 264 864 864 HOH HOH A . 
K 9 HOH 265 865 865 HOH HOH A . 
K 9 HOH 266 866 866 HOH HOH A . 
K 9 HOH 267 867 867 HOH HOH A . 
K 9 HOH 268 868 868 HOH HOH A . 
K 9 HOH 269 869 869 HOH HOH A . 
K 9 HOH 270 870 870 HOH HOH A . 
K 9 HOH 271 871 871 HOH HOH A . 
K 9 HOH 272 872 872 HOH HOH A . 
K 9 HOH 273 873 873 HOH HOH A . 
K 9 HOH 274 874 874 HOH HOH A . 
K 9 HOH 275 875 875 HOH HOH A . 
K 9 HOH 276 876 876 HOH HOH A . 
K 9 HOH 277 877 877 HOH HOH A . 
K 9 HOH 278 878 878 HOH HOH A . 
K 9 HOH 279 879 879 HOH HOH A . 
K 9 HOH 280 880 880 HOH HOH A . 
K 9 HOH 281 881 881 HOH HOH A . 
K 9 HOH 282 882 882 HOH HOH A . 
K 9 HOH 283 883 883 HOH HOH A . 
K 9 HOH 284 884 884 HOH HOH A . 
K 9 HOH 285 885 885 HOH HOH A . 
K 9 HOH 286 886 886 HOH HOH A . 
K 9 HOH 287 887 887 HOH HOH A . 
K 9 HOH 288 888 888 HOH HOH A . 
K 9 HOH 289 889 889 HOH HOH A . 
K 9 HOH 290 890 890 HOH HOH A . 
K 9 HOH 291 891 891 HOH HOH A . 
K 9 HOH 292 892 892 HOH HOH A . 
K 9 HOH 293 893 893 HOH HOH A . 
K 9 HOH 294 894 894 HOH HOH A . 
K 9 HOH 295 895 895 HOH HOH A . 
K 9 HOH 296 896 896 HOH HOH A . 
K 9 HOH 297 897 897 HOH HOH A . 
K 9 HOH 298 898 898 HOH HOH A . 
K 9 HOH 299 899 899 HOH HOH A . 
K 9 HOH 300 900 900 HOH HOH A . 
K 9 HOH 301 901 901 HOH HOH A . 
K 9 HOH 302 902 902 HOH HOH A . 
K 9 HOH 303 903 903 HOH HOH A . 
K 9 HOH 304 904 904 HOH HOH A . 
K 9 HOH 305 905 905 HOH HOH A . 
K 9 HOH 306 906 906 HOH HOH A . 
K 9 HOH 307 907 907 HOH HOH A . 
K 9 HOH 308 908 908 HOH HOH A . 
K 9 HOH 309 909 909 HOH HOH A . 
K 9 HOH 310 910 910 HOH HOH A . 
K 9 HOH 311 911 911 HOH HOH A . 
K 9 HOH 312 912 912 HOH HOH A . 
K 9 HOH 313 913 913 HOH HOH A . 
K 9 HOH 314 914 914 HOH HOH A . 
K 9 HOH 315 915 915 HOH HOH A . 
K 9 HOH 316 916 916 HOH HOH A . 
K 9 HOH 317 917 917 HOH HOH A . 
K 9 HOH 318 918 918 HOH HOH A . 
K 9 HOH 319 919 919 HOH HOH A . 
K 9 HOH 320 920 920 HOH HOH A . 
K 9 HOH 321 921 921 HOH HOH A . 
K 9 HOH 322 922 922 HOH HOH A . 
K 9 HOH 323 923 923 HOH HOH A . 
K 9 HOH 324 924 924 HOH HOH A . 
K 9 HOH 325 925 925 HOH HOH A . 
K 9 HOH 326 926 926 HOH HOH A . 
K 9 HOH 327 927 927 HOH HOH A . 
K 9 HOH 328 928 928 HOH HOH A . 
K 9 HOH 329 929 929 HOH HOH A . 
K 9 HOH 330 930 930 HOH HOH A . 
K 9 HOH 331 931 931 HOH HOH A . 
K 9 HOH 332 932 932 HOH HOH A . 
K 9 HOH 333 933 933 HOH HOH A . 
K 9 HOH 334 934 934 HOH HOH A . 
K 9 HOH 335 935 935 HOH HOH A . 
K 9 HOH 336 936 936 HOH HOH A . 
K 9 HOH 337 937 937 HOH HOH A . 
K 9 HOH 338 938 938 HOH HOH A . 
K 9 HOH 339 939 939 HOH HOH A . 
K 9 HOH 340 940 940 HOH HOH A . 
K 9 HOH 341 941 941 HOH HOH A . 
K 9 HOH 342 942 942 HOH HOH A . 
K 9 HOH 343 943 943 HOH HOH A . 
K 9 HOH 344 944 944 HOH HOH A . 
K 9 HOH 345 945 945 HOH HOH A . 
K 9 HOH 346 946 946 HOH HOH A . 
K 9 HOH 347 947 947 HOH HOH A . 
K 9 HOH 348 948 948 HOH HOH A . 
K 9 HOH 349 949 949 HOH HOH A . 
K 9 HOH 350 950 950 HOH HOH A . 
K 9 HOH 351 951 951 HOH HOH A . 
K 9 HOH 352 952 952 HOH HOH A . 
K 9 HOH 353 953 953 HOH HOH A . 
K 9 HOH 354 954 954 HOH HOH A . 
K 9 HOH 355 955 955 HOH HOH A . 
K 9 HOH 356 956 956 HOH HOH A . 
K 9 HOH 357 957 957 HOH HOH A . 
K 9 HOH 358 958 958 HOH HOH A . 
K 9 HOH 359 959 959 HOH HOH A . 
K 9 HOH 360 960 960 HOH HOH A . 
K 9 HOH 361 961 961 HOH HOH A . 
K 9 HOH 362 962 962 HOH HOH A . 
K 9 HOH 363 963 963 HOH HOH A . 
K 9 HOH 364 964 964 HOH HOH A . 
K 9 HOH 365 965 965 HOH HOH A . 
K 9 HOH 366 966 966 HOH HOH A . 
K 9 HOH 367 967 967 HOH HOH A . 
K 9 HOH 368 968 968 HOH HOH A . 
K 9 HOH 369 969 969 HOH HOH A . 
K 9 HOH 370 970 970 HOH HOH A . 
K 9 HOH 371 971 971 HOH HOH A . 
K 9 HOH 372 972 972 HOH HOH A . 
K 9 HOH 373 973 973 HOH HOH A . 
K 9 HOH 374 974 974 HOH HOH A . 
K 9 HOH 375 975 975 HOH HOH A . 
L 9 HOH 1   101 101 HOH HOH T . 
L 9 HOH 2   102 102 HOH HOH T . 
L 9 HOH 3   103 103 HOH HOH T . 
L 9 HOH 4   104 104 HOH HOH T . 
L 9 HOH 5   105 105 HOH HOH T . 
L 9 HOH 6   106 106 HOH HOH T . 
L 9 HOH 7   107 107 HOH HOH T . 
L 9 HOH 8   108 108 HOH HOH T . 
L 9 HOH 9   109 109 HOH HOH T . 
L 9 HOH 10  110 110 HOH HOH T . 
L 9 HOH 11  111 111 HOH HOH T . 
L 9 HOH 12  112 112 HOH HOH T . 
L 9 HOH 13  113 113 HOH HOH T . 
L 9 HOH 14  114 114 HOH HOH T . 
L 9 HOH 15  115 115 HOH HOH T . 
L 9 HOH 16  116 116 HOH HOH T . 
L 9 HOH 17  117 117 HOH HOH T . 
L 9 HOH 18  118 118 HOH HOH T . 
L 9 HOH 19  119 119 HOH HOH T . 
L 9 HOH 20  120 120 HOH HOH T . 
L 9 HOH 21  121 121 HOH HOH T . 
L 9 HOH 22  122 122 HOH HOH T . 
L 9 HOH 23  123 123 HOH HOH T . 
L 9 HOH 24  124 124 HOH HOH T . 
L 9 HOH 25  125 125 HOH HOH T . 
L 9 HOH 26  126 126 HOH HOH T . 
L 9 HOH 27  127 127 HOH HOH T . 
L 9 HOH 28  128 128 HOH HOH T . 
L 9 HOH 29  129 129 HOH HOH T . 
L 9 HOH 30  130 130 HOH HOH T . 
L 9 HOH 31  131 131 HOH HOH T . 
L 9 HOH 32  132 132 HOH HOH T . 
L 9 HOH 33  133 133 HOH HOH T . 
L 9 HOH 34  134 134 HOH HOH T . 
L 9 HOH 35  135 135 HOH HOH T . 
L 9 HOH 36  136 136 HOH HOH T . 
L 9 HOH 37  137 137 HOH HOH T . 
M 9 HOH 1   101 101 HOH HOH P . 
M 9 HOH 2   102 102 HOH HOH P . 
M 9 HOH 3   103 103 HOH HOH P . 
M 9 HOH 4   104 104 HOH HOH P . 
M 9 HOH 5   105 105 HOH HOH P . 
M 9 HOH 6   106 106 HOH HOH P . 
M 9 HOH 7   107 107 HOH HOH P . 
M 9 HOH 8   108 108 HOH HOH P . 
M 9 HOH 9   109 109 HOH HOH P . 
M 9 HOH 10  110 110 HOH HOH P . 
M 9 HOH 11  111 111 HOH HOH P . 
M 9 HOH 12  112 112 HOH HOH P . 
M 9 HOH 13  113 113 HOH HOH P . 
M 9 HOH 14  114 114 HOH HOH P . 
M 9 HOH 15  115 115 HOH HOH P . 
M 9 HOH 16  116 116 HOH HOH P . 
M 9 HOH 17  117 117 HOH HOH P . 
M 9 HOH 18  118 118 HOH HOH P . 
M 9 HOH 19  119 119 HOH HOH P . 
M 9 HOH 20  120 120 HOH HOH P . 
M 9 HOH 21  121 121 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5710  ? 
1 MORE         -66   ? 
1 'SSA (A^2)'  22000 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 40.6  ? 
2  OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 81.2  ? 
3  OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 105.5 ? 
4  OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 110.0 ? 
5  OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 81.1  ? 
6  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.2  ? 
7  OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 159.7 ? 
8  OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 159.0 ? 
9  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 89.9  ? 
10 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 86.8  ? 
11 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 106.1 ? 
12 OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 79.2  ? 
13 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 172.1 ? 
14 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 91.4  ? 
15 O1B   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 84.0  ? 
16 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 80.9  ? 
17 OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 109.5 ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 96.9  ? 
19 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 168.9 ? 
20 O1B   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 82.1  ? 
21 O1A   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 87.3  ? 
22 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 81.6  ? 
23 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 73.2  ? 
24 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.1  ? 
25 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 158.9 ? 
26 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 89.9  ? 
27 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 86.7  ? 
28 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 102.4 ? 
29 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 172.0 ? 
30 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 91.4  ? 
31 O1B   ? I DTP .   ? A DTP 506 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 84.1  ? 
32 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 117.9 ? 
33 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 97.0  ? 
34 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 168.9 ? 
35 O1B   ? I DTP .   ? A DTP 506 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 82.1  ? 
36 O1A   ? I DTP .   ? A DTP 506 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 87.3  ? 
37 OD1   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 36.7  ? 
38 OD1   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 73.8  ? 
39 OD2   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 110.3 ? 
40 OD1   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 113.0 ? 
41 OD2   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 107.7 ? 
42 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 K  B J K  . ? A K  507 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 101.2 ? 
43 OD1   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 152.8 ? 
44 OD2   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 158.2 ? 
45 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 K  B J K  . ? A K  507 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 83.2  ? 
46 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 K  B J K  . ? A K  507 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 85.3  ? 
47 OD1   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 82.6  ? 
48 OD2   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 80.5  ? 
49 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 89.2  ? 
50 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 163.0 ? 
51 "O3'" ? C DT  8   ? P DT  8   ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 82.8  ? 
52 OD1   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 100.3 ? 
53 OD2   B A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 64.4  ? 
54 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 163.5 ? 
55 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 95.3  ? 
56 "O3'" ? C DT  8   ? P DT  8   ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 97.7  ? 
57 O1A   ? I DTP .   ? A DTP 506 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 74.6  ? 
58 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 90.0  ? 
59 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 97.2  ? 
60 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 101.2 ? 
61 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 173.1 ? 
62 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 83.2  ? 
63 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 85.3  ? 
64 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 88.5  ? 
65 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 163.5 ? 
66 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 95.3  ? 
67 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O     ? K HOH .   ? A HOH 819 ? 1_555 97.7  ? 
68 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 96.1  ? 
69 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 89.2  ? 
70 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 163.0 ? 
71 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 82.8  ? 
72 O     ? K HOH .   ? A HOH 819 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 74.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2016-06-29 
3 'Structure model' 1 2 2017-09-20 
4 'Structure model' 1 3 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'          
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Derived calculations'       
4 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_audit_support    
2 3 'Structure model' pdbx_struct_oper_list 
3 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_audit_support.funding_organization'  
2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 4 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .        2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    409 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ILE 
_pdbx_validate_close_contact.auth_seq_id_2    411 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.06 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" P DA 7 ? ? "C4'" P DA 7 ? ? "C3'" P DA 7 ? ? 101.27 104.50 -3.23 0.40 N 
2 1 "O4'" P DA 7 ? ? "C1'" P DA 7 ? ? N9    P DA 7 ? ? 110.91 108.30 2.61  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 37.85   54.73   
2 1 TYR A 39  ? ? 66.10   -175.05 
3 1 LYS A 40  ? ? -157.32 -38.18  
4 1 SER A 217 ? ? -154.50 -157.29 
5 1 SER A 257 ? ? 93.46   -9.98   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KFU 'double helix'        
5KFU 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.039  -0.105 -0.160 -3.943 -8.348  4.972  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.087  -0.015 0.314  -2.418 -17.314 4.396  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.157 -0.136 -0.294 -6.335 -3.009  0.095  3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.132  -0.145 0.042  3.964  -2.394  -0.745 4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.272  -0.120 -0.266 11.315 -7.834  1.849  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.494 -0.204 -0.082 -2.053 -7.435  5.673  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.022  -0.120 0.190  -5.908 -4.561  -1.055 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.083 -0.158 -0.054 14.326 0.542   1.482  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.819  -1.050 3.296 -3.324 1.832 26.557 -2.728 -2.608 3.094 3.963  7.188   
26.822 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.404 -1.091 3.382 6.241  8.488 29.217 -3.637 1.930  2.819 16.177 -11.896 
31.020 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.645 -0.486 3.166 -2.602 2.238 34.322 -1.157 0.696  3.167 3.781  4.395   
34.488 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.310  -0.592 3.168 2.750  1.577 31.375 -1.374 -0.074 3.151 2.906  -5.069  
31.531 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.290 -0.562 3.713 -4.626 5.257 32.970 -1.936 -0.350 3.589 9.135  8.038   
33.686 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.671 -0.558 3.453 -3.001 1.363 37.340 -1.058 0.627  3.472 2.124  4.675   
37.480 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.214  0.194  3.026 -0.699 2.121 27.330 -0.076 -0.612 3.026 4.481  1.476   
27.419 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Intramural DK036146-08' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 'POTASSIUM ION'                     K   
9 water                               HOH 
#