data_5KFV
# 
_entry.id   5KFV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KFV         
WWPDB D_1000222139 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5KFA PDB . 
unspecified 5KFB PDB . 
unspecified 5KFC PDB . 
unspecified 5KG0 PDB . 
unspecified 5KG1 PDB . 
unspecified 5KG2 PDB . 
unspecified 5KG3 PDB . 
unspecified 5KG4 PDB . 
unspecified 5KG5 PDB . 
unspecified 5KG6 PDB . 
unspecified 5KG7 PDB . 
unspecified 5KFD PDB . 
unspecified 5KFE PDB . 
unspecified 5KFS PDB . 
unspecified 5KFT PDB . 
unspecified 5KFU PDB . 
unspecified 5KFW PDB . 
unspecified 5KFX PDB . 
unspecified 5KFG PDB . 
unspecified 5KFY PDB . 
unspecified 5KFZ PDB . 
unspecified 5KFH PDB . 
unspecified 5KFK PDB . 
unspecified 5KFL PDB . 
unspecified 5KFI PDB . 
unspecified 5KFJ PDB . 
unspecified 5KFM PDB . 
unspecified 5KFN PDB . 
unspecified 5KFO PDB . 
unspecified 5KFP PDB . 
unspecified 5KFQ PDB . 
unspecified 5KFR PDB . 
unspecified 5KFF PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KFV 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gao, Y.'  1 ? 
primary 'Yang, W.' 2 ? 
# 
_cell.entry_id           5KFV 
_cell.length_a           98.280 
_cell.length_b           98.280 
_cell.length_c           81.930 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5KFV 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48531.590 1   2.7.7.7 R61A ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ?    ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ?    ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    2   ?       ?    ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ?    ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ?    ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ?    ? ? 
8 non-polymer syn 'POTASSIUM ION'                                      39.098    1   ?       ?    ? ? 
9 water       nat water                                                18.015    435 ?       ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTASMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTASMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ALA n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' ? 9606 ? 
3 1 sample 1 8  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5KFV       5KFV   ? 2 ? 1 
3 PDB 5KFV       5KFV   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KFV A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5KFV T 1 ? 12  ? 5KFV   1 ? 12  ? 1 12  
3 3 5KFV P 1 ? 8   ? 5KFV   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KFV GLY A 1  ? UNP Q9Y253 ?   ?  'expression tag'      -2 1 
1 5KFV PRO A 2  ? UNP Q9Y253 ?   ?  'expression tag'      -1 2 
1 5KFV HIS A 3  ? UNP Q9Y253 ?   ?  'expression tag'      0  3 
1 5KFV ALA A 64 ? UNP Q9Y253 ARG 61 'engineered mutation' 61 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'                      ?                               'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KFV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.09 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.12 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5KFV 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.600 
_reflns.number_obs                   58772 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.05900 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.3100 
_reflns.B_iso_Wilson_estimate        26.72 
_reflns.pdbx_redundancy              7.400 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.64 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.84100 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.230 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5KFV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     58771 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.91 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    99.2 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.780 
_refine.ls_number_reflns_R_free                  4571 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               23.64 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4ECQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.190 
_refine.pdbx_overall_phase_error                 23.120 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3360 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             435 
_refine_hist.number_atoms_total               4228 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        19.91 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.6001 
_refine_ls_shell.d_res_low                        1.6182 
_refine_ls_shell.number_reflns_R_work             0 
_refine_ls_shell.R_factor_R_work                  0.2552 
_refine_ls_shell.percent_reflns_obs               0.00 
_refine_ls_shell.R_factor_R_free                  0.2971 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             164 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                     5KFV 
_struct.title                        'Human DNA polymerase eta R61A-DNA ternary complex: reaction with 1 mM Mg2+ for 140s' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KFV 
_struct_keywords.text            
'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, replication, transferase-dna complex' 
_struct_keywords.pdbx_keywords   'replication, transferase/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 9 ? 
L N N 9 ? 
M N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 AB2 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P12 AB3 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P13 AB4 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P14 AB5 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P15 AB6 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P16 AB7 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P17 AB8 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 AB9 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 AC1 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 AC2 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.184 ? 
metalc2  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 F MG  . MG  B ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.176 ? 
metalc3  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 D MG  . MG  A ? A ASP 13  A MG  501 1_555 ? ? ? ? ? ? ?            2.223 ? 
metalc4  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.838 ? 
metalc5  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 F MG  . MG  B ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.830 ? 
metalc6  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 J K   . K   B ? A ASP 13  A K   507 1_555 ? ? ? ? ? ? ?            2.223 ? 
metalc7  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.347 ? 
metalc8  metalc ? ? A MET 17  O     ? ? ? 1_555 F MG  . MG  B ? A MET 14  A MG  503 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc9  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 D MG  . MG  A ? A ASP 115 A MG  501 1_555 ? ? ? ? ? ? ?            2.389 ? 
metalc10 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 J K   . K   B ? A ASP 115 A K   507 1_555 ? ? ? ? ? ? ?            2.389 ? 
metalc11 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc12 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 F MG  . MG  B ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc13 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MG  . MG  A ? A GLU 116 A MG  501 1_555 ? ? ? ? ? ? ?            2.209 ? 
metalc14 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 J K   . K   B ? A GLU 116 A K   507 1_555 ? ? ? ? ? ? ?            2.209 ? 
metalc15 metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D MG  . MG  A ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc16 metalc ? ? C DT  8   "O3'" ? ? ? 1_555 J K   . K   B ? P DT  8   A K   507 1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc17 metalc ? ? D MG  .   MG    A ? ? 1_555 K HOH . O   ? ? A MG  501 A HOH 804 1_555 ? ? ? ? ? ? ?            2.234 ? 
metalc18 metalc ? ? D MG  .   MG    A ? ? 1_555 I DTP . O1A ? ? A MG  501 A DTP 506 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc19 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1B ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc20 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1A ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc21 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1G ? ? A CA  502 A DTP 506 1_555 ? ? ? ? ? ? ?            2.222 ? 
metalc22 metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O1B ? ? A MG  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.250 ? 
metalc23 metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O1A ? ? A MG  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc24 metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O1G ? ? A MG  503 A DTP 506 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc25 metalc ? ? I DTP .   O1A   ? ? ? 1_555 J K   . K   B ? A DTP 506 A K   507 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc26 metalc ? ? J K   .   K     B ? ? 1_555 K HOH . O   ? ? A K   507 A HOH 804 1_555 ? ? ? ? ? ? ?            2.234 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.78  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -3.01 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -9.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N CYS A 324 ? N CYS A 321 O LEU A 427 ? O LEU A 424 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N CYS A 324 ? N CYS A 321 O LEU A 427 ? O LEU A 424 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  501 ? 8  'binding site for residue MG A 501'  
AC2 Software A CA  502 ? 6  'binding site for residue CA A 502'  
AC3 Software A MG  503 ? 6  'binding site for residue MG A 503'  
AC4 Software A GOL 504 ? 9  'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 10 'binding site for residue GOL A 505' 
AC6 Software A DTP 506 ? 29 'binding site for residue DTP A 506' 
AC7 Software A K   507 ? 8  'binding site for residue K A 507'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4  AC1 8  CA  E .   ? CA  A 502 . ? 1_555 ? 
5  AC1 8  MG  F .   ? MG  A 503 . ? 1_555 ? 
6  AC1 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
7  AC1 8  HOH K .   ? HOH A 804 . ? 1_555 ? 
8  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
9  AC2 6  ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 6  MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 6  ASP A 118 ? ASP A 115 . ? 1_555 ? 
12 AC2 6  MG  D .   ? MG  A 501 . ? 1_555 ? 
13 AC2 6  DTP I .   ? DTP A 506 . ? 1_555 ? 
14 AC2 6  K   J .   ? K   A 507 . ? 1_555 ? 
15 AC3 6  ASP A 16  ? ASP A 13  . ? 1_555 ? 
16 AC3 6  MET A 17  ? MET A 14  . ? 1_555 ? 
17 AC3 6  ASP A 118 ? ASP A 115 . ? 1_555 ? 
18 AC3 6  MG  D .   ? MG  A 501 . ? 1_555 ? 
19 AC3 6  DTP I .   ? DTP A 506 . ? 1_555 ? 
20 AC3 6  K   J .   ? K   A 507 . ? 1_555 ? 
21 AC4 9  ARG A 27  ? ARG A 24  . ? 6_545 ? 
22 AC4 9  GLN A 28  ? GLN A 25  . ? 6_545 ? 
23 AC4 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
24 AC4 9  SER A 251 ? SER A 248 . ? 1_555 ? 
25 AC4 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
26 AC4 9  HOH K .   ? HOH A 608 . ? 1_555 ? 
27 AC4 9  HOH K .   ? HOH A 636 . ? 1_555 ? 
28 AC4 9  HOH K .   ? HOH A 642 . ? 1_555 ? 
29 AC4 9  HOH K .   ? HOH A 716 . ? 1_555 ? 
30 AC5 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
31 AC5 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
32 AC5 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
33 AC5 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
34 AC5 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
35 AC5 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
36 AC5 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
37 AC5 10 HOH K .   ? HOH A 602 . ? 1_555 ? 
38 AC5 10 HOH K .   ? HOH A 648 . ? 5_664 ? 
39 AC5 10 HOH K .   ? HOH A 681 . ? 1_555 ? 
40 AC6 29 ASP A 16  ? ASP A 13  . ? 1_555 ? 
41 AC6 29 MET A 17  ? MET A 14  . ? 1_555 ? 
42 AC6 29 ASP A 18  ? ASP A 15  . ? 1_555 ? 
43 AC6 29 CYS A 19  ? CYS A 16  . ? 1_555 ? 
44 AC6 29 PHE A 20  ? PHE A 17  . ? 1_555 ? 
45 AC6 29 PHE A 21  ? PHE A 18  . ? 1_555 ? 
46 AC6 29 ILE A 51  ? ILE A 48  . ? 1_555 ? 
47 AC6 29 ALA A 52  ? ALA A 49  . ? 1_555 ? 
48 AC6 29 TYR A 55  ? TYR A 52  . ? 1_555 ? 
49 AC6 29 ARG A 58  ? ARG A 55  . ? 1_555 ? 
50 AC6 29 ILE A 117 ? ILE A 114 . ? 1_555 ? 
51 AC6 29 ASP A 118 ? ASP A 115 . ? 1_555 ? 
52 AC6 29 LYS A 234 ? LYS A 231 . ? 1_555 ? 
53 AC6 29 MG  D .   ? MG  A 501 . ? 1_555 ? 
54 AC6 29 CA  E .   ? CA  A 502 . ? 1_555 ? 
55 AC6 29 MG  F .   ? MG  A 503 . ? 1_555 ? 
56 AC6 29 K   J .   ? K   A 507 . ? 1_555 ? 
57 AC6 29 HOH K .   ? HOH A 638 . ? 1_555 ? 
58 AC6 29 HOH K .   ? HOH A 675 . ? 1_555 ? 
59 AC6 29 HOH K .   ? HOH A 698 . ? 1_555 ? 
60 AC6 29 HOH K .   ? HOH A 731 . ? 1_555 ? 
61 AC6 29 HOH K .   ? HOH A 774 . ? 1_555 ? 
62 AC6 29 HOH K .   ? HOH A 779 . ? 1_555 ? 
63 AC6 29 HOH K .   ? HOH A 804 . ? 1_555 ? 
64 AC6 29 DT  C 8   ? DT  P 8   . ? 1_555 ? 
65 AC6 29 HOH M .   ? HOH P 101 . ? 1_555 ? 
66 AC6 29 DT  B 3   ? DT  T 3   . ? 1_555 ? 
67 AC6 29 DT  B 4   ? DT  T 4   . ? 1_555 ? 
68 AC6 29 DA  B 5   ? DA  T 5   . ? 1_555 ? 
69 AC7 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
70 AC7 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
71 AC7 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
72 AC7 8  CA  E .   ? CA  A 502 . ? 1_555 ? 
73 AC7 8  MG  F .   ? MG  A 503 . ? 1_555 ? 
74 AC7 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
75 AC7 8  HOH K .   ? HOH A 804 . ? 1_555 ? 
76 AC7 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KFV 
_atom_sites.fract_transf_matrix[1][1]   0.010175 
_atom_sites.fract_transf_matrix[1][2]   0.005875 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011749 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012206 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
K  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.582 -33.942 -3.409  1.00 42.62 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.005 -33.761 -3.635  1.00 41.02 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.315 -32.804 -4.774  1.00 43.86 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.002 -31.614 -4.687  1.00 45.61 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 67.931 -33.324 -5.852  1.00 43.00 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.336 -32.558 -7.042  1.00 44.65 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.164 -32.051 -7.888  1.00 44.43 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.333 -31.110 -8.669  1.00 51.55 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.173 -33.569 -7.839  1.00 41.26 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.669 -34.907 -7.400  1.00 40.14 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.330 -34.740 -5.947  1.00 41.46 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 65.997 -32.668 -7.738  1.00 41.05 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 64.825 -32.292 -8.527  1.00 41.82 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 63.865 -31.416 -7.728  1.00 44.51 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 62.850 -30.951 -8.253  1.00 44.16 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.100 -33.546 -9.030  1.00 37.04 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.014 -34.546 -9.664  1.00 29.38 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.704 -34.288 -10.830 1.00 32.41 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.372 -35.794 -9.281  1.00 28.49 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.439 -35.340 -11.146 1.00 31.06 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.257 -36.268 -10.222 1.00 31.74 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.193 -31.190 -6.459  1.00 45.91 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.329 -30.413 -5.578  1.00 51.50 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.584 -28.921 -5.767  1.00 44.17 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.587 -28.391 -5.287  1.00 45.68 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.548 -30.812 -4.115  1.00 51.94 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.597 -30.130 -3.146  1.00 54.85 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 60.892 -30.667 -3.430  1.00 72.46 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 60.941 -32.315 -2.731  1.00 50.68 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.678 -28.258 -6.483  1.00 47.90 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.779 -26.822 -6.732  1.00 45.98 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 62.806 -26.052 -5.418  1.00 40.04 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.132 -26.423 -4.456  1.00 39.82 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.628 -26.342 -7.610  1.00 41.79 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.598 -24.987 -5.380  1.00 33.27 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 63.832 -24.267 -4.136  1.00 23.78 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.338 -22.826 -4.194  1.00 19.64 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.557 -22.062 -3.260  1.00 22.29 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.316 -24.259 -3.780  1.00 28.80 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.049 -23.588 -4.816  1.00 25.05 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 65.829 -25.687 -3.624  1.00 29.34 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.693 -22.465 -5.302  1.00 22.63 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.106 -21.139 -5.445  1.00 23.65 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.145 -20.041 -5.368  1.00 20.16 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 62.924 -19.010 -4.726  1.00 21.72 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.292 -20.264 -6.003  1.00 19.62 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.397 -19.310 -5.938  1.00 15.22 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 65.726 -18.764 -7.323  1.00 18.15 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 66.813 -18.258 -7.554  1.00 17.84 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.641 -19.961 -5.333  1.00 20.91 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.596 -20.160 -3.826  1.00 18.63 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 67.809 -20.915 -3.322  1.00 18.89 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.667 -20.374 -2.602  1.00 22.95 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 67.905 -22.172 -3.720  1.00 20.41 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 64.746 -18.853 -8.218  1.00 20.18 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 64.900 -18.517 -9.628  1.00 20.39 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 64.850 -17.011 -9.900  1.00 19.39 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.407 -16.543 -10.883 1.00 21.48 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 63.808 -19.223 -10.446 1.00 23.68 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.407 -19.122 -9.797  1.00 27.33 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.256 -19.432 -8.592  1.00 28.09 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.444 -18.727 -10.497 1.00 33.72 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.184 -16.263 -9.027  1.00 17.24 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 63.988 -14.825 -9.233  1.00 16.46 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.627 -13.972 -8.149  1.00 13.62 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 64.831 -14.433 -7.029  1.00 16.18 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.490 -14.481 -9.278  1.00 13.57 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 61.711 -15.104 -10.425 1.00 16.11 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.230 -14.741 -10.308 1.00 18.44 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.585 -15.366 -9.159  1.00 15.82 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.526 -14.856 -8.531  1.00 16.00 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 57.987 -15.484 -7.488  1.00 14.01 ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.015 -13.695 -8.931  1.00 18.61 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 64.899 -12.707 -8.469  1.00 11.77 ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.218 -11.732 -7.429  1.00 11.76 ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.081 -10.710 -7.427  1.00 12.95 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 63.832 -10.075 -8.449  1.00 14.08 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.569 -11.016 -7.655  1.00 13.39 ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 66.856 -10.020 -6.527  1.00 13.97 ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 67.699 -12.017 -7.749  1.00 16.96 ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.397 -10.566 -6.293  1.00 11.53 ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.230 -9.681  -6.216  1.00 12.04 ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.427 -8.708  -5.068  1.00 9.35  ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 62.873 -9.091  -3.993  1.00 11.14 ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 60.908 -10.462 -6.010  1.00 11.10 ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 59.710 -9.504  -5.810  1.00 12.99 ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.625 -11.398 -7.200  1.00 11.62 ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.119 -7.433  -5.291  1.00 10.65 ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.167 -6.500  -4.177  1.00 9.55  ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 60.818 -5.882  -3.956  1.00 9.93  ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.010 -5.800  -4.880  1.00 12.02 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.215 -5.410  -4.407  1.00 11.22 ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.591 -5.452  -2.727  1.00 7.92  ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.408 -4.664  -2.407  1.00 7.87  ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 59.885 -3.367  -1.774  1.00 12.58 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.594 -3.387  -0.770  1.00 12.83 ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.455 -5.426  -1.482  1.00 11.98 ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.144 -4.808  -0.956  1.00 12.12 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.351 -3.867  0.259   1.00 12.85 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.391 -4.090  -2.084  1.00 9.93  ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.505 -2.242  -2.378  1.00 9.71  ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 59.884 -0.926  -1.863  1.00 12.35 ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.656 -0.266  -1.274  1.00 11.95 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.650 -0.139  -1.964  1.00 13.57 ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.463 -0.043  -2.963  1.00 13.49 ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 60.900 1.306   -2.383  1.00 12.57 ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.619 -0.763  -3.642  1.00 13.42 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 58.713 0.103   0.001   1.00 10.22 ? 13  ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.606 0.742   0.683   1.00 12.78 ? 13  ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 57.978 2.069   1.337   1.00 11.82 ? 13  ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 58.783 2.099   2.181   1.00 11.10 ? 13  ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.029 -0.138  1.751   1.00 9.71  ? 13  ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 55.907 0.517   2.498   1.00 17.23 ? 13  ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 56.216 1.261   3.303   1.00 22.07 ? 13  ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 54.824 0.337   2.198   1.00 23.72 ? 13  ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.279 3.113   0.972   1.00 10.34 ? 14  MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 57.648 4.387   1.529   1.00 10.73 ? 14  MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.466 4.444   3.055   1.00 11.84 ? 14  MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.576 3.884   3.530   1.00 12.66 ? 14  MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 56.856 5.501   0.872   1.00 11.12 ? 14  MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 56.915 5.504   -0.629  1.00 12.68 ? 14  MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.603 5.564   -1.327  1.00 13.83 ? 14  MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.122 7.178   -0.851  1.00 17.21 ? 14  MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.338 5.114   3.777   1.00 10.39 ? 15  ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.168 5.258   5.211   1.00 9.61  ? 15  ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.135 6.347   5.487   1.00 10.72 ? 15  ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.160 7.340   4.876   1.00 10.84 ? 15  ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.453 5.687   5.859   1.00 11.83 ? 15  ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.558 4.663   5.743   1.00 11.31 ? 15  ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.292 3.500   5.633   1.00 13.54 ? 15  ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.673 5.064   5.786   1.00 15.35 ? 15  ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.215 6.041   6.377   1.00 9.93  ? 16  CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.207 6.986   6.865   1.00 10.42 ? 16  CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.710 7.938   5.767   1.00 9.91  ? 16  CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 54.854 9.064   5.886   1.00 11.36 ? 16  CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.488 7.650   8.205   1.00 11.57 ? 16  CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 56.986 8.568   8.281   1.00 13.52 ? 16  CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.233 7.385   4.671   1.00 10.29 ? 17  PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.239 8.125   3.427   1.00 9.94  ? 17  PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.464 9.443   3.408   1.00 9.83  ? 17  PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.023 10.396  3.096   1.00 8.80  ? 17  PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.658 7.236   2.310   1.00 9.21  ? 17  PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.704 7.850   0.948   1.00 10.45 ? 17  PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 54.831 8.444   0.492   1.00 9.69  ? 17  PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.615 7.839   0.141   1.00 10.72 ? 17  PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 54.872 8.991   -0.751  1.00 13.56 ? 17  PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.660 8.412   -1.095  1.00 12.38 ? 17  PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 53.795 8.963   -1.538  1.00 14.00 ? 17  PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.227 9.479   3.849   1.00 8.17  ? 18  PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.496 10.744  3.761   1.00 7.96  ? 18  PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.146 11.778  4.670   1.00 10.93 ? 18  PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.107 12.959  4.378   1.00 10.76 ? 18  PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.009 10.621  4.143   1.00 9.38  ? 18  PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.150 9.888   3.153   1.00 9.62  ? 18  PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 49.681 9.127   2.114   1.00 10.94 ? 18  PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 47.771 9.950   3.282   1.00 14.07 ? 18  PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 48.845 8.451   1.232   1.00 10.72 ? 18  PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 46.927 9.276   2.401   1.00 14.66 ? 18  PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.470 8.520   1.378   1.00 14.03 ? 18  PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.737 11.329  5.779   1.00 8.61  ? 19  VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.452 12.252  6.658   1.00 8.63  ? 19  VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.672 12.858  5.943   1.00 10.93 ? 19  VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 54.921 14.063  6.023   1.00 10.88 ? 19  VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 53.878 11.552  7.960   1.00 8.82  ? 19  VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 55.002 12.353  8.646   1.00 10.79 ? 19  VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.676 11.404  8.877   1.00 11.17 ? 19  VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.438 12.037  5.235   1.00 11.39 ? 20  GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.584 12.571  4.519   1.00 8.94  ? 20  GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.173 13.555  3.439   1.00 10.44 ? 20  GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 56.890 14.534  3.191   1.00 11.93 ? 20  GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.392 11.456  3.890   1.00 10.86 ? 20  GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.258 10.715  4.859   1.00 12.40 ? 20  GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.316 9.983   4.086   1.00 13.16 ? 20  GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.388 10.529  3.838   1.00 13.13 ? 20  GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.005 8.760   3.649   1.00 14.48 ? 20  GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.057 13.283  2.780   1.00 9.41  ? 21  VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.538 14.204  1.762   1.00 7.28  ? 21  VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.228 15.556  2.422   1.00 11.48 ? 21  VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.601 16.607  1.894   1.00 11.85 ? 21  VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.271 13.637  1.061   1.00 9.76  ? 21  VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.634 14.674  0.139   1.00 14.21 ? 21  VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.612 12.363  0.262   1.00 9.14  ? 21  VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.590 15.529  3.591   1.00 10.14 ? 22  GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.282 16.790  4.276   1.00 10.00 ? 22  GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.539 17.449  4.864   1.00 11.93 ? 22  GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.638 18.683  4.922   1.00 11.33 ? 22  GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.224 16.559  5.364   1.00 9.18  ? 22  GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 50.903 16.106  4.832   1.00 10.26 ? 22  GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.192 17.153  3.984   1.00 13.42 ? 22  GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.472 18.362  4.144   1.00 13.83 ? 22  GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.333 16.751  3.177   1.00 14.04 ? 22  GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.518 16.641  5.274   1.00 11.63 ? 23  GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 56.759 17.189  5.830   1.00 9.43  ? 23  GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.642 17.854  4.769   1.00 11.05 ? 23  GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.310 18.859  5.041   1.00 11.54 ? 23  GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.543 16.085  6.540   1.00 10.92 ? 23  GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 56.973 15.741  7.895   1.00 12.70 ? 23  GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.715 14.581  8.530   1.00 13.71 ? 23  GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.126 13.653  7.837   1.00 14.05 ? 23  GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 57.887 14.627  9.841   1.00 14.48 ? 23  GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.655 17.288  3.565   1.00 10.08 ? 24  ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.353 17.937  2.456   1.00 9.58  ? 24  ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 57.755 19.313  2.208   1.00 13.16 ? 24  ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.481 20.281  2.064   1.00 13.08 ? 24  ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.280 17.099  1.179   1.00 10.48 ? 24  ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 59.051 17.728  0.017   1.00 13.17 ? 24  ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.088 16.801  -1.182  1.00 13.28 ? 24  ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 57.788 16.714  -1.840  1.00 11.15 ? 24  ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.583 16.099  -2.991  1.00 9.70  ? 24  ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.599 15.513  -3.621  1.00 8.68  ? 24  ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.375 16.105  -3.526  1.00 14.11 ? 24  ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.427 19.386  2.177   1.00 10.03 ? 25  GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 55.725 20.637  1.875   1.00 10.91 ? 25  GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 55.897 21.680  2.968   1.00 13.87 ? 25  GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 55.996 22.882  2.692   1.00 12.01 ? 25  GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.227 20.364  1.659   1.00 13.46 ? 25  GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.445 21.579  1.125   1.00 11.76 ? 25  GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 51.949 21.296  1.013   1.00 17.88 ? 25  GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.549 20.260  0.492   1.00 17.16 ? 25  GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.126 22.232  1.469   1.00 24.73 ? 25  GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 55.885 21.222  4.215   1.00 11.52 ? 26  ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 55.939 22.098  5.370   1.00 13.22 ? 26  ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.103 21.702  6.258   1.00 13.22 ? 26  ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 56.993 20.791  7.077   1.00 12.71 ? 26  ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.619 22.052  6.156   1.00 13.63 ? 26  ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.622 22.992  7.360   1.00 14.95 ? 26  ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.608 23.668  7.627   1.00 16.40 ? 26  ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.491 23.056  8.073   1.00 17.12 ? 26  ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.240 22.385  6.090   1.00 13.65 ? 27  PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.463 22.098  6.843   1.00 15.00 ? 27  PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.256 22.147  8.359   1.00 15.64 ? 27  PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 59.968 21.465  9.090   1.00 14.37 ? 27  PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.418 23.202  6.380   1.00 17.54 ? 27  PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 59.947 23.497  4.987   1.00 14.49 ? 27  PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.459 23.394  5.044   1.00 12.83 ? 27  PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.274 22.909  8.823   1.00 14.64 ? 28  HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.009 22.979  10.261  1.00 19.46 ? 28  HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.638 21.624  10.859  1.00 17.65 ? 28  HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 57.759 21.417  12.067  1.00 20.94 ? 28  HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 56.892 23.975  10.561  1.00 22.96 ? 28  HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.333 25.403  10.523  1.00 26.14 ? 28  HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 56.550 26.408  9.988   1.00 29.73 ? 28  HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.468 25.993  10.953  1.00 30.09 ? 28  HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.188 27.558  10.103  1.00 30.50 ? 28  HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.356 27.337  10.679  1.00 29.55 ? 28  HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.181 20.705  10.017  1.00 13.57 ? 29  LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 56.743 19.387  10.502  1.00 15.69 ? 29  LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 57.864 18.359  10.531  1.00 16.53 ? 29  LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 57.689 17.259  11.065  1.00 12.52 ? 29  LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.608 18.849  9.633   1.00 10.57 ? 29  LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.354 19.696  9.435   1.00 13.47 ? 29  LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.372 18.954  8.531   1.00 15.58 ? 29  LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 53.713 20.045  10.767  1.00 20.79 ? 29  LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 59.015 18.703  9.955   1.00 12.48 ? 30  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.113 17.754  9.837   1.00 13.62 ? 30  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 60.719 17.417  11.200  1.00 15.73 ? 30  ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 60.835 18.280  12.066  1.00 15.83 ? 30  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.185 18.298  8.897   1.00 15.15 ? 30  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.668 18.575  7.491   1.00 14.10 ? 30  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 61.710 19.171  6.573   1.00 17.22 ? 30  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.145 19.447  5.247   1.00 16.19 ? 30  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 61.841 19.931  4.221   1.00 19.43 ? 30  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.133 20.197  4.359   1.00 18.24 ? 30  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.242 20.144  3.055   1.00 15.34 ? 30  ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.072 16.144  11.374  1.00 17.35 ? 31  ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 61.689 15.660  12.614  1.00 20.78 ? 31  ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 60.867 16.028  13.851  1.00 21.59 ? 31  ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.397 16.523  14.855  1.00 22.99 ? 31  ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.116 16.203  12.747  1.00 25.77 ? 31  ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 63.961 15.931  11.507  1.00 27.49 ? 31  ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.238 14.778  11.174  1.00 34.79 ? 31  ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.370 16.997  10.816  1.00 29.19 ? 31  ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.564 15.792  13.753  1.00 15.10 ? 32  LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.621 16.081  14.827  1.00 17.69 ? 32  LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.656 14.926  14.956  1.00 16.50 ? 32  LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.427 14.218  13.980  1.00 16.75 ? 32  LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 57.832 17.361  14.539  1.00 17.99 ? 32  LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 58.666 18.612  14.492  1.00 24.49 ? 32  LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 58.998 19.103  15.885  1.00 29.65 ? 32  LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 60.112 20.135  15.830  1.00 36.08 ? 32  LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 59.891 21.120  14.733  1.00 40.07 ? 32  LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 57.083 14.734  16.159  1.00 14.06 ? 33  PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 55.923 13.852  16.250  1.00 13.93 ? 33  PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 54.806 14.499  15.445  1.00 15.23 ? 33  PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 54.346 15.599  15.746  1.00 12.29 ? 33  PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 55.600 13.809  17.749  1.00 16.12 ? 33  PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 56.213 15.066  18.315  1.00 18.22 ? 33  PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 57.383 15.426  17.431  1.00 16.51 ? 33  PRO A CD    1 
ATOM   289  N  N     . CYS A 1 37  ? 54.387 13.835  14.389  1.00 12.47 ? 34  CYS A N     1 
ATOM   290  C  CA    A CYS A 1 37  ? 53.461 14.419  13.431  0.41 12.64 ? 34  CYS A CA    1 
ATOM   291  C  CA    B CYS A 1 37  ? 53.315 14.408  13.616  0.59 12.48 ? 34  CYS A CA    1 
ATOM   292  C  C     . CYS A 1 37  ? 52.542 13.328  12.898  1.00 11.85 ? 34  CYS A C     1 
ATOM   293  O  O     . CYS A 1 37  ? 52.966 12.182  12.818  1.00 12.55 ? 34  CYS A O     1 
ATOM   294  C  CB    A CYS A 1 37  ? 54.255 15.090  12.296  0.41 12.52 ? 34  CYS A CB    1 
ATOM   295  C  CB    B CYS A 1 37  ? 53.852 15.448  12.635  0.59 12.43 ? 34  CYS A CB    1 
ATOM   296  S  SG    A CYS A 1 37  ? 53.321 15.756  10.878  0.41 12.47 ? 34  CYS A SG    1 
ATOM   297  S  SG    B CYS A 1 37  ? 54.897 14.783  11.350  0.59 15.58 ? 34  CYS A SG    1 
ATOM   298  N  N     . ALA A 1 38  ? 51.336 13.688  12.481  1.00 11.02 ? 35  ALA A N     1 
ATOM   299  C  CA    . ALA A 1 38  ? 50.435 12.730  11.865  1.00 10.42 ? 35  ALA A CA    1 
ATOM   300  C  C     . ALA A 1 38  ? 49.583 13.428  10.837  1.00 11.84 ? 35  ALA A C     1 
ATOM   301  O  O     . ALA A 1 38  ? 49.463 14.661  10.851  1.00 12.14 ? 35  ALA A O     1 
ATOM   302  C  CB    . ALA A 1 38  ? 49.555 12.040  12.914  1.00 12.35 ? 35  ALA A CB    1 
ATOM   303  N  N     . VAL A 1 39  ? 48.977 12.636  9.962   1.00 9.22  ? 36  VAL A N     1 
ATOM   304  C  CA    . VAL A 1 39  ? 48.050 13.161  8.965   1.00 10.25 ? 36  VAL A CA    1 
ATOM   305  C  C     . VAL A 1 39  ? 46.642 12.738  9.339   1.00 14.99 ? 36  VAL A C     1 
ATOM   306  O  O     . VAL A 1 39  ? 46.399 11.573  9.653   1.00 12.22 ? 36  VAL A O     1 
ATOM   307  C  CB    . VAL A 1 39  ? 48.410 12.669  7.547   1.00 9.54  ? 36  VAL A CB    1 
ATOM   308  C  CG1   . VAL A 1 39  ? 47.318 13.016  6.533   1.00 12.44 ? 36  VAL A CG1   1 
ATOM   309  C  CG2   . VAL A 1 39  ? 49.755 13.271  7.120   1.00 11.89 ? 36  VAL A CG2   1 
ATOM   310  N  N     . VAL A 1 40  ? 45.721 13.698  9.322   1.00 13.43 ? 37  VAL A N     1 
ATOM   311  C  CA    . VAL A 1 40  ? 44.373 13.484  9.828   1.00 12.82 ? 37  VAL A CA    1 
ATOM   312  C  C     . VAL A 1 40  ? 43.372 13.814  8.733   1.00 15.51 ? 37  VAL A C     1 
ATOM   313  O  O     . VAL A 1 40  ? 43.616 14.731  7.945   1.00 17.05 ? 37  VAL A O     1 
ATOM   314  C  CB    . VAL A 1 40  ? 44.102 14.366  11.103  1.00 13.59 ? 37  VAL A CB    1 
ATOM   315  C  CG1   A VAL A 1 40  ? 44.948 13.899  12.257  0.38 14.84 ? 37  VAL A CG1   1 
ATOM   316  C  CG1   B VAL A 1 40  ? 44.025 15.845  10.742  0.62 16.91 ? 37  VAL A CG1   1 
ATOM   317  C  CG2   A VAL A 1 40  ? 44.351 15.842  10.809  0.38 16.51 ? 37  VAL A CG2   1 
ATOM   318  C  CG2   B VAL A 1 40  ? 42.842 13.931  11.807  0.62 13.86 ? 37  VAL A CG2   1 
ATOM   319  N  N     . GLN A 1 41  ? 42.265 13.074  8.644   1.00 13.63 ? 38  GLN A N     1 
ATOM   320  C  CA    . GLN A 1 41  ? 41.216 13.520  7.726   1.00 17.18 ? 38  GLN A CA    1 
ATOM   321  C  C     . GLN A 1 41  ? 39.952 13.844  8.511   1.00 14.08 ? 38  GLN A C     1 
ATOM   322  O  O     . GLN A 1 41  ? 39.563 13.126  9.434   1.00 15.73 ? 38  GLN A O     1 
ATOM   323  C  CB    . GLN A 1 41  ? 40.962 12.515  6.575   1.00 22.77 ? 38  GLN A CB    1 
ATOM   324  C  CG    . GLN A 1 41  ? 40.629 11.096  6.924   1.00 28.86 ? 38  GLN A CG    1 
ATOM   325  C  CD    . GLN A 1 41  ? 40.556 10.164  5.687   1.00 21.11 ? 38  GLN A CD    1 
ATOM   326  O  OE1   . GLN A 1 41  ? 40.877 10.543  4.544   1.00 22.80 ? 38  GLN A OE1   1 
ATOM   327  N  NE2   . GLN A 1 41  ? 40.119 8.944   5.927   1.00 22.57 ? 38  GLN A NE2   1 
ATOM   328  N  N     . TYR A 1 42  ? 39.366 14.978  8.125   1.00 15.19 ? 39  TYR A N     1 
ATOM   329  C  CA    . TYR A 1 42  ? 38.234 15.619  8.799   1.00 16.10 ? 39  TYR A CA    1 
ATOM   330  C  C     . TYR A 1 42  ? 38.694 16.071  10.188  1.00 16.92 ? 39  TYR A C     1 
ATOM   331  O  O     . TYR A 1 42  ? 39.873 15.931  10.523  1.00 17.22 ? 39  TYR A O     1 
ATOM   332  C  CB    . TYR A 1 42  ? 37.030 14.684  8.837   1.00 16.42 ? 39  TYR A CB    1 
ATOM   333  C  CG    . TYR A 1 42  ? 36.630 14.177  7.455   1.00 15.42 ? 39  TYR A CG    1 
ATOM   334  C  CD1   . TYR A 1 42  ? 36.389 15.061  6.412   1.00 18.07 ? 39  TYR A CD1   1 
ATOM   335  C  CD2   . TYR A 1 42  ? 36.534 12.805  7.189   1.00 15.96 ? 39  TYR A CD2   1 
ATOM   336  C  CE1   . TYR A 1 42  ? 36.033 14.602  5.145   1.00 18.43 ? 39  TYR A CE1   1 
ATOM   337  C  CE2   . TYR A 1 42  ? 36.168 12.339  5.921   1.00 16.77 ? 39  TYR A CE2   1 
ATOM   338  C  CZ    . TYR A 1 42  ? 35.916 13.245  4.913   1.00 16.29 ? 39  TYR A CZ    1 
ATOM   339  O  OH    . TYR A 1 42  ? 35.546 12.794  3.660   1.00 14.90 ? 39  TYR A OH    1 
ATOM   340  N  N     . LYS A 1 43  ? 37.805 16.661  10.975  1.00 18.49 ? 40  LYS A N     1 
ATOM   341  C  CA    . LYS A 1 43  ? 38.232 17.309  12.233  1.00 18.31 ? 40  LYS A CA    1 
ATOM   342  C  C     . LYS A 1 43  ? 37.126 17.349  13.272  1.00 24.33 ? 40  LYS A C     1 
ATOM   343  O  O     . LYS A 1 43  ? 37.381 17.196  14.464  1.00 24.77 ? 40  LYS A O     1 
ATOM   344  C  CB    . LYS A 1 43  ? 38.719 18.740  11.982  1.00 21.58 ? 40  LYS A CB    1 
ATOM   345  C  CG    . LYS A 1 43  ? 40.079 18.856  11.307  1.00 32.89 ? 40  LYS A CG    1 
ATOM   346  C  CD    . LYS A 1 43  ? 41.301 18.988  12.243  1.00 30.58 ? 40  LYS A CD    1 
ATOM   347  C  CE    . LYS A 1 43  ? 40.969 19.636  13.576  1.00 33.14 ? 40  LYS A CE    1 
ATOM   348  N  NZ    . LYS A 1 43  ? 42.226 19.883  14.369  1.00 31.44 ? 40  LYS A NZ    1 
ATOM   349  N  N     . SER A 1 44  ? 35.899 17.575  12.818  1.00 21.33 ? 41  SER A N     1 
ATOM   350  C  CA    . SER A 1 44  ? 34.777 17.777  13.724  1.00 25.72 ? 41  SER A CA    1 
ATOM   351  C  C     . SER A 1 44  ? 34.507 16.603  14.666  1.00 29.22 ? 41  SER A C     1 
ATOM   352  O  O     . SER A 1 44  ? 34.251 16.804  15.852  1.00 29.53 ? 41  SER A O     1 
ATOM   353  C  CB    . SER A 1 44  ? 33.526 18.099  12.910  1.00 28.52 ? 41  SER A CB    1 
ATOM   354  O  OG    . SER A 1 44  ? 33.769 19.247  12.108  1.00 34.81 ? 41  SER A OG    1 
ATOM   355  N  N     . TRP A 1 45  ? 34.575 15.380  14.154  1.00 23.88 ? 42  TRP A N     1 
ATOM   356  C  CA    . TRP A 1 45  ? 34.332 14.210  14.993  1.00 23.58 ? 42  TRP A CA    1 
ATOM   357  C  C     . TRP A 1 45  ? 35.629 13.703  15.628  1.00 20.14 ? 42  TRP A C     1 
ATOM   358  O  O     . TRP A 1 45  ? 36.492 13.153  14.943  1.00 22.23 ? 42  TRP A O     1 
ATOM   359  C  CB    . TRP A 1 45  ? 33.672 13.103  14.177  1.00 27.56 ? 42  TRP A CB    1 
ATOM   360  C  CG    . TRP A 1 45  ? 33.264 11.913  14.986  1.00 31.46 ? 42  TRP A CG    1 
ATOM   361  C  CD1   . TRP A 1 45  ? 33.979 10.768  15.184  1.00 28.83 ? 42  TRP A CD1   1 
ATOM   362  C  CD2   . TRP A 1 45  ? 32.035 11.748  15.694  1.00 34.32 ? 42  TRP A CD2   1 
ATOM   363  N  NE1   . TRP A 1 45  ? 33.272 9.899   15.981  1.00 34.83 ? 42  TRP A NE1   1 
ATOM   364  C  CE2   . TRP A 1 45  ? 32.074 10.477  16.306  1.00 37.08 ? 42  TRP A CE2   1 
ATOM   365  C  CE3   . TRP A 1 45  ? 30.906 12.552  15.872  1.00 34.85 ? 42  TRP A CE3   1 
ATOM   366  C  CZ2   . TRP A 1 45  ? 31.024 9.994   17.084  1.00 37.65 ? 42  TRP A CZ2   1 
ATOM   367  C  CZ3   . TRP A 1 45  ? 29.866 12.072  16.643  1.00 37.95 ? 42  TRP A CZ3   1 
ATOM   368  C  CH2   . TRP A 1 45  ? 29.931 10.805  17.238  1.00 35.30 ? 42  TRP A CH2   1 
ATOM   369  N  N     . LYS A 1 46  ? 35.750 13.924  16.936  1.00 24.07 ? 43  LYS A N     1 
ATOM   370  C  CA    . LYS A 1 46  ? 36.876 13.462  17.750  1.00 24.60 ? 43  LYS A CA    1 
ATOM   371  C  C     . LYS A 1 46  ? 38.248 13.896  17.248  1.00 23.63 ? 43  LYS A C     1 
ATOM   372  O  O     . LYS A 1 46  ? 39.250 13.199  17.458  1.00 20.95 ? 43  LYS A O     1 
ATOM   373  C  CB    . LYS A 1 46  ? 36.830 11.945  17.875  1.00 25.82 ? 43  LYS A CB    1 
ATOM   374  C  CG    . LYS A 1 46  ? 35.566 11.448  18.541  1.00 29.88 ? 43  LYS A CG    1 
ATOM   375  C  CD    . LYS A 1 46  ? 35.549 9.948   18.639  1.00 33.69 ? 43  LYS A CD    1 
ATOM   376  C  CE    . LYS A 1 46  ? 34.499 9.513   19.639  1.00 36.76 ? 43  LYS A CE    1 
ATOM   377  N  NZ    . LYS A 1 46  ? 34.836 10.029  21.003  1.00 44.33 ? 43  LYS A NZ    1 
ATOM   378  N  N     . GLY A 1 47  ? 38.292 15.055  16.606  1.00 17.36 ? 44  GLY A N     1 
ATOM   379  C  CA    . GLY A 1 47  ? 39.539 15.637  16.166  1.00 18.51 ? 44  GLY A CA    1 
ATOM   380  C  C     . GLY A 1 47  ? 39.961 15.197  14.782  1.00 17.19 ? 44  GLY A C     1 
ATOM   381  O  O     . GLY A 1 47  ? 40.948 15.701  14.256  1.00 16.08 ? 44  GLY A O     1 
ATOM   382  N  N     . GLY A 1 48  ? 39.213 14.252  14.208  1.00 18.78 ? 45  GLY A N     1 
ATOM   383  C  CA    . GLY A 1 48  ? 39.516 13.700  12.900  1.00 17.76 ? 45  GLY A CA    1 
ATOM   384  C  C     . GLY A 1 48  ? 40.188 12.346  13.035  1.00 17.89 ? 45  GLY A C     1 
ATOM   385  O  O     . GLY A 1 48  ? 40.685 12.002  14.104  1.00 16.54 ? 45  GLY A O     1 
ATOM   386  N  N     . GLY A 1 49  ? 40.240 11.586  11.949  1.00 15.02 ? 46  GLY A N     1 
ATOM   387  C  CA    . GLY A 1 49  ? 40.828 10.259  12.005  1.00 16.12 ? 46  GLY A CA    1 
ATOM   388  C  C     . GLY A 1 49  ? 42.242 10.258  11.472  1.00 16.63 ? 46  GLY A C     1 
ATOM   389  O  O     . GLY A 1 49  ? 42.492 10.719  10.358  1.00 15.50 ? 46  GLY A O     1 
ATOM   390  N  N     . ILE A 1 50  ? 43.166 9.724   12.262  1.00 12.64 ? 47  ILE A N     1 
ATOM   391  C  CA    . ILE A 1 50  ? 44.566 9.680   11.876  1.00 13.41 ? 47  ILE A CA    1 
ATOM   392  C  C     . ILE A 1 50  ? 44.789 8.565   10.858  1.00 14.18 ? 47  ILE A C     1 
ATOM   393  O  O     . ILE A 1 50  ? 44.357 7.431   11.080  1.00 16.46 ? 47  ILE A O     1 
ATOM   394  C  CB    . ILE A 1 50  ? 45.464 9.448   13.096  1.00 15.28 ? 47  ILE A CB    1 
ATOM   395  C  CG1   . ILE A 1 50  ? 45.452 10.688  13.991  1.00 20.47 ? 47  ILE A CG1   1 
ATOM   396  C  CG2   . ILE A 1 50  ? 46.885 9.102   12.672  1.00 14.94 ? 47  ILE A CG2   1 
ATOM   397  C  CD1   . ILE A 1 50  ? 46.398 10.604  15.131  1.00 24.80 ? 47  ILE A CD1   1 
ATOM   398  N  N     . ILE A 1 51  ? 45.448 8.881   9.746   1.00 13.27 ? 48  ILE A N     1 
ATOM   399  C  CA    . ILE A 1 51  ? 45.729 7.843   8.765   1.00 15.63 ? 48  ILE A CA    1 
ATOM   400  C  C     . ILE A 1 51  ? 47.221 7.650   8.478   1.00 11.62 ? 48  ILE A C     1 
ATOM   401  O  O     . ILE A 1 51  ? 47.576 6.730   7.741   1.00 13.70 ? 48  ILE A O     1 
ATOM   402  C  CB    . ILE A 1 51  ? 44.994 8.097   7.435   1.00 16.68 ? 48  ILE A CB    1 
ATOM   403  C  CG1   . ILE A 1 51  ? 45.386 9.443   6.818   1.00 13.70 ? 48  ILE A CG1   1 
ATOM   404  C  CG2   . ILE A 1 51  ? 43.470 7.981   7.642   1.00 16.76 ? 48  ILE A CG2   1 
ATOM   405  C  CD1   . ILE A 1 51  ? 44.862 9.603   5.379   1.00 16.30 ? 48  ILE A CD1   1 
ATOM   406  N  N     . ALA A 1 52  ? 48.089 8.472   9.076   1.00 11.41 ? 49  ALA A N     1 
ATOM   407  C  CA    . ALA A 1 52  ? 49.538 8.251   8.954   1.00 9.24  ? 49  ALA A CA    1 
ATOM   408  C  C     . ALA A 1 52  ? 50.273 8.908   10.109  1.00 10.49 ? 49  ALA A C     1 
ATOM   409  O  O     . ALA A 1 52  ? 49.852 9.955   10.588  1.00 11.68 ? 49  ALA A O     1 
ATOM   410  C  CB    . ALA A 1 52  ? 50.075 8.785   7.594   1.00 10.26 ? 49  ALA A CB    1 
ATOM   411  N  N     . VAL A 1 53  ? 51.374 8.301   10.558  1.00 9.55  ? 50  VAL A N     1 
ATOM   412  C  CA    . VAL A 1 53  ? 52.035 8.710   11.794  1.00 8.23  ? 50  VAL A CA    1 
ATOM   413  C  C     . VAL A 1 53  ? 53.542 8.627   11.646  1.00 9.22  ? 50  VAL A C     1 
ATOM   414  O  O     . VAL A 1 53  ? 54.078 7.589   11.219  1.00 10.37 ? 50  VAL A O     1 
ATOM   415  C  CB    . VAL A 1 53  ? 51.602 7.807   12.995  1.00 9.46  ? 50  VAL A CB    1 
ATOM   416  C  CG1   . VAL A 1 53  ? 52.188 8.314   14.281  1.00 13.27 ? 50  VAL A CG1   1 
ATOM   417  C  CG2   . VAL A 1 53  ? 50.094 7.715   13.097  1.00 15.31 ? 50  VAL A CG2   1 
ATOM   418  N  N     . SER A 1 54  ? 54.224 9.714   11.979  1.00 9.56  ? 51  SER A N     1 
ATOM   419  C  CA    . SER A 1 54  ? 55.675 9.749   11.928  1.00 9.99  ? 51  SER A CA    1 
ATOM   420  C  C     . SER A 1 54  ? 56.262 8.862   13.013  1.00 12.02 ? 51  SER A C     1 
ATOM   421  O  O     . SER A 1 54  ? 55.620 8.602   14.036  1.00 10.71 ? 51  SER A O     1 
ATOM   422  C  CB    . SER A 1 54  ? 56.192 11.180  12.096  1.00 10.82 ? 51  SER A CB    1 
ATOM   423  O  OG    . SER A 1 54  ? 56.250 11.526  13.475  1.00 11.59 ? 51  SER A OG    1 
ATOM   424  N  N     . TYR A 1 55  ? 57.488 8.400   12.794  1.00 12.01 ? 52  TYR A N     1 
ATOM   425  C  CA    . TYR A 1 55  ? 58.093 7.470   13.741  1.00 12.25 ? 52  TYR A CA    1 
ATOM   426  C  C     . TYR A 1 55  ? 58.337 8.119   15.104  1.00 14.75 ? 52  TYR A C     1 
ATOM   427  O  O     . TYR A 1 55  ? 58.226 7.452   16.130  1.00 14.62 ? 52  TYR A O     1 
ATOM   428  C  CB    . TYR A 1 55  ? 59.373 6.880   13.143  1.00 11.54 ? 52  TYR A CB    1 
ATOM   429  C  CG    . TYR A 1 55  ? 59.017 5.806   12.144  1.00 12.19 ? 52  TYR A CG    1 
ATOM   430  C  CD1   . TYR A 1 55  ? 58.668 6.124   10.838  1.00 10.54 ? 52  TYR A CD1   1 
ATOM   431  C  CD2   . TYR A 1 55  ? 58.950 4.471   12.532  1.00 15.32 ? 52  TYR A CD2   1 
ATOM   432  C  CE1   . TYR A 1 55  ? 58.287 5.130   9.931   1.00 13.01 ? 52  TYR A CE1   1 
ATOM   433  C  CE2   . TYR A 1 55  ? 58.581 3.477   11.641  1.00 14.12 ? 52  TYR A CE2   1 
ATOM   434  C  CZ    . TYR A 1 55  ? 58.253 3.797   10.343  1.00 13.19 ? 52  TYR A CZ    1 
ATOM   435  O  OH    . TYR A 1 55  ? 57.881 2.791   9.473   1.00 15.06 ? 52  TYR A OH    1 
ATOM   436  N  N     . GLU A 1 56  ? 58.613 9.419   15.123  1.00 13.71 ? 53  GLU A N     1 
ATOM   437  C  CA    . GLU A 1 56  ? 58.684 10.134  16.400  1.00 14.84 ? 53  GLU A CA    1 
ATOM   438  C  C     . GLU A 1 56  ? 57.366 10.045  17.169  1.00 15.96 ? 53  GLU A C     1 
ATOM   439  O  O     . GLU A 1 56  ? 57.358 9.878   18.392  1.00 17.35 ? 53  GLU A O     1 
ATOM   440  C  CB    . GLU A 1 56  ? 59.057 11.600  16.181  1.00 15.20 ? 53  GLU A CB    1 
ATOM   441  C  CG    . GLU A 1 56  ? 60.442 11.845  15.567  1.00 19.99 ? 53  GLU A CG    1 
ATOM   442  C  CD    . GLU A 1 56  ? 60.507 11.665  14.044  1.00 26.41 ? 53  GLU A CD    1 
ATOM   443  O  OE1   . GLU A 1 56  ? 59.485 11.298  13.414  1.00 20.13 ? 53  GLU A OE1   1 
ATOM   444  O  OE2   . GLU A 1 56  ? 61.598 11.902  13.473  1.00 31.56 ? 53  GLU A OE2   1 
ATOM   445  N  N     . ALA A 1 57  ? 56.241 10.163  16.465  1.00 10.93 ? 54  ALA A N     1 
ATOM   446  C  CA    . ALA A 1 57  ? 54.947 10.105  17.138  1.00 9.61  ? 54  ALA A CA    1 
ATOM   447  C  C     . ALA A 1 57  ? 54.594 8.668   17.544  1.00 12.97 ? 54  ALA A C     1 
ATOM   448  O  O     . ALA A 1 57  ? 53.937 8.451   18.554  1.00 13.47 ? 54  ALA A O     1 
ATOM   449  C  CB    . ALA A 1 57  ? 53.853 10.694  16.249  1.00 12.24 ? 54  ALA A CB    1 
ATOM   450  N  N     . ARG A 1 58  ? 55.038 7.685   16.768  1.00 12.80 ? 55  ARG A N     1 
ATOM   451  C  CA    . ARG A 1 58  ? 54.768 6.296   17.124  1.00 11.71 ? 55  ARG A CA    1 
ATOM   452  C  C     . ARG A 1 58  ? 55.405 5.928   18.460  1.00 14.18 ? 55  ARG A C     1 
ATOM   453  O  O     . ARG A 1 58  ? 54.890 5.071   19.172  1.00 15.31 ? 55  ARG A O     1 
ATOM   454  C  CB    . ARG A 1 58  ? 55.264 5.353   16.033  1.00 12.50 ? 55  ARG A CB    1 
ATOM   455  C  CG    . ARG A 1 58  ? 54.617 5.607   14.709  1.00 15.25 ? 55  ARG A CG    1 
ATOM   456  C  CD    . ARG A 1 58  ? 55.053 4.587   13.682  1.00 14.37 ? 55  ARG A CD    1 
ATOM   457  N  NE    . ARG A 1 58  ? 54.623 4.995   12.347  1.00 11.46 ? 55  ARG A NE    1 
ATOM   458  C  CZ    . ARG A 1 58  ? 54.725 4.242   11.265  1.00 16.56 ? 55  ARG A CZ    1 
ATOM   459  N  NH1   . ARG A 1 58  ? 55.250 3.025   11.352  1.00 13.31 ? 55  ARG A NH1   1 
ATOM   460  N  NH2   . ARG A 1 58  ? 54.291 4.720   10.095  1.00 15.05 ? 55  ARG A NH2   1 
ATOM   461  N  N     . ALA A 1 59  ? 56.506 6.597   18.795  1.00 14.85 ? 56  ALA A N     1 
ATOM   462  C  CA    . ALA A 1 59  ? 57.191 6.335   20.061  1.00 14.47 ? 56  ALA A CA    1 
ATOM   463  C  C     . ALA A 1 59  ? 56.294 6.655   21.260  1.00 16.62 ? 56  ALA A C     1 
ATOM   464  O  O     . ALA A 1 59  ? 56.491 6.103   22.338  1.00 17.82 ? 56  ALA A O     1 
ATOM   465  C  CB    . ALA A 1 59  ? 58.492 7.127   20.141  1.00 16.12 ? 56  ALA A CB    1 
ATOM   466  N  N     . PHE A 1 60  ? 55.313 7.540   21.075  1.00 13.24 ? 57  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 60  ? 54.376 7.906   22.145  1.00 13.62 ? 57  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 60  ? 53.163 6.986   22.171  1.00 14.93 ? 57  PHE A C     1 
ATOM   469  O  O     . PHE A 1 60  ? 52.312 7.097   23.055  1.00 18.18 ? 57  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 60  ? 53.895 9.353   21.990  1.00 13.96 ? 57  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 60  ? 54.935 10.388  22.296  1.00 15.20 ? 57  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 60  ? 54.993 10.991  23.557  1.00 18.46 ? 57  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 60  ? 55.840 10.776  21.333  1.00 16.44 ? 57  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 60  ? 55.941 11.966  23.833  1.00 22.95 ? 57  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 60  ? 56.788 11.743  21.599  1.00 22.85 ? 57  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 60  ? 56.841 12.342  22.854  1.00 22.99 ? 57  PHE A CZ    1 
ATOM   477  N  N     . GLY A 1 61  ? 53.067 6.107   21.178  1.00 13.25 ? 58  GLY A N     1 
ATOM   478  C  CA    . GLY A 1 61  ? 51.946 5.187   21.069  1.00 16.10 ? 58  GLY A CA    1 
ATOM   479  C  C     . GLY A 1 61  ? 50.859 5.619   20.101  1.00 12.74 ? 58  GLY A C     1 
ATOM   480  O  O     . GLY A 1 61  ? 49.794 4.984   19.999  1.00 13.85 ? 58  GLY A O     1 
ATOM   481  N  N     . VAL A 1 62  ? 51.119 6.697   19.370  1.00 12.91 ? 59  VAL A N     1 
ATOM   482  C  CA    . VAL A 1 62  ? 50.169 7.166   18.370  1.00 14.05 ? 59  VAL A CA    1 
ATOM   483  C  C     . VAL A 1 62  ? 50.146 6.176   17.203  1.00 12.24 ? 59  VAL A C     1 
ATOM   484  O  O     . VAL A 1 62  ? 51.196 5.696   16.765  1.00 13.60 ? 59  VAL A O     1 
ATOM   485  C  CB    . VAL A 1 62  ? 50.522 8.587   17.880  1.00 10.93 ? 59  VAL A CB    1 
ATOM   486  C  CG1   . VAL A 1 62  ? 49.490 9.067   16.864  1.00 13.07 ? 59  VAL A CG1   1 
ATOM   487  C  CG2   . VAL A 1 62  ? 50.548 9.554   19.061  1.00 13.26 ? 59  VAL A CG2   1 
ATOM   488  N  N     . THR A 1 63  ? 48.948 5.839   16.723  1.00 14.43 ? 60  THR A N     1 
ATOM   489  C  CA    . THR A 1 63  ? 48.808 4.963   15.569  1.00 15.13 ? 60  THR A CA    1 
ATOM   490  C  C     . THR A 1 63  ? 47.849 5.526   14.549  1.00 16.62 ? 60  THR A C     1 
ATOM   491  O  O     . THR A 1 63  ? 47.107 6.459   14.836  1.00 16.48 ? 60  THR A O     1 
ATOM   492  C  CB    . THR A 1 63  ? 48.277 3.577   15.962  1.00 14.84 ? 60  THR A CB    1 
ATOM   493  O  OG1   . THR A 1 63  ? 46.900 3.698   16.343  1.00 17.76 ? 60  THR A OG1   1 
ATOM   494  C  CG2   . THR A 1 63  ? 49.071 3.003   17.106  1.00 17.49 ? 60  THR A CG2   1 
ATOM   495  N  N     . ALA A 1 64  ? 47.833 4.945   13.355  1.00 13.58 ? 61  ALA A N     1 
ATOM   496  C  CA    . ALA A 1 64  ? 46.740 5.202   12.425  1.00 16.05 ? 61  ALA A CA    1 
ATOM   497  C  C     . ALA A 1 64  ? 45.486 4.510   12.982  1.00 22.81 ? 61  ALA A C     1 
ATOM   498  O  O     . ALA A 1 64  ? 45.608 3.725   13.916  1.00 23.60 ? 61  ALA A O     1 
ATOM   499  C  CB    . ALA A 1 64  ? 47.093 4.704   11.028  1.00 18.45 ? 61  ALA A CB    1 
ATOM   500  N  N     . SER A 1 65  ? 44.304 4.814   12.437  1.00 21.65 ? 62  SER A N     1 
ATOM   501  C  CA    . SER A 1 65  ? 43.009 4.302   12.942  1.00 27.03 ? 62  SER A CA    1 
ATOM   502  C  C     . SER A 1 65  ? 42.612 4.946   14.271  1.00 26.60 ? 62  SER A C     1 
ATOM   503  O  O     . SER A 1 65  ? 41.551 4.662   14.807  1.00 38.93 ? 62  SER A O     1 
ATOM   504  C  CB    . SER A 1 65  ? 43.011 2.778   13.111  1.00 36.79 ? 62  SER A CB    1 
ATOM   505  O  OG    . SER A 1 65  ? 43.469 2.415   14.406  1.00 42.23 ? 62  SER A OG    1 
ATOM   506  N  N     . MET A 1 66  ? 43.460 5.822   14.789  1.00 25.03 ? 63  MET A N     1 
ATOM   507  C  CA    . MET A 1 66  ? 43.210 6.524   16.044  1.00 20.07 ? 63  MET A CA    1 
ATOM   508  C  C     . MET A 1 66  ? 42.549 7.871   15.776  1.00 19.05 ? 63  MET A C     1 
ATOM   509  O  O     . MET A 1 66  ? 42.888 8.515   14.794  1.00 18.67 ? 63  MET A O     1 
ATOM   510  C  CB    . MET A 1 66  ? 44.541 6.712   16.764  1.00 23.40 ? 63  MET A CB    1 
ATOM   511  C  CG    . MET A 1 66  ? 44.504 7.151   18.177  1.00 21.50 ? 63  MET A CG    1 
ATOM   512  S  SD    . MET A 1 66  ? 46.188 7.035   18.836  1.00 21.37 ? 63  MET A SD    1 
ATOM   513  C  CE    . MET A 1 66  ? 46.278 5.323   19.318  1.00 22.28 ? 63  MET A CE    1 
ATOM   514  N  N     . TRP A 1 67  ? 41.619 8.294   16.636  1.00 16.23 ? 64  TRP A N     1 
ATOM   515  C  CA    . TRP A 1 67  ? 41.082 9.655   16.567  1.00 19.65 ? 64  TRP A CA    1 
ATOM   516  C  C     . TRP A 1 67  ? 42.133 10.641  17.054  1.00 18.28 ? 64  TRP A C     1 
ATOM   517  O  O     . TRP A 1 67  ? 42.867 10.335  17.989  1.00 16.51 ? 64  TRP A O     1 
ATOM   518  C  CB    . TRP A 1 67  ? 39.811 9.791   17.409  1.00 19.57 ? 64  TRP A CB    1 
ATOM   519  C  CG    . TRP A 1 67  ? 38.716 8.941   16.918  1.00 20.69 ? 64  TRP A CG    1 
ATOM   520  C  CD1   . TRP A 1 67  ? 38.152 7.881   17.564  1.00 25.95 ? 64  TRP A CD1   1 
ATOM   521  C  CD2   . TRP A 1 67  ? 38.052 9.048   15.653  1.00 20.53 ? 64  TRP A CD2   1 
ATOM   522  N  NE1   . TRP A 1 67  ? 37.170 7.325   16.781  1.00 30.09 ? 64  TRP A NE1   1 
ATOM   523  C  CE2   . TRP A 1 67  ? 37.089 8.022   15.605  1.00 30.31 ? 64  TRP A CE2   1 
ATOM   524  C  CE3   . TRP A 1 67  ? 38.172 9.916   14.563  1.00 18.36 ? 64  TRP A CE3   1 
ATOM   525  C  CZ2   . TRP A 1 67  ? 36.245 7.848   14.509  1.00 28.94 ? 64  TRP A CZ2   1 
ATOM   526  C  CZ3   . TRP A 1 67  ? 37.339 9.731   13.471  1.00 21.53 ? 64  TRP A CZ3   1 
ATOM   527  C  CH2   . TRP A 1 67  ? 36.389 8.709   13.453  1.00 25.54 ? 64  TRP A CH2   1 
ATOM   528  N  N     . ALA A 1 68  ? 42.215 11.816  16.435  1.00 14.03 ? 65  ALA A N     1 
ATOM   529  C  CA    . ALA A 1 68  ? 43.232 12.782  16.835  1.00 16.02 ? 65  ALA A CA    1 
ATOM   530  C  C     . ALA A 1 68  ? 43.095 13.187  18.304  1.00 15.07 ? 65  ALA A C     1 
ATOM   531  O  O     . ALA A 1 68  ? 44.096 13.427  18.964  1.00 14.95 ? 65  ALA A O     1 
ATOM   532  C  CB    . ALA A 1 68  ? 43.193 14.024  15.939  1.00 15.14 ? 65  ALA A CB    1 
ATOM   533  N  N     . ASP A 1 69  ? 41.868 13.276  18.819  1.00 19.38 ? 66  ASP A N     1 
ATOM   534  C  CA    . ASP A 1 69  ? 41.716 13.708  20.211  1.00 16.52 ? 66  ASP A CA    1 
ATOM   535  C  C     . ASP A 1 69  ? 42.348 12.690  21.163  1.00 18.20 ? 66  ASP A C     1 
ATOM   536  O  O     . ASP A 1 69  ? 42.926 13.053  22.194  1.00 17.35 ? 66  ASP A O     1 
ATOM   537  C  CB    . ASP A 1 69  ? 40.250 13.921  20.568  1.00 23.93 ? 66  ASP A CB    1 
ATOM   538  C  CG    . ASP A 1 69  ? 39.663 15.163  19.914  1.00 22.31 ? 66  ASP A CG    1 
ATOM   539  O  OD1   . ASP A 1 69  ? 40.424 16.023  19.416  1.00 27.57 ? 66  ASP A OD1   1 
ATOM   540  O  OD2   . ASP A 1 69  ? 38.432 15.275  19.909  1.00 27.29 ? 66  ASP A OD2   1 
ATOM   541  N  N     . ASP A 1 70  ? 42.249 11.417  20.806  1.00 15.01 ? 67  ASP A N     1 
ATOM   542  C  CA    . ASP A 1 70  ? 42.845 10.365  21.618  1.00 15.85 ? 67  ASP A CA    1 
ATOM   543  C  C     . ASP A 1 70  ? 44.359 10.338  21.456  1.00 15.22 ? 67  ASP A C     1 
ATOM   544  O  O     . ASP A 1 70  ? 45.100 10.147  22.418  1.00 14.37 ? 67  ASP A O     1 
ATOM   545  C  CB    . ASP A 1 70  ? 42.222 9.025   21.244  1.00 20.36 ? 67  ASP A CB    1 
ATOM   546  C  CG    . ASP A 1 70  ? 40.735 8.984   21.565  1.00 28.42 ? 67  ASP A CG    1 
ATOM   547  O  OD1   . ASP A 1 70  ? 40.314 9.688   22.516  1.00 27.17 ? 67  ASP A OD1   1 
ATOM   548  O  OD2   . ASP A 1 70  ? 39.986 8.286   20.854  1.00 29.66 ? 67  ASP A OD2   1 
ATOM   549  N  N     . ALA A 1 71  ? 44.821 10.553  20.232  1.00 14.56 ? 68  ALA A N     1 
ATOM   550  C  CA    . ALA A 1 71  ? 46.255 10.648  19.991  1.00 14.36 ? 68  ALA A CA    1 
ATOM   551  C  C     . ALA A 1 71  ? 46.891 11.786  20.799  1.00 12.46 ? 68  ALA A C     1 
ATOM   552  O  O     . ALA A 1 71  ? 47.985 11.634  21.322  1.00 14.32 ? 68  ALA A O     1 
ATOM   553  C  CB    . ALA A 1 71  ? 46.538 10.843  18.509  1.00 15.20 ? 68  ALA A CB    1 
ATOM   554  N  N     . LYS A 1 72  ? 46.196 12.919  20.883  1.00 12.26 ? 69  LYS A N     1 
ATOM   555  C  CA    . LYS A 1 72  ? 46.695 14.070  21.629  1.00 14.11 ? 69  LYS A CA    1 
ATOM   556  C  C     . LYS A 1 72  ? 46.815 13.764  23.119  1.00 15.60 ? 69  LYS A C     1 
ATOM   557  O  O     . LYS A 1 72  ? 47.590 14.396  23.835  1.00 14.54 ? 69  LYS A O     1 
ATOM   558  C  CB    . LYS A 1 72  ? 45.774 15.274  21.409  1.00 13.69 ? 69  LYS A CB    1 
ATOM   559  C  CG    . LYS A 1 72  ? 46.083 16.073  20.145  1.00 15.58 ? 69  LYS A CG    1 
ATOM   560  C  CD    . LYS A 1 72  ? 47.398 16.847  20.267  1.00 17.68 ? 69  LYS A CD    1 
ATOM   561  C  CE    . LYS A 1 72  ? 47.491 17.990  19.258  1.00 23.58 ? 69  LYS A CE    1 
ATOM   562  N  NZ    . LYS A 1 72  ? 48.752 18.793  19.457  1.00 20.22 ? 69  LYS A NZ    1 
ATOM   563  N  N     . LYS A 1 73  ? 46.040 12.791  23.594  1.00 14.01 ? 70  LYS A N     1 
ATOM   564  C  CA    . LYS A 1 73  ? 46.167 12.393  24.986  1.00 16.40 ? 70  LYS A CA    1 
ATOM   565  C  C     . LYS A 1 73  ? 47.508 11.677  25.201  1.00 17.64 ? 70  LYS A C     1 
ATOM   566  O  O     . LYS A 1 73  ? 48.129 11.825  26.248  1.00 18.33 ? 70  LYS A O     1 
ATOM   567  C  CB    . LYS A 1 73  ? 45.003 11.502  25.399  1.00 13.05 ? 70  LYS A CB    1 
ATOM   568  C  CG    . LYS A 1 73  ? 43.641 12.120  25.154  1.00 13.15 ? 70  LYS A CG    1 
ATOM   569  C  CD    . LYS A 1 73  ? 42.539 11.097  25.387  1.00 15.11 ? 70  LYS A CD    1 
ATOM   570  C  CE    . LYS A 1 73  ? 41.138 11.648  25.116  1.00 19.61 ? 70  LYS A CE    1 
ATOM   571  N  NZ    . LYS A 1 73  ? 40.116 10.565  25.162  1.00 23.07 ? 70  LYS A NZ    1 
ATOM   572  N  N     . LEU A 1 74  ? 47.956 10.915  24.202  1.00 15.12 ? 71  LEU A N     1 
ATOM   573  C  CA    . LEU A 1 74  ? 49.249 10.224  24.307  1.00 14.54 ? 71  LEU A CA    1 
ATOM   574  C  C     . LEU A 1 74  ? 50.430 11.149  24.025  1.00 16.95 ? 71  LEU A C     1 
ATOM   575  O  O     . LEU A 1 74  ? 51.536 10.963  24.557  1.00 17.93 ? 71  LEU A O     1 
ATOM   576  C  CB    . LEU A 1 74  ? 49.303 9.039   23.342  1.00 14.32 ? 71  LEU A CB    1 
ATOM   577  C  CG    . LEU A 1 74  ? 48.315 7.897   23.581  1.00 17.96 ? 71  LEU A CG    1 
ATOM   578  C  CD1   . LEU A 1 74  ? 48.466 6.895   22.453  1.00 16.89 ? 71  LEU A CD1   1 
ATOM   579  C  CD2   . LEU A 1 74  ? 48.517 7.213   24.939  1.00 16.34 ? 71  LEU A CD2   1 
ATOM   580  N  N     . CYS A 1 75  ? 50.184 12.137  23.173  1.00 14.83 ? 72  CYS A N     1 
ATOM   581  C  CA    . CYS A 1 75  ? 51.237 12.991  22.647  1.00 15.31 ? 72  CYS A CA    1 
ATOM   582  C  C     . CYS A 1 75  ? 50.688 14.399  22.490  1.00 16.20 ? 72  CYS A C     1 
ATOM   583  O  O     . CYS A 1 75  ? 50.199 14.775  21.429  1.00 15.42 ? 72  CYS A O     1 
ATOM   584  C  CB    . CYS A 1 75  ? 51.747 12.439  21.325  1.00 16.45 ? 72  CYS A CB    1 
ATOM   585  S  SG    . CYS A 1 75  ? 53.061 13.401  20.543  1.00 18.23 ? 72  CYS A SG    1 
ATOM   586  N  N     . PRO A 1 76  ? 50.734 15.176  23.576  1.00 17.02 ? 73  PRO A N     1 
ATOM   587  C  CA    . PRO A 1 76  ? 50.158 16.526  23.585  1.00 17.65 ? 73  PRO A CA    1 
ATOM   588  C  C     . PRO A 1 76  ? 50.748 17.477  22.543  1.00 15.39 ? 73  PRO A C     1 
ATOM   589  O  O     . PRO A 1 76  ? 50.032 18.369  22.062  1.00 19.97 ? 73  PRO A O     1 
ATOM   590  C  CB    . PRO A 1 76  ? 50.461 17.012  25.004  1.00 21.72 ? 73  PRO A CB    1 
ATOM   591  C  CG    . PRO A 1 76  ? 50.455 15.759  25.816  1.00 23.05 ? 73  PRO A CG    1 
ATOM   592  C  CD    . PRO A 1 76  ? 51.092 14.716  24.931  1.00 21.54 ? 73  PRO A CD    1 
ATOM   593  N  N     . ASP A 1 77  ? 52.019 17.298  22.212  1.00 16.75 ? 74  ASP A N     1 
ATOM   594  C  CA    . ASP A 1 77  ? 52.679 18.167  21.245  1.00 19.85 ? 74  ASP A CA    1 
ATOM   595  C  C     . ASP A 1 77  ? 52.600 17.624  19.825  1.00 19.23 ? 74  ASP A C     1 
ATOM   596  O  O     . ASP A 1 77  ? 53.319 18.108  18.946  1.00 17.86 ? 74  ASP A O     1 
ATOM   597  C  CB    . ASP A 1 77  ? 54.150 18.361  21.607  1.00 20.59 ? 74  ASP A CB    1 
ATOM   598  C  CG    . ASP A 1 77  ? 54.340 19.000  22.961  1.00 28.65 ? 74  ASP A CG    1 
ATOM   599  O  OD1   . ASP A 1 77  ? 55.251 18.550  23.693  1.00 33.76 ? 74  ASP A OD1   1 
ATOM   600  O  OD2   . ASP A 1 77  ? 53.588 19.943  23.295  1.00 29.67 ? 74  ASP A OD2   1 
ATOM   601  N  N     . LEU A 1 78  ? 51.760 16.613  19.604  1.00 14.44 ? 75  LEU A N     1 
ATOM   602  C  CA    . LEU A 1 78  ? 51.612 16.033  18.262  1.00 12.95 ? 75  LEU A CA    1 
ATOM   603  C  C     . LEU A 1 78  ? 51.226 17.091  17.249  1.00 15.80 ? 75  LEU A C     1 
ATOM   604  O  O     . LEU A 1 78  ? 50.285 17.839  17.473  1.00 15.20 ? 75  LEU A O     1 
ATOM   605  C  CB    . LEU A 1 78  ? 50.557 14.935  18.251  1.00 11.69 ? 75  LEU A CB    1 
ATOM   606  C  CG    . LEU A 1 78  ? 50.230 14.193  16.951  1.00 13.07 ? 75  LEU A CG    1 
ATOM   607  C  CD1   . LEU A 1 78  ? 51.384 13.287  16.527  1.00 13.44 ? 75  LEU A CD1   1 
ATOM   608  C  CD2   . LEU A 1 78  ? 48.984 13.373  17.173  1.00 14.99 ? 75  LEU A CD2   1 
ATOM   609  N  N     . LEU A 1 79  ? 51.951 17.145  16.138  1.00 11.71 ? 76  LEU A N     1 
ATOM   610  C  CA    . LEU A 1 79  ? 51.595 18.066  15.076  1.00 11.59 ? 76  LEU A CA    1 
ATOM   611  C  C     . LEU A 1 79  ? 50.709 17.355  14.069  1.00 16.56 ? 76  LEU A C     1 
ATOM   612  O  O     . LEU A 1 79  ? 50.854 16.155  13.822  1.00 14.23 ? 76  LEU A O     1 
ATOM   613  C  CB    . LEU A 1 79  ? 52.844 18.628  14.410  1.00 10.40 ? 76  LEU A CB    1 
ATOM   614  C  CG    . LEU A 1 79  ? 53.799 19.318  15.379  1.00 11.88 ? 76  LEU A CG    1 
ATOM   615  C  CD1   . LEU A 1 79  ? 54.993 19.888  14.644  1.00 13.68 ? 76  LEU A CD1   1 
ATOM   616  C  CD2   . LEU A 1 79  ? 53.068 20.422  16.153  1.00 14.72 ? 76  LEU A CD2   1 
ATOM   617  N  N     . LEU A 1 80  ? 49.785 18.099  13.479  1.00 12.46 ? 77  LEU A N     1 
ATOM   618  C  CA    . LEU A 1 80  ? 48.831 17.499  12.563  1.00 15.84 ? 77  LEU A CA    1 
ATOM   619  C  C     . LEU A 1 80  ? 48.777 18.236  11.239  1.00 18.01 ? 77  LEU A C     1 
ATOM   620  O  O     . LEU A 1 80  ? 48.788 19.471  11.193  1.00 20.45 ? 77  LEU A O     1 
ATOM   621  C  CB    . LEU A 1 80  ? 47.440 17.464  13.184  1.00 15.06 ? 77  LEU A CB    1 
ATOM   622  C  CG    . LEU A 1 80  ? 47.265 16.663  14.463  1.00 15.02 ? 77  LEU A CG    1 
ATOM   623  C  CD1   . LEU A 1 80  ? 45.853 16.858  14.990  1.00 18.81 ? 77  LEU A CD1   1 
ATOM   624  C  CD2   . LEU A 1 80  ? 47.564 15.179  14.231  1.00 14.40 ? 77  LEU A CD2   1 
ATOM   625  N  N     . ALA A 1 81  ? 48.741 17.469  10.161  1.00 12.00 ? 78  ALA A N     1 
ATOM   626  C  CA    . ALA A 1 81  ? 48.459 18.015  8.839   1.00 13.12 ? 78  ALA A CA    1 
ATOM   627  C  C     . ALA A 1 81  ? 47.154 17.420  8.332   1.00 13.75 ? 78  ALA A C     1 
ATOM   628  O  O     . ALA A 1 81  ? 46.917 16.222  8.476   1.00 13.34 ? 78  ALA A O     1 
ATOM   629  C  CB    . ALA A 1 81  ? 49.609 17.726  7.880   1.00 13.73 ? 78  ALA A CB    1 
ATOM   630  N  N     . GLN A 1 82  ? 46.288 18.260  7.764   1.00 13.58 ? 79  GLN A N     1 
ATOM   631  C  CA    . GLN A 1 82  ? 44.969 17.784  7.338   1.00 16.31 ? 79  GLN A CA    1 
ATOM   632  C  C     . GLN A 1 82  ? 44.934 17.413  5.874   1.00 12.53 ? 79  GLN A C     1 
ATOM   633  O  O     . GLN A 1 82  ? 45.501 18.125  5.042   1.00 16.19 ? 79  GLN A O     1 
ATOM   634  C  CB    . GLN A 1 82  ? 43.898 18.844  7.587   1.00 19.30 ? 79  GLN A CB    1 
ATOM   635  C  CG    . GLN A 1 82  ? 43.638 19.181  9.028   1.00 22.44 ? 79  GLN A CG    1 
ATOM   636  C  CD    . GLN A 1 82  ? 42.489 20.151  9.140   1.00 25.43 ? 79  GLN A CD    1 
ATOM   637  O  OE1   . GLN A 1 82  ? 42.658 21.290  9.568   1.00 30.26 ? 79  GLN A OE1   1 
ATOM   638  N  NE2   . GLN A 1 82  ? 41.305 19.710  8.711   1.00 29.21 ? 79  GLN A NE2   1 
ATOM   639  N  N     . VAL A 1 83  ? 44.259 16.308  5.572   1.00 14.83 ? 80  VAL A N     1 
ATOM   640  C  CA    . VAL A 1 83  ? 43.938 15.947  4.196   1.00 13.36 ? 80  VAL A CA    1 
ATOM   641  C  C     . VAL A 1 83  ? 43.040 17.021  3.600   1.00 14.09 ? 80  VAL A C     1 
ATOM   642  O  O     . VAL A 1 83  ? 42.102 17.487  4.240   1.00 13.48 ? 80  VAL A O     1 
ATOM   643  C  CB    . VAL A 1 83  ? 43.237 14.584  4.117   1.00 14.20 ? 80  VAL A CB    1 
ATOM   644  C  CG1   . VAL A 1 83  ? 42.746 14.300  2.713   1.00 13.56 ? 80  VAL A CG1   1 
ATOM   645  C  CG2   . VAL A 1 83  ? 44.187 13.479  4.590   1.00 13.42 ? 80  VAL A CG2   1 
ATOM   646  N  N     . ARG A 1 84  ? 43.362 17.407  2.378   1.00 13.73 ? 81  ARG A N     1 
ATOM   647  C  CA    . ARG A 1 84  ? 42.590 18.406  1.655   1.00 13.99 ? 81  ARG A CA    1 
ATOM   648  C  C     . ARG A 1 84  ? 41.133 17.993  1.526   1.00 15.56 ? 81  ARG A C     1 
ATOM   649  O  O     . ARG A 1 84  ? 40.819 16.811  1.353   1.00 13.15 ? 81  ARG A O     1 
ATOM   650  C  CB    . ARG A 1 84  ? 43.202 18.616  0.272   1.00 20.70 ? 81  ARG A CB    1 
ATOM   651  C  CG    . ARG A 1 84  ? 42.350 19.456  -0.665  1.00 19.57 ? 81  ARG A CG    1 
ATOM   652  C  CD    . ARG A 1 84  ? 43.059 19.672  -2.000  1.00 26.10 ? 81  ARG A CD    1 
ATOM   653  N  NE    . ARG A 1 84  ? 42.122 20.020  -3.065  1.00 37.30 ? 81  ARG A NE    1 
ATOM   654  C  CZ    . ARG A 1 84  ? 42.392 19.916  -4.364  1.00 40.53 ? 81  ARG A CZ    1 
ATOM   655  N  NH1   . ARG A 1 84  ? 43.579 19.481  -4.765  1.00 39.53 ? 81  ARG A NH1   1 
ATOM   656  N  NH2   . ARG A 1 84  ? 41.474 20.249  -5.264  1.00 38.62 ? 81  ARG A NH2   1 
ATOM   657  N  N     . GLU A 1 85  ? 40.235 18.964  1.625   1.00 12.86 ? 82  GLU A N     1 
ATOM   658  C  CA    . GLU A 1 85  ? 38.841 18.707  1.342   1.00 14.72 ? 82  GLU A CA    1 
ATOM   659  C  C     . GLU A 1 85  ? 38.395 19.491  0.120   1.00 16.39 ? 82  GLU A C     1 
ATOM   660  O  O     . GLU A 1 85  ? 38.687 20.681  -0.004  1.00 18.38 ? 82  GLU A O     1 
ATOM   661  C  CB    . GLU A 1 85  ? 37.984 19.046  2.559   1.00 20.51 ? 82  GLU A CB    1 
ATOM   662  C  CG    . GLU A 1 85  ? 38.027 17.939  3.607   1.00 24.16 ? 82  GLU A CG    1 
ATOM   663  C  CD    . GLU A 1 85  ? 37.355 18.314  4.920   1.00 25.76 ? 82  GLU A CD    1 
ATOM   664  O  OE1   . GLU A 1 85  ? 36.153 18.689  4.929   1.00 29.31 ? 82  GLU A OE1   1 
ATOM   665  O  OE2   . GLU A 1 85  ? 38.050 18.224  5.952   1.00 25.46 ? 82  GLU A OE2   1 
ATOM   666  N  N     . SER A 1 86  ? 37.719 18.793  -0.794  1.00 14.57 ? 83  SER A N     1 
ATOM   667  C  CA    . SER A 1 86  ? 37.151 19.376  -2.000  1.00 16.03 ? 83  SER A CA    1 
ATOM   668  C  C     . SER A 1 86  ? 35.788 18.773  -2.259  1.00 16.78 ? 83  SER A C     1 
ATOM   669  O  O     . SER A 1 86  ? 35.591 17.571  -2.074  1.00 17.57 ? 83  SER A O     1 
ATOM   670  C  CB    . SER A 1 86  ? 38.043 19.137  -3.214  1.00 18.07 ? 83  SER A CB    1 
ATOM   671  O  OG    . SER A 1 86  ? 39.345 19.625  -2.985  1.00 27.95 ? 83  SER A OG    1 
ATOM   672  N  N     . ARG A 1 87  ? 34.858 19.615  -2.705  1.00 18.17 ? 84  ARG A N     1 
ATOM   673  C  CA    . ARG A 1 87  ? 33.477 19.216  -2.943  1.00 19.70 ? 84  ARG A CA    1 
ATOM   674  C  C     . ARG A 1 87  ? 32.908 18.436  -1.779  1.00 14.75 ? 84  ARG A C     1 
ATOM   675  O  O     . ARG A 1 87  ? 32.178 17.467  -1.974  1.00 20.10 ? 84  ARG A O     1 
ATOM   676  C  CB    . ARG A 1 87  ? 33.361 18.392  -4.223  1.00 19.85 ? 84  ARG A CB    1 
ATOM   677  C  CG    . ARG A 1 87  ? 34.026 19.032  -5.412  1.00 25.55 ? 84  ARG A CG    1 
ATOM   678  C  CD    . ARG A 1 87  ? 33.895 18.147  -6.641  1.00 27.20 ? 84  ARG A CD    1 
ATOM   679  N  NE    . ARG A 1 87  ? 34.788 18.598  -7.704  1.00 32.44 ? 84  ARG A NE    1 
ATOM   680  C  CZ    . ARG A 1 87  ? 36.087 18.315  -7.757  1.00 30.93 ? 84  ARG A CZ    1 
ATOM   681  N  NH1   . ARG A 1 87  ? 36.660 17.576  -6.801  1.00 30.68 ? 84  ARG A NH1   1 
ATOM   682  N  NH2   . ARG A 1 87  ? 36.820 18.780  -8.762  1.00 33.55 ? 84  ARG A NH2   1 
ATOM   683  N  N     . GLY A 1 88  ? 33.264 18.841  -0.568  1.00 15.54 ? 85  GLY A N     1 
ATOM   684  C  CA    . GLY A 1 88  ? 32.675 18.260  0.627   1.00 16.46 ? 85  GLY A CA    1 
ATOM   685  C  C     . GLY A 1 88  ? 33.302 16.977  1.144   1.00 14.72 ? 85  GLY A C     1 
ATOM   686  O  O     . GLY A 1 88  ? 32.803 16.388  2.103   1.00 17.02 ? 85  GLY A O     1 
ATOM   687  N  N     . LYS A 1 89  ? 34.392 16.535  0.516   1.00 14.76 ? 86  LYS A N     1 
ATOM   688  C  CA    . LYS A 1 89  ? 34.977 15.240  0.865   1.00 13.91 ? 86  LYS A CA    1 
ATOM   689  C  C     . LYS A 1 89  ? 36.495 15.280  0.914   1.00 13.17 ? 86  LYS A C     1 
ATOM   690  O  O     . LYS A 1 89  ? 37.126 16.168  0.337   1.00 13.21 ? 86  LYS A O     1 
ATOM   691  C  CB    . LYS A 1 89  ? 34.518 14.175  -0.133  1.00 16.75 ? 86  LYS A CB    1 
ATOM   692  C  CG    . LYS A 1 89  ? 35.038 14.364  -1.542  1.00 16.38 ? 86  LYS A CG    1 
ATOM   693  C  CD    . LYS A 1 89  ? 34.563 13.235  -2.474  1.00 18.45 ? 86  LYS A CD    1 
ATOM   694  C  CE    . LYS A 1 89  ? 35.112 11.873  -2.034  1.00 16.10 ? 86  LYS A CE    1 
ATOM   695  N  NZ    . LYS A 1 89  ? 36.592 11.809  -2.225  1.00 18.00 ? 86  LYS A NZ    1 
ATOM   696  N  N     . ALA A 1 90  ? 37.082 14.312  1.607   1.00 15.44 ? 87  ALA A N     1 
ATOM   697  C  CA    . ALA A 1 90  ? 38.528 14.170  1.593   1.00 15.83 ? 87  ALA A CA    1 
ATOM   698  C  C     . ALA A 1 90  ? 38.993 13.971  0.164   1.00 16.51 ? 87  ALA A C     1 
ATOM   699  O  O     . ALA A 1 90  ? 38.350 13.257  -0.609  1.00 16.82 ? 87  ALA A O     1 
ATOM   700  C  CB    . ALA A 1 90  ? 38.972 13.005  2.462   1.00 16.95 ? 87  ALA A CB    1 
ATOM   701  N  N     . ASN A 1 91  ? 40.107 14.607  -0.181  1.00 13.17 ? 88  ASN A N     1 
ATOM   702  C  CA    . ASN A 1 91  ? 40.648 14.487  -1.528  1.00 15.48 ? 88  ASN A CA    1 
ATOM   703  C  C     . ASN A 1 91  ? 42.106 14.072  -1.460  1.00 14.90 ? 88  ASN A C     1 
ATOM   704  O  O     . ASN A 1 91  ? 42.924 14.806  -0.916  1.00 15.16 ? 88  ASN A O     1 
ATOM   705  C  CB    . ASN A 1 91  ? 40.509 15.806  -2.283  1.00 14.93 ? 88  ASN A CB    1 
ATOM   706  C  CG    . ASN A 1 91  ? 40.863 15.670  -3.744  1.00 21.32 ? 88  ASN A CG    1 
ATOM   707  O  OD1   . ASN A 1 91  ? 42.003 15.415  -4.083  1.00 15.93 ? 88  ASN A OD1   1 
ATOM   708  N  ND2   . ASN A 1 91  ? 39.873 15.833  -4.621  1.00 24.19 ? 88  ASN A ND2   1 
ATOM   709  N  N     . LEU A 1 92  ? 42.433 12.899  -2.001  1.00 13.79 ? 89  LEU A N     1 
ATOM   710  C  CA    . LEU A 1 92  ? 43.780 12.346  -1.807  1.00 12.27 ? 89  LEU A CA    1 
ATOM   711  C  C     . LEU A 1 92  ? 44.748 12.650  -2.958  1.00 13.83 ? 89  LEU A C     1 
ATOM   712  O  O     . LEU A 1 92  ? 45.775 11.989  -3.094  1.00 12.71 ? 89  LEU A O     1 
ATOM   713  C  CB    . LEU A 1 92  ? 43.693 10.830  -1.584  1.00 12.71 ? 89  LEU A CB    1 
ATOM   714  C  CG    . LEU A 1 92  ? 42.727 10.407  -0.470  1.00 14.50 ? 89  LEU A CG    1 
ATOM   715  C  CD1   . LEU A 1 92  ? 42.592 8.900   -0.407  1.00 13.60 ? 89  LEU A CD1   1 
ATOM   716  C  CD2   . LEU A 1 92  ? 43.223 10.947  0.861   1.00 15.80 ? 89  LEU A CD2   1 
ATOM   717  N  N     . THR A 1 93  ? 44.454 13.674  -3.758  1.00 13.16 ? 90  THR A N     1 
ATOM   718  C  CA    . THR A 1 93  ? 45.247 13.915  -4.965  1.00 13.01 ? 90  THR A CA    1 
ATOM   719  C  C     . THR A 1 93  ? 46.730 14.175  -4.721  1.00 15.42 ? 90  THR A C     1 
ATOM   720  O  O     . THR A 1 93  ? 47.578 13.645  -5.448  1.00 14.47 ? 90  THR A O     1 
ATOM   721  C  CB    . THR A 1 93  ? 44.651 15.080  -5.768  1.00 16.33 ? 90  THR A CB    1 
ATOM   722  O  OG1   . THR A 1 93  ? 43.353 14.687  -6.220  1.00 18.11 ? 90  THR A OG1   1 
ATOM   723  C  CG2   . THR A 1 93  ? 45.516 15.429  -6.979  1.00 18.15 ? 90  THR A CG2   1 
ATOM   724  N  N     . LYS A 1 94  ? 47.052 14.962  -3.696  1.00 13.14 ? 91  LYS A N     1 
ATOM   725  C  CA    . LYS A 1 94  ? 48.441 15.256  -3.383  1.00 11.76 ? 91  LYS A CA    1 
ATOM   726  C  C     . LYS A 1 94  ? 49.265 13.983  -3.159  1.00 11.23 ? 91  LYS A C     1 
ATOM   727  O  O     . LYS A 1 94  ? 50.428 13.925  -3.549  1.00 14.48 ? 91  LYS A O     1 
ATOM   728  C  CB    . LYS A 1 94  ? 48.531 16.157  -2.146  1.00 13.25 ? 91  LYS A CB    1 
ATOM   729  C  CG    . LYS A 1 94  ? 49.936 16.647  -1.831  1.00 16.27 ? 91  LYS A CG    1 
ATOM   730  C  CD    . LYS A 1 94  ? 50.034 17.122  -0.372  1.00 18.36 ? 91  LYS A CD    1 
ATOM   731  C  CE    . LYS A 1 94  ? 49.117 18.304  -0.139  1.00 18.64 ? 91  LYS A CE    1 
ATOM   732  N  NZ    . LYS A 1 94  ? 49.250 18.855  1.238   1.00 12.31 ? 91  LYS A NZ    1 
ATOM   733  N  N     . TYR A 1 95  ? 48.658 12.975  -2.546  1.00 11.87 ? 92  TYR A N     1 
ATOM   734  C  CA    . TYR A 1 95  ? 49.374 11.747  -2.219  1.00 9.57  ? 92  TYR A CA    1 
ATOM   735  C  C     . TYR A 1 95  ? 49.444 10.857  -3.446  1.00 13.70 ? 92  TYR A C     1 
ATOM   736  O  O     . TYR A 1 95  ? 50.450 10.177  -3.648  1.00 10.83 ? 92  TYR A O     1 
ATOM   737  C  CB    . TYR A 1 95  ? 48.700 11.021  -1.043  1.00 10.04 ? 92  TYR A CB    1 
ATOM   738  C  CG    . TYR A 1 95  ? 48.398 12.001  0.056   1.00 10.41 ? 92  TYR A CG    1 
ATOM   739  C  CD1   . TYR A 1 95  ? 47.094 12.418  0.286   1.00 11.35 ? 92  TYR A CD1   1 
ATOM   740  C  CD2   . TYR A 1 95  ? 49.422 12.593  0.798   1.00 10.56 ? 92  TYR A CD2   1 
ATOM   741  C  CE1   . TYR A 1 95  ? 46.808 13.370  1.271   1.00 12.63 ? 92  TYR A CE1   1 
ATOM   742  C  CE2   . TYR A 1 95  ? 49.152 13.523  1.782   1.00 11.04 ? 92  TYR A CE2   1 
ATOM   743  C  CZ    . TYR A 1 95  ? 47.834 13.908  2.009   1.00 10.86 ? 92  TYR A CZ    1 
ATOM   744  O  OH    . TYR A 1 95  ? 47.525 14.849  2.967   1.00 12.86 ? 92  TYR A OH    1 
ATOM   745  N  N     . ARG A 1 96  ? 48.400 10.874  -4.279  1.00 12.47 ? 93  ARG A N     1 
ATOM   746  C  CA    . ARG A 1 96  ? 48.457 10.104  -5.527  1.00 13.54 ? 93  ARG A CA    1 
ATOM   747  C  C     . ARG A 1 96  ? 49.552 10.649  -6.443  1.00 13.42 ? 93  ARG A C     1 
ATOM   748  O  O     . ARG A 1 96  ? 50.287 9.881   -7.093  1.00 14.04 ? 93  ARG A O     1 
ATOM   749  C  CB    . ARG A 1 96  ? 47.109 10.109  -6.264  1.00 13.13 ? 93  ARG A CB    1 
ATOM   750  C  CG    . ARG A 1 96  ? 46.030 9.298   -5.574  1.00 13.70 ? 93  ARG A CG    1 
ATOM   751  C  CD    . ARG A 1 96  ? 44.820 9.043   -6.460  1.00 14.79 ? 93  ARG A CD    1 
ATOM   752  N  NE    . ARG A 1 96  ? 43.795 8.334   -5.701  1.00 19.12 ? 93  ARG A NE    1 
ATOM   753  C  CZ    . ARG A 1 96  ? 42.764 8.916   -5.094  1.00 16.61 ? 93  ARG A CZ    1 
ATOM   754  N  NH1   . ARG A 1 96  ? 41.919 8.166   -4.394  1.00 14.50 ? 93  ARG A NH1   1 
ATOM   755  N  NH2   . ARG A 1 96  ? 42.577 10.234  -5.184  1.00 14.44 ? 93  ARG A NH2   1 
ATOM   756  N  N     . GLU A 1 97  ? 49.672 11.974  -6.496  1.00 13.09 ? 94  GLU A N     1 
ATOM   757  C  CA    . GLU A 1 97  ? 50.687 12.610  -7.329  1.00 13.70 ? 94  GLU A CA    1 
ATOM   758  C  C     . GLU A 1 97  ? 52.096 12.351  -6.768  1.00 12.06 ? 94  GLU A C     1 
ATOM   759  O  O     . GLU A 1 97  ? 53.011 12.085  -7.530  1.00 11.67 ? 94  GLU A O     1 
ATOM   760  C  CB    . GLU A 1 97  ? 50.405 14.111  -7.476  1.00 15.28 ? 94  GLU A CB    1 
ATOM   761  C  CG    . GLU A 1 97  ? 49.137 14.361  -8.282  1.00 19.91 ? 94  GLU A CG    1 
ATOM   762  C  CD    . GLU A 1 97  ? 48.793 15.827  -8.476  1.00 26.98 ? 94  GLU A CD    1 
ATOM   763  O  OE1   . GLU A 1 97  ? 49.373 16.709  -7.794  1.00 29.61 ? 94  GLU A OE1   1 
ATOM   764  O  OE2   . GLU A 1 97  ? 47.914 16.093  -9.328  1.00 27.17 ? 94  GLU A OE2   1 
ATOM   765  N  N     . ALA A 1 98  ? 52.255 12.386  -5.445  1.00 13.10 ? 95  ALA A N     1 
ATOM   766  C  CA    . ALA A 1 98  ? 53.537 12.034  -4.847  1.00 12.17 ? 95  ALA A CA    1 
ATOM   767  C  C     . ALA A 1 98  ? 53.885 10.577  -5.154  1.00 10.35 ? 95  ALA A C     1 
ATOM   768  O  O     . ALA A 1 98  ? 55.037 10.254  -5.377  1.00 12.64 ? 95  ALA A O     1 
ATOM   769  C  CB    . ALA A 1 98  ? 53.524 12.263  -3.355  1.00 10.19 ? 95  ALA A CB    1 
ATOM   770  N  N     . SER A 1 99  ? 52.881 9.708   -5.163  1.00 11.36 ? 96  SER A N     1 
ATOM   771  C  CA    . SER A 1 99  ? 53.090 8.308   -5.516  1.00 10.51 ? 96  SER A CA    1 
ATOM   772  C  C     . SER A 1 99  ? 53.643 8.151   -6.934  1.00 11.03 ? 96  SER A C     1 
ATOM   773  O  O     . SER A 1 99  ? 54.566 7.375   -7.179  1.00 12.32 ? 96  SER A O     1 
ATOM   774  C  CB    . SER A 1 99  ? 51.772 7.541   -5.388  1.00 13.33 ? 96  SER A CB    1 
ATOM   775  O  OG    . SER A 1 99  ? 51.926 6.188   -5.745  1.00 15.43 ? 96  SER A OG    1 
ATOM   776  N  N     . VAL A 1 100 ? 53.052 8.879   -7.868  1.00 11.75 ? 97  VAL A N     1 
ATOM   777  C  CA    . VAL A 1 100 ? 53.531 8.844   -9.250  1.00 13.39 ? 97  VAL A CA    1 
ATOM   778  C  C     . VAL A 1 100 ? 55.007 9.254   -9.342  1.00 13.11 ? 97  VAL A C     1 
ATOM   779  O  O     . VAL A 1 100 ? 55.775 8.657   -10.102 1.00 14.51 ? 97  VAL A O     1 
ATOM   780  C  CB    . VAL A 1 100 ? 52.654 9.741   -10.139 1.00 14.21 ? 97  VAL A CB    1 
ATOM   781  C  CG1   . VAL A 1 100 ? 53.273 9.909   -11.533 1.00 16.83 ? 97  VAL A CG1   1 
ATOM   782  C  CG2   . VAL A 1 100 ? 51.245 9.153   -10.227 1.00 17.74 ? 97  VAL A CG2   1 
ATOM   783  N  N     . GLU A 1 101 ? 55.432 10.228  -8.540  1.00 11.08 ? 98  GLU A N     1 
ATOM   784  C  CA    . GLU A 1 101 ? 56.845 10.624  -8.528  1.00 12.22 ? 98  GLU A CA    1 
ATOM   785  C  C     . GLU A 1 101 ? 57.771 9.443   -8.241  1.00 12.70 ? 98  GLU A C     1 
ATOM   786  O  O     . GLU A 1 101 ? 58.799 9.246   -8.894  1.00 14.69 ? 98  GLU A O     1 
ATOM   787  C  CB    . GLU A 1 101 ? 57.107 11.683  -7.459  1.00 12.92 ? 98  GLU A CB    1 
ATOM   788  C  CG    . GLU A 1 101 ? 56.592 13.086  -7.732  1.00 15.63 ? 98  GLU A CG    1 
ATOM   789  C  CD    . GLU A 1 101 ? 56.989 14.058  -6.618  1.00 13.27 ? 98  GLU A CD    1 
ATOM   790  O  OE1   . GLU A 1 101 ? 58.185 14.447  -6.549  1.00 14.78 ? 98  GLU A OE1   1 
ATOM   791  O  OE2   . GLU A 1 101 ? 56.092 14.447  -5.825  1.00 16.72 ? 98  GLU A OE2   1 
ATOM   792  N  N     . VAL A 1 102 ? 57.403 8.681   -7.221  1.00 10.51 ? 99  VAL A N     1 
ATOM   793  C  CA    . VAL A 1 102 ? 58.227 7.578   -6.776  1.00 10.44 ? 99  VAL A CA    1 
ATOM   794  C  C     . VAL A 1 102 ? 58.156 6.426   -7.762  1.00 11.53 ? 99  VAL A C     1 
ATOM   795  O  O     . VAL A 1 102 ? 59.190 5.824   -8.094  1.00 14.35 ? 99  VAL A O     1 
ATOM   796  C  CB    . VAL A 1 102 ? 57.800 7.091   -5.384  1.00 11.36 ? 99  VAL A CB    1 
ATOM   797  C  CG1   . VAL A 1 102 ? 58.579 5.839   -5.009  1.00 16.95 ? 99  VAL A CG1   1 
ATOM   798  C  CG2   . VAL A 1 102 ? 57.996 8.222   -4.367  1.00 12.61 ? 99  VAL A CG2   1 
ATOM   799  N  N     . MET A 1 103 ? 56.950 6.118   -8.234  1.00 11.09 ? 100 MET A N     1 
ATOM   800  C  CA    . MET A 1 103 ? 56.769 5.022   -9.176  1.00 11.65 ? 100 MET A CA    1 
ATOM   801  C  C     . MET A 1 103 ? 57.549 5.254   -10.461 1.00 13.37 ? 100 MET A C     1 
ATOM   802  O  O     . MET A 1 103 ? 58.121 4.320   -11.004 1.00 14.36 ? 100 MET A O     1 
ATOM   803  C  CB    . MET A 1 103 ? 55.290 4.815   -9.498  1.00 17.00 ? 100 MET A CB    1 
ATOM   804  C  CG    . MET A 1 103 ? 54.412 4.535   -8.288  1.00 15.32 ? 100 MET A CG    1 
ATOM   805  S  SD    . MET A 1 103 ? 54.828 2.990   -7.466  1.00 19.87 ? 100 MET A SD    1 
ATOM   806  C  CE    . MET A 1 103 ? 53.870 3.067   -5.934  1.00 16.60 ? 100 MET A CE    1 
ATOM   807  N  N     . GLU A 1 104 ? 57.596 6.497   -10.947 1.00 12.54 ? 101 GLU A N     1 
ATOM   808  C  CA    . GLU A 1 104 ? 58.316 6.752   -12.189 1.00 14.93 ? 101 GLU A CA    1 
ATOM   809  C  C     . GLU A 1 104 ? 59.839 6.564   -12.030 1.00 14.05 ? 101 GLU A C     1 
ATOM   810  O  O     . GLU A 1 104 ? 60.498 6.050   -12.944 1.00 16.82 ? 101 GLU A O     1 
ATOM   811  C  CB    . GLU A 1 104 ? 57.955 8.158   -12.718 1.00 16.22 ? 101 GLU A CB    1 
ATOM   812  C  CG    . GLU A 1 104 ? 56.496 8.195   -13.215 1.00 21.87 ? 101 GLU A CG    1 
ATOM   813  C  CD    . GLU A 1 104 ? 56.128 9.467   -13.971 1.00 31.31 ? 101 GLU A CD    1 
ATOM   814  O  OE1   . GLU A 1 104 ? 56.888 10.457  -13.901 1.00 30.97 ? 101 GLU A OE1   1 
ATOM   815  O  OE2   . GLU A 1 104 ? 55.071 9.471   -14.637 1.00 29.32 ? 101 GLU A OE2   1 
ATOM   816  N  N     . ILE A 1 105 ? 60.386 6.955   -10.885 1.00 12.94 ? 102 ILE A N     1 
ATOM   817  C  CA    . ILE A 1 105 ? 61.812 6.737   -10.583 1.00 12.22 ? 102 ILE A CA    1 
ATOM   818  C  C     . ILE A 1 105 ? 62.113 5.235   -10.504 1.00 13.15 ? 102 ILE A C     1 
ATOM   819  O  O     . ILE A 1 105 ? 63.040 4.728   -11.150 1.00 14.84 ? 102 ILE A O     1 
ATOM   820  C  CB    . ILE A 1 105 ? 62.210 7.427   -9.262  1.00 14.14 ? 102 ILE A CB    1 
ATOM   821  C  CG1   . ILE A 1 105 ? 62.078 8.944   -9.384  1.00 13.66 ? 102 ILE A CG1   1 
ATOM   822  C  CG2   . ILE A 1 105 ? 63.621 7.043   -8.836  1.00 14.17 ? 102 ILE A CG2   1 
ATOM   823  C  CD1   . ILE A 1 105 ? 62.188 9.638   -8.059  1.00 14.57 ? 102 ILE A CD1   1 
ATOM   824  N  N     . MET A 1 106 ? 61.298 4.501   -9.760  1.00 13.19 ? 103 MET A N     1 
ATOM   825  C  CA    . MET A 1 106 ? 61.517 3.053   -9.687  1.00 13.19 ? 103 MET A CA    1 
ATOM   826  C  C     . MET A 1 106 ? 61.495 2.394   -11.063 1.00 14.57 ? 103 MET A C     1 
ATOM   827  O  O     . MET A 1 106 ? 62.304 1.496   -11.342 1.00 16.70 ? 103 MET A O     1 
ATOM   828  C  CB    . MET A 1 106 ? 60.468 2.400   -8.775  1.00 12.35 ? 103 MET A CB    1 
ATOM   829  C  CG    A MET A 1 106 ? 60.588 2.743   -7.306  0.54 12.96 ? 103 MET A CG    1 
ATOM   830  C  CG    B MET A 1 106 ? 60.841 2.588   -7.305  0.46 12.74 ? 103 MET A CG    1 
ATOM   831  S  SD    A MET A 1 106 ? 59.323 1.841   -6.372  0.54 15.87 ? 103 MET A SD    1 
ATOM   832  S  SD    B MET A 1 106 ? 59.740 1.744   -6.161  0.46 16.55 ? 103 MET A SD    1 
ATOM   833  C  CE    A MET A 1 106 ? 59.735 0.145   -6.763  0.54 15.80 ? 103 MET A CE    1 
ATOM   834  C  CE    B MET A 1 106 ? 58.227 2.637   -6.487  0.46 16.56 ? 103 MET A CE    1 
ATOM   835  N  N     . SER A 1 107 ? 60.604 2.859   -11.932 1.00 12.51 ? 104 SER A N     1 
ATOM   836  C  CA    A SER A 1 107 ? 60.415 2.237   -13.238 0.29 14.49 ? 104 SER A CA    1 
ATOM   837  C  CA    B SER A 1 107 ? 60.414 2.247   -13.240 0.71 14.37 ? 104 SER A CA    1 
ATOM   838  C  C     . SER A 1 107 ? 61.643 2.383   -14.134 1.00 19.26 ? 104 SER A C     1 
ATOM   839  O  O     . SER A 1 107 ? 61.739 1.708   -15.163 1.00 18.73 ? 104 SER A O     1 
ATOM   840  C  CB    A SER A 1 107 ? 59.184 2.820   -13.941 0.29 16.82 ? 104 SER A CB    1 
ATOM   841  C  CB    B SER A 1 107 ? 59.195 2.852   -13.936 0.71 16.79 ? 104 SER A CB    1 
ATOM   842  O  OG    A SER A 1 107 ? 59.301 4.219   -14.135 0.29 17.16 ? 104 SER A OG    1 
ATOM   843  O  OG    B SER A 1 107 ? 58.008 2.529   -13.239 0.71 18.91 ? 104 SER A OG    1 
ATOM   844  N  N     . ARG A 1 108 ? 62.570 3.260   -13.744 1.00 16.14 ? 105 ARG A N     1 
ATOM   845  C  CA    . ARG A 1 108 ? 63.818 3.465   -14.489 1.00 17.18 ? 105 ARG A CA    1 
ATOM   846  C  C     . ARG A 1 108 ? 64.741 2.269   -14.328 1.00 20.74 ? 105 ARG A C     1 
ATOM   847  O  O     . ARG A 1 108 ? 65.573 1.997   -15.192 1.00 23.95 ? 105 ARG A O     1 
ATOM   848  C  CB    . ARG A 1 108 ? 64.565 4.715   -14.018 1.00 18.43 ? 105 ARG A CB    1 
ATOM   849  C  CG    . ARG A 1 108 ? 63.854 6.036   -14.233 1.00 19.59 ? 105 ARG A CG    1 
ATOM   850  C  CD    . ARG A 1 108 ? 64.850 7.188   -14.407 1.00 20.13 ? 105 ARG A CD    1 
ATOM   851  N  NE    . ARG A 1 108 ? 65.833 7.315   -13.335 1.00 23.24 ? 105 ARG A NE    1 
ATOM   852  C  CZ    . ARG A 1 108 ? 65.763 8.217   -12.356 1.00 18.99 ? 105 ARG A CZ    1 
ATOM   853  N  NH1   . ARG A 1 108 ? 66.702 8.253   -11.422 1.00 21.70 ? 105 ARG A NH1   1 
ATOM   854  N  NH2   . ARG A 1 108 ? 64.753 9.070   -12.316 1.00 19.92 ? 105 ARG A NH2   1 
ATOM   855  N  N     . PHE A 1 109 ? 64.601 1.568   -13.205 1.00 22.08 ? 106 PHE A N     1 
ATOM   856  C  CA    . PHE A 1 109 ? 65.507 0.465   -12.882 1.00 22.02 ? 106 PHE A CA    1 
ATOM   857  C  C     . PHE A 1 109 ? 64.953 -0.867  -13.357 1.00 23.71 ? 106 PHE A C     1 
ATOM   858  O  O     . PHE A 1 109 ? 65.705 -1.758  -13.757 1.00 30.79 ? 106 PHE A O     1 
ATOM   859  C  CB    . PHE A 1 109 ? 65.770 0.414   -11.376 1.00 17.27 ? 106 PHE A CB    1 
ATOM   860  C  CG    . PHE A 1 109 ? 66.501 1.615   -10.842 1.00 22.51 ? 106 PHE A CG    1 
ATOM   861  C  CD1   . PHE A 1 109 ? 65.825 2.801   -10.599 1.00 18.84 ? 106 PHE A CD1   1 
ATOM   862  C  CD2   . PHE A 1 109 ? 67.858 1.554   -10.551 1.00 18.18 ? 106 PHE A CD2   1 
ATOM   863  C  CE1   . PHE A 1 109 ? 66.481 3.915   -10.102 1.00 18.79 ? 106 PHE A CE1   1 
ATOM   864  C  CE2   . PHE A 1 109 ? 68.523 2.661   -10.049 1.00 19.42 ? 106 PHE A CE2   1 
ATOM   865  C  CZ    . PHE A 1 109 ? 67.840 3.849   -9.827  1.00 17.29 ? 106 PHE A CZ    1 
ATOM   866  N  N     . ALA A 1 110 ? 63.634 -0.998  -13.313 1.00 23.34 ? 107 ALA A N     1 
ATOM   867  C  CA    . ALA A 1 110 ? 62.967 -2.228  -13.703 1.00 20.36 ? 107 ALA A CA    1 
ATOM   868  C  C     . ALA A 1 110 ? 61.470 -2.025  -13.825 1.00 27.59 ? 107 ALA A C     1 
ATOM   869  O  O     . ALA A 1 110 ? 60.924 -1.025  -13.366 1.00 25.19 ? 107 ALA A O     1 
ATOM   870  C  CB    . ALA A 1 110 ? 63.256 -3.339  -12.700 1.00 21.99 ? 107 ALA A CB    1 
ATOM   871  N  N     . VAL A 1 111 ? 60.817 -2.991  -14.454 1.00 25.22 ? 108 VAL A N     1 
ATOM   872  C  CA    . VAL A 1 111 ? 59.368 -3.038  -14.545 1.00 27.02 ? 108 VAL A CA    1 
ATOM   873  C  C     . VAL A 1 111 ? 58.768 -3.246  -13.146 1.00 23.69 ? 108 VAL A C     1 
ATOM   874  O  O     . VAL A 1 111 ? 59.211 -4.123  -12.411 1.00 26.48 ? 108 VAL A O     1 
ATOM   875  C  CB    . VAL A 1 111 ? 58.929 -4.163  -15.498 1.00 34.64 ? 108 VAL A CB    1 
ATOM   876  C  CG1   . VAL A 1 111 ? 57.595 -4.754  -15.074 1.00 31.61 ? 108 VAL A CG1   1 
ATOM   877  C  CG2   . VAL A 1 111 ? 58.892 -3.653  -16.936 1.00 40.54 ? 108 VAL A CG2   1 
ATOM   878  N  N     . ILE A 1 112 ? 57.784 -2.432  -12.767 1.00 24.98 ? 109 ILE A N     1 
ATOM   879  C  CA    . ILE A 1 112 ? 57.232 -2.536  -11.415 1.00 18.69 ? 109 ILE A CA    1 
ATOM   880  C  C     . ILE A 1 112 ? 55.758 -2.912  -11.383 1.00 15.66 ? 109 ILE A C     1 
ATOM   881  O  O     . ILE A 1 112 ? 55.029 -2.700  -12.341 1.00 17.29 ? 109 ILE A O     1 
ATOM   882  C  CB    . ILE A 1 112 ? 57.423 -1.217  -10.616 1.00 19.99 ? 109 ILE A CB    1 
ATOM   883  C  CG1   . ILE A 1 112 ? 56.429 -0.147  -11.067 1.00 20.77 ? 109 ILE A CG1   1 
ATOM   884  C  CG2   . ILE A 1 112 ? 58.877 -0.760  -10.682 1.00 20.16 ? 109 ILE A CG2   1 
ATOM   885  C  CD1   . ILE A 1 112 ? 56.483 1.155   -10.240 1.00 20.54 ? 109 ILE A CD1   1 
ATOM   886  N  N     . GLU A 1 113 ? 55.342 -3.518  -10.276 1.00 12.24 ? 110 GLU A N     1 
ATOM   887  C  CA    . GLU A 1 113 ? 53.925 -3.721  -9.987  1.00 12.93 ? 110 GLU A CA    1 
ATOM   888  C  C     . GLU A 1 113 ? 53.514 -2.769  -8.870  1.00 13.94 ? 110 GLU A C     1 
ATOM   889  O  O     . GLU A 1 113 ? 54.013 -2.875  -7.755  1.00 14.19 ? 110 GLU A O     1 
ATOM   890  C  CB    . GLU A 1 113 ? 53.627 -5.173  -9.567  1.00 14.00 ? 110 GLU A CB    1 
ATOM   891  C  CG    . GLU A 1 113 ? 52.169 -5.411  -9.184  1.00 14.34 ? 110 GLU A CG    1 
ATOM   892  C  CD    . GLU A 1 113 ? 51.866 -6.862  -8.818  1.00 20.59 ? 110 GLU A CD    1 
ATOM   893  O  OE1   . GLU A 1 113 ? 50.732 -7.123  -8.353  1.00 23.48 ? 110 GLU A OE1   1 
ATOM   894  O  OE2   . GLU A 1 113 ? 52.745 -7.741  -9.015  1.00 18.35 ? 110 GLU A OE2   1 
ATOM   895  N  N     . ARG A 1 114 ? 52.625 -1.830  -9.170  1.00 13.22 ? 111 ARG A N     1 
ATOM   896  C  CA    . ARG A 1 114 ? 52.077 -0.941  -8.136  1.00 14.11 ? 111 ARG A CA    1 
ATOM   897  C  C     . ARG A 1 114 ? 51.163 -1.735  -7.221  1.00 17.07 ? 111 ARG A C     1 
ATOM   898  O  O     . ARG A 1 114 ? 50.106 -2.218  -7.641  1.00 22.27 ? 111 ARG A O     1 
ATOM   899  C  CB    . ARG A 1 114 ? 51.318 0.227   -8.773  1.00 13.30 ? 111 ARG A CB    1 
ATOM   900  C  CG    . ARG A 1 114 ? 50.711 1.212   -7.767  1.00 16.62 ? 111 ARG A CG    1 
ATOM   901  C  CD    . ARG A 1 114 ? 49.638 2.065   -8.447  1.00 13.07 ? 111 ARG A CD    1 
ATOM   902  N  NE    . ARG A 1 114 ? 49.305 3.265   -7.688  1.00 18.20 ? 111 ARG A NE    1 
ATOM   903  C  CZ    . ARG A 1 114 ? 48.387 3.325   -6.728  1.00 20.20 ? 111 ARG A CZ    1 
ATOM   904  N  NH1   . ARG A 1 114 ? 47.700 2.243   -6.382  1.00 23.95 ? 111 ARG A NH1   1 
ATOM   905  N  NH2   . ARG A 1 114 ? 48.163 4.476   -6.110  1.00 21.98 ? 111 ARG A NH2   1 
ATOM   906  N  N     . ALA A 1 115 ? 51.567 -1.880  -5.966  1.00 12.14 ? 112 ALA A N     1 
ATOM   907  C  CA    . ALA A 1 115 ? 50.856 -2.729  -5.034  1.00 10.24 ? 112 ALA A CA    1 
ATOM   908  C  C     . ALA A 1 115 ? 49.950 -1.908  -4.118  1.00 14.04 ? 112 ALA A C     1 
ATOM   909  O  O     . ALA A 1 115 ? 48.969 -2.421  -3.582  1.00 17.46 ? 112 ALA A O     1 
ATOM   910  C  CB    . ALA A 1 115 ? 51.836 -3.544  -4.210  1.00 12.74 ? 112 ALA A CB    1 
ATOM   911  N  N     . SER A 1 116 ? 50.299 -0.640  -3.942  1.00 12.56 ? 113 SER A N     1 
ATOM   912  C  CA    . SER A 1 116 ? 49.501 0.295   -3.158  1.00 13.99 ? 113 SER A CA    1 
ATOM   913  C  C     . SER A 1 116 ? 49.929 1.702   -3.519  1.00 13.90 ? 113 SER A C     1 
ATOM   914  O  O     . SER A 1 116 ? 50.798 1.892   -4.370  1.00 13.20 ? 113 SER A O     1 
ATOM   915  C  CB    . SER A 1 116 ? 49.675 0.070   -1.651  1.00 16.25 ? 113 SER A CB    1 
ATOM   916  O  OG    . SER A 1 116 ? 50.903 0.620   -1.210  1.00 16.71 ? 113 SER A OG    1 
ATOM   917  N  N     . ILE A 1 117 ? 49.356 2.690   -2.846  1.00 12.57 ? 114 ILE A N     1 
ATOM   918  C  CA    . ILE A 1 117 ? 49.712 4.064   -3.133  1.00 11.18 ? 114 ILE A CA    1 
ATOM   919  C  C     . ILE A 1 117 ? 51.198 4.319   -2.812  1.00 12.18 ? 114 ILE A C     1 
ATOM   920  O  O     . ILE A 1 117 ? 51.808 5.224   -3.372  1.00 12.51 ? 114 ILE A O     1 
ATOM   921  C  CB    . ILE A 1 117 ? 48.810 5.042   -2.350  1.00 11.25 ? 114 ILE A CB    1 
ATOM   922  C  CG1   . ILE A 1 117 ? 48.912 6.445   -2.959  1.00 12.12 ? 114 ILE A CG1   1 
ATOM   923  C  CG2   . ILE A 1 117 ? 49.148 5.016   -0.861  1.00 11.72 ? 114 ILE A CG2   1 
ATOM   924  C  CD1   . ILE A 1 117 ? 47.855 7.413   -2.445  1.00 12.23 ? 114 ILE A CD1   1 
ATOM   925  N  N     . ASP A 1 118 ? 51.798 3.508   -1.939  1.00 11.59 ? 115 ASP A N     1 
ATOM   926  C  CA    . ASP A 1 118 ? 53.176 3.826   -1.556  1.00 13.86 ? 115 ASP A CA    1 
ATOM   927  C  C     . ASP A 1 118 ? 54.134 2.645   -1.625  1.00 11.66 ? 115 ASP A C     1 
ATOM   928  O  O     . ASP A 1 118 ? 55.210 2.683   -0.998  1.00 12.01 ? 115 ASP A O     1 
ATOM   929  C  CB    . ASP A 1 118 ? 53.200 4.426   -0.153  1.00 11.86 ? 115 ASP A CB    1 
ATOM   930  C  CG    . ASP A 1 118 ? 53.279 3.376   0.936   1.00 13.80 ? 115 ASP A CG    1 
ATOM   931  O  OD1   . ASP A 1 118 ? 52.666 2.285   0.794   1.00 13.65 ? 115 ASP A OD1   1 
ATOM   932  O  OD2   . ASP A 1 118 ? 54.000 3.637   1.917   1.00 12.80 ? 115 ASP A OD2   1 
ATOM   933  N  N     . GLU A 1 119 ? 53.780 1.612   -2.378  1.00 11.83 ? 116 GLU A N     1 
ATOM   934  C  CA    . GLU A 1 119 ? 54.716 0.507   -2.512  1.00 12.70 ? 116 GLU A CA    1 
ATOM   935  C  C     . GLU A 1 119 ? 54.590 -0.221  -3.829  1.00 11.70 ? 116 GLU A C     1 
ATOM   936  O  O     . GLU A 1 119 ? 53.533 -0.227  -4.466  1.00 12.55 ? 116 GLU A O     1 
ATOM   937  C  CB    . GLU A 1 119 ? 54.557 -0.470  -1.362  1.00 17.81 ? 116 GLU A CB    1 
ATOM   938  C  CG    . GLU A 1 119 ? 53.446 -1.455  -1.510  1.00 12.61 ? 116 GLU A CG    1 
ATOM   939  C  CD    . GLU A 1 119 ? 52.992 -1.969  -0.157  1.00 21.61 ? 116 GLU A CD    1 
ATOM   940  O  OE1   . GLU A 1 119 ? 53.357 -3.099  0.223   1.00 23.75 ? 116 GLU A OE1   1 
ATOM   941  O  OE2   . GLU A 1 119 ? 52.282 -1.227  0.540   1.00 22.34 ? 116 GLU A OE2   1 
ATOM   942  N  N     . ALA A 1 120 ? 55.723 -0.762  -4.263  1.00 11.23 ? 117 ALA A N     1 
ATOM   943  C  CA    . ALA A 1 120 ? 55.780 -1.457  -5.532  1.00 11.64 ? 117 ALA A CA    1 
ATOM   944  C  C     . ALA A 1 120 ? 56.741 -2.623  -5.465  1.00 13.12 ? 117 ALA A C     1 
ATOM   945  O  O     . ALA A 1 120 ? 57.778 -2.556  -4.804  1.00 12.00 ? 117 ALA A O     1 
ATOM   946  C  CB    . ALA A 1 120 ? 56.193 -0.504  -6.650  1.00 13.65 ? 117 ALA A CB    1 
ATOM   947  N  N     . TYR A 1 121 ? 56.403 -3.685  -6.185  1.00 10.96 ? 118 TYR A N     1 
ATOM   948  C  CA    . TYR A 1 121 ? 57.328 -4.791  -6.349  1.00 11.57 ? 118 TYR A CA    1 
ATOM   949  C  C     . TYR A 1 121 ? 58.154 -4.579  -7.585  1.00 11.66 ? 118 TYR A C     1 
ATOM   950  O  O     . TYR A 1 121 ? 57.687 -3.981  -8.565  1.00 14.30 ? 118 TYR A O     1 
ATOM   951  C  CB    . TYR A 1 121 ? 56.589 -6.118  -6.452  1.00 10.68 ? 118 TYR A CB    1 
ATOM   952  C  CG    . TYR A 1 121 ? 55.890 -6.491  -5.177  1.00 11.51 ? 118 TYR A CG    1 
ATOM   953  C  CD1   . TYR A 1 121 ? 54.562 -6.152  -4.966  1.00 14.14 ? 118 TYR A CD1   1 
ATOM   954  C  CD2   . TYR A 1 121 ? 56.554 -7.180  -4.188  1.00 11.41 ? 118 TYR A CD2   1 
ATOM   955  C  CE1   . TYR A 1 121 ? 53.917 -6.487  -3.793  1.00 12.21 ? 118 TYR A CE1   1 
ATOM   956  C  CE2   . TYR A 1 121 ? 55.917 -7.528  -3.012  1.00 13.09 ? 118 TYR A CE2   1 
ATOM   957  C  CZ    . TYR A 1 121 ? 54.602 -7.181  -2.824  1.00 13.47 ? 118 TYR A CZ    1 
ATOM   958  O  OH    . TYR A 1 121 ? 53.967 -7.526  -1.661  1.00 14.45 ? 118 TYR A OH    1 
ATOM   959  N  N     . VAL A 1 122 ? 59.365 -5.127  -7.543  1.00 10.62 ? 119 VAL A N     1 
ATOM   960  C  CA    . VAL A 1 122 ? 60.357 -5.019  -8.591  1.00 15.87 ? 119 VAL A CA    1 
ATOM   961  C  C     . VAL A 1 122 ? 60.850 -6.424  -8.922  1.00 17.30 ? 119 VAL A C     1 
ATOM   962  O  O     . VAL A 1 122 ? 61.255 -7.129  -8.010  1.00 15.80 ? 119 VAL A O     1 
ATOM   963  C  CB    . VAL A 1 122 ? 61.568 -4.187  -8.108  1.00 17.59 ? 119 VAL A CB    1 
ATOM   964  C  CG1   . VAL A 1 122 ? 62.310 -3.608  -9.272  1.00 27.13 ? 119 VAL A CG1   1 
ATOM   965  C  CG2   . VAL A 1 122 ? 61.128 -3.116  -7.125  1.00 24.53 ? 119 VAL A CG2   1 
ATOM   966  N  N     . ASP A 1 123 ? 60.836 -6.847  -10.184 1.00 18.29 ? 120 ASP A N     1 
ATOM   967  C  CA    . ASP A 1 123 ? 61.554 -8.084  -10.540 1.00 16.02 ? 120 ASP A CA    1 
ATOM   968  C  C     . ASP A 1 123 ? 62.921 -7.698  -11.085 1.00 16.96 ? 120 ASP A C     1 
ATOM   969  O  O     . ASP A 1 123 ? 63.043 -7.170  -12.192 1.00 21.06 ? 120 ASP A O     1 
ATOM   970  C  CB    . ASP A 1 123 ? 60.780 -8.944  -11.547 1.00 21.05 ? 120 ASP A CB    1 
ATOM   971  C  CG    . ASP A 1 123 ? 61.415 -10.321 -11.750 1.00 24.75 ? 120 ASP A CG    1 
ATOM   972  O  OD1   . ASP A 1 123 ? 62.634 -10.371 -11.960 1.00 20.40 ? 120 ASP A OD1   1 
ATOM   973  O  OD2   . ASP A 1 123 ? 60.713 -11.361 -11.678 1.00 24.78 ? 120 ASP A OD2   1 
ATOM   974  N  N     . LEU A 1 124 ? 63.948 -7.966  -10.287 1.00 16.04 ? 121 LEU A N     1 
ATOM   975  C  CA    . LEU A 1 124 ? 65.310 -7.554  -10.585 1.00 14.37 ? 121 LEU A CA    1 
ATOM   976  C  C     . LEU A 1 124 ? 66.170 -8.664  -11.189 1.00 13.84 ? 121 LEU A C     1 
ATOM   977  O  O     . LEU A 1 124 ? 67.386 -8.492  -11.322 1.00 15.11 ? 121 LEU A O     1 
ATOM   978  C  CB    . LEU A 1 124 ? 65.987 -7.046  -9.315  1.00 17.00 ? 121 LEU A CB    1 
ATOM   979  C  CG    . LEU A 1 124 ? 65.374 -5.810  -8.672  1.00 14.74 ? 121 LEU A CG    1 
ATOM   980  C  CD1   . LEU A 1 124 ? 65.873 -5.673  -7.249  1.00 16.73 ? 121 LEU A CD1   1 
ATOM   981  C  CD2   . LEU A 1 124 ? 65.735 -4.601  -9.512  1.00 20.73 ? 121 LEU A CD2   1 
ATOM   982  N  N     . THR A 1 125 ? 65.546 -9.788  -11.530 1.00 14.77 ? 122 THR A N     1 
ATOM   983  C  CA    . THR A 1 125 ? 66.305 -10.932 -12.034 1.00 15.63 ? 122 THR A CA    1 
ATOM   984  C  C     . THR A 1 125 ? 67.224 -10.541 -13.205 1.00 16.02 ? 122 THR A C     1 
ATOM   985  O  O     . THR A 1 125 ? 68.429 -10.798 -13.150 1.00 17.78 ? 122 THR A O     1 
ATOM   986  C  CB    . THR A 1 125 ? 65.378 -12.045 -12.461 1.00 18.97 ? 122 THR A CB    1 
ATOM   987  O  OG1   . THR A 1 125 ? 64.504 -12.357 -11.370 1.00 16.83 ? 122 THR A OG1   1 
ATOM   988  C  CG2   . THR A 1 125 ? 66.190 -13.279 -12.831 1.00 17.91 ? 122 THR A CG2   1 
ATOM   989  N  N     . SER A 1 126 ? 66.662 -9.887  -14.224 1.00 18.41 ? 123 SER A N     1 
ATOM   990  C  CA    . SER A 1 126 ? 67.444 -9.480  -15.400 1.00 19.12 ? 123 SER A CA    1 
ATOM   991  C  C     . SER A 1 126 ? 68.506 -8.432  -15.065 1.00 22.99 ? 123 SER A C     1 
ATOM   992  O  O     . SER A 1 126 ? 69.659 -8.558  -15.485 1.00 23.51 ? 123 SER A O     1 
ATOM   993  C  CB    . SER A 1 126 ? 66.524 -8.944  -16.496 1.00 22.84 ? 123 SER A CB    1 
ATOM   994  O  OG    A SER A 1 126 ? 65.572 -9.908  -16.904 0.48 23.32 ? 123 SER A OG    1 
ATOM   995  O  OG    B SER A 1 126 ? 65.889 -7.751  -16.082 0.52 23.97 ? 123 SER A OG    1 
ATOM   996  N  N     . ALA A 1 127 ? 68.122 -7.403  -14.312 1.00 19.83 ? 124 ALA A N     1 
ATOM   997  C  CA    . ALA A 1 127 ? 69.058 -6.370  -13.882 1.00 20.26 ? 124 ALA A CA    1 
ATOM   998  C  C     . ALA A 1 127 ? 70.243 -6.952  -13.105 1.00 20.97 ? 124 ALA A C     1 
ATOM   999  O  O     . ALA A 1 127 ? 71.377 -6.490  -13.240 1.00 22.09 ? 124 ALA A O     1 
ATOM   1000 C  CB    . ALA A 1 127 ? 68.340 -5.317  -13.028 1.00 20.40 ? 124 ALA A CB    1 
ATOM   1001 N  N     . VAL A 1 128 ? 69.973 -7.960  -12.279 1.00 20.37 ? 125 VAL A N     1 
ATOM   1002 C  CA    . VAL A 1 128 ? 71.026 -8.604  -11.508 1.00 19.05 ? 125 VAL A CA    1 
ATOM   1003 C  C     . VAL A 1 128 ? 72.002 -9.359  -12.405 1.00 21.24 ? 125 VAL A C     1 
ATOM   1004 O  O     . VAL A 1 128 ? 73.209 -9.285  -12.200 1.00 22.70 ? 125 VAL A O     1 
ATOM   1005 C  CB    . VAL A 1 128 ? 70.432 -9.557  -10.458 1.00 19.48 ? 125 VAL A CB    1 
ATOM   1006 C  CG1   . VAL A 1 128 ? 71.462 -10.589 -10.025 1.00 18.16 ? 125 VAL A CG1   1 
ATOM   1007 C  CG2   . VAL A 1 128 ? 69.954 -8.755  -9.258  1.00 16.38 ? 125 VAL A CG2   1 
ATOM   1008 N  N     . GLN A 1 129 ? 71.473 -10.061 -13.400 1.00 18.92 ? 126 GLN A N     1 
ATOM   1009 C  CA    . GLN A 1 129 ? 72.311 -10.753 -14.377 1.00 27.17 ? 126 GLN A CA    1 
ATOM   1010 C  C     . GLN A 1 129 ? 73.233 -9.762  -15.073 1.00 27.04 ? 126 GLN A C     1 
ATOM   1011 O  O     . GLN A 1 129 ? 74.420 -10.023 -15.257 1.00 30.61 ? 126 GLN A O     1 
ATOM   1012 C  CB    . GLN A 1 129 ? 71.453 -11.498 -15.401 1.00 27.52 ? 126 GLN A CB    1 
ATOM   1013 C  CG    . GLN A 1 129 ? 70.603 -12.602 -14.800 1.00 33.56 ? 126 GLN A CG    1 
ATOM   1014 C  CD    . GLN A 1 129 ? 71.436 -13.733 -14.203 1.00 37.13 ? 126 GLN A CD    1 
ATOM   1015 O  OE1   . GLN A 1 129 ? 71.004 -14.405 -13.267 1.00 39.30 ? 126 GLN A OE1   1 
ATOM   1016 N  NE2   . GLN A 1 129 ? 72.622 -13.964 -14.762 1.00 40.21 ? 126 GLN A NE2   1 
ATOM   1017 N  N     . GLU A 1 130 ? 72.672 -8.618  -15.449 1.00 27.49 ? 127 GLU A N     1 
ATOM   1018 C  CA    . GLU A 1 130 ? 73.454 -7.541  -16.041 1.00 29.01 ? 127 GLU A CA    1 
ATOM   1019 C  C     . GLU A 1 130 ? 74.606 -7.077  -15.159 1.00 34.16 ? 127 GLU A C     1 
ATOM   1020 O  O     . GLU A 1 130 ? 75.760 -7.077  -15.589 1.00 35.55 ? 127 GLU A O     1 
ATOM   1021 C  CB    . GLU A 1 130 ? 72.554 -6.347  -16.353 1.00 31.03 ? 127 GLU A CB    1 
ATOM   1022 C  CG    . GLU A 1 130 ? 71.721 -6.523  -17.590 1.00 35.57 ? 127 GLU A CG    1 
ATOM   1023 C  CD    . GLU A 1 130 ? 71.922 -5.383  -18.565 1.00 52.22 ? 127 GLU A CD    1 
ATOM   1024 O  OE1   . GLU A 1 130 ? 72.396 -4.308  -18.133 1.00 53.32 ? 127 GLU A OE1   1 
ATOM   1025 O  OE2   . GLU A 1 130 ? 71.615 -5.563  -19.762 1.00 59.90 ? 127 GLU A OE2   1 
ATOM   1026 N  N     . ARG A 1 131 ? 74.290 -6.666  -13.936 1.00 26.61 ? 128 ARG A N     1 
ATOM   1027 C  CA    . ARG A 1 131 ? 75.299 -6.102  -13.048 1.00 31.50 ? 128 ARG A CA    1 
ATOM   1028 C  C     . ARG A 1 131 ? 76.381 -7.124  -12.720 1.00 32.30 ? 128 ARG A C     1 
ATOM   1029 O  O     . ARG A 1 131 ? 77.545 -6.770  -12.530 1.00 32.58 ? 128 ARG A O     1 
ATOM   1030 C  CB    . ARG A 1 131 ? 74.656 -5.582  -11.757 1.00 26.22 ? 128 ARG A CB    1 
ATOM   1031 C  CG    . ARG A 1 131 ? 75.660 -5.023  -10.768 1.00 30.45 ? 128 ARG A CG    1 
ATOM   1032 C  CD    . ARG A 1 131 ? 76.203 -3.686  -11.243 1.00 28.35 ? 128 ARG A CD    1 
ATOM   1033 N  NE    . ARG A 1 131 ? 75.090 -2.777  -11.468 1.00 34.19 ? 128 ARG A NE    1 
ATOM   1034 C  CZ    . ARG A 1 131 ? 74.641 -1.936  -10.545 1.00 29.77 ? 128 ARG A CZ    1 
ATOM   1035 N  NH1   . ARG A 1 131 ? 75.234 -1.890  -9.363  1.00 24.61 ? 128 ARG A NH1   1 
ATOM   1036 N  NH2   . ARG A 1 131 ? 73.612 -1.144  -10.805 1.00 40.47 ? 128 ARG A NH2   1 
ATOM   1037 N  N     . LEU A 1 132 ? 75.991 -8.394  -12.671 1.00 28.60 ? 129 LEU A N     1 
ATOM   1038 C  CA    . LEU A 1 132 ? 76.921 -9.481  -12.359 1.00 29.26 ? 129 LEU A CA    1 
ATOM   1039 C  C     . LEU A 1 132 ? 78.050 -9.577  -13.381 1.00 39.57 ? 129 LEU A C     1 
ATOM   1040 O  O     . LEU A 1 132 ? 79.193 -9.865  -13.030 1.00 40.02 ? 129 LEU A O     1 
ATOM   1041 C  CB    . LEU A 1 132 ? 76.164 -10.809 -12.271 1.00 29.43 ? 129 LEU A CB    1 
ATOM   1042 C  CG    . LEU A 1 132 ? 75.735 -11.171 -10.844 1.00 27.24 ? 129 LEU A CG    1 
ATOM   1043 C  CD1   . LEU A 1 132 ? 74.796 -12.366 -10.837 1.00 23.61 ? 129 LEU A CD1   1 
ATOM   1044 C  CD2   . LEU A 1 132 ? 76.954 -11.435 -9.981  1.00 28.27 ? 129 LEU A CD2   1 
ATOM   1045 N  N     . GLN A 1 133 ? 77.733 -9.323  -14.644 1.00 41.67 ? 130 GLN A N     1 
ATOM   1046 C  CA    . GLN A 1 133 ? 78.753 -9.378  -15.680 1.00 42.07 ? 130 GLN A CA    1 
ATOM   1047 C  C     . GLN A 1 133 ? 79.687 -8.170  -15.665 1.00 45.76 ? 130 GLN A C     1 
ATOM   1048 O  O     . GLN A 1 133 ? 80.869 -8.310  -15.952 1.00 53.40 ? 130 GLN A O     1 
ATOM   1049 C  CB    . GLN A 1 133 ? 78.102 -9.531  -17.048 1.00 45.66 ? 130 GLN A CB    1 
ATOM   1050 C  CG    . GLN A 1 133 ? 77.333 -10.835 -17.183 1.00 51.85 ? 130 GLN A CG    1 
ATOM   1051 C  CD    . GLN A 1 133 ? 76.613 -10.951 -18.508 1.00 61.71 ? 130 GLN A CD    1 
ATOM   1052 O  OE1   . GLN A 1 133 ? 77.095 -10.459 -19.528 1.00 73.01 ? 130 GLN A OE1   1 
ATOM   1053 N  NE2   . GLN A 1 133 ? 75.469 -11.631 -18.508 1.00 61.73 ? 130 GLN A NE2   1 
ATOM   1054 N  N     . LYS A 1 134 ? 79.184 -6.989  -15.318 1.00 44.03 ? 131 LYS A N     1 
ATOM   1055 C  CA    . LYS A 1 134 ? 80.070 -5.827  -15.236 1.00 49.89 ? 131 LYS A CA    1 
ATOM   1056 C  C     . LYS A 1 134 ? 81.001 -5.974  -14.033 1.00 53.97 ? 131 LYS A C     1 
ATOM   1057 O  O     . LYS A 1 134 ? 82.144 -5.506  -14.065 1.00 58.61 ? 131 LYS A O     1 
ATOM   1058 C  CB    . LYS A 1 134 ? 79.292 -4.503  -15.156 1.00 46.35 ? 131 LYS A CB    1 
ATOM   1059 C  CG    . LYS A 1 134 ? 79.206 -3.870  -13.758 1.00 50.29 ? 131 LYS A CG    1 
ATOM   1060 C  CD    . LYS A 1 134 ? 78.684 -2.424  -13.820 1.00 51.79 ? 131 LYS A CD    1 
ATOM   1061 C  CE    . LYS A 1 134 ? 77.431 -2.296  -14.682 1.00 45.93 ? 131 LYS A CE    1 
ATOM   1062 N  NZ    . LYS A 1 134 ? 76.608 -1.094  -14.329 1.00 49.30 ? 131 LYS A NZ    1 
ATOM   1063 N  N     . LEU A 1 135 ? 80.522 -6.649  -12.988 1.00 47.97 ? 132 LEU A N     1 
ATOM   1064 C  CA    . LEU A 1 135 ? 81.337 -6.888  -11.803 1.00 54.47 ? 132 LEU A CA    1 
ATOM   1065 C  C     . LEU A 1 135 ? 82.530 -7.778  -12.131 1.00 56.77 ? 132 LEU A C     1 
ATOM   1066 O  O     . LEU A 1 135 ? 83.620 -7.589  -11.589 1.00 57.67 ? 132 LEU A O     1 
ATOM   1067 C  CB    . LEU A 1 135 ? 80.504 -7.514  -10.680 1.00 52.52 ? 132 LEU A CB    1 
ATOM   1068 C  CG    . LEU A 1 135 ? 79.582 -6.576  -9.898  1.00 46.29 ? 132 LEU A CG    1 
ATOM   1069 C  CD1   . LEU A 1 135 ? 78.963 -7.290  -8.708  1.00 46.61 ? 132 LEU A CD1   1 
ATOM   1070 C  CD2   . LEU A 1 135 ? 80.368 -5.351  -9.449  1.00 49.40 ? 132 LEU A CD2   1 
ATOM   1071 N  N     . GLN A 1 136 ? 82.310 -8.746  -13.017 1.00 55.31 ? 133 GLN A N     1 
ATOM   1072 C  CA    . GLN A 1 136 ? 83.374 -9.638  -13.471 1.00 59.68 ? 133 GLN A CA    1 
ATOM   1073 C  C     . GLN A 1 136 ? 84.031 -10.393 -12.319 1.00 57.99 ? 133 GLN A C     1 
ATOM   1074 O  O     . GLN A 1 136 ? 85.251 -10.351 -12.157 1.00 58.92 ? 133 GLN A O     1 
ATOM   1075 C  CB    . GLN A 1 136 ? 84.435 -8.845  -14.238 1.00 60.46 ? 133 GLN A CB    1 
ATOM   1076 C  CG    . GLN A 1 136 ? 84.031 -8.460  -15.645 1.00 60.40 ? 133 GLN A CG    1 
ATOM   1077 C  CD    . GLN A 1 136 ? 85.097 -8.806  -16.656 1.00 70.70 ? 133 GLN A CD    1 
ATOM   1078 O  OE1   . GLN A 1 136 ? 85.161 -9.935  -17.146 1.00 73.80 ? 133 GLN A OE1   1 
ATOM   1079 N  NE2   . GLN A 1 136 ? 85.954 -7.839  -16.966 1.00 76.37 ? 133 GLN A NE2   1 
ATOM   1080 N  N     . GLY A 1 137 ? 83.217 -11.074 -11.517 1.00 53.19 ? 134 GLY A N     1 
ATOM   1081 C  CA    . GLY A 1 137 ? 83.719 -11.855 -10.404 1.00 51.23 ? 134 GLY A CA    1 
ATOM   1082 C  C     . GLY A 1 137 ? 84.470 -11.030 -9.374  1.00 54.49 ? 134 GLY A C     1 
ATOM   1083 O  O     . GLY A 1 137 ? 85.317 -11.556 -8.657  1.00 57.41 ? 134 GLY A O     1 
ATOM   1084 N  N     . GLN A 1 138 ? 84.184 -9.732  -9.312  1.00 53.25 ? 135 GLN A N     1 
ATOM   1085 C  CA    . GLN A 1 138 ? 84.750 -8.889  -8.261  1.00 54.47 ? 135 GLN A CA    1 
ATOM   1086 C  C     . GLN A 1 138 ? 83.808 -8.898  -7.060  1.00 51.96 ? 135 GLN A C     1 
ATOM   1087 O  O     . GLN A 1 138 ? 82.599 -8.731  -7.222  1.00 49.89 ? 135 GLN A O     1 
ATOM   1088 C  CB    . GLN A 1 138 ? 84.988 -7.454  -8.758  1.00 55.50 ? 135 GLN A CB    1 
ATOM   1089 C  CG    . GLN A 1 138 ? 85.428 -6.465  -7.670  1.00 57.82 ? 135 GLN A CG    1 
ATOM   1090 C  CD    . GLN A 1 138 ? 85.455 -5.019  -8.148  1.00 63.06 ? 135 GLN A CD    1 
ATOM   1091 O  OE1   . GLN A 1 138 ? 86.298 -4.643  -8.964  1.00 68.24 ? 135 GLN A OE1   1 
ATOM   1092 N  NE2   . GLN A 1 138 ? 84.548 -4.199  -7.624  1.00 56.22 ? 135 GLN A NE2   1 
ATOM   1093 N  N     . PRO A 1 139 ? 84.360 -9.104  -5.852  1.00 49.91 ? 136 PRO A N     1 
ATOM   1094 C  CA    . PRO A 1 139 ? 83.562 -9.157  -4.623  1.00 45.96 ? 136 PRO A CA    1 
ATOM   1095 C  C     . PRO A 1 139 ? 82.733 -7.899  -4.396  1.00 40.77 ? 136 PRO A C     1 
ATOM   1096 O  O     . PRO A 1 139 ? 83.075 -6.823  -4.880  1.00 40.06 ? 136 PRO A O     1 
ATOM   1097 C  CB    . PRO A 1 139 ? 84.622 -9.316  -3.528  1.00 46.85 ? 136 PRO A CB    1 
ATOM   1098 C  CG    . PRO A 1 139 ? 85.863 -8.756  -4.127  1.00 47.29 ? 136 PRO A CG    1 
ATOM   1099 C  CD    . PRO A 1 139 ? 85.800 -9.191  -5.559  1.00 50.93 ? 136 PRO A CD    1 
ATOM   1100 N  N     . ILE A 1 140 ? 81.630 -8.052  -3.676  1.00 34.65 ? 137 ILE A N     1 
ATOM   1101 C  CA    . ILE A 1 140 ? 80.792 -6.919  -3.341  1.00 26.32 ? 137 ILE A CA    1 
ATOM   1102 C  C     . ILE A 1 140 ? 81.253 -6.334  -2.019  1.00 25.81 ? 137 ILE A C     1 
ATOM   1103 O  O     . ILE A 1 140 ? 81.271 -7.010  -0.993  1.00 27.74 ? 137 ILE A O     1 
ATOM   1104 C  CB    . ILE A 1 140 ? 79.323 -7.327  -3.283  1.00 27.64 ? 137 ILE A CB    1 
ATOM   1105 C  CG1   . ILE A 1 140 ? 78.921 -7.872  -4.655  1.00 31.22 ? 137 ILE A CG1   1 
ATOM   1106 C  CG2   . ILE A 1 140 ? 78.463 -6.139  -2.904  1.00 23.73 ? 137 ILE A CG2   1 
ATOM   1107 C  CD1   . ILE A 1 140 ? 77.553 -8.451  -4.716  1.00 30.17 ? 137 ILE A CD1   1 
ATOM   1108 N  N     . SER A 1 141 ? 81.657 -5.075  -2.060  1.00 24.24 ? 138 SER A N     1 
ATOM   1109 C  CA    . SER A 1 141 ? 82.138 -4.390  -0.868  1.00 25.47 ? 138 SER A CA    1 
ATOM   1110 C  C     . SER A 1 141 ? 80.971 -4.052  0.052   1.00 23.30 ? 138 SER A C     1 
ATOM   1111 O  O     . SER A 1 141 ? 79.863 -3.778  -0.418  1.00 22.29 ? 138 SER A O     1 
ATOM   1112 C  CB    . SER A 1 141 ? 82.905 -3.123  -1.260  1.00 25.83 ? 138 SER A CB    1 
ATOM   1113 O  OG    . SER A 1 141 ? 83.048 -2.240  -0.163  1.00 35.67 ? 138 SER A OG    1 
ATOM   1114 N  N     . ALA A 1 142 ? 81.211 -4.075  1.359   1.00 21.86 ? 139 ALA A N     1 
ATOM   1115 C  CA    . ALA A 1 142 ? 80.195 -3.678  2.321   1.00 20.98 ? 139 ALA A CA    1 
ATOM   1116 C  C     . ALA A 1 142 ? 79.748 -2.247  2.052   1.00 24.23 ? 139 ALA A C     1 
ATOM   1117 O  O     . ALA A 1 142 ? 78.630 -1.858  2.395   1.00 21.62 ? 139 ALA A O     1 
ATOM   1118 C  CB    . ALA A 1 142 ? 80.715 -3.809  3.736   1.00 25.67 ? 139 ALA A CB    1 
ATOM   1119 N  N     . ASP A 1 143 ? 80.624 -1.470  1.421   1.00 23.51 ? 140 ASP A N     1 
ATOM   1120 C  CA    . ASP A 1 143 ? 80.342 -0.064  1.158   1.00 26.26 ? 140 ASP A CA    1 
ATOM   1121 C  C     . ASP A 1 143 ? 79.221 0.117   0.155   1.00 25.95 ? 140 ASP A C     1 
ATOM   1122 O  O     . ASP A 1 143 ? 78.616 1.184   0.091   1.00 25.27 ? 140 ASP A O     1 
ATOM   1123 C  CB    . ASP A 1 143 ? 81.595 0.645   0.656   1.00 24.30 ? 140 ASP A CB    1 
ATOM   1124 C  CG    . ASP A 1 143 ? 82.687 0.689   1.699   1.00 36.79 ? 140 ASP A CG    1 
ATOM   1125 O  OD1   . ASP A 1 143 ? 82.358 0.597   2.903   1.00 32.27 ? 140 ASP A OD1   1 
ATOM   1126 O  OD2   . ASP A 1 143 ? 83.871 0.821   1.318   1.00 41.30 ? 140 ASP A OD2   1 
ATOM   1127 N  N     . LEU A 1 144 ? 78.944 -0.922  -0.628  1.00 19.34 ? 141 LEU A N     1 
ATOM   1128 C  CA    . LEU A 1 144 ? 77.855 -0.855  -1.589  1.00 20.49 ? 141 LEU A CA    1 
ATOM   1129 C  C     . LEU A 1 144 ? 76.510 -1.174  -0.944  1.00 18.79 ? 141 LEU A C     1 
ATOM   1130 O  O     . LEU A 1 144 ? 75.473 -1.004  -1.572  1.00 17.53 ? 141 LEU A O     1 
ATOM   1131 C  CB    . LEU A 1 144 ? 78.119 -1.796  -2.747  1.00 20.66 ? 141 LEU A CB    1 
ATOM   1132 C  CG    . LEU A 1 144 ? 79.399 -1.470  -3.510  1.00 23.85 ? 141 LEU A CG    1 
ATOM   1133 C  CD1   . LEU A 1 144 ? 79.607 -2.452  -4.640  1.00 27.63 ? 141 LEU A CD1   1 
ATOM   1134 C  CD2   . LEU A 1 144 ? 79.321 -0.047  -4.047  1.00 25.86 ? 141 LEU A CD2   1 
ATOM   1135 N  N     . LEU A 1 145 ? 76.532 -1.608  0.316   1.00 16.98 ? 142 LEU A N     1 
ATOM   1136 C  CA    . LEU A 1 145 ? 75.314 -1.973  1.038   1.00 14.93 ? 142 LEU A CA    1 
ATOM   1137 C  C     . LEU A 1 145 ? 75.182 -1.210  2.360   1.00 15.86 ? 142 LEU A C     1 
ATOM   1138 O  O     . LEU A 1 145 ? 75.054 -1.810  3.433   1.00 15.15 ? 142 LEU A O     1 
ATOM   1139 C  CB    . LEU A 1 145 ? 75.300 -3.491  1.286   1.00 15.68 ? 142 LEU A CB    1 
ATOM   1140 C  CG    . LEU A 1 145 ? 75.173 -4.307  0.000   1.00 16.73 ? 142 LEU A CG    1 
ATOM   1141 C  CD1   . LEU A 1 145 ? 75.568 -5.774  0.206   1.00 17.55 ? 142 LEU A CD1   1 
ATOM   1142 C  CD2   . LEU A 1 145 ? 73.765 -4.204  -0.562  1.00 17.69 ? 142 LEU A CD2   1 
ATOM   1143 N  N     . PRO A 1 146 ? 75.192 0.133   2.287   1.00 19.25 ? 143 PRO A N     1 
ATOM   1144 C  CA    . PRO A 1 146 ? 75.299 0.915   3.520   1.00 18.14 ? 143 PRO A CA    1 
ATOM   1145 C  C     . PRO A 1 146 ? 74.043 0.950   4.383   1.00 16.59 ? 143 PRO A C     1 
ATOM   1146 O  O     . PRO A 1 146 ? 74.137 1.405   5.518   1.00 18.38 ? 143 PRO A O     1 
ATOM   1147 C  CB    . PRO A 1 146 ? 75.627 2.321   3.004   1.00 19.62 ? 143 PRO A CB    1 
ATOM   1148 C  CG    . PRO A 1 146 ? 74.959 2.379   1.667   1.00 18.64 ? 143 PRO A CG    1 
ATOM   1149 C  CD    . PRO A 1 146 ? 75.135 0.992   1.091   1.00 18.57 ? 143 PRO A CD    1 
ATOM   1150 N  N     . SER A 1 147 ? 72.893 0.493   3.880   1.00 17.32 ? 144 SER A N     1 
ATOM   1151 C  CA    . SER A 1 147 ? 71.689 0.486   4.719   1.00 14.24 ? 144 SER A CA    1 
ATOM   1152 C  C     . SER A 1 147 ? 71.018 -0.888  4.755   1.00 15.86 ? 144 SER A C     1 
ATOM   1153 O  O     . SER A 1 147 ? 69.846 -1.010  5.120   1.00 14.37 ? 144 SER A O     1 
ATOM   1154 C  CB    . SER A 1 147 ? 70.685 1.540   4.234   1.00 17.01 ? 144 SER A CB    1 
ATOM   1155 O  OG    . SER A 1 147 ? 70.179 1.213   2.958   1.00 16.06 ? 144 SER A OG    1 
ATOM   1156 N  N     . THR A 1 148 ? 71.782 -1.918  4.411   1.00 12.87 ? 145 THR A N     1 
ATOM   1157 C  CA    . THR A 1 148 ? 71.248 -3.281  4.276   1.00 14.24 ? 145 THR A CA    1 
ATOM   1158 C  C     . THR A 1 148 ? 71.437 -4.144  5.524   1.00 14.49 ? 145 THR A C     1 
ATOM   1159 O  O     . THR A 1 148 ? 72.524 -4.172  6.119   1.00 16.02 ? 145 THR A O     1 
ATOM   1160 C  CB    . THR A 1 148 ? 71.902 -4.005  3.085   1.00 11.99 ? 145 THR A CB    1 
ATOM   1161 O  OG1   . THR A 1 148 ? 71.559 -3.345  1.868   1.00 12.22 ? 145 THR A OG1   1 
ATOM   1162 C  CG2   . THR A 1 148 ? 71.437 -5.467  3.002   1.00 13.69 ? 145 THR A CG2   1 
ATOM   1163 N  N     . TYR A 1 149 ? 70.367 -4.836  5.902   1.00 13.57 ? 146 TYR A N     1 
ATOM   1164 C  CA    . TYR A 1 149 ? 70.372 -5.862  6.952   1.00 13.66 ? 146 TYR A CA    1 
ATOM   1165 C  C     . TYR A 1 149 ? 70.287 -7.211  6.301   1.00 14.36 ? 146 TYR A C     1 
ATOM   1166 O  O     . TYR A 1 149 ? 69.536 -7.387  5.348   1.00 14.50 ? 146 TYR A O     1 
ATOM   1167 C  CB    . TYR A 1 149 ? 69.184 -5.724  7.902   1.00 13.01 ? 146 TYR A CB    1 
ATOM   1168 C  CG    . TYR A 1 149 ? 69.382 -4.693  8.972   1.00 15.55 ? 146 TYR A CG    1 
ATOM   1169 C  CD1   . TYR A 1 149 ? 69.760 -5.068  10.251  1.00 17.48 ? 146 TYR A CD1   1 
ATOM   1170 C  CD2   . TYR A 1 149 ? 69.174 -3.343  8.708   1.00 15.71 ? 146 TYR A CD2   1 
ATOM   1171 C  CE1   . TYR A 1 149 ? 69.943 -4.132  11.241  1.00 17.93 ? 146 TYR A CE1   1 
ATOM   1172 C  CE2   . TYR A 1 149 ? 69.355 -2.399  9.691   1.00 17.12 ? 146 TYR A CE2   1 
ATOM   1173 C  CZ    . TYR A 1 149 ? 69.742 -2.799  10.957  1.00 20.26 ? 146 TYR A CZ    1 
ATOM   1174 O  OH    . TYR A 1 149 ? 69.931 -1.870  11.957  1.00 26.93 ? 146 TYR A OH    1 
ATOM   1175 N  N     . ILE A 1 150 ? 71.054 -8.163  6.817   1.00 11.48 ? 147 ILE A N     1 
ATOM   1176 C  CA    . ILE A 1 150 ? 70.925 -9.549  6.387   1.00 11.49 ? 147 ILE A CA    1 
ATOM   1177 C  C     . ILE A 1 150 ? 70.180 -10.314 7.466   1.00 12.94 ? 147 ILE A C     1 
ATOM   1178 O  O     . ILE A 1 150 ? 70.707 -10.505 8.568   1.00 13.90 ? 147 ILE A O     1 
ATOM   1179 C  CB    . ILE A 1 150 ? 72.295 -10.211 6.151   1.00 10.42 ? 147 ILE A CB    1 
ATOM   1180 C  CG1   . ILE A 1 150 ? 73.208 -9.341  5.275   1.00 12.82 ? 147 ILE A CG1   1 
ATOM   1181 C  CG2   . ILE A 1 150 ? 72.093 -11.619 5.556   1.00 14.27 ? 147 ILE A CG2   1 
ATOM   1182 C  CD1   . ILE A 1 150 ? 72.703 -9.129  3.848   1.00 12.30 ? 147 ILE A CD1   1 
ATOM   1183 N  N     . GLU A 1 151 ? 68.951 -10.740 7.173   1.00 11.17 ? 148 GLU A N     1 
ATOM   1184 C  CA    . GLU A 1 151 ? 68.118 -11.350 8.197   1.00 13.32 ? 148 GLU A CA    1 
ATOM   1185 C  C     . GLU A 1 151 ? 68.722 -12.667 8.678   1.00 14.76 ? 148 GLU A C     1 
ATOM   1186 O  O     . GLU A 1 151 ? 69.136 -13.481 7.859   1.00 15.61 ? 148 GLU A O     1 
ATOM   1187 C  CB    . GLU A 1 151 ? 66.696 -11.582 7.668   1.00 13.33 ? 148 GLU A CB    1 
ATOM   1188 C  CG    . GLU A 1 151 ? 65.831 -12.425 8.603   1.00 16.54 ? 148 GLU A CG    1 
ATOM   1189 C  CD    . GLU A 1 151 ? 65.602 -11.783 9.959   1.00 18.10 ? 148 GLU A CD    1 
ATOM   1190 O  OE1   . GLU A 1 151 ? 65.309 -12.522 10.925  1.00 19.40 ? 148 GLU A OE1   1 
ATOM   1191 O  OE2   . GLU A 1 151 ? 65.687 -10.539 10.068  1.00 20.68 ? 148 GLU A OE2   1 
ATOM   1192 N  N     . GLY A 1 152 ? 68.789 -12.840 10.001  1.00 14.95 ? 149 GLY A N     1 
ATOM   1193 C  CA    . GLY A 1 152 ? 69.379 -14.025 10.606  1.00 18.46 ? 149 GLY A CA    1 
ATOM   1194 C  C     . GLY A 1 152 ? 70.833 -13.872 11.036  1.00 18.84 ? 149 GLY A C     1 
ATOM   1195 O  O     . GLY A 1 152 ? 71.383 -14.742 11.727  1.00 20.72 ? 149 GLY A O     1 
ATOM   1196 N  N     . LEU A 1 153 ? 71.468 -12.783 10.621  1.00 12.38 ? 150 LEU A N     1 
ATOM   1197 C  CA    . LEU A 1 153 ? 72.873 -12.549 10.961  1.00 14.84 ? 150 LEU A CA    1 
ATOM   1198 C  C     . LEU A 1 153 ? 73.012 -11.256 11.755  1.00 18.03 ? 150 LEU A C     1 
ATOM   1199 O  O     . LEU A 1 153 ? 72.207 -10.348 11.597  1.00 18.91 ? 150 LEU A O     1 
ATOM   1200 C  CB    . LEU A 1 153 ? 73.726 -12.519 9.692   1.00 13.62 ? 150 LEU A CB    1 
ATOM   1201 C  CG    . LEU A 1 153 ? 73.785 -13.809 8.870   1.00 18.42 ? 150 LEU A CG    1 
ATOM   1202 C  CD1   . LEU A 1 153 ? 74.685 -13.666 7.666   1.00 16.06 ? 150 LEU A CD1   1 
ATOM   1203 C  CD2   . LEU A 1 153 ? 74.237 -14.986 9.754   1.00 21.07 ? 150 LEU A CD2   1 
ATOM   1204 N  N     . PRO A 1 154 ? 74.033 -11.161 12.627  1.00 17.85 ? 151 PRO A N     1 
ATOM   1205 C  CA    . PRO A 1 154 ? 75.078 -12.165 12.859  1.00 16.89 ? 151 PRO A CA    1 
ATOM   1206 C  C     . PRO A 1 154 ? 74.604 -13.346 13.694  1.00 19.07 ? 151 PRO A C     1 
ATOM   1207 O  O     . PRO A 1 154 ? 73.598 -13.271 14.390  1.00 20.45 ? 151 PRO A O     1 
ATOM   1208 C  CB    . PRO A 1 154 ? 76.159 -11.377 13.612  1.00 18.31 ? 151 PRO A CB    1 
ATOM   1209 C  CG    . PRO A 1 154 ? 75.401 -10.299 14.323  1.00 20.48 ? 151 PRO A CG    1 
ATOM   1210 C  CD    . PRO A 1 154 ? 74.257 -9.931  13.409  1.00 22.82 ? 151 PRO A CD    1 
ATOM   1211 N  N     . GLN A 1 155 ? 75.347 -14.442 13.616  1.00 24.24 ? 152 GLN A N     1 
ATOM   1212 C  CA    . GLN A 1 155 ? 75.065 -15.614 14.430  1.00 29.87 ? 152 GLN A CA    1 
ATOM   1213 C  C     . GLN A 1 155 ? 76.374 -16.127 15.033  1.00 35.24 ? 152 GLN A C     1 
ATOM   1214 O  O     . GLN A 1 155 ? 77.452 -15.825 14.515  1.00 40.30 ? 152 GLN A O     1 
ATOM   1215 C  CB    . GLN A 1 155 ? 74.401 -16.707 13.593  1.00 31.76 ? 152 GLN A CB    1 
ATOM   1216 C  CG    . GLN A 1 155 ? 75.395 -17.779 13.192  1.00 37.21 ? 152 GLN A CG    1 
ATOM   1217 C  CD    . GLN A 1 155 ? 74.800 -18.879 12.362  1.00 34.90 ? 152 GLN A CD    1 
ATOM   1218 O  OE1   . GLN A 1 155 ? 73.599 -19.166 12.437  1.00 32.97 ? 152 GLN A OE1   1 
ATOM   1219 N  NE2   . GLN A 1 155 ? 75.645 -19.518 11.559  1.00 26.40 ? 152 GLN A NE2   1 
ATOM   1220 N  N     . GLY A 1 156 ? 76.268 -16.903 16.111  1.00 40.87 ? 153 GLY A N     1 
ATOM   1221 C  CA    . GLY A 1 156 ? 77.428 -17.471 16.783  1.00 49.59 ? 153 GLY A CA    1 
ATOM   1222 C  C     . GLY A 1 156 ? 78.234 -16.431 17.550  1.00 54.00 ? 153 GLY A C     1 
ATOM   1223 O  O     . GLY A 1 156 ? 77.658 -15.484 18.095  1.00 60.13 ? 153 GLY A O     1 
ATOM   1224 N  N     . PRO A 1 157 ? 79.562 -16.626 17.647  1.00 63.10 ? 154 PRO A N     1 
ATOM   1225 C  CA    . PRO A 1 157 ? 80.458 -15.617 18.241  1.00 63.92 ? 154 PRO A CA    1 
ATOM   1226 C  C     . PRO A 1 157 ? 80.466 -14.320 17.425  1.00 58.46 ? 154 PRO A C     1 
ATOM   1227 O  O     . PRO A 1 157 ? 81.198 -13.382 17.739  1.00 63.25 ? 154 PRO A O     1 
ATOM   1228 C  CB    . PRO A 1 157 ? 81.831 -16.297 18.194  1.00 50.29 ? 154 PRO A CB    1 
ATOM   1229 C  CG    . PRO A 1 157 ? 81.654 -17.437 17.224  1.00 49.47 ? 154 PRO A CG    1 
ATOM   1230 C  CD    . PRO A 1 157 ? 80.255 -17.878 17.354  1.00 53.97 ? 154 PRO A CD    1 
ATOM   1231 N  N     . THR A 1 163 ? 78.750 -5.060  19.492  1.00 66.83 ? 160 THR A N     1 
ATOM   1232 C  CA    . THR A 1 163 ? 77.651 -5.962  19.825  1.00 65.58 ? 160 THR A CA    1 
ATOM   1233 C  C     . THR A 1 163 ? 76.531 -5.152  20.511  1.00 60.80 ? 160 THR A C     1 
ATOM   1234 O  O     . THR A 1 163 ? 75.410 -5.642  20.719  1.00 61.87 ? 160 THR A O     1 
ATOM   1235 C  CB    . THR A 1 163 ? 78.152 -7.146  20.731  1.00 62.84 ? 160 THR A CB    1 
ATOM   1236 O  OG1   . THR A 1 163 ? 79.182 -7.872  20.049  1.00 66.03 ? 160 THR A OG1   1 
ATOM   1237 C  CG2   . THR A 1 163 ? 77.038 -8.136  21.066  1.00 61.38 ? 160 THR A CG2   1 
ATOM   1238 N  N     . VAL A 1 164 ? 76.811 -3.889  20.810  1.00 60.79 ? 161 VAL A N     1 
ATOM   1239 C  CA    . VAL A 1 164 ? 75.928 -3.114  21.683  1.00 60.63 ? 161 VAL A CA    1 
ATOM   1240 C  C     . VAL A 1 164 ? 74.963 -2.225  20.879  1.00 53.43 ? 161 VAL A C     1 
ATOM   1241 O  O     . VAL A 1 164 ? 73.762 -2.200  21.110  1.00 54.03 ? 161 VAL A O     1 
ATOM   1242 C  CB    . VAL A 1 164 ? 76.805 -2.286  22.676  1.00 62.29 ? 161 VAL A CB    1 
ATOM   1243 C  CG1   . VAL A 1 164 ? 76.064 -2.026  23.965  1.00 52.44 ? 161 VAL A CG1   1 
ATOM   1244 C  CG2   . VAL A 1 164 ? 78.057 -3.132  23.026  1.00 63.19 ? 161 VAL A CG2   1 
ATOM   1245 N  N     . GLN A 1 165 ? 75.575 -1.431  20.010  1.00 49.65 ? 162 GLN A N     1 
ATOM   1246 C  CA    . GLN A 1 165 ? 75.028 -0.736  18.833  1.00 47.20 ? 162 GLN A CA    1 
ATOM   1247 C  C     . GLN A 1 165 ? 74.133 -1.545  17.863  1.00 42.40 ? 162 GLN A C     1 
ATOM   1248 O  O     . GLN A 1 165 ? 74.415 -2.708  17.635  1.00 44.51 ? 162 GLN A O     1 
ATOM   1249 C  CB    . GLN A 1 165 ? 76.238 -0.190  18.077  1.00 49.50 ? 162 GLN A CB    1 
ATOM   1250 C  CG    . GLN A 1 165 ? 77.582 -0.819  18.520  1.00 53.45 ? 162 GLN A CG    1 
ATOM   1251 C  CD    . GLN A 1 165 ? 78.817 -0.005  17.918  1.00 56.98 ? 162 GLN A CD    1 
ATOM   1252 O  OE1   . GLN A 1 165 ? 78.807 1.255   17.825  1.00 55.64 ? 162 GLN A OE1   1 
ATOM   1253 N  NE2   . GLN A 1 165 ? 79.915 -0.748  17.733  1.00 58.62 ? 162 GLN A NE2   1 
ATOM   1254 N  N     . LYS A 1 166 ? 73.085 -0.914  17.299  1.00 39.86 ? 163 LYS A N     1 
ATOM   1255 C  CA    . LYS A 1 166 ? 72.284 -1.443  16.171  1.00 37.23 ? 163 LYS A CA    1 
ATOM   1256 C  C     . LYS A 1 166 ? 73.078 -1.367  14.862  1.00 30.95 ? 163 LYS A C     1 
ATOM   1257 O  O     . LYS A 1 166 ? 73.115 -2.326  14.089  1.00 29.40 ? 163 LYS A O     1 
ATOM   1258 C  CB    . LYS A 1 166 ? 70.935 -0.682  16.000  1.00 38.10 ? 163 LYS A CB    1 
ATOM   1259 C  CG    . LYS A 1 166 ? 69.992 -1.432  15.070  1.00 40.92 ? 163 LYS A CG    1 
ATOM   1260 C  CD    . LYS A 1 166 ? 68.482 -1.152  15.139  1.00 41.85 ? 163 LYS A CD    1 
ATOM   1261 C  CE    . LYS A 1 166 ? 67.785 -2.282  14.336  1.00 37.33 ? 163 LYS A CE    1 
ATOM   1262 N  NZ    . LYS A 1 166 ? 66.626 -1.916  13.461  1.00 33.39 ? 163 LYS A NZ    1 
ATOM   1263 N  N     . GLU A 1 167 ? 73.733 -0.235  14.615  1.00 30.96 ? 164 GLU A N     1 
ATOM   1264 C  CA    . GLU A 1 167 ? 74.542 -0.098  13.402  1.00 30.45 ? 164 GLU A CA    1 
ATOM   1265 C  C     . GLU A 1 167 ? 75.717 -1.071  13.425  1.00 31.55 ? 164 GLU A C     1 
ATOM   1266 O  O     . GLU A 1 167 ? 76.083 -1.639  12.396  1.00 25.83 ? 164 GLU A O     1 
ATOM   1267 C  CB    . GLU A 1 167 ? 75.045 1.341   13.223  1.00 32.25 ? 164 GLU A CB    1 
ATOM   1268 C  CG    . GLU A 1 167 ? 76.038 1.530   12.059  1.00 27.12 ? 164 GLU A CG    1 
ATOM   1269 C  CD    . GLU A 1 167 ? 75.437 1.262   10.675  1.00 29.81 ? 164 GLU A CD    1 
ATOM   1270 O  OE1   . GLU A 1 167 ? 76.225 1.139   9.709   1.00 30.14 ? 164 GLU A OE1   1 
ATOM   1271 O  OE2   . GLU A 1 167 ? 74.191 1.190   10.544  1.00 29.69 ? 164 GLU A OE2   1 
ATOM   1272 N  N     . GLY A 1 168 ? 76.305 -1.260  14.600  1.00 31.70 ? 165 GLY A N     1 
ATOM   1273 C  CA    . GLY A 1 168 ? 77.388 -2.208  14.759  1.00 33.78 ? 165 GLY A CA    1 
ATOM   1274 C  C     . GLY A 1 168 ? 76.928 -3.626  14.483  1.00 25.90 ? 165 GLY A C     1 
ATOM   1275 O  O     . GLY A 1 168 ? 77.635 -4.382  13.817  1.00 27.98 ? 165 GLY A O     1 
ATOM   1276 N  N     . MET A 1 169 ? 75.751 -3.990  14.999  1.00 31.96 ? 166 MET A N     1 
ATOM   1277 C  CA    . MET A 1 169 ? 75.147 -5.299  14.711  1.00 28.87 ? 166 MET A CA    1 
ATOM   1278 C  C     . MET A 1 169 ? 74.882 -5.465  13.219  1.00 27.04 ? 166 MET A C     1 
ATOM   1279 O  O     . MET A 1 169 ? 75.119 -6.536  12.656  1.00 23.87 ? 166 MET A O     1 
ATOM   1280 C  CB    . MET A 1 169 ? 73.826 -5.501  15.467  1.00 35.00 ? 166 MET A CB    1 
ATOM   1281 C  CG    . MET A 1 169 ? 73.918 -5.623  16.988  1.00 45.74 ? 166 MET A CG    1 
ATOM   1282 S  SD    . MET A 1 169 ? 74.865 -7.029  17.612  1.00 63.84 ? 166 MET A SD    1 
ATOM   1283 C  CE    . MET A 1 169 ? 73.807 -8.370  17.073  1.00 45.46 ? 166 MET A CE    1 
ATOM   1284 N  N     . ARG A 1 170 ? 74.376 -4.412  12.580  1.00 23.76 ? 167 ARG A N     1 
ATOM   1285 C  CA    . ARG A 1 170 ? 74.067 -4.496  11.157  1.00 22.29 ? 167 ARG A CA    1 
ATOM   1286 C  C     . ARG A 1 170 ? 75.314 -4.848  10.355  1.00 20.85 ? 167 ARG A C     1 
ATOM   1287 O  O     . ARG A 1 170 ? 75.283 -5.731  9.498   1.00 20.31 ? 167 ARG A O     1 
ATOM   1288 C  CB    . ARG A 1 170 ? 73.464 -3.184  10.636  1.00 19.55 ? 167 ARG A CB    1 
ATOM   1289 C  CG    . ARG A 1 170 ? 73.090 -3.242  9.157   1.00 18.37 ? 167 ARG A CG    1 
ATOM   1290 C  CD    . ARG A 1 170 ? 72.907 -1.841  8.570   1.00 18.24 ? 167 ARG A CD    1 
ATOM   1291 N  NE    . ARG A 1 170 ? 74.179 -1.145  8.377   1.00 18.69 ? 167 ARG A NE    1 
ATOM   1292 C  CZ    . ARG A 1 170 ? 74.965 -1.290  7.313   1.00 17.75 ? 167 ARG A CZ    1 
ATOM   1293 N  NH1   . ARG A 1 170 ? 74.637 -2.118  6.332   1.00 18.05 ? 167 ARG A NH1   1 
ATOM   1294 N  NH2   . ARG A 1 170 ? 76.092 -0.606  7.237   1.00 24.04 ? 167 ARG A NH2   1 
ATOM   1295 N  N     . LYS A 1 171 ? 76.412 -4.148  10.632  1.00 21.01 ? 168 LYS A N     1 
ATOM   1296 C  CA    . LYS A 1 171 ? 77.658 -4.393  9.918   1.00 22.57 ? 168 LYS A CA    1 
ATOM   1297 C  C     . LYS A 1 171 ? 78.227 -5.771  10.225  1.00 22.98 ? 168 LYS A C     1 
ATOM   1298 O  O     . LYS A 1 171 ? 78.786 -6.413  9.338   1.00 17.63 ? 168 LYS A O     1 
ATOM   1299 C  CB    . LYS A 1 171 ? 78.688 -3.322  10.255  1.00 24.06 ? 168 LYS A CB    1 
ATOM   1300 C  CG    . LYS A 1 171 ? 78.504 -2.038  9.481   1.00 30.71 ? 168 LYS A CG    1 
ATOM   1301 C  CD    . LYS A 1 171 ? 79.718 -1.138  9.650   1.00 32.94 ? 168 LYS A CD    1 
ATOM   1302 C  CE    . LYS A 1 171 ? 79.583 0.122   8.820   1.00 34.95 ? 168 LYS A CE    1 
ATOM   1303 N  NZ    . LYS A 1 171 ? 80.839 0.913   8.805   1.00 41.92 ? 168 LYS A NZ    1 
ATOM   1304 N  N     . GLN A 1 172 ? 78.095 -6.216  11.473  1.00 24.18 ? 169 GLN A N     1 
ATOM   1305 C  CA    . GLN A 1 172 ? 78.545 -7.557  11.849  1.00 23.52 ? 169 GLN A CA    1 
ATOM   1306 C  C     . GLN A 1 172 ? 77.870 -8.589  10.960  1.00 20.41 ? 169 GLN A C     1 
ATOM   1307 O  O     . GLN A 1 172 ? 78.524 -9.449  10.365  1.00 19.98 ? 169 GLN A O     1 
ATOM   1308 C  CB    . GLN A 1 172 ? 78.235 -7.871  13.313  1.00 26.04 ? 169 GLN A CB    1 
ATOM   1309 C  CG    . GLN A 1 172 ? 79.103 -7.175  14.344  1.00 32.89 ? 169 GLN A CG    1 
ATOM   1310 C  CD    . GLN A 1 172 ? 78.601 -7.419  15.758  1.00 41.54 ? 169 GLN A CD    1 
ATOM   1311 O  OE1   . GLN A 1 172 ? 77.606 -8.117  15.961  1.00 47.74 ? 169 GLN A OE1   1 
ATOM   1312 N  NE2   . GLN A 1 172 ? 79.293 -6.854  16.742  1.00 48.49 ? 169 GLN A NE2   1 
ATOM   1313 N  N     . GLY A 1 173 ? 76.546 -8.492  10.874  1.00 22.32 ? 170 GLY A N     1 
ATOM   1314 C  CA    . GLY A 1 173 ? 75.781 -9.416  10.062  1.00 17.45 ? 170 GLY A CA    1 
ATOM   1315 C  C     . GLY A 1 173 ? 76.167 -9.337  8.603   1.00 17.06 ? 170 GLY A C     1 
ATOM   1316 O  O     . GLY A 1 173 ? 76.344 -10.363 7.941   1.00 18.08 ? 170 GLY A O     1 
ATOM   1317 N  N     . LEU A 1 174 ? 76.312 -8.112  8.097   1.00 15.82 ? 171 LEU A N     1 
ATOM   1318 C  CA    . LEU A 1 174 ? 76.644 -7.906  6.696   1.00 17.15 ? 171 LEU A CA    1 
ATOM   1319 C  C     . LEU A 1 174 ? 78.022 -8.482  6.381   1.00 19.93 ? 171 LEU A C     1 
ATOM   1320 O  O     . LEU A 1 174 ? 78.247 -9.059  5.316   1.00 18.80 ? 171 LEU A O     1 
ATOM   1321 C  CB    . LEU A 1 174 ? 76.587 -6.412  6.345   1.00 20.36 ? 171 LEU A CB    1 
ATOM   1322 C  CG    . LEU A 1 174 ? 76.931 -6.056  4.897   1.00 15.25 ? 171 LEU A CG    1 
ATOM   1323 C  CD1   . LEU A 1 174 ? 76.024 -6.796  3.900   1.00 17.08 ? 171 LEU A CD1   1 
ATOM   1324 C  CD2   . LEU A 1 174 ? 76.889 -4.551  4.672   1.00 21.29 ? 171 LEU A CD2   1 
ATOM   1325 N  N     . PHE A 1 175 ? 78.944 -8.344  7.321   1.00 17.29 ? 172 PHE A N     1 
ATOM   1326 C  CA    . PHE A 1 175 ? 80.282 -8.857  7.075   1.00 22.83 ? 172 PHE A CA    1 
ATOM   1327 C  C     . PHE A 1 175 ? 80.278 -10.388 7.034   1.00 19.99 ? 172 PHE A C     1 
ATOM   1328 O  O     . PHE A 1 175 ? 80.899 -10.983 6.152   1.00 21.74 ? 172 PHE A O     1 
ATOM   1329 C  CB    . PHE A 1 175 ? 81.254 -8.322  8.116   1.00 20.67 ? 172 PHE A CB    1 
ATOM   1330 C  CG    . PHE A 1 175 ? 81.808 -6.972  7.764   1.00 32.61 ? 172 PHE A CG    1 
ATOM   1331 C  CD1   . PHE A 1 175 ? 82.400 -6.762  6.524   1.00 37.58 ? 172 PHE A CD1   1 
ATOM   1332 C  CD2   . PHE A 1 175 ? 81.734 -5.913  8.653   1.00 34.07 ? 172 PHE A CD2   1 
ATOM   1333 C  CE1   . PHE A 1 175 ? 82.911 -5.522  6.179   1.00 36.19 ? 172 PHE A CE1   1 
ATOM   1334 C  CE2   . PHE A 1 175 ? 82.247 -4.663  8.313   1.00 37.27 ? 172 PHE A CE2   1 
ATOM   1335 C  CZ    . PHE A 1 175 ? 82.835 -4.472  7.073   1.00 39.42 ? 172 PHE A CZ    1 
ATOM   1336 N  N     . GLN A 1 176 ? 79.553 -11.022 7.955   1.00 20.23 ? 173 GLN A N     1 
ATOM   1337 C  CA    . GLN A 1 176 ? 79.440 -12.490 7.953   1.00 16.30 ? 173 GLN A CA    1 
ATOM   1338 C  C     . GLN A 1 176 ? 78.870 -12.973 6.629   1.00 22.18 ? 173 GLN A C     1 
ATOM   1339 O  O     . GLN A 1 176 ? 79.351 -13.941 6.041   1.00 22.70 ? 173 GLN A O     1 
ATOM   1340 C  CB    . GLN A 1 176 ? 78.567 -12.990 9.112   1.00 20.27 ? 173 GLN A CB    1 
ATOM   1341 C  CG    . GLN A 1 176 ? 79.195 -12.833 10.498  1.00 22.31 ? 173 GLN A CG    1 
ATOM   1342 C  CD    . GLN A 1 176 ? 78.395 -13.523 11.595  1.00 22.72 ? 173 GLN A CD    1 
ATOM   1343 O  OE1   . GLN A 1 176 ? 77.285 -13.999 11.372  1.00 24.29 ? 173 GLN A OE1   1 
ATOM   1344 N  NE2   . GLN A 1 176 ? 78.971 -13.585 12.793  1.00 29.66 ? 173 GLN A NE2   1 
ATOM   1345 N  N     . TRP A 1 177 ? 77.844 -12.271 6.160   1.00 17.31 ? 174 TRP A N     1 
ATOM   1346 C  CA    . TRP A 1 177 ? 77.197 -12.609 4.907   1.00 17.40 ? 174 TRP A CA    1 
ATOM   1347 C  C     . TRP A 1 177 ? 78.173 -12.525 3.738   1.00 19.20 ? 174 TRP A C     1 
ATOM   1348 O  O     . TRP A 1 177 ? 78.312 -13.463 2.951   1.00 22.72 ? 174 TRP A O     1 
ATOM   1349 C  CB    . TRP A 1 177 ? 76.000 -11.673 4.675   1.00 12.99 ? 174 TRP A CB    1 
ATOM   1350 C  CG    . TRP A 1 177 ? 75.344 -11.840 3.342   1.00 15.62 ? 174 TRP A CG    1 
ATOM   1351 C  CD1   . TRP A 1 177 ? 75.475 -11.019 2.262   1.00 13.65 ? 174 TRP A CD1   1 
ATOM   1352 C  CD2   . TRP A 1 177 ? 74.447 -12.893 2.939   1.00 13.40 ? 174 TRP A CD2   1 
ATOM   1353 N  NE1   . TRP A 1 177 ? 74.726 -11.487 1.218   1.00 15.16 ? 174 TRP A NE1   1 
ATOM   1354 C  CE2   . TRP A 1 177 ? 74.075 -12.628 1.606   1.00 14.22 ? 174 TRP A CE2   1 
ATOM   1355 C  CE3   . TRP A 1 177 ? 73.921 -14.021 3.576   1.00 16.31 ? 174 TRP A CE3   1 
ATOM   1356 C  CZ2   . TRP A 1 177 ? 73.201 -13.450 0.895   1.00 13.84 ? 174 TRP A CZ2   1 
ATOM   1357 C  CZ3   . TRP A 1 177 ? 73.050 -14.846 2.866   1.00 15.26 ? 174 TRP A CZ3   1 
ATOM   1358 C  CH2   . TRP A 1 177 ? 72.696 -14.554 1.540   1.00 17.85 ? 174 TRP A CH2   1 
ATOM   1359 N  N     . LEU A 1 178 ? 78.848 -11.392 3.632   1.00 17.63 ? 175 LEU A N     1 
ATOM   1360 C  CA    . LEU A 1 178 ? 79.735 -11.156 2.508   1.00 16.02 ? 175 LEU A CA    1 
ATOM   1361 C  C     . LEU A 1 178 ? 80.935 -12.106 2.555   1.00 22.89 ? 175 LEU A C     1 
ATOM   1362 O  O     . LEU A 1 178 ? 81.386 -12.591 1.516   1.00 25.87 ? 175 LEU A O     1 
ATOM   1363 C  CB    . LEU A 1 178 ? 80.200 -9.701  2.496   1.00 19.66 ? 175 LEU A CB    1 
ATOM   1364 C  CG    . LEU A 1 178 ? 79.099 -8.682  2.195   1.00 20.14 ? 175 LEU A CG    1 
ATOM   1365 C  CD1   . LEU A 1 178 ? 79.662 -7.280  2.313   1.00 21.36 ? 175 LEU A CD1   1 
ATOM   1366 C  CD2   . LEU A 1 178 ? 78.512 -8.918  0.797   1.00 18.90 ? 175 LEU A CD2   1 
ATOM   1367 N  N     . ASP A 1 179 ? 81.421 -12.377 3.764   1.00 24.93 ? 176 ASP A N     1 
ATOM   1368 C  CA    . ASP A 1 179 ? 82.571 -13.267 3.960   1.00 29.88 ? 176 ASP A CA    1 
ATOM   1369 C  C     . ASP A 1 179 ? 82.279 -14.679 3.487   1.00 31.84 ? 176 ASP A C     1 
ATOM   1370 O  O     . ASP A 1 179 ? 83.188 -15.413 3.100   1.00 33.54 ? 176 ASP A O     1 
ATOM   1371 C  CB    . ASP A 1 179 ? 82.993 -13.305 5.434   1.00 28.63 ? 176 ASP A CB    1 
ATOM   1372 C  CG    . ASP A 1 179 ? 83.661 -12.025 5.885   1.00 38.85 ? 176 ASP A CG    1 
ATOM   1373 O  OD1   . ASP A 1 179 ? 84.074 -11.228 5.017   1.00 40.76 ? 176 ASP A OD1   1 
ATOM   1374 O  OD2   . ASP A 1 179 ? 83.765 -11.807 7.113   1.00 46.47 ? 176 ASP A OD2   1 
ATOM   1375 N  N     . SER A 1 180 ? 81.006 -15.050 3.522   1.00 28.51 ? 177 SER A N     1 
ATOM   1376 C  CA    A SER A 1 180 ? 80.590 -16.389 3.130   0.51 29.36 ? 177 SER A CA    1 
ATOM   1377 C  CA    B SER A 1 180 ? 80.576 -16.386 3.131   0.49 29.36 ? 177 SER A CA    1 
ATOM   1378 C  C     . SER A 1 180 ? 80.180 -16.446 1.666   1.00 31.31 ? 177 SER A C     1 
ATOM   1379 O  O     . SER A 1 180 ? 79.972 -17.528 1.112   1.00 37.62 ? 177 SER A O     1 
ATOM   1380 C  CB    A SER A 1 180 ? 79.436 -16.856 4.013   0.51 27.85 ? 177 SER A CB    1 
ATOM   1381 C  CB    B SER A 1 180 ? 79.398 -16.837 3.993   0.49 27.85 ? 177 SER A CB    1 
ATOM   1382 O  OG    A SER A 1 180 ? 79.820 -16.837 5.375   0.51 27.67 ? 177 SER A OG    1 
ATOM   1383 O  OG    B SER A 1 180 ? 78.789 -17.992 3.443   0.49 34.45 ? 177 SER A OG    1 
ATOM   1384 N  N     . LEU A 1 181 ? 80.054 -15.280 1.044   1.00 26.09 ? 178 LEU A N     1 
ATOM   1385 C  CA    . LEU A 1 181 ? 79.610 -15.237 -0.337  1.00 24.26 ? 178 LEU A CA    1 
ATOM   1386 C  C     . LEU A 1 181 ? 80.612 -15.903 -1.242  1.00 39.76 ? 178 LEU A C     1 
ATOM   1387 O  O     . LEU A 1 181 ? 81.815 -15.832 -1.020  1.00 40.58 ? 178 LEU A O     1 
ATOM   1388 C  CB    . LEU A 1 181 ? 79.364 -13.801 -0.810  1.00 30.85 ? 178 LEU A CB    1 
ATOM   1389 C  CG    . LEU A 1 181 ? 77.918 -13.300 -0.764  1.00 28.69 ? 178 LEU A CG    1 
ATOM   1390 C  CD1   . LEU A 1 181 ? 77.815 -12.023 -1.592  1.00 21.12 ? 178 LEU A CD1   1 
ATOM   1391 C  CD2   . LEU A 1 181 ? 76.922 -14.358 -1.258  1.00 25.29 ? 178 LEU A CD2   1 
ATOM   1392 N  N     . GLN A 1 182 ? 80.095 -16.564 -2.266  1.00 41.94 ? 179 GLN A N     1 
ATOM   1393 C  CA    . GLN A 1 182 ? 80.945 -17.183 -3.267  1.00 52.08 ? 179 GLN A CA    1 
ATOM   1394 C  C     . GLN A 1 182 ? 80.692 -16.616 -4.628  1.00 54.29 ? 179 GLN A C     1 
ATOM   1395 O  O     . GLN A 1 182 ? 79.913 -17.160 -5.417  1.00 52.19 ? 179 GLN A O     1 
ATOM   1396 C  CB    . GLN A 1 182 ? 80.756 -18.684 -3.302  1.00 55.36 ? 179 GLN A CB    1 
ATOM   1397 C  CG    . GLN A 1 182 ? 82.041 -19.383 -2.899  1.00 59.47 ? 179 GLN A CG    1 
ATOM   1398 C  CD    . GLN A 1 182 ? 83.086 -19.495 -3.965  1.00 65.62 ? 179 GLN A CD    1 
ATOM   1399 O  OE1   . GLN A 1 182 ? 82.771 -19.355 -5.140  1.00 68.66 ? 179 GLN A OE1   1 
ATOM   1400 N  NE2   . GLN A 1 182 ? 84.374 -19.647 -3.553  1.00 62.88 ? 179 GLN A NE2   1 
ATOM   1401 N  N     . ILE A 1 183 ? 81.428 -15.544 -4.897  1.00 54.85 ? 180 ILE A N     1 
ATOM   1402 C  CA    . ILE A 1 183 ? 81.207 -14.678 -6.040  1.00 56.96 ? 180 ILE A CA    1 
ATOM   1403 C  C     . ILE A 1 183 ? 81.691 -15.246 -7.360  1.00 60.02 ? 180 ILE A C     1 
ATOM   1404 O  O     . ILE A 1 183 ? 81.394 -14.688 -8.401  1.00 56.31 ? 180 ILE A O     1 
ATOM   1405 C  CB    . ILE A 1 183 ? 81.884 -13.290 -5.828  1.00 52.61 ? 180 ILE A CB    1 
ATOM   1406 C  CG1   . ILE A 1 183 ? 83.335 -13.445 -5.361  1.00 56.65 ? 180 ILE A CG1   1 
ATOM   1407 C  CG2   . ILE A 1 183 ? 81.100 -12.457 -4.827  1.00 48.88 ? 180 ILE A CG2   1 
ATOM   1408 C  CD1   . ILE A 1 183 ? 84.341 -13.531 -6.494  1.00 56.93 ? 180 ILE A CD1   1 
ATOM   1409 N  N     . ASP A 1 184 ? 82.444 -16.338 -7.325  1.00 63.10 ? 181 ASP A N     1 
ATOM   1410 C  CA    . ASP A 1 184 ? 82.815 -17.034 -8.551  1.00 62.59 ? 181 ASP A CA    1 
ATOM   1411 C  C     . ASP A 1 184 ? 81.602 -17.658 -9.254  1.00 60.52 ? 181 ASP A C     1 
ATOM   1412 O  O     . ASP A 1 184 ? 81.642 -17.872 -10.461 1.00 60.49 ? 181 ASP A O     1 
ATOM   1413 C  CB    . ASP A 1 184 ? 83.872 -18.098 -8.246  1.00 64.34 ? 181 ASP A CB    1 
ATOM   1414 C  CG    . ASP A 1 184 ? 84.903 -17.609 -7.263  1.00 73.88 ? 181 ASP A CG    1 
ATOM   1415 O  OD1   . ASP A 1 184 ? 85.833 -16.894 -7.686  1.00 77.30 ? 181 ASP A OD1   1 
ATOM   1416 O  OD2   . ASP A 1 184 ? 84.799 -17.910 -6.072  1.00 72.02 ? 181 ASP A OD2   1 
ATOM   1417 N  N     . ASN A 1 185 ? 80.543 -17.981 -8.510  1.00 57.85 ? 182 ASN A N     1 
ATOM   1418 C  CA    . ASN A 1 185 ? 79.343 -18.585 -9.101  1.00 51.91 ? 182 ASN A CA    1 
ATOM   1419 C  C     . ASN A 1 185 ? 78.332 -17.524 -9.581  1.00 50.58 ? 182 ASN A C     1 
ATOM   1420 O  O     . ASN A 1 185 ? 77.697 -16.853 -8.765  1.00 48.38 ? 182 ASN A O     1 
ATOM   1421 C  CB    . ASN A 1 185 ? 78.682 -19.527 -8.082  1.00 46.62 ? 182 ASN A CB    1 
ATOM   1422 C  CG    . ASN A 1 185 ? 77.618 -20.421 -8.702  1.00 43.78 ? 182 ASN A CG    1 
ATOM   1423 O  OD1   . ASN A 1 185 ? 77.231 -20.238 -9.857  1.00 42.41 ? 182 ASN A OD1   1 
ATOM   1424 N  ND2   . ASN A 1 185 ? 77.142 -21.400 -7.932  1.00 42.44 ? 182 ASN A ND2   1 
ATOM   1425 N  N     . LEU A 1 186 ? 78.156 -17.387 -10.896 1.00 48.51 ? 183 LEU A N     1 
ATOM   1426 C  CA    . LEU A 1 186 ? 77.234 -16.374 -11.429 1.00 45.11 ? 183 LEU A CA    1 
ATOM   1427 C  C     . LEU A 1 186 ? 75.758 -16.784 -11.333 1.00 40.48 ? 183 LEU A C     1 
ATOM   1428 O  O     . LEU A 1 186 ? 74.863 -15.998 -11.660 1.00 42.82 ? 183 LEU A O     1 
ATOM   1429 C  CB    . LEU A 1 186 ? 77.577 -16.035 -12.886 1.00 43.93 ? 183 LEU A CB    1 
ATOM   1430 C  CG    . LEU A 1 186 ? 78.492 -14.819 -13.075 1.00 47.54 ? 183 LEU A CG    1 
ATOM   1431 C  CD1   . LEU A 1 186 ? 79.955 -15.243 -13.088 1.00 51.18 ? 183 LEU A CD1   1 
ATOM   1432 C  CD2   . LEU A 1 186 ? 78.143 -14.039 -14.335 1.00 46.74 ? 183 LEU A CD2   1 
ATOM   1433 N  N     . THR A 1 187 ? 75.498 -18.007 -10.883 1.00 39.35 ? 184 THR A N     1 
ATOM   1434 C  CA    . THR A 1 187 ? 74.117 -18.428 -10.674 1.00 37.05 ? 184 THR A CA    1 
ATOM   1435 C  C     . THR A 1 187 ? 73.803 -18.761 -9.213  1.00 33.69 ? 184 THR A C     1 
ATOM   1436 O  O     . THR A 1 187 ? 72.741 -19.318 -8.927  1.00 37.63 ? 184 THR A O     1 
ATOM   1437 C  CB    . THR A 1 187 ? 73.747 -19.652 -11.546 1.00 42.09 ? 184 THR A CB    1 
ATOM   1438 O  OG1   . THR A 1 187 ? 72.337 -19.888 -11.452 1.00 48.96 ? 184 THR A OG1   1 
ATOM   1439 C  CG2   . THR A 1 187 ? 74.486 -20.903 -11.093 1.00 38.48 ? 184 THR A CG2   1 
ATOM   1440 N  N     . SER A 1 188 ? 74.712 -18.434 -8.293  1.00 31.38 ? 185 SER A N     1 
ATOM   1441 C  CA    . SER A 1 188 ? 74.417 -18.579 -6.863  1.00 24.95 ? 185 SER A CA    1 
ATOM   1442 C  C     . SER A 1 188 ? 73.277 -17.651 -6.460  1.00 19.24 ? 185 SER A C     1 
ATOM   1443 O  O     . SER A 1 188 ? 73.387 -16.439 -6.607  1.00 19.12 ? 185 SER A O     1 
ATOM   1444 C  CB    . SER A 1 188 ? 75.637 -18.271 -6.004  1.00 29.87 ? 185 SER A CB    1 
ATOM   1445 O  OG    . SER A 1 188 ? 75.286 -18.266 -4.626  1.00 26.67 ? 185 SER A OG    1 
ATOM   1446 N  N     . PRO A 1 189 ? 72.179 -18.220 -5.960  1.00 19.28 ? 186 PRO A N     1 
ATOM   1447 C  CA    . PRO A 1 189 ? 71.041 -17.392 -5.531  1.00 15.53 ? 186 PRO A CA    1 
ATOM   1448 C  C     . PRO A 1 189 ? 71.420 -16.347 -4.490  1.00 17.71 ? 186 PRO A C     1 
ATOM   1449 O  O     . PRO A 1 189 ? 70.903 -15.233 -4.537  1.00 17.12 ? 186 PRO A O     1 
ATOM   1450 C  CB    . PRO A 1 189 ? 70.073 -18.416 -4.938  1.00 17.12 ? 186 PRO A CB    1 
ATOM   1451 C  CG    . PRO A 1 189 ? 70.403 -19.699 -5.676  1.00 19.56 ? 186 PRO A CG    1 
ATOM   1452 C  CD    . PRO A 1 189 ? 71.891 -19.661 -5.851  1.00 19.82 ? 186 PRO A CD    1 
ATOM   1453 N  N     . ASP A 1 190 ? 72.294 -16.701 -3.551  1.00 14.93 ? 187 ASP A N     1 
ATOM   1454 C  CA    . ASP A 1 190 ? 72.687 -15.768 -2.509  1.00 13.60 ? 187 ASP A CA    1 
ATOM   1455 C  C     . ASP A 1 190 ? 73.418 -14.583 -3.125  1.00 14.07 ? 187 ASP A C     1 
ATOM   1456 O  O     . ASP A 1 190 ? 73.205 -13.442 -2.728  1.00 14.60 ? 187 ASP A O     1 
ATOM   1457 C  CB    . ASP A 1 190 ? 73.575 -16.449 -1.464  1.00 16.37 ? 187 ASP A CB    1 
ATOM   1458 C  CG    . ASP A 1 190 ? 72.798 -17.398 -0.561  1.00 17.75 ? 187 ASP A CG    1 
ATOM   1459 O  OD1   . ASP A 1 190 ? 71.551 -17.378 -0.569  1.00 14.33 ? 187 ASP A OD1   1 
ATOM   1460 O  OD2   . ASP A 1 190 ? 73.442 -18.176 0.164   1.00 17.40 ? 187 ASP A OD2   1 
ATOM   1461 N  N     . LEU A 1 191 ? 74.283 -14.865 -4.094  1.00 14.15 ? 188 LEU A N     1 
ATOM   1462 C  CA    . LEU A 1 191 ? 75.007 -13.797 -4.770  1.00 14.01 ? 188 LEU A CA    1 
ATOM   1463 C  C     . LEU A 1 191 ? 74.016 -12.918 -5.516  1.00 14.79 ? 188 LEU A C     1 
ATOM   1464 O  O     . LEU A 1 191 ? 74.125 -11.690 -5.475  1.00 14.09 ? 188 LEU A O     1 
ATOM   1465 C  CB    . LEU A 1 191 ? 76.068 -14.356 -5.732  1.00 18.39 ? 188 LEU A CB    1 
ATOM   1466 C  CG    . LEU A 1 191 ? 76.830 -13.297 -6.544  1.00 21.70 ? 188 LEU A CG    1 
ATOM   1467 C  CD1   . LEU A 1 191 ? 77.468 -12.254 -5.654  1.00 18.91 ? 188 LEU A CD1   1 
ATOM   1468 C  CD2   . LEU A 1 191 ? 77.884 -13.963 -7.422  1.00 23.37 ? 188 LEU A CD2   1 
ATOM   1469 N  N     . GLN A 1 192 ? 73.054 -13.550 -6.184  1.00 13.89 ? 189 GLN A N     1 
ATOM   1470 C  CA    . GLN A 1 192 ? 72.048 -12.823 -6.957  1.00 16.94 ? 189 GLN A CA    1 
ATOM   1471 C  C     . GLN A 1 192 ? 71.245 -11.888 -6.046  1.00 16.20 ? 189 GLN A C     1 
ATOM   1472 O  O     . GLN A 1 192 ? 71.014 -10.725 -6.391  1.00 13.55 ? 189 GLN A O     1 
ATOM   1473 C  CB    . GLN A 1 192 ? 71.138 -13.796 -7.701  1.00 15.67 ? 189 GLN A CB    1 
ATOM   1474 C  CG    . GLN A 1 192 ? 71.876 -14.484 -8.853  1.00 18.43 ? 189 GLN A CG    1 
ATOM   1475 C  CD    . GLN A 1 192 ? 71.108 -15.620 -9.489  1.00 25.88 ? 189 GLN A CD    1 
ATOM   1476 O  OE1   . GLN A 1 192 ? 70.129 -16.121 -8.937  1.00 33.63 ? 189 GLN A OE1   1 
ATOM   1477 N  NE2   . GLN A 1 192 ? 71.547 -16.028 -10.672 1.00 32.61 ? 189 GLN A NE2   1 
ATOM   1478 N  N     . LEU A 1 193 ? 70.844 -12.377 -4.874  1.00 13.42 ? 190 LEU A N     1 
ATOM   1479 C  CA    . LEU A 1 193 ? 70.137 -11.528 -3.914  1.00 10.64 ? 190 LEU A CA    1 
ATOM   1480 C  C     . LEU A 1 193 ? 70.980 -10.332 -3.476  1.00 12.23 ? 190 LEU A C     1 
ATOM   1481 O  O     . LEU A 1 193 ? 70.469 -9.222  -3.303  1.00 15.25 ? 190 LEU A O     1 
ATOM   1482 C  CB    . LEU A 1 193 ? 69.725 -12.330 -2.687  1.00 10.64 ? 190 LEU A CB    1 
ATOM   1483 C  CG    . LEU A 1 193 ? 68.629 -13.371 -2.840  1.00 11.43 ? 190 LEU A CG    1 
ATOM   1484 C  CD1   . LEU A 1 193 ? 68.291 -13.942 -1.469  1.00 15.84 ? 190 LEU A CD1   1 
ATOM   1485 C  CD2   . LEU A 1 193 ? 67.400 -12.783 -3.489  1.00 12.79 ? 190 LEU A CD2   1 
ATOM   1486 N  N     . THR A 1 194 ? 72.271 -10.583 -3.259  1.00 14.47 ? 191 THR A N     1 
ATOM   1487 C  CA    . THR A 1 194 ? 73.186 -9.552  -2.802  1.00 12.94 ? 191 THR A CA    1 
ATOM   1488 C  C     . THR A 1 194 ? 73.316 -8.442  -3.830  1.00 15.02 ? 191 THR A C     1 
ATOM   1489 O  O     . THR A 1 194 ? 73.320 -7.270  -3.477  1.00 15.40 ? 191 THR A O     1 
ATOM   1490 C  CB    . THR A 1 194 ? 74.581 -10.111 -2.529  1.00 14.40 ? 191 THR A CB    1 
ATOM   1491 O  OG1   . THR A 1 194 ? 74.485 -11.165 -1.565  1.00 12.94 ? 191 THR A OG1   1 
ATOM   1492 C  CG2   . THR A 1 194 ? 75.480 -9.019  -1.963  1.00 13.15 ? 191 THR A CG2   1 
ATOM   1493 N  N     . VAL A 1 195 ? 73.438 -8.831  -5.094  1.00 15.89 ? 192 VAL A N     1 
ATOM   1494 C  CA    . VAL A 1 195 ? 73.543 -7.848  -6.158  1.00 15.71 ? 192 VAL A CA    1 
ATOM   1495 C  C     . VAL A 1 195 ? 72.198 -7.131  -6.251  1.00 14.41 ? 192 VAL A C     1 
ATOM   1496 O  O     . VAL A 1 195 ? 72.149 -5.908  -6.450  1.00 14.09 ? 192 VAL A O     1 
ATOM   1497 C  CB    . VAL A 1 195 ? 73.923 -8.498  -7.488  1.00 15.87 ? 192 VAL A CB    1 
ATOM   1498 C  CG1   . VAL A 1 195 ? 73.761 -7.504  -8.644  1.00 16.05 ? 192 VAL A CG1   1 
ATOM   1499 C  CG2   . VAL A 1 195 ? 75.348 -9.041  -7.404  1.00 15.92 ? 192 VAL A CG2   1 
ATOM   1500 N  N     . GLY A 1 196 ? 71.115 -7.879  -6.073  1.00 11.04 ? 193 GLY A N     1 
ATOM   1501 C  CA    . GLY A 1 196 ? 69.789 -7.268  -6.045  1.00 14.23 ? 193 GLY A CA    1 
ATOM   1502 C  C     . GLY A 1 196 ? 69.754 -6.162  -5.001  1.00 13.76 ? 193 GLY A C     1 
ATOM   1503 O  O     . GLY A 1 196 ? 69.241 -5.064  -5.252  1.00 14.98 ? 193 GLY A O     1 
ATOM   1504 N  N     . ALA A 1 197 ? 70.310 -6.441  -3.825  1.00 11.96 ? 194 ALA A N     1 
ATOM   1505 C  CA    . ALA A 1 197 ? 70.343 -5.470  -2.735  1.00 9.80  ? 194 ALA A CA    1 
ATOM   1506 C  C     . ALA A 1 197 ? 71.183 -4.237  -3.083  1.00 14.08 ? 194 ALA A C     1 
ATOM   1507 O  O     . ALA A 1 197 ? 70.834 -3.131  -2.695  1.00 14.22 ? 194 ALA A O     1 
ATOM   1508 C  CB    . ALA A 1 197 ? 70.854 -6.124  -1.453  1.00 13.77 ? 194 ALA A CB    1 
ATOM   1509 N  N     . VAL A 1 198 ? 72.278 -4.437  -3.820  1.00 13.02 ? 195 VAL A N     1 
ATOM   1510 C  CA    . VAL A 1 198 ? 73.084 -3.312  -4.311  1.00 10.73 ? 195 VAL A CA    1 
ATOM   1511 C  C     . VAL A 1 198 ? 72.250 -2.383  -5.195  1.00 16.67 ? 195 VAL A C     1 
ATOM   1512 O  O     . VAL A 1 198 ? 72.297 -1.153  -5.045  1.00 16.69 ? 195 VAL A O     1 
ATOM   1513 C  CB    . VAL A 1 198 ? 74.296 -3.791  -5.124  1.00 14.18 ? 195 VAL A CB    1 
ATOM   1514 C  CG1   . VAL A 1 198 ? 75.094 -2.588  -5.646  1.00 17.69 ? 195 VAL A CG1   1 
ATOM   1515 C  CG2   . VAL A 1 198 ? 75.174 -4.662  -4.270  1.00 17.14 ? 195 VAL A CG2   1 
ATOM   1516 N  N     . ILE A 1 199 ? 71.471 -2.982  -6.090  1.00 13.65 ? 196 ILE A N     1 
ATOM   1517 C  CA    . ILE A 1 199 ? 70.613 -2.222  -6.997  1.00 14.43 ? 196 ILE A CA    1 
ATOM   1518 C  C     . ILE A 1 199 ? 69.528 -1.478  -6.210  1.00 15.52 ? 196 ILE A C     1 
ATOM   1519 O  O     . ILE A 1 199 ? 69.246 -0.324  -6.499  1.00 14.87 ? 196 ILE A O     1 
ATOM   1520 C  CB    . ILE A 1 199 ? 69.974 -3.127  -8.067  1.00 14.12 ? 196 ILE A CB    1 
ATOM   1521 C  CG1   . ILE A 1 199 ? 71.061 -3.616  -9.037  1.00 16.62 ? 196 ILE A CG1   1 
ATOM   1522 C  CG2   . ILE A 1 199 ? 68.895 -2.357  -8.823  1.00 12.64 ? 196 ILE A CG2   1 
ATOM   1523 C  CD1   . ILE A 1 199 ? 70.631 -4.739  -9.967  1.00 17.60 ? 196 ILE A CD1   1 
ATOM   1524 N  N     . VAL A 1 200 ? 68.959 -2.122  -5.191  1.00 13.24 ? 197 VAL A N     1 
ATOM   1525 C  CA    . VAL A 1 200 ? 67.915 -1.477  -4.405  1.00 12.27 ? 197 VAL A CA    1 
ATOM   1526 C  C     . VAL A 1 200 ? 68.482 -0.319  -3.566  1.00 14.80 ? 197 VAL A C     1 
ATOM   1527 O  O     . VAL A 1 200 ? 67.796 0.686   -3.367  1.00 13.00 ? 197 VAL A O     1 
ATOM   1528 C  CB    . VAL A 1 200 ? 67.178 -2.511  -3.528  1.00 11.18 ? 197 VAL A CB    1 
ATOM   1529 C  CG1   . VAL A 1 200 ? 66.165 -1.818  -2.604  1.00 13.20 ? 197 VAL A CG1   1 
ATOM   1530 C  CG2   . VAL A 1 200 ? 66.487 -3.516  -4.430  1.00 13.03 ? 197 VAL A CG2   1 
ATOM   1531 N  N     . GLU A 1 201 ? 69.738 -0.419  -3.124  1.00 11.74 ? 198 GLU A N     1 
ATOM   1532 C  CA    . GLU A 1 201 ? 70.383 0.726   -2.466  1.00 12.05 ? 198 GLU A CA    1 
ATOM   1533 C  C     . GLU A 1 201 ? 70.386 1.897   -3.441  1.00 15.74 ? 198 GLU A C     1 
ATOM   1534 O  O     . GLU A 1 201 ? 70.106 3.044   -3.062  1.00 15.51 ? 198 GLU A O     1 
ATOM   1535 C  CB    . GLU A 1 201 ? 71.824 0.408   -2.023  1.00 14.74 ? 198 GLU A CB    1 
ATOM   1536 C  CG    . GLU A 1 201 ? 71.969 -0.617  -0.886  1.00 16.50 ? 198 GLU A CG    1 
ATOM   1537 C  CD    . GLU A 1 201 ? 71.895 -0.037  0.520   1.00 14.15 ? 198 GLU A CD    1 
ATOM   1538 O  OE1   . GLU A 1 201 ? 71.565 1.163   0.704   1.00 17.68 ? 198 GLU A OE1   1 
ATOM   1539 O  OE2   . GLU A 1 201 ? 72.142 -0.795  1.481   1.00 15.19 ? 198 GLU A OE2   1 
ATOM   1540 N  N     . GLU A 1 202 ? 70.684 1.596   -4.701  1.00 14.10 ? 199 GLU A N     1 
ATOM   1541 C  CA    . GLU A 1 202 ? 70.809 2.639   -5.719  1.00 14.53 ? 199 GLU A CA    1 
ATOM   1542 C  C     . GLU A 1 202 ? 69.430 3.240   -6.000  1.00 16.37 ? 199 GLU A C     1 
ATOM   1543 O  O     . GLU A 1 202 ? 69.271 4.465   -6.020  1.00 16.60 ? 199 GLU A O     1 
ATOM   1544 C  CB    . GLU A 1 202 ? 71.456 2.072   -6.993  1.00 15.40 ? 199 GLU A CB    1 
ATOM   1545 C  CG    . GLU A 1 202 ? 72.938 1.761   -6.802  1.00 15.47 ? 199 GLU A CG    1 
ATOM   1546 C  CD    . GLU A 1 202 ? 73.512 0.832   -7.862  1.00 20.15 ? 199 GLU A CD    1 
ATOM   1547 O  OE1   . GLU A 1 202 ? 74.730 0.551   -7.793  1.00 26.69 ? 199 GLU A OE1   1 
ATOM   1548 O  OE2   . GLU A 1 202 ? 72.758 0.377   -8.746  1.00 24.84 ? 199 GLU A OE2   1 
ATOM   1549 N  N     . MET A 1 203 ? 68.435 2.367   -6.168  1.00 14.83 ? 200 MET A N     1 
ATOM   1550 C  CA    . MET A 1 203 ? 67.036 2.785   -6.339  1.00 14.93 ? 200 MET A CA    1 
ATOM   1551 C  C     . MET A 1 203 ? 66.574 3.670   -5.204  1.00 14.88 ? 200 MET A C     1 
ATOM   1552 O  O     . MET A 1 203 ? 65.980 4.734   -5.432  1.00 14.34 ? 200 MET A O     1 
ATOM   1553 C  CB    . MET A 1 203 ? 66.106 1.576   -6.427  1.00 14.16 ? 200 MET A CB    1 
ATOM   1554 C  CG    A MET A 1 203 ? 66.376 0.629   -7.574  0.52 15.11 ? 200 MET A CG    1 
ATOM   1555 C  CG    B MET A 1 203 ? 64.692 1.936   -6.769  0.48 13.50 ? 200 MET A CG    1 
ATOM   1556 S  SD    A MET A 1 203 ? 65.152 -0.695  -7.593  0.52 15.51 ? 200 MET A SD    1 
ATOM   1557 S  SD    B MET A 1 203 ? 63.603 0.508   -6.907  0.48 18.83 ? 200 MET A SD    1 
ATOM   1558 C  CE    A MET A 1 203 ? 63.675 0.265   -7.901  0.52 11.74 ? 200 MET A CE    1 
ATOM   1559 C  CE    B MET A 1 203 ? 64.227 -0.328  -8.349  0.48 17.04 ? 200 MET A CE    1 
ATOM   1560 N  N     . ARG A 1 204 ? 66.844 3.246   -3.974  1.00 10.67 ? 201 ARG A N     1 
ATOM   1561 C  CA    . ARG A 1 204 ? 66.368 3.993   -2.810  1.00 11.80 ? 201 ARG A CA    1 
ATOM   1562 C  C     . ARG A 1 204 ? 67.088 5.336   -2.677  1.00 14.51 ? 201 ARG A C     1 
ATOM   1563 O  O     . ARG A 1 204 ? 66.489 6.319   -2.265  1.00 14.12 ? 201 ARG A O     1 
ATOM   1564 C  CB    . ARG A 1 204 ? 66.519 3.171   -1.529  1.00 13.46 ? 201 ARG A CB    1 
ATOM   1565 C  CG    . ARG A 1 204 ? 65.553 1.977   -1.483  1.00 15.26 ? 201 ARG A CG    1 
ATOM   1566 C  CD    . ARG A 1 204 ? 65.672 1.180   -0.203  1.00 12.55 ? 201 ARG A CD    1 
ATOM   1567 N  NE    . ARG A 1 204 ? 65.691 2.034   0.973   1.00 13.20 ? 201 ARG A NE    1 
ATOM   1568 C  CZ    . ARG A 1 204 ? 66.742 2.164   1.769   1.00 14.17 ? 201 ARG A CZ    1 
ATOM   1569 N  NH1   . ARG A 1 204 ? 66.699 2.987   2.808   1.00 12.55 ? 201 ARG A NH1   1 
ATOM   1570 N  NH2   . ARG A 1 204 ? 67.847 1.470   1.522   1.00 17.78 ? 201 ARG A NH2   1 
ATOM   1571 N  N     . ALA A 1 205 ? 68.367 5.365   -3.041  1.00 14.00 ? 202 ALA A N     1 
ATOM   1572 C  CA    . ALA A 1 205 ? 69.127 6.611   -3.050  1.00 16.32 ? 202 ALA A CA    1 
ATOM   1573 C  C     . ALA A 1 205 ? 68.528 7.569   -4.083  1.00 11.44 ? 202 ALA A C     1 
ATOM   1574 O  O     . ALA A 1 205 ? 68.409 8.781   -3.831  1.00 15.58 ? 202 ALA A O     1 
ATOM   1575 C  CB    . ALA A 1 205 ? 70.606 6.331   -3.351  1.00 13.56 ? 202 ALA A CB    1 
ATOM   1576 N  N     . ALA A 1 206 ? 68.132 7.026   -5.234  1.00 11.38 ? 203 ALA A N     1 
ATOM   1577 C  CA    . ALA A 1 206 ? 67.556 7.847   -6.294  1.00 14.00 ? 203 ALA A CA    1 
ATOM   1578 C  C     . ALA A 1 206 ? 66.231 8.420   -5.832  1.00 13.77 ? 203 ALA A C     1 
ATOM   1579 O  O     . ALA A 1 206 ? 65.928 9.596   -6.065  1.00 15.44 ? 203 ALA A O     1 
ATOM   1580 C  CB    . ALA A 1 206 ? 67.380 7.044   -7.570  1.00 19.13 ? 203 ALA A CB    1 
ATOM   1581 N  N     . ILE A 1 207 ? 65.417 7.587   -5.188  1.00 10.76 ? 204 ILE A N     1 
ATOM   1582 C  CA    . ILE A 1 207 ? 64.133 8.087   -4.718  1.00 10.80 ? 204 ILE A CA    1 
ATOM   1583 C  C     . ILE A 1 207 ? 64.352 9.218   -3.738  1.00 13.73 ? 204 ILE A C     1 
ATOM   1584 O  O     . ILE A 1 207 ? 63.697 10.252  -3.836  1.00 12.18 ? 204 ILE A O     1 
ATOM   1585 C  CB    . ILE A 1 207 ? 63.298 6.973   -4.070  1.00 8.91  ? 204 ILE A CB    1 
ATOM   1586 C  CG1   . ILE A 1 207 ? 62.906 5.971   -5.146  1.00 11.32 ? 204 ILE A CG1   1 
ATOM   1587 C  CG2   . ILE A 1 207 ? 62.033 7.539   -3.359  1.00 8.99  ? 204 ILE A CG2   1 
ATOM   1588 C  CD1   . ILE A 1 207 ? 62.272 4.674   -4.575  1.00 13.35 ? 204 ILE A CD1   1 
ATOM   1589 N  N     . GLU A 1 208 ? 65.289 9.048   -2.809  1.00 12.69 ? 205 GLU A N     1 
ATOM   1590 C  CA    . GLU A 1 208 ? 65.463 10.070  -1.786  1.00 12.52 ? 205 GLU A CA    1 
ATOM   1591 C  C     . GLU A 1 208 ? 66.059 11.330  -2.398  1.00 14.05 ? 205 GLU A C     1 
ATOM   1592 O  O     . GLU A 1 208 ? 65.608 12.431  -2.098  1.00 14.59 ? 205 GLU A O     1 
ATOM   1593 C  CB    . GLU A 1 208 ? 66.340 9.578   -0.634  1.00 16.78 ? 205 GLU A CB    1 
ATOM   1594 C  CG    . GLU A 1 208 ? 66.524 10.668  0.437   1.00 15.49 ? 205 GLU A CG    1 
ATOM   1595 C  CD    . GLU A 1 208 ? 67.208 10.180  1.709   1.00 16.92 ? 205 GLU A CD    1 
ATOM   1596 O  OE1   . GLU A 1 208 ? 67.170 10.926  2.711   1.00 19.34 ? 205 GLU A OE1   1 
ATOM   1597 O  OE2   . GLU A 1 208 ? 67.776 9.064   1.715   1.00 18.68 ? 205 GLU A OE2   1 
ATOM   1598 N  N     . ARG A 1 209 ? 67.049 11.160  -3.278  1.00 15.08 ? 206 ARG A N     1 
ATOM   1599 C  CA    . ARG A 1 209 ? 67.675 12.311  -3.932  1.00 16.28 ? 206 ARG A CA    1 
ATOM   1600 C  C     . ARG A 1 209 ? 66.653 13.141  -4.695  1.00 14.30 ? 206 ARG A C     1 
ATOM   1601 O  O     . ARG A 1 209 ? 66.677 14.366  -4.620  1.00 16.42 ? 206 ARG A O     1 
ATOM   1602 C  CB    . ARG A 1 209 ? 68.802 11.883  -4.891  1.00 15.20 ? 206 ARG A CB    1 
ATOM   1603 C  CG    . ARG A 1 209 ? 69.572 13.093  -5.461  1.00 21.44 ? 206 ARG A CG    1 
ATOM   1604 C  CD    . ARG A 1 209 ? 70.607 12.730  -6.523  1.00 24.94 ? 206 ARG A CD    1 
ATOM   1605 N  NE    . ARG A 1 209 ? 70.030 12.566  -7.863  1.00 25.56 ? 206 ARG A NE    1 
ATOM   1606 C  CZ    . ARG A 1 209 ? 69.677 13.573  -8.665  1.00 24.74 ? 206 ARG A CZ    1 
ATOM   1607 N  NH1   . ARG A 1 209 ? 69.175 13.324  -9.870  1.00 22.29 ? 206 ARG A NH1   1 
ATOM   1608 N  NH2   . ARG A 1 209 ? 69.822 14.833  -8.269  1.00 22.33 ? 206 ARG A NH2   1 
ATOM   1609 N  N     . GLU A 1 210 ? 65.751 12.479  -5.418  1.00 12.31 ? 207 GLU A N     1 
ATOM   1610 C  CA    . GLU A 1 210 ? 64.922 13.163  -6.404  1.00 12.51 ? 207 GLU A CA    1 
ATOM   1611 C  C     . GLU A 1 210 ? 63.544 13.555  -5.878  1.00 11.39 ? 207 GLU A C     1 
ATOM   1612 O  O     . GLU A 1 210 ? 62.819 14.298  -6.546  1.00 10.86 ? 207 GLU A O     1 
ATOM   1613 C  CB    . GLU A 1 210 ? 64.786 12.299  -7.651  1.00 12.65 ? 207 GLU A CB    1 
ATOM   1614 C  CG    . GLU A 1 210 ? 66.119 11.959  -8.281  1.00 10.87 ? 207 GLU A CG    1 
ATOM   1615 C  CD    . GLU A 1 210 ? 65.980 11.129  -9.517  1.00 19.13 ? 207 GLU A CD    1 
ATOM   1616 O  OE1   . GLU A 1 210 ? 64.908 11.177  -10.156 1.00 18.16 ? 207 GLU A OE1   1 
ATOM   1617 O  OE2   . GLU A 1 210 ? 66.960 10.433  -9.858  1.00 22.94 ? 207 GLU A OE2   1 
ATOM   1618 N  N     . THR A 1 211 ? 63.182 13.091  -4.677  1.00 13.02 ? 208 THR A N     1 
ATOM   1619 C  CA    . THR A 1 211 ? 61.866 13.435  -4.135  1.00 9.27  ? 208 THR A CA    1 
ATOM   1620 C  C     . THR A 1 211 ? 61.950 13.949  -2.708  1.00 12.23 ? 208 THR A C     1 
ATOM   1621 O  O     . THR A 1 211 ? 61.035 14.622  -2.253  1.00 13.42 ? 208 THR A O     1 
ATOM   1622 C  CB    . THR A 1 211 ? 60.892 12.232  -4.142  1.00 13.13 ? 208 THR A CB    1 
ATOM   1623 O  OG1   . THR A 1 211 ? 61.306 11.287  -3.153  1.00 11.56 ? 208 THR A OG1   1 
ATOM   1624 C  CG2   . THR A 1 211 ? 60.822 11.571  -5.509  1.00 11.76 ? 208 THR A CG2   1 
ATOM   1625 N  N     . GLY A 1 212 ? 63.031 13.624  -1.998  1.00 12.59 ? 209 GLY A N     1 
ATOM   1626 C  CA    . GLY A 1 212 ? 63.133 13.936  -0.579  1.00 12.78 ? 209 GLY A CA    1 
ATOM   1627 C  C     . GLY A 1 212 ? 62.540 12.873  0.334   1.00 15.04 ? 209 GLY A C     1 
ATOM   1628 O  O     . GLY A 1 212 ? 62.615 13.000  1.557   1.00 17.29 ? 209 GLY A O     1 
ATOM   1629 N  N     . PHE A 1 213 ? 61.952 11.832  -0.254  1.00 13.62 ? 210 PHE A N     1 
ATOM   1630 C  CA    . PHE A 1 213 ? 61.263 10.792  0.520   1.00 11.41 ? 210 PHE A CA    1 
ATOM   1631 C  C     . PHE A 1 213 ? 62.163 9.592   0.809   1.00 13.32 ? 210 PHE A C     1 
ATOM   1632 O  O     . PHE A 1 213 ? 62.849 9.103   -0.077  1.00 14.59 ? 210 PHE A O     1 
ATOM   1633 C  CB    . PHE A 1 213 ? 60.025 10.285  -0.225  1.00 10.57 ? 210 PHE A CB    1 
ATOM   1634 C  CG    . PHE A 1 213 ? 59.011 11.356  -0.582  1.00 9.35  ? 210 PHE A CG    1 
ATOM   1635 C  CD1   . PHE A 1 213 ? 58.309 11.263  -1.778  1.00 12.29 ? 210 PHE A CD1   1 
ATOM   1636 C  CD2   . PHE A 1 213 ? 58.720 12.402  0.283   1.00 11.08 ? 210 PHE A CD2   1 
ATOM   1637 C  CE1   . PHE A 1 213 ? 57.351 12.212  -2.123  1.00 9.57  ? 210 PHE A CE1   1 
ATOM   1638 C  CE2   . PHE A 1 213 ? 57.773 13.362  -0.066  1.00 10.93 ? 210 PHE A CE2   1 
ATOM   1639 C  CZ    . PHE A 1 213 ? 57.086 13.258  -1.267  1.00 11.82 ? 210 PHE A CZ    1 
ATOM   1640 N  N     . GLN A 1 214 ? 62.129 9.125   2.051   1.00 11.89 ? 211 GLN A N     1 
ATOM   1641 C  CA    . GLN A 1 214 ? 62.810 7.900   2.451   1.00 12.89 ? 211 GLN A CA    1 
ATOM   1642 C  C     . GLN A 1 214 ? 61.884 6.706   2.377   1.00 11.34 ? 211 GLN A C     1 
ATOM   1643 O  O     . GLN A 1 214 ? 60.665 6.844   2.482   1.00 12.36 ? 211 GLN A O     1 
ATOM   1644 C  CB    . GLN A 1 214 ? 63.360 8.043   3.867   1.00 14.09 ? 211 GLN A CB    1 
ATOM   1645 C  CG    . GLN A 1 214 ? 64.561 8.984   3.908   1.00 13.36 ? 211 GLN A CG    1 
ATOM   1646 C  CD    . GLN A 1 214 ? 65.104 9.192   5.295   1.00 15.54 ? 211 GLN A CD    1 
ATOM   1647 O  OE1   . GLN A 1 214 ? 64.497 8.789   6.283   1.00 15.72 ? 211 GLN A OE1   1 
ATOM   1648 N  NE2   . GLN A 1 214 ? 66.269 9.830   5.374   1.00 17.54 ? 211 GLN A NE2   1 
ATOM   1649 N  N     . CYS A 1 215 ? 62.475 5.528   2.227   1.00 10.97 ? 212 CYS A N     1 
ATOM   1650 C  CA    . CYS A 1 215 ? 61.695 4.303   2.145   1.00 10.36 ? 212 CYS A CA    1 
ATOM   1651 C  C     . CYS A 1 215 ? 62.499 3.141   2.683   1.00 11.74 ? 212 CYS A C     1 
ATOM   1652 O  O     . CYS A 1 215 ? 63.712 3.241   2.874   1.00 14.08 ? 212 CYS A O     1 
ATOM   1653 C  CB    . CYS A 1 215 ? 61.283 4.014   0.705   1.00 10.41 ? 212 CYS A CB    1 
ATOM   1654 S  SG    . CYS A 1 215 ? 62.693 3.758   -0.394  1.00 16.76 ? 212 CYS A SG    1 
ATOM   1655 N  N     . SER A 1 216 ? 61.796 2.046   2.927   1.00 10.57 ? 213 SER A N     1 
ATOM   1656 C  CA    . SER A 1 216 ? 62.422 0.796   3.291   1.00 10.66 ? 213 SER A CA    1 
ATOM   1657 C  C     . SER A 1 216 ? 62.230 -0.173  2.141   1.00 10.73 ? 213 SER A C     1 
ATOM   1658 O  O     . SER A 1 216 ? 61.443 0.085   1.228   1.00 11.67 ? 213 SER A O     1 
ATOM   1659 C  CB    . SER A 1 216 ? 61.808 0.257   4.567   1.00 12.66 ? 213 SER A CB    1 
ATOM   1660 O  OG    . SER A 1 216 ? 61.986 1.198   5.615   1.00 15.66 ? 213 SER A OG    1 
ATOM   1661 N  N     . ALA A 1 217 ? 62.944 -1.296  2.166   1.00 11.01 ? 214 ALA A N     1 
ATOM   1662 C  CA    . ALA A 1 217 ? 62.751 -2.289  1.116   1.00 9.55  ? 214 ALA A CA    1 
ATOM   1663 C  C     . ALA A 1 217 ? 63.115 -3.671  1.586   1.00 10.65 ? 214 ALA A C     1 
ATOM   1664 O  O     . ALA A 1 217 ? 63.910 -3.809  2.498   1.00 8.96  ? 214 ALA A O     1 
ATOM   1665 C  CB    . ALA A 1 217 ? 63.579 -1.943  -0.129  1.00 10.81 ? 214 ALA A CB    1 
ATOM   1666 N  N     . GLY A 1 218 ? 62.534 -4.662  0.945   1.00 11.17 ? 215 GLY A N     1 
ATOM   1667 C  CA    . GLY A 1 218 ? 62.924 -6.033  1.137   1.00 10.53 ? 215 GLY A CA    1 
ATOM   1668 C  C     . GLY A 1 218 ? 63.387 -6.670  -0.154  1.00 10.62 ? 215 GLY A C     1 
ATOM   1669 O  O     . GLY A 1 218 ? 62.895 -6.360  -1.160  1.00 10.51 ? 215 GLY A O     1 
ATOM   1670 N  N     . ILE A 1 219 ? 64.379 -7.536  -0.041  1.00 9.20  ? 216 ILE A N     1 
ATOM   1671 C  CA    . ILE A 1 219 ? 64.932 -8.234  -1.170  1.00 10.51 ? 216 ILE A CA    1 
ATOM   1672 C  C     . ILE A 1 219 ? 64.922 -9.734  -0.861  1.00 10.63 ? 216 ILE A C     1 
ATOM   1673 O  O     . ILE A 1 219 ? 65.506 -10.175 0.064   1.00 10.68 ? 216 ILE A O     1 
ATOM   1674 C  CB    . ILE A 1 219 ? 66.395 -7.815  -1.497  1.00 11.66 ? 216 ILE A CB    1 
ATOM   1675 C  CG1   . ILE A 1 219 ? 66.530 -6.300  -1.712  1.00 13.31 ? 216 ILE A CG1   1 
ATOM   1676 C  CG2   . ILE A 1 219 ? 66.897 -8.515  -2.746  1.00 12.90 ? 216 ILE A CG2   1 
ATOM   1677 C  CD1   . ILE A 1 219 ? 67.006 -5.515  -0.516  1.00 15.19 ? 216 ILE A CD1   1 
ATOM   1678 N  N     . SER A 1 220 ? 64.244 -10.470 -1.696  1.00 10.74 ? 217 SER A N     1 
ATOM   1679 C  CA    . SER A 1 220 ? 64.207 -11.882 -1.578  1.00 10.07 ? 217 SER A CA    1 
ATOM   1680 C  C     . SER A 1 220 ? 63.920 -12.504 -2.942  1.00 12.17 ? 217 SER A C     1 
ATOM   1681 O  O     . SER A 1 220 ? 64.205 -11.934 -3.917  1.00 11.78 ? 217 SER A O     1 
ATOM   1682 C  CB    . SER A 1 220 ? 63.174 -12.336 -0.542  1.00 12.47 ? 217 SER A CB    1 
ATOM   1683 O  OG    . SER A 1 220 ? 63.431 -13.636 -0.207  1.00 12.79 ? 217 SER A OG    1 
ATOM   1684 N  N     . HIS A 1 221 ? 63.464 -13.742 -2.930  1.00 12.71 ? 218 HIS A N     1 
ATOM   1685 C  CA    . HIS A 1 221 ? 63.215 -14.498 -4.121  1.00 11.52 ? 218 HIS A CA    1 
ATOM   1686 C  C     . HIS A 1 221 ? 61.760 -14.474 -4.602  1.00 13.52 ? 218 HIS A C     1 
ATOM   1687 O  O     . HIS A 1 221 ? 61.475 -15.003 -5.596  1.00 13.09 ? 218 HIS A O     1 
ATOM   1688 C  CB    . HIS A 1 221 ? 63.652 -15.978 -3.939  1.00 12.13 ? 218 HIS A CB    1 
ATOM   1689 C  CG    . HIS A 1 221 ? 65.118 -16.174 -3.840  1.00 16.70 ? 218 HIS A CG    1 
ATOM   1690 N  ND1   . HIS A 1 221 ? 65.983 -15.828 -4.845  1.00 13.15 ? 218 HIS A ND1   1 
ATOM   1691 C  CD2   . HIS A 1 221 ? 65.870 -16.673 -2.842  1.00 13.38 ? 218 HIS A CD2   1 
ATOM   1692 C  CE1   . HIS A 1 221 ? 67.208 -16.135 -4.469  1.00 14.42 ? 218 HIS A CE1   1 
ATOM   1693 N  NE2   . HIS A 1 221 ? 67.165 -16.645 -3.260  1.00 14.38 ? 218 HIS A NE2   1 
ATOM   1694 N  N     . ASN A 1 222 ? 60.884 -13.843 -3.879  1.00 10.50 ? 219 ASN A N     1 
ATOM   1695 C  CA    . ASN A 1 222 ? 59.486 -13.734 -4.291  1.00 12.15 ? 219 ASN A CA    1 
ATOM   1696 C  C     . ASN A 1 222 ? 58.800 -12.580 -3.570  1.00 9.74  ? 219 ASN A C     1 
ATOM   1697 O  O     . ASN A 1 222 ? 59.396 -11.938 -2.696  1.00 11.30 ? 219 ASN A O     1 
ATOM   1698 C  CB    . ASN A 1 222 ? 58.728 -15.042 -4.026  1.00 10.14 ? 219 ASN A CB    1 
ATOM   1699 C  CG    . ASN A 1 222 ? 58.899 -15.519 -2.609  1.00 14.09 ? 219 ASN A CG    1 
ATOM   1700 O  OD1   . ASN A 1 222 ? 58.463 -14.845 -1.667  1.00 11.59 ? 219 ASN A OD1   1 
ATOM   1701 N  ND2   . ASN A 1 222 ? 59.517 -16.702 -2.437  1.00 14.22 ? 219 ASN A ND2   1 
ATOM   1702 N  N     . LYS A 1 223 ? 57.555 -12.307 -3.938  1.00 11.69 ? 220 LYS A N     1 
ATOM   1703 C  CA    . LYS A 1 223 ? 56.849 -11.149 -3.391  1.00 11.08 ? 220 LYS A CA    1 
ATOM   1704 C  C     . LYS A 1 223 ? 56.554 -11.259 -1.892  1.00 11.45 ? 220 LYS A C     1 
ATOM   1705 O  O     . LYS A 1 223 ? 56.720 -10.281 -1.140  1.00 11.43 ? 220 LYS A O     1 
ATOM   1706 C  CB    . LYS A 1 223 ? 55.547 -10.916 -4.182  1.00 11.46 ? 220 LYS A CB    1 
ATOM   1707 C  CG    . LYS A 1 223 ? 55.786 -10.437 -5.619  1.00 14.19 ? 220 LYS A CG    1 
ATOM   1708 C  CD    . LYS A 1 223 ? 54.567 -9.695  -6.209  1.00 18.27 ? 220 LYS A CD    1 
ATOM   1709 C  CE    . LYS A 1 223 ? 53.467 -10.619 -6.575  1.00 21.69 ? 220 LYS A CE    1 
ATOM   1710 N  NZ    . LYS A 1 223 ? 52.333 -9.889  -7.253  1.00 18.14 ? 220 LYS A NZ    1 
ATOM   1711 N  N     . VAL A 1 224 ? 56.106 -12.430 -1.438  1.00 11.35 ? 221 VAL A N     1 
ATOM   1712 C  CA    . VAL A 1 224 ? 55.727 -12.549 -0.032  1.00 11.33 ? 221 VAL A CA    1 
ATOM   1713 C  C     . VAL A 1 224 ? 56.946 -12.377 0.863   1.00 11.06 ? 221 VAL A C     1 
ATOM   1714 O  O     . VAL A 1 224 ? 56.880 -11.670 1.877   1.00 11.59 ? 221 VAL A O     1 
ATOM   1715 C  CB    . VAL A 1 224 ? 55.050 -13.896 0.285   1.00 12.91 ? 221 VAL A CB    1 
ATOM   1716 C  CG1   . VAL A 1 224 ? 55.063 -14.169 1.790   1.00 16.22 ? 221 VAL A CG1   1 
ATOM   1717 C  CG2   . VAL A 1 224 ? 53.635 -13.894 -0.237  1.00 14.81 ? 221 VAL A CG2   1 
ATOM   1718 N  N     . LEU A 1 225 ? 58.068 -13.006 0.500   1.00 10.86 ? 222 LEU A N     1 
ATOM   1719 C  CA    . LEU A 1 225 ? 59.258 -12.840 1.333   1.00 10.26 ? 222 LEU A CA    1 
ATOM   1720 C  C     . LEU A 1 225 ? 59.808 -11.417 1.225   1.00 11.84 ? 222 LEU A C     1 
ATOM   1721 O  O     . LEU A 1 225 ? 60.303 -10.866 2.202   1.00 9.94  ? 222 LEU A O     1 
ATOM   1722 C  CB    . LEU A 1 225 ? 60.353 -13.850 0.963   1.00 11.22 ? 222 LEU A CB    1 
ATOM   1723 C  CG    . LEU A 1 225 ? 60.059 -15.306 1.345   1.00 10.21 ? 222 LEU A CG    1 
ATOM   1724 C  CD1   . LEU A 1 225 ? 61.242 -16.179 0.931   1.00 11.30 ? 222 LEU A CD1   1 
ATOM   1725 C  CD2   . LEU A 1 225 ? 59.767 -15.446 2.834   1.00 13.20 ? 222 LEU A CD2   1 
ATOM   1726 N  N     . ALA A 1 226 ? 59.708 -10.810 0.047   1.00 9.52  ? 223 ALA A N     1 
ATOM   1727 C  CA    . ALA A 1 226 ? 60.208 -9.443  -0.092  1.00 8.63  ? 223 ALA A CA    1 
ATOM   1728 C  C     . ALA A 1 226 ? 59.413 -8.469  0.771   1.00 9.27  ? 223 ALA A C     1 
ATOM   1729 O  O     . ALA A 1 226 ? 59.991 -7.576  1.394   1.00 9.43  ? 223 ALA A O     1 
ATOM   1730 C  CB    . ALA A 1 226 ? 60.178 -9.005  -1.552  1.00 9.65  ? 223 ALA A CB    1 
ATOM   1731 N  N     . LYS A 1 227 ? 58.098 -8.645  0.798   1.00 10.57 ? 224 LYS A N     1 
ATOM   1732 C  CA    . LYS A 1 227 ? 57.220 -7.848  1.638   1.00 9.81  ? 224 LYS A CA    1 
ATOM   1733 C  C     . LYS A 1 227 ? 57.542 -8.029  3.117   1.00 11.92 ? 224 LYS A C     1 
ATOM   1734 O  O     . LYS A 1 227 ? 57.668 -7.059  3.864   1.00 12.24 ? 224 LYS A O     1 
ATOM   1735 C  CB    . LYS A 1 227 ? 55.754 -8.212  1.371   1.00 11.89 ? 224 LYS A CB    1 
ATOM   1736 C  CG    A LYS A 1 227 ? 54.797 -7.469  2.283   0.78 15.08 ? 224 LYS A CG    1 
ATOM   1737 C  CG    B LYS A 1 227 ? 54.758 -7.560  2.315   0.22 15.12 ? 224 LYS A CG    1 
ATOM   1738 C  CD    A LYS A 1 227 ? 54.943 -5.964  2.130   0.78 16.87 ? 224 LYS A CD    1 
ATOM   1739 C  CD    B LYS A 1 227 ? 54.673 -6.059  2.099   0.22 17.13 ? 224 LYS A CD    1 
ATOM   1740 C  CE    A LYS A 1 227 ? 53.931 -5.237  3.001   0.78 19.36 ? 224 LYS A CE    1 
ATOM   1741 C  CE    B LYS A 1 227 ? 53.597 -5.442  2.984   0.22 19.18 ? 224 LYS A CE    1 
ATOM   1742 N  NZ    A LYS A 1 227 ? 53.844 -3.784  2.698   0.78 18.50 ? 224 LYS A NZ    1 
ATOM   1743 N  NZ    B LYS A 1 227 ? 52.276 -6.114  2.817   0.22 20.43 ? 224 LYS A NZ    1 
ATOM   1744 N  N     . LEU A 1 228 ? 57.705 -9.276  3.533   1.00 10.98 ? 225 LEU A N     1 
ATOM   1745 C  CA    . LEU A 1 228 ? 58.004 -9.572  4.917   1.00 16.55 ? 225 LEU A CA    1 
ATOM   1746 C  C     . LEU A 1 228 ? 59.351 -8.963  5.311   1.00 13.90 ? 225 LEU A C     1 
ATOM   1747 O  O     . LEU A 1 228 ? 59.491 -8.333  6.376   1.00 14.72 ? 225 LEU A O     1 
ATOM   1748 C  CB    . LEU A 1 228 ? 58.013 -11.082 5.126   1.00 13.82 ? 225 LEU A CB    1 
ATOM   1749 C  CG    . LEU A 1 228 ? 58.060 -11.488 6.591   1.00 17.28 ? 225 LEU A CG    1 
ATOM   1750 C  CD1   . LEU A 1 228 ? 56.774 -11.047 7.286   1.00 21.75 ? 225 LEU A CD1   1 
ATOM   1751 C  CD2   . LEU A 1 228 ? 58.275 -12.987 6.703   1.00 15.21 ? 225 LEU A CD2   1 
ATOM   1752 N  N     . ALA A 1 229 ? 60.334 -9.144  4.433   1.00 13.00 ? 226 ALA A N     1 
ATOM   1753 C  CA    . ALA A 1 229 ? 61.665 -8.582  4.646   1.00 10.56 ? 226 ALA A CA    1 
ATOM   1754 C  C     . ALA A 1 229 ? 61.624 -7.081  4.852   1.00 11.62 ? 226 ALA A C     1 
ATOM   1755 O  O     . ALA A 1 229 ? 62.304 -6.555  5.731   1.00 13.73 ? 226 ALA A O     1 
ATOM   1756 C  CB    . ALA A 1 229 ? 62.583 -8.902  3.468   1.00 10.96 ? 226 ALA A CB    1 
ATOM   1757 N  N     . CYS A 1 230 ? 60.857 -6.392  4.008   1.00 11.35 ? 227 CYS A N     1 
ATOM   1758 C  CA    . CYS A 1 230 ? 60.787 -4.940  4.050   1.00 13.99 ? 227 CYS A CA    1 
ATOM   1759 C  C     . CYS A 1 230 ? 60.448 -4.414  5.449   1.00 14.76 ? 227 CYS A C     1 
ATOM   1760 O  O     . CYS A 1 230 ? 61.065 -3.456  5.930   1.00 14.15 ? 227 CYS A O     1 
ATOM   1761 C  CB    . CYS A 1 230 ? 59.754 -4.441  3.036   1.00 9.02  ? 227 CYS A CB    1 
ATOM   1762 S  SG    . CYS A 1 230 ? 59.675 -2.641  2.946   1.00 12.64 ? 227 CYS A SG    1 
ATOM   1763 N  N     . GLY A 1 231 ? 59.504 -5.068  6.120   1.00 12.90 ? 228 GLY A N     1 
ATOM   1764 C  CA    . GLY A 1 231 ? 59.072 -4.607  7.426   1.00 15.96 ? 228 GLY A CA    1 
ATOM   1765 C  C     . GLY A 1 231 ? 60.013 -4.909  8.585   1.00 15.59 ? 228 GLY A C     1 
ATOM   1766 O  O     . GLY A 1 231 ? 59.835 -4.379  9.679   1.00 18.35 ? 228 GLY A O     1 
ATOM   1767 N  N     . LEU A 1 232 ? 61.022 -5.744  8.360   1.00 14.67 ? 229 LEU A N     1 
ATOM   1768 C  CA    . LEU A 1 232 ? 61.859 -6.209  9.469   1.00 14.06 ? 229 LEU A CA    1 
ATOM   1769 C  C     . LEU A 1 232 ? 62.745 -5.108  10.019  1.00 16.02 ? 229 LEU A C     1 
ATOM   1770 O  O     . LEU A 1 232 ? 63.076 -5.119  11.203  1.00 16.27 ? 229 LEU A O     1 
ATOM   1771 C  CB    . LEU A 1 232 ? 62.719 -7.398  9.033   1.00 14.61 ? 229 LEU A CB    1 
ATOM   1772 C  CG    . LEU A 1 232 ? 61.905 -8.655  8.728   1.00 16.86 ? 229 LEU A CG    1 
ATOM   1773 C  CD1   . LEU A 1 232 ? 62.803 -9.793  8.263   1.00 15.46 ? 229 LEU A CD1   1 
ATOM   1774 C  CD2   . LEU A 1 232 ? 61.087 -9.046  9.952   1.00 16.68 ? 229 LEU A CD2   1 
ATOM   1775 N  N     . ASN A 1 233 ? 63.126 -4.158  9.164   1.00 13.36 ? 230 ASN A N     1 
ATOM   1776 C  CA    . ASN A 1 233 ? 63.980 -3.067  9.584   1.00 14.41 ? 230 ASN A CA    1 
ATOM   1777 C  C     . ASN A 1 233 ? 63.476 -1.778  8.952   1.00 18.11 ? 230 ASN A C     1 
ATOM   1778 O  O     . ASN A 1 233 ? 64.028 -1.296  7.981   1.00 30.00 ? 230 ASN A O     1 
ATOM   1779 C  CB    . ASN A 1 233 ? 65.435 -3.353  9.205   1.00 15.00 ? 230 ASN A CB    1 
ATOM   1780 C  CG    . ASN A 1 233 ? 66.007 -4.553  9.951   1.00 15.38 ? 230 ASN A CG    1 
ATOM   1781 O  OD1   . ASN A 1 233 ? 66.341 -4.455  11.131  1.00 16.14 ? 230 ASN A OD1   1 
ATOM   1782 N  ND2   . ASN A 1 233 ? 66.130 -5.690  9.260   1.00 13.01 ? 230 ASN A ND2   1 
ATOM   1783 N  N     . LYS A 1 234 ? 62.361 -1.284  9.463   1.00 22.26 ? 231 LYS A N     1 
ATOM   1784 C  CA    . LYS A 1 234 ? 61.845 0.026   9.079   1.00 17.39 ? 231 LYS A CA    1 
ATOM   1785 C  C     . LYS A 1 234 ? 62.180 0.990   10.199  1.00 20.27 ? 231 LYS A C     1 
ATOM   1786 O  O     . LYS A 1 234 ? 62.252 0.580   11.361  1.00 25.49 ? 231 LYS A O     1 
ATOM   1787 C  CB    . LYS A 1 234 ? 60.331 -0.006  8.861   1.00 23.54 ? 231 LYS A CB    1 
ATOM   1788 C  CG    . LYS A 1 234 ? 59.892 -0.335  7.461   1.00 23.11 ? 231 LYS A CG    1 
ATOM   1789 C  CD    . LYS A 1 234 ? 58.452 0.159   7.223   1.00 24.82 ? 231 LYS A CD    1 
ATOM   1790 C  CE    . LYS A 1 234 ? 58.098 0.222   5.727   1.00 24.02 ? 231 LYS A CE    1 
ATOM   1791 N  NZ    . LYS A 1 234 ? 58.011 1.642   5.210   1.00 15.99 ? 231 LYS A NZ    1 
ATOM   1792 N  N     . PRO A 1 235 ? 62.362 2.278   9.889   1.00 16.62 ? 232 PRO A N     1 
ATOM   1793 C  CA    . PRO A 1 235 ? 62.353 2.966   8.595   1.00 13.34 ? 232 PRO A CA    1 
ATOM   1794 C  C     . PRO A 1 235 ? 63.727 3.123   7.996   1.00 15.00 ? 232 PRO A C     1 
ATOM   1795 O  O     . PRO A 1 235 ? 64.733 2.888   8.671   1.00 14.75 ? 232 PRO A O     1 
ATOM   1796 C  CB    . PRO A 1 235 ? 61.799 4.345   8.954   1.00 15.43 ? 232 PRO A CB    1 
ATOM   1797 C  CG    . PRO A 1 235 ? 62.385 4.595   10.319  1.00 15.64 ? 232 PRO A CG    1 
ATOM   1798 C  CD    . PRO A 1 235 ? 62.423 3.241   11.005  1.00 17.90 ? 232 PRO A CD    1 
ATOM   1799 N  N     . ASN A 1 236 ? 63.760 3.543   6.735   1.00 13.85 ? 233 ASN A N     1 
ATOM   1800 C  CA    . ASN A 1 236 ? 64.994 3.957   6.075   1.00 12.46 ? 233 ASN A CA    1 
ATOM   1801 C  C     . ASN A 1 236 ? 66.091 2.892   6.041   1.00 10.43 ? 233 ASN A C     1 
ATOM   1802 O  O     . ASN A 1 236 ? 67.265 3.222   6.095   1.00 13.04 ? 233 ASN A O     1 
ATOM   1803 C  CB    . ASN A 1 236 ? 65.533 5.229   6.740   1.00 13.22 ? 233 ASN A CB    1 
ATOM   1804 C  CG    . ASN A 1 236 ? 66.516 5.962   5.862   1.00 15.22 ? 233 ASN A CG    1 
ATOM   1805 O  OD1   . ASN A 1 236 ? 66.437 5.884   4.643   1.00 17.51 ? 233 ASN A OD1   1 
ATOM   1806 N  ND2   . ASN A 1 236 ? 67.471 6.660   6.483   1.00 17.73 ? 233 ASN A ND2   1 
ATOM   1807 N  N     . ARG A 1 237 ? 65.692 1.626   5.957   1.00 11.20 ? 234 ARG A N     1 
ATOM   1808 C  CA    . ARG A 1 237 ? 66.648 0.524   5.812   1.00 13.91 ? 234 ARG A CA    1 
ATOM   1809 C  C     . ARG A 1 237 ? 66.083 -0.532  4.885   1.00 14.24 ? 234 ARG A C     1 
ATOM   1810 O  O     . ARG A 1 237 ? 64.893 -0.564  4.621   1.00 12.14 ? 234 ARG A O     1 
ATOM   1811 C  CB    . ARG A 1 237 ? 66.985 -0.128  7.165   1.00 13.93 ? 234 ARG A CB    1 
ATOM   1812 C  CG    . ARG A 1 237 ? 67.663 0.759   8.180   1.00 14.09 ? 234 ARG A CG    1 
ATOM   1813 C  CD    . ARG A 1 237 ? 69.055 1.149   7.734   1.00 18.96 ? 234 ARG A CD    1 
ATOM   1814 N  NE    . ARG A 1 237 ? 69.766 1.889   8.774   1.00 20.94 ? 234 ARG A NE    1 
ATOM   1815 C  CZ    . ARG A 1 237 ? 69.854 3.217   8.817   1.00 22.21 ? 234 ARG A CZ    1 
ATOM   1816 N  NH1   . ARG A 1 237 ? 69.276 3.963   7.880   1.00 24.16 ? 234 ARG A NH1   1 
ATOM   1817 N  NH2   . ARG A 1 237 ? 70.529 3.799   9.798   1.00 23.23 ? 234 ARG A NH2   1 
ATOM   1818 N  N     . GLN A 1 238 ? 66.934 -1.431  4.420   1.00 10.35 ? 235 GLN A N     1 
ATOM   1819 C  CA    . GLN A 1 238 ? 66.449 -2.522  3.587   1.00 10.52 ? 235 GLN A CA    1 
ATOM   1820 C  C     . GLN A 1 238 ? 66.984 -3.835  4.116   1.00 11.73 ? 235 GLN A C     1 
ATOM   1821 O  O     . GLN A 1 238 ? 68.012 -3.869  4.769   1.00 12.74 ? 235 GLN A O     1 
ATOM   1822 C  CB    . GLN A 1 238 ? 66.853 -2.320  2.127   1.00 11.90 ? 235 GLN A CB    1 
ATOM   1823 C  CG    . GLN A 1 238 ? 68.363 -2.171  1.923   1.00 12.91 ? 235 GLN A CG    1 
ATOM   1824 C  CD    . GLN A 1 238 ? 68.729 -1.910  0.471   1.00 14.14 ? 235 GLN A CD    1 
ATOM   1825 O  OE1   . GLN A 1 238 ? 68.320 -0.902  -0.116  1.00 14.48 ? 235 GLN A OE1   1 
ATOM   1826 N  NE2   . GLN A 1 238 ? 69.489 -2.831  -0.130  1.00 12.38 ? 235 GLN A NE2   1 
ATOM   1827 N  N     . THR A 1 239 ? 66.260 -4.917  3.847   1.00 10.68 ? 236 THR A N     1 
ATOM   1828 C  CA    . THR A 1 239 ? 66.576 -6.194  4.467   1.00 10.71 ? 236 THR A CA    1 
ATOM   1829 C  C     . THR A 1 239 ? 66.592 -7.271  3.402   1.00 11.21 ? 236 THR A C     1 
ATOM   1830 O  O     . THR A 1 239 ? 65.680 -7.332  2.574   1.00 12.38 ? 236 THR A O     1 
ATOM   1831 C  CB    . THR A 1 239 ? 65.550 -6.556  5.557   1.00 12.75 ? 236 THR A CB    1 
ATOM   1832 O  OG1   . THR A 1 239 ? 65.452 -5.478  6.487   1.00 11.98 ? 236 THR A OG1   1 
ATOM   1833 C  CG2   . THR A 1 239 ? 65.984 -7.811  6.326   1.00 12.82 ? 236 THR A CG2   1 
ATOM   1834 N  N     . LEU A 1 240 ? 67.637 -8.097  3.421   1.00 10.03 ? 237 LEU A N     1 
ATOM   1835 C  CA    . LEU A 1 240 ? 67.774 -9.232  2.524   1.00 9.25  ? 237 LEU A CA    1 
ATOM   1836 C  C     . LEU A 1 240 ? 67.346 -10.489 3.292   1.00 12.76 ? 237 LEU A C     1 
ATOM   1837 O  O     . LEU A 1 240 ? 67.910 -10.798 4.349   1.00 11.76 ? 237 LEU A O     1 
ATOM   1838 C  CB    . LEU A 1 240 ? 69.226 -9.342  2.015   1.00 11.37 ? 237 LEU A CB    1 
ATOM   1839 C  CG    . LEU A 1 240 ? 69.587 -10.356 0.926   1.00 10.45 ? 237 LEU A CG    1 
ATOM   1840 C  CD1   . LEU A 1 240 ? 70.902 -9.948  0.258   1.00 13.37 ? 237 LEU A CD1   1 
ATOM   1841 C  CD2   . LEU A 1 240 ? 69.731 -11.757 1.496   1.00 13.19 ? 237 LEU A CD2   1 
ATOM   1842 N  N     . VAL A 1 241 ? 66.341 -11.196 2.766   1.00 9.41  ? 238 VAL A N     1 
ATOM   1843 C  CA    . VAL A 1 241 ? 65.902 -12.476 3.331   1.00 11.72 ? 238 VAL A CA    1 
ATOM   1844 C  C     . VAL A 1 241 ? 66.289 -13.548 2.336   1.00 10.17 ? 238 VAL A C     1 
ATOM   1845 O  O     . VAL A 1 241 ? 65.705 -13.658 1.260   1.00 12.57 ? 238 VAL A O     1 
ATOM   1846 C  CB    . VAL A 1 241 ? 64.387 -12.497 3.627   1.00 10.65 ? 238 VAL A CB    1 
ATOM   1847 C  CG1   . VAL A 1 241 ? 63.869 -13.936 3.831   1.00 10.35 ? 238 VAL A CG1   1 
ATOM   1848 C  CG2   . VAL A 1 241 ? 64.095 -11.674 4.862   1.00 10.63 ? 238 VAL A CG2   1 
ATOM   1849 N  N     . SER A 1 242 ? 67.308 -14.323 2.701   1.00 9.98  ? 239 SER A N     1 
ATOM   1850 C  CA    . SER A 1 242 ? 67.785 -15.382 1.836   1.00 11.36 ? 239 SER A CA    1 
ATOM   1851 C  C     . SER A 1 242 ? 66.896 -16.622 1.957   1.00 10.23 ? 239 SER A C     1 
ATOM   1852 O  O     . SER A 1 242 ? 66.099 -16.753 2.897   1.00 10.90 ? 239 SER A O     1 
ATOM   1853 C  CB    . SER A 1 242 ? 69.225 -15.747 2.193   1.00 13.81 ? 239 SER A CB    1 
ATOM   1854 O  OG    . SER A 1 242 ? 69.251 -16.302 3.502   1.00 15.32 ? 239 SER A OG    1 
ATOM   1855 N  N     . HIS A 1 243 ? 67.049 -17.551 1.020   1.00 11.26 ? 240 HIS A N     1 
ATOM   1856 C  CA    . HIS A 1 243 ? 66.290 -18.789 1.100   1.00 10.06 ? 240 HIS A CA    1 
ATOM   1857 C  C     . HIS A 1 243 ? 66.675 -19.523 2.381   1.00 13.03 ? 240 HIS A C     1 
ATOM   1858 O  O     . HIS A 1 243 ? 65.815 -20.079 3.075   1.00 10.25 ? 240 HIS A O     1 
ATOM   1859 C  CB    . HIS A 1 243 ? 66.548 -19.678 -0.118  1.00 14.06 ? 240 HIS A CB    1 
ATOM   1860 C  CG    . HIS A 1 243 ? 65.767 -20.956 -0.093  1.00 12.62 ? 240 HIS A CG    1 
ATOM   1861 N  ND1   . HIS A 1 243 ? 64.422 -21.005 -0.356  1.00 17.69 ? 240 HIS A ND1   1 
ATOM   1862 C  CD2   . HIS A 1 243 ? 66.152 -22.229 0.177   1.00 18.64 ? 240 HIS A CD2   1 
ATOM   1863 C  CE1   . HIS A 1 243 ? 64.002 -22.260 -0.265  1.00 18.81 ? 240 HIS A CE1   1 
ATOM   1864 N  NE2   . HIS A 1 243 ? 65.032 -23.017 0.058   1.00 17.87 ? 240 HIS A NE2   1 
ATOM   1865 N  N     . GLY A 1 244 ? 67.971 -19.484 2.690   1.00 12.94 ? 241 GLY A N     1 
ATOM   1866 C  CA    . GLY A 1 244 ? 68.502 -20.180 3.851   1.00 11.66 ? 241 GLY A CA    1 
ATOM   1867 C  C     . GLY A 1 244 ? 67.984 -19.653 5.170   1.00 10.84 ? 241 GLY A C     1 
ATOM   1868 O  O     . GLY A 1 244 ? 67.888 -20.392 6.149   1.00 14.39 ? 241 GLY A O     1 
ATOM   1869 N  N     . SER A 1 245 ? 67.631 -18.372 5.199   1.00 10.56 ? 242 SER A N     1 
ATOM   1870 C  CA    . SER A 1 245 ? 67.131 -17.752 6.419   1.00 12.77 ? 242 SER A CA    1 
ATOM   1871 C  C     . SER A 1 245 ? 65.697 -18.134 6.752   1.00 10.84 ? 242 SER A C     1 
ATOM   1872 O  O     . SER A 1 245 ? 65.225 -17.863 7.856   1.00 10.93 ? 242 SER A O     1 
ATOM   1873 C  CB    . SER A 1 245 ? 67.210 -16.228 6.309   1.00 12.05 ? 242 SER A CB    1 
ATOM   1874 O  OG    . SER A 1 245 ? 66.184 -15.749 5.451   1.00 11.53 ? 242 SER A OG    1 
ATOM   1875 N  N     . VAL A 1 246 ? 65.004 -18.775 5.819   1.00 10.43 ? 243 VAL A N     1 
ATOM   1876 C  CA    . VAL A 1 246 ? 63.572 -19.003 6.011   1.00 11.70 ? 243 VAL A CA    1 
ATOM   1877 C  C     . VAL A 1 246 ? 63.208 -19.949 7.184   1.00 12.49 ? 243 VAL A C     1 
ATOM   1878 O  O     . VAL A 1 246 ? 62.329 -19.600 7.972   1.00 11.64 ? 243 VAL A O     1 
ATOM   1879 C  CB    . VAL A 1 246 ? 62.916 -19.490 4.694   1.00 10.17 ? 243 VAL A CB    1 
ATOM   1880 C  CG1   . VAL A 1 246 ? 61.501 -19.977 4.939   1.00 12.24 ? 243 VAL A CG1   1 
ATOM   1881 C  CG2   . VAL A 1 246 ? 62.900 -18.331 3.680   1.00 13.03 ? 243 VAL A CG2   1 
ATOM   1882 N  N     . PRO A 1 247 ? 63.882 -21.116 7.339   1.00 12.91 ? 244 PRO A N     1 
ATOM   1883 C  CA    . PRO A 1 247 ? 63.476 -21.973 8.473   1.00 10.71 ? 244 PRO A CA    1 
ATOM   1884 C  C     . PRO A 1 247 ? 63.534 -21.274 9.843   1.00 10.64 ? 244 PRO A C     1 
ATOM   1885 O  O     . PRO A 1 247 ? 62.576 -21.391 10.605  1.00 13.37 ? 244 PRO A O     1 
ATOM   1886 C  CB    . PRO A 1 247 ? 64.487 -23.140 8.413   1.00 10.59 ? 244 PRO A CB    1 
ATOM   1887 C  CG    . PRO A 1 247 ? 64.791 -23.246 6.925   1.00 12.84 ? 244 PRO A CG    1 
ATOM   1888 C  CD    . PRO A 1 247 ? 64.916 -21.773 6.515   1.00 12.34 ? 244 PRO A CD    1 
ATOM   1889 N  N     . GLN A 1 248 ? 64.611 -20.554 10.152  1.00 12.45 ? 245 GLN A N     1 
ATOM   1890 C  CA    . GLN A 1 248 ? 64.659 -19.847 11.425  1.00 13.92 ? 245 GLN A CA    1 
ATOM   1891 C  C     . GLN A 1 248 ? 63.625 -18.724 11.489  1.00 13.79 ? 245 GLN A C     1 
ATOM   1892 O  O     . GLN A 1 248 ? 62.920 -18.568 12.491  1.00 13.93 ? 245 GLN A O     1 
ATOM   1893 C  CB    . GLN A 1 248 ? 66.066 -19.297 11.677  1.00 13.98 ? 245 GLN A CB    1 
ATOM   1894 C  CG    . GLN A 1 248 ? 67.103 -20.388 11.900  1.00 23.71 ? 245 GLN A CG    1 
ATOM   1895 C  CD    . GLN A 1 248 ? 68.129 -20.042 12.969  1.00 23.86 ? 245 GLN A CD    1 
ATOM   1896 O  OE1   . GLN A 1 248 ? 67.787 -19.902 14.146  1.00 36.37 ? 245 GLN A OE1   1 
ATOM   1897 N  NE2   . GLN A 1 248 ? 69.405 -19.942 12.570  1.00 25.51 ? 245 GLN A NE2   1 
ATOM   1898 N  N     . LEU A 1 249 ? 63.530 -17.953 10.409  1.00 11.36 ? 246 LEU A N     1 
ATOM   1899 C  CA    . LEU A 1 249 ? 62.595 -16.835 10.371  1.00 11.86 ? 246 LEU A CA    1 
ATOM   1900 C  C     . LEU A 1 249 ? 61.170 -17.319 10.600  1.00 11.03 ? 246 LEU A C     1 
ATOM   1901 O  O     . LEU A 1 249 ? 60.402 -16.736 11.373  1.00 12.02 ? 246 LEU A O     1 
ATOM   1902 C  CB    . LEU A 1 249 ? 62.712 -16.116 9.030   1.00 11.36 ? 246 LEU A CB    1 
ATOM   1903 C  CG    . LEU A 1 249 ? 61.792 -14.909 8.852   1.00 12.28 ? 246 LEU A CG    1 
ATOM   1904 C  CD1   . LEU A 1 249 ? 62.121 -13.860 9.901   1.00 15.96 ? 246 LEU A CD1   1 
ATOM   1905 C  CD2   . LEU A 1 249 ? 61.941 -14.361 7.452   1.00 14.45 ? 246 LEU A CD2   1 
ATOM   1906 N  N     . PHE A 1 250 ? 60.819 -18.407 9.938   1.00 11.32 ? 247 PHE A N     1 
ATOM   1907 C  CA    . PHE A 1 250 ? 59.436 -18.858 9.993   1.00 10.58 ? 247 PHE A CA    1 
ATOM   1908 C  C     . PHE A 1 250 ? 59.130 -19.630 11.277  1.00 10.02 ? 247 PHE A C     1 
ATOM   1909 O  O     . PHE A 1 250 ? 57.962 -19.796 11.631  1.00 12.32 ? 247 PHE A O     1 
ATOM   1910 C  CB    . PHE A 1 250 ? 59.101 -19.711 8.770   1.00 12.13 ? 247 PHE A CB    1 
ATOM   1911 C  CG    . PHE A 1 250 ? 58.672 -18.916 7.563   1.00 11.63 ? 247 PHE A CG    1 
ATOM   1912 C  CD1   . PHE A 1 250 ? 58.167 -19.569 6.448   1.00 14.50 ? 247 PHE A CD1   1 
ATOM   1913 C  CD2   . PHE A 1 250 ? 58.765 -17.531 7.553   1.00 11.74 ? 247 PHE A CD2   1 
ATOM   1914 C  CE1   . PHE A 1 250 ? 57.755 -18.857 5.335   1.00 12.91 ? 247 PHE A CE1   1 
ATOM   1915 C  CE2   . PHE A 1 250 ? 58.372 -16.807 6.430   1.00 12.89 ? 247 PHE A CE2   1 
ATOM   1916 C  CZ    . PHE A 1 250 ? 57.858 -17.473 5.325   1.00 12.83 ? 247 PHE A CZ    1 
ATOM   1917 N  N     . SER A 1 251 ? 60.165 -20.079 11.996  1.00 9.45  ? 248 SER A N     1 
ATOM   1918 C  CA    . SER A 1 251 ? 59.932 -20.953 13.147  1.00 13.70 ? 248 SER A CA    1 
ATOM   1919 C  C     . SER A 1 251 ? 59.228 -20.215 14.274  1.00 13.14 ? 248 SER A C     1 
ATOM   1920 O  O     . SER A 1 251 ? 58.593 -20.835 15.120  1.00 10.71 ? 248 SER A O     1 
ATOM   1921 C  CB    . SER A 1 251 ? 61.245 -21.548 13.659  1.00 11.83 ? 248 SER A CB    1 
ATOM   1922 O  OG    . SER A 1 251 ? 62.044 -20.558 14.281  1.00 13.01 ? 248 SER A OG    1 
ATOM   1923 N  N     . GLN A 1 252 ? 59.326 -18.893 14.280  1.00 12.94 ? 249 GLN A N     1 
ATOM   1924 C  CA    . GLN A 1 252 ? 58.625 -18.123 15.297  1.00 12.81 ? 249 GLN A CA    1 
ATOM   1925 C  C     . GLN A 1 252 ? 57.719 -17.046 14.712  1.00 13.26 ? 249 GLN A C     1 
ATOM   1926 O  O     . GLN A 1 252 ? 57.379 -16.091 15.402  1.00 17.28 ? 249 GLN A O     1 
ATOM   1927 C  CB    . GLN A 1 252 ? 59.619 -17.474 16.240  1.00 18.41 ? 249 GLN A CB    1 
ATOM   1928 C  CG    . GLN A 1 252 ? 60.310 -18.446 17.134  1.00 19.37 ? 249 GLN A CG    1 
ATOM   1929 C  CD    . GLN A 1 252 ? 61.165 -17.731 18.145  1.00 19.36 ? 249 GLN A CD    1 
ATOM   1930 O  OE1   . GLN A 1 252 ? 60.761 -17.549 19.295  1.00 22.39 ? 249 GLN A OE1   1 
ATOM   1931 N  NE2   . GLN A 1 252 ? 62.334 -17.273 17.708  1.00 23.85 ? 249 GLN A NE2   1 
ATOM   1932 N  N     . MET A 1 253 ? 57.341 -17.202 13.447  1.00 11.58 ? 250 MET A N     1 
ATOM   1933 C  CA    . MET A 1 253 ? 56.610 -16.155 12.731  1.00 13.90 ? 250 MET A CA    1 
ATOM   1934 C  C     . MET A 1 253 ? 55.129 -16.450 12.787  1.00 11.43 ? 250 MET A C     1 
ATOM   1935 O  O     . MET A 1 253 ? 54.691 -17.421 12.201  1.00 13.24 ? 250 MET A O     1 
ATOM   1936 C  CB    . MET A 1 253 ? 57.094 -16.078 11.274  1.00 14.04 ? 250 MET A CB    1 
ATOM   1937 C  CG    . MET A 1 253 ? 56.431 -15.016 10.409  1.00 18.86 ? 250 MET A CG    1 
ATOM   1938 S  SD    . MET A 1 253 ? 56.806 -13.328 10.915  1.00 21.19 ? 250 MET A SD    1 
ATOM   1939 C  CE    . MET A 1 253 ? 58.601 -13.265 10.790  1.00 16.15 ? 250 MET A CE    1 
ATOM   1940 N  N     . PRO A 1 254 ? 54.343 -15.615 13.493  1.00 14.27 ? 251 PRO A N     1 
ATOM   1941 C  CA    . PRO A 1 254 ? 52.897 -15.857 13.480  1.00 13.30 ? 251 PRO A CA    1 
ATOM   1942 C  C     . PRO A 1 254 ? 52.345 -15.887 12.065  1.00 13.63 ? 251 PRO A C     1 
ATOM   1943 O  O     . PRO A 1 254 ? 52.736 -15.087 11.217  1.00 15.01 ? 251 PRO A O     1 
ATOM   1944 C  CB    . PRO A 1 254 ? 52.319 -14.671 14.265  1.00 15.14 ? 251 PRO A CB    1 
ATOM   1945 C  CG    . PRO A 1 254 ? 53.477 -14.187 15.117  1.00 14.50 ? 251 PRO A CG    1 
ATOM   1946 C  CD    . PRO A 1 254 ? 54.703 -14.410 14.254  1.00 18.18 ? 251 PRO A CD    1 
ATOM   1947 N  N     . ILE A 1 255 ? 51.451 -16.829 11.820  1.00 12.98 ? 252 ILE A N     1 
ATOM   1948 C  CA    . ILE A 1 255 ? 50.884 -17.034 10.504  1.00 12.41 ? 252 ILE A CA    1 
ATOM   1949 C  C     . ILE A 1 255 ? 50.288 -15.731 9.948   1.00 11.93 ? 252 ILE A C     1 
ATOM   1950 O  O     . ILE A 1 255 ? 50.421 -15.448 8.762   1.00 12.05 ? 252 ILE A O     1 
ATOM   1951 C  CB    . ILE A 1 255 ? 49.847 -18.181 10.565  1.00 14.59 ? 252 ILE A CB    1 
ATOM   1952 C  CG1   . ILE A 1 255 ? 50.597 -19.521 10.690  1.00 18.09 ? 252 ILE A CG1   1 
ATOM   1953 C  CG2   . ILE A 1 255 ? 48.913 -18.163 9.364   1.00 15.55 ? 252 ILE A CG2   1 
ATOM   1954 C  CD1   . ILE A 1 255 ? 49.756 -20.662 11.208  1.00 20.22 ? 252 ILE A CD1   1 
ATOM   1955 N  N     . ARG A 1 256 ? 49.704 -14.910 10.821  1.00 13.79 ? 253 ARG A N     1 
ATOM   1956 C  CA    . ARG A 1 256 ? 48.978 -13.724 10.372  1.00 11.76 ? 253 ARG A CA    1 
ATOM   1957 C  C     . ARG A 1 256 ? 49.900 -12.674 9.766   1.00 14.60 ? 253 ARG A C     1 
ATOM   1958 O  O     . ARG A 1 256 ? 49.438 -11.718 9.126   1.00 14.94 ? 253 ARG A O     1 
ATOM   1959 C  CB    . ARG A 1 256 ? 48.185 -13.111 11.530  1.00 14.07 ? 253 ARG A CB    1 
ATOM   1960 C  CG    . ARG A 1 256 ? 49.068 -12.521 12.609  1.00 14.87 ? 253 ARG A CG    1 
ATOM   1961 C  CD    . ARG A 1 256 ? 48.270 -11.848 13.718  1.00 17.37 ? 253 ARG A CD    1 
ATOM   1962 N  NE    . ARG A 1 256 ? 49.175 -11.381 14.770  1.00 20.19 ? 253 ARG A NE    1 
ATOM   1963 C  CZ    . ARG A 1 256 ? 49.641 -12.135 15.765  1.00 20.83 ? 253 ARG A CZ    1 
ATOM   1964 N  NH1   . ARG A 1 256 ? 49.275 -13.411 15.886  1.00 17.92 ? 253 ARG A NH1   1 
ATOM   1965 N  NH2   . ARG A 1 256 ? 50.476 -11.603 16.652  1.00 21.25 ? 253 ARG A NH2   1 
ATOM   1966 N  N     . LYS A 1 257 ? 51.205 -12.836 9.958   1.00 12.57 ? 254 LYS A N     1 
ATOM   1967 C  CA    . LYS A 1 257 ? 52.135 -11.841 9.442   1.00 12.44 ? 254 LYS A CA    1 
ATOM   1968 C  C     . LYS A 1 257 ? 52.349 -11.961 7.952   1.00 13.26 ? 254 LYS A C     1 
ATOM   1969 O  O     . LYS A 1 257 ? 52.888 -11.045 7.329   1.00 17.83 ? 254 LYS A O     1 
ATOM   1970 C  CB    . LYS A 1 257 ? 53.484 -11.941 10.143  1.00 12.49 ? 254 LYS A CB    1 
ATOM   1971 C  CG    . LYS A 1 257 ? 53.422 -11.689 11.630  1.00 17.01 ? 254 LYS A CG    1 
ATOM   1972 C  CD    . LYS A 1 257 ? 52.708 -10.403 11.978  1.00 19.32 ? 254 LYS A CD    1 
ATOM   1973 C  CE    . LYS A 1 257 ? 52.750 -10.161 13.485  1.00 30.53 ? 254 LYS A CE    1 
ATOM   1974 N  NZ    . LYS A 1 257 ? 52.311 -8.777  13.851  1.00 31.43 ? 254 LYS A NZ    1 
ATOM   1975 N  N     . ILE A 1 258 ? 51.974 -13.099 7.374   1.00 12.99 ? 255 ILE A N     1 
ATOM   1976 C  CA    . ILE A 1 258 ? 52.275 -13.322 5.965   1.00 13.23 ? 255 ILE A CA    1 
ATOM   1977 C  C     . ILE A 1 258 ? 51.129 -12.762 5.136   1.00 14.73 ? 255 ILE A C     1 
ATOM   1978 O  O     . ILE A 1 258 ? 49.960 -12.999 5.445   1.00 14.83 ? 255 ILE A O     1 
ATOM   1979 C  CB    . ILE A 1 258 ? 52.502 -14.825 5.656   1.00 16.58 ? 255 ILE A CB    1 
ATOM   1980 C  CG1   . ILE A 1 258 ? 53.970 -15.199 5.905   1.00 21.10 ? 255 ILE A CG1   1 
ATOM   1981 C  CG2   . ILE A 1 258 ? 52.198 -15.135 4.208   1.00 16.74 ? 255 ILE A CG2   1 
ATOM   1982 C  CD1   . ILE A 1 258 ? 54.408 -15.101 7.336   1.00 22.68 ? 255 ILE A CD1   1 
ATOM   1983 N  N     . ARG A 1 259 ? 51.469 -12.014 4.089   1.00 15.63 ? 256 ARG A N     1 
ATOM   1984 C  CA    . ARG A 1 259 ? 50.469 -11.337 3.275   1.00 15.58 ? 256 ARG A CA    1 
ATOM   1985 C  C     . ARG A 1 259 ? 49.465 -12.343 2.700   1.00 17.69 ? 256 ARG A C     1 
ATOM   1986 O  O     . ARG A 1 259 ? 49.876 -13.353 2.118   1.00 15.80 ? 256 ARG A O     1 
ATOM   1987 C  CB    . ARG A 1 259 ? 51.156 -10.538 2.158   1.00 15.26 ? 256 ARG A CB    1 
ATOM   1988 C  CG    . ARG A 1 259 ? 50.255 -9.539  1.437   1.00 21.86 ? 256 ARG A CG    1 
ATOM   1989 C  CD    . ARG A 1 259 ? 49.991 -9.987  0.014   1.00 35.33 ? 256 ARG A CD    1 
ATOM   1990 N  NE    . ARG A 1 259 ? 51.117 -9.716  -0.879  1.00 33.90 ? 256 ARG A NE    1 
ATOM   1991 C  CZ    . ARG A 1 259 ? 51.217 -10.193 -2.120  1.00 37.33 ? 256 ARG A CZ    1 
ATOM   1992 N  NH1   . ARG A 1 259 ? 50.256 -10.965 -2.616  1.00 40.27 ? 256 ARG A NH1   1 
ATOM   1993 N  NH2   . ARG A 1 259 ? 52.272 -9.891  -2.871  1.00 26.50 ? 256 ARG A NH2   1 
ATOM   1994 N  N     . SER A 1 260 ? 48.173 -12.042 2.913   1.00 14.93 ? 257 SER A N     1 
ATOM   1995 C  CA    . SER A 1 260 ? 46.979 -12.851 2.572   1.00 17.27 ? 257 SER A CA    1 
ATOM   1996 C  C     . SER A 1 260 ? 46.508 -13.738 3.727   1.00 15.68 ? 257 SER A C     1 
ATOM   1997 O  O     . SER A 1 260 ? 45.398 -14.263 3.687   1.00 13.96 ? 257 SER A O     1 
ATOM   1998 C  CB    . SER A 1 260 ? 47.190 -13.724 1.325   1.00 16.25 ? 257 SER A CB    1 
ATOM   1999 O  OG    . SER A 1 260 ? 47.792 -14.974 1.644   1.00 16.39 ? 257 SER A OG    1 
ATOM   2000 N  N     . LEU A 1 261 ? 47.330 -13.888 4.760   1.00 13.49 ? 258 LEU A N     1 
ATOM   2001 C  CA    . LEU A 1 261 ? 46.942 -14.712 5.904   1.00 12.45 ? 258 LEU A CA    1 
ATOM   2002 C  C     . LEU A 1 261 ? 46.535 -13.905 7.140   1.00 13.63 ? 258 LEU A C     1 
ATOM   2003 O  O     . LEU A 1 261 ? 46.372 -14.467 8.218   1.00 12.53 ? 258 LEU A O     1 
ATOM   2004 C  CB    . LEU A 1 261 ? 48.086 -15.671 6.266   1.00 13.00 ? 258 LEU A CB    1 
ATOM   2005 C  CG    . LEU A 1 261 ? 48.450 -16.651 5.148   1.00 11.48 ? 258 LEU A CG    1 
ATOM   2006 C  CD1   . LEU A 1 261 ? 49.505 -17.626 5.653   1.00 14.57 ? 258 LEU A CD1   1 
ATOM   2007 C  CD2   . LEU A 1 261 ? 47.242 -17.441 4.600   1.00 12.97 ? 258 LEU A CD2   1 
ATOM   2008 N  N     . GLY A 1 262 ? 46.348 -12.592 6.991   1.00 14.38 ? 259 GLY A N     1 
ATOM   2009 C  CA    . GLY A 1 262 ? 46.029 -11.748 8.136   1.00 15.29 ? 259 GLY A CA    1 
ATOM   2010 C  C     . GLY A 1 262 ? 44.556 -11.689 8.498   1.00 18.00 ? 259 GLY A C     1 
ATOM   2011 O  O     . GLY A 1 262 ? 44.176 -10.958 9.410   1.00 19.36 ? 259 GLY A O     1 
ATOM   2012 N  N     . GLY A 1 263 ? 43.732 -12.456 7.787   1.00 15.09 ? 260 GLY A N     1 
ATOM   2013 C  CA    . GLY A 1 263 ? 42.292 -12.435 7.965   1.00 17.92 ? 260 GLY A CA    1 
ATOM   2014 C  C     . GLY A 1 263 ? 41.699 -13.791 8.314   1.00 19.14 ? 260 GLY A C     1 
ATOM   2015 O  O     . GLY A 1 263 ? 42.293 -14.563 9.067   1.00 16.37 ? 260 GLY A O     1 
ATOM   2016 N  N     . LYS A 1 264 ? 40.529 -14.101 7.757   1.00 16.65 ? 261 LYS A N     1 
ATOM   2017 C  CA    . LYS A 1 264 ? 39.804 -15.310 8.143   1.00 16.51 ? 261 LYS A CA    1 
ATOM   2018 C  C     . LYS A 1 264 ? 40.550 -16.596 7.761   1.00 16.75 ? 261 LYS A C     1 
ATOM   2019 O  O     . LYS A 1 264 ? 40.542 -17.561 8.531   1.00 19.39 ? 261 LYS A O     1 
ATOM   2020 C  CB    . LYS A 1 264 ? 38.401 -15.308 7.517   1.00 18.45 ? 261 LYS A CB    1 
ATOM   2021 C  CG    . LYS A 1 264 ? 37.473 -14.270 8.132   1.00 22.25 ? 261 LYS A CG    1 
ATOM   2022 C  CD    . LYS A 1 264 ? 36.126 -14.207 7.391   1.00 23.94 ? 261 LYS A CD    1 
ATOM   2023 C  CE    . LYS A 1 264 ? 35.268 -13.050 7.886   1.00 35.27 ? 261 LYS A CE    1 
ATOM   2024 N  NZ    . LYS A 1 264 ? 33.940 -12.991 7.202   1.00 33.49 ? 261 LYS A NZ    1 
ATOM   2025 N  N     . LEU A 1 265 ? 41.181 -16.622 6.586   1.00 15.68 ? 262 LEU A N     1 
ATOM   2026 C  CA    . LEU A 1 265 ? 41.917 -17.817 6.167   1.00 14.59 ? 262 LEU A CA    1 
ATOM   2027 C  C     . LEU A 1 265 ? 43.023 -18.135 7.161   1.00 12.92 ? 262 LEU A C     1 
ATOM   2028 O  O     . LEU A 1 265 ? 43.179 -19.277 7.600   1.00 14.93 ? 262 LEU A O     1 
ATOM   2029 C  CB    . LEU A 1 265 ? 42.532 -17.652 4.776   1.00 14.88 ? 262 LEU A CB    1 
ATOM   2030 C  CG    . LEU A 1 265 ? 43.346 -18.834 4.239   1.00 17.89 ? 262 LEU A CG    1 
ATOM   2031 C  CD1   . LEU A 1 265 ? 42.449 -20.078 4.116   1.00 17.83 ? 262 LEU A CD1   1 
ATOM   2032 C  CD2   . LEU A 1 265 ? 44.001 -18.529 2.902   1.00 15.32 ? 262 LEU A CD2   1 
ATOM   2033 N  N     . GLY A 1 266 ? 43.815 -17.126 7.497   1.00 14.69 ? 263 GLY A N     1 
ATOM   2034 C  CA    . GLY A 1 266 ? 44.879 -17.327 8.466   1.00 11.29 ? 263 GLY A CA    1 
ATOM   2035 C  C     . GLY A 1 266 ? 44.367 -17.805 9.814   1.00 14.11 ? 263 GLY A C     1 
ATOM   2036 O  O     . GLY A 1 266 ? 44.985 -18.654 10.456  1.00 13.32 ? 263 GLY A O     1 
ATOM   2037 N  N     . ALA A 1 267 ? 43.237 -17.255 10.259  1.00 13.77 ? 264 ALA A N     1 
ATOM   2038 C  CA    . ALA A 1 267 ? 42.650 -17.705 11.508  1.00 15.74 ? 264 ALA A CA    1 
ATOM   2039 C  C     . ALA A 1 267 ? 42.229 -19.158 11.402  1.00 14.04 ? 264 ALA A C     1 
ATOM   2040 O  O     . ALA A 1 267 ? 42.317 -19.900 12.370  1.00 18.39 ? 264 ALA A O     1 
ATOM   2041 C  CB    . ALA A 1 267 ? 41.459 -16.823 11.885  1.00 15.50 ? 264 ALA A CB    1 
ATOM   2042 N  N     . SER A 1 268 ? 41.790 -19.569 10.215  1.00 14.39 ? 265 SER A N     1 
ATOM   2043 C  CA    . SER A 1 268 ? 41.315 -20.936 10.023  1.00 14.91 ? 265 SER A CA    1 
ATOM   2044 C  C     . SER A 1 268 ? 42.510 -21.893 10.020  1.00 12.69 ? 265 SER A C     1 
ATOM   2045 O  O     . SER A 1 268 ? 42.421 -22.990 10.556  1.00 15.76 ? 265 SER A O     1 
ATOM   2046 C  CB    . SER A 1 268 ? 40.499 -21.065 8.725   1.00 15.92 ? 265 SER A CB    1 
ATOM   2047 O  OG    A SER A 1 268 ? 39.644 -19.949 8.541   0.19 17.04 ? 265 SER A OG    1 
ATOM   2048 O  OG    B SER A 1 268 ? 41.304 -21.040 7.568   0.47 17.90 ? 265 SER A OG    1 
ATOM   2049 O  OG    C SER A 1 268 ? 40.168 -22.418 8.482   0.33 16.74 ? 265 SER A OG    1 
ATOM   2050 N  N     . VAL A 1 269 ? 43.625 -21.469 9.426   1.00 13.72 ? 266 VAL A N     1 
ATOM   2051 C  CA    . VAL A 1 269 ? 44.841 -22.284 9.418   1.00 13.68 ? 266 VAL A CA    1 
ATOM   2052 C  C     . VAL A 1 269 ? 45.206 -22.621 10.865  1.00 16.02 ? 266 VAL A C     1 
ATOM   2053 O  O     . VAL A 1 269 ? 45.422 -23.789 11.228  1.00 15.52 ? 266 VAL A O     1 
ATOM   2054 C  CB    . VAL A 1 269 ? 46.001 -21.563 8.706   1.00 13.83 ? 266 VAL A CB    1 
ATOM   2055 C  CG1   . VAL A 1 269 ? 47.311 -22.317 8.908   1.00 19.02 ? 266 VAL A CG1   1 
ATOM   2056 C  CG2   . VAL A 1 269 ? 45.693 -21.419 7.202   1.00 13.22 ? 266 VAL A CG2   1 
ATOM   2057 N  N     . ILE A 1 270 ? 45.192 -21.590 11.699  1.00 13.45 ? 267 ILE A N     1 
ATOM   2058 C  CA    . ILE A 1 270 ? 45.543 -21.702 13.112  1.00 16.15 ? 267 ILE A CA    1 
ATOM   2059 C  C     . ILE A 1 270 ? 44.576 -22.612 13.862  1.00 16.08 ? 267 ILE A C     1 
ATOM   2060 O  O     . ILE A 1 270 ? 44.995 -23.490 14.625  1.00 20.22 ? 267 ILE A O     1 
ATOM   2061 C  CB    . ILE A 1 270 ? 45.565 -20.292 13.760  1.00 15.84 ? 267 ILE A CB    1 
ATOM   2062 C  CG1   . ILE A 1 270 ? 46.714 -19.460 13.184  1.00 17.05 ? 267 ILE A CG1   1 
ATOM   2063 C  CG2   . ILE A 1 270 ? 45.635 -20.366 15.275  1.00 21.33 ? 267 ILE A CG2   1 
ATOM   2064 C  CD1   . ILE A 1 270 ? 46.643 -17.985 13.540  1.00 21.32 ? 267 ILE A CD1   1 
ATOM   2065 N  N     . GLU A 1 271 ? 43.280 -22.412 13.637  1.00 15.44 ? 268 GLU A N     1 
ATOM   2066 C  CA    . GLU A 1 271 ? 42.264 -23.165 14.369  1.00 17.75 ? 268 GLU A CA    1 
ATOM   2067 C  C     . GLU A 1 271 ? 42.228 -24.621 13.966  1.00 18.51 ? 268 GLU A C     1 
ATOM   2068 O  O     . GLU A 1 271 ? 42.244 -25.507 14.817  1.00 19.32 ? 268 GLU A O     1 
ATOM   2069 C  CB    . GLU A 1 271 ? 40.887 -22.544 14.154  1.00 22.83 ? 268 GLU A CB    1 
ATOM   2070 C  CG    . GLU A 1 271 ? 39.760 -23.211 14.934  1.00 36.93 ? 268 GLU A CG    1 
ATOM   2071 C  CD    . GLU A 1 271 ? 38.611 -22.257 15.195  1.00 41.01 ? 268 GLU A CD    1 
ATOM   2072 O  OE1   . GLU A 1 271 ? 38.874 -21.044 15.371  1.00 51.22 ? 268 GLU A OE1   1 
ATOM   2073 O  OE2   . GLU A 1 271 ? 37.446 -22.712 15.205  1.00 44.94 ? 268 GLU A OE2   1 
ATOM   2074 N  N     . ILE A 1 272 ? 42.170 -24.864 12.662  1.00 18.48 ? 269 ILE A N     1 
ATOM   2075 C  CA    . ILE A 1 272 ? 42.005 -26.210 12.137  1.00 16.47 ? 269 ILE A CA    1 
ATOM   2076 C  C     . ILE A 1 272 ? 43.227 -27.081 12.400  1.00 17.11 ? 269 ILE A C     1 
ATOM   2077 O  O     . ILE A 1 272 ? 43.107 -28.262 12.747  1.00 21.15 ? 269 ILE A O     1 
ATOM   2078 C  CB    . ILE A 1 272 ? 41.706 -26.169 10.622  1.00 16.34 ? 269 ILE A CB    1 
ATOM   2079 C  CG1   . ILE A 1 272 ? 40.289 -25.638 10.377  1.00 17.95 ? 269 ILE A CG1   1 
ATOM   2080 C  CG2   . ILE A 1 272 ? 41.885 -27.543 9.989   1.00 17.19 ? 269 ILE A CG2   1 
ATOM   2081 C  CD1   . ILE A 1 272 ? 39.873 -25.607 8.905   1.00 22.34 ? 269 ILE A CD1   1 
ATOM   2082 N  N     . LEU A 1 273 ? 44.412 -26.505 12.226  1.00 18.41 ? 270 LEU A N     1 
ATOM   2083 C  CA    . LEU A 1 273 ? 45.638 -27.295 12.336  1.00 15.51 ? 270 LEU A CA    1 
ATOM   2084 C  C     . LEU A 1 273 ? 46.230 -27.255 13.730  1.00 16.42 ? 270 LEU A C     1 
ATOM   2085 O  O     . LEU A 1 273 ? 47.113 -28.053 14.060  1.00 18.44 ? 270 LEU A O     1 
ATOM   2086 C  CB    . LEU A 1 273 ? 46.670 -26.816 11.327  1.00 18.85 ? 270 LEU A CB    1 
ATOM   2087 C  CG    . LEU A 1 273 ? 46.251 -26.939 9.865   1.00 16.13 ? 270 LEU A CG    1 
ATOM   2088 C  CD1   . LEU A 1 273 ? 47.357 -26.400 8.973   1.00 15.74 ? 270 LEU A CD1   1 
ATOM   2089 C  CD2   . LEU A 1 273 ? 45.946 -28.391 9.530   1.00 20.26 ? 270 LEU A CD2   1 
ATOM   2090 N  N     . GLY A 1 274 ? 45.755 -26.321 14.548  1.00 17.91 ? 271 GLY A N     1 
ATOM   2091 C  CA    . GLY A 1 274 ? 46.248 -26.200 15.907  1.00 15.31 ? 271 GLY A CA    1 
ATOM   2092 C  C     . GLY A 1 274 ? 47.701 -25.793 15.953  1.00 17.77 ? 271 GLY A C     1 
ATOM   2093 O  O     . GLY A 1 274 ? 48.486 -26.322 16.748  1.00 22.49 ? 271 GLY A O     1 
ATOM   2094 N  N     . ILE A 1 275 ? 48.064 -24.850 15.089  1.00 14.82 ? 272 ILE A N     1 
ATOM   2095 C  CA    . ILE A 1 275 ? 49.428 -24.325 15.047  1.00 15.75 ? 272 ILE A CA    1 
ATOM   2096 C  C     . ILE A 1 275 ? 49.440 -22.798 15.217  1.00 15.37 ? 272 ILE A C     1 
ATOM   2097 O  O     . ILE A 1 275 ? 48.397 -22.155 15.171  1.00 17.55 ? 272 ILE A O     1 
ATOM   2098 C  CB    . ILE A 1 275 ? 50.129 -24.684 13.724  1.00 13.80 ? 272 ILE A CB    1 
ATOM   2099 C  CG1   . ILE A 1 275 ? 49.393 -24.082 12.522  1.00 16.28 ? 272 ILE A CG1   1 
ATOM   2100 C  CG2   . ILE A 1 275 ? 50.257 -26.205 13.560  1.00 12.89 ? 272 ILE A CG2   1 
ATOM   2101 C  CD1   . ILE A 1 275 ? 50.124 -24.358 11.191  1.00 15.20 ? 272 ILE A CD1   1 
ATOM   2102 N  N     . GLU A 1 276 ? 50.623 -22.220 15.403  1.00 14.21 ? 273 GLU A N     1 
ATOM   2103 C  CA    . GLU A 1 276 ? 50.755 -20.769 15.551  1.00 15.23 ? 273 GLU A CA    1 
ATOM   2104 C  C     . GLU A 1 276 ? 51.706 -20.128 14.537  1.00 14.92 ? 273 GLU A C     1 
ATOM   2105 O  O     . GLU A 1 276 ? 51.524 -18.980 14.157  1.00 14.91 ? 273 GLU A O     1 
ATOM   2106 C  CB    . GLU A 1 276 ? 51.259 -20.398 16.953  1.00 18.82 ? 273 GLU A CB    1 
ATOM   2107 C  CG    . GLU A 1 276 ? 50.428 -20.930 18.110  1.00 27.66 ? 273 GLU A CG    1 
ATOM   2108 C  CD    . GLU A 1 276 ? 51.065 -20.643 19.465  1.00 32.80 ? 273 GLU A CD    1 
ATOM   2109 O  OE1   . GLU A 1 276 ? 50.924 -21.487 20.378  1.00 43.72 ? 273 GLU A OE1   1 
ATOM   2110 O  OE2   . GLU A 1 276 ? 51.694 -19.572 19.624  1.00 37.78 ? 273 GLU A OE2   1 
ATOM   2111 N  N     . TYR A 1 277 ? 52.747 -20.853 14.143  1.00 15.72 ? 274 TYR A N     1 
ATOM   2112 C  CA    . TYR A 1 277 ? 53.838 -20.249 13.367  1.00 13.37 ? 274 TYR A CA    1 
ATOM   2113 C  C     . TYR A 1 277 ? 53.916 -20.806 11.956  1.00 16.02 ? 274 TYR A C     1 
ATOM   2114 O  O     . TYR A 1 277 ? 53.597 -21.977 11.710  1.00 14.73 ? 274 TYR A O     1 
ATOM   2115 C  CB    . TYR A 1 277 ? 55.189 -20.453 14.072  1.00 15.17 ? 274 TYR A CB    1 
ATOM   2116 C  CG    . TYR A 1 277 ? 55.195 -19.938 15.493  1.00 13.32 ? 274 TYR A CG    1 
ATOM   2117 C  CD1   . TYR A 1 277 ? 55.427 -20.795 16.559  1.00 16.93 ? 274 TYR A CD1   1 
ATOM   2118 C  CD2   . TYR A 1 277 ? 54.922 -18.606 15.762  1.00 16.06 ? 274 TYR A CD2   1 
ATOM   2119 C  CE1   . TYR A 1 277 ? 55.413 -20.338 17.857  1.00 15.61 ? 274 TYR A CE1   1 
ATOM   2120 C  CE2   . TYR A 1 277 ? 54.888 -18.130 17.065  1.00 16.50 ? 274 TYR A CE2   1 
ATOM   2121 C  CZ    . TYR A 1 277 ? 55.138 -19.011 18.112  1.00 19.92 ? 274 TYR A CZ    1 
ATOM   2122 O  OH    . TYR A 1 277 ? 55.116 -18.569 19.415  1.00 22.20 ? 274 TYR A OH    1 
ATOM   2123 N  N     . MET A 1 278 ? 54.366 -19.963 11.033  1.00 10.53 ? 275 MET A N     1 
ATOM   2124 C  CA    . MET A 1 278 ? 54.452 -20.344 9.636   1.00 11.22 ? 275 MET A CA    1 
ATOM   2125 C  C     . MET A 1 278 ? 55.239 -21.645 9.456   1.00 13.28 ? 275 MET A C     1 
ATOM   2126 O  O     . MET A 1 278 ? 54.857 -22.502 8.663   1.00 12.81 ? 275 MET A O     1 
ATOM   2127 C  CB    . MET A 1 278 ? 55.096 -19.216 8.825   1.00 16.49 ? 275 MET A CB    1 
ATOM   2128 C  CG    . MET A 1 278 ? 54.715 -19.197 7.371   1.00 18.80 ? 275 MET A CG    1 
ATOM   2129 S  SD    . MET A 1 278 ? 52.942 -18.930 7.092   1.00 19.13 ? 275 MET A SD    1 
ATOM   2130 C  CE    . MET A 1 278 ? 52.901 -19.426 5.371   1.00 26.71 ? 275 MET A CE    1 
ATOM   2131 N  N     . GLY A 1 279 ? 56.325 -21.801 10.209  1.00 10.77 ? 276 GLY A N     1 
ATOM   2132 C  CA    . GLY A 1 279 ? 57.191 -22.955 10.032  1.00 13.87 ? 276 GLY A CA    1 
ATOM   2133 C  C     . GLY A 1 279 ? 56.489 -24.272 10.348  1.00 14.58 ? 276 GLY A C     1 
ATOM   2134 O  O     . GLY A 1 279 ? 56.829 -25.325 9.793   1.00 14.83 ? 276 GLY A O     1 
ATOM   2135 N  N     . GLU A 1 280 ? 55.488 -24.221 11.228  1.00 11.56 ? 277 GLU A N     1 
ATOM   2136 C  CA    . GLU A 1 280 ? 54.780 -25.436 11.615  1.00 11.04 ? 277 GLU A CA    1 
ATOM   2137 C  C     . GLU A 1 280 ? 53.990 -26.037 10.446  1.00 11.32 ? 277 GLU A C     1 
ATOM   2138 O  O     . GLU A 1 280 ? 53.613 -27.209 10.481  1.00 12.22 ? 277 GLU A O     1 
ATOM   2139 C  CB    . GLU A 1 280 ? 53.830 -25.163 12.785  1.00 12.67 ? 277 GLU A CB    1 
ATOM   2140 C  CG    . GLU A 1 280 ? 54.511 -24.792 14.081  1.00 14.03 ? 277 GLU A CG    1 
ATOM   2141 C  CD    . GLU A 1 280 ? 53.507 -24.567 15.184  1.00 17.15 ? 277 GLU A CD    1 
ATOM   2142 O  OE1   . GLU A 1 280 ? 53.188 -23.400 15.439  1.00 15.61 ? 277 GLU A OE1   1 
ATOM   2143 O  OE2   . GLU A 1 280 ? 53.028 -25.551 15.782  1.00 19.10 ? 277 GLU A OE2   1 
ATOM   2144 N  N     . LEU A 1 281 ? 53.753 -25.255 9.405   1.00 11.02 ? 278 LEU A N     1 
ATOM   2145 C  CA    . LEU A 1 281 ? 53.020 -25.765 8.253   1.00 10.55 ? 278 LEU A CA    1 
ATOM   2146 C  C     . LEU A 1 281 ? 53.768 -26.864 7.513   1.00 11.84 ? 278 LEU A C     1 
ATOM   2147 O  O     . LEU A 1 281 ? 53.145 -27.642 6.780   1.00 11.13 ? 278 LEU A O     1 
ATOM   2148 C  CB    . LEU A 1 281 ? 52.701 -24.635 7.274   1.00 12.16 ? 278 LEU A CB    1 
ATOM   2149 C  CG    . LEU A 1 281 ? 51.499 -23.776 7.655   1.00 15.19 ? 278 LEU A CG    1 
ATOM   2150 C  CD1   . LEU A 1 281 ? 51.535 -22.446 6.852   1.00 12.91 ? 278 LEU A CD1   1 
ATOM   2151 C  CD2   . LEU A 1 281 ? 50.206 -24.532 7.410   1.00 15.30 ? 278 LEU A CD2   1 
ATOM   2152 N  N     . THR A 1 282 ? 55.089 -26.925 7.670   1.00 13.26 ? 279 THR A N     1 
ATOM   2153 C  CA    . THR A 1 282 ? 55.874 -27.856 6.849   1.00 15.12 ? 279 THR A CA    1 
ATOM   2154 C  C     . THR A 1 282 ? 55.517 -29.316 7.138   1.00 14.16 ? 279 THR A C     1 
ATOM   2155 O  O     . THR A 1 282 ? 55.770 -30.186 6.317   1.00 15.86 ? 279 THR A O     1 
ATOM   2156 C  CB    . THR A 1 282 ? 57.406 -27.689 7.047   1.00 14.00 ? 279 THR A CB    1 
ATOM   2157 O  OG1   . THR A 1 282 ? 57.751 -28.008 8.405   1.00 15.27 ? 279 THR A OG1   1 
ATOM   2158 C  CG2   . THR A 1 282 ? 57.879 -26.265 6.702   1.00 13.63 ? 279 THR A CG2   1 
ATOM   2159 N  N     . GLN A 1 283 ? 54.945 -29.583 8.307   1.00 13.88 ? 280 GLN A N     1 
ATOM   2160 C  CA    . GLN A 1 283 ? 54.651 -30.962 8.685   1.00 16.39 ? 280 GLN A CA    1 
ATOM   2161 C  C     . GLN A 1 283 ? 53.408 -31.547 8.028   1.00 18.62 ? 280 GLN A C     1 
ATOM   2162 O  O     . GLN A 1 283 ? 53.071 -32.700 8.270   1.00 22.69 ? 280 GLN A O     1 
ATOM   2163 C  CB    . GLN A 1 283 ? 54.513 -31.046 10.201  1.00 15.21 ? 280 GLN A CB    1 
ATOM   2164 C  CG    A GLN A 1 283 ? 53.268 -30.411 10.735  0.49 16.09 ? 280 GLN A CG    1 
ATOM   2165 C  CG    B GLN A 1 283 ? 55.838 -30.785 10.859  0.51 13.26 ? 280 GLN A CG    1 
ATOM   2166 C  CD    A GLN A 1 283 ? 53.335 -30.201 12.232  0.49 22.73 ? 280 GLN A CD    1 
ATOM   2167 C  CD    B GLN A 1 283 ? 56.945 -31.545 10.159  0.51 17.51 ? 280 GLN A CD    1 
ATOM   2168 O  OE1   A GLN A 1 283 ? 53.552 -31.144 12.995  0.49 23.17 ? 280 GLN A OE1   1 
ATOM   2169 O  OE1   B GLN A 1 283 ? 56.937 -32.776 10.132  0.51 20.43 ? 280 GLN A OE1   1 
ATOM   2170 N  NE2   A GLN A 1 283 ? 53.171 -28.955 12.658  0.49 15.76 ? 280 GLN A NE2   1 
ATOM   2171 N  NE2   B GLN A 1 283 ? 57.888 -30.817 9.560   0.51 21.43 ? 280 GLN A NE2   1 
ATOM   2172 N  N     . PHE A 1 284 ? 52.719 -30.768 7.206   1.00 15.52 ? 281 PHE A N     1 
ATOM   2173 C  CA    . PHE A 1 284 ? 51.521 -31.266 6.544   1.00 14.72 ? 281 PHE A CA    1 
ATOM   2174 C  C     . PHE A 1 284 ? 51.820 -31.568 5.081   1.00 17.12 ? 281 PHE A C     1 
ATOM   2175 O  O     . PHE A 1 284 ? 52.685 -30.933 4.465   1.00 16.75 ? 281 PHE A O     1 
ATOM   2176 C  CB    . PHE A 1 284 ? 50.373 -30.263 6.686   1.00 13.56 ? 281 PHE A CB    1 
ATOM   2177 C  CG    . PHE A 1 284 ? 50.017 -29.986 8.119   1.00 13.74 ? 281 PHE A CG    1 
ATOM   2178 C  CD1   . PHE A 1 284 ? 49.132 -30.811 8.795   1.00 19.15 ? 281 PHE A CD1   1 
ATOM   2179 C  CD2   . PHE A 1 284 ? 50.611 -28.942 8.809   1.00 16.14 ? 281 PHE A CD2   1 
ATOM   2180 C  CE1   . PHE A 1 284 ? 48.826 -30.574 10.124  1.00 20.70 ? 281 PHE A CE1   1 
ATOM   2181 C  CE2   . PHE A 1 284 ? 50.318 -28.711 10.131  1.00 14.93 ? 281 PHE A CE2   1 
ATOM   2182 C  CZ    . PHE A 1 284 ? 49.429 -29.524 10.796  1.00 17.36 ? 281 PHE A CZ    1 
ATOM   2183 N  N     . THR A 1 285 ? 51.134 -32.563 4.533   1.00 18.17 ? 282 THR A N     1 
ATOM   2184 C  CA    . THR A 1 285 ? 51.304 -32.850 3.120   1.00 16.38 ? 282 THR A CA    1 
ATOM   2185 C  C     . THR A 1 285 ? 50.571 -31.801 2.324   1.00 15.19 ? 282 THR A C     1 
ATOM   2186 O  O     . THR A 1 285 ? 49.696 -31.127 2.845   1.00 14.94 ? 282 THR A O     1 
ATOM   2187 C  CB    . THR A 1 285 ? 50.775 -34.243 2.725   1.00 13.90 ? 282 THR A CB    1 
ATOM   2188 O  OG1   . THR A 1 285 ? 49.352 -34.271 2.859   1.00 16.87 ? 282 THR A OG1   1 
ATOM   2189 C  CG2   . THR A 1 285 ? 51.404 -35.303 3.608   1.00 20.29 ? 282 THR A CG2   1 
ATOM   2190 N  N     . GLU A 1 286 ? 50.925 -31.674 1.053   1.00 15.46 ? 283 GLU A N     1 
ATOM   2191 C  CA    . GLU A 1 286 ? 50.210 -30.768 0.178   1.00 14.67 ? 283 GLU A CA    1 
ATOM   2192 C  C     . GLU A 1 286 ? 48.722 -31.156 0.118   1.00 14.40 ? 283 GLU A C     1 
ATOM   2193 O  O     . GLU A 1 286 ? 47.836 -30.290 0.215   1.00 15.34 ? 283 GLU A O     1 
ATOM   2194 C  CB    . GLU A 1 286 ? 50.853 -30.760 -1.217  1.00 13.53 ? 283 GLU A CB    1 
ATOM   2195 C  CG    . GLU A 1 286 ? 50.253 -29.710 -2.121  1.00 14.78 ? 283 GLU A CG    1 
ATOM   2196 C  CD    . GLU A 1 286 ? 51.016 -29.544 -3.420  1.00 20.02 ? 283 GLU A CD    1 
ATOM   2197 O  OE1   . GLU A 1 286 ? 51.962 -30.316 -3.661  1.00 24.99 ? 283 GLU A OE1   1 
ATOM   2198 O  OE2   . GLU A 1 286 ? 50.671 -28.626 -4.197  1.00 21.42 ? 283 GLU A OE2   1 
ATOM   2199 N  N     . SER A 1 287 ? 48.442 -32.458 0.025   1.00 15.26 ? 284 SER A N     1 
ATOM   2200 C  CA    . SER A 1 287 ? 47.056 -32.908 -0.044  1.00 15.55 ? 284 SER A CA    1 
ATOM   2201 C  C     . SER A 1 287 ? 46.306 -32.557 1.236   1.00 14.31 ? 284 SER A C     1 
ATOM   2202 O  O     . SER A 1 287 ? 45.122 -32.195 1.190   1.00 15.70 ? 284 SER A O     1 
ATOM   2203 C  CB    . SER A 1 287 ? 46.986 -34.418 -0.303  1.00 17.64 ? 284 SER A CB    1 
ATOM   2204 O  OG    A SER A 1 287 ? 47.552 -34.730 -1.559  0.77 21.35 ? 284 SER A OG    1 
ATOM   2205 O  OG    B SER A 1 287 ? 47.716 -35.135 0.674   0.23 15.34 ? 284 SER A OG    1 
ATOM   2206 N  N     . GLN A 1 288 ? 46.998 -32.620 2.378   1.00 16.16 ? 285 GLN A N     1 
ATOM   2207 C  CA    . GLN A 1 288 ? 46.348 -32.281 3.642   1.00 14.40 ? 285 GLN A CA    1 
ATOM   2208 C  C     . GLN A 1 288 ? 45.938 -30.814 3.651   1.00 12.30 ? 285 GLN A C     1 
ATOM   2209 O  O     . GLN A 1 288 ? 44.817 -30.457 4.030   1.00 15.40 ? 285 GLN A O     1 
ATOM   2210 C  CB    . GLN A 1 288 ? 47.272 -32.554 4.833   1.00 13.77 ? 285 GLN A CB    1 
ATOM   2211 C  CG    . GLN A 1 288 ? 47.256 -33.968 5.346   1.00 20.58 ? 285 GLN A CG    1 
ATOM   2212 C  CD    . GLN A 1 288 ? 48.207 -34.150 6.520   1.00 23.54 ? 285 GLN A CD    1 
ATOM   2213 O  OE1   . GLN A 1 288 ? 49.378 -33.786 6.445   1.00 18.99 ? 285 GLN A OE1   1 
ATOM   2214 N  NE2   . GLN A 1 288 ? 47.700 -34.716 7.613   1.00 26.92 ? 285 GLN A NE2   1 
ATOM   2215 N  N     . LEU A 1 289 ? 46.867 -29.958 3.249   1.00 15.82 ? 286 LEU A N     1 
ATOM   2216 C  CA    . LEU A 1 289 ? 46.569 -28.536 3.237   1.00 12.44 ? 286 LEU A CA    1 
ATOM   2217 C  C     . LEU A 1 289 ? 45.466 -28.228 2.226   1.00 15.12 ? 286 LEU A C     1 
ATOM   2218 O  O     . LEU A 1 289 ? 44.581 -27.413 2.492   1.00 15.59 ? 286 LEU A O     1 
ATOM   2219 C  CB    . LEU A 1 289 ? 47.822 -27.724 2.932   1.00 12.59 ? 286 LEU A CB    1 
ATOM   2220 C  CG    . LEU A 1 289 ? 48.910 -27.823 4.001   1.00 13.74 ? 286 LEU A CG    1 
ATOM   2221 C  CD1   . LEU A 1 289 ? 50.138 -27.024 3.555   1.00 14.50 ? 286 LEU A CD1   1 
ATOM   2222 C  CD2   . LEU A 1 289 ? 48.399 -27.383 5.387   1.00 14.54 ? 286 LEU A CD2   1 
ATOM   2223 N  N     . GLN A 1 290 ? 45.520 -28.882 1.070   1.00 14.68 ? 287 GLN A N     1 
ATOM   2224 C  CA    . GLN A 1 290 ? 44.460 -28.713 0.074   1.00 16.93 ? 287 GLN A CA    1 
ATOM   2225 C  C     . GLN A 1 290 ? 43.093 -29.146 0.589   1.00 16.85 ? 287 GLN A C     1 
ATOM   2226 O  O     . GLN A 1 290 ? 42.059 -28.542 0.265   1.00 17.10 ? 287 GLN A O     1 
ATOM   2227 C  CB    . GLN A 1 290 ? 44.806 -29.496 -1.191  1.00 16.97 ? 287 GLN A CB    1 
ATOM   2228 C  CG    . GLN A 1 290 ? 45.939 -28.891 -1.987  1.00 19.37 ? 287 GLN A CG    1 
ATOM   2229 C  CD    . GLN A 1 290 ? 46.322 -29.739 -3.177  1.00 20.21 ? 287 GLN A CD    1 
ATOM   2230 O  OE1   . GLN A 1 290 ? 46.340 -30.974 -3.102  1.00 19.62 ? 287 GLN A OE1   1 
ATOM   2231 N  NE2   . GLN A 1 290 ? 46.644 -29.083 -4.282  1.00 23.69 ? 287 GLN A NE2   1 
ATOM   2232 N  N     . SER A 1 291 ? 43.071 -30.192 1.403   1.00 17.89 ? 288 SER A N     1 
ATOM   2233 C  CA    . SER A 1 291 ? 41.797 -30.686 1.926   1.00 17.41 ? 288 SER A CA    1 
ATOM   2234 C  C     . SER A 1 291 ? 41.113 -29.660 2.833   1.00 20.08 ? 288 SER A C     1 
ATOM   2235 O  O     . SER A 1 291 ? 39.886 -29.530 2.828   1.00 25.45 ? 288 SER A O     1 
ATOM   2236 C  CB    . SER A 1 291 ? 41.996 -32.006 2.681   1.00 18.34 ? 288 SER A CB    1 
ATOM   2237 O  OG    . SER A 1 291 ? 42.621 -31.800 3.944   1.00 22.16 ? 288 SER A OG    1 
ATOM   2238 N  N     . HIS A 1 292 ? 41.897 -28.917 3.607   1.00 18.94 ? 289 HIS A N     1 
ATOM   2239 C  CA    . HIS A 1 292 ? 41.316 -27.933 4.505   1.00 18.91 ? 289 HIS A CA    1 
ATOM   2240 C  C     . HIS A 1 292 ? 41.039 -26.581 3.844   1.00 19.56 ? 289 HIS A C     1 
ATOM   2241 O  O     . HIS A 1 292 ? 40.045 -25.926 4.157   1.00 22.20 ? 289 HIS A O     1 
ATOM   2242 C  CB    . HIS A 1 292 ? 42.231 -27.706 5.702   1.00 19.70 ? 289 HIS A CB    1 
ATOM   2243 C  CG    . HIS A 1 292 ? 42.442 -28.919 6.551   1.00 16.02 ? 289 HIS A CG    1 
ATOM   2244 N  ND1   . HIS A 1 292 ? 41.422 -29.525 7.257   1.00 23.86 ? 289 HIS A ND1   1 
ATOM   2245 C  CD2   . HIS A 1 292 ? 43.568 -29.607 6.851   1.00 21.49 ? 289 HIS A CD2   1 
ATOM   2246 C  CE1   . HIS A 1 292 ? 41.909 -30.550 7.933   1.00 21.92 ? 289 HIS A CE1   1 
ATOM   2247 N  NE2   . HIS A 1 292 ? 43.210 -30.617 7.711   1.00 26.07 ? 289 HIS A NE2   1 
ATOM   2248 N  N     . PHE A 1 293 ? 41.930 -26.151 2.953   1.00 16.74 ? 290 PHE A N     1 
ATOM   2249 C  CA    . PHE A 1 293 ? 41.928 -24.756 2.512   1.00 17.61 ? 290 PHE A CA    1 
ATOM   2250 C  C     . PHE A 1 293 ? 41.646 -24.589 1.024   1.00 19.50 ? 290 PHE A C     1 
ATOM   2251 O  O     . PHE A 1 293 ? 41.642 -23.466 0.505   1.00 17.55 ? 290 PHE A O     1 
ATOM   2252 C  CB    . PHE A 1 293 ? 43.266 -24.115 2.915   1.00 13.07 ? 290 PHE A CB    1 
ATOM   2253 C  CG    . PHE A 1 293 ? 43.587 -24.341 4.369   1.00 14.92 ? 290 PHE A CG    1 
ATOM   2254 C  CD1   . PHE A 1 293 ? 42.734 -23.854 5.355   1.00 15.81 ? 290 PHE A CD1   1 
ATOM   2255 C  CD2   . PHE A 1 293 ? 44.691 -25.082 4.751   1.00 12.56 ? 290 PHE A CD2   1 
ATOM   2256 C  CE1   . PHE A 1 293 ? 42.989 -24.094 6.691   1.00 16.43 ? 290 PHE A CE1   1 
ATOM   2257 C  CE2   . PHE A 1 293 ? 44.957 -25.321 6.082   1.00 14.36 ? 290 PHE A CE2   1 
ATOM   2258 C  CZ    . PHE A 1 293 ? 44.103 -24.831 7.051   1.00 14.41 ? 290 PHE A CZ    1 
ATOM   2259 N  N     . GLY A 1 294 ? 41.377 -25.703 0.346   1.00 17.75 ? 291 GLY A N     1 
ATOM   2260 C  CA    . GLY A 1 294 ? 41.137 -25.668 -1.083  1.00 19.73 ? 291 GLY A CA    1 
ATOM   2261 C  C     . GLY A 1 294 ? 42.403 -25.927 -1.867  1.00 17.94 ? 291 GLY A C     1 
ATOM   2262 O  O     . GLY A 1 294 ? 43.515 -25.757 -1.359  1.00 17.74 ? 291 GLY A O     1 
ATOM   2263 N  N     . GLU A 1 295 ? 42.234 -26.337 -3.116  1.00 16.87 ? 292 GLU A N     1 
ATOM   2264 C  CA    . GLU A 1 295 ? 43.346 -26.682 -3.983  1.00 18.64 ? 292 GLU A CA    1 
ATOM   2265 C  C     . GLU A 1 295 ? 44.392 -25.573 -4.117  1.00 16.97 ? 292 GLU A C     1 
ATOM   2266 O  O     . GLU A 1 295 ? 45.586 -25.818 -3.954  1.00 17.43 ? 292 GLU A O     1 
ATOM   2267 C  CB    . GLU A 1 295 ? 42.818 -27.064 -5.366  1.00 23.61 ? 292 GLU A CB    1 
ATOM   2268 C  CG    . GLU A 1 295 ? 43.870 -27.639 -6.281  1.00 22.69 ? 292 GLU A CG    1 
ATOM   2269 C  CD    . GLU A 1 295 ? 43.284 -28.239 -7.553  1.00 37.06 ? 292 GLU A CD    1 
ATOM   2270 O  OE1   . GLU A 1 295 ? 44.040 -28.901 -8.299  1.00 44.37 ? 292 GLU A OE1   1 
ATOM   2271 O  OE2   . GLU A 1 295 ? 42.068 -28.066 -7.804  1.00 27.82 ? 292 GLU A OE2   1 
ATOM   2272 N  N     . LYS A 1 296 ? 43.944 -24.355 -4.414  1.00 15.24 ? 293 LYS A N     1 
ATOM   2273 C  CA    . LYS A 1 296 ? 44.874 -23.263 -4.691  1.00 15.13 ? 293 LYS A CA    1 
ATOM   2274 C  C     . LYS A 1 296 ? 45.581 -22.825 -3.408  1.00 16.43 ? 293 LYS A C     1 
ATOM   2275 O  O     . LYS A 1 296 ? 46.814 -22.748 -3.357  1.00 14.63 ? 293 LYS A O     1 
ATOM   2276 C  CB    . LYS A 1 296 ? 44.126 -22.083 -5.339  1.00 18.38 ? 293 LYS A CB    1 
ATOM   2277 C  CG    . LYS A 1 296 ? 45.026 -21.064 -6.006  1.00 28.45 ? 293 LYS A CG    1 
ATOM   2278 C  CD    . LYS A 1 296 ? 44.206 -20.060 -6.814  1.00 34.54 ? 293 LYS A CD    1 
ATOM   2279 C  CE    . LYS A 1 296 ? 44.815 -18.662 -6.759  1.00 35.53 ? 293 LYS A CE    1 
ATOM   2280 N  NZ    . LYS A 1 296 ? 44.441 -17.944 -5.502  1.00 40.88 ? 293 LYS A NZ    1 
ATOM   2281 N  N     . ASN A 1 297 ? 44.804 -22.549 -2.369  1.00 15.92 ? 294 ASN A N     1 
ATOM   2282 C  CA    . ASN A 1 297 ? 45.398 -22.171 -1.079  1.00 13.70 ? 294 ASN A CA    1 
ATOM   2283 C  C     . ASN A 1 297 ? 46.322 -23.242 -0.525  1.00 15.02 ? 294 ASN A C     1 
ATOM   2284 O  O     . ASN A 1 297 ? 47.387 -22.925 0.019   1.00 16.13 ? 294 ASN A O     1 
ATOM   2285 C  CB    . ASN A 1 297 ? 44.321 -21.896 -0.045  1.00 15.66 ? 294 ASN A CB    1 
ATOM   2286 C  CG    . ASN A 1 297 ? 43.632 -20.584 -0.262  1.00 18.15 ? 294 ASN A CG    1 
ATOM   2287 O  OD1   . ASN A 1 297 ? 44.201 -19.659 -0.838  1.00 19.25 ? 294 ASN A OD1   1 
ATOM   2288 N  ND2   . ASN A 1 297 ? 42.402 -20.480 0.218   1.00 19.52 ? 294 ASN A ND2   1 
ATOM   2289 N  N     . GLY A 1 298 ? 45.896 -24.503 -0.611  1.00 17.16 ? 295 GLY A N     1 
ATOM   2290 C  CA    . GLY A 1 298 ? 46.698 -25.613 -0.100  1.00 13.21 ? 295 GLY A CA    1 
ATOM   2291 C  C     . GLY A 1 298 ? 48.075 -25.692 -0.744  1.00 13.53 ? 295 GLY A C     1 
ATOM   2292 O  O     . GLY A 1 298 ? 49.087 -25.803 -0.049  1.00 13.37 ? 295 GLY A O     1 
ATOM   2293 N  N     . SER A 1 299 ? 48.114 -25.632 -2.076  1.00 12.98 ? 296 SER A N     1 
ATOM   2294 C  CA    . SER A 1 299 ? 49.367 -25.629 -2.812  1.00 12.72 ? 296 SER A CA    1 
ATOM   2295 C  C     . SER A 1 299 ? 50.182 -24.393 -2.470  1.00 14.96 ? 296 SER A C     1 
ATOM   2296 O  O     . SER A 1 299 ? 51.394 -24.482 -2.304  1.00 14.84 ? 296 SER A O     1 
ATOM   2297 C  CB    . SER A 1 299 ? 49.112 -25.685 -4.324  1.00 17.59 ? 296 SER A CB    1 
ATOM   2298 O  OG    . SER A 1 299 ? 48.662 -26.977 -4.693  1.00 16.19 ? 296 SER A OG    1 
ATOM   2299 N  N     . TRP A 1 300 ? 49.507 -23.251 -2.358  1.00 13.18 ? 297 TRP A N     1 
ATOM   2300 C  CA    . TRP A 1 300 ? 50.191 -22.009 -2.019  1.00 12.15 ? 297 TRP A CA    1 
ATOM   2301 C  C     . TRP A 1 300 ? 50.830 -22.121 -0.643  1.00 13.95 ? 297 TRP A C     1 
ATOM   2302 O  O     . TRP A 1 300 ? 52.022 -21.832 -0.490  1.00 13.81 ? 297 TRP A O     1 
ATOM   2303 C  CB    . TRP A 1 300 ? 49.224 -20.822 -2.071  1.00 12.69 ? 297 TRP A CB    1 
ATOM   2304 C  CG    . TRP A 1 300 ? 49.914 -19.501 -1.858  1.00 16.39 ? 297 TRP A CG    1 
ATOM   2305 C  CD1   . TRP A 1 300 ? 50.532 -18.736 -2.814  1.00 19.83 ? 297 TRP A CD1   1 
ATOM   2306 C  CD2   . TRP A 1 300 ? 50.033 -18.771 -0.625  1.00 14.02 ? 297 TRP A CD2   1 
ATOM   2307 N  NE1   . TRP A 1 300 ? 51.029 -17.589 -2.248  1.00 19.36 ? 297 TRP A NE1   1 
ATOM   2308 C  CE2   . TRP A 1 300 ? 50.744 -17.590 -0.908  1.00 16.59 ? 297 TRP A CE2   1 
ATOM   2309 C  CE3   . TRP A 1 300 ? 49.608 -19.004 0.686   1.00 15.91 ? 297 TRP A CE3   1 
ATOM   2310 C  CZ2   . TRP A 1 300 ? 51.036 -16.643 0.077   1.00 14.14 ? 297 TRP A CZ2   1 
ATOM   2311 C  CZ3   . TRP A 1 300 ? 49.907 -18.072 1.655   1.00 20.90 ? 297 TRP A CZ3   1 
ATOM   2312 C  CH2   . TRP A 1 300 ? 50.616 -16.908 1.349   1.00 17.15 ? 297 TRP A CH2   1 
ATOM   2313 N  N     . LEU A 1 301 ? 50.064 -22.589 0.346   1.00 12.78 ? 298 LEU A N     1 
ATOM   2314 C  CA    . LEU A 1 301 ? 50.633 -22.761 1.687   1.00 12.29 ? 298 LEU A CA    1 
ATOM   2315 C  C     . LEU A 1 301 ? 51.787 -23.763 1.749   1.00 13.05 ? 298 LEU A C     1 
ATOM   2316 O  O     . LEU A 1 301 ? 52.783 -23.529 2.453   1.00 12.38 ? 298 LEU A O     1 
ATOM   2317 C  CB    . LEU A 1 301 ? 49.552 -23.196 2.672   1.00 10.22 ? 298 LEU A CB    1 
ATOM   2318 C  CG    . LEU A 1 301 ? 48.476 -22.142 2.965   1.00 12.61 ? 298 LEU A CG    1 
ATOM   2319 C  CD1   . LEU A 1 301 ? 47.259 -22.783 3.567   1.00 14.49 ? 298 LEU A CD1   1 
ATOM   2320 C  CD2   . LEU A 1 301 ? 49.004 -21.073 3.907   1.00 16.95 ? 298 LEU A CD2   1 
ATOM   2321 N  N     . TYR A 1 302 ? 51.656 -24.871 1.028   1.00 11.99 ? 299 TYR A N     1 
ATOM   2322 C  CA    . TYR A 1 302 ? 52.692 -25.910 1.045   1.00 11.30 ? 299 TYR A CA    1 
ATOM   2323 C  C     . TYR A 1 302 ? 54.039 -25.349 0.572   1.00 12.49 ? 299 TYR A C     1 
ATOM   2324 O  O     . TYR A 1 302 ? 55.088 -25.580 1.186   1.00 11.58 ? 299 TYR A O     1 
ATOM   2325 C  CB    . TYR A 1 302 ? 52.274 -27.099 0.166   1.00 12.82 ? 299 TYR A CB    1 
ATOM   2326 C  CG    . TYR A 1 302 ? 53.280 -28.221 0.175   1.00 14.93 ? 299 TYR A CG    1 
ATOM   2327 C  CD1   . TYR A 1 302 ? 53.259 -29.181 1.175   1.00 15.48 ? 299 TYR A CD1   1 
ATOM   2328 C  CD2   . TYR A 1 302 ? 54.255 -28.314 -0.806  1.00 14.79 ? 299 TYR A CD2   1 
ATOM   2329 C  CE1   . TYR A 1 302 ? 54.182 -30.216 1.203   1.00 16.02 ? 299 TYR A CE1   1 
ATOM   2330 C  CE2   . TYR A 1 302 ? 55.198 -29.339 -0.783  1.00 20.30 ? 299 TYR A CE2   1 
ATOM   2331 C  CZ    . TYR A 1 302 ? 55.145 -30.289 0.227   1.00 21.77 ? 299 TYR A CZ    1 
ATOM   2332 O  OH    . TYR A 1 302 ? 56.064 -31.311 0.268   1.00 24.61 ? 299 TYR A OH    1 
ATOM   2333 N  N     . ALA A 1 303 ? 53.999 -24.590 -0.514  1.00 12.19 ? 300 ALA A N     1 
ATOM   2334 C  CA    . ALA A 1 303 ? 55.200 -23.943 -1.020  1.00 9.79  ? 300 ALA A CA    1 
ATOM   2335 C  C     . ALA A 1 303 ? 55.621 -22.751 -0.153  1.00 10.82 ? 300 ALA A C     1 
ATOM   2336 O  O     . ALA A 1 303 ? 56.808 -22.574 0.127   1.00 12.05 ? 300 ALA A O     1 
ATOM   2337 C  CB    . ALA A 1 303 ? 54.985 -23.494 -2.484  1.00 12.40 ? 300 ALA A CB    1 
ATOM   2338 N  N     . MET A 1 304 ? 54.660 -21.938 0.280   1.00 11.91 ? 301 MET A N     1 
ATOM   2339 C  CA    . MET A 1 304 ? 55.012 -20.723 1.014   1.00 12.05 ? 301 MET A CA    1 
ATOM   2340 C  C     . MET A 1 304 ? 55.749 -20.989 2.319   1.00 9.76  ? 301 MET A C     1 
ATOM   2341 O  O     . MET A 1 304 ? 56.684 -20.247 2.671   1.00 10.51 ? 301 MET A O     1 
ATOM   2342 C  CB    . MET A 1 304 ? 53.771 -19.887 1.320   1.00 12.46 ? 301 MET A CB    1 
ATOM   2343 C  CG    . MET A 1 304 ? 54.117 -18.469 1.777   1.00 15.55 ? 301 MET A CG    1 
ATOM   2344 S  SD    . MET A 1 304 ? 54.880 -17.512 0.443   1.00 16.85 ? 301 MET A SD    1 
ATOM   2345 C  CE    . MET A 1 304 ? 56.604 -17.506 0.945   1.00 14.46 ? 301 MET A CE    1 
ATOM   2346 N  N     . CYS A 1 305 ? 55.341 -22.029 3.044   1.00 10.87 ? 302 CYS A N     1 
ATOM   2347 C  CA    . CYS A 1 305 ? 55.983 -22.282 4.333   1.00 11.47 ? 302 CYS A CA    1 
ATOM   2348 C  C     . CYS A 1 305 ? 57.420 -22.788 4.142   1.00 11.33 ? 302 CYS A C     1 
ATOM   2349 O  O     . CYS A 1 305 ? 58.196 -22.812 5.098   1.00 14.27 ? 302 CYS A O     1 
ATOM   2350 C  CB    . CYS A 1 305 ? 55.177 -23.267 5.181   1.00 11.54 ? 302 CYS A CB    1 
ATOM   2351 S  SG    . CYS A 1 305 ? 55.144 -24.969 4.573   1.00 12.01 ? 302 CYS A SG    1 
ATOM   2352 N  N     . ARG A 1 306 ? 57.770 -23.147 2.912   1.00 9.83  ? 303 ARG A N     1 
ATOM   2353 C  CA    . ARG A 1 306 ? 59.145 -23.516 2.564   1.00 10.35 ? 303 ARG A CA    1 
ATOM   2354 C  C     . ARG A 1 306 ? 59.920 -22.333 1.930   1.00 12.45 ? 303 ARG A C     1 
ATOM   2355 O  O     . ARG A 1 306 ? 61.080 -22.481 1.536   1.00 14.62 ? 303 ARG A O     1 
ATOM   2356 C  CB    . ARG A 1 306 ? 59.143 -24.746 1.634   1.00 13.89 ? 303 ARG A CB    1 
ATOM   2357 C  CG    . ARG A 1 306 ? 58.629 -26.011 2.333   1.00 12.04 ? 303 ARG A CG    1 
ATOM   2358 C  CD    . ARG A 1 306 ? 58.294 -27.164 1.389   1.00 14.94 ? 303 ARG A CD    1 
ATOM   2359 N  NE    . ARG A 1 306 ? 58.104 -28.380 2.173   1.00 17.84 ? 303 ARG A NE    1 
ATOM   2360 C  CZ    . ARG A 1 306 ? 57.006 -28.660 2.870   1.00 14.32 ? 303 ARG A CZ    1 
ATOM   2361 N  NH1   . ARG A 1 306 ? 56.930 -29.793 3.566   1.00 17.35 ? 303 ARG A NH1   1 
ATOM   2362 N  NH2   . ARG A 1 306 ? 55.968 -27.825 2.862   1.00 12.26 ? 303 ARG A NH2   1 
ATOM   2363 N  N     . GLY A 1 307 ? 59.282 -21.164 1.857   1.00 10.71 ? 304 GLY A N     1 
ATOM   2364 C  CA    . GLY A 1 307 ? 59.908 -19.968 1.316   1.00 12.61 ? 304 GLY A CA    1 
ATOM   2365 C  C     . GLY A 1 307 ? 59.700 -19.831 -0.181  1.00 10.91 ? 304 GLY A C     1 
ATOM   2366 O  O     . GLY A 1 307 ? 60.364 -19.036 -0.840  1.00 12.58 ? 304 GLY A O     1 
ATOM   2367 N  N     . ILE A 1 308 ? 58.781 -20.615 -0.720  1.00 12.62 ? 305 ILE A N     1 
ATOM   2368 C  CA    . ILE A 1 308 ? 58.604 -20.705 -2.169  1.00 12.41 ? 305 ILE A CA    1 
ATOM   2369 C  C     . ILE A 1 308 ? 57.277 -20.110 -2.598  1.00 14.22 ? 305 ILE A C     1 
ATOM   2370 O  O     . ILE A 1 308 ? 56.246 -20.453 -2.057  1.00 11.97 ? 305 ILE A O     1 
ATOM   2371 C  CB    . ILE A 1 308 ? 58.680 -22.166 -2.626  1.00 15.68 ? 305 ILE A CB    1 
ATOM   2372 C  CG1   . ILE A 1 308 ? 60.060 -22.728 -2.268  1.00 15.67 ? 305 ILE A CG1   1 
ATOM   2373 C  CG2   . ILE A 1 308 ? 58.349 -22.279 -4.103  1.00 14.14 ? 305 ILE A CG2   1 
ATOM   2374 C  CD1   . ILE A 1 308 ? 60.196 -24.213 -2.546  1.00 21.19 ? 305 ILE A CD1   1 
ATOM   2375 N  N     . GLU A 1 309 ? 57.309 -19.201 -3.566  1.00 11.52 ? 306 GLU A N     1 
ATOM   2376 C  CA    . GLU A 1 309 ? 56.072 -18.622 -4.079  1.00 19.27 ? 306 GLU A CA    1 
ATOM   2377 C  C     . GLU A 1 309 ? 56.301 -18.180 -5.509  1.00 18.53 ? 306 GLU A C     1 
ATOM   2378 O  O     . GLU A 1 309 ? 57.390 -17.728 -5.849  1.00 20.84 ? 306 GLU A O     1 
ATOM   2379 C  CB    . GLU A 1 309 ? 55.603 -17.436 -3.241  1.00 20.90 ? 306 GLU A CB    1 
ATOM   2380 C  CG    . GLU A 1 309 ? 54.219 -17.001 -3.626  1.00 25.22 ? 306 GLU A CG    1 
ATOM   2381 C  CD    . GLU A 1 309 ? 53.932 -15.544 -3.373  1.00 21.84 ? 306 GLU A CD    1 
ATOM   2382 O  OE1   . GLU A 1 309 ? 54.868 -14.710 -3.383  1.00 17.21 ? 306 GLU A OE1   1 
ATOM   2383 O  OE2   . GLU A 1 309 ? 52.749 -15.242 -3.159  1.00 27.73 ? 306 GLU A OE2   1 
ATOM   2384 N  N     . HIS A 1 310 ? 55.283 -18.292 -6.352  1.00 21.99 ? 307 HIS A N     1 
ATOM   2385 C  CA    . HIS A 1 310 ? 55.529 -18.089 -7.770  1.00 21.48 ? 307 HIS A CA    1 
ATOM   2386 C  C     . HIS A 1 310 ? 54.800 -16.895 -8.371  1.00 19.10 ? 307 HIS A C     1 
ATOM   2387 O  O     . HIS A 1 310 ? 55.011 -16.591 -9.540  1.00 21.34 ? 307 HIS A O     1 
ATOM   2388 C  CB    . HIS A 1 310 ? 55.183 -19.369 -8.526  1.00 28.15 ? 307 HIS A CB    1 
ATOM   2389 C  CG    . HIS A 1 310 ? 56.121 -20.502 -8.221  1.00 31.55 ? 307 HIS A CG    1 
ATOM   2390 N  ND1   . HIS A 1 310 ? 57.482 -20.319 -8.084  1.00 32.99 ? 307 HIS A ND1   1 
ATOM   2391 C  CD2   . HIS A 1 310 ? 55.892 -21.815 -7.990  1.00 34.84 ? 307 HIS A CD2   1 
ATOM   2392 C  CE1   . HIS A 1 310 ? 58.054 -21.478 -7.805  1.00 33.81 ? 307 HIS A CE1   1 
ATOM   2393 N  NE2   . HIS A 1 310 ? 57.109 -22.402 -7.741  1.00 33.37 ? 307 HIS A NE2   1 
ATOM   2394 N  N     . ASP A 1 311 ? 53.982 -16.219 -7.568  1.00 17.02 ? 308 ASP A N     1 
ATOM   2395 C  CA    . ASP A 1 311 ? 53.212 -15.059 -8.047  1.00 16.57 ? 308 ASP A CA    1 
ATOM   2396 C  C     . ASP A 1 311 ? 54.113 -14.068 -8.764  1.00 18.81 ? 308 ASP A C     1 
ATOM   2397 O  O     . ASP A 1 311 ? 55.067 -13.569 -8.180  1.00 15.91 ? 308 ASP A O     1 
ATOM   2398 C  CB    . ASP A 1 311 ? 52.510 -14.361 -6.889  1.00 17.66 ? 308 ASP A CB    1 
ATOM   2399 C  CG    . ASP A 1 311 ? 51.496 -13.337 -7.364  1.00 25.80 ? 308 ASP A CG    1 
ATOM   2400 O  OD1   . ASP A 1 311 ? 51.169 -12.411 -6.601  1.00 33.37 ? 308 ASP A OD1   1 
ATOM   2401 O  OD2   . ASP A 1 311 ? 51.003 -13.471 -8.504  1.00 30.12 ? 308 ASP A OD2   1 
ATOM   2402 N  N     . PRO A 1 312 ? 53.836 -13.789 -10.048 1.00 17.40 ? 309 PRO A N     1 
ATOM   2403 C  CA    . PRO A 1 312 ? 54.767 -12.912 -10.759 1.00 15.15 ? 309 PRO A CA    1 
ATOM   2404 C  C     . PRO A 1 312 ? 54.608 -11.453 -10.381 1.00 13.10 ? 309 PRO A C     1 
ATOM   2405 O  O     . PRO A 1 312 ? 53.546 -11.039 -9.922  1.00 14.51 ? 309 PRO A O     1 
ATOM   2406 C  CB    . PRO A 1 312 ? 54.397 -13.127 -12.234 1.00 18.28 ? 309 PRO A CB    1 
ATOM   2407 C  CG    . PRO A 1 312 ? 53.009 -13.568 -12.200 1.00 17.31 ? 309 PRO A CG    1 
ATOM   2408 C  CD    . PRO A 1 312 ? 52.879 -14.423 -10.967 1.00 19.43 ? 309 PRO A CD    1 
ATOM   2409 N  N     . VAL A 1 313 ? 55.645 -10.672 -10.597 1.00 15.33 ? 310 VAL A N     1 
ATOM   2410 C  CA    . VAL A 1 313 ? 55.531 -9.272  -10.418 1.00 12.14 ? 310 VAL A CA    1 
ATOM   2411 C  C     . VAL A 1 313 ? 54.840 -8.824  -11.710 1.00 16.04 ? 310 VAL A C     1 
ATOM   2412 O  O     . VAL A 1 313 ? 55.384 -8.949  -12.729 1.00 16.25 ? 310 VAL A O     1 
ATOM   2413 C  CB    . VAL A 1 313 ? 56.919 -8.651  -10.378 1.00 14.55 ? 310 VAL A CB    1 
ATOM   2414 C  CG1   . VAL A 1 313 ? 56.837 -7.163  -10.339 1.00 15.07 ? 310 VAL A CG1   1 
ATOM   2415 C  CG2   . VAL A 1 313 ? 57.660 -9.109  -9.159  1.00 15.82 ? 310 VAL A CG2   1 
ATOM   2416 N  N     . LYS A 1 314 ? 53.626 -8.339  -11.598 1.00 16.30 ? 311 LYS A N     1 
ATOM   2417 C  CA    . LYS A 1 314 ? 52.914 -7.854  -12.740 1.00 16.75 ? 311 LYS A CA    1 
ATOM   2418 C  C     . LYS A 1 314 ? 53.405 -6.500  -13.254 1.00 15.73 ? 311 LYS A C     1 
ATOM   2419 O  O     . LYS A 1 314 ? 53.638 -5.582  -12.548 1.00 16.95 ? 311 LYS A O     1 
ATOM   2420 C  CB    . LYS A 1 314 ? 51.421 -7.839  -12.476 1.00 21.27 ? 311 LYS A CB    1 
ATOM   2421 C  CG    . LYS A 1 314 ? 50.908 -9.261  -12.261 1.00 22.54 ? 311 LYS A CG    1 
ATOM   2422 C  CD    . LYS A 1 314 ? 49.617 -9.402  -11.508 1.00 32.21 ? 311 LYS A CD    1 
ATOM   2423 C  CE    . LYS A 1 314 ? 49.446 -10.838 -10.950 1.00 31.56 ? 311 LYS A CE    1 
ATOM   2424 N  NZ    . LYS A 1 314 ? 50.590 -11.419 -10.193 1.00 26.44 ? 311 LYS A NZ    1 
ATOM   2425 N  N     . PRO A 1 315 ? 53.513 -6.492  -14.643 1.00 14.64 ? 312 PRO A N     1 
ATOM   2426 C  CA    . PRO A 1 315 ? 53.917 -5.215  -15.201 1.00 15.36 ? 312 PRO A CA    1 
ATOM   2427 C  C     . PRO A 1 315 ? 52.723 -4.277  -15.240 1.00 19.78 ? 312 PRO A C     1 
ATOM   2428 O  O     . PRO A 1 315 ? 52.029 -4.152  -16.206 1.00 19.49 ? 312 PRO A O     1 
ATOM   2429 C  CB    . PRO A 1 315 ? 54.341 -5.553  -16.622 1.00 17.41 ? 312 PRO A CB    1 
ATOM   2430 C  CG    . PRO A 1 315 ? 53.502 -6.693  -17.014 1.00 17.78 ? 312 PRO A CG    1 
ATOM   2431 C  CD    . PRO A 1 315 ? 53.485 -7.529  -15.806 1.00 16.23 ? 312 PRO A CD    1 
ATOM   2432 N  N     . ARG A 1 316 ? 52.502 -3.638  -14.123 1.00 15.07 ? 313 ARG A N     1 
ATOM   2433 C  CA    . ARG A 1 316 ? 51.398 -2.675  -14.002 1.00 14.95 ? 313 ARG A CA    1 
ATOM   2434 C  C     . ARG A 1 316 ? 51.768 -1.531  -13.041 1.00 17.54 ? 313 ARG A C     1 
ATOM   2435 O  O     . ARG A 1 316 ? 51.885 -1.722  -11.889 1.00 15.73 ? 313 ARG A O     1 
ATOM   2436 C  CB    . ARG A 1 316 ? 50.157 -3.370  -13.474 1.00 15.33 ? 313 ARG A CB    1 
ATOM   2437 C  CG    . ARG A 1 316 ? 48.932 -2.534  -13.686 1.00 19.79 ? 313 ARG A CG    1 
ATOM   2438 C  CD    . ARG A 1 316 ? 47.738 -3.005  -12.963 1.00 17.93 ? 313 ARG A CD    1 
ATOM   2439 N  NE    . ARG A 1 316 ? 48.032 -3.535  -11.668 1.00 19.25 ? 313 ARG A NE    1 
ATOM   2440 C  CZ    . ARG A 1 316 ? 48.105 -2.812  -10.569 1.00 26.32 ? 313 ARG A CZ    1 
ATOM   2441 N  NH1   . ARG A 1 316 ? 47.937 -1.493  -10.640 1.00 24.60 ? 313 ARG A NH1   1 
ATOM   2442 N  NH2   . ARG A 1 316 ? 48.370 -3.385  -9.396  1.00 26.22 ? 313 ARG A NH2   1 
ATOM   2443 N  N     . GLN A 1 317 ? 51.935 -0.352  -13.593 1.00 17.29 ? 314 GLN A N     1 
ATOM   2444 C  CA    . GLN A 1 317 ? 52.376 0.797   -12.815 1.00 20.38 ? 314 GLN A CA    1 
ATOM   2445 C  C     . GLN A 1 317 ? 51.199 1.690   -12.410 1.00 18.38 ? 314 GLN A C     1 
ATOM   2446 O  O     . GLN A 1 317 ? 51.267 2.457   -11.436 1.00 20.49 ? 314 GLN A O     1 
ATOM   2447 C  CB    . GLN A 1 317 ? 53.387 1.593   -13.631 1.00 26.70 ? 314 GLN A CB    1 
ATOM   2448 C  CG    . GLN A 1 317 ? 54.088 2.650   -12.860 1.00 30.64 ? 314 GLN A CG    1 
ATOM   2449 C  CD    . GLN A 1 317 ? 55.023 3.434   -13.731 1.00 26.49 ? 314 GLN A CD    1 
ATOM   2450 O  OE1   . GLN A 1 317 ? 55.366 3.007   -14.842 1.00 30.73 ? 314 GLN A OE1   1 
ATOM   2451 N  NE2   . GLN A 1 317 ? 55.439 4.591   -13.248 1.00 27.72 ? 314 GLN A NE2   1 
ATOM   2452 N  N     . LEU A 1 318 ? 50.113 1.571   -13.165 1.00 16.92 ? 315 LEU A N     1 
ATOM   2453 C  CA    . LEU A 1 318 ? 48.941 2.408   -12.971 1.00 15.42 ? 315 LEU A CA    1 
ATOM   2454 C  C     . LEU A 1 318 ? 47.801 1.647   -12.312 1.00 16.98 ? 315 LEU A C     1 
ATOM   2455 O  O     . LEU A 1 318 ? 47.592 0.464   -12.593 1.00 16.47 ? 315 LEU A O     1 
ATOM   2456 C  CB    . LEU A 1 318 ? 48.444 2.953   -14.315 1.00 15.37 ? 315 LEU A CB    1 
ATOM   2457 C  CG    . LEU A 1 318 ? 49.448 3.663   -15.218 1.00 19.13 ? 315 LEU A CG    1 
ATOM   2458 C  CD1   . LEU A 1 318 ? 48.856 3.894   -16.611 1.00 18.44 ? 315 LEU A CD1   1 
ATOM   2459 C  CD2   . LEU A 1 318 ? 49.891 4.976   -14.586 1.00 18.37 ? 315 LEU A CD2   1 
ATOM   2460 N  N     . PRO A 1 319 ? 47.021 2.332   -11.465 1.00 15.15 ? 316 PRO A N     1 
ATOM   2461 C  CA    . PRO A 1 319 ? 45.840 1.655   -10.915 1.00 15.34 ? 316 PRO A CA    1 
ATOM   2462 C  C     . PRO A 1 319 ? 44.852 1.210   -12.005 1.00 15.91 ? 316 PRO A C     1 
ATOM   2463 O  O     . PRO A 1 319 ? 44.734 1.879   -13.030 1.00 20.21 ? 316 PRO A O     1 
ATOM   2464 C  CB    . PRO A 1 319 ? 45.221 2.705   -9.980  1.00 19.61 ? 316 PRO A CB    1 
ATOM   2465 C  CG    . PRO A 1 319 ? 45.938 3.969   -10.239 1.00 22.87 ? 316 PRO A CG    1 
ATOM   2466 C  CD    . PRO A 1 319 ? 47.228 3.681   -10.907 1.00 16.53 ? 316 PRO A CD    1 
ATOM   2467 N  N     . LYS A 1 320 ? 44.192 0.069   -11.783 1.00 17.72 ? 317 LYS A N     1 
ATOM   2468 C  CA    . LYS A 1 320 ? 43.218 -0.506  -12.719 1.00 20.62 ? 317 LYS A CA    1 
ATOM   2469 C  C     . LYS A 1 320 ? 41.833 0.126   -12.625 1.00 20.43 ? 317 LYS A C     1 
ATOM   2470 O  O     . LYS A 1 320 ? 40.965 -0.126  -13.461 1.00 20.37 ? 317 LYS A O     1 
ATOM   2471 C  CB    . LYS A 1 320 ? 43.051 -2.010  -12.460 1.00 23.91 ? 317 LYS A CB    1 
ATOM   2472 C  CG    . LYS A 1 320 ? 44.224 -2.887  -12.797 1.00 28.17 ? 317 LYS A CG    1 
ATOM   2473 C  CD    . LYS A 1 320 ? 43.819 -4.358  -12.672 1.00 29.45 ? 317 LYS A CD    1 
ATOM   2474 C  CE    . LYS A 1 320 ? 44.944 -5.285  -13.076 1.00 32.63 ? 317 LYS A CE    1 
ATOM   2475 N  NZ    . LYS A 1 320 ? 44.471 -6.683  -13.254 1.00 35.64 ? 317 LYS A NZ    1 
ATOM   2476 N  N     . THR A 1 321 ? 41.605 0.873   -11.554 1.00 17.26 ? 318 THR A N     1 
ATOM   2477 C  CA    . THR A 1 321 ? 40.309 1.491   -11.307 1.00 17.46 ? 318 THR A CA    1 
ATOM   2478 C  C     . THR A 1 321 ? 40.560 2.878   -10.757 1.00 18.21 ? 318 THR A C     1 
ATOM   2479 O  O     . THR A 1 321 ? 41.630 3.156   -10.214 1.00 21.07 ? 318 THR A O     1 
ATOM   2480 C  CB    . THR A 1 321 ? 39.451 0.675   -10.308 1.00 22.07 ? 318 THR A CB    1 
ATOM   2481 O  OG1   . THR A 1 321 ? 40.187 0.486   -9.088  1.00 18.53 ? 318 THR A OG1   1 
ATOM   2482 C  CG2   . THR A 1 321 ? 39.065 -0.687  -10.886 1.00 19.54 ? 318 THR A CG2   1 
ATOM   2483 N  N     . ILE A 1 322 ? 39.584 3.760   -10.931 1.00 17.08 ? 319 ILE A N     1 
ATOM   2484 C  CA    . ILE A 1 322 ? 39.622 5.085   -10.330 1.00 17.09 ? 319 ILE A CA    1 
ATOM   2485 C  C     . ILE A 1 322 ? 38.283 5.278   -9.625  1.00 16.82 ? 319 ILE A C     1 
ATOM   2486 O  O     . ILE A 1 322 ? 37.241 5.259   -10.270 1.00 16.04 ? 319 ILE A O     1 
ATOM   2487 C  CB    . ILE A 1 322 ? 39.864 6.179   -11.391 1.00 13.08 ? 319 ILE A CB    1 
ATOM   2488 C  CG1   . ILE A 1 322 ? 41.208 5.942   -12.097 1.00 16.98 ? 319 ILE A CG1   1 
ATOM   2489 C  CG2   . ILE A 1 322 ? 39.790 7.577   -10.772 1.00 18.98 ? 319 ILE A CG2   1 
ATOM   2490 C  CD1   . ILE A 1 322 ? 41.576 7.033   -13.071 1.00 20.80 ? 319 ILE A CD1   1 
ATOM   2491 N  N     . GLY A 1 323 ? 38.316 5.400   -8.304  1.00 15.29 ? 320 GLY A N     1 
ATOM   2492 C  CA    . GLY A 1 323 ? 37.096 5.443   -7.507  1.00 16.21 ? 320 GLY A CA    1 
ATOM   2493 C  C     . GLY A 1 323 ? 37.013 6.613   -6.543  1.00 16.56 ? 320 GLY A C     1 
ATOM   2494 O  O     . GLY A 1 323 ? 38.017 7.213   -6.171  1.00 17.48 ? 320 GLY A O     1 
ATOM   2495 N  N     . CYS A 1 324 ? 35.782 6.926   -6.147  1.00 16.56 ? 321 CYS A N     1 
ATOM   2496 C  CA    . CYS A 1 324 ? 35.460 8.041   -5.263  1.00 17.13 ? 321 CYS A CA    1 
ATOM   2497 C  C     . CYS A 1 324 ? 34.432 7.498   -4.285  1.00 18.54 ? 321 CYS A C     1 
ATOM   2498 O  O     . CYS A 1 324 ? 33.419 6.948   -4.715  1.00 16.75 ? 321 CYS A O     1 
ATOM   2499 C  CB    . CYS A 1 324 ? 34.898 9.250   -6.045  1.00 17.71 ? 321 CYS A CB    1 
ATOM   2500 S  SG    A CYS A 1 324 ? 36.028 9.972   -7.223  0.62 20.66 ? 321 CYS A SG    1 
ATOM   2501 S  SG    B CYS A 1 324 ? 35.260 10.866  -5.390  0.38 22.43 ? 321 CYS A SG    1 
ATOM   2502 N  N     . SER A 1 325 ? 34.678 7.630   -2.988  1.00 15.17 ? 322 SER A N     1 
ATOM   2503 C  CA    A SER A 1 325 ? 33.731 7.112   -2.014  0.42 16.43 ? 322 SER A CA    1 
ATOM   2504 C  CA    B SER A 1 325 ? 33.818 7.047   -1.963  0.58 16.39 ? 322 SER A CA    1 
ATOM   2505 C  C     . SER A 1 325 ? 33.626 8.012   -0.794  1.00 17.53 ? 322 SER A C     1 
ATOM   2506 O  O     . SER A 1 325 ? 34.578 8.685   -0.390  1.00 19.25 ? 322 SER A O     1 
ATOM   2507 C  CB    A SER A 1 325 ? 34.109 5.693   -1.587  0.42 17.44 ? 322 SER A CB    1 
ATOM   2508 C  CB    B SER A 1 325 ? 34.424 5.729   -1.465  0.58 17.11 ? 322 SER A CB    1 
ATOM   2509 O  OG    A SER A 1 325 ? 35.319 5.681   -0.860  0.42 15.64 ? 322 SER A OG    1 
ATOM   2510 O  OG    B SER A 1 325 ? 33.815 5.283   -0.266  0.58 17.56 ? 322 SER A OG    1 
ATOM   2511 N  N     . LYS A 1 326 ? 32.426 8.050   -0.233  1.00 16.52 ? 323 LYS A N     1 
ATOM   2512 C  CA    . LYS A 1 326 ? 32.215 8.803   0.992   1.00 17.77 ? 323 LYS A CA    1 
ATOM   2513 C  C     . LYS A 1 326 ? 31.235 8.099   1.908   1.00 17.68 ? 323 LYS A C     1 
ATOM   2514 O  O     . LYS A 1 326 ? 30.179 7.638   1.473   1.00 17.56 ? 323 LYS A O     1 
ATOM   2515 C  CB    . LYS A 1 326 ? 31.719 10.216  0.697   1.00 15.70 ? 323 LYS A CB    1 
ATOM   2516 C  CG    . LYS A 1 326 ? 31.600 11.042  1.975   1.00 15.26 ? 323 LYS A CG    1 
ATOM   2517 C  CD    . LYS A 1 326 ? 31.471 12.524  1.697   1.00 22.82 ? 323 LYS A CD    1 
ATOM   2518 C  CE    . LYS A 1 326 ? 31.316 13.293  3.000   1.00 24.25 ? 323 LYS A CE    1 
ATOM   2519 N  NZ    . LYS A 1 326 ? 32.339 12.864  3.980   1.00 29.36 ? 323 LYS A NZ    1 
ATOM   2520 N  N     . ASN A 1 327 ? 31.621 7.996   3.172   1.00 15.79 ? 324 ASN A N     1 
ATOM   2521 C  CA    . ASN A 1 327 ? 30.732 7.567   4.241   1.00 20.14 ? 324 ASN A CA    1 
ATOM   2522 C  C     . ASN A 1 327 ? 29.871 8.717   4.746   1.00 21.53 ? 324 ASN A C     1 
ATOM   2523 O  O     . ASN A 1 327 ? 30.284 9.877   4.729   1.00 18.40 ? 324 ASN A O     1 
ATOM   2524 C  CB    . ASN A 1 327 ? 31.523 7.002   5.421   1.00 23.87 ? 324 ASN A CB    1 
ATOM   2525 C  CG    . ASN A 1 327 ? 32.108 5.637   5.144   1.00 23.33 ? 324 ASN A CG    1 
ATOM   2526 O  OD1   . ASN A 1 327 ? 31.888 5.040   4.086   1.00 25.72 ? 324 ASN A OD1   1 
ATOM   2527 N  ND2   . ASN A 1 327 ? 32.855 5.125   6.111   1.00 26.72 ? 324 ASN A ND2   1 
ATOM   2528 N  N     . PHE A 1 328 ? 28.665 8.406   5.188   1.00 20.96 ? 325 PHE A N     1 
ATOM   2529 C  CA    . PHE A 1 328 ? 27.777 9.362   5.803   1.00 22.17 ? 325 PHE A CA    1 
ATOM   2530 C  C     . PHE A 1 328 ? 27.307 8.751   7.096   1.00 29.26 ? 325 PHE A C     1 
ATOM   2531 O  O     . PHE A 1 328 ? 26.275 8.163   7.173   1.00 27.33 ? 325 PHE A O     1 
ATOM   2532 C  CB    . PHE A 1 328 ? 26.634 9.691   4.877   1.00 21.93 ? 325 PHE A CB    1 
ATOM   2533 C  CG    . PHE A 1 328 ? 27.077 10.213  3.579   1.00 21.21 ? 325 PHE A CG    1 
ATOM   2534 C  CD1   . PHE A 1 328 ? 27.229 9.379   2.531   1.00 19.78 ? 325 PHE A CD1   1 
ATOM   2535 C  CD2   . PHE A 1 328 ? 27.349 11.531  3.416   1.00 20.74 ? 325 PHE A CD2   1 
ATOM   2536 C  CE1   . PHE A 1 328 ? 27.663 9.844   1.357   1.00 16.53 ? 325 PHE A CE1   1 
ATOM   2537 C  CE2   . PHE A 1 328 ? 27.777 12.008  2.225   1.00 21.41 ? 325 PHE A CE2   1 
ATOM   2538 C  CZ    . PHE A 1 328 ? 27.928 11.147  1.186   1.00 20.67 ? 325 PHE A CZ    1 
ATOM   2539 N  N     . PRO A 1 329 ? 28.133 8.813   8.116   1.00 28.28 ? 326 PRO A N     1 
ATOM   2540 C  CA    . PRO A 1 329 ? 27.866 8.078   9.337   1.00 33.61 ? 326 PRO A CA    1 
ATOM   2541 C  C     . PRO A 1 329 ? 26.825 8.665   10.233  1.00 35.08 ? 326 PRO A C     1 
ATOM   2542 O  O     . PRO A 1 329 ? 26.582 9.822   10.216  1.00 34.88 ? 326 PRO A O     1 
ATOM   2543 C  CB    . PRO A 1 329 ? 29.184 8.154   10.080  1.00 34.79 ? 326 PRO A CB    1 
ATOM   2544 C  CG    . PRO A 1 329 ? 29.744 9.454   9.636   1.00 36.31 ? 326 PRO A CG    1 
ATOM   2545 C  CD    . PRO A 1 329 ? 29.397 9.531   8.193   1.00 30.19 ? 326 PRO A CD    1 
ATOM   2546 N  N     . GLY A 1 330 ? 26.271 7.785   11.038  1.00 42.29 ? 327 GLY A N     1 
ATOM   2547 C  CA    . GLY A 1 330 ? 25.508 8.166   12.194  1.00 43.84 ? 327 GLY A CA    1 
ATOM   2548 C  C     . GLY A 1 330 ? 24.378 8.993   11.729  1.00 40.39 ? 327 GLY A C     1 
ATOM   2549 O  O     . GLY A 1 330 ? 23.546 8.536   10.997  1.00 42.72 ? 327 GLY A O     1 
ATOM   2550 N  N     . LYS A 1 331 ? 24.310 10.192  12.236  1.00 42.13 ? 328 LYS A N     1 
ATOM   2551 C  CA    . LYS A 1 331 ? 23.224 11.060  11.899  1.00 38.64 ? 328 LYS A CA    1 
ATOM   2552 C  C     . LYS A 1 331 ? 23.357 11.753  10.587  1.00 40.47 ? 328 LYS A C     1 
ATOM   2553 O  O     . LYS A 1 331 ? 22.445 12.369  10.148  1.00 42.93 ? 328 LYS A O     1 
ATOM   2554 C  CB    . LYS A 1 331 ? 22.984 12.032  13.025  1.00 48.30 ? 328 LYS A CB    1 
ATOM   2555 C  CG    . LYS A 1 331 ? 21.808 11.557  13.827  1.00 52.36 ? 328 LYS A CG    1 
ATOM   2556 C  CD    . LYS A 1 331 ? 21.889 12.059  15.244  1.00 57.41 ? 328 LYS A CD    1 
ATOM   2557 C  CE    . LYS A 1 331 ? 20.854 11.394  16.107  1.00 61.74 ? 328 LYS A CE    1 
ATOM   2558 N  NZ    . LYS A 1 331 ? 19.483 11.876  15.759  1.00 60.64 ? 328 LYS A NZ    1 
ATOM   2559 N  N     . THR A 1 332 ? 24.515 11.705  9.971   1.00 37.28 ? 329 THR A N     1 
ATOM   2560 C  CA    . THR A 1 332 ? 24.688 12.446  8.719   1.00 34.19 ? 329 THR A CA    1 
ATOM   2561 C  C     . THR A 1 332 ? 24.174 11.648  7.510   1.00 30.91 ? 329 THR A C     1 
ATOM   2562 O  O     . THR A 1 332 ? 24.273 12.109  6.371   1.00 31.42 ? 329 THR A O     1 
ATOM   2563 C  CB    . THR A 1 332 ? 26.168 12.825  8.468   1.00 34.24 ? 329 THR A CB    1 
ATOM   2564 O  OG1   . THR A 1 332 ? 26.924 11.644  8.180   1.00 30.13 ? 329 THR A OG1   1 
ATOM   2565 C  CG2   . THR A 1 332 ? 26.773 13.527  9.685   1.00 33.05 ? 329 THR A CG2   1 
ATOM   2566 N  N     . ALA A 1 333 ? 23.626 10.461  7.767   1.00 33.03 ? 330 ALA A N     1 
ATOM   2567 C  CA    . ALA A 1 333 ? 23.141 9.576   6.707   1.00 30.51 ? 330 ALA A CA    1 
ATOM   2568 C  C     . ALA A 1 333 ? 22.103 10.256  5.818   1.00 33.05 ? 330 ALA A C     1 
ATOM   2569 O  O     . ALA A 1 333 ? 21.220 10.963  6.301   1.00 34.03 ? 330 ALA A O     1 
ATOM   2570 C  CB    . ALA A 1 333 ? 22.570 8.306   7.306   1.00 30.65 ? 330 ALA A CB    1 
ATOM   2571 N  N     . LEU A 1 334 ? 22.215 10.037  4.512   1.00 28.16 ? 331 LEU A N     1 
ATOM   2572 C  CA    . LEU A 1 334 ? 21.390 10.744  3.536   1.00 27.41 ? 331 LEU A CA    1 
ATOM   2573 C  C     . LEU A 1 334 ? 19.951 10.217  3.523   1.00 30.70 ? 331 LEU A C     1 
ATOM   2574 O  O     . LEU A 1 334 ? 19.702 9.082   3.139   1.00 30.86 ? 331 LEU A O     1 
ATOM   2575 C  CB    . LEU A 1 334 ? 21.999 10.618  2.142   1.00 28.64 ? 331 LEU A CB    1 
ATOM   2576 C  CG    . LEU A 1 334 ? 23.503 10.846  2.064   1.00 23.84 ? 331 LEU A CG    1 
ATOM   2577 C  CD1   . LEU A 1 334 ? 23.957 10.685  0.624   1.00 22.20 ? 331 LEU A CD1   1 
ATOM   2578 C  CD2   . LEU A 1 334 ? 23.843 12.237  2.593   1.00 23.71 ? 331 LEU A CD2   1 
ATOM   2579 N  N     . ALA A 1 335 ? 19.007 11.057  3.929   1.00 34.50 ? 332 ALA A N     1 
ATOM   2580 C  CA    . ALA A 1 335 ? 17.628 10.606  4.076   1.00 33.28 ? 332 ALA A CA    1 
ATOM   2581 C  C     . ALA A 1 335 ? 16.679 11.288  3.093   1.00 35.07 ? 332 ALA A C     1 
ATOM   2582 O  O     . ALA A 1 335 ? 15.485 11.001  3.089   1.00 37.65 ? 332 ALA A O     1 
ATOM   2583 C  CB    . ALA A 1 335 ? 17.155 10.825  5.507   1.00 35.50 ? 332 ALA A CB    1 
ATOM   2584 N  N     . THR A 1 336 ? 17.202 12.189  2.268   1.00 32.61 ? 333 THR A N     1 
ATOM   2585 C  CA    . THR A 1 336 ? 16.389 12.840  1.251   1.00 35.42 ? 333 THR A CA    1 
ATOM   2586 C  C     . THR A 1 336 ? 16.947 12.594  -0.140  1.00 40.75 ? 333 THR A C     1 
ATOM   2587 O  O     . THR A 1 336 ? 18.151 12.397  -0.316  1.00 36.64 ? 333 THR A O     1 
ATOM   2588 C  CB    . THR A 1 336 ? 16.271 14.368  1.483   1.00 38.54 ? 333 THR A CB    1 
ATOM   2589 O  OG1   . THR A 1 336 ? 17.421 15.050  0.956   1.00 29.25 ? 333 THR A OG1   1 
ATOM   2590 C  CG2   . THR A 1 336 ? 16.120 14.676  2.960   1.00 37.10 ? 333 THR A CG2   1 
ATOM   2591 N  N     . ARG A 1 337 ? 16.062 12.611  -1.130  1.00 41.17 ? 334 ARG A N     1 
ATOM   2592 C  CA    . ARG A 1 337 ? 16.451 12.343  -2.504  1.00 41.09 ? 334 ARG A CA    1 
ATOM   2593 C  C     . ARG A 1 337 ? 17.467 13.366  -2.985  1.00 35.82 ? 334 ARG A C     1 
ATOM   2594 O  O     . ARG A 1 337 ? 18.460 13.016  -3.618  1.00 38.97 ? 334 ARG A O     1 
ATOM   2595 C  CB    . ARG A 1 337 ? 15.216 12.338  -3.412  1.00 45.96 ? 334 ARG A CB    1 
ATOM   2596 C  CG    . ARG A 1 337 ? 15.466 12.839  -4.820  1.00 47.84 ? 334 ARG A CG    1 
ATOM   2597 C  CD    . ARG A 1 337 ? 14.241 12.642  -5.698  1.00 49.13 ? 334 ARG A CD    1 
ATOM   2598 N  NE    . ARG A 1 337 ? 13.535 13.903  -5.890  1.00 56.70 ? 334 ARG A NE    1 
ATOM   2599 C  CZ    . ARG A 1 337 ? 12.457 14.048  -6.653  1.00 60.63 ? 334 ARG A CZ    1 
ATOM   2600 N  NH1   . ARG A 1 337 ? 11.967 13.007  -7.315  1.00 60.67 ? 334 ARG A NH1   1 
ATOM   2601 N  NH2   . ARG A 1 337 ? 11.879 15.238  -6.762  1.00 59.52 ? 334 ARG A NH2   1 
ATOM   2602 N  N     . GLU A 1 338 ? 17.230 14.634  -2.669  1.00 40.09 ? 335 GLU A N     1 
ATOM   2603 C  CA    . GLU A 1 338 ? 18.104 15.698  -3.142  1.00 37.78 ? 335 GLU A CA    1 
ATOM   2604 C  C     . GLU A 1 338 ? 19.452 15.718  -2.423  1.00 29.08 ? 335 GLU A C     1 
ATOM   2605 O  O     . GLU A 1 338 ? 20.433 16.248  -2.944  1.00 31.16 ? 335 GLU A O     1 
ATOM   2606 C  CB    . GLU A 1 338 ? 17.432 17.054  -2.994  1.00 38.46 ? 335 GLU A CB    1 
ATOM   2607 C  CG    . GLU A 1 338 ? 17.415 17.813  -4.301  1.00 45.39 ? 335 GLU A CG    1 
ATOM   2608 C  CD    . GLU A 1 338 ? 16.967 19.247  -4.144  1.00 53.94 ? 335 GLU A CD    1 
ATOM   2609 O  OE1   . GLU A 1 338 ? 16.052 19.497  -3.329  1.00 54.11 ? 335 GLU A OE1   1 
ATOM   2610 O  OE2   . GLU A 1 338 ? 17.545 20.125  -4.827  1.00 57.10 ? 335 GLU A OE2   1 
ATOM   2611 N  N     . GLN A 1 339 ? 19.494 15.166  -1.217  1.00 34.19 ? 336 GLN A N     1 
ATOM   2612 C  CA    . GLN A 1 339 ? 20.770 14.908  -0.566  1.00 30.25 ? 336 GLN A CA    1 
ATOM   2613 C  C     . GLN A 1 339 ? 21.562 13.903  -1.381  1.00 30.31 ? 336 GLN A C     1 
ATOM   2614 O  O     . GLN A 1 339 ? 22.732 14.123  -1.715  1.00 26.06 ? 336 GLN A O     1 
ATOM   2615 C  CB    . GLN A 1 339 ? 20.563 14.369  0.842   1.00 30.40 ? 336 GLN A CB    1 
ATOM   2616 C  CG    . GLN A 1 339 ? 20.890 15.336  1.943   1.00 29.66 ? 336 GLN A CG    1 
ATOM   2617 C  CD    . GLN A 1 339 ? 20.838 14.666  3.288   1.00 33.55 ? 336 GLN A CD    1 
ATOM   2618 O  OE1   . GLN A 1 339 ? 19.886 13.948  3.601   1.00 29.84 ? 336 GLN A OE1   1 
ATOM   2619 N  NE2   . GLN A 1 339 ? 21.874 14.874  4.088   1.00 31.33 ? 336 GLN A NE2   1 
ATOM   2620 N  N     . VAL A 1 340 ? 20.903 12.794  -1.691  1.00 29.05 ? 337 VAL A N     1 
ATOM   2621 C  CA    . VAL A 1 340 ? 21.530 11.704  -2.415  1.00 28.35 ? 337 VAL A CA    1 
ATOM   2622 C  C     . VAL A 1 340 ? 22.057 12.198  -3.748  1.00 27.50 ? 337 VAL A C     1 
ATOM   2623 O  O     . VAL A 1 340 ? 23.162 11.844  -4.154  1.00 27.87 ? 337 VAL A O     1 
ATOM   2624 C  CB    . VAL A 1 340 ? 20.551 10.537  -2.636  1.00 31.74 ? 337 VAL A CB    1 
ATOM   2625 C  CG1   . VAL A 1 340 ? 21.148 9.501   -3.585  1.00 26.87 ? 337 VAL A CG1   1 
ATOM   2626 C  CG2   . VAL A 1 340 ? 20.209 9.892   -1.312  1.00 25.39 ? 337 VAL A CG2   1 
ATOM   2627 N  N     . GLN A 1 341 ? 21.276 13.039  -4.413  1.00 27.73 ? 338 GLN A N     1 
ATOM   2628 C  CA    . GLN A 1 341 ? 21.650 13.545  -5.726  1.00 27.08 ? 338 GLN A CA    1 
ATOM   2629 C  C     . GLN A 1 341 ? 22.775 14.567  -5.654  1.00 29.11 ? 338 GLN A C     1 
ATOM   2630 O  O     . GLN A 1 341 ? 23.621 14.641  -6.551  1.00 26.77 ? 338 GLN A O     1 
ATOM   2631 C  CB    . GLN A 1 341 ? 20.432 14.149  -6.425  1.00 29.91 ? 338 GLN A CB    1 
ATOM   2632 C  CG    . GLN A 1 341 ? 19.426 13.101  -6.864  1.00 36.27 ? 338 GLN A CG    1 
ATOM   2633 C  CD    . GLN A 1 341 ? 18.137 13.700  -7.389  1.00 38.82 ? 338 GLN A CD    1 
ATOM   2634 O  OE1   . GLN A 1 341 ? 17.904 14.904  -7.282  1.00 43.83 ? 338 GLN A OE1   1 
ATOM   2635 N  NE2   . GLN A 1 341 ? 17.296 12.857  -7.980  1.00 43.41 ? 338 GLN A NE2   1 
ATOM   2636 N  N     . TRP A 1 342 ? 22.795 15.357  -4.589  1.00 26.03 ? 339 TRP A N     1 
ATOM   2637 C  CA    . TRP A 1 342 ? 23.844 16.353  -4.447  1.00 21.55 ? 339 TRP A CA    1 
ATOM   2638 C  C     . TRP A 1 342 ? 25.188 15.661  -4.237  1.00 19.81 ? 339 TRP A C     1 
ATOM   2639 O  O     . TRP A 1 342 ? 26.190 16.048  -4.830  1.00 21.22 ? 339 TRP A O     1 
ATOM   2640 C  CB    . TRP A 1 342 ? 23.549 17.311  -3.290  1.00 20.80 ? 339 TRP A CB    1 
ATOM   2641 C  CG    . TRP A 1 342 ? 24.524 18.464  -3.216  1.00 23.63 ? 339 TRP A CG    1 
ATOM   2642 C  CD1   . TRP A 1 342 ? 24.494 19.613  -3.950  1.00 25.60 ? 339 TRP A CD1   1 
ATOM   2643 C  CD2   . TRP A 1 342 ? 25.665 18.565  -2.359  1.00 21.13 ? 339 TRP A CD2   1 
ATOM   2644 N  NE1   . TRP A 1 342 ? 25.547 20.423  -3.607  1.00 30.78 ? 339 TRP A NE1   1 
ATOM   2645 C  CE2   . TRP A 1 342 ? 26.276 19.808  -2.625  1.00 24.64 ? 339 TRP A CE2   1 
ATOM   2646 C  CE3   . TRP A 1 342 ? 26.223 17.730  -1.387  1.00 23.54 ? 339 TRP A CE3   1 
ATOM   2647 C  CZ2   . TRP A 1 342 ? 27.430 20.228  -1.965  1.00 28.91 ? 339 TRP A CZ2   1 
ATOM   2648 C  CZ3   . TRP A 1 342 ? 27.360 18.153  -0.723  1.00 24.73 ? 339 TRP A CZ3   1 
ATOM   2649 C  CH2   . TRP A 1 342 ? 27.957 19.386  -1.020  1.00 23.67 ? 339 TRP A CH2   1 
ATOM   2650 N  N     . TRP A 1 343 ? 25.200 14.638  -3.394  1.00 22.84 ? 340 TRP A N     1 
ATOM   2651 C  CA    . TRP A 1 343 ? 26.442 13.934  -3.099  1.00 20.92 ? 340 TRP A CA    1 
ATOM   2652 C  C     . TRP A 1 343 ? 26.882 13.056  -4.264  1.00 23.32 ? 340 TRP A C     1 
ATOM   2653 O  O     . TRP A 1 343 ? 28.075 12.925  -4.516  1.00 20.57 ? 340 TRP A O     1 
ATOM   2654 C  CB    . TRP A 1 343 ? 26.307 13.108  -1.825  1.00 23.40 ? 340 TRP A CB    1 
ATOM   2655 C  CG    . TRP A 1 343 ? 26.444 13.951  -0.599  1.00 21.54 ? 340 TRP A CG    1 
ATOM   2656 C  CD1   . TRP A 1 343 ? 25.454 14.326  0.262   1.00 27.26 ? 340 TRP A CD1   1 
ATOM   2657 C  CD2   . TRP A 1 343 ? 27.648 14.564  -0.121  1.00 21.39 ? 340 TRP A CD2   1 
ATOM   2658 N  NE1   . TRP A 1 343 ? 25.974 15.123  1.260   1.00 23.03 ? 340 TRP A NE1   1 
ATOM   2659 C  CE2   . TRP A 1 343 ? 27.317 15.281  1.046   1.00 19.84 ? 340 TRP A CE2   1 
ATOM   2660 C  CE3   . TRP A 1 343 ? 28.972 14.566  -0.563  1.00 21.32 ? 340 TRP A CE3   1 
ATOM   2661 C  CZ2   . TRP A 1 343 ? 28.268 15.991  1.781   1.00 19.76 ? 340 TRP A CZ2   1 
ATOM   2662 C  CZ3   . TRP A 1 343 ? 29.910 15.277  0.162   1.00 17.62 ? 340 TRP A CZ3   1 
ATOM   2663 C  CH2   . TRP A 1 343 ? 29.555 15.975  1.324   1.00 23.55 ? 340 TRP A CH2   1 
ATOM   2664 N  N     . LEU A 1 344 ? 25.936 12.471  -4.995  1.00 17.45 ? 341 LEU A N     1 
ATOM   2665 C  CA    . LEU A 1 344 ? 26.321 11.725  -6.193  1.00 21.72 ? 341 LEU A CA    1 
ATOM   2666 C  C     . LEU A 1 344 ? 27.025 12.667  -7.161  1.00 17.79 ? 341 LEU A C     1 
ATOM   2667 O  O     . LEU A 1 344 ? 28.007 12.291  -7.830  1.00 19.39 ? 341 LEU A O     1 
ATOM   2668 C  CB    . LEU A 1 344 ? 25.108 11.071  -6.862  1.00 18.16 ? 341 LEU A CB    1 
ATOM   2669 C  CG    . LEU A 1 344 ? 24.564 9.793   -6.222  1.00 23.64 ? 341 LEU A CG    1 
ATOM   2670 C  CD1   . LEU A 1 344 ? 23.298 9.340   -6.940  1.00 25.45 ? 341 LEU A CD1   1 
ATOM   2671 C  CD2   . LEU A 1 344 ? 25.602 8.683   -6.211  1.00 21.13 ? 341 LEU A CD2   1 
ATOM   2672 N  N     . LEU A 1 345 ? 26.556 13.908  -7.224  1.00 19.08 ? 342 LEU A N     1 
ATOM   2673 C  CA    . LEU A 1 345 ? 27.165 14.877  -8.112  1.00 17.78 ? 342 LEU A CA    1 
ATOM   2674 C  C     . LEU A 1 345 ? 28.572 15.246  -7.642  1.00 16.41 ? 342 LEU A C     1 
ATOM   2675 O  O     . LEU A 1 345 ? 29.492 15.358  -8.450  1.00 21.23 ? 342 LEU A O     1 
ATOM   2676 C  CB    . LEU A 1 345 ? 26.294 16.138  -8.230  1.00 21.87 ? 342 LEU A CB    1 
ATOM   2677 C  CG    . LEU A 1 345 ? 26.838 17.216  -9.167  1.00 21.28 ? 342 LEU A CG    1 
ATOM   2678 C  CD1   . LEU A 1 345 ? 27.082 16.668  -10.582 1.00 23.73 ? 342 LEU A CD1   1 
ATOM   2679 C  CD2   . LEU A 1 345 ? 25.886 18.409  -9.229  1.00 25.64 ? 342 LEU A CD2   1 
ATOM   2680 N  N     . GLN A 1 346 ? 28.742 15.421  -6.338  1.00 16.90 ? 343 GLN A N     1 
ATOM   2681 C  CA    . GLN A 1 346 ? 30.056 15.794  -5.809  1.00 17.67 ? 343 GLN A CA    1 
ATOM   2682 C  C     . GLN A 1 346 ? 31.086 14.711  -6.134  1.00 16.42 ? 343 GLN A C     1 
ATOM   2683 O  O     . GLN A 1 346 ? 32.189 15.007  -6.618  1.00 17.42 ? 343 GLN A O     1 
ATOM   2684 C  CB    . GLN A 1 346 ? 30.000 16.018  -4.295  1.00 21.22 ? 343 GLN A CB    1 
ATOM   2685 C  CG    . GLN A 1 346 ? 29.062 17.148  -3.849  1.00 18.88 ? 343 GLN A CG    1 
ATOM   2686 C  CD    . GLN A 1 346 ? 29.075 18.352  -4.771  1.00 21.97 ? 343 GLN A CD    1 
ATOM   2687 O  OE1   . GLN A 1 346 ? 30.045 19.110  -4.827  1.00 20.89 ? 343 GLN A OE1   1 
ATOM   2688 N  NE2   . GLN A 1 346 ? 27.977 18.538  -5.503  1.00 22.50 ? 343 GLN A NE2   1 
ATOM   2689 N  N     . LEU A 1 347 ? 30.712 13.468  -5.859  1.00 19.44 ? 344 LEU A N     1 
ATOM   2690 C  CA    . LEU A 1 347 ? 31.570 12.329  -6.175  1.00 18.91 ? 344 LEU A CA    1 
ATOM   2691 C  C     . LEU A 1 347 ? 31.842 12.277  -7.679  1.00 16.22 ? 344 LEU A C     1 
ATOM   2692 O  O     . LEU A 1 347 ? 32.981 12.073  -8.108  1.00 15.81 ? 344 LEU A O     1 
ATOM   2693 C  CB    . LEU A 1 347 ? 30.939 11.016  -5.705  1.00 16.21 ? 344 LEU A CB    1 
ATOM   2694 C  CG    . LEU A 1 347 ? 30.942 10.685  -4.208  1.00 22.56 ? 344 LEU A CG    1 
ATOM   2695 C  CD1   . LEU A 1 347 ? 30.314 9.328   -3.942  1.00 22.00 ? 344 LEU A CD1   1 
ATOM   2696 C  CD2   . LEU A 1 347 ? 32.333 10.690  -3.681  1.00 25.61 ? 344 LEU A CD2   1 
ATOM   2697 N  N     . ALA A 1 348 ? 30.799 12.485  -8.484  1.00 15.89 ? 345 ALA A N     1 
ATOM   2698 C  CA    . ALA A 1 348 ? 30.948 12.393  -9.932  1.00 17.44 ? 345 ALA A CA    1 
ATOM   2699 C  C     . ALA A 1 348 ? 31.864 13.484  -10.479 1.00 16.27 ? 345 ALA A C     1 
ATOM   2700 O  O     . ALA A 1 348 ? 32.572 13.284  -11.468 1.00 17.18 ? 345 ALA A O     1 
ATOM   2701 C  CB    . ALA A 1 348 ? 29.582 12.470  -10.609 1.00 15.27 ? 345 ALA A CB    1 
ATOM   2702 N  N     . GLN A 1 349 ? 31.828 14.651  -9.844  1.00 13.86 ? 346 GLN A N     1 
ATOM   2703 C  CA    . GLN A 1 349 ? 32.666 15.752  -10.259 1.00 16.54 ? 346 GLN A CA    1 
ATOM   2704 C  C     . GLN A 1 349 ? 34.134 15.473  -9.945  1.00 18.13 ? 346 GLN A C     1 
ATOM   2705 O  O     . GLN A 1 349 ? 34.999 15.789  -10.748 1.00 17.46 ? 346 GLN A O     1 
ATOM   2706 C  CB    . GLN A 1 349 ? 32.205 17.053  -9.606  1.00 19.57 ? 346 GLN A CB    1 
ATOM   2707 C  CG    . GLN A 1 349 ? 30.939 17.612  -10.256 1.00 23.17 ? 346 GLN A CG    1 
ATOM   2708 C  CD    . GLN A 1 349 ? 30.421 18.864  -9.568  1.00 28.00 ? 346 GLN A CD    1 
ATOM   2709 O  OE1   . GLN A 1 349 ? 30.908 19.255  -8.506  1.00 37.34 ? 346 GLN A OE1   1 
ATOM   2710 N  NE2   . GLN A 1 349 ? 29.431 19.503  -10.180 1.00 38.78 ? 346 GLN A NE2   1 
ATOM   2711 N  N     . GLU A 1 350 ? 34.417 14.865  -8.796  1.00 15.84 ? 347 GLU A N     1 
ATOM   2712 C  CA    . GLU A 1 350 ? 35.803 14.497  -8.516  1.00 16.76 ? 347 GLU A CA    1 
ATOM   2713 C  C     . GLU A 1 350 ? 36.244 13.389  -9.472  1.00 14.95 ? 347 GLU A C     1 
ATOM   2714 O  O     . GLU A 1 350 ? 37.369 13.410  -9.969  1.00 17.38 ? 347 GLU A O     1 
ATOM   2715 C  CB    . GLU A 1 350 ? 36.015 14.042  -7.068  1.00 16.58 ? 347 GLU A CB    1 
ATOM   2716 C  CG    . GLU A 1 350 ? 37.479 13.613  -6.834  1.00 17.60 ? 347 GLU A CG    1 
ATOM   2717 C  CD    . GLU A 1 350 ? 37.745 13.025  -5.457  1.00 22.71 ? 347 GLU A CD    1 
ATOM   2718 O  OE1   . GLU A 1 350 ? 37.113 13.459  -4.471  1.00 20.71 ? 347 GLU A OE1   1 
ATOM   2719 O  OE2   . GLU A 1 350 ? 38.595 12.118  -5.357  1.00 17.03 ? 347 GLU A OE2   1 
ATOM   2720 N  N     . LEU A 1 351 ? 35.361 12.427  -9.712  1.00 16.58 ? 348 LEU A N     1 
ATOM   2721 C  CA    . LEU A 1 351 ? 35.665 11.319  -10.600 1.00 17.13 ? 348 LEU A CA    1 
ATOM   2722 C  C     . LEU A 1 351 ? 35.962 11.819  -12.012 1.00 18.62 ? 348 LEU A C     1 
ATOM   2723 O  O     . LEU A 1 351 ? 36.938 11.401  -12.636 1.00 18.32 ? 348 LEU A O     1 
ATOM   2724 C  CB    . LEU A 1 351 ? 34.518 10.311  -10.611 1.00 17.46 ? 348 LEU A CB    1 
ATOM   2725 C  CG    . LEU A 1 351 ? 34.778 9.010   -11.383 1.00 19.08 ? 348 LEU A CG    1 
ATOM   2726 C  CD1   . LEU A 1 351 ? 36.051 8.327   -10.853 1.00 20.93 ? 348 LEU A CD1   1 
ATOM   2727 C  CD2   . LEU A 1 351 ? 33.587 8.060   -11.300 1.00 20.46 ? 348 LEU A CD2   1 
ATOM   2728 N  N     . GLU A 1 352 ? 35.133 12.730  -12.515 1.00 15.85 ? 349 GLU A N     1 
ATOM   2729 C  CA    . GLU A 1 352 ? 35.374 13.303  -13.837 1.00 17.54 ? 349 GLU A CA    1 
ATOM   2730 C  C     . GLU A 1 352 ? 36.729 13.982  -13.896 1.00 17.53 ? 349 GLU A C     1 
ATOM   2731 O  O     . GLU A 1 352 ? 37.459 13.867  -14.874 1.00 16.60 ? 349 GLU A O     1 
ATOM   2732 C  CB    . GLU A 1 352 ? 34.293 14.320  -14.207 1.00 19.15 ? 349 GLU A CB    1 
ATOM   2733 C  CG    . GLU A 1 352 ? 34.617 15.064  -15.504 1.00 21.72 ? 349 GLU A CG    1 
ATOM   2734 C  CD    . GLU A 1 352 ? 33.547 16.069  -15.914 1.00 35.72 ? 349 GLU A CD    1 
ATOM   2735 O  OE1   . GLU A 1 352 ? 33.793 16.833  -16.870 1.00 36.10 ? 349 GLU A OE1   1 
ATOM   2736 O  OE2   . GLU A 1 352 ? 32.459 16.092  -15.296 1.00 32.77 ? 349 GLU A OE2   1 
ATOM   2737 N  N     . GLU A 1 353 ? 37.065 14.698  -12.832 1.00 19.26 ? 350 GLU A N     1 
ATOM   2738 C  CA    . GLU A 1 353 ? 38.321 15.419  -12.789 1.00 14.98 ? 350 GLU A CA    1 
ATOM   2739 C  C     . GLU A 1 353 ? 39.496 14.441  -12.896 1.00 19.39 ? 350 GLU A C     1 
ATOM   2740 O  O     . GLU A 1 353 ? 40.423 14.623  -13.695 1.00 18.88 ? 350 GLU A O     1 
ATOM   2741 C  CB    . GLU A 1 353 ? 38.411 16.235  -11.500 1.00 21.90 ? 350 GLU A CB    1 
ATOM   2742 C  CG    . GLU A 1 353 ? 39.583 17.178  -11.429 1.00 30.79 ? 350 GLU A CG    1 
ATOM   2743 C  CD    . GLU A 1 353 ? 39.403 18.205  -10.325 1.00 36.40 ? 350 GLU A CD    1 
ATOM   2744 O  OE1   . GLU A 1 353 ? 39.197 17.789  -9.166  1.00 41.52 ? 350 GLU A OE1   1 
ATOM   2745 O  OE2   . GLU A 1 353 ? 39.451 19.420  -10.617 1.00 45.55 ? 350 GLU A OE2   1 
ATOM   2746 N  N     . ARG A 1 354 ? 39.432 13.384  -12.102 1.00 16.97 ? 351 ARG A N     1 
ATOM   2747 C  CA    . ARG A 1 354 ? 40.513 12.413  -12.099 1.00 17.03 ? 351 ARG A CA    1 
ATOM   2748 C  C     . ARG A 1 354 ? 40.540 11.616  -13.391 1.00 14.75 ? 351 ARG A C     1 
ATOM   2749 O  O     . ARG A 1 354 ? 41.623 11.315  -13.896 1.00 17.09 ? 351 ARG A O     1 
ATOM   2750 C  CB    . ARG A 1 354 ? 40.395 11.499  -10.878 1.00 18.28 ? 351 ARG A CB    1 
ATOM   2751 C  CG    . ARG A 1 354 ? 40.740 12.240  -9.589  1.00 15.88 ? 351 ARG A CG    1 
ATOM   2752 C  CD    . ARG A 1 354 ? 40.284 11.514  -8.346  1.00 19.10 ? 351 ARG A CD    1 
ATOM   2753 N  NE    . ARG A 1 354 ? 40.795 10.155  -8.281  1.00 17.63 ? 351 ARG A NE    1 
ATOM   2754 C  CZ    . ARG A 1 354 ? 40.343 9.237   -7.438  1.00 18.44 ? 351 ARG A CZ    1 
ATOM   2755 N  NH1   . ARG A 1 354 ? 39.389 9.540   -6.545  1.00 16.04 ? 351 ARG A NH1   1 
ATOM   2756 N  NH2   . ARG A 1 354 ? 40.873 8.027   -7.472  1.00 13.70 ? 351 ARG A NH2   1 
ATOM   2757 N  N     . LEU A 1 355 ? 39.364 11.303  -13.937 1.00 15.75 ? 352 LEU A N     1 
ATOM   2758 C  CA    . LEU A 1 355 ? 39.283 10.542  -15.183 1.00 14.74 ? 352 LEU A CA    1 
ATOM   2759 C  C     . LEU A 1 355 ? 39.854 11.338  -16.353 1.00 17.65 ? 352 LEU A C     1 
ATOM   2760 O  O     . LEU A 1 355 ? 40.579 10.797  -17.184 1.00 19.94 ? 352 LEU A O     1 
ATOM   2761 C  CB    . LEU A 1 355 ? 37.847 10.138  -15.486 1.00 16.54 ? 352 LEU A CB    1 
ATOM   2762 C  CG    . LEU A 1 355 ? 37.292 8.927   -14.746 1.00 18.95 ? 352 LEU A CG    1 
ATOM   2763 C  CD1   . LEU A 1 355 ? 35.859 8.702   -15.165 1.00 19.43 ? 352 LEU A CD1   1 
ATOM   2764 C  CD2   . LEU A 1 355 ? 38.129 7.683   -15.022 1.00 16.89 ? 352 LEU A CD2   1 
ATOM   2765 N  N     . THR A 1 356 ? 39.524 12.626  -16.423 1.00 17.39 ? 353 THR A N     1 
ATOM   2766 C  CA    . THR A 1 356 ? 39.992 13.439  -17.533 1.00 20.11 ? 353 THR A CA    1 
ATOM   2767 C  C     . THR A 1 356 ? 41.507 13.568  -17.484 1.00 20.22 ? 353 THR A C     1 
ATOM   2768 O  O     . THR A 1 356 ? 42.171 13.450  -18.509 1.00 22.16 ? 353 THR A O     1 
ATOM   2769 C  CB    . THR A 1 356 ? 39.321 14.830  -17.542 1.00 21.47 ? 353 THR A CB    1 
ATOM   2770 O  OG1   . THR A 1 356 ? 37.920 14.658  -17.780 1.00 26.05 ? 353 THR A OG1   1 
ATOM   2771 C  CG2   . THR A 1 356 ? 39.899 15.698  -18.634 1.00 24.93 ? 353 THR A CG2   1 
ATOM   2772 N  N     . LYS A 1 357 ? 42.062 13.763  -16.291 1.00 18.82 ? 354 LYS A N     1 
ATOM   2773 C  CA    . LYS A 1 357 ? 43.513 13.808  -16.165 1.00 17.79 ? 354 LYS A CA    1 
ATOM   2774 C  C     . LYS A 1 357 ? 44.138 12.459  -16.528 1.00 16.90 ? 354 LYS A C     1 
ATOM   2775 O  O     . LYS A 1 357 ? 45.184 12.405  -17.184 1.00 20.31 ? 354 LYS A O     1 
ATOM   2776 C  CB    . LYS A 1 357 ? 43.927 14.220  -14.755 1.00 18.54 ? 354 LYS A CB    1 
ATOM   2777 C  CG    . LYS A 1 357 ? 45.429 14.348  -14.599 1.00 24.41 ? 354 LYS A CG    1 
ATOM   2778 C  CD    . LYS A 1 357 ? 45.794 15.384  -13.542 1.00 37.49 ? 354 LYS A CD    1 
ATOM   2779 C  CE    . LYS A 1 357 ? 47.209 15.892  -13.763 1.00 40.27 ? 354 LYS A CE    1 
ATOM   2780 N  NZ    . LYS A 1 357 ? 48.143 14.744  -13.896 1.00 29.02 ? 354 LYS A NZ    1 
ATOM   2781 N  N     . ASP A 1 358 ? 43.491 11.374  -16.120 1.00 17.20 ? 355 ASP A N     1 
ATOM   2782 C  CA    . ASP A 1 358 ? 44.005 10.034  -16.422 1.00 20.36 ? 355 ASP A CA    1 
ATOM   2783 C  C     . ASP A 1 358 ? 44.054 9.795   -17.933 1.00 18.46 ? 355 ASP A C     1 
ATOM   2784 O  O     . ASP A 1 358 ? 45.023 9.234   -18.441 1.00 17.58 ? 355 ASP A O     1 
ATOM   2785 C  CB    . ASP A 1 358 ? 43.155 8.953   -15.738 1.00 18.35 ? 355 ASP A CB    1 
ATOM   2786 C  CG    . ASP A 1 358 ? 43.681 7.547   -15.990 1.00 21.74 ? 355 ASP A CG    1 
ATOM   2787 O  OD1   . ASP A 1 358 ? 44.638 7.134   -15.292 1.00 16.49 ? 355 ASP A OD1   1 
ATOM   2788 O  OD2   . ASP A 1 358 ? 43.128 6.848   -16.872 1.00 18.87 ? 355 ASP A OD2   1 
ATOM   2789 N  N     . ARG A 1 359 ? 43.019 10.236  -18.648 1.00 17.00 ? 356 ARG A N     1 
ATOM   2790 C  CA    . ARG A 1 359 ? 42.945 10.015  -20.088 1.00 20.55 ? 356 ARG A CA    1 
ATOM   2791 C  C     . ARG A 1 359 ? 44.085 10.738  -20.796 1.00 18.87 ? 356 ARG A C     1 
ATOM   2792 O  O     . ARG A 1 359 ? 44.739 10.183  -21.685 1.00 19.84 ? 356 ARG A O     1 
ATOM   2793 C  CB    . ARG A 1 359 ? 41.593 10.486  -20.630 1.00 19.08 ? 356 ARG A CB    1 
ATOM   2794 C  CG    . ARG A 1 359 ? 41.308 10.093  -22.076 1.00 22.34 ? 356 ARG A CG    1 
ATOM   2795 C  CD    . ARG A 1 359 ? 39.908 10.559  -22.486 1.00 22.68 ? 356 ARG A CD    1 
ATOM   2796 N  NE    . ARG A 1 359 ? 39.750 12.010  -22.353 1.00 28.72 ? 356 ARG A NE    1 
ATOM   2797 C  CZ    . ARG A 1 359 ? 38.583 12.641  -22.204 1.00 29.69 ? 356 ARG A CZ    1 
ATOM   2798 N  NH1   . ARG A 1 359 ? 37.443 11.958  -22.164 1.00 32.99 ? 356 ARG A NH1   1 
ATOM   2799 N  NH2   . ARG A 1 359 ? 38.557 13.965  -22.089 1.00 31.96 ? 356 ARG A NH2   1 
ATOM   2800 N  N     . ASN A 1 360 ? 44.345 11.972  -20.375 1.00 18.00 ? 357 ASN A N     1 
ATOM   2801 C  CA    . ASN A 1 360 ? 45.430 12.768  -20.950 1.00 16.86 ? 357 ASN A CA    1 
ATOM   2802 C  C     . ASN A 1 360 ? 46.817 12.195  -20.660 1.00 19.55 ? 357 ASN A C     1 
ATOM   2803 O  O     . ASN A 1 360 ? 47.682 12.177  -21.534 1.00 23.05 ? 357 ASN A O     1 
ATOM   2804 C  CB    . ASN A 1 360 ? 45.369 14.205  -20.432 1.00 18.73 ? 357 ASN A CB    1 
ATOM   2805 C  CG    . ASN A 1 360 ? 44.241 14.997  -21.042 1.00 22.82 ? 357 ASN A CG    1 
ATOM   2806 O  OD1   . ASN A 1 360 ? 43.855 14.769  -22.190 1.00 25.97 ? 357 ASN A OD1   1 
ATOM   2807 N  ND2   . ASN A 1 360 ? 43.726 15.965  -20.289 1.00 22.62 ? 357 ASN A ND2   1 
ATOM   2808 N  N     . ASP A 1 361 ? 47.015 11.732  -19.427 1.00 18.40 ? 358 ASP A N     1 
ATOM   2809 C  CA    . ASP A 1 361 ? 48.316 11.227  -18.984 1.00 20.63 ? 358 ASP A CA    1 
ATOM   2810 C  C     . ASP A 1 361 ? 48.624 9.851   -19.529 1.00 19.66 ? 358 ASP A C     1 
ATOM   2811 O  O     . ASP A 1 361 ? 49.768 9.545   -19.862 1.00 18.90 ? 358 ASP A O     1 
ATOM   2812 C  CB    . ASP A 1 361 ? 48.388 11.161  -17.448 1.00 19.69 ? 358 ASP A CB    1 
ATOM   2813 C  CG    . ASP A 1 361 ? 48.503 12.534  -16.804 1.00 30.80 ? 358 ASP A CG    1 
ATOM   2814 O  OD1   . ASP A 1 361 ? 48.784 13.520  -17.527 1.00 25.69 ? 358 ASP A OD1   1 
ATOM   2815 O  OD2   . ASP A 1 361 ? 48.321 12.615  -15.569 1.00 25.32 ? 358 ASP A OD2   1 
ATOM   2816 N  N     . ASN A 1 362 ? 47.598 9.014   -19.601 1.00 18.20 ? 359 ASN A N     1 
ATOM   2817 C  CA    . ASN A 1 362 ? 47.835 7.584   -19.718 1.00 21.08 ? 359 ASN A CA    1 
ATOM   2818 C  C     . ASN A 1 362 ? 47.235 6.933   -20.956 1.00 21.03 ? 359 ASN A C     1 
ATOM   2819 O  O     . ASN A 1 362 ? 47.360 5.724   -21.120 1.00 19.41 ? 359 ASN A O     1 
ATOM   2820 C  CB    . ASN A 1 362 ? 47.331 6.886   -18.442 1.00 17.87 ? 359 ASN A CB    1 
ATOM   2821 C  CG    . ASN A 1 362 ? 48.094 7.348   -17.185 1.00 23.48 ? 359 ASN A CG    1 
ATOM   2822 O  OD1   . ASN A 1 362 ? 49.319 7.496   -17.210 1.00 19.50 ? 359 ASN A OD1   1 
ATOM   2823 N  ND2   . ASN A 1 362 ? 47.371 7.563   -16.087 1.00 19.62 ? 359 ASN A ND2   1 
ATOM   2824 N  N     . ASP A 1 363 ? 46.613 7.725   -21.830 1.00 20.11 ? 360 ASP A N     1 
ATOM   2825 C  CA    . ASP A 1 363 ? 46.093 7.211   -23.107 1.00 22.05 ? 360 ASP A CA    1 
ATOM   2826 C  C     . ASP A 1 363 ? 45.177 6.025   -22.931 1.00 21.85 ? 360 ASP A C     1 
ATOM   2827 O  O     . ASP A 1 363 ? 45.387 4.959   -23.530 1.00 21.03 ? 360 ASP A O     1 
ATOM   2828 C  CB    . ASP A 1 363 ? 47.242 6.813   -24.036 1.00 25.55 ? 360 ASP A CB    1 
ATOM   2829 C  CG    . ASP A 1 363 ? 48.156 7.971   -24.345 1.00 29.81 ? 360 ASP A CG    1 
ATOM   2830 O  OD1   . ASP A 1 363 ? 47.633 9.030   -24.760 1.00 28.26 ? 360 ASP A OD1   1 
ATOM   2831 O  OD2   . ASP A 1 363 ? 49.383 7.830   -24.142 1.00 29.67 ? 360 ASP A OD2   1 
ATOM   2832 N  N     . ARG A 1 364 ? 44.165 6.202   -22.094 1.00 19.55 ? 361 ARG A N     1 
ATOM   2833 C  CA    . ARG A 1 364 ? 43.166 5.172   -21.896 1.00 20.24 ? 361 ARG A CA    1 
ATOM   2834 C  C     . ARG A 1 364 ? 41.854 5.815   -21.496 1.00 20.41 ? 361 ARG A C     1 
ATOM   2835 O  O     . ARG A 1 364 ? 41.828 6.962   -21.027 1.00 19.59 ? 361 ARG A O     1 
ATOM   2836 C  CB    . ARG A 1 364 ? 43.612 4.174   -20.830 1.00 20.11 ? 361 ARG A CB    1 
ATOM   2837 C  CG    . ARG A 1 364 ? 43.965 4.824   -19.491 1.00 19.30 ? 361 ARG A CG    1 
ATOM   2838 C  CD    . ARG A 1 364 ? 44.346 3.773   -18.458 1.00 16.99 ? 361 ARG A CD    1 
ATOM   2839 N  NE    . ARG A 1 364 ? 44.446 4.360   -17.128 1.00 17.43 ? 361 ARG A NE    1 
ATOM   2840 C  CZ    . ARG A 1 364 ? 44.661 3.662   -16.015 1.00 21.46 ? 361 ARG A CZ    1 
ATOM   2841 N  NH1   . ARG A 1 364 ? 44.726 4.286   -14.843 1.00 16.49 ? 361 ARG A NH1   1 
ATOM   2842 N  NH2   . ARG A 1 364 ? 44.795 2.348   -16.074 1.00 19.31 ? 361 ARG A NH2   1 
ATOM   2843 N  N     . VAL A 1 365 ? 40.775 5.069   -21.673 1.00 19.76 ? 362 VAL A N     1 
ATOM   2844 C  CA    . VAL A 1 365 ? 39.443 5.517   -21.286 1.00 20.33 ? 362 VAL A CA    1 
ATOM   2845 C  C     . VAL A 1 365 ? 38.708 4.404   -20.537 1.00 23.89 ? 362 VAL A C     1 
ATOM   2846 O  O     . VAL A 1 365 ? 38.697 3.246   -20.955 1.00 23.47 ? 362 VAL A O     1 
ATOM   2847 C  CB    . VAL A 1 365 ? 38.609 5.966   -22.526 1.00 22.28 ? 362 VAL A CB    1 
ATOM   2848 C  CG1   A VAL A 1 365 ? 39.211 7.202   -23.163 0.44 23.77 ? 362 VAL A CG1   1 
ATOM   2849 C  CG1   B VAL A 1 365 ? 38.692 4.923   -23.635 0.56 24.98 ? 362 VAL A CG1   1 
ATOM   2850 C  CG2   A VAL A 1 365 ? 38.498 4.842   -23.548 0.44 24.90 ? 362 VAL A CG2   1 
ATOM   2851 C  CG2   B VAL A 1 365 ? 37.170 6.259   -22.147 0.56 20.59 ? 362 VAL A CG2   1 
ATOM   2852 N  N     . ALA A 1 366 ? 38.119 4.756   -19.404 1.00 20.31 ? 363 ALA A N     1 
ATOM   2853 C  CA    . ALA A 1 366 ? 37.266 3.838   -18.668 1.00 21.77 ? 363 ALA A CA    1 
ATOM   2854 C  C     . ALA A 1 366 ? 35.928 3.630   -19.389 1.00 25.09 ? 363 ALA A C     1 
ATOM   2855 O  O     . ALA A 1 366 ? 35.378 4.562   -19.987 1.00 25.45 ? 363 ALA A O     1 
ATOM   2856 C  CB    . ALA A 1 366 ? 37.037 4.359   -17.261 1.00 20.45 ? 363 ALA A CB    1 
ATOM   2857 N  N     . THR A 1 367 ? 35.403 2.412   -19.331 1.00 18.29 ? 364 THR A N     1 
ATOM   2858 C  CA    . THR A 1 367 ? 34.178 2.086   -20.055 1.00 19.05 ? 364 THR A CA    1 
ATOM   2859 C  C     . THR A 1 367 ? 33.025 1.619   -19.167 1.00 21.30 ? 364 THR A C     1 
ATOM   2860 O  O     . THR A 1 367 ? 31.895 1.472   -19.634 1.00 20.79 ? 364 THR A O     1 
ATOM   2861 C  CB    . THR A 1 367 ? 34.451 0.999   -21.114 1.00 22.40 ? 364 THR A CB    1 
ATOM   2862 O  OG1   . THR A 1 367 ? 34.716 -0.249  -20.465 1.00 23.80 ? 364 THR A OG1   1 
ATOM   2863 C  CG2   . THR A 1 367 ? 35.653 1.401   -21.971 1.00 23.54 ? 364 THR A CG2   1 
ATOM   2864 N  N     . GLN A 1 368 ? 33.299 1.376   -17.892 1.00 23.61 ? 365 GLN A N     1 
ATOM   2865 C  CA    . GLN A 1 368 ? 32.260 0.882   -17.002 1.00 21.63 ? 365 GLN A CA    1 
ATOM   2866 C  C     . GLN A 1 368 ? 32.224 1.710   -15.727 1.00 19.93 ? 365 GLN A C     1 
ATOM   2867 O  O     . GLN A 1 368 ? 33.267 2.033   -15.166 1.00 21.73 ? 365 GLN A O     1 
ATOM   2868 C  CB    . GLN A 1 368 ? 32.487 -0.595  -16.673 1.00 26.02 ? 365 GLN A CB    1 
ATOM   2869 C  CG    . GLN A 1 368 ? 31.372 -1.228  -15.864 1.00 27.83 ? 365 GLN A CG    1 
ATOM   2870 C  CD    . GLN A 1 368 ? 31.578 -2.717  -15.655 1.00 34.08 ? 365 GLN A CD    1 
ATOM   2871 O  OE1   . GLN A 1 368 ? 32.364 -3.133  -14.803 1.00 40.35 ? 365 GLN A OE1   1 
ATOM   2872 N  NE2   . GLN A 1 368 ? 30.864 -3.529  -16.426 1.00 37.44 ? 365 GLN A NE2   1 
ATOM   2873 N  N     . LEU A 1 369 ? 31.019 2.088   -15.312 1.00 21.68 ? 366 LEU A N     1 
ATOM   2874 C  CA    . LEU A 1 369 ? 30.819 2.811   -14.056 1.00 22.05 ? 366 LEU A CA    1 
ATOM   2875 C  C     . LEU A 1 369 ? 30.187 1.879   -13.030 1.00 24.28 ? 366 LEU A C     1 
ATOM   2876 O  O     . LEU A 1 369 ? 29.141 1.277   -13.290 1.00 23.58 ? 366 LEU A O     1 
ATOM   2877 C  CB    . LEU A 1 369 ? 29.932 4.043   -14.262 1.00 20.68 ? 366 LEU A CB    1 
ATOM   2878 C  CG    . LEU A 1 369 ? 29.664 4.875   -13.007 1.00 22.14 ? 366 LEU A CG    1 
ATOM   2879 C  CD1   . LEU A 1 369 ? 30.907 5.674   -12.658 1.00 21.32 ? 366 LEU A CD1   1 
ATOM   2880 C  CD2   . LEU A 1 369 ? 28.442 5.787   -13.188 1.00 25.21 ? 366 LEU A CD2   1 
ATOM   2881 N  N     . VAL A 1 370 ? 30.829 1.743   -11.874 1.00 17.72 ? 367 VAL A N     1 
ATOM   2882 C  CA    . VAL A 1 370 ? 30.283 0.927   -10.799 1.00 18.88 ? 367 VAL A CA    1 
ATOM   2883 C  C     . VAL A 1 370 ? 29.742 1.822   -9.695  1.00 21.62 ? 367 VAL A C     1 
ATOM   2884 O  O     . VAL A 1 370 ? 30.445 2.715   -9.219  1.00 23.07 ? 367 VAL A O     1 
ATOM   2885 C  CB    . VAL A 1 370 ? 31.338 -0.023  -10.211 1.00 24.13 ? 367 VAL A CB    1 
ATOM   2886 C  CG1   . VAL A 1 370 ? 30.747 -0.824  -9.061  1.00 24.08 ? 367 VAL A CG1   1 
ATOM   2887 C  CG2   . VAL A 1 370 ? 31.886 -0.939  -11.305 1.00 22.18 ? 367 VAL A CG2   1 
ATOM   2888 N  N     . VAL A 1 371 ? 28.498 1.577   -9.299  1.00 19.62 ? 368 VAL A N     1 
ATOM   2889 C  CA    . VAL A 1 371 ? 27.843 2.363   -8.263  1.00 20.06 ? 368 VAL A CA    1 
ATOM   2890 C  C     . VAL A 1 371 ? 27.571 1.484   -7.064  1.00 25.41 ? 368 VAL A C     1 
ATOM   2891 O  O     . VAL A 1 371 ? 26.989 0.408   -7.192  1.00 23.53 ? 368 VAL A O     1 
ATOM   2892 C  CB    . VAL A 1 371 ? 26.525 2.989   -8.777  1.00 21.37 ? 368 VAL A CB    1 
ATOM   2893 C  CG1   . VAL A 1 371 ? 25.932 3.921   -7.731  1.00 22.52 ? 368 VAL A CG1   1 
ATOM   2894 C  CG2   . VAL A 1 371 ? 26.773 3.738   -10.077 1.00 22.51 ? 368 VAL A CG2   1 
ATOM   2895 N  N     . SER A 1 372 ? 28.026 1.927   -5.897  1.00 22.51 ? 369 SER A N     1 
ATOM   2896 C  CA    . SER A 1 372 ? 27.845 1.160   -4.680  1.00 25.09 ? 369 SER A CA    1 
ATOM   2897 C  C     . SER A 1 372 ? 27.302 2.047   -3.571  1.00 21.95 ? 369 SER A C     1 
ATOM   2898 O  O     . SER A 1 372 ? 27.691 3.209   -3.437  1.00 20.26 ? 369 SER A O     1 
ATOM   2899 C  CB    . SER A 1 372 ? 29.161 0.508   -4.254  1.00 25.70 ? 369 SER A CB    1 
ATOM   2900 O  OG    . SER A 1 372 ? 28.982 -0.297  -3.103  1.00 33.23 ? 369 SER A OG    1 
ATOM   2901 N  N     . ILE A 1 373 ? 26.363 1.506   -2.807  1.00 25.54 ? 370 ILE A N     1 
ATOM   2902 C  CA    . ILE A 1 373 ? 25.851 2.211   -1.646  1.00 21.45 ? 370 ILE A CA    1 
ATOM   2903 C  C     . ILE A 1 373 ? 25.787 1.294   -0.444  1.00 31.88 ? 370 ILE A C     1 
ATOM   2904 O  O     . ILE A 1 373 ? 25.871 0.068   -0.554  1.00 30.33 ? 370 ILE A O     1 
ATOM   2905 C  CB    . ILE A 1 373 ? 24.443 2.806   -1.877  1.00 27.83 ? 370 ILE A CB    1 
ATOM   2906 C  CG1   . ILE A 1 373 ? 23.401 1.698   -1.984  1.00 28.55 ? 370 ILE A CG1   1 
ATOM   2907 C  CG2   . ILE A 1 373 ? 24.420 3.696   -3.113  1.00 20.16 ? 370 ILE A CG2   1 
ATOM   2908 C  CD1   . ILE A 1 373 ? 22.054 2.195   -2.457  1.00 29.85 ? 370 ILE A CD1   1 
ATOM   2909 N  N     . ARG A 1 374 ? 25.637 1.914   0.716   1.00 26.43 ? 371 ARG A N     1 
ATOM   2910 C  CA    . ARG A 1 374 ? 25.429 1.172   1.934   1.00 32.41 ? 371 ARG A CA    1 
ATOM   2911 C  C     . ARG A 1 374 ? 24.189 1.728   2.594   1.00 31.70 ? 371 ARG A C     1 
ATOM   2912 O  O     . ARG A 1 374 ? 23.929 2.929   2.521   1.00 27.64 ? 371 ARG A O     1 
ATOM   2913 C  CB    . ARG A 1 374 ? 26.634 1.269   2.855   1.00 33.74 ? 371 ARG A CB    1 
ATOM   2914 C  CG    . ARG A 1 374 ? 26.539 0.387   4.072   1.00 36.82 ? 371 ARG A CG    1 
ATOM   2915 C  CD    . ARG A 1 374 ? 27.798 0.537   4.854   1.00 43.61 ? 371 ARG A CD    1 
ATOM   2916 N  NE    . ARG A 1 374 ? 27.770 -0.198  6.100   1.00 53.27 ? 371 ARG A NE    1 
ATOM   2917 C  CZ    . ARG A 1 374 ? 28.605 0.040   7.100   1.00 55.67 ? 371 ARG A CZ    1 
ATOM   2918 N  NH1   . ARG A 1 374 ? 29.520 0.999   6.996   1.00 52.60 ? 371 ARG A NH1   1 
ATOM   2919 N  NH2   . ARG A 1 374 ? 28.512 -0.670  8.202   1.00 59.48 ? 371 ARG A NH2   1 
ATOM   2920 N  N     . VAL A 1 375 ? 23.383 0.882   3.229   1.00 38.69 ? 372 VAL A N     1 
ATOM   2921 C  CA    . VAL A 1 375 ? 22.185 1.379   3.920   1.00 38.66 ? 372 VAL A CA    1 
ATOM   2922 C  C     . VAL A 1 375 ? 22.321 1.217   5.403   1.00 36.88 ? 372 VAL A C     1 
ATOM   2923 O  O     . VAL A 1 375 ? 22.926 0.309   5.841   1.00 39.55 ? 372 VAL A O     1 
ATOM   2924 C  CB    . VAL A 1 375 ? 20.943 0.639   3.508   1.00 42.69 ? 372 VAL A CB    1 
ATOM   2925 C  CG1   . VAL A 1 375 ? 20.616 0.876   2.056   1.00 40.47 ? 372 VAL A CG1   1 
ATOM   2926 C  CG2   . VAL A 1 375 ? 21.172 -0.813  3.762   1.00 46.75 ? 372 VAL A CG2   1 
ATOM   2927 N  N     . GLN A 1 376 ? 21.734 2.112   6.161   1.00 39.13 ? 373 GLN A N     1 
ATOM   2928 C  CA    . GLN A 1 376 ? 21.866 2.060   7.598   1.00 42.44 ? 373 GLN A CA    1 
ATOM   2929 C  C     . GLN A 1 376 ? 21.313 0.731   8.030   1.00 44.63 ? 373 GLN A C     1 
ATOM   2930 O  O     . GLN A 1 376 ? 20.300 0.374   7.554   1.00 45.85 ? 373 GLN A O     1 
ATOM   2931 C  CB    . GLN A 1 376 ? 21.055 3.174   8.214   1.00 43.23 ? 373 GLN A CB    1 
ATOM   2932 C  CG    . GLN A 1 376 ? 21.500 3.544   9.630   1.00 47.60 ? 373 GLN A CG    1 
ATOM   2933 C  CD    . GLN A 1 376 ? 21.220 4.991   9.948   1.00 45.82 ? 373 GLN A CD    1 
ATOM   2934 O  OE1   . GLN A 1 376 ? 20.100 5.421   9.817   1.00 46.58 ? 373 GLN A OE1   1 
ATOM   2935 N  NE2   . GLN A 1 376 ? 22.268 5.761   10.317  1.00 45.10 ? 373 GLN A NE2   1 
ATOM   2936 N  N     . GLY A 1 377 ? 22.007 0.013   8.892   1.00 44.18 ? 374 GLY A N     1 
ATOM   2937 C  CA    . GLY A 1 377 ? 21.701 -1.357  9.289   1.00 49.67 ? 374 GLY A CA    1 
ATOM   2938 C  C     . GLY A 1 377 ? 22.802 -2.404  9.022   1.00 55.64 ? 374 GLY A C     1 
ATOM   2939 O  O     . GLY A 1 377 ? 23.319 -3.073  9.928   1.00 51.66 ? 374 GLY A O     1 
ATOM   2940 N  N     . ASP A 1 378 ? 23.211 -2.473  7.776   1.00 50.74 ? 375 ASP A N     1 
ATOM   2941 C  CA    . ASP A 1 378 ? 24.159 -3.421  7.315   1.00 49.71 ? 375 ASP A CA    1 
ATOM   2942 C  C     . ASP A 1 378 ? 25.542 -3.101  7.854   1.00 58.31 ? 375 ASP A C     1 
ATOM   2943 O  O     . ASP A 1 378 ? 25.882 -1.963  7.979   1.00 59.87 ? 375 ASP A O     1 
ATOM   2944 C  CB    . ASP A 1 378 ? 24.159 -3.349  5.811   1.00 51.94 ? 375 ASP A CB    1 
ATOM   2945 C  CG    . ASP A 1 378 ? 24.808 -4.540  5.193   1.00 53.96 ? 375 ASP A CG    1 
ATOM   2946 O  OD1   . ASP A 1 378 ? 25.634 -5.158  5.862   1.00 53.78 ? 375 ASP A OD1   1 
ATOM   2947 O  OD2   . ASP A 1 378 ? 24.478 -4.817  4.057   1.00 50.71 ? 375 ASP A OD2   1 
ATOM   2948 N  N     . LYS A 1 379 ? 26.355 -4.087  8.204   1.00 59.88 ? 376 LYS A N     1 
ATOM   2949 C  CA    . LYS A 1 379 ? 27.741 -3.768  8.543   1.00 62.43 ? 376 LYS A CA    1 
ATOM   2950 C  C     . LYS A 1 379 ? 28.708 -4.468  7.580   1.00 64.74 ? 376 LYS A C     1 
ATOM   2951 O  O     . LYS A 1 379 ? 29.892 -4.658  7.876   1.00 68.21 ? 376 LYS A O     1 
ATOM   2952 C  CB    . LYS A 1 379 ? 28.057 -4.120  10.001  1.00 65.80 ? 376 LYS A CB    1 
ATOM   2953 C  CG    . LYS A 1 379 ? 29.186 -3.269  10.596  1.00 65.42 ? 376 LYS A CG    1 
ATOM   2954 C  CD    . LYS A 1 379 ? 28.709 -1.850  10.945  1.00 68.24 ? 376 LYS A CD    1 
ATOM   2955 C  CE    . LYS A 1 379 ? 29.792 -0.992  11.608  1.00 71.64 ? 376 LYS A CE    1 
ATOM   2956 N  NZ    . LYS A 1 379 ? 29.261 -0.074  12.654  1.00 69.83 ? 376 LYS A NZ    1 
ATOM   2957 N  N     . ARG A 1 380 ? 28.191 -4.852  6.418   1.00 60.65 ? 377 ARG A N     1 
ATOM   2958 C  CA    . ARG A 1 380 ? 29.057 -5.115  5.278   1.00 61.06 ? 377 ARG A CA    1 
ATOM   2959 C  C     . ARG A 1 380 ? 29.502 -3.763  4.715   1.00 58.16 ? 377 ARG A C     1 
ATOM   2960 O  O     . ARG A 1 380 ? 28.747 -2.788  4.777   1.00 58.10 ? 377 ARG A O     1 
ATOM   2961 C  CB    . ARG A 1 380 ? 28.343 -5.946  4.205   1.00 57.66 ? 377 ARG A CB    1 
ATOM   2962 C  CG    . ARG A 1 380 ? 27.910 -7.342  4.644   1.00 57.54 ? 377 ARG A CG    1 
ATOM   2963 C  CD    . ARG A 1 380 ? 27.130 -8.056  3.540   1.00 53.93 ? 377 ARG A CD    1 
ATOM   2964 N  NE    . ARG A 1 380 ? 25.917 -7.334  3.152   1.00 51.78 ? 377 ARG A NE    1 
ATOM   2965 C  CZ    . ARG A 1 380 ? 25.151 -7.660  2.114   1.00 48.32 ? 377 ARG A CZ    1 
ATOM   2966 N  NH1   . ARG A 1 380 ? 25.465 -8.702  1.354   1.00 45.04 ? 377 ARG A NH1   1 
ATOM   2967 N  NH2   . ARG A 1 380 ? 24.068 -6.948  1.833   1.00 47.78 ? 377 ARG A NH2   1 
ATOM   2968 N  N     . LEU A 1 381 ? 30.724 -3.700  4.192   1.00 55.22 ? 378 LEU A N     1 
ATOM   2969 C  CA    . LEU A 1 381 ? 31.226 -2.480  3.565   1.00 51.90 ? 378 LEU A CA    1 
ATOM   2970 C  C     . LEU A 1 381 ? 30.217 -1.996  2.522   1.00 51.63 ? 378 LEU A C     1 
ATOM   2971 O  O     . LEU A 1 381 ? 29.733 -0.861  2.579   1.00 45.62 ? 378 LEU A O     1 
ATOM   2972 C  CB    . LEU A 1 381 ? 32.606 -2.725  2.930   1.00 50.45 ? 378 LEU A CB    1 
ATOM   2973 C  CG    . LEU A 1 381 ? 33.438 -1.560  2.368   1.00 47.84 ? 378 LEU A CG    1 
ATOM   2974 C  CD1   . LEU A 1 381 ? 34.936 -1.827  2.548   1.00 44.31 ? 378 LEU A CD1   1 
ATOM   2975 C  CD2   . LEU A 1 381 ? 33.124 -1.299  0.897   1.00 45.47 ? 378 LEU A CD2   1 
ATOM   2976 N  N     . SER A 1 382 ? 29.880 -2.881  1.590   1.00 50.95 ? 379 SER A N     1 
ATOM   2977 C  CA    . SER A 1 382 ? 28.905 -2.566  0.558   1.00 47.00 ? 379 SER A CA    1 
ATOM   2978 C  C     . SER A 1 382 ? 27.613 -3.339  0.769   1.00 45.24 ? 379 SER A C     1 
ATOM   2979 O  O     . SER A 1 382 ? 27.632 -4.525  1.104   1.00 47.14 ? 379 SER A O     1 
ATOM   2980 C  CB    . SER A 1 382 ? 29.470 -2.871  -0.830  1.00 38.98 ? 379 SER A CB    1 
ATOM   2981 O  OG    . SER A 1 382 ? 28.456 -2.778  -1.818  1.00 40.60 ? 379 SER A OG    1 
ATOM   2982 N  N     . SER A 1 383 ? 26.490 -2.657  0.569   1.00 41.87 ? 380 SER A N     1 
ATOM   2983 C  CA    . SER A 1 383 ? 25.186 -3.301  0.635   1.00 41.81 ? 380 SER A CA    1 
ATOM   2984 C  C     . SER A 1 383 ? 24.723 -3.702  -0.754  1.00 46.91 ? 380 SER A C     1 
ATOM   2985 O  O     . SER A 1 383 ? 24.011 -4.693  -0.917  1.00 42.78 ? 380 SER A O     1 
ATOM   2986 C  CB    . SER A 1 383 ? 24.152 -2.378  1.285   1.00 45.29 ? 380 SER A CB    1 
ATOM   2987 O  OG    . SER A 1 383 ? 24.549 -2.007  2.595   1.00 45.76 ? 380 SER A OG    1 
ATOM   2988 N  N     . LEU A 1 384 ? 25.137 -2.928  -1.754  1.00 42.07 ? 381 LEU A N     1 
ATOM   2989 C  CA    . LEU A 1 384 ? 24.710 -3.153  -3.129  1.00 39.48 ? 381 LEU A CA    1 
ATOM   2990 C  C     . LEU A 1 384 ? 25.694 -2.575  -4.135  1.00 38.62 ? 381 LEU A C     1 
ATOM   2991 O  O     . LEU A 1 384 ? 26.097 -1.423  -4.019  1.00 31.21 ? 381 LEU A O     1 
ATOM   2992 C  CB    . LEU A 1 384 ? 23.329 -2.544  -3.358  1.00 36.63 ? 381 LEU A CB    1 
ATOM   2993 C  CG    . LEU A 1 384 ? 22.846 -2.462  -4.807  1.00 41.13 ? 381 LEU A CG    1 
ATOM   2994 C  CD1   . LEU A 1 384 ? 21.422 -2.960  -4.915  1.00 43.57 ? 381 LEU A CD1   1 
ATOM   2995 C  CD2   . LEU A 1 384 ? 22.940 -1.036  -5.318  1.00 40.09 ? 381 LEU A CD2   1 
ATOM   2996 N  N     . ARG A 1 385 ? 26.055 -3.379  -5.132  1.00 36.64 ? 382 ARG A N     1 
ATOM   2997 C  CA    . ARG A 1 385 ? 26.999 -2.974  -6.166  1.00 31.76 ? 382 ARG A CA    1 
ATOM   2998 C  C     . ARG A 1 385 ? 26.350 -3.158  -7.534  1.00 31.67 ? 382 ARG A C     1 
ATOM   2999 O  O     . ARG A 1 385 ? 25.938 -4.268  -7.880  1.00 34.32 ? 382 ARG A O     1 
ATOM   3000 C  CB    . ARG A 1 385 ? 28.280 -3.810  -6.076  1.00 35.91 ? 382 ARG A CB    1 
ATOM   3001 C  CG    . ARG A 1 385 ? 29.577 -3.022  -6.034  1.00 40.51 ? 382 ARG A CG    1 
ATOM   3002 C  CD    . ARG A 1 385 ? 30.681 -3.873  -5.413  1.00 41.98 ? 382 ARG A CD    1 
ATOM   3003 N  NE    . ARG A 1 385 ? 31.677 -3.078  -4.697  1.00 47.98 ? 382 ARG A NE    1 
ATOM   3004 C  CZ    . ARG A 1 385 ? 32.564 -3.585  -3.843  1.00 47.63 ? 382 ARG A CZ    1 
ATOM   3005 N  NH1   . ARG A 1 385 ? 32.582 -4.891  -3.582  1.00 44.47 ? 382 ARG A NH1   1 
ATOM   3006 N  NH2   . ARG A 1 385 ? 33.432 -2.780  -3.242  1.00 48.26 ? 382 ARG A NH2   1 
ATOM   3007 N  N     . ARG A 1 386 ? 26.242 -2.087  -8.309  1.00 25.87 ? 383 ARG A N     1 
ATOM   3008 C  CA    . ARG A 1 386 ? 25.639 -2.188  -9.636  1.00 30.09 ? 383 ARG A CA    1 
ATOM   3009 C  C     . ARG A 1 386 ? 26.488 -1.482  -10.691 1.00 28.96 ? 383 ARG A C     1 
ATOM   3010 O  O     . ARG A 1 386 ? 27.018 -0.404  -10.444 1.00 24.26 ? 383 ARG A O     1 
ATOM   3011 C  CB    . ARG A 1 386 ? 24.229 -1.606  -9.617  1.00 31.97 ? 383 ARG A CB    1 
ATOM   3012 C  CG    . ARG A 1 386 ? 23.271 -2.340  -8.696  1.00 35.90 ? 383 ARG A CG    1 
ATOM   3013 C  CD    . ARG A 1 386 ? 22.695 -3.556  -9.385  1.00 33.74 ? 383 ARG A CD    1 
ATOM   3014 N  NE    . ARG A 1 386 ? 21.436 -3.985  -8.786  1.00 29.73 ? 383 ARG A NE    1 
ATOM   3015 C  CZ    . ARG A 1 386 ? 21.338 -4.912  -7.840  1.00 39.38 ? 383 ARG A CZ    1 
ATOM   3016 N  NH1   . ARG A 1 386 ? 22.429 -5.522  -7.391  1.00 39.30 ? 383 ARG A NH1   1 
ATOM   3017 N  NH2   . ARG A 1 386 ? 20.144 -5.243  -7.360  1.00 40.48 ? 383 ARG A NH2   1 
ATOM   3018 N  N     . CYS A 1 387 ? 26.632 -2.096  -11.862 1.00 31.16 ? 384 CYS A N     1 
ATOM   3019 C  CA    . CYS A 1 387 ? 27.389 -1.469  -12.946 1.00 30.64 ? 384 CYS A CA    1 
ATOM   3020 C  C     . CYS A 1 387 ? 26.477 -0.896  -14.018 1.00 28.39 ? 384 CYS A C     1 
ATOM   3021 O  O     . CYS A 1 387 ? 25.384 -1.404  -14.262 1.00 28.88 ? 384 CYS A O     1 
ATOM   3022 C  CB    . CYS A 1 387 ? 28.361 -2.465  -13.594 1.00 30.93 ? 384 CYS A CB    1 
ATOM   3023 S  SG    A CYS A 1 387 ? 27.576 -3.734  -14.651 0.65 30.51 ? 384 CYS A SG    1 
ATOM   3024 S  SG    B CYS A 1 387 ? 29.500 -3.251  -12.443 0.35 32.30 ? 384 CYS A SG    1 
ATOM   3025 N  N     . CYS A 1 388 ? 26.940 0.167   -14.662 1.00 27.51 ? 385 CYS A N     1 
ATOM   3026 C  CA    . CYS A 1 388 ? 26.285 0.665   -15.861 1.00 31.35 ? 385 CYS A CA    1 
ATOM   3027 C  C     . CYS A 1 388 ? 27.346 1.153   -16.841 1.00 29.05 ? 385 CYS A C     1 
ATOM   3028 O  O     . CYS A 1 388 ? 28.522 1.205   -16.499 1.00 26.96 ? 385 CYS A O     1 
ATOM   3029 C  CB    . CYS A 1 388 ? 25.290 1.769   -15.514 1.00 25.82 ? 385 CYS A CB    1 
ATOM   3030 S  SG    . CYS A 1 388 ? 26.031 3.284   -14.902 1.00 29.25 ? 385 CYS A SG    1 
ATOM   3031 N  N     . ALA A 1 389 ? 26.955 1.493   -18.065 1.00 30.83 ? 386 ALA A N     1 
ATOM   3032 C  CA    . ALA A 1 389 ? 27.952 1.922   -19.044 1.00 28.90 ? 386 ALA A CA    1 
ATOM   3033 C  C     . ALA A 1 389 ? 28.483 3.311   -18.715 1.00 27.43 ? 386 ALA A C     1 
ATOM   3034 O  O     . ALA A 1 389 ? 27.755 4.164   -18.210 1.00 31.54 ? 386 ALA A O     1 
ATOM   3035 C  CB    . ALA A 1 389 ? 27.377 1.897   -20.455 1.00 26.67 ? 386 ALA A CB    1 
ATOM   3036 N  N     . LEU A 1 390 ? 29.763 3.525   -18.990 1.00 21.09 ? 387 LEU A N     1 
ATOM   3037 C  CA    . LEU A 1 390 ? 30.381 4.835   -18.850 1.00 24.25 ? 387 LEU A CA    1 
ATOM   3038 C  C     . LEU A 1 390 ? 30.838 5.273   -20.229 1.00 25.59 ? 387 LEU A C     1 
ATOM   3039 O  O     . LEU A 1 390 ? 31.913 4.887   -20.685 1.00 26.31 ? 387 LEU A O     1 
ATOM   3040 C  CB    . LEU A 1 390 ? 31.561 4.791   -17.881 1.00 25.16 ? 387 LEU A CB    1 
ATOM   3041 C  CG    . LEU A 1 390 ? 31.954 6.052   -17.100 1.00 18.37 ? 387 LEU A CG    1 
ATOM   3042 C  CD1   . LEU A 1 390 ? 33.134 5.713   -16.194 1.00 22.21 ? 387 LEU A CD1   1 
ATOM   3043 C  CD2   . LEU A 1 390 ? 32.296 7.247   -17.979 1.00 25.99 ? 387 LEU A CD2   1 
ATOM   3044 N  N     . THR A 1 391 ? 30.019 6.079   -20.888 1.00 27.89 ? 388 THR A N     1 
ATOM   3045 C  CA    . THR A 1 391 ? 30.251 6.433   -22.282 1.00 30.40 ? 388 THR A CA    1 
ATOM   3046 C  C     . THR A 1 391 ? 30.819 7.839   -22.467 1.00 31.76 ? 388 THR A C     1 
ATOM   3047 O  O     . THR A 1 391 ? 31.387 8.148   -23.510 1.00 30.76 ? 388 THR A O     1 
ATOM   3048 C  CB    . THR A 1 391 ? 28.948 6.316   -23.094 1.00 34.98 ? 388 THR A CB    1 
ATOM   3049 O  OG1   . THR A 1 391 ? 27.995 7.272   -22.613 1.00 39.38 ? 388 THR A OG1   1 
ATOM   3050 C  CG2   . THR A 1 391 ? 28.364 4.908   -22.964 1.00 30.35 ? 388 THR A CG2   1 
ATOM   3051 N  N     . ARG A 1 392 ? 30.655 8.694   -21.463 1.00 32.59 ? 389 ARG A N     1 
ATOM   3052 C  CA    . ARG A 1 392 ? 31.180 10.054  -21.527 1.00 28.57 ? 389 ARG A CA    1 
ATOM   3053 C  C     . ARG A 1 392 ? 31.737 10.490  -20.182 1.00 26.92 ? 389 ARG A C     1 
ATOM   3054 O  O     . ARG A 1 392 ? 31.147 10.220  -19.141 1.00 29.02 ? 389 ARG A O     1 
ATOM   3055 C  CB    . ARG A 1 392 ? 30.100 11.040  -21.984 1.00 35.57 ? 389 ARG A CB    1 
ATOM   3056 C  CG    . ARG A 1 392 ? 29.846 11.015  -23.479 1.00 39.49 ? 389 ARG A CG    1 
ATOM   3057 C  CD    . ARG A 1 392 ? 29.083 12.246  -23.946 1.00 44.37 ? 389 ARG A CD    1 
ATOM   3058 N  NE    . ARG A 1 392 ? 28.422 12.959  -22.856 1.00 50.60 ? 389 ARG A NE    1 
ATOM   3059 C  CZ    . ARG A 1 392 ? 28.734 14.195  -22.475 1.00 48.87 ? 389 ARG A CZ    1 
ATOM   3060 N  NH1   . ARG A 1 392 ? 29.730 14.840  -23.067 1.00 52.16 ? 389 ARG A NH1   1 
ATOM   3061 N  NH2   . ARG A 1 392 ? 28.072 14.776  -21.483 1.00 53.80 ? 389 ARG A NH2   1 
ATOM   3062 N  N     . TYR A 1 393 ? 32.879 11.161  -20.208 1.00 27.88 ? 390 TYR A N     1 
ATOM   3063 C  CA    . TYR A 1 393 ? 33.451 11.719  -18.994 1.00 25.79 ? 390 TYR A CA    1 
ATOM   3064 C  C     . TYR A 1 393 ? 32.691 12.986  -18.613 1.00 32.14 ? 390 TYR A C     1 
ATOM   3065 O  O     . TYR A 1 393 ? 33.180 14.102  -18.804 1.00 27.73 ? 390 TYR A O     1 
ATOM   3066 C  CB    . TYR A 1 393 ? 34.941 12.008  -19.180 1.00 25.13 ? 390 TYR A CB    1 
ATOM   3067 C  CG    . TYR A 1 393 ? 35.832 10.781  -19.099 1.00 22.74 ? 390 TYR A CG    1 
ATOM   3068 C  CD1   . TYR A 1 393 ? 37.213 10.907  -19.114 1.00 21.09 ? 390 TYR A CD1   1 
ATOM   3069 C  CD2   . TYR A 1 393 ? 35.290 9.506   -18.985 1.00 26.59 ? 390 TYR A CD2   1 
ATOM   3070 C  CE1   . TYR A 1 393 ? 38.031 9.793   -19.021 1.00 19.70 ? 390 TYR A CE1   1 
ATOM   3071 C  CE2   . TYR A 1 393 ? 36.105 8.384   -18.894 1.00 21.93 ? 390 TYR A CE2   1 
ATOM   3072 C  CZ    . TYR A 1 393 ? 37.471 8.538   -18.918 1.00 21.97 ? 390 TYR A CZ    1 
ATOM   3073 O  OH    . TYR A 1 393 ? 38.283 7.428   -18.819 1.00 21.61 ? 390 TYR A OH    1 
ATOM   3074 N  N     . ASP A 1 394 ? 31.481 12.806  -18.093 1.00 23.75 ? 391 ASP A N     1 
ATOM   3075 C  CA    . ASP A 1 394 ? 30.660 13.936  -17.694 1.00 26.95 ? 391 ASP A CA    1 
ATOM   3076 C  C     . ASP A 1 394 ? 30.008 13.677  -16.354 1.00 23.63 ? 391 ASP A C     1 
ATOM   3077 O  O     . ASP A 1 394 ? 29.275 12.697  -16.188 1.00 24.37 ? 391 ASP A O     1 
ATOM   3078 C  CB    . ASP A 1 394 ? 29.598 14.229  -18.745 1.00 35.14 ? 391 ASP A CB    1 
ATOM   3079 C  CG    . ASP A 1 394 ? 28.778 15.449  -18.402 1.00 34.12 ? 391 ASP A CG    1 
ATOM   3080 O  OD1   . ASP A 1 394 ? 27.715 15.289  -17.770 1.00 31.85 ? 391 ASP A OD1   1 
ATOM   3081 O  OD2   . ASP A 1 394 ? 29.212 16.568  -18.742 1.00 41.14 ? 391 ASP A OD2   1 
ATOM   3082 N  N     . ALA A 1 395 ? 30.281 14.554  -15.394 1.00 21.87 ? 392 ALA A N     1 
ATOM   3083 C  CA    . ALA A 1 395 ? 29.819 14.336  -14.028 1.00 21.46 ? 392 ALA A CA    1 
ATOM   3084 C  C     . ALA A 1 395 ? 28.292 14.338  -13.893 1.00 19.39 ? 392 ALA A C     1 
ATOM   3085 O  O     . ALA A 1 395 ? 27.732 13.542  -13.143 1.00 20.72 ? 392 ALA A O     1 
ATOM   3086 C  CB    . ALA A 1 395 ? 30.435 15.381  -13.098 1.00 18.53 ? 392 ALA A CB    1 
ATOM   3087 N  N     . HIS A 1 396 ? 27.614 15.234  -14.599 1.00 29.34 ? 393 HIS A N     1 
ATOM   3088 C  CA    . HIS A 1 396 ? 26.162 15.270  -14.482 1.00 27.93 ? 393 HIS A CA    1 
ATOM   3089 C  C     . HIS A 1 396 ? 25.548 13.998  -15.054 1.00 21.77 ? 393 HIS A C     1 
ATOM   3090 O  O     . HIS A 1 396 ? 24.632 13.434  -14.459 1.00 24.76 ? 393 HIS A O     1 
ATOM   3091 C  CB    . HIS A 1 396 ? 25.590 16.520  -15.156 1.00 27.04 ? 393 HIS A CB    1 
ATOM   3092 C  CG    . HIS A 1 396 ? 25.851 17.781  -14.387 1.00 30.32 ? 393 HIS A CG    1 
ATOM   3093 N  ND1   . HIS A 1 396 ? 26.862 18.661  -14.713 1.00 36.34 ? 393 HIS A ND1   1 
ATOM   3094 C  CD2   . HIS A 1 396 ? 25.249 18.291  -13.287 1.00 32.33 ? 393 HIS A CD2   1 
ATOM   3095 C  CE1   . HIS A 1 396 ? 26.861 19.666  -13.854 1.00 32.84 ? 393 HIS A CE1   1 
ATOM   3096 N  NE2   . HIS A 1 396 ? 25.896 19.464  -12.977 1.00 30.59 ? 393 HIS A NE2   1 
ATOM   3097 N  N     . LYS A 1 397 ? 26.067 13.530  -16.184 1.00 22.57 ? 394 LYS A N     1 
ATOM   3098 C  CA    . LYS A 1 397 ? 25.600 12.264  -16.750 1.00 23.37 ? 394 LYS A CA    1 
ATOM   3099 C  C     . LYS A 1 397 ? 25.915 11.086  -15.831 1.00 22.45 ? 394 LYS A C     1 
ATOM   3100 O  O     . LYS A 1 397 ? 25.065 10.226  -15.595 1.00 27.12 ? 394 LYS A O     1 
ATOM   3101 C  CB    . LYS A 1 397 ? 26.208 12.010  -18.132 1.00 29.22 ? 394 LYS A CB    1 
ATOM   3102 C  CG    . LYS A 1 397 ? 26.187 10.527  -18.527 1.00 35.32 ? 394 LYS A CG    1 
ATOM   3103 C  CD    . LYS A 1 397 ? 26.341 10.306  -20.028 1.00 38.16 ? 394 LYS A CD    1 
ATOM   3104 C  CE    . LYS A 1 397 ? 25.108 9.615   -20.612 1.00 44.33 ? 394 LYS A CE    1 
ATOM   3105 N  NZ    . LYS A 1 397 ? 24.891 8.232   -20.091 1.00 45.91 ? 394 LYS A NZ    1 
ATOM   3106 N  N     . MET A 1 398 ? 27.138 11.042  -15.311 1.00 24.35 ? 395 MET A N     1 
ATOM   3107 C  CA    . MET A 1 398 ? 27.517 9.935   -14.441 1.00 23.37 ? 395 MET A CA    1 
ATOM   3108 C  C     . MET A 1 398 ? 26.689 9.919   -13.153 1.00 22.78 ? 395 MET A C     1 
ATOM   3109 O  O     . MET A 1 398 ? 26.243 8.858   -12.707 1.00 22.60 ? 395 MET A O     1 
ATOM   3110 C  CB    . MET A 1 398 ? 29.013 9.993   -14.125 1.00 20.03 ? 395 MET A CB    1 
ATOM   3111 C  CG    . MET A 1 398 ? 29.909 9.670   -15.315 1.00 19.37 ? 395 MET A CG    1 
ATOM   3112 S  SD    . MET A 1 398 ? 31.619 9.376   -14.801 1.00 25.89 ? 395 MET A SD    1 
ATOM   3113 C  CE    . MET A 1 398 ? 32.194 11.062  -14.605 1.00 26.52 ? 395 MET A CE    1 
ATOM   3114 N  N     . SER A 1 399 ? 26.462 11.088  -12.561 1.00 24.41 ? 396 SER A N     1 
ATOM   3115 C  CA    . SER A 1 399 ? 25.676 11.144  -11.330 1.00 22.76 ? 396 SER A CA    1 
ATOM   3116 C  C     . SER A 1 399 ? 24.203 10.829  -11.598 1.00 22.02 ? 396 SER A C     1 
ATOM   3117 O  O     . SER A 1 399 ? 23.540 10.183  -10.788 1.00 22.06 ? 396 SER A O     1 
ATOM   3118 C  CB    . SER A 1 399 ? 25.828 12.509  -10.640 1.00 22.06 ? 396 SER A CB    1 
ATOM   3119 O  OG    . SER A 1 399 ? 25.240 13.567  -11.378 1.00 26.85 ? 396 SER A OG    1 
ATOM   3120 N  N     . HIS A 1 400 ? 23.693 11.261  -12.744 1.00 26.67 ? 397 HIS A N     1 
ATOM   3121 C  CA    . HIS A 1 400 ? 22.324 10.901  -13.105 1.00 30.48 ? 397 HIS A CA    1 
ATOM   3122 C  C     . HIS A 1 400 ? 22.201 9.389   -13.340 1.00 28.24 ? 397 HIS A C     1 
ATOM   3123 O  O     . HIS A 1 400 ? 21.262 8.752   -12.869 1.00 29.86 ? 397 HIS A O     1 
ATOM   3124 C  CB    . HIS A 1 400 ? 21.870 11.680  -14.339 1.00 29.22 ? 397 HIS A CB    1 
ATOM   3125 C  CG    . HIS A 1 400 ? 20.473 11.360  -14.769 1.00 39.90 ? 397 HIS A CG    1 
ATOM   3126 N  ND1   . HIS A 1 400 ? 20.183 10.352  -15.662 1.00 39.22 ? 397 HIS A ND1   1 
ATOM   3127 C  CD2   . HIS A 1 400 ? 19.285 11.903  -14.414 1.00 43.10 ? 397 HIS A CD2   1 
ATOM   3128 C  CE1   . HIS A 1 400 ? 18.875 10.294  -15.847 1.00 44.34 ? 397 HIS A CE1   1 
ATOM   3129 N  NE2   . HIS A 1 400 ? 18.308 11.224  -15.101 1.00 42.51 ? 397 HIS A NE2   1 
ATOM   3130 N  N     . ASP A 1 401 ? 23.169 8.817   -14.051 1.00 30.89 ? 398 ASP A N     1 
ATOM   3131 C  CA    . ASP A 1 401 ? 23.193 7.376   -14.274 1.00 25.54 ? 398 ASP A CA    1 
ATOM   3132 C  C     . ASP A 1 401 ? 23.289 6.593   -12.974 1.00 28.84 ? 398 ASP A C     1 
ATOM   3133 O  O     . ASP A 1 401 ? 22.607 5.587   -12.810 1.00 31.62 ? 398 ASP A O     1 
ATOM   3134 C  CB    . ASP A 1 401 ? 24.351 6.987   -15.193 1.00 28.51 ? 398 ASP A CB    1 
ATOM   3135 C  CG    . ASP A 1 401 ? 24.137 7.438   -16.624 1.00 34.42 ? 398 ASP A CG    1 
ATOM   3136 O  OD1   . ASP A 1 401 ? 22.979 7.745   -16.988 1.00 34.87 ? 398 ASP A OD1   1 
ATOM   3137 O  OD2   . ASP A 1 401 ? 25.122 7.472   -17.390 1.00 31.67 ? 398 ASP A OD2   1 
ATOM   3138 N  N     . ALA A 1 402 ? 24.134 7.057   -12.053 1.00 23.91 ? 399 ALA A N     1 
ATOM   3139 C  CA    . ALA A 1 402 ? 24.285 6.400   -10.764 1.00 28.03 ? 399 ALA A CA    1 
ATOM   3140 C  C     . ALA A 1 402 ? 22.963 6.378   -10.024 1.00 23.57 ? 399 ALA A C     1 
ATOM   3141 O  O     . ALA A 1 402 ? 22.579 5.357   -9.447  1.00 26.98 ? 399 ALA A O     1 
ATOM   3142 C  CB    . ALA A 1 402 ? 25.345 7.101   -9.920  1.00 22.67 ? 399 ALA A CB    1 
ATOM   3143 N  N     . PHE A 1 403 ? 22.274 7.515   -10.037 1.00 27.17 ? 400 PHE A N     1 
ATOM   3144 C  CA    . PHE A 1 403 ? 21.004 7.638   -9.336  1.00 29.42 ? 400 PHE A CA    1 
ATOM   3145 C  C     . PHE A 1 403 ? 19.977 6.667   -9.896  1.00 33.36 ? 400 PHE A C     1 
ATOM   3146 O  O     . PHE A 1 403 ? 19.217 6.054   -9.154  1.00 34.06 ? 400 PHE A O     1 
ATOM   3147 C  CB    . PHE A 1 403 ? 20.466 9.061   -9.429  1.00 28.64 ? 400 PHE A CB    1 
ATOM   3148 C  CG    . PHE A 1 403 ? 19.199 9.264   -8.668  1.00 39.59 ? 400 PHE A CG    1 
ATOM   3149 C  CD1   . PHE A 1 403 ? 17.992 9.408   -9.334  1.00 36.63 ? 400 PHE A CD1   1 
ATOM   3150 C  CD2   . PHE A 1 403 ? 19.208 9.295   -7.283  1.00 35.68 ? 400 PHE A CD2   1 
ATOM   3151 C  CE1   . PHE A 1 403 ? 16.815 9.586   -8.633  1.00 43.11 ? 400 PHE A CE1   1 
ATOM   3152 C  CE2   . PHE A 1 403 ? 18.035 9.477   -6.573  1.00 42.48 ? 400 PHE A CE2   1 
ATOM   3153 C  CZ    . PHE A 1 403 ? 16.835 9.621   -7.249  1.00 45.08 ? 400 PHE A CZ    1 
ATOM   3154 N  N     . THR A 1 404 ? 19.968 6.535   -11.215 1.00 31.37 ? 401 THR A N     1 
ATOM   3155 C  CA    . THR A 1 404 ? 19.067 5.610   -11.880 1.00 34.63 ? 401 THR A CA    1 
ATOM   3156 C  C     . THR A 1 404 ? 19.272 4.168   -11.413 1.00 35.95 ? 401 THR A C     1 
ATOM   3157 O  O     . THR A 1 404 ? 18.299 3.453   -11.157 1.00 39.53 ? 401 THR A O     1 
ATOM   3158 C  CB    . THR A 1 404 ? 19.233 5.681   -13.408 1.00 31.65 ? 401 THR A CB    1 
ATOM   3159 O  OG1   . THR A 1 404 ? 18.840 6.980   -13.862 1.00 34.54 ? 401 THR A OG1   1 
ATOM   3160 C  CG2   . THR A 1 404 ? 18.368 4.630   -14.096 1.00 40.83 ? 401 THR A CG2   1 
ATOM   3161 N  N     . VAL A 1 405 ? 20.522 3.734   -11.277 1.00 32.11 ? 402 VAL A N     1 
ATOM   3162 C  CA    . VAL A 1 405 ? 20.755 2.330   -10.956 1.00 31.35 ? 402 VAL A CA    1 
ATOM   3163 C  C     . VAL A 1 405 ? 20.512 2.018   -9.482  1.00 34.39 ? 402 VAL A C     1 
ATOM   3164 O  O     . VAL A 1 405 ? 20.400 0.852   -9.121  1.00 38.81 ? 402 VAL A O     1 
ATOM   3165 C  CB    . VAL A 1 405 ? 22.179 1.873   -11.345 1.00 35.58 ? 402 VAL A CB    1 
ATOM   3166 C  CG1   . VAL A 1 405 ? 22.533 2.398   -12.722 1.00 31.20 ? 402 VAL A CG1   1 
ATOM   3167 C  CG2   . VAL A 1 405 ? 23.195 2.310   -10.320 1.00 36.99 ? 402 VAL A CG2   1 
ATOM   3168 N  N     . ILE A 1 406 ? 20.406 3.044   -8.637  1.00 32.18 ? 403 ILE A N     1 
ATOM   3169 C  CA    . ILE A 1 406 ? 20.206 2.813   -7.205  1.00 38.18 ? 403 ILE A CA    1 
ATOM   3170 C  C     . ILE A 1 406 ? 18.838 3.230   -6.672  1.00 40.61 ? 403 ILE A C     1 
ATOM   3171 O  O     . ILE A 1 406 ? 18.465 2.843   -5.561  1.00 40.67 ? 403 ILE A O     1 
ATOM   3172 C  CB    . ILE A 1 406 ? 21.260 3.553   -6.354  1.00 33.89 ? 403 ILE A CB    1 
ATOM   3173 C  CG1   . ILE A 1 406 ? 21.043 5.066   -6.438  1.00 31.21 ? 403 ILE A CG1   1 
ATOM   3174 C  CG2   . ILE A 1 406 ? 22.646 3.149   -6.772  1.00 26.83 ? 403 ILE A CG2   1 
ATOM   3175 C  CD1   . ILE A 1 406 ? 21.675 5.845   -5.307  1.00 34.35 ? 403 ILE A CD1   1 
ATOM   3176 N  N     . LYS A 1 407 ? 18.095 4.008   -7.453  1.00 37.69 ? 404 LYS A N     1 
ATOM   3177 C  CA    . LYS A 1 407 ? 16.879 4.654   -6.956  1.00 43.69 ? 404 LYS A CA    1 
ATOM   3178 C  C     . LYS A 1 407 ? 15.803 3.690   -6.452  1.00 46.95 ? 404 LYS A C     1 
ATOM   3179 O  O     . LYS A 1 407 ? 14.923 4.088   -5.684  1.00 45.42 ? 404 LYS A O     1 
ATOM   3180 C  CB    . LYS A 1 407 ? 16.274 5.545   -8.039  1.00 41.32 ? 404 LYS A CB    1 
ATOM   3181 C  CG    . LYS A 1 407 ? 15.754 4.780   -9.234  1.00 41.25 ? 404 LYS A CG    1 
ATOM   3182 C  CD    . LYS A 1 407 ? 15.809 5.631   -10.490 1.00 46.16 ? 404 LYS A CD    1 
ATOM   3183 C  CE    . LYS A 1 407 ? 14.591 5.396   -11.371 1.00 46.69 ? 404 LYS A CE    1 
ATOM   3184 N  NZ    . LYS A 1 407 ? 14.628 4.032   -11.978 1.00 53.23 ? 404 LYS A NZ    1 
ATOM   3185 N  N     . ASN A 1 408 ? 15.864 2.430   -6.871  1.00 46.17 ? 405 ASN A N     1 
ATOM   3186 C  CA    . ASN A 1 408 ? 14.881 1.455   -6.415  1.00 45.68 ? 405 ASN A CA    1 
ATOM   3187 C  C     . ASN A 1 408 ? 15.291 0.785   -5.114  1.00 47.94 ? 405 ASN A C     1 
ATOM   3188 O  O     . ASN A 1 408 ? 14.598 -0.101  -4.617  1.00 44.09 ? 405 ASN A O     1 
ATOM   3189 C  CB    . ASN A 1 408 ? 14.634 0.402   -7.490  1.00 49.18 ? 405 ASN A CB    1 
ATOM   3190 C  CG    . ASN A 1 408 ? 13.866 0.954   -8.669  1.00 54.97 ? 405 ASN A CG    1 
ATOM   3191 O  OD1   . ASN A 1 408 ? 13.139 1.944   -8.548  1.00 54.96 ? 405 ASN A OD1   1 
ATOM   3192 N  ND2   . ASN A 1 408 ? 14.031 0.325   -9.824  1.00 52.45 ? 405 ASN A ND2   1 
ATOM   3193 N  N     . CYS A 1 409 ? 16.414 1.215   -4.555  1.00 43.07 ? 406 CYS A N     1 
ATOM   3194 C  CA    . CYS A 1 409 ? 16.809 0.733   -3.243  1.00 44.93 ? 406 CYS A CA    1 
ATOM   3195 C  C     . CYS A 1 409 ? 15.993 1.466   -2.193  1.00 45.85 ? 406 CYS A C     1 
ATOM   3196 O  O     . CYS A 1 409 ? 15.920 1.055   -1.036  1.00 51.55 ? 406 CYS A O     1 
ATOM   3197 C  CB    . CYS A 1 409 ? 18.302 0.938   -3.014  1.00 44.90 ? 406 CYS A CB    1 
ATOM   3198 S  SG    . CYS A 1 409 ? 19.283 -0.306  -3.840  1.00 54.13 ? 406 CYS A SG    1 
ATOM   3199 N  N     . ASN A 1 410 ? 15.371 2.557   -2.622  1.00 42.05 ? 407 ASN A N     1 
ATOM   3200 C  CA    . ASN A 1 410 ? 14.576 3.396   -1.742  1.00 46.44 ? 407 ASN A CA    1 
ATOM   3201 C  C     . ASN A 1 410 ? 13.270 2.724   -1.322  1.00 49.99 ? 407 ASN A C     1 
ATOM   3202 O  O     . ASN A 1 410 ? 12.345 2.589   -2.119  1.00 51.35 ? 407 ASN A O     1 
ATOM   3203 C  CB    . ASN A 1 410 ? 14.289 4.732   -2.425  1.00 40.21 ? 407 ASN A CB    1 
ATOM   3204 C  CG    . ASN A 1 410 ? 13.723 5.755   -1.476  1.00 42.72 ? 407 ASN A CG    1 
ATOM   3205 O  OD1   . ASN A 1 410 ? 13.588 5.494   -0.280  1.00 47.10 ? 407 ASN A OD1   1 
ATOM   3206 N  ND2   . ASN A 1 410 ? 13.407 6.941   -1.996  1.00 42.11 ? 407 ASN A ND2   1 
ATOM   3207 N  N     . THR A 1 411 ? 13.204 2.312   -0.061  1.00 50.77 ? 408 THR A N     1 
ATOM   3208 C  CA    . THR A 1 411 ? 12.039 1.601   0.447   1.00 51.65 ? 408 THR A CA    1 
ATOM   3209 C  C     . THR A 1 411 ? 10.862 2.538   0.693   1.00 53.17 ? 408 THR A C     1 
ATOM   3210 O  O     . THR A 1 411 ? 9.713  2.126   0.559   1.00 58.43 ? 408 THR A O     1 
ATOM   3211 C  CB    . THR A 1 411 ? 12.361 0.831   1.756   1.00 50.54 ? 408 THR A CB    1 
ATOM   3212 O  OG1   . THR A 1 411 ? 12.417 1.739   2.863   1.00 54.63 ? 408 THR A OG1   1 
ATOM   3213 C  CG2   . THR A 1 411 ? 13.676 0.069   1.640   1.00 53.83 ? 408 THR A CG2   1 
ATOM   3214 N  N     . SER A 1 412 ? 11.141 3.792   1.039   1.00 53.58 ? 409 SER A N     1 
ATOM   3215 C  CA    . SER A 1 412 ? 10.075 4.722   1.406   1.00 54.96 ? 409 SER A CA    1 
ATOM   3216 C  C     . SER A 1 412 ? 9.089  4.904   0.264   1.00 59.21 ? 409 SER A C     1 
ATOM   3217 O  O     . SER A 1 412 ? 9.489  5.118   -0.878  1.00 60.03 ? 409 SER A O     1 
ATOM   3218 C  CB    . SER A 1 412 ? 10.644 6.082   1.822   1.00 55.88 ? 409 SER A CB    1 
ATOM   3219 O  OG    . SER A 1 412 ? 10.582 7.025   0.768   1.00 57.01 ? 409 SER A OG    1 
ATOM   3220 N  N     . GLY A 1 413 ? 7.802  4.807   0.584   1.00 64.77 ? 410 GLY A N     1 
ATOM   3221 C  CA    . GLY A 1 413 ? 6.746  4.968   -0.398  1.00 64.14 ? 410 GLY A CA    1 
ATOM   3222 C  C     . GLY A 1 413 ? 6.711  6.371   -0.959  1.00 64.83 ? 410 GLY A C     1 
ATOM   3223 O  O     . GLY A 1 413 ? 6.300  6.568   -2.100  1.00 64.94 ? 410 GLY A O     1 
ATOM   3224 N  N     . ILE A 1 414 ? 7.129  7.345   -0.152  1.00 63.48 ? 411 ILE A N     1 
ATOM   3225 C  CA    . ILE A 1 414 ? 7.328  8.707   -0.638  1.00 62.06 ? 411 ILE A CA    1 
ATOM   3226 C  C     . ILE A 1 414 ? 8.719  8.814   -1.258  1.00 63.83 ? 411 ILE A C     1 
ATOM   3227 O  O     . ILE A 1 414 ? 9.687  8.226   -0.768  1.00 59.79 ? 411 ILE A O     1 
ATOM   3228 C  CB    . ILE A 1 414 ? 7.137  9.765   0.480   1.00 62.65 ? 411 ILE A CB    1 
ATOM   3229 C  CG1   . ILE A 1 414 ? 7.372  11.176  -0.081  1.00 59.24 ? 411 ILE A CG1   1 
ATOM   3230 C  CG2   . ILE A 1 414 ? 7.994  9.427   1.694   1.00 60.52 ? 411 ILE A CG2   1 
ATOM   3231 C  CD1   . ILE A 1 414 ? 6.623  12.261  0.637   1.00 57.58 ? 411 ILE A CD1   1 
ATOM   3232 N  N     . GLN A 1 415 ? 8.808  9.545   -2.361  1.00 65.48 ? 412 GLN A N     1 
ATOM   3233 C  CA    . GLN A 1 415 ? 10.016 9.540   -3.171  1.00 63.33 ? 412 GLN A CA    1 
ATOM   3234 C  C     . GLN A 1 415 ? 10.878 10.777  -2.915  1.00 61.61 ? 412 GLN A C     1 
ATOM   3235 O  O     . GLN A 1 415 ? 11.992 10.893  -3.429  1.00 61.05 ? 412 GLN A O     1 
ATOM   3236 C  CB    . GLN A 1 415 ? 9.639  9.431   -4.646  1.00 65.55 ? 412 GLN A CB    1 
ATOM   3237 C  CG    . GLN A 1 415 ? 10.558 8.549   -5.451  1.00 68.85 ? 412 GLN A CG    1 
ATOM   3238 C  CD    . GLN A 1 415 ? 10.614 8.931   -6.918  1.00 73.40 ? 412 GLN A CD    1 
ATOM   3239 O  OE1   . GLN A 1 415 ? 11.551 9.593   -7.372  1.00 78.42 ? 412 GLN A OE1   1 
ATOM   3240 N  NE2   . GLN A 1 415 ? 9.616  8.492   -7.676  1.00 72.81 ? 412 GLN A NE2   1 
ATOM   3241 N  N     . THR A 1 416 ? 10.355 11.700  -2.116  1.00 60.28 ? 413 THR A N     1 
ATOM   3242 C  CA    . THR A 1 416 ? 11.169 12.780  -1.574  1.00 59.66 ? 413 THR A CA    1 
ATOM   3243 C  C     . THR A 1 416 ? 12.146 12.225  -0.552  1.00 55.46 ? 413 THR A C     1 
ATOM   3244 O  O     . THR A 1 416 ? 13.305 12.632  -0.497  1.00 50.70 ? 413 THR A O     1 
ATOM   3245 C  CB    . THR A 1 416 ? 10.315 13.859  -0.896  1.00 59.00 ? 413 THR A CB    1 
ATOM   3246 O  OG1   . THR A 1 416 ? 9.106  14.057  -1.638  1.00 62.41 ? 413 THR A OG1   1 
ATOM   3247 C  CG2   . THR A 1 416 ? 11.086 15.165  -0.786  1.00 61.21 ? 413 THR A CG2   1 
ATOM   3248 N  N     . GLU A 1 417 ? 11.655 11.297  0.264   1.00 52.81 ? 414 GLU A N     1 
ATOM   3249 C  CA    . GLU A 1 417 ? 12.451 10.709  1.328   1.00 51.80 ? 414 GLU A CA    1 
ATOM   3250 C  C     . GLU A 1 417 ? 13.250 9.519   0.828   1.00 50.72 ? 414 GLU A C     1 
ATOM   3251 O  O     . GLU A 1 417 ? 12.930 8.922   -0.201  1.00 50.38 ? 414 GLU A O     1 
ATOM   3252 C  CB    . GLU A 1 417 ? 11.560 10.271  2.493   1.00 51.85 ? 414 GLU A CB    1 
ATOM   3253 C  CG    . GLU A 1 417 ? 10.679 11.367  3.044   1.00 54.01 ? 414 GLU A CG    1 
ATOM   3254 C  CD    . GLU A 1 417 ? 11.418 12.673  3.205   1.00 53.27 ? 414 GLU A CD    1 
ATOM   3255 O  OE1   . GLU A 1 417 ? 12.261 12.775  4.127   1.00 49.20 ? 414 GLU A OE1   1 
ATOM   3256 O  OE2   . GLU A 1 417 ? 11.148 13.599  2.408   1.00 55.44 ? 414 GLU A OE2   1 
ATOM   3257 N  N     . TRP A 1 418 ? 14.295 9.180   1.573   1.00 42.07 ? 415 TRP A N     1 
ATOM   3258 C  CA    . TRP A 1 418 ? 15.083 7.997   1.286   1.00 41.63 ? 415 TRP A CA    1 
ATOM   3259 C  C     . TRP A 1 418 ? 15.176 7.114   2.521   1.00 42.63 ? 415 TRP A C     1 
ATOM   3260 O  O     . TRP A 1 418 ? 15.685 7.544   3.558   1.00 38.99 ? 415 TRP A O     1 
ATOM   3261 C  CB    . TRP A 1 418 ? 16.485 8.377   0.808   1.00 38.61 ? 415 TRP A CB    1 
ATOM   3262 C  CG    . TRP A 1 418 ? 17.121 7.277   0.061   1.00 37.28 ? 415 TRP A CG    1 
ATOM   3263 C  CD1   . TRP A 1 418 ? 17.617 6.124   0.577   1.00 32.91 ? 415 TRP A CD1   1 
ATOM   3264 C  CD2   . TRP A 1 418 ? 17.300 7.199   -1.355  1.00 35.12 ? 415 TRP A CD2   1 
ATOM   3265 N  NE1   . TRP A 1 418 ? 18.107 5.331   -0.427  1.00 38.91 ? 415 TRP A NE1   1 
ATOM   3266 C  CE2   . TRP A 1 418 ? 17.924 5.968   -1.624  1.00 32.71 ? 415 TRP A CE2   1 
ATOM   3267 C  CE3   . TRP A 1 418 ? 16.999 8.050   -2.418  1.00 35.17 ? 415 TRP A CE3   1 
ATOM   3268 C  CZ2   . TRP A 1 418 ? 18.259 5.567   -2.915  1.00 38.47 ? 415 TRP A CZ2   1 
ATOM   3269 C  CZ3   . TRP A 1 418 ? 17.330 7.652   -3.700  1.00 41.86 ? 415 TRP A CZ3   1 
ATOM   3270 C  CH2   . TRP A 1 418 ? 17.957 6.422   -3.937  1.00 37.78 ? 415 TRP A CH2   1 
ATOM   3271 N  N     . SER A 1 419 ? 14.673 5.888   2.416   1.00 46.48 ? 416 SER A N     1 
ATOM   3272 C  CA    . SER A 1 419 ? 14.808 4.935   3.508   1.00 44.59 ? 416 SER A CA    1 
ATOM   3273 C  C     . SER A 1 419 ? 15.221 3.561   2.979   1.00 47.13 ? 416 SER A C     1 
ATOM   3274 O  O     . SER A 1 419 ? 14.820 3.168   1.883   1.00 43.87 ? 416 SER A O     1 
ATOM   3275 C  CB    . SER A 1 419 ? 13.510 4.816   4.306   1.00 53.18 ? 416 SER A CB    1 
ATOM   3276 O  OG    . SER A 1 419 ? 12.456 4.354   3.485   1.00 55.45 ? 416 SER A OG    1 
ATOM   3277 N  N     . PRO A 1 420 ? 16.064 2.844   3.742   1.00 47.63 ? 417 PRO A N     1 
ATOM   3278 C  CA    . PRO A 1 420 ? 16.736 3.404   4.919   1.00 46.80 ? 417 PRO A CA    1 
ATOM   3279 C  C     . PRO A 1 420 ? 17.772 4.424   4.463   1.00 40.40 ? 417 PRO A C     1 
ATOM   3280 O  O     . PRO A 1 420 ? 18.176 4.368   3.299   1.00 45.42 ? 417 PRO A O     1 
ATOM   3281 C  CB    . PRO A 1 420 ? 17.392 2.185   5.574   1.00 44.13 ? 417 PRO A CB    1 
ATOM   3282 C  CG    . PRO A 1 420 ? 17.564 1.210   4.459   1.00 47.50 ? 417 PRO A CG    1 
ATOM   3283 C  CD    . PRO A 1 420 ? 16.399 1.424   3.536   1.00 46.21 ? 417 PRO A CD    1 
ATOM   3284 N  N     . PRO A 1 421 ? 18.148 5.368   5.337   1.00 39.61 ? 418 PRO A N     1 
ATOM   3285 C  CA    . PRO A 1 421 ? 19.131 6.381   4.942   1.00 37.36 ? 418 PRO A CA    1 
ATOM   3286 C  C     . PRO A 1 421 ? 20.429 5.752   4.439   1.00 29.44 ? 418 PRO A C     1 
ATOM   3287 O  O     . PRO A 1 421 ? 20.817 4.677   4.904   1.00 33.29 ? 418 PRO A O     1 
ATOM   3288 C  CB    . PRO A 1 421 ? 19.364 7.170   6.232   1.00 36.43 ? 418 PRO A CB    1 
ATOM   3289 C  CG    . PRO A 1 421 ? 18.123 6.954   7.039   1.00 40.45 ? 418 PRO A CG    1 
ATOM   3290 C  CD    . PRO A 1 421 ? 17.673 5.562   6.718   1.00 41.82 ? 418 PRO A CD    1 
ATOM   3291 N  N     . LEU A 1 422 ? 21.069 6.422   3.486   1.00 32.03 ? 419 LEU A N     1 
ATOM   3292 C  CA    . LEU A 1 422 ? 22.326 5.954   2.908   1.00 27.48 ? 419 LEU A CA    1 
ATOM   3293 C  C     . LEU A 1 422 ? 23.509 6.365   3.770   1.00 25.91 ? 419 LEU A C     1 
ATOM   3294 O  O     . LEU A 1 422 ? 23.658 7.538   4.117   1.00 30.28 ? 419 LEU A O     1 
ATOM   3295 C  CB    . LEU A 1 422 ? 22.495 6.496   1.480   1.00 21.87 ? 419 LEU A CB    1 
ATOM   3296 C  CG    . LEU A 1 422 ? 21.377 6.107   0.504   1.00 28.71 ? 419 LEU A CG    1 
ATOM   3297 C  CD1   . LEU A 1 422 ? 21.680 6.530   -0.942  1.00 26.14 ? 419 LEU A CD1   1 
ATOM   3298 C  CD2   . LEU A 1 422 ? 21.136 4.612   0.586   1.00 30.61 ? 419 LEU A CD2   1 
ATOM   3299 N  N     . THR A 1 423 ? 24.349 5.395   4.111   1.00 25.86 ? 420 THR A N     1 
ATOM   3300 C  CA    . THR A 1 423 ? 25.521 5.662   4.941   1.00 23.83 ? 420 THR A CA    1 
ATOM   3301 C  C     . THR A 1 423 ? 26.806 5.556   4.124   1.00 23.52 ? 420 THR A C     1 
ATOM   3302 O  O     . THR A 1 423 ? 27.909 5.673   4.668   1.00 20.95 ? 420 THR A O     1 
ATOM   3303 C  CB    . THR A 1 423 ? 25.593 4.703   6.136   1.00 28.58 ? 420 THR A CB    1 
ATOM   3304 O  OG1   . THR A 1 423 ? 25.484 3.352   5.669   1.00 34.28 ? 420 THR A OG1   1 
ATOM   3305 C  CG2   . THR A 1 423 ? 24.449 4.987   7.109   1.00 33.51 ? 420 THR A CG2   1 
ATOM   3306 N  N     . MET A 1 424 ? 26.661 5.331   2.821   1.00 20.50 ? 421 MET A N     1 
ATOM   3307 C  CA    . MET A 1 424 ? 27.823 5.315   1.928   1.00 20.06 ? 421 MET A CA    1 
ATOM   3308 C  C     . MET A 1 424 ? 27.422 5.430   0.461   1.00 25.00 ? 421 MET A C     1 
ATOM   3309 O  O     . MET A 1 424 ? 26.446 4.824   0.022   1.00 21.93 ? 421 MET A O     1 
ATOM   3310 C  CB    . MET A 1 424 ? 28.651 4.043   2.139   1.00 22.73 ? 421 MET A CB    1 
ATOM   3311 C  CG    . MET A 1 424 ? 29.975 4.011   1.375   1.00 25.54 ? 421 MET A CG    1 
ATOM   3312 S  SD    . MET A 1 424 ? 29.795 3.329   -0.294  1.00 24.97 ? 421 MET A SD    1 
ATOM   3313 C  CE    . MET A 1 424 ? 29.370 1.634   0.097   1.00 25.44 ? 421 MET A CE    1 
ATOM   3314 N  N     . LEU A 1 425 ? 28.192 6.224   -0.277  1.00 17.07 ? 422 LEU A N     1 
ATOM   3315 C  CA    . LEU A 1 425 ? 28.133 6.287   -1.733  1.00 18.08 ? 422 LEU A CA    1 
ATOM   3316 C  C     . LEU A 1 425 ? 29.523 6.034   -2.303  1.00 18.95 ? 422 LEU A C     1 
ATOM   3317 O  O     . LEU A 1 425 ? 30.529 6.428   -1.710  1.00 18.49 ? 422 LEU A O     1 
ATOM   3318 C  CB    . LEU A 1 425 ? 27.639 7.645   -2.220  1.00 19.26 ? 422 LEU A CB    1 
ATOM   3319 C  CG    . LEU A 1 425 ? 26.264 8.114   -1.779  1.00 20.75 ? 422 LEU A CG    1 
ATOM   3320 C  CD1   . LEU A 1 425 ? 26.038 9.516   -2.322  1.00 19.93 ? 422 LEU A CD1   1 
ATOM   3321 C  CD2   . LEU A 1 425 ? 25.204 7.147   -2.295  1.00 19.79 ? 422 LEU A CD2   1 
ATOM   3322 N  N     . PHE A 1 426 ? 29.567 5.420   -3.475  1.00 18.15 ? 423 PHE A N     1 
ATOM   3323 C  CA    . PHE A 1 426 ? 30.819 4.998   -4.079  1.00 18.66 ? 423 PHE A CA    1 
ATOM   3324 C  C     . PHE A 1 426 ? 30.631 5.013   -5.592  1.00 17.26 ? 423 PHE A C     1 
ATOM   3325 O  O     . PHE A 1 426 ? 29.664 4.438   -6.107  1.00 20.81 ? 423 PHE A O     1 
ATOM   3326 C  CB    . PHE A 1 426 ? 31.201 3.612   -3.544  1.00 19.86 ? 423 PHE A CB    1 
ATOM   3327 C  CG    A PHE A 1 426 ? 32.613 3.170   -3.867  0.38 19.77 ? 423 PHE A CG    1 
ATOM   3328 C  CG    B PHE A 1 426 ? 32.318 2.956   -4.285  0.62 19.44 ? 423 PHE A CG    1 
ATOM   3329 C  CD1   A PHE A 1 426 ? 33.078 1.944   -3.408  0.38 22.44 ? 423 PHE A CD1   1 
ATOM   3330 C  CD1   B PHE A 1 426 ? 33.636 3.275   -3.999  0.62 18.79 ? 423 PHE A CD1   1 
ATOM   3331 C  CD2   A PHE A 1 426 ? 33.472 3.961   -4.614  0.38 18.00 ? 423 PHE A CD2   1 
ATOM   3332 C  CD2   B PHE A 1 426 ? 32.058 1.990   -5.241  0.62 19.20 ? 423 PHE A CD2   1 
ATOM   3333 C  CE1   A PHE A 1 426 ? 34.362 1.517   -3.693  0.38 21.05 ? 423 PHE A CE1   1 
ATOM   3334 C  CE1   B PHE A 1 426 ? 34.672 2.654   -4.672  0.62 21.32 ? 423 PHE A CE1   1 
ATOM   3335 C  CE2   A PHE A 1 426 ? 34.761 3.540   -4.905  0.38 21.32 ? 423 PHE A CE2   1 
ATOM   3336 C  CE2   B PHE A 1 426 ? 33.089 1.359   -5.905  0.62 21.78 ? 423 PHE A CE2   1 
ATOM   3337 C  CZ    A PHE A 1 426 ? 35.207 2.318   -4.445  0.38 22.48 ? 423 PHE A CZ    1 
ATOM   3338 C  CZ    B PHE A 1 426 ? 34.394 1.693   -5.618  0.62 21.34 ? 423 PHE A CZ    1 
ATOM   3339 N  N     . LEU A 1 427 ? 31.505 5.718   -6.299  1.00 15.58 ? 424 LEU A N     1 
ATOM   3340 C  CA    . LEU A 1 427 ? 31.510 5.671   -7.756  1.00 18.58 ? 424 LEU A CA    1 
ATOM   3341 C  C     . LEU A 1 427 ? 32.863 5.187   -8.223  1.00 17.96 ? 424 LEU A C     1 
ATOM   3342 O  O     . LEU A 1 427 ? 33.886 5.731   -7.812  1.00 19.31 ? 424 LEU A O     1 
ATOM   3343 C  CB    . LEU A 1 427 ? 31.221 7.039   -8.363  1.00 16.79 ? 424 LEU A CB    1 
ATOM   3344 C  CG    . LEU A 1 427 ? 29.813 7.589   -8.165  1.00 22.02 ? 424 LEU A CG    1 
ATOM   3345 C  CD1   . LEU A 1 427 ? 29.694 8.940   -8.836  1.00 19.34 ? 424 LEU A CD1   1 
ATOM   3346 C  CD2   . LEU A 1 427 ? 28.779 6.612   -8.709  1.00 22.95 ? 424 LEU A CD2   1 
ATOM   3347 N  N     . CYS A 1 428 ? 32.886 4.184   -9.094  1.00 14.78 ? 425 CYS A N     1 
ATOM   3348 C  CA    . CYS A 1 428 ? 34.162 3.650   -9.557  1.00 18.24 ? 425 CYS A CA    1 
ATOM   3349 C  C     . CYS A 1 428 ? 34.154 3.443   -11.064 1.00 20.57 ? 425 CYS A C     1 
ATOM   3350 O  O     . CYS A 1 428 ? 33.227 2.838   -11.605 1.00 20.82 ? 425 CYS A O     1 
ATOM   3351 C  CB    . CYS A 1 428 ? 34.475 2.335   -8.849  1.00 20.14 ? 425 CYS A CB    1 
ATOM   3352 S  SG    . CYS A 1 428 ? 36.135 1.688   -9.184  1.00 25.62 ? 425 CYS A SG    1 
ATOM   3353 N  N     . ALA A 1 429 ? 35.189 3.960   -11.719 1.00 17.08 ? 426 ALA A N     1 
ATOM   3354 C  CA    . ALA A 1 429 ? 35.385 3.809   -13.151 1.00 15.10 ? 426 ALA A CA    1 
ATOM   3355 C  C     . ALA A 1 429 ? 36.338 2.637   -13.379 1.00 17.93 ? 426 ALA A C     1 
ATOM   3356 O  O     . ALA A 1 429 ? 37.390 2.543   -12.743 1.00 18.98 ? 426 ALA A O     1 
ATOM   3357 C  CB    . ALA A 1 429 ? 35.941 5.095   -13.754 1.00 18.45 ? 426 ALA A CB    1 
ATOM   3358 N  N     . THR A 1 430 ? 35.942 1.733   -14.265 1.00 19.04 ? 427 THR A N     1 
ATOM   3359 C  CA    . THR A 1 430 ? 36.659 0.470   -14.459 1.00 20.20 ? 427 THR A CA    1 
ATOM   3360 C  C     . THR A 1 430 ? 36.683 0.088   -15.936 1.00 24.87 ? 427 THR A C     1 
ATOM   3361 O  O     . THR A 1 430 ? 36.147 0.808   -16.774 1.00 18.71 ? 427 THR A O     1 
ATOM   3362 C  CB    . THR A 1 430 ? 36.006 -0.686  -13.656 1.00 24.56 ? 427 THR A CB    1 
ATOM   3363 O  OG1   . THR A 1 430 ? 34.753 -1.036  -14.257 1.00 27.28 ? 427 THR A OG1   1 
ATOM   3364 C  CG2   . THR A 1 430 ? 35.756 -0.292  -12.196 1.00 24.98 ? 427 THR A CG2   1 
ATOM   3365 N  N     . LYS A 1 431 ? 37.297 -1.058  -16.233 1.00 21.40 ? 428 LYS A N     1 
ATOM   3366 C  CA    . LYS A 1 431 ? 37.387 -1.597  -17.595 1.00 25.05 ? 428 LYS A CA    1 
ATOM   3367 C  C     . LYS A 1 431 ? 37.945 -0.585  -18.606 1.00 19.64 ? 428 LYS A C     1 
ATOM   3368 O  O     . LYS A 1 431 ? 37.251 -0.135  -19.523 1.00 20.18 ? 428 LYS A O     1 
ATOM   3369 C  CB    . LYS A 1 431 ? 36.020 -2.113  -18.050 1.00 22.24 ? 428 LYS A CB    1 
ATOM   3370 C  CG    . LYS A 1 431 ? 35.484 -3.230  -17.164 1.00 28.74 ? 428 LYS A CG    1 
ATOM   3371 C  CD    . LYS A 1 431 ? 34.268 -3.923  -17.768 1.00 38.25 ? 428 LYS A CD    1 
ATOM   3372 C  CE    . LYS A 1 431 ? 33.788 -5.060  -16.868 1.00 38.94 ? 428 LYS A CE    1 
ATOM   3373 N  NZ    . LYS A 1 431 ? 34.910 -5.936  -16.419 1.00 42.44 ? 428 LYS A NZ    1 
ATOM   3374 N  N     . PHE A 1 432 ? 39.212 -0.239  -18.428 1.00 19.30 ? 429 PHE A N     1 
ATOM   3375 C  CA    . PHE A 1 432 ? 39.894 0.678   -19.329 1.00 19.55 ? 429 PHE A CA    1 
ATOM   3376 C  C     . PHE A 1 432 ? 40.219 0.060   -20.676 1.00 25.49 ? 429 PHE A C     1 
ATOM   3377 O  O     . PHE A 1 432 ? 40.492 -1.139  -20.773 1.00 24.20 ? 429 PHE A O     1 
ATOM   3378 C  CB    . PHE A 1 432 ? 41.185 1.186   -18.686 1.00 20.42 ? 429 PHE A CB    1 
ATOM   3379 C  CG    . PHE A 1 432 ? 40.951 2.158   -17.572 1.00 22.42 ? 429 PHE A CG    1 
ATOM   3380 C  CD1   . PHE A 1 432 ? 40.851 3.509   -17.834 1.00 22.24 ? 429 PHE A CD1   1 
ATOM   3381 C  CD2   . PHE A 1 432 ? 40.830 1.723   -16.260 1.00 25.19 ? 429 PHE A CD2   1 
ATOM   3382 C  CE1   . PHE A 1 432 ? 40.624 4.413   -16.817 1.00 21.51 ? 429 PHE A CE1   1 
ATOM   3383 C  CE2   . PHE A 1 432 ? 40.608 2.627   -15.233 1.00 25.74 ? 429 PHE A CE2   1 
ATOM   3384 C  CZ    . PHE A 1 432 ? 40.511 3.974   -15.512 1.00 24.63 ? 429 PHE A CZ    1 
ATOM   3385 N  N     . SER A 1 433 ? 40.188 0.908   -21.705 1.00 20.99 ? 430 SER A N     1 
ATOM   3386 C  CA    . SER A 1 433 ? 40.657 0.573   -23.046 1.00 21.28 ? 430 SER A CA    1 
ATOM   3387 C  C     . SER A 1 433 ? 41.635 1.631   -23.514 1.00 22.08 ? 430 SER A C     1 
ATOM   3388 O  O     . SER A 1 433 ? 41.534 2.793   -23.124 1.00 21.80 ? 430 SER A O     1 
ATOM   3389 C  CB    . SER A 1 433 ? 39.497 0.470   -24.035 1.00 26.38 ? 430 SER A CB    1 
ATOM   3390 O  OG    . SER A 1 433 ? 38.576 -0.518  -23.630 1.00 36.00 ? 430 SER A OG    1 
ATOM   3391 N  N     . ALA A 1 434 ? 42.585 1.228   -24.348 1.00 22.72 ? 431 ALA A N     1 
ATOM   3392 C  CA    . ALA A 1 434 ? 43.561 2.165   -24.874 1.00 26.46 ? 431 ALA A CA    1 
ATOM   3393 C  C     . ALA A 1 434 ? 42.847 3.203   -25.726 1.00 29.64 ? 431 ALA A C     1 
ATOM   3394 O  O     . ALA A 1 434 ? 41.826 2.912   -26.350 1.00 29.63 ? 431 ALA A O     1 
ATOM   3395 C  CB    . ALA A 1 434 ? 44.627 1.444   -25.681 1.00 27.37 ? 431 ALA A CB    1 
ATOM   3396 N  N     . SER A 1 435 ? 43.374 4.418   -25.731 1.00 25.81 ? 432 SER A N     1 
ATOM   3397 C  CA    . SER A 1 435 ? 42.773 5.503   -26.498 1.00 26.18 ? 432 SER A CA    1 
ATOM   3398 C  C     . SER A 1 435 ? 43.840 6.508   -26.897 1.00 30.07 ? 432 SER A C     1 
ATOM   3399 O  O     . SER A 1 435 ? 43.539 7.615   -27.329 1.00 38.60 ? 432 SER A O     1 
ATOM   3400 C  CB    . SER A 1 435 ? 41.670 6.185   -25.697 1.00 30.31 ? 432 SER A CB    1 
ATOM   3401 O  OG    . SER A 1 435 ? 42.202 6.891   -24.590 1.00 37.34 ? 432 SER A OG    1 
ATOM   3402 O  OXT   . SER A 1 435 ? 45.034 6.235   -26.788 1.00 38.13 ? 432 SER A OXT   1 
ATOM   3403 O  "O3'" . DC  B 2 1   ? 27.634 4.614   11.473  1.00 59.22 ? 1   DC  T "O3'" 1 
ATOM   3404 P  P     . DA  B 2 2   ? 28.046 4.348   13.005  1.00 76.95 ? 2   DA  T P     1 
ATOM   3405 O  OP1   . DA  B 2 2   ? 28.228 2.886   13.195  1.00 72.20 ? 2   DA  T OP1   1 
ATOM   3406 O  OP2   . DA  B 2 2   ? 27.095 5.099   13.858  1.00 65.98 ? 2   DA  T OP2   1 
ATOM   3407 O  "O5'" . DA  B 2 2   ? 29.466 5.067   13.154  1.00 59.71 ? 2   DA  T "O5'" 1 
ATOM   3408 C  "C5'" . DA  B 2 2   ? 30.589 4.619   12.401  1.00 51.40 ? 2   DA  T "C5'" 1 
ATOM   3409 C  "C4'" . DA  B 2 2   ? 31.851 5.325   12.863  1.00 48.20 ? 2   DA  T "C4'" 1 
ATOM   3410 O  "O4'" . DA  B 2 2   ? 31.739 6.746   12.587  1.00 48.02 ? 2   DA  T "O4'" 1 
ATOM   3411 C  "C3'" . DA  B 2 2   ? 32.138 5.215   14.360  1.00 47.06 ? 2   DA  T "C3'" 1 
ATOM   3412 O  "O3'" . DA  B 2 2   ? 33.529 5.192   14.585  1.00 49.23 ? 2   DA  T "O3'" 1 
ATOM   3413 C  "C2'" . DA  B 2 2   ? 31.510 6.484   14.924  1.00 47.50 ? 2   DA  T "C2'" 1 
ATOM   3414 C  "C1'" . DA  B 2 2   ? 31.762 7.478   13.799  1.00 44.07 ? 2   DA  T "C1'" 1 
ATOM   3415 N  N9    . DA  B 2 2   ? 30.752 8.524   13.727  1.00 41.85 ? 2   DA  T N9    1 
ATOM   3416 C  C8    . DA  B 2 2   ? 29.506 8.513   14.296  1.00 42.68 ? 2   DA  T C8    1 
ATOM   3417 N  N7    . DA  B 2 2   ? 28.811 9.605   14.069  1.00 40.73 ? 2   DA  T N7    1 
ATOM   3418 C  C5    . DA  B 2 2   ? 29.665 10.385  13.304  1.00 40.18 ? 2   DA  T C5    1 
ATOM   3419 C  C6    . DA  B 2 2   ? 29.528 11.665  12.735  1.00 39.95 ? 2   DA  T C6    1 
ATOM   3420 N  N6    . DA  B 2 2   ? 28.426 12.416  12.860  1.00 39.19 ? 2   DA  T N6    1 
ATOM   3421 N  N1    . DA  B 2 2   ? 30.571 12.147  12.029  1.00 39.94 ? 2   DA  T N1    1 
ATOM   3422 C  C2    . DA  B 2 2   ? 31.671 11.393  11.900  1.00 35.66 ? 2   DA  T C2    1 
ATOM   3423 N  N3    . DA  B 2 2   ? 31.916 10.181  12.383  1.00 37.07 ? 2   DA  T N3    1 
ATOM   3424 C  C4    . DA  B 2 2   ? 30.864 9.730   13.085  1.00 38.89 ? 2   DA  T C4    1 
ATOM   3425 P  P     A DT  B 2 3   ? 34.210 3.846   15.134  0.56 47.66 ? 3   DT  T P     1 
ATOM   3426 P  P     B DT  B 2 3   ? 34.277 3.830   14.987  0.44 47.63 ? 3   DT  T P     1 
ATOM   3427 O  OP1   A DT  B 2 3   ? 33.244 2.744   14.912  0.56 46.73 ? 3   DT  T OP1   1 
ATOM   3428 O  OP1   B DT  B 2 3   ? 33.273 2.911   15.567  0.44 48.03 ? 3   DT  T OP1   1 
ATOM   3429 O  OP2   A DT  B 2 3   ? 34.739 4.128   16.487  0.56 45.57 ? 3   DT  T OP2   1 
ATOM   3430 O  OP2   B DT  B 2 3   ? 35.485 4.210   15.759  0.44 44.20 ? 3   DT  T OP2   1 
ATOM   3431 O  "O5'" A DT  B 2 3   ? 35.453 3.618   14.156  0.56 43.78 ? 3   DT  T "O5'" 1 
ATOM   3432 O  "O5'" B DT  B 2 3   ? 34.787 3.238   13.589  0.44 42.42 ? 3   DT  T "O5'" 1 
ATOM   3433 C  "C5'" A DT  B 2 3   ? 36.414 4.635   14.006  0.56 39.88 ? 3   DT  T "C5'" 1 
ATOM   3434 C  "C5'" B DT  B 2 3   ? 36.120 3.506   13.145  0.44 38.91 ? 3   DT  T "C5'" 1 
ATOM   3435 C  "C4'" A DT  B 2 3   ? 37.190 4.458   12.723  0.56 37.25 ? 3   DT  T "C4'" 1 
ATOM   3436 C  "C4'" B DT  B 2 3   ? 36.192 4.843   12.429  0.44 37.67 ? 3   DT  T "C4'" 1 
ATOM   3437 O  "O4'" A DT  B 2 3   ? 38.305 3.571   12.962  0.56 38.58 ? 3   DT  T "O4'" 1 
ATOM   3438 O  "O4'" B DT  B 2 3   ? 37.588 5.204   12.212  0.44 37.26 ? 3   DT  T "O4'" 1 
ATOM   3439 C  "C3'" A DT  B 2 3   ? 36.381 3.855   11.575  0.56 36.94 ? 3   DT  T "C3'" 1 
ATOM   3440 C  "C3'" B DT  B 2 3   ? 35.523 4.864   11.056  0.44 35.08 ? 3   DT  T "C3'" 1 
ATOM   3441 O  "O3'" A DT  B 2 3   ? 36.422 4.720   10.426  0.56 34.84 ? 3   DT  T "O3'" 1 
ATOM   3442 O  "O3'" B DT  B 2 3   ? 34.808 6.085   10.868  0.44 36.22 ? 3   DT  T "O3'" 1 
ATOM   3443 C  "C2'" A DT  B 2 3   ? 37.035 2.492   11.321  0.56 36.42 ? 3   DT  T "C2'" 1 
ATOM   3444 C  "C2'" B DT  B 2 3   ? 36.704 4.732   10.098  0.44 33.52 ? 3   DT  T "C2'" 1 
ATOM   3445 C  "C1'" A DT  B 2 3   ? 38.437 2.680   11.887  0.56 37.70 ? 3   DT  T "C1'" 1 
ATOM   3446 C  "C1'" B DT  B 2 3   ? 37.804 5.475   10.843  0.44 33.04 ? 3   DT  T "C1'" 1 
ATOM   3447 N  N1    A DT  B 2 3   ? 39.046 1.428   12.412  0.56 39.52 ? 3   DT  T N1    1 
ATOM   3448 N  N1    B DT  B 2 3   ? 39.184 5.017   10.472  0.44 32.68 ? 3   DT  T N1    1 
ATOM   3449 C  C2    A DT  B 2 3   ? 40.286 1.043   11.961  0.56 39.57 ? 3   DT  T C2    1 
ATOM   3450 C  C2    B DT  B 2 3   ? 40.113 5.938   10.036  0.44 29.66 ? 3   DT  T C2    1 
ATOM   3451 O  O2    A DT  B 2 3   ? 40.917 1.667   11.124  0.56 37.68 ? 3   DT  T O2    1 
ATOM   3452 O  O2    B DT  B 2 3   ? 39.881 7.129   9.940   0.44 31.22 ? 3   DT  T O2    1 
ATOM   3453 N  N3    A DT  B 2 3   ? 40.759 -0.119  12.514  0.56 40.69 ? 3   DT  T N3    1 
ATOM   3454 N  N3    B DT  B 2 3   ? 41.336 5.411   9.722   0.44 28.54 ? 3   DT  T N3    1 
ATOM   3455 C  C4    A DT  B 2 3   ? 40.134 -0.909  13.462  0.56 44.96 ? 3   DT  T C4    1 
ATOM   3456 C  C4    B DT  B 2 3   ? 41.720 4.086   9.791   0.44 28.56 ? 3   DT  T C4    1 
ATOM   3457 O  O4    A DT  B 2 3   ? 40.641 -1.936  13.902  0.56 46.41 ? 3   DT  T O4    1 
ATOM   3458 O  O4    B DT  B 2 3   ? 42.850 3.714   9.486   0.44 30.79 ? 3   DT  T O4    1 
ATOM   3459 C  C5    A DT  B 2 3   ? 38.840 -0.441  13.898  0.56 42.19 ? 3   DT  T C5    1 
ATOM   3460 C  C5    B DT  B 2 3   ? 40.701 3.172   10.253  0.44 32.16 ? 3   DT  T C5    1 
ATOM   3461 C  C7    A DT  B 2 3   ? 38.066 -1.215  14.923  0.56 42.21 ? 3   DT  T C7    1 
ATOM   3462 C  C7    B DT  B 2 3   ? 40.998 1.706   10.370  0.44 33.62 ? 3   DT  T C7    1 
ATOM   3463 C  C6    A DT  B 2 3   ? 38.365 0.691   13.361  0.56 40.03 ? 3   DT  T C6    1 
ATOM   3464 C  C6    B DT  B 2 3   ? 39.499 3.677   10.569  0.44 33.27 ? 3   DT  T C6    1 
ATOM   3465 P  P     A DT  B 2 4   ? 35.047 5.239   9.773   0.71 28.35 ? 4   DT  T P     1 
ATOM   3466 P  P     B DT  B 2 4   ? 33.789 6.254   9.633   0.29 31.41 ? 4   DT  T P     1 
ATOM   3467 O  OP1   A DT  B 2 4   ? 34.313 6.064   10.760  0.71 37.00 ? 4   DT  T OP1   1 
ATOM   3468 O  OP1   B DT  B 2 4   ? 32.865 7.366   9.944   0.29 34.79 ? 4   DT  T OP1   1 
ATOM   3469 O  OP2   A DT  B 2 4   ? 34.422 4.032   9.192   0.71 31.83 ? 4   DT  T OP2   1 
ATOM   3470 O  OP2   B DT  B 2 4   ? 33.248 4.926   9.278   0.29 33.60 ? 4   DT  T OP2   1 
ATOM   3471 O  "O5'" A DT  B 2 4   ? 35.500 6.144   8.532   0.71 23.74 ? 4   DT  T "O5'" 1 
ATOM   3472 O  "O5'" B DT  B 2 4   ? 34.737 6.713   8.438   0.29 27.33 ? 4   DT  T "O5'" 1 
ATOM   3473 C  "C5'" A DT  B 2 4   ? 35.765 7.543   8.673   0.71 23.95 ? 4   DT  T "C5'" 1 
ATOM   3474 C  "C5'" B DT  B 2 4   ? 35.751 7.659   8.690   0.29 24.08 ? 4   DT  T "C5'" 1 
ATOM   3475 C  "C4'" . DT  B 2 4   ? 36.435 8.072   7.408   1.00 18.53 ? 4   DT  T "C4'" 1 
ATOM   3476 O  "O4'" . DT  B 2 4   ? 37.699 7.388   7.244   1.00 18.63 ? 4   DT  T "O4'" 1 
ATOM   3477 C  "C3'" . DT  B 2 4   ? 35.665 7.816   6.120   1.00 19.98 ? 4   DT  T "C3'" 1 
ATOM   3478 O  "O3'" A DT  B 2 4   ? 35.965 8.850   5.212   0.71 16.97 ? 4   DT  T "O3'" 1 
ATOM   3479 O  "O3'" B DT  B 2 4   ? 35.964 8.854   5.212   0.29 17.05 ? 4   DT  T "O3'" 1 
ATOM   3480 C  "C2'" . DT  B 2 4   ? 36.233 6.465   5.652   1.00 19.35 ? 4   DT  T "C2'" 1 
ATOM   3481 C  "C1'" . DT  B 2 4   ? 37.695 6.634   6.043   1.00 17.35 ? 4   DT  T "C1'" 1 
ATOM   3482 N  N1    . DT  B 2 4   ? 38.455 5.389   6.316   1.00 18.59 ? 4   DT  T N1    1 
ATOM   3483 C  C2    . DT  B 2 4   ? 39.770 5.365   5.952   1.00 17.34 ? 4   DT  T C2    1 
ATOM   3484 O  O2    . DT  B 2 4   ? 40.303 6.284   5.362   1.00 16.16 ? 4   DT  T O2    1 
ATOM   3485 N  N3    . DT  B 2 4   ? 40.437 4.221   6.272   1.00 19.81 ? 4   DT  T N3    1 
ATOM   3486 C  C4    . DT  B 2 4   ? 39.949 3.125   6.929   1.00 19.97 ? 4   DT  T C4    1 
ATOM   3487 O  O4    . DT  B 2 4   ? 40.650 2.149   7.173   1.00 20.35 ? 4   DT  T O4    1 
ATOM   3488 C  C5    . DT  B 2 4   ? 38.558 3.212   7.324   1.00 21.94 ? 4   DT  T C5    1 
ATOM   3489 C  C7    . DT  B 2 4   ? 37.908 2.059   8.039   1.00 23.28 ? 4   DT  T C7    1 
ATOM   3490 C  C6    . DT  B 2 4   ? 37.882 4.334   7.009   1.00 22.38 ? 4   DT  T C6    1 
ATOM   3491 P  P     . DA  B 2 5   ? 35.320 8.883   3.744   1.00 17.64 ? 5   DA  T P     1 
ATOM   3492 O  OP1   . DA  B 2 5   ? 35.000 10.297  3.461   1.00 18.74 ? 5   DA  T OP1   1 
ATOM   3493 O  OP2   . DA  B 2 5   ? 34.286 7.831   3.644   1.00 17.69 ? 5   DA  T OP2   1 
ATOM   3494 O  "O5'" . DA  B 2 5   ? 36.524 8.423   2.807   1.00 16.23 ? 5   DA  T "O5'" 1 
ATOM   3495 C  "C5'" . DA  B 2 5   ? 37.695 9.245   2.694   1.00 14.56 ? 5   DA  T "C5'" 1 
ATOM   3496 C  "C4'" . DA  B 2 5   ? 38.659 8.632   1.710   1.00 15.64 ? 5   DA  T "C4'" 1 
ATOM   3497 O  "O4'" . DA  B 2 5   ? 39.243 7.426   2.295   1.00 17.72 ? 5   DA  T "O4'" 1 
ATOM   3498 C  "C3'" . DA  B 2 5   ? 38.019 8.187   0.396   1.00 13.88 ? 5   DA  T "C3'" 1 
ATOM   3499 O  "O3'" . DA  B 2 5   ? 38.922 8.430   -0.666  1.00 16.80 ? 5   DA  T "O3'" 1 
ATOM   3500 C  "C2'" . DA  B 2 5   ? 37.824 6.687   0.618   1.00 17.03 ? 5   DA  T "C2'" 1 
ATOM   3501 C  "C1'" . DA  B 2 5   ? 39.095 6.359   1.381   1.00 20.20 ? 5   DA  T "C1'" 1 
ATOM   3502 N  N9    . DA  B 2 5   ? 39.031 5.107   2.128   1.00 15.78 ? 5   DA  T N9    1 
ATOM   3503 C  C8    . DA  B 2 5   ? 37.959 4.607   2.808   1.00 19.45 ? 5   DA  T C8    1 
ATOM   3504 N  N7    . DA  B 2 5   ? 38.197 3.465   3.410   1.00 19.93 ? 5   DA  T N7    1 
ATOM   3505 C  C5    . DA  B 2 5   ? 39.528 3.203   3.113   1.00 19.32 ? 5   DA  T C5    1 
ATOM   3506 C  C6    . DA  B 2 5   ? 40.385 2.136   3.455   1.00 18.58 ? 5   DA  T C6    1 
ATOM   3507 N  N6    . DA  B 2 5   ? 40.005 1.097   4.209   1.00 21.11 ? 5   DA  T N6    1 
ATOM   3508 N  N1    . DA  B 2 5   ? 41.653 2.182   2.994   1.00 18.05 ? 5   DA  T N1    1 
ATOM   3509 C  C2    . DA  B 2 5   ? 42.030 3.227   2.238   1.00 15.77 ? 5   DA  T C2    1 
ATOM   3510 N  N3    . DA  B 2 5   ? 41.314 4.287   1.855   1.00 19.06 ? 5   DA  T N3    1 
ATOM   3511 C  C4    . DA  B 2 5   ? 40.058 4.205   2.326   1.00 18.75 ? 5   DA  T C4    1 
ATOM   3512 P  P     . DT  B 2 6   ? 38.435 8.429   -2.200  1.00 16.08 ? 6   DT  T P     1 
ATOM   3513 O  OP1   . DT  B 2 6   ? 39.590 8.905   -2.973  1.00 16.98 ? 6   DT  T OP1   1 
ATOM   3514 O  OP2   . DT  B 2 6   ? 37.132 9.152   -2.286  1.00 15.10 ? 6   DT  T OP2   1 
ATOM   3515 O  "O5'" . DT  B 2 6   ? 38.091 6.893   -2.471  1.00 17.71 ? 6   DT  T "O5'" 1 
ATOM   3516 C  "C5'" . DT  B 2 6   ? 38.812 6.149   -3.412  1.00 18.69 ? 6   DT  T "C5'" 1 
ATOM   3517 C  "C4'" . DT  B 2 6   ? 40.001 5.442   -2.791  1.00 18.81 ? 6   DT  T "C4'" 1 
ATOM   3518 O  "O4'" . DT  B 2 6   ? 39.603 4.721   -1.616  1.00 19.30 ? 6   DT  T "O4'" 1 
ATOM   3519 C  "C3'" . DT  B 2 6   ? 40.603 4.396   -3.709  1.00 20.80 ? 6   DT  T "C3'" 1 
ATOM   3520 O  "O3'" . DT  B 2 6   ? 41.679 4.965   -4.405  1.00 18.59 ? 6   DT  T "O3'" 1 
ATOM   3521 C  "C2'" . DT  B 2 6   ? 41.053 3.261   -2.780  1.00 21.54 ? 6   DT  T "C2'" 1 
ATOM   3522 C  "C1'" . DT  B 2 6   ? 40.515 3.674   -1.412  1.00 21.99 ? 6   DT  T "C1'" 1 
ATOM   3523 N  N1    . DT  B 2 6   ? 39.836 2.591   -0.671  1.00 18.13 ? 6   DT  T N1    1 
ATOM   3524 C  C2    . DT  B 2 6   ? 40.571 1.503   -0.258  1.00 16.25 ? 6   DT  T C2    1 
ATOM   3525 O  O2    . DT  B 2 6   ? 41.755 1.372   -0.496  1.00 19.77 ? 6   DT  T O2    1 
ATOM   3526 N  N3    . DT  B 2 6   ? 39.865 0.580   0.459   1.00 17.00 ? 6   DT  T N3    1 
ATOM   3527 C  C4    . DT  B 2 6   ? 38.525 0.623   0.790   1.00 18.86 ? 6   DT  T C4    1 
ATOM   3528 O  O4    . DT  B 2 6   ? 37.977 -0.263  1.442   1.00 23.77 ? 6   DT  T O4    1 
ATOM   3529 C  C5    . DT  B 2 6   ? 37.816 1.788   0.332   1.00 21.64 ? 6   DT  T C5    1 
ATOM   3530 C  C7    . DT  B 2 6   ? 36.358 1.945   0.639   1.00 22.18 ? 6   DT  T C7    1 
ATOM   3531 C  C6    . DT  B 2 6   ? 38.498 2.706   -0.367  1.00 20.48 ? 6   DT  T C6    1 
ATOM   3532 P  P     . DG  B 2 7   ? 41.869 4.631   -5.959  1.00 16.91 ? 7   DG  T P     1 
ATOM   3533 O  OP1   . DG  B 2 7   ? 43.039 5.407   -6.413  1.00 16.23 ? 7   DG  T OP1   1 
ATOM   3534 O  OP2   . DG  B 2 7   ? 40.606 4.731   -6.691  1.00 17.64 ? 7   DG  T OP2   1 
ATOM   3535 O  "O5'" . DG  B 2 7   ? 42.198 3.057   -5.978  1.00 17.59 ? 7   DG  T "O5'" 1 
ATOM   3536 C  "C5'" . DG  B 2 7   ? 43.470 2.595   -5.590  1.00 22.83 ? 7   DG  T "C5'" 1 
ATOM   3537 C  "C4'" . DG  B 2 7   ? 43.496 1.079   -5.560  1.00 13.61 ? 7   DG  T "C4'" 1 
ATOM   3538 O  "O4'" . DG  B 2 7   ? 42.793 0.597   -4.401  1.00 17.64 ? 7   DG  T "O4'" 1 
ATOM   3539 C  "C3'" . DG  B 2 7   ? 42.852 0.383   -6.768  1.00 20.84 ? 7   DG  T "C3'" 1 
ATOM   3540 O  "O3'" . DG  B 2 7   ? 43.828 -0.382  -7.421  1.00 22.75 ? 7   DG  T "O3'" 1 
ATOM   3541 C  "C2'" . DG  B 2 7   ? 41.759 -0.500  -6.145  1.00 18.85 ? 7   DG  T "C2'" 1 
ATOM   3542 C  "C1'" . DG  B 2 7   ? 42.261 -0.653  -4.721  1.00 21.72 ? 7   DG  T "C1'" 1 
ATOM   3543 N  N9    . DG  B 2 7   ? 41.211 -0.987  -3.769  1.00 18.77 ? 7   DG  T N9    1 
ATOM   3544 C  C8    . DG  B 2 7   ? 40.010 -0.346  -3.592  1.00 17.08 ? 7   DG  T C8    1 
ATOM   3545 N  N7    . DG  B 2 7   ? 39.264 -0.890  -2.666  1.00 19.91 ? 7   DG  T N7    1 
ATOM   3546 C  C5    . DG  B 2 7   ? 40.023 -1.960  -2.209  1.00 18.02 ? 7   DG  T C5    1 
ATOM   3547 C  C6    . DG  B 2 7   ? 39.737 -2.917  -1.211  1.00 17.75 ? 7   DG  T C6    1 
ATOM   3548 O  O6    . DG  B 2 7   ? 38.716 -3.014  -0.504  1.00 16.91 ? 7   DG  T O6    1 
ATOM   3549 N  N1    . DG  B 2 7   ? 40.780 -3.834  -1.070  1.00 16.97 ? 7   DG  T N1    1 
ATOM   3550 C  C2    . DG  B 2 7   ? 41.952 -3.813  -1.791  1.00 14.48 ? 7   DG  T C2    1 
ATOM   3551 N  N2    . DG  B 2 7   ? 42.852 -4.775  -1.514  1.00 15.81 ? 7   DG  T N2    1 
ATOM   3552 N  N3    . DG  B 2 7   ? 42.230 -2.916  -2.724  1.00 16.91 ? 7   DG  T N3    1 
ATOM   3553 C  C4    . DG  B 2 7   ? 41.220 -2.031  -2.882  1.00 17.69 ? 7   DG  T C4    1 
ATOM   3554 P  P     . DA  B 2 8   ? 43.468 -1.317  -8.676  1.00 19.12 ? 8   DA  T P     1 
ATOM   3555 O  OP1   . DA  B 2 8   ? 44.533 -1.054  -9.650  1.00 19.33 ? 8   DA  T OP1   1 
ATOM   3556 O  OP2   . DA  B 2 8   ? 42.031 -1.274  -9.066  1.00 21.84 ? 8   DA  T OP2   1 
ATOM   3557 O  "O5'" . DA  B 2 8   ? 43.752 -2.784  -8.121  1.00 20.34 ? 8   DA  T "O5'" 1 
ATOM   3558 C  "C5'" . DA  B 2 8   ? 45.057 -3.099  -7.664  1.00 17.55 ? 8   DA  T "C5'" 1 
ATOM   3559 C  "C4'" . DA  B 2 8   ? 45.106 -4.530  -7.204  1.00 20.81 ? 8   DA  T "C4'" 1 
ATOM   3560 O  "O4'" . DA  B 2 8   ? 44.227 -4.675  -6.063  1.00 19.61 ? 8   DA  T "O4'" 1 
ATOM   3561 C  "C3'" . DA  B 2 8   ? 44.638 -5.535  -8.257  1.00 24.37 ? 8   DA  T "C3'" 1 
ATOM   3562 O  "O3'" . DA  B 2 8   ? 45.527 -6.625  -8.300  1.00 24.84 ? 8   DA  T "O3'" 1 
ATOM   3563 C  "C2'" . DA  B 2 8   ? 43.258 -5.960  -7.771  1.00 23.76 ? 8   DA  T "C2'" 1 
ATOM   3564 C  "C1'" . DA  B 2 8   ? 43.348 -5.752  -6.261  1.00 22.46 ? 8   DA  T "C1'" 1 
ATOM   3565 N  N9    . DA  B 2 8   ? 42.065 -5.391  -5.679  1.00 18.61 ? 8   DA  T N9    1 
ATOM   3566 C  C8    . DA  B 2 8   ? 41.264 -4.350  -6.063  1.00 21.01 ? 8   DA  T C8    1 
ATOM   3567 N  N7    . DA  B 2 8   ? 40.155 -4.256  -5.381  1.00 17.97 ? 8   DA  T N7    1 
ATOM   3568 C  C5    . DA  B 2 8   ? 40.219 -5.307  -4.491  1.00 18.16 ? 8   DA  T C5    1 
ATOM   3569 C  C6    . DA  B 2 8   ? 39.330 -5.755  -3.495  1.00 17.67 ? 8   DA  T C6    1 
ATOM   3570 N  N6    . DA  B 2 8   ? 38.154 -5.156  -3.229  1.00 17.11 ? 8   DA  T N6    1 
ATOM   3571 N  N1    . DA  B 2 8   ? 39.687 -6.854  -2.785  1.00 18.24 ? 8   DA  T N1    1 
ATOM   3572 C  C2    . DA  B 2 8   ? 40.861 -7.445  -3.057  1.00 13.83 ? 8   DA  T C2    1 
ATOM   3573 N  N3    . DA  B 2 8   ? 41.785 -7.117  -3.978  1.00 16.59 ? 8   DA  T N3    1 
ATOM   3574 C  C4    . DA  B 2 8   ? 41.394 -6.027  -4.667  1.00 17.80 ? 8   DA  T C4    1 
ATOM   3575 P  P     . DC  B 2 9   ? 45.415 -7.730  -9.458  1.00 23.45 ? 9   DC  T P     1 
ATOM   3576 O  OP1   . DC  B 2 9   ? 46.803 -8.164  -9.716  1.00 26.59 ? 9   DC  T OP1   1 
ATOM   3577 O  OP2   . DC  B 2 9   ? 44.553 -7.247  -10.558 1.00 28.78 ? 9   DC  T OP2   1 
ATOM   3578 O  "O5'" . DC  B 2 9   ? 44.628 -8.915  -8.741  1.00 23.12 ? 9   DC  T "O5'" 1 
ATOM   3579 C  "C5'" . DC  B 2 9   ? 45.168 -9.452  -7.554  1.00 19.84 ? 9   DC  T "C5'" 1 
ATOM   3580 C  "C4'" . DC  B 2 9   ? 44.193 -10.398 -6.924  1.00 21.71 ? 9   DC  T "C4'" 1 
ATOM   3581 O  "O4'" . DC  B 2 9   ? 43.080 -9.654  -6.361  1.00 23.08 ? 9   DC  T "O4'" 1 
ATOM   3582 C  "C3'" . DC  B 2 9   ? 43.577 -11.407 -7.891  1.00 28.19 ? 9   DC  T "C3'" 1 
ATOM   3583 O  "O3'" . DC  B 2 9   ? 43.509 -12.637 -7.242  1.00 27.46 ? 9   DC  T "O3'" 1 
ATOM   3584 C  "C2'" . DC  B 2 9   ? 42.183 -10.831 -8.138  1.00 24.68 ? 9   DC  T "C2'" 1 
ATOM   3585 C  "C1'" . DC  B 2 9   ? 41.886 -10.286 -6.760  1.00 27.14 ? 9   DC  T "C1'" 1 
ATOM   3586 N  N1    . DC  B 2 9   ? 40.766 -9.312  -6.713  1.00 21.81 ? 9   DC  T N1    1 
ATOM   3587 C  C2    . DC  B 2 9   ? 39.833 -9.424  -5.690  1.00 23.26 ? 9   DC  T C2    1 
ATOM   3588 O  O2    . DC  B 2 9   ? 39.977 -10.322 -4.850  1.00 20.47 ? 9   DC  T O2    1 
ATOM   3589 N  N3    . DC  B 2 9   ? 38.802 -8.555  -5.637  1.00 19.40 ? 9   DC  T N3    1 
ATOM   3590 C  C4    . DC  B 2 9   ? 38.682 -7.599  -6.558  1.00 23.18 ? 9   DC  T C4    1 
ATOM   3591 N  N4    . DC  B 2 9   ? 37.636 -6.766  -6.454  1.00 21.17 ? 9   DC  T N4    1 
ATOM   3592 C  C5    . DC  B 2 9   ? 39.620 -7.465  -7.625  1.00 22.05 ? 9   DC  T C5    1 
ATOM   3593 C  C6    . DC  B 2 9   ? 40.645 -8.339  -7.665  1.00 23.36 ? 9   DC  T C6    1 
ATOM   3594 P  P     . DG  B 2 10  ? 43.215 -13.990 -8.052  1.00 27.57 ? 10  DG  T P     1 
ATOM   3595 O  OP1   . DG  B 2 10  ? 44.461 -14.775 -8.015  1.00 34.86 ? 10  DG  T OP1   1 
ATOM   3596 O  OP2   . DG  B 2 10  ? 42.539 -13.679 -9.337  1.00 29.06 ? 10  DG  T OP2   1 
ATOM   3597 O  "O5'" . DG  B 2 10  ? 42.161 -14.719 -7.137  1.00 27.26 ? 10  DG  T "O5'" 1 
ATOM   3598 C  "C5'" . DG  B 2 10  ? 42.263 -14.647 -5.742  1.00 25.87 ? 10  DG  T "C5'" 1 
ATOM   3599 C  "C4'" . DG  B 2 10  ? 41.061 -15.315 -5.124  1.00 29.92 ? 10  DG  T "C4'" 1 
ATOM   3600 O  "O4'" . DG  B 2 10  ? 40.011 -14.330 -4.950  1.00 29.63 ? 10  DG  T "O4'" 1 
ATOM   3601 C  "C3'" . DG  B 2 10  ? 40.459 -16.423 -5.985  1.00 32.93 ? 10  DG  T "C3'" 1 
ATOM   3602 O  "O3'" . DG  B 2 10  ? 39.936 -17.449 -5.155  1.00 34.61 ? 10  DG  T "O3'" 1 
ATOM   3603 C  "C2'" . DG  B 2 10  ? 39.359 -15.698 -6.755  1.00 31.85 ? 10  DG  T "C2'" 1 
ATOM   3604 C  "C1'" . DG  B 2 10  ? 38.886 -14.675 -5.737  1.00 26.60 ? 10  DG  T "C1'" 1 
ATOM   3605 N  N9    . DG  B 2 10  ? 38.374 -13.462 -6.353  1.00 23.26 ? 10  DG  T N9    1 
ATOM   3606 C  C8    . DG  B 2 10  ? 38.991 -12.707 -7.325  1.00 23.54 ? 10  DG  T C8    1 
ATOM   3607 N  N7    . DG  B 2 10  ? 38.292 -11.673 -7.698  1.00 19.87 ? 10  DG  T N7    1 
ATOM   3608 C  C5    . DG  B 2 10  ? 37.139 -11.743 -6.925  1.00 19.59 ? 10  DG  T C5    1 
ATOM   3609 C  C6    . DG  B 2 10  ? 36.006 -10.893 -6.900  1.00 18.36 ? 10  DG  T C6    1 
ATOM   3610 O  O6    . DG  B 2 10  ? 35.802 -9.867  -7.570  1.00 24.40 ? 10  DG  T O6    1 
ATOM   3611 N  N1    . DG  B 2 10  ? 35.056 -11.327 -5.976  1.00 22.38 ? 10  DG  T N1    1 
ATOM   3612 C  C2    . DG  B 2 10  ? 35.181 -12.453 -5.182  1.00 20.97 ? 10  DG  T C2    1 
ATOM   3613 N  N2    . DG  B 2 10  ? 34.156 -12.716 -4.357  1.00 25.29 ? 10  DG  T N2    1 
ATOM   3614 N  N3    . DG  B 2 10  ? 36.235 -13.262 -5.201  1.00 23.58 ? 10  DG  T N3    1 
ATOM   3615 C  C4    . DG  B 2 10  ? 37.174 -12.845 -6.093  1.00 19.51 ? 10  DG  T C4    1 
ATOM   3616 P  P     . DC  B 2 11  ? 39.307 -18.784 -5.791  1.00 34.81 ? 11  DC  T P     1 
ATOM   3617 O  OP1   . DC  B 2 11  ? 39.831 -19.902 -4.985  1.00 35.59 ? 11  DC  T OP1   1 
ATOM   3618 O  OP2   . DC  B 2 11  ? 39.489 -18.819 -7.255  1.00 31.21 ? 11  DC  T OP2   1 
ATOM   3619 O  "O5'" . DC  B 2 11  ? 37.747 -18.607 -5.525  1.00 29.59 ? 11  DC  T "O5'" 1 
ATOM   3620 C  "C5'" . DC  B 2 11  ? 37.287 -18.172 -4.271  1.00 24.58 ? 11  DC  T "C5'" 1 
ATOM   3621 C  "C4'" . DC  B 2 11  ? 35.774 -18.143 -4.262  1.00 25.09 ? 11  DC  T "C4'" 1 
ATOM   3622 O  "O4'" . DC  B 2 11  ? 35.314 -16.900 -4.844  1.00 25.25 ? 11  DC  T "O4'" 1 
ATOM   3623 C  "C3'" . DC  B 2 11  ? 35.107 -19.265 -5.061  1.00 20.32 ? 11  DC  T "C3'" 1 
ATOM   3624 O  "O3'" . DC  B 2 11  ? 34.020 -19.809 -4.293  1.00 17.95 ? 11  DC  T "O3'" 1 
ATOM   3625 C  "C2'" . DC  B 2 11  ? 34.637 -18.562 -6.349  1.00 23.27 ? 11  DC  T "C2'" 1 
ATOM   3626 C  "C1'" . DC  B 2 11  ? 34.364 -17.148 -5.858  1.00 23.37 ? 11  DC  T "C1'" 1 
ATOM   3627 N  N1    . DC  B 2 11  ? 34.544 -16.063 -6.884  1.00 17.99 ? 11  DC  T N1    1 
ATOM   3628 C  C2    . DC  B 2 11  ? 33.541 -15.106 -7.067  1.00 18.55 ? 11  DC  T C2    1 
ATOM   3629 O  O2    . DC  B 2 11  ? 32.490 -15.190 -6.418  1.00 20.95 ? 11  DC  T O2    1 
ATOM   3630 N  N3    . DC  B 2 11  ? 33.736 -14.108 -7.971  1.00 19.58 ? 11  DC  T N3    1 
ATOM   3631 C  C4    . DC  B 2 11  ? 34.868 -14.040 -8.658  1.00 16.60 ? 11  DC  T C4    1 
ATOM   3632 N  N4    . DC  B 2 11  ? 35.009 -13.030 -9.533  1.00 18.35 ? 11  DC  T N4    1 
ATOM   3633 C  C5    . DC  B 2 11  ? 35.913 -14.998 -8.484  1.00 15.23 ? 11  DC  T C5    1 
ATOM   3634 C  C6    . DC  B 2 11  ? 35.714 -15.981 -7.584  1.00 19.63 ? 11  DC  T C6    1 
ATOM   3635 P  P     . DT  B 2 12  ? 33.298 -21.174 -4.747  1.00 18.43 ? 12  DT  T P     1 
ATOM   3636 O  OP1   . DT  B 2 12  ? 32.752 -21.792 -3.515  1.00 20.79 ? 12  DT  T OP1   1 
ATOM   3637 O  OP2   . DT  B 2 12  ? 34.197 -21.942 -5.625  1.00 18.45 ? 12  DT  T OP2   1 
ATOM   3638 O  "O5'" . DT  B 2 12  ? 32.097 -20.660 -5.637  1.00 20.27 ? 12  DT  T "O5'" 1 
ATOM   3639 C  "C5'" . DT  B 2 12  ? 30.966 -20.124 -5.016  1.00 18.15 ? 12  DT  T "C5'" 1 
ATOM   3640 C  "C4'" . DT  B 2 12  ? 29.973 -19.689 -6.056  1.00 20.77 ? 12  DT  T "C4'" 1 
ATOM   3641 O  "O4'" . DT  B 2 12  ? 30.520 -18.564 -6.785  1.00 23.70 ? 12  DT  T "O4'" 1 
ATOM   3642 C  "C3'" . DT  B 2 12  ? 29.646 -20.756 -7.114  1.00 23.19 ? 12  DT  T "C3'" 1 
ATOM   3643 O  "O3'" . DT  B 2 12  ? 28.258 -20.702 -7.428  1.00 22.58 ? 12  DT  T "O3'" 1 
ATOM   3644 C  "C2'" . DT  B 2 12  ? 30.490 -20.311 -8.305  1.00 18.40 ? 12  DT  T "C2'" 1 
ATOM   3645 C  "C1'" . DT  B 2 12  ? 30.332 -18.812 -8.159  1.00 22.30 ? 12  DT  T "C1'" 1 
ATOM   3646 N  N1    . DT  B 2 12  ? 31.292 -18.005 -8.942  1.00 20.96 ? 12  DT  T N1    1 
ATOM   3647 C  C2    . DT  B 2 12  ? 30.901 -16.753 -9.357  1.00 19.63 ? 12  DT  T C2    1 
ATOM   3648 O  O2    . DT  B 2 12  ? 29.812 -16.281 -9.103  1.00 23.81 ? 12  DT  T O2    1 
ATOM   3649 N  N3    . DT  B 2 12  ? 31.820 -16.081 -10.082 1.00 20.22 ? 12  DT  T N3    1 
ATOM   3650 C  C4    . DT  B 2 12  ? 33.078 -16.514 -10.444 1.00 16.81 ? 12  DT  T C4    1 
ATOM   3651 O  O4    . DT  B 2 12  ? 33.833 -15.820 -11.113 1.00 21.87 ? 12  DT  T O4    1 
ATOM   3652 C  C5    . DT  B 2 12  ? 33.441 -17.838 -9.979  1.00 19.15 ? 12  DT  T C5    1 
ATOM   3653 C  C7    . DT  B 2 12  ? 34.784 -18.411 -10.306 1.00 20.51 ? 12  DT  T C7    1 
ATOM   3654 C  C6    . DT  B 2 12  ? 32.536 -18.516 -9.255  1.00 23.56 ? 12  DT  T C6    1 
ATOM   3655 O  "O5'" . DA  C 3 1   ? 29.275 -7.855  -15.289 1.00 35.30 ? 1   DA  P "O5'" 1 
ATOM   3656 C  "C5'" . DA  C 3 1   ? 27.937 -8.061  -15.698 1.00 27.77 ? 1   DA  P "C5'" 1 
ATOM   3657 C  "C4'" . DA  C 3 1   ? 27.073 -8.513  -14.531 1.00 25.22 ? 1   DA  P "C4'" 1 
ATOM   3658 O  "O4'" . DA  C 3 1   ? 27.462 -9.844  -14.118 1.00 30.93 ? 1   DA  P "O4'" 1 
ATOM   3659 C  "C3'" . DA  C 3 1   ? 27.140 -7.637  -13.284 1.00 25.39 ? 1   DA  P "C3'" 1 
ATOM   3660 O  "O3'" . DA  C 3 1   ? 25.862 -7.540  -12.694 1.00 25.68 ? 1   DA  P "O3'" 1 
ATOM   3661 C  "C2'" . DA  C 3 1   ? 28.120 -8.363  -12.369 1.00 28.26 ? 1   DA  P "C2'" 1 
ATOM   3662 C  "C1'" . DA  C 3 1   ? 28.018 -9.824  -12.817 1.00 27.89 ? 1   DA  P "C1'" 1 
ATOM   3663 N  N9    . DA  C 3 1   ? 29.317 -10.479 -12.884 1.00 23.33 ? 1   DA  P N9    1 
ATOM   3664 C  C8    . DA  C 3 1   ? 30.377 -10.122 -13.669 1.00 24.62 ? 1   DA  P C8    1 
ATOM   3665 N  N7    . DA  C 3 1   ? 31.431 -10.896 -13.520 1.00 23.65 ? 1   DA  P N7    1 
ATOM   3666 C  C5    . DA  C 3 1   ? 31.030 -11.820 -12.570 1.00 18.93 ? 1   DA  P C5    1 
ATOM   3667 C  C6    . DA  C 3 1   ? 31.690 -12.911 -11.970 1.00 22.85 ? 1   DA  P C6    1 
ATOM   3668 N  N6    . DA  C 3 1   ? 32.938 -13.267 -12.268 1.00 20.01 ? 1   DA  P N6    1 
ATOM   3669 N  N1    . DA  C 3 1   ? 31.003 -13.633 -11.059 1.00 21.85 ? 1   DA  P N1    1 
ATOM   3670 C  C2    . DA  C 3 1   ? 29.739 -13.283 -10.770 1.00 19.97 ? 1   DA  P C2    1 
ATOM   3671 N  N3    . DA  C 3 1   ? 29.018 -12.277 -11.258 1.00 19.80 ? 1   DA  P N3    1 
ATOM   3672 C  C4    . DA  C 3 1   ? 29.731 -11.577 -12.163 1.00 23.37 ? 1   DA  P C4    1 
ATOM   3673 P  P     . DG  C 3 2   ? 25.531 -6.313  -11.705 1.00 33.69 ? 2   DG  P P     1 
ATOM   3674 O  OP1   . DG  C 3 2   ? 24.082 -6.047  -11.831 1.00 29.60 ? 2   DG  P OP1   1 
ATOM   3675 O  OP2   . DG  C 3 2   ? 26.548 -5.254  -11.907 1.00 31.53 ? 2   DG  P OP2   1 
ATOM   3676 O  "O5'" . DG  C 3 2   ? 25.822 -6.902  -10.258 1.00 28.24 ? 2   DG  P "O5'" 1 
ATOM   3677 C  "C5'" . DG  C 3 2   ? 24.871 -7.735  -9.649  1.00 26.12 ? 2   DG  P "C5'" 1 
ATOM   3678 C  "C4'" . DG  C 3 2   ? 25.496 -8.445  -8.483  1.00 24.98 ? 2   DG  P "C4'" 1 
ATOM   3679 O  "O4'" . DG  C 3 2   ? 26.711 -9.081  -8.920  1.00 25.72 ? 2   DG  P "O4'" 1 
ATOM   3680 C  "C3'" . DG  C 3 2   ? 25.884 -7.528  -7.323  1.00 27.68 ? 2   DG  P "C3'" 1 
ATOM   3681 O  "O3'" . DG  C 3 2   ? 25.225 -7.967  -6.166  1.00 28.49 ? 2   DG  P "O3'" 1 
ATOM   3682 C  "C2'" . DG  C 3 2   ? 27.413 -7.673  -7.214  1.00 26.96 ? 2   DG  P "C2'" 1 
ATOM   3683 C  "C1'" . DG  C 3 2   ? 27.654 -9.012  -7.887  1.00 25.26 ? 2   DG  P "C1'" 1 
ATOM   3684 N  N9    . DG  C 3 2   ? 28.995 -9.174  -8.465  1.00 22.44 ? 2   DG  P N9    1 
ATOM   3685 C  C8    . DG  C 3 2   ? 29.665 -8.304  -9.296  1.00 23.86 ? 2   DG  P C8    1 
ATOM   3686 N  N7    . DG  C 3 2   ? 30.849 -8.730  -9.654  1.00 23.43 ? 2   DG  P N7    1 
ATOM   3687 C  C5    . DG  C 3 2   ? 30.967 -9.971  -9.026  1.00 20.62 ? 2   DG  P C5    1 
ATOM   3688 C  C6    . DG  C 3 2   ? 32.035 -10.910 -9.028  1.00 18.01 ? 2   DG  P C6    1 
ATOM   3689 O  O6    . DG  C 3 2   ? 33.120 -10.844 -9.621  1.00 19.69 ? 2   DG  P O6    1 
ATOM   3690 N  N1    . DG  C 3 2   ? 31.736 -12.033 -8.252  1.00 21.76 ? 2   DG  P N1    1 
ATOM   3691 C  C2    . DG  C 3 2   ? 30.563 -12.215 -7.560  1.00 22.17 ? 2   DG  P C2    1 
ATOM   3692 N  N2    . DG  C 3 2   ? 30.445 -13.362 -6.865  1.00 21.31 ? 2   DG  P N2    1 
ATOM   3693 N  N3    . DG  C 3 2   ? 29.564 -11.346 -7.552  1.00 23.53 ? 2   DG  P N3    1 
ATOM   3694 C  C4    . DG  C 3 2   ? 29.835 -10.251 -8.292  1.00 24.22 ? 2   DG  P C4    1 
ATOM   3695 P  P     . DC  C 3 3   ? 25.454 -7.252  -4.747  1.00 32.03 ? 3   DC  P P     1 
ATOM   3696 O  OP1   . DC  C 3 3   ? 24.160 -7.323  -4.040  1.00 38.69 ? 3   DC  P OP1   1 
ATOM   3697 O  OP2   . DC  C 3 3   ? 26.162 -5.968  -4.910  1.00 35.60 ? 3   DC  P OP2   1 
ATOM   3698 O  "O5'" . DC  C 3 3   ? 26.494 -8.220  -4.014  1.00 39.25 ? 3   DC  P "O5'" 1 
ATOM   3699 C  "C5'" . DC  C 3 3   ? 26.211 -9.607  -3.879  1.00 37.34 ? 3   DC  P "C5'" 1 
ATOM   3700 C  "C4'" . DC  C 3 3   ? 27.415 -10.335 -3.309  1.00 38.27 ? 3   DC  P "C4'" 1 
ATOM   3701 O  "O4'" . DC  C 3 3   ? 28.453 -10.374 -4.308  1.00 35.79 ? 3   DC  P "O4'" 1 
ATOM   3702 C  "C3'" . DC  C 3 3   ? 28.032 -9.673  -2.068  1.00 33.89 ? 3   DC  P "C3'" 1 
ATOM   3703 O  "O3'" . DC  C 3 3   ? 27.869 -10.507 -0.934  1.00 42.79 ? 3   DC  P "O3'" 1 
ATOM   3704 C  "C2'" . DC  C 3 3   ? 29.514 -9.475  -2.413  1.00 35.98 ? 3   DC  P "C2'" 1 
ATOM   3705 C  "C1'" . DC  C 3 3   ? 29.707 -10.301 -3.678  1.00 34.24 ? 3   DC  P "C1'" 1 
ATOM   3706 N  N1    . DC  C 3 3   ? 30.677 -9.681  -4.626  1.00 32.99 ? 3   DC  P N1    1 
ATOM   3707 C  C2    . DC  C 3 3   ? 31.848 -10.363 -4.954  1.00 24.66 ? 3   DC  P C2    1 
ATOM   3708 O  O2    . DC  C 3 3   ? 32.044 -11.484 -4.468  1.00 32.25 ? 3   DC  P O2    1 
ATOM   3709 N  N3    . DC  C 3 3   ? 32.732 -9.781  -5.805  1.00 26.96 ? 3   DC  P N3    1 
ATOM   3710 C  C4    . DC  C 3 3   ? 32.477 -8.572  -6.307  1.00 26.28 ? 3   DC  P C4    1 
ATOM   3711 N  N4    . DC  C 3 3   ? 33.374 -8.042  -7.146  1.00 29.58 ? 3   DC  P N4    1 
ATOM   3712 C  C5    . DC  C 3 3   ? 31.286 -7.859  -5.977  1.00 30.24 ? 3   DC  P C5    1 
ATOM   3713 C  C6    . DC  C 3 3   ? 30.427 -8.444  -5.138  1.00 24.42 ? 3   DC  P C6    1 
ATOM   3714 P  P     . DG  C 3 4   ? 28.431 -10.042 0.498   1.00 37.82 ? 4   DG  P P     1 
ATOM   3715 O  OP1   . DG  C 3 4   ? 27.578 -10.703 1.512   1.00 46.41 ? 4   DG  P OP1   1 
ATOM   3716 O  OP2   . DG  C 3 4   ? 28.618 -8.570  0.503   1.00 35.52 ? 4   DG  P OP2   1 
ATOM   3717 O  "O5'" . DG  C 3 4   ? 29.893 -10.682 0.558   1.00 27.43 ? 4   DG  P "O5'" 1 
ATOM   3718 C  "C5'" . DG  C 3 4   ? 30.064 -12.047 0.227   1.00 31.52 ? 4   DG  P "C5'" 1 
ATOM   3719 C  "C4'" . DG  C 3 4   ? 31.528 -12.432 0.299   1.00 37.01 ? 4   DG  P "C4'" 1 
ATOM   3720 O  "O4'" . DG  C 3 4   ? 32.240 -11.869 -0.831  1.00 31.56 ? 4   DG  P "O4'" 1 
ATOM   3721 C  "C3'" . DG  C 3 4   ? 32.249 -11.944 1.553   1.00 36.92 ? 4   DG  P "C3'" 1 
ATOM   3722 O  "O3'" . DG  C 3 4   ? 32.984 -13.007 2.108   1.00 35.93 ? 4   DG  P "O3'" 1 
ATOM   3723 C  "C2'" . DG  C 3 4   ? 33.161 -10.827 1.045   1.00 28.90 ? 4   DG  P "C2'" 1 
ATOM   3724 C  "C1'" . DG  C 3 4   ? 33.430 -11.262 -0.386  1.00 26.27 ? 4   DG  P "C1'" 1 
ATOM   3725 N  N9    . DG  C 3 4   ? 33.725 -10.148 -1.276  1.00 24.43 ? 4   DG  P N9    1 
ATOM   3726 C  C8    . DG  C 3 4   ? 32.934 -9.050  -1.508  1.00 22.31 ? 4   DG  P C8    1 
ATOM   3727 N  N7    . DG  C 3 4   ? 33.440 -8.217  -2.371  1.00 21.77 ? 4   DG  P N7    1 
ATOM   3728 C  C5    . DG  C 3 4   ? 34.648 -8.797  -2.729  1.00 23.27 ? 4   DG  P C5    1 
ATOM   3729 C  C6    . DG  C 3 4   ? 35.631 -8.347  -3.627  1.00 20.01 ? 4   DG  P C6    1 
ATOM   3730 O  O6    . DG  C 3 4   ? 35.634 -7.304  -4.299  1.00 24.09 ? 4   DG  P O6    1 
ATOM   3731 N  N1    . DG  C 3 4   ? 36.705 -9.243  -3.714  1.00 20.84 ? 4   DG  P N1    1 
ATOM   3732 C  C2    . DG  C 3 4   ? 36.801 -10.419 -3.008  1.00 19.10 ? 4   DG  P C2    1 
ATOM   3733 N  N2    . DG  C 3 4   ? 37.911 -11.153 -3.217  1.00 19.19 ? 4   DG  P N2    1 
ATOM   3734 N  N3    . DG  C 3 4   ? 35.874 -10.855 -2.160  1.00 20.48 ? 4   DG  P N3    1 
ATOM   3735 C  C4    . DG  C 3 4   ? 34.829 -9.996  -2.075  1.00 18.71 ? 4   DG  P C4    1 
ATOM   3736 P  P     . DT  C 3 5   ? 33.671 -12.858 3.549   1.00 40.25 ? 5   DT  P P     1 
ATOM   3737 O  OP1   . DT  C 3 5   ? 33.489 -14.156 4.236   1.00 32.21 ? 5   DT  P OP1   1 
ATOM   3738 O  OP2   . DT  C 3 5   ? 33.235 -11.597 4.172   1.00 30.58 ? 5   DT  P OP2   1 
ATOM   3739 O  "O5'" . DT  C 3 5   ? 35.213 -12.665 3.196   1.00 32.97 ? 5   DT  P "O5'" 1 
ATOM   3740 C  "C5'" . DT  C 3 5   ? 35.832 -13.557 2.310   1.00 24.82 ? 5   DT  P "C5'" 1 
ATOM   3741 C  "C4'" . DT  C 3 5   ? 37.233 -13.089 1.982   1.00 20.37 ? 5   DT  P "C4'" 1 
ATOM   3742 O  "O4'" . DT  C 3 5   ? 37.185 -12.029 1.004   1.00 20.46 ? 5   DT  P "O4'" 1 
ATOM   3743 C  "C3'" . DT  C 3 5   ? 38.032 -12.548 3.166   1.00 20.86 ? 5   DT  P "C3'" 1 
ATOM   3744 O  "O3'" . DT  C 3 5   ? 39.229 -13.297 3.262   1.00 19.12 ? 5   DT  P "O3'" 1 
ATOM   3745 C  "C2'" . DT  C 3 5   ? 38.301 -11.072 2.801   1.00 17.28 ? 5   DT  P "C2'" 1 
ATOM   3746 C  "C1'" . DT  C 3 5   ? 38.212 -11.102 1.291   1.00 15.36 ? 5   DT  P "C1'" 1 
ATOM   3747 N  N1    . DT  C 3 5   ? 37.822 -9.813  0.668   1.00 17.35 ? 5   DT  P N1    1 
ATOM   3748 C  C2    . DT  C 3 5   ? 38.643 -9.250  -0.284  1.00 18.09 ? 5   DT  P C2    1 
ATOM   3749 O  O2    . DT  C 3 5   ? 39.708 -9.735  -0.625  1.00 19.66 ? 5   DT  P O2    1 
ATOM   3750 N  N3    . DT  C 3 5   ? 38.174 -8.087  -0.831  1.00 17.73 ? 5   DT  P N3    1 
ATOM   3751 C  C4    . DT  C 3 5   ? 36.992 -7.446  -0.530  1.00 16.95 ? 5   DT  P C4    1 
ATOM   3752 O  O4    . DT  C 3 5   ? 36.661 -6.400  -1.082  1.00 20.64 ? 5   DT  P O4    1 
ATOM   3753 C  C5    . DT  C 3 5   ? 36.169 -8.093  0.470   1.00 18.66 ? 5   DT  P C5    1 
ATOM   3754 C  C7    . DT  C 3 5   ? 34.863 -7.483  0.884   1.00 22.94 ? 5   DT  P C7    1 
ATOM   3755 C  C6    . DT  C 3 5   ? 36.618 -9.236  1.016   1.00 20.02 ? 5   DT  P C6    1 
ATOM   3756 P  P     . DC  C 3 6   ? 40.196 -13.164 4.533   1.00 17.21 ? 6   DC  P P     1 
ATOM   3757 O  OP1   . DC  C 3 6   ? 40.912 -14.466 4.586   1.00 16.07 ? 6   DC  P OP1   1 
ATOM   3758 O  OP2   . DC  C 3 6   ? 39.460 -12.614 5.698   1.00 18.17 ? 6   DC  P OP2   1 
ATOM   3759 O  "O5'" . DC  C 3 6   ? 41.237 -12.039 4.085   1.00 16.12 ? 6   DC  P "O5'" 1 
ATOM   3760 C  "C5'" . DC  C 3 6   ? 42.133 -12.279 3.023   1.00 12.24 ? 6   DC  P "C5'" 1 
ATOM   3761 C  "C4'" . DC  C 3 6   ? 42.819 -10.988 2.652   1.00 16.64 ? 6   DC  P "C4'" 1 
ATOM   3762 O  "O4'" . DC  C 3 6   ? 41.869 -10.091 2.048   1.00 15.98 ? 6   DC  P "O4'" 1 
ATOM   3763 C  "C3'" . DC  C 3 6   ? 43.405 -10.224 3.838   1.00 13.71 ? 6   DC  P "C3'" 1 
ATOM   3764 O  "O3'" . DC  C 3 6   ? 44.807 -10.415 3.812   1.00 14.92 ? 6   DC  P "O3'" 1 
ATOM   3765 C  "C2'" . DC  C 3 6   ? 43.012 -8.751  3.575   1.00 15.81 ? 6   DC  P "C2'" 1 
ATOM   3766 C  "C1'" . DC  C 3 6   ? 42.381 -8.800  2.185   1.00 15.54 ? 6   DC  P "C1'" 1 
ATOM   3767 N  N1    . DC  C 3 6   ? 41.277 -7.835  1.995   1.00 13.05 ? 6   DC  P N1    1 
ATOM   3768 C  C2    . DC  C 3 6   ? 41.370 -6.904  0.963   1.00 16.77 ? 6   DC  P C2    1 
ATOM   3769 O  O2    . DC  C 3 6   ? 42.367 -6.921  0.230   1.00 15.00 ? 6   DC  P O2    1 
ATOM   3770 N  N3    . DC  C 3 6   ? 40.364 -6.013  0.792   1.00 14.43 ? 6   DC  P N3    1 
ATOM   3771 C  C4    . DC  C 3 6   ? 39.305 -6.028  1.601   1.00 16.83 ? 6   DC  P C4    1 
ATOM   3772 N  N4    . DC  C 3 6   ? 38.337 -5.123  1.382   1.00 19.12 ? 6   DC  P N4    1 
ATOM   3773 C  C5    . DC  C 3 6   ? 39.186 -6.968  2.666   1.00 13.87 ? 6   DC  P C5    1 
ATOM   3774 C  C6    . DC  C 3 6   ? 40.193 -7.849  2.827   1.00 14.31 ? 6   DC  P C6    1 
ATOM   3775 P  P     . DA  C 3 7   ? 45.790 -9.680  4.841   1.00 15.03 ? 7   DA  P P     1 
ATOM   3776 O  OP1   . DA  C 3 7   ? 47.018 -10.510 4.929   1.00 16.02 ? 7   DA  P OP1   1 
ATOM   3777 O  OP2   . DA  C 3 7   ? 45.033 -9.328  6.060   1.00 18.57 ? 7   DA  P OP2   1 
ATOM   3778 O  "O5'" . DA  C 3 7   ? 46.093 -8.270  4.143   1.00 15.88 ? 7   DA  P "O5'" 1 
ATOM   3779 C  "C5'" . DA  C 3 7   ? 46.753 -8.210  2.899   1.00 19.62 ? 7   DA  P "C5'" 1 
ATOM   3780 C  "C4'" . DA  C 3 7   ? 46.684 -6.794  2.351   1.00 17.45 ? 7   DA  P "C4'" 1 
ATOM   3781 O  "O4'" . DA  C 3 7   ? 45.320 -6.487  1.976   1.00 18.70 ? 7   DA  P "O4'" 1 
ATOM   3782 C  "C3'" . DA  C 3 7   ? 46.986 -5.688  3.349   1.00 24.63 ? 7   DA  P "C3'" 1 
ATOM   3783 O  "O3'" . DA  C 3 7   ? 48.435 -5.555  3.677   1.00 31.24 ? 7   DA  P "O3'" 1 
ATOM   3784 C  "C2'" . DA  C 3 7   ? 46.374 -4.473  2.667   1.00 21.19 ? 7   DA  P "C2'" 1 
ATOM   3785 C  "C1'" . DA  C 3 7   ? 45.216 -5.073  1.885   1.00 19.23 ? 7   DA  P "C1'" 1 
ATOM   3786 N  N9    . DA  C 3 7   ? 43.920 -4.633  2.359   1.00 14.15 ? 7   DA  P N9    1 
ATOM   3787 C  C8    . DA  C 3 7   ? 43.143 -5.189  3.336   1.00 15.24 ? 7   DA  P C8    1 
ATOM   3788 N  N7    . DA  C 3 7   ? 41.999 -4.559  3.522   1.00 16.92 ? 7   DA  P N7    1 
ATOM   3789 C  C5    . DA  C 3 7   ? 42.050 -3.507  2.618   1.00 17.50 ? 7   DA  P C5    1 
ATOM   3790 C  C6    . DA  C 3 7   ? 41.157 -2.456  2.329   1.00 16.73 ? 7   DA  P C6    1 
ATOM   3791 N  N6    . DA  C 3 7   ? 39.975 -2.304  2.937   1.00 21.44 ? 7   DA  P N6    1 
ATOM   3792 N  N1    . DA  C 3 7   ? 41.516 -1.581  1.367   1.00 16.58 ? 7   DA  P N1    1 
ATOM   3793 C  C2    . DA  C 3 7   ? 42.699 -1.730  0.759   1.00 17.34 ? 7   DA  P C2    1 
ATOM   3794 N  N3    . DA  C 3 7   ? 43.627 -2.672  0.957   1.00 16.86 ? 7   DA  P N3    1 
ATOM   3795 C  C4    . DA  C 3 7   ? 43.233 -3.530  1.908   1.00 15.57 ? 7   DA  P C4    1 
ATOM   3796 P  P     A DT  C 3 8   ? 49.568 -5.024  2.661   0.46 26.01 ? 8   DT  P P     1 
ATOM   3797 P  P     B DT  C 3 8   ? 49.020 -4.195  4.345   0.54 24.42 ? 8   DT  P P     1 
ATOM   3798 O  OP1   A DT  C 3 8   ? 49.394 -5.495  1.279   0.46 24.48 ? 8   DT  P OP1   1 
ATOM   3799 O  OP1   B DT  C 3 8   ? 50.493 -4.292  4.462   0.54 21.75 ? 8   DT  P OP1   1 
ATOM   3800 O  OP2   A DT  C 3 8   ? 50.839 -5.307  3.351   0.46 27.09 ? 8   DT  P OP2   1 
ATOM   3801 O  OP2   B DT  C 3 8   ? 48.204 -3.884  5.544   0.54 19.35 ? 8   DT  P OP2   1 
ATOM   3802 O  "O5'" A DT  C 3 8   ? 49.362 -3.456  2.704   0.46 23.50 ? 8   DT  P "O5'" 1 
ATOM   3803 O  "O5'" B DT  C 3 8   ? 48.647 -3.005  3.334   0.54 25.75 ? 8   DT  P "O5'" 1 
ATOM   3804 C  "C5'" A DT  C 3 8   ? 49.520 -2.751  1.554   0.46 21.53 ? 8   DT  P "C5'" 1 
ATOM   3805 C  "C5'" B DT  C 3 8   ? 49.318 -2.765  2.059   0.54 22.56 ? 8   DT  P "C5'" 1 
ATOM   3806 C  "C4'" . DT  C 3 8   ? 48.980 -1.339  1.673   1.00 21.00 ? 8   DT  P "C4'" 1 
ATOM   3807 O  "O4'" . DT  C 3 8   ? 47.551 -1.271  1.802   1.00 18.53 ? 8   DT  P "O4'" 1 
ATOM   3808 C  "C3'" . DT  C 3 8   ? 49.564 -0.389  2.721   1.00 20.54 ? 8   DT  P "C3'" 1 
ATOM   3809 O  "O3'" . DT  C 3 8   ? 50.298 0.625   2.088   1.00 15.80 ? 8   DT  P "O3'" 1 
ATOM   3810 C  "C2'" . DT  C 3 8   ? 48.337 0.174   3.464   1.00 20.60 ? 8   DT  P "C2'" 1 
ATOM   3811 C  "C1'" . DT  C 3 8   ? 47.206 -0.083  2.484   1.00 21.87 ? 8   DT  P "C1'" 1 
ATOM   3812 N  N1    . DT  C 3 8   ? 45.880 -0.266  3.142   1.00 18.33 ? 8   DT  P N1    1 
ATOM   3813 C  C2    . DT  C 3 8   ? 44.851 0.593   2.825   1.00 16.41 ? 8   DT  P C2    1 
ATOM   3814 O  O2    . DT  C 3 8   ? 44.967 1.497   2.019   1.00 22.74 ? 8   DT  P O2    1 
ATOM   3815 N  N3    . DT  C 3 8   ? 43.670 0.347   3.482   1.00 19.85 ? 8   DT  P N3    1 
ATOM   3816 C  C4    . DT  C 3 8   ? 43.426 -0.643  4.407   1.00 18.12 ? 8   DT  P C4    1 
ATOM   3817 O  O4    . DT  C 3 8   ? 42.334 -0.788  4.949   1.00 21.00 ? 8   DT  P O4    1 
ATOM   3818 C  C5    . DT  C 3 8   ? 44.550 -1.503  4.701   1.00 17.17 ? 8   DT  P C5    1 
ATOM   3819 C  C7    . DT  C 3 8   ? 44.396 -2.618  5.688   1.00 21.74 ? 8   DT  P C7    1 
ATOM   3820 C  C6    . DT  C 3 8   ? 45.706 -1.277  4.058   1.00 19.11 ? 8   DT  P C6    1 
HETATM 3821 MG MG    A MG  D 4 .   ? 52.603 0.293   2.111   0.90 17.32 ? 501 MG  A MG    1 
HETATM 3822 CA CA    A CA  E 5 .   ? 54.611 2.640   3.842   0.50 11.20 ? 502 CA  A CA    1 
HETATM 3823 MG MG    B MG  F 4 .   ? 54.614 2.632   3.840   0.50 11.28 ? 503 MG  A MG    1 
HETATM 3824 C  C1    . GOL G 6 .   ? 60.389 -25.112 11.762  1.00 27.14 ? 504 GOL A C1    1 
HETATM 3825 O  O1    . GOL G 6 .   ? 59.275 -24.591 12.426  1.00 16.09 ? 504 GOL A O1    1 
HETATM 3826 C  C2    . GOL G 6 .   ? 60.384 -24.543 10.354  1.00 27.58 ? 504 GOL A C2    1 
HETATM 3827 O  O2    . GOL G 6 .   ? 60.570 -23.151 10.458  1.00 17.77 ? 504 GOL A O2    1 
HETATM 3828 C  C3    . GOL G 6 .   ? 61.511 -25.186 9.549   1.00 24.96 ? 504 GOL A C3    1 
HETATM 3829 O  O3    . GOL G 6 .   ? 61.398 -24.823 8.195   1.00 20.53 ? 504 GOL A O3    1 
HETATM 3830 C  C1    . GOL H 6 .   ? 54.097 28.052  4.682   1.00 29.86 ? 505 GOL A C1    1 
HETATM 3831 O  O1    . GOL H 6 .   ? 52.753 27.776  4.321   1.00 25.32 ? 505 GOL A O1    1 
HETATM 3832 C  C2    . GOL H 6 .   ? 54.634 26.989  5.645   1.00 34.09 ? 505 GOL A C2    1 
HETATM 3833 O  O2    . GOL H 6 .   ? 53.960 25.758  5.456   1.00 36.20 ? 505 GOL A O2    1 
HETATM 3834 C  C3    . GOL H 6 .   ? 56.126 26.788  5.404   1.00 30.56 ? 505 GOL A C3    1 
HETATM 3835 O  O3    . GOL H 6 .   ? 56.719 26.018  6.440   1.00 24.90 ? 505 GOL A O3    1 
HETATM 3836 P  PG    . DTP I 7 .   ? 55.118 2.717   7.282   1.00 12.52 ? 506 DTP A PG    1 
HETATM 3837 O  O1G   . DTP I 7 .   ? 55.038 2.054   5.942   1.00 12.66 ? 506 DTP A O1G   1 
HETATM 3838 O  O2G   . DTP I 7 .   ? 56.476 3.349   7.497   1.00 11.71 ? 506 DTP A O2G   1 
HETATM 3839 O  O3G   . DTP I 7 .   ? 54.765 1.757   8.423   1.00 12.41 ? 506 DTP A O3G   1 
HETATM 3840 P  PB    . DTP I 7 .   ? 52.989 4.235   6.181   1.00 11.74 ? 506 DTP A PB    1 
HETATM 3841 O  O1B   . DTP I 7 .   ? 53.714 4.415   4.875   1.00 11.03 ? 506 DTP A O1B   1 
HETATM 3842 O  O2B   . DTP I 7 .   ? 52.244 5.478   6.604   1.00 12.13 ? 506 DTP A O2B   1 
HETATM 3843 O  O3B   . DTP I 7 .   ? 54.018 3.876   7.362   1.00 10.79 ? 506 DTP A O3B   1 
HETATM 3844 P  PA    . DTP I 7 .   ? 51.419 2.200   4.929   1.00 13.33 ? 506 DTP A PA    1 
HETATM 3845 O  O1A   . DTP I 7 .   ? 52.532 1.696   4.068   1.00 15.10 ? 506 DTP A O1A   1 
HETATM 3846 O  O2A   . DTP I 7 .   ? 50.606 1.081   5.543   1.00 15.53 ? 506 DTP A O2A   1 
HETATM 3847 O  O3A   . DTP I 7 .   ? 51.952 3.035   6.171   1.00 12.91 ? 506 DTP A O3A   1 
HETATM 3848 O  "O5'" . DTP I 7 .   ? 50.396 3.089   4.109   1.00 11.62 ? 506 DTP A "O5'" 1 
HETATM 3849 C  "C5'" . DTP I 7 .   ? 50.845 4.025   3.177   1.00 13.57 ? 506 DTP A "C5'" 1 
HETATM 3850 C  "C4'" . DTP I 7 .   ? 49.922 5.238   3.194   1.00 9.91  ? 506 DTP A "C4'" 1 
HETATM 3851 O  "O4'" . DTP I 7 .   ? 48.635 4.816   2.780   1.00 13.59 ? 506 DTP A "O4'" 1 
HETATM 3852 C  "C3'" . DTP I 7 .   ? 49.793 5.820   4.519   1.00 9.76  ? 506 DTP A "C3'" 1 
HETATM 3853 O  "O3'" . DTP I 7 .   ? 50.803 6.834   4.715   1.00 10.84 ? 506 DTP A "O3'" 1 
HETATM 3854 C  "C2'" . DTP I 7 .   ? 48.434 6.397   4.539   1.00 12.56 ? 506 DTP A "C2'" 1 
HETATM 3855 C  "C1'" . DTP I 7 .   ? 47.685 5.493   3.621   1.00 13.74 ? 506 DTP A "C1'" 1 
HETATM 3856 N  N9    . DTP I 7 .   ? 46.937 4.514   4.335   1.00 13.31 ? 506 DTP A N9    1 
HETATM 3857 C  C8    . DTP I 7 .   ? 47.370 3.331   4.835   1.00 14.83 ? 506 DTP A C8    1 
HETATM 3858 N  N7    . DTP I 7 .   ? 46.371 2.680   5.432   1.00 15.18 ? 506 DTP A N7    1 
HETATM 3859 C  C5    . DTP I 7 .   ? 45.257 3.413   5.307   1.00 14.59 ? 506 DTP A C5    1 
HETATM 3860 C  C6    . DTP I 7 .   ? 43.931 3.273   5.694   1.00 16.27 ? 506 DTP A C6    1 
HETATM 3861 N  N6    . DTP I 7 .   ? 43.506 2.123   6.415   1.00 15.72 ? 506 DTP A N6    1 
HETATM 3862 N  N1    . DTP I 7 .   ? 43.055 4.228   5.409   1.00 15.26 ? 506 DTP A N1    1 
HETATM 3863 C  C2    . DTP I 7 .   ? 43.387 5.345   4.738   1.00 14.44 ? 506 DTP A C2    1 
HETATM 3864 N  N3    . DTP I 7 .   ? 44.672 5.512   4.334   1.00 13.44 ? 506 DTP A N3    1 
HETATM 3865 C  C4    . DTP I 7 .   ? 45.597 4.578   4.606   1.00 11.77 ? 506 DTP A C4    1 
HETATM 3866 K  K     B K   J 8 .   ? 52.603 0.293   2.111   0.10 16.96 ? 507 K   A K     1 
HETATM 3867 O  O     . HOH K 9 .   ? 80.312 -16.048 7.438   1.00 31.95 ? 601 HOH A O     1 
HETATM 3868 O  O     . HOH K 9 .   ? 52.952 24.162  4.123   1.00 30.09 ? 602 HOH A O     1 
HETATM 3869 O  O     . HOH K 9 .   ? 62.648 9.552   -13.262 1.00 31.41 ? 603 HOH A O     1 
HETATM 3870 O  O     . HOH K 9 .   ? 57.470 12.065  -12.255 1.00 30.60 ? 604 HOH A O     1 
HETATM 3871 O  O     . HOH K 9 .   ? 68.116 -15.701 -7.751  1.00 24.02 ? 605 HOH A O     1 
HETATM 3872 O  O     . HOH K 9 .   ? 57.054 -34.675 8.615   1.00 29.81 ? 606 HOH A O     1 
HETATM 3873 O  O     . HOH K 9 .   ? 30.492 1.339   3.321   1.00 36.57 ? 607 HOH A O     1 
HETATM 3874 O  O     . HOH K 9 .   ? 60.128 -27.845 8.968   1.00 27.41 ? 608 HOH A O     1 
HETATM 3875 O  O     . HOH K 9 .   ? 37.220 15.029  -20.334 1.00 36.04 ? 609 HOH A O     1 
HETATM 3876 O  O     . HOH K 9 .   ? 43.652 -33.024 5.825   1.00 31.18 ? 610 HOH A O     1 
HETATM 3877 O  O     . HOH K 9 .   ? 24.651 -7.940  -0.860  1.00 46.86 ? 611 HOH A O     1 
HETATM 3878 O  O     . HOH K 9 .   ? 48.272 -36.655 2.591   1.00 23.49 ? 612 HOH A O     1 
HETATM 3879 O  O     . HOH K 9 .   ? 48.018 -33.235 -3.534  1.00 27.41 ? 613 HOH A O     1 
HETATM 3880 O  O     . HOH K 9 .   ? 49.412 -9.271  -8.347  1.00 24.60 ? 614 HOH A O     1 
HETATM 3881 O  O     . HOH K 9 .   ? 40.921 14.006  -6.270  1.00 28.58 ? 615 HOH A O     1 
HETATM 3882 O  O     . HOH K 9 .   ? 34.111 5.960   -21.679 1.00 27.48 ? 616 HOH A O     1 
HETATM 3883 O  O     . HOH K 9 .   ? 65.120 -6.762  -13.878 1.00 21.78 ? 617 HOH A O     1 
HETATM 3884 O  O     . HOH K 9 .   ? 36.864 15.973  -4.192  1.00 22.00 ? 618 HOH A O     1 
HETATM 3885 O  O     . HOH K 9 .   ? 70.069 0.614   11.411  1.00 29.51 ? 619 HOH A O     1 
HETATM 3886 O  O     . HOH K 9 .   ? 60.932 20.812  11.796  1.00 29.41 ? 620 HOH A O     1 
HETATM 3887 O  O     . HOH K 9 .   ? 34.725 5.586   2.097   1.00 18.89 ? 621 HOH A O     1 
HETATM 3888 O  O     . HOH K 9 .   ? 45.455 18.255  -3.543  1.00 32.62 ? 622 HOH A O     1 
HETATM 3889 O  O     . HOH K 9 .   ? 50.458 17.655  -5.667  1.00 29.02 ? 623 HOH A O     1 
HETATM 3890 O  O     . HOH K 9 .   ? 42.869 -25.539 17.312  1.00 31.14 ? 624 HOH A O     1 
HETATM 3891 O  O     . HOH K 9 .   ? 40.249 8.797   27.029  1.00 21.29 ? 625 HOH A O     1 
HETATM 3892 O  O     . HOH K 9 .   ? 60.126 6.158   -15.615 1.00 26.39 ? 626 HOH A O     1 
HETATM 3893 O  O     . HOH K 9 .   ? 27.557 6.720   -16.981 1.00 29.65 ? 627 HOH A O     1 
HETATM 3894 O  O     . HOH K 9 .   ? 31.597 -1.041  -2.721  1.00 33.18 ? 628 HOH A O     1 
HETATM 3895 O  O     . HOH K 9 .   ? 60.790 -15.690 13.702  1.00 29.34 ? 629 HOH A O     1 
HETATM 3896 O  O     . HOH K 9 .   ? 63.113 -17.470 15.248  1.00 34.38 ? 630 HOH A O     1 
HETATM 3897 O  O     . HOH K 9 .   ? 56.145 -13.892 -5.841  1.00 14.65 ? 631 HOH A O     1 
HETATM 3898 O  O     . HOH K 9 .   ? 22.028 -4.282  3.382   1.00 46.34 ? 632 HOH A O     1 
HETATM 3899 O  O     . HOH K 9 .   ? 48.263 -6.121  -11.757 1.00 34.29 ? 633 HOH A O     1 
HETATM 3900 O  O     . HOH K 9 .   ? 53.011 19.488  -1.514  1.00 25.51 ? 634 HOH A O     1 
HETATM 3901 O  O     . HOH K 9 .   ? 53.784 15.351  -6.612  1.00 17.07 ? 635 HOH A O     1 
HETATM 3902 O  O     . HOH K 9 .   ? 63.075 -26.428 7.011   1.00 20.09 ? 636 HOH A O     1 
HETATM 3903 O  O     . HOH K 9 .   ? 48.001 10.888  -13.641 1.00 28.85 ? 637 HOH A O     1 
HETATM 3904 O  O     . HOH K 9 .   ? 52.447 1.344   9.553   1.00 15.31 ? 638 HOH A O     1 
HETATM 3905 O  O     . HOH K 9 .   ? 37.195 13.650  21.538  1.00 34.04 ? 639 HOH A O     1 
HETATM 3906 O  O     . HOH K 9 .   ? 60.445 -0.279  -16.260 1.00 35.87 ? 640 HOH A O     1 
HETATM 3907 O  O     . HOH K 9 .   ? 41.201 16.911  -14.688 1.00 21.96 ? 641 HOH A O     1 
HETATM 3908 O  O     . HOH K 9 .   ? 60.645 -23.435 6.111   1.00 18.88 ? 642 HOH A O     1 
HETATM 3909 O  O     . HOH K 9 .   ? 52.151 20.175  5.015   1.00 18.04 ? 643 HOH A O     1 
HETATM 3910 O  O     . HOH K 9 .   ? 52.403 3.652   17.878  1.00 26.10 ? 644 HOH A O     1 
HETATM 3911 O  O     . HOH K 9 .   ? 52.515 -19.567 22.114  1.00 32.96 ? 645 HOH A O     1 
HETATM 3912 O  O     . HOH K 9 .   ? 39.355 -2.081  -14.147 1.00 27.00 ? 646 HOH A O     1 
HETATM 3913 O  O     . HOH K 9 .   ? 56.982 -16.354 -11.269 1.00 22.47 ? 647 HOH A O     1 
HETATM 3914 O  O     . HOH K 9 .   ? 49.878 -27.738 18.478  1.00 26.89 ? 648 HOH A O     1 
HETATM 3915 O  O     . HOH K 9 .   ? 72.108 -7.713  11.558  1.00 18.96 ? 649 HOH A O     1 
HETATM 3916 O  O     . HOH K 9 .   ? 48.981 2.767   21.176  1.00 24.95 ? 650 HOH A O     1 
HETATM 3917 O  O     . HOH K 9 .   ? 32.864 10.725  5.438   1.00 22.72 ? 651 HOH A O     1 
HETATM 3918 O  O     . HOH K 9 .   ? 53.107 -28.147 15.288  1.00 18.29 ? 652 HOH A O     1 
HETATM 3919 O  O     . HOH K 9 .   ? 62.892 12.778  -10.762 1.00 23.70 ? 653 HOH A O     1 
HETATM 3920 O  O     . HOH K 9 .   ? 64.911 -34.579 -5.887  1.00 33.32 ? 654 HOH A O     1 
HETATM 3921 O  O     . HOH K 9 .   ? 65.369 12.857  2.874   1.00 29.01 ? 655 HOH A O     1 
HETATM 3922 O  O     . HOH K 9 .   ? 69.490 -13.072 -11.554 1.00 27.94 ? 656 HOH A O     1 
HETATM 3923 O  O     . HOH K 9 .   ? 77.554 3.241   -1.195  1.00 41.53 ? 657 HOH A O     1 
HETATM 3924 O  O     . HOH K 9 .   ? 36.036 -0.740  -24.346 1.00 43.72 ? 658 HOH A O     1 
HETATM 3925 O  O     . HOH K 9 .   ? 52.610 -26.221 -3.891  1.00 22.19 ? 659 HOH A O     1 
HETATM 3926 O  O     . HOH K 9 .   ? 39.028 4.700   15.622  1.00 33.69 ? 660 HOH A O     1 
HETATM 3927 O  O     . HOH K 9 .   ? 55.185 1.642   -17.111 1.00 38.77 ? 661 HOH A O     1 
HETATM 3928 O  O     . HOH K 9 .   ? 52.312 -5.622  -0.829  1.00 21.14 ? 662 HOH A O     1 
HETATM 3929 O  O     . HOH K 9 .   ? 69.315 9.911   -8.744  1.00 24.90 ? 663 HOH A O     1 
HETATM 3930 O  O     . HOH K 9 .   ? 53.777 15.606  23.266  1.00 30.08 ? 664 HOH A O     1 
HETATM 3931 O  O     . HOH K 9 .   ? 58.162 -17.951 19.680  1.00 22.30 ? 665 HOH A O     1 
HETATM 3932 O  O     . HOH K 9 .   ? 59.637 13.920  -8.715  1.00 18.98 ? 666 HOH A O     1 
HETATM 3933 O  O     . HOH K 9 .   ? 40.614 16.837  6.348   1.00 22.75 ? 667 HOH A O     1 
HETATM 3934 O  O     . HOH K 9 .   ? 74.930 0.238   -3.864  1.00 27.03 ? 668 HOH A O     1 
HETATM 3935 O  O     . HOH K 9 .   ? 47.649 -26.837 -7.154  1.00 30.18 ? 669 HOH A O     1 
HETATM 3936 O  O     . HOH K 9 .   ? 53.578 -32.277 -2.852  1.00 32.55 ? 670 HOH A O     1 
HETATM 3937 O  O     . HOH K 9 .   ? 59.557 13.043  11.396  1.00 25.06 ? 671 HOH A O     1 
HETATM 3938 O  O     . HOH K 9 .   ? 51.082 6.363   -18.864 1.00 31.08 ? 672 HOH A O     1 
HETATM 3939 O  O     . HOH K 9 .   ? 70.299 -17.096 12.381  1.00 24.94 ? 673 HOH A O     1 
HETATM 3940 O  O     . HOH K 9 .   ? 53.455 6.076   -12.244 1.00 22.22 ? 674 HOH A O     1 
HETATM 3941 O  O     . HOH K 9 .   ? 46.717 4.197   7.672   1.00 26.22 ? 675 HOH A O     1 
HETATM 3942 O  O     . HOH K 9 .   ? 71.813 -3.936  -13.931 1.00 28.40 ? 676 HOH A O     1 
HETATM 3943 O  O     . HOH K 9 .   ? 58.131 -12.057 -11.443 1.00 15.52 ? 677 HOH A O     1 
HETATM 3944 O  O     . HOH K 9 .   ? 46.621 16.345  25.409  1.00 24.23 ? 678 HOH A O     1 
HETATM 3945 O  O     . HOH K 9 .   ? 53.587 -28.408 4.216   1.00 15.34 ? 679 HOH A O     1 
HETATM 3946 O  O     . HOH K 9 .   ? 50.247 -12.921 -0.765  1.00 23.21 ? 680 HOH A O     1 
HETATM 3947 O  O     . HOH K 9 .   ? 58.872 27.060  7.681   1.00 26.68 ? 681 HOH A O     1 
HETATM 3948 O  O     . HOH K 9 .   ? 33.448 7.508   17.214  1.00 39.65 ? 682 HOH A O     1 
HETATM 3949 O  O     . HOH K 9 .   ? 50.981 0.489   -15.971 1.00 25.67 ? 683 HOH A O     1 
HETATM 3950 O  O     . HOH K 9 .   ? 62.405 -17.055 -7.081  1.00 24.19 ? 684 HOH A O     1 
HETATM 3951 O  O     . HOH K 9 .   ? 46.973 -22.607 17.419  1.00 25.53 ? 685 HOH A O     1 
HETATM 3952 O  O     . HOH K 9 .   ? 34.544 17.512  -12.776 1.00 27.35 ? 686 HOH A O     1 
HETATM 3953 O  O     . HOH K 9 .   ? 62.202 14.773  -9.134  1.00 14.33 ? 687 HOH A O     1 
HETATM 3954 O  O     . HOH K 9 .   ? 70.837 3.514   -0.414  1.00 16.92 ? 688 HOH A O     1 
HETATM 3955 O  O     . HOH K 9 .   ? 65.312 5.828   2.185   1.00 20.80 ? 689 HOH A O     1 
HETATM 3956 O  O     . HOH K 9 .   ? 63.467 -11.556 12.659  1.00 36.92 ? 690 HOH A O     1 
HETATM 3957 O  O     . HOH K 9 .   ? 40.920 -29.849 12.928  1.00 27.73 ? 691 HOH A O     1 
HETATM 3958 O  O     . HOH K 9 .   ? 63.828 -3.354  6.048   1.00 12.54 ? 692 HOH A O     1 
HETATM 3959 O  O     . HOH K 9 .   ? 61.326 -31.634 -10.387 1.00 40.34 ? 693 HOH A O     1 
HETATM 3960 O  O     . HOH K 9 .   ? 57.760 -7.413  8.254   1.00 19.76 ? 694 HOH A O     1 
HETATM 3961 O  O     . HOH K 9 .   ? 40.976 7.599   -18.520 1.00 17.68 ? 695 HOH A O     1 
HETATM 3962 O  O     . HOH K 9 .   ? 65.625 -15.130 11.614  1.00 19.18 ? 696 HOH A O     1 
HETATM 3963 O  O     . HOH K 9 .   ? 43.216 -33.157 -0.493  1.00 19.97 ? 697 HOH A O     1 
HETATM 3964 O  O     . HOH K 9 .   ? 51.821 5.813   9.269   1.00 13.59 ? 698 HOH A O     1 
HETATM 3965 O  O     . HOH K 9 .   ? 67.182 -20.699 8.759   1.00 13.20 ? 699 HOH A O     1 
HETATM 3966 O  O     . HOH K 9 .   ? 50.081 -14.717 -3.278  1.00 36.73 ? 700 HOH A O     1 
HETATM 3967 O  O     . HOH K 9 .   ? 52.079 15.807  -4.617  1.00 16.42 ? 701 HOH A O     1 
HETATM 3968 O  O     . HOH K 9 .   ? 66.357 3.845   10.635  1.00 27.05 ? 702 HOH A O     1 
HETATM 3969 O  O     . HOH K 9 .   ? 78.952 3.267   1.812   1.00 32.07 ? 703 HOH A O     1 
HETATM 3970 O  O     . HOH K 9 .   ? 41.327 15.601  -22.770 1.00 27.51 ? 704 HOH A O     1 
HETATM 3971 O  O     . HOH K 9 .   ? 61.324 -17.680 -13.010 1.00 37.08 ? 705 HOH A O     1 
HETATM 3972 O  O     . HOH K 9 .   ? 45.400 15.814  -1.465  1.00 16.51 ? 706 HOH A O     1 
HETATM 3973 O  O     . HOH K 9 .   ? 45.467 2.055   17.988  1.00 30.03 ? 707 HOH A O     1 
HETATM 3974 O  O     . HOH K 9 .   ? 30.658 1.728   -22.056 1.00 30.30 ? 708 HOH A O     1 
HETATM 3975 O  O     . HOH K 9 .   ? 49.573 -15.773 -8.848  1.00 30.01 ? 709 HOH A O     1 
HETATM 3976 O  O     . HOH K 9 .   ? 64.116 -24.314 -7.977  1.00 37.87 ? 710 HOH A O     1 
HETATM 3977 O  O     . HOH K 9 .   ? 60.384 13.923  6.317   1.00 25.41 ? 711 HOH A O     1 
HETATM 3978 O  O     . HOH K 9 .   ? 46.595 19.435  1.552   1.00 24.84 ? 712 HOH A O     1 
HETATM 3979 O  O     . HOH K 9 .   ? 62.236 7.417   7.065   1.00 13.58 ? 713 HOH A O     1 
HETATM 3980 O  O     . HOH K 9 .   ? 47.410 15.886  -17.647 1.00 31.99 ? 714 HOH A O     1 
HETATM 3981 O  O     . HOH K 9 .   ? 49.955 -17.184 15.505  1.00 17.80 ? 715 HOH A O     1 
HETATM 3982 O  O     . HOH K 9 .   ? 57.648 -23.311 14.221  1.00 11.50 ? 716 HOH A O     1 
HETATM 3983 O  O     . HOH K 9 .   ? 62.735 -23.439 3.500   1.00 21.98 ? 717 HOH A O     1 
HETATM 3984 O  O     . HOH K 9 .   ? 55.893 18.812  18.315  1.00 21.00 ? 718 HOH A O     1 
HETATM 3985 O  O     . HOH K 9 .   ? 65.278 -9.089  12.360  1.00 36.24 ? 719 HOH A O     1 
HETATM 3986 O  O     . HOH K 9 .   ? 68.915 -17.535 -1.311  1.00 13.24 ? 720 HOH A O     1 
HETATM 3987 O  O     . HOH K 9 .   ? 46.903 -0.344  -8.370  1.00 26.01 ? 721 HOH A O     1 
HETATM 3988 O  O     . HOH K 9 .   ? 62.215 11.856  5.405   1.00 27.25 ? 722 HOH A O     1 
HETATM 3989 O  O     . HOH K 9 .   ? 63.073 -18.949 -1.584  1.00 18.52 ? 723 HOH A O     1 
HETATM 3990 O  O     . HOH K 9 .   ? 42.819 -1.468  -24.833 1.00 26.22 ? 724 HOH A O     1 
HETATM 3991 O  O     . HOH K 9 .   ? 23.160 14.462  -9.256  1.00 29.28 ? 725 HOH A O     1 
HETATM 3992 O  O     . HOH K 9 .   ? 76.172 1.408   -5.613  1.00 33.25 ? 726 HOH A O     1 
HETATM 3993 O  O     . HOH K 9 .   ? 40.975 6.532   18.979  1.00 21.40 ? 727 HOH A O     1 
HETATM 3994 O  O     . HOH K 9 .   ? 51.134 5.132   -10.799 1.00 21.58 ? 728 HOH A O     1 
HETATM 3995 O  O     . HOH K 9 .   ? 77.915 -0.936  5.199   1.00 24.17 ? 729 HOH A O     1 
HETATM 3996 O  O     . HOH K 9 .   ? 48.792 -34.489 10.133  1.00 31.57 ? 730 HOH A O     1 
HETATM 3997 O  O     . HOH K 9 .   ? 54.516 -0.650  5.819   1.00 21.28 ? 731 HOH A O     1 
HETATM 3998 O  O     . HOH K 9 .   ? 42.023 -18.886 14.918  1.00 26.51 ? 732 HOH A O     1 
HETATM 3999 O  O     . HOH K 9 .   ? 68.921 -13.448 5.105   1.00 11.94 ? 733 HOH A O     1 
HETATM 4000 O  O     . HOH K 9 .   ? 49.687 -8.985  13.011  1.00 28.51 ? 734 HOH A O     1 
HETATM 4001 O  O     . HOH K 9 .   ? 67.492 -6.480  12.621  1.00 23.45 ? 735 HOH A O     1 
HETATM 4002 O  O     . HOH K 9 .   ? 70.464 -19.004 1.387   1.00 16.15 ? 736 HOH A O     1 
HETATM 4003 O  O     . HOH K 9 .   ? 59.711 11.428  -10.331 1.00 17.44 ? 737 HOH A O     1 
HETATM 4004 O  O     . HOH K 9 .   ? 41.640 -30.421 -6.412  1.00 20.54 ? 738 HOH A O     1 
HETATM 4005 O  O     . HOH K 9 .   ? 72.941 2.177   7.894   1.00 26.51 ? 739 HOH A O     1 
HETATM 4006 O  O     . HOH K 9 .   ? 43.860 11.110  -12.273 1.00 20.67 ? 740 HOH A O     1 
HETATM 4007 O  O     . HOH K 9 .   ? 42.323 13.047  -23.731 1.00 26.76 ? 741 HOH A O     1 
HETATM 4008 O  O     . HOH K 9 .   ? 59.108 4.919   16.833  1.00 19.76 ? 742 HOH A O     1 
HETATM 4009 O  O     . HOH K 9 .   ? 40.212 -28.446 -9.830  1.00 29.54 ? 743 HOH A O     1 
HETATM 4010 O  O     . HOH K 9 .   ? 76.379 2.600   6.632   1.00 30.66 ? 744 HOH A O     1 
HETATM 4011 O  O     . HOH K 9 .   ? 43.354 12.095  -7.210  1.00 19.04 ? 745 HOH A O     1 
HETATM 4012 O  O     . HOH K 9 .   ? 50.924 -8.798  -5.123  1.00 23.88 ? 746 HOH A O     1 
HETATM 4013 O  O     . HOH K 9 .   ? 67.239 -8.173  9.825   1.00 22.63 ? 747 HOH A O     1 
HETATM 4014 O  O     . HOH K 9 .   ? 40.394 7.519   24.250  1.00 32.89 ? 748 HOH A O     1 
HETATM 4015 O  O     . HOH K 9 .   ? 51.385 -35.200 7.747   1.00 37.24 ? 749 HOH A O     1 
HETATM 4016 O  O     . HOH K 9 .   ? 58.719 4.555   22.945  1.00 25.96 ? 750 HOH A O     1 
HETATM 4017 O  O     . HOH K 9 .   ? 53.896 -9.389  5.335   1.00 19.15 ? 751 HOH A O     1 
HETATM 4018 O  O     . HOH K 9 .   ? 48.250 19.970  4.629   1.00 26.93 ? 752 HOH A O     1 
HETATM 4019 O  O     . HOH K 9 .   ? 50.839 5.510   -8.295  1.00 17.79 ? 753 HOH A O     1 
HETATM 4020 O  O     . HOH K 9 .   ? 41.160 21.508  2.285   1.00 22.22 ? 754 HOH A O     1 
HETATM 4021 O  O     . HOH K 9 .   ? 70.529 -15.892 7.753   1.00 16.54 ? 755 HOH A O     1 
HETATM 4022 O  O     . HOH K 9 .   ? 55.285 17.461  -0.670  1.00 13.89 ? 756 HOH A O     1 
HETATM 4023 O  O     . HOH K 9 .   ? 29.187 4.123   6.601   1.00 35.74 ? 757 HOH A O     1 
HETATM 4024 O  O     . HOH K 9 .   ? 49.299 17.484  -11.308 1.00 37.41 ? 758 HOH A O     1 
HETATM 4025 O  O     . HOH K 9 .   ? 68.601 16.256  -3.912  1.00 15.65 ? 759 HOH A O     1 
HETATM 4026 O  O     . HOH K 9 .   ? 64.211 6.579   -0.675  1.00 19.62 ? 760 HOH A O     1 
HETATM 4027 O  O     . HOH K 9 .   ? 65.280 -22.809 3.296   1.00 13.81 ? 761 HOH A O     1 
HETATM 4028 O  O     . HOH K 9 .   ? 49.113 -10.131 6.853   1.00 19.95 ? 762 HOH A O     1 
HETATM 4029 O  O     . HOH K 9 .   ? 43.479 -14.420 5.709   1.00 16.28 ? 763 HOH A O     1 
HETATM 4030 O  O     . HOH K 9 .   ? 65.517 -21.460 14.617  1.00 31.42 ? 764 HOH A O     1 
HETATM 4031 O  O     . HOH K 9 .   ? 69.458 -18.781 -9.473  1.00 34.62 ? 765 HOH A O     1 
HETATM 4032 O  O     . HOH K 9 .   ? 49.605 -3.104  -17.125 1.00 25.00 ? 766 HOH A O     1 
HETATM 4033 O  O     . HOH K 9 .   ? 48.358 -22.170 -5.616  1.00 22.04 ? 767 HOH A O     1 
HETATM 4034 O  O     . HOH K 9 .   ? 45.055 16.981  -18.047 1.00 29.38 ? 768 HOH A O     1 
HETATM 4035 O  O     . HOH K 9 .   ? 42.428 15.412  23.616  1.00 24.14 ? 769 HOH A O     1 
HETATM 4036 O  O     . HOH K 9 .   ? 52.602 -12.524 -3.827  1.00 27.85 ? 770 HOH A O     1 
HETATM 4037 O  O     . HOH K 9 .   ? 63.163 -7.412  12.814  1.00 25.24 ? 771 HOH A O     1 
HETATM 4038 O  O     . HOH K 9 .   ? 48.783 -9.403  10.566  1.00 24.58 ? 772 HOH A O     1 
HETATM 4039 O  O     . HOH K 9 .   ? 83.567 -5.250  2.331   1.00 31.58 ? 773 HOH A O     1 
HETATM 4040 O  O     . HOH K 9 .   ? 46.171 0.524   7.218   1.00 27.07 ? 774 HOH A O     1 
HETATM 4041 O  O     . HOH K 9 .   ? 72.036 2.114   12.089  1.00 33.54 ? 775 HOH A O     1 
HETATM 4042 O  O     . HOH K 9 .   ? 56.077 1.233   13.355  1.00 28.39 ? 776 HOH A O     1 
HETATM 4043 O  O     . HOH K 9 .   ? 38.362 -17.940 10.269  1.00 22.71 ? 777 HOH A O     1 
HETATM 4044 O  O     . HOH K 9 .   ? 52.437 8.568   25.734  1.00 29.68 ? 778 HOH A O     1 
HETATM 4045 O  O     . HOH K 9 .   ? 44.244 7.315   2.212   1.00 18.29 ? 779 HOH A O     1 
HETATM 4046 O  O     . HOH K 9 .   ? 44.699 -14.230 10.495  1.00 16.61 ? 780 HOH A O     1 
HETATM 4047 O  O     . HOH K 9 .   ? 49.861 3.117   12.653  1.00 19.22 ? 781 HOH A O     1 
HETATM 4048 O  O     . HOH K 9 .   ? 33.657 3.134   2.996   1.00 31.34 ? 782 HOH A O     1 
HETATM 4049 O  O     . HOH K 9 .   ? 60.168 -18.405 -4.652  1.00 14.34 ? 783 HOH A O     1 
HETATM 4050 O  O     . HOH K 9 .   ? 45.884 7.443   -12.773 1.00 29.35 ? 784 HOH A O     1 
HETATM 4051 O  O     . HOH K 9 .   ? 64.890 19.873  6.557   1.00 28.82 ? 785 HOH A O     1 
HETATM 4052 O  O     . HOH K 9 .   ? 66.885 -16.527 9.725   1.00 15.51 ? 786 HOH A O     1 
HETATM 4053 O  O     . HOH K 9 .   ? 51.084 8.669   -15.326 1.00 27.52 ? 787 HOH A O     1 
HETATM 4054 O  O     . HOH K 9 .   ? 59.119 11.102  8.578   1.00 17.89 ? 788 HOH A O     1 
HETATM 4055 O  O     . HOH K 9 .   ? 34.429 14.818  11.372  1.00 22.43 ? 789 HOH A O     1 
HETATM 4056 O  O     . HOH K 9 .   ? 53.196 7.335   -14.676 1.00 26.54 ? 790 HOH A O     1 
HETATM 4057 O  O     . HOH K 9 .   ? 43.782 -15.047 1.483   1.00 17.88 ? 791 HOH A O     1 
HETATM 4058 O  O     . HOH K 9 .   ? 63.740 -9.432  -14.408 1.00 21.58 ? 792 HOH A O     1 
HETATM 4059 O  O     . HOH K 9 .   ? 47.105 13.965  -11.036 1.00 31.13 ? 793 HOH A O     1 
HETATM 4060 O  O     . HOH K 9 .   ? 32.946 2.571   -0.237  1.00 29.47 ? 794 HOH A O     1 
HETATM 4061 O  O     . HOH K 9 .   ? 67.398 6.436   0.677   1.00 24.23 ? 795 HOH A O     1 
HETATM 4062 O  O     . HOH K 9 .   ? 52.877 -33.355 -0.168  1.00 23.39 ? 796 HOH A O     1 
HETATM 4063 O  O     . HOH K 9 .   ? 71.260 6.047   -7.318  1.00 20.11 ? 797 HOH A O     1 
HETATM 4064 O  O     . HOH K 9 .   ? 50.285 -34.583 -0.751  1.00 23.16 ? 798 HOH A O     1 
HETATM 4065 O  O     . HOH K 9 .   ? 77.624 -16.713 10.544  1.00 34.21 ? 799 HOH A O     1 
HETATM 4066 O  O     . HOH K 9 .   ? 47.264 -16.495 -0.719  1.00 24.99 ? 800 HOH A O     1 
HETATM 4067 O  O     . HOH K 9 .   ? 57.896 -27.411 11.436  1.00 23.18 ? 801 HOH A O     1 
HETATM 4068 O  O     . HOH K 9 .   ? 41.959 -22.387 -2.665  1.00 17.21 ? 802 HOH A O     1 
HETATM 4069 O  O     . HOH K 9 .   ? 36.810 18.409  16.999  1.00 38.23 ? 803 HOH A O     1 
HETATM 4070 O  O     . HOH K 9 .   ? 52.660 -1.159  3.808   1.00 20.01 ? 804 HOH A O     1 
HETATM 4071 O  O     . HOH K 9 .   ? 72.959 -7.306  8.895   1.00 16.44 ? 805 HOH A O     1 
HETATM 4072 O  O     . HOH K 9 .   ? 46.282 -0.315  -15.027 1.00 20.52 ? 806 HOH A O     1 
HETATM 4073 O  O     . HOH K 9 .   ? 61.846 -13.223 -13.549 1.00 29.79 ? 807 HOH A O     1 
HETATM 4074 O  O     . HOH K 9 .   ? 21.506 13.784  6.766   1.00 34.45 ? 808 HOH A O     1 
HETATM 4075 O  O     . HOH K 9 .   ? 42.282 15.487  -8.764  1.00 29.00 ? 809 HOH A O     1 
HETATM 4076 O  O     . HOH K 9 .   ? 53.406 -20.222 -2.434  1.00 17.42 ? 810 HOH A O     1 
HETATM 4077 O  O     . HOH K 9 .   ? 80.941 -10.874 -8.181  1.00 51.42 ? 811 HOH A O     1 
HETATM 4078 O  O     . HOH K 9 .   ? 41.177 -23.845 -5.004  1.00 22.03 ? 812 HOH A O     1 
HETATM 4079 O  O     . HOH K 9 .   ? 59.653 10.561  19.983  1.00 21.68 ? 813 HOH A O     1 
HETATM 4080 O  O     . HOH K 9 .   ? 38.181 -22.580 10.566  1.00 28.05 ? 814 HOH A O     1 
HETATM 4081 O  O     . HOH K 9 .   ? 36.333 12.780  12.087  1.00 19.47 ? 815 HOH A O     1 
HETATM 4082 O  O     . HOH K 9 .   ? 55.092 -1.073  -14.729 1.00 29.19 ? 816 HOH A O     1 
HETATM 4083 O  O     . HOH K 9 .   ? 68.995 4.477   3.751   1.00 18.81 ? 817 HOH A O     1 
HETATM 4084 O  O     . HOH K 9 .   ? 42.049 -9.012  9.683   1.00 30.11 ? 818 HOH A O     1 
HETATM 4085 O  O     . HOH K 9 .   ? 57.270 23.511  14.008  1.00 31.78 ? 819 HOH A O     1 
HETATM 4086 O  O     . HOH K 9 .   ? 70.796 6.428   7.802   1.00 31.66 ? 820 HOH A O     1 
HETATM 4087 O  O     . HOH K 9 .   ? 65.258 -22.291 -7.835  1.00 30.69 ? 821 HOH A O     1 
HETATM 4088 O  O     . HOH K 9 .   ? 45.169 -32.614 8.489   1.00 40.04 ? 822 HOH A O     1 
HETATM 4089 O  O     . HOH K 9 .   ? 74.707 -22.234 -6.587  1.00 36.71 ? 823 HOH A O     1 
HETATM 4090 O  O     . HOH K 9 .   ? 58.511 -30.410 -1.011  1.00 36.79 ? 824 HOH A O     1 
HETATM 4091 O  O     . HOH K 9 .   ? 47.122 2.434   -1.004  1.00 19.22 ? 825 HOH A O     1 
HETATM 4092 O  O     . HOH K 9 .   ? 44.214 10.260  -24.543 1.00 31.04 ? 826 HOH A O     1 
HETATM 4093 O  O     . HOH K 9 .   ? 55.395 -32.704 4.912   1.00 28.99 ? 827 HOH A O     1 
HETATM 4094 O  O     . HOH K 9 .   ? 68.657 -15.213 -14.785 1.00 39.83 ? 828 HOH A O     1 
HETATM 4095 O  O     . HOH K 9 .   ? 53.456 13.529  -10.017 1.00 20.00 ? 829 HOH A O     1 
HETATM 4096 O  O     . HOH K 9 .   ? 57.169 0.149   -14.693 1.00 25.67 ? 830 HOH A O     1 
HETATM 4097 O  O     . HOH K 9 .   ? 45.972 16.718  1.280   1.00 13.67 ? 831 HOH A O     1 
HETATM 4098 O  O     . HOH K 9 .   ? 65.619 8.752   8.975   1.00 33.69 ? 832 HOH A O     1 
HETATM 4099 O  O     . HOH K 9 .   ? 51.235 -33.864 10.215  1.00 31.43 ? 833 HOH A O     1 
HETATM 4100 O  O     . HOH K 9 .   ? 59.803 14.493  3.403   1.00 20.72 ? 834 HOH A O     1 
HETATM 4101 O  O     . HOH K 9 .   ? 18.741 14.476  6.237   1.00 39.66 ? 835 HOH A O     1 
HETATM 4102 O  O     . HOH K 9 .   ? 37.645 10.771  21.333  1.00 37.99 ? 836 HOH A O     1 
HETATM 4103 O  O     . HOH K 9 .   ? 53.331 -8.460  8.624   1.00 26.55 ? 837 HOH A O     1 
HETATM 4104 O  O     . HOH K 9 .   ? 80.496 -3.764  13.792  1.00 36.90 ? 838 HOH A O     1 
HETATM 4105 O  O     . HOH K 9 .   ? 40.557 -1.839  -16.376 1.00 29.11 ? 839 HOH A O     1 
HETATM 4106 O  O     . HOH K 9 .   ? 41.347 20.268  4.776   1.00 21.22 ? 840 HOH A O     1 
HETATM 4107 O  O     . HOH K 9 .   ? 73.166 -19.408 -2.839  1.00 25.60 ? 841 HOH A O     1 
HETATM 4108 O  O     . HOH K 9 .   ? 50.980 21.743  7.306   1.00 25.27 ? 842 HOH A O     1 
HETATM 4109 O  O     . HOH K 9 .   ? 44.875 0.556   -18.401 1.00 23.70 ? 843 HOH A O     1 
HETATM 4110 O  O     . HOH K 9 .   ? 48.848 -29.505 15.937  1.00 34.13 ? 844 HOH A O     1 
HETATM 4111 O  O     . HOH K 9 .   ? 61.633 -2.386  12.090  1.00 32.39 ? 845 HOH A O     1 
HETATM 4112 O  O     . HOH K 9 .   ? 20.449 18.088  -5.241  1.00 33.52 ? 846 HOH A O     1 
HETATM 4113 O  O     . HOH K 9 .   ? 48.896 7.333   -7.620  1.00 22.68 ? 847 HOH A O     1 
HETATM 4114 O  O     . HOH K 9 .   ? 56.159 -2.785  4.231   1.00 25.86 ? 848 HOH A O     1 
HETATM 4115 O  O     . HOH K 9 .   ? 19.891 10.184  8.823   1.00 39.42 ? 849 HOH A O     1 
HETATM 4116 O  O     . HOH K 9 .   ? 65.407 -25.919 0.484   1.00 27.23 ? 850 HOH A O     1 
HETATM 4117 O  O     . HOH K 9 .   ? 59.913 -17.864 -7.608  1.00 25.93 ? 851 HOH A O     1 
HETATM 4118 O  O     . HOH K 9 .   ? 68.972 -10.757 12.099  1.00 26.64 ? 852 HOH A O     1 
HETATM 4119 O  O     . HOH K 9 .   ? 83.534 -7.872  0.719   1.00 39.40 ? 853 HOH A O     1 
HETATM 4120 O  O     . HOH K 9 .   ? 48.924 -15.635 13.591  1.00 18.50 ? 854 HOH A O     1 
HETATM 4121 O  O     . HOH K 9 .   ? 61.738 1.861   13.990  1.00 37.79 ? 855 HOH A O     1 
HETATM 4122 O  O     . HOH K 9 .   ? 43.502 -28.637 15.666  1.00 36.85 ? 856 HOH A O     1 
HETATM 4123 O  O     . HOH K 9 .   ? 54.389 -11.282 3.448   1.00 15.91 ? 857 HOH A O     1 
HETATM 4124 O  O     . HOH K 9 .   ? 41.021 -3.109  -22.933 1.00 21.23 ? 858 HOH A O     1 
HETATM 4125 O  O     . HOH K 9 .   ? 40.446 -29.287 -2.117  1.00 24.56 ? 859 HOH A O     1 
HETATM 4126 O  O     . HOH K 9 .   ? 47.209 21.563  9.792   1.00 27.57 ? 860 HOH A O     1 
HETATM 4127 O  O     . HOH K 9 .   ? 68.174 -16.934 -11.898 1.00 34.74 ? 861 HOH A O     1 
HETATM 4128 O  O     . HOH K 9 .   ? 11.705 0.520   -4.169  1.00 46.48 ? 862 HOH A O     1 
HETATM 4129 O  O     . HOH K 9 .   ? 46.170 -9.431  11.026  1.00 34.92 ? 863 HOH A O     1 
HETATM 4130 O  O     . HOH K 9 .   ? 59.353 9.644   10.819  1.00 14.03 ? 864 HOH A O     1 
HETATM 4131 O  O     . HOH K 9 .   ? 55.170 2.696   20.964  1.00 27.00 ? 865 HOH A O     1 
HETATM 4132 O  O     . HOH K 9 .   ? 50.603 -6.512  -5.430  1.00 25.55 ? 866 HOH A O     1 
HETATM 4133 O  O     . HOH K 9 .   ? 43.326 9.723   -9.822  1.00 21.47 ? 867 HOH A O     1 
HETATM 4134 O  O     . HOH K 9 .   ? 35.252 22.510  -3.364  1.00 31.92 ? 868 HOH A O     1 
HETATM 4135 O  O     . HOH K 9 .   ? 36.691 21.643  4.732   1.00 32.03 ? 869 HOH A O     1 
HETATM 4136 O  O     . HOH K 9 .   ? 49.218 -14.900 18.503  1.00 31.79 ? 870 HOH A O     1 
HETATM 4137 O  O     . HOH K 9 .   ? 61.737 -6.735  -14.872 1.00 36.15 ? 871 HOH A O     1 
HETATM 4138 O  O     . HOH K 9 .   ? 59.422 -31.447 3.972   1.00 26.85 ? 872 HOH A O     1 
HETATM 4139 O  O     . HOH K 9 .   ? 61.626 15.789  2.173   1.00 28.87 ? 873 HOH A O     1 
HETATM 4140 O  O     . HOH K 9 .   ? 61.408 14.623  8.776   1.00 26.70 ? 874 HOH A O     1 
HETATM 4141 O  O     . HOH K 9 .   ? 43.159 -30.867 -10.433 1.00 32.83 ? 875 HOH A O     1 
HETATM 4142 O  O     . HOH K 9 .   ? 46.645 -14.566 14.914  1.00 29.23 ? 876 HOH A O     1 
HETATM 4143 O  O     . HOH K 9 .   ? 36.309 -2.938  -4.202  1.00 28.50 ? 877 HOH A O     1 
HETATM 4144 O  O     . HOH K 9 .   ? 69.671 -8.824  10.903  1.00 27.18 ? 878 HOH A O     1 
HETATM 4145 O  O     . HOH K 9 .   ? 50.708 15.656  -12.544 1.00 38.23 ? 879 HOH A O     1 
HETATM 4146 O  O     . HOH K 9 .   ? 53.584 17.268  -3.080  1.00 18.03 ? 880 HOH A O     1 
HETATM 4147 O  O     . HOH K 9 .   ? 61.679 -18.785 21.938  1.00 36.22 ? 881 HOH A O     1 
HETATM 4148 O  O     . HOH K 9 .   ? 35.267 20.784  0.685   1.00 25.80 ? 882 HOH A O     1 
HETATM 4149 O  O     . HOH K 9 .   ? 31.228 -5.625  1.696   1.00 43.67 ? 883 HOH A O     1 
HETATM 4150 O  O     . HOH K 9 .   ? 46.379 -18.614 -2.718  1.00 33.78 ? 884 HOH A O     1 
HETATM 4151 O  O     . HOH K 9 .   ? 28.857 8.175   -18.950 1.00 28.61 ? 885 HOH A O     1 
HETATM 4152 O  O     . HOH K 9 .   ? 39.904 6.925   13.509  1.00 26.08 ? 886 HOH A O     1 
HETATM 4153 O  O     . HOH K 9 .   ? 64.719 19.397  1.836   1.00 25.30 ? 887 HOH A O     1 
HETATM 4154 O  O     . HOH K 9 .   ? 39.275 18.546  18.060  1.00 29.46 ? 888 HOH A O     1 
HETATM 4155 O  O     . HOH K 9 .   ? 11.997 3.190   -5.278  1.00 51.10 ? 889 HOH A O     1 
HETATM 4156 O  O     . HOH K 9 .   ? 38.100 10.395  9.444   1.00 25.83 ? 890 HOH A O     1 
HETATM 4157 O  O     . HOH K 9 .   ? 65.280 -4.420  -15.316 1.00 25.64 ? 891 HOH A O     1 
HETATM 4158 O  O     . HOH K 9 .   ? 63.043 -4.750  -15.762 1.00 38.32 ? 892 HOH A O     1 
HETATM 4159 O  O     . HOH K 9 .   ? 67.827 -14.390 -10.167 1.00 26.15 ? 893 HOH A O     1 
HETATM 4160 O  O     . HOH K 9 .   ? 63.799 20.066  11.084  1.00 27.94 ? 894 HOH A O     1 
HETATM 4161 O  O     . HOH K 9 .   ? 51.329 -8.435  4.725   1.00 28.66 ? 895 HOH A O     1 
HETATM 4162 O  O     . HOH K 9 .   ? 67.471 -25.853 -6.481  1.00 40.02 ? 896 HOH A O     1 
HETATM 4163 O  O     . HOH K 9 .   ? 67.540 -5.286  -17.153 1.00 37.82 ? 897 HOH A O     1 
HETATM 4164 O  O     . HOH K 9 .   ? 37.066 -7.518  -18.100 1.00 38.32 ? 898 HOH A O     1 
HETATM 4165 O  O     . HOH K 9 .   ? 38.584 -3.619  -20.127 1.00 28.90 ? 899 HOH A O     1 
HETATM 4166 O  O     . HOH K 9 .   ? 38.878 21.318  5.819   1.00 24.35 ? 900 HOH A O     1 
HETATM 4167 O  O     . HOH K 9 .   ? 52.694 30.777  5.457   1.00 34.46 ? 901 HOH A O     1 
HETATM 4168 O  O     . HOH K 9 .   ? 25.539 14.801  5.136   1.00 28.70 ? 902 HOH A O     1 
HETATM 4169 O  O     . HOH K 9 .   ? 35.602 21.885  12.352  1.00 32.30 ? 903 HOH A O     1 
HETATM 4170 O  O     . HOH K 9 .   ? 49.044 8.399   -13.437 1.00 25.88 ? 904 HOH A O     1 
HETATM 4171 O  O     . HOH K 9 .   ? 52.893 -20.062 -5.026  1.00 24.11 ? 905 HOH A O     1 
HETATM 4172 O  O     . HOH K 9 .   ? 71.416 1.368   18.919  1.00 35.97 ? 906 HOH A O     1 
HETATM 4173 O  O     . HOH K 9 .   ? 50.428 10.967  -13.667 1.00 37.23 ? 907 HOH A O     1 
HETATM 4174 O  O     . HOH K 9 .   ? 61.650 24.202  9.793   1.00 28.02 ? 908 HOH A O     1 
HETATM 4175 O  O     . HOH K 9 .   ? 38.707 -19.884 12.275  1.00 29.86 ? 909 HOH A O     1 
HETATM 4176 O  O     . HOH K 9 .   ? 51.037 4.573   24.784  1.00 26.91 ? 910 HOH A O     1 
HETATM 4177 O  O     . HOH K 9 .   ? 57.171 -18.971 22.008  1.00 32.34 ? 911 HOH A O     1 
HETATM 4178 O  O     . HOH K 9 .   ? 42.784 17.213  -17.277 1.00 33.40 ? 912 HOH A O     1 
HETATM 4179 O  O     . HOH K 9 .   ? 61.606 7.940   16.196  1.00 29.13 ? 913 HOH A O     1 
HETATM 4180 O  O     . HOH K 9 .   ? 47.769 -18.893 -5.423  1.00 32.29 ? 914 HOH A O     1 
HETATM 4181 O  O     . HOH K 9 .   ? 69.855 -21.669 0.749   1.00 22.68 ? 915 HOH A O     1 
HETATM 4182 O  O     . HOH K 9 .   ? 61.927 -25.540 4.831   1.00 31.99 ? 916 HOH A O     1 
HETATM 4183 O  O     . HOH K 9 .   ? 47.753 10.666  -9.451  1.00 24.04 ? 917 HOH A O     1 
HETATM 4184 O  O     . HOH K 9 .   ? 46.956 15.974  -23.429 1.00 28.81 ? 918 HOH A O     1 
HETATM 4185 O  O     . HOH K 9 .   ? 61.129 9.959   7.276   1.00 26.35 ? 919 HOH A O     1 
HETATM 4186 O  O     . HOH K 9 .   ? 38.484 13.668  24.463  1.00 42.35 ? 920 HOH A O     1 
HETATM 4187 O  O     . HOH K 9 .   ? 67.963 -27.714 -7.723  1.00 44.32 ? 921 HOH A O     1 
HETATM 4188 O  O     . HOH K 9 .   ? 68.360 -21.428 -8.186  1.00 33.57 ? 922 HOH A O     1 
HETATM 4189 O  O     . HOH K 9 .   ? 64.293 -15.503 13.755  1.00 32.26 ? 923 HOH A O     1 
HETATM 4190 O  O     . HOH K 9 .   ? 50.757 -22.600 -5.688  1.00 30.93 ? 924 HOH A O     1 
HETATM 4191 O  O     . HOH K 9 .   ? 59.717 -29.180 -8.609  1.00 42.49 ? 925 HOH A O     1 
HETATM 4192 O  O     . HOH K 9 .   ? 55.273 -7.309  6.592   1.00 27.59 ? 926 HOH A O     1 
HETATM 4193 O  O     . HOH K 9 .   ? 40.014 -18.289 -1.445  1.00 30.23 ? 927 HOH A O     1 
HETATM 4194 O  O     . HOH K 9 .   ? 48.851 12.033  -11.528 1.00 26.61 ? 928 HOH A O     1 
HETATM 4195 O  O     . HOH K 9 .   ? 43.875 0.328   -20.889 1.00 26.83 ? 929 HOH A O     1 
HETATM 4196 O  O     . HOH K 9 .   ? 77.417 -17.132 8.177   1.00 35.91 ? 930 HOH A O     1 
HETATM 4197 O  O     . HOH K 9 .   ? 55.132 -17.326 -13.176 1.00 34.14 ? 931 HOH A O     1 
HETATM 4198 O  O     . HOH K 9 .   ? 33.695 22.578  -0.698  1.00 37.15 ? 932 HOH A O     1 
HETATM 4199 O  O     . HOH K 9 .   ? 49.563 26.171  3.039   1.00 30.50 ? 933 HOH A O     1 
HETATM 4200 O  O     . HOH K 9 .   ? 70.955 8.956   -6.924  1.00 30.13 ? 934 HOH A O     1 
HETATM 4201 O  O     . HOH K 9 .   ? 50.699 3.404   10.113  1.00 16.32 ? 935 HOH A O     1 
HETATM 4202 O  O     . HOH K 9 .   ? 73.180 4.634   -1.415  1.00 27.64 ? 936 HOH A O     1 
HETATM 4203 O  O     . HOH K 9 .   ? 39.572 4.544   18.096  1.00 37.09 ? 937 HOH A O     1 
HETATM 4204 O  O     . HOH K 9 .   ? 52.733 0.224   12.125  1.00 21.90 ? 938 HOH A O     1 
HETATM 4205 O  O     . HOH K 9 .   ? 42.485 5.308   20.912  1.00 38.97 ? 939 HOH A O     1 
HETATM 4206 O  O     . HOH K 9 .   ? 61.634 11.457  -12.258 1.00 25.81 ? 940 HOH A O     1 
HETATM 4207 O  O     . HOH K 9 .   ? 69.462 5.251   1.129   1.00 26.96 ? 941 HOH A O     1 
HETATM 4208 O  O     . HOH K 9 .   ? 67.721 1.799   12.165  1.00 30.33 ? 942 HOH A O     1 
HETATM 4209 O  O     . HOH K 9 .   ? 43.186 19.911  -11.902 1.00 34.31 ? 943 HOH A O     1 
HETATM 4210 O  O     . HOH K 9 .   ? 59.293 -27.946 -2.118  1.00 34.45 ? 944 HOH A O     1 
HETATM 4211 O  O     . HOH K 9 .   ? 61.696 12.176  9.501   1.00 32.41 ? 945 HOH A O     1 
HETATM 4212 O  O     . HOH K 9 .   ? 44.023 -1.569  -16.248 1.00 36.24 ? 946 HOH A O     1 
HETATM 4213 O  O     . HOH K 9 .   ? 34.687 13.987  21.781  1.00 37.36 ? 947 HOH A O     1 
HETATM 4214 O  O     . HOH K 9 .   ? 55.703 13.439  -11.409 1.00 23.51 ? 948 HOH A O     1 
HETATM 4215 O  O     . HOH K 9 .   ? 69.503 -10.080 14.644  1.00 41.64 ? 949 HOH A O     1 
HETATM 4216 O  O     . HOH K 9 .   ? 54.184 -34.785 1.310   1.00 31.21 ? 950 HOH A O     1 
HETATM 4217 O  O     . HOH K 9 .   ? 44.639 -14.727 13.175  1.00 36.40 ? 951 HOH A O     1 
HETATM 4218 O  O     . HOH K 9 .   ? 57.415 -14.352 -12.963 1.00 25.65 ? 952 HOH A O     1 
HETATM 4219 O  O     . HOH K 9 .   ? 50.151 0.851   19.969  1.00 29.86 ? 953 HOH A O     1 
HETATM 4220 O  O     . HOH K 9 .   ? 47.214 -20.176 18.649  1.00 29.39 ? 954 HOH A O     1 
HETATM 4221 O  O     . HOH K 9 .   ? 58.219 15.355  -10.623 1.00 24.82 ? 955 HOH A O     1 
HETATM 4222 O  O     . HOH K 9 .   ? 48.857 -0.281  -16.690 1.00 27.62 ? 956 HOH A O     1 
HETATM 4223 O  O     . HOH K 9 .   ? 52.094 2.499   -17.400 1.00 38.73 ? 957 HOH A O     1 
HETATM 4224 O  O     . HOH K 9 .   ? 51.316 13.439  -11.441 1.00 26.11 ? 958 HOH A O     1 
HETATM 4225 O  O     . HOH K 9 .   ? 61.484 9.148   18.990  1.00 31.27 ? 959 HOH A O     1 
HETATM 4226 O  O     . HOH K 9 .   ? 47.661 0.868   -18.867 1.00 26.88 ? 960 HOH A O     1 
HETATM 4227 O  O     . HOH K 9 .   ? 62.373 -29.420 -12.228 1.00 32.93 ? 961 HOH A O     1 
HETATM 4228 O  O     . HOH K 9 .   ? 47.344 7.823   -9.520  1.00 20.76 ? 962 HOH A O     1 
HETATM 4229 O  O     . HOH K 9 .   ? 67.817 -26.304 -0.442  1.00 32.25 ? 963 HOH A O     1 
HETATM 4230 O  O     . HOH K 9 .   ? 43.293 16.060  -10.758 1.00 35.60 ? 964 HOH A O     1 
HETATM 4231 O  O     . HOH K 9 .   ? 53.697 16.053  -9.250  1.00 25.67 ? 965 HOH A O     1 
HETATM 4232 O  O     . HOH K 9 .   ? 43.781 15.598  26.137  1.00 27.93 ? 966 HOH A O     1 
HETATM 4233 O  O     . HOH K 9 .   ? 55.903 -3.060  7.961   1.00 28.62 ? 967 HOH A O     1 
HETATM 4234 O  O     . HOH K 9 .   ? 38.859 18.602  -15.083 1.00 38.58 ? 968 HOH A O     1 
HETATM 4235 O  O     . HOH K 9 .   ? 56.236 21.499  18.241  1.00 27.19 ? 969 HOH A O     1 
HETATM 4236 O  O     . HOH K 9 .   ? 57.787 17.731  19.924  1.00 28.86 ? 970 HOH A O     1 
HETATM 4237 O  O     . HOH K 9 .   ? 46.172 1.950   20.529  1.00 34.31 ? 971 HOH A O     1 
HETATM 4238 O  O     . HOH K 9 .   ? 44.345 13.258  -10.491 1.00 32.85 ? 972 HOH A O     1 
HETATM 4239 O  O     . HOH K 9 .   ? 48.099 -17.942 17.174  1.00 30.50 ? 973 HOH A O     1 
HETATM 4240 O  O     . HOH K 9 .   ? 38.002 -15.746 11.985  1.00 32.81 ? 974 HOH A O     1 
HETATM 4241 O  O     . HOH K 9 .   ? 48.662 6.687   -11.646 1.00 20.80 ? 975 HOH A O     1 
HETATM 4242 O  O     . HOH K 9 .   ? 61.413 8.137   9.761   1.00 22.76 ? 976 HOH A O     1 
HETATM 4243 O  O     . HOH K 9 .   ? 43.184 17.855  22.755  1.00 39.16 ? 977 HOH A O     1 
HETATM 4244 O  O     . HOH K 9 .   ? 59.953 9.743   22.380  1.00 31.46 ? 978 HOH A O     1 
HETATM 4245 O  O     . HOH L 9 .   ? 37.847 -18.408 -8.639  1.00 38.32 ? 101 HOH T O     1 
HETATM 4246 O  O     . HOH L 9 .   ? 33.577 8.948   11.474  1.00 37.18 ? 102 HOH T O     1 
HETATM 4247 O  O     . HOH L 9 .   ? 41.458 -19.845 -3.327  1.00 25.37 ? 103 HOH T O     1 
HETATM 4248 O  O     . HOH L 9 .   ? 34.921 5.921   17.976  1.00 42.04 ? 104 HOH T O     1 
HETATM 4249 O  O     . HOH L 9 .   ? 42.973 5.530   -8.872  1.00 19.61 ? 105 HOH T O     1 
HETATM 4250 O  O     . HOH L 9 .   ? 37.163 0.356   -2.992  1.00 27.65 ? 106 HOH T O     1 
HETATM 4251 O  O     . HOH L 9 .   ? 30.699 5.262   8.747   1.00 38.42 ? 107 HOH T O     1 
HETATM 4252 O  O     . HOH L 9 .   ? 45.085 -5.053  -2.887  1.00 34.31 ? 108 HOH T O     1 
HETATM 4253 O  O     . HOH L 9 .   ? 36.304 -2.195  -1.208  1.00 27.58 ? 109 HOH T O     1 
HETATM 4254 O  O     . HOH L 9 .   ? 40.397 11.388  -3.476  1.00 15.88 ? 110 HOH T O     1 
HETATM 4255 O  O     . HOH L 9 .   ? 38.812 -10.333 -9.954  1.00 30.19 ? 111 HOH T O     1 
HETATM 4256 O  O     . HOH L 9 .   ? 41.872 -7.346  -10.532 1.00 33.61 ? 112 HOH T O     1 
HETATM 4257 O  O     . HOH L 9 .   ? 35.629 10.977  0.889   1.00 22.06 ? 113 HOH T O     1 
HETATM 4258 O  O     . HOH L 9 .   ? 31.870 14.119  10.618  1.00 37.98 ? 114 HOH T O     1 
HETATM 4259 O  O     . HOH L 9 .   ? 35.912 2.502   4.656   1.00 28.15 ? 115 HOH T O     1 
HETATM 4260 O  O     . HOH L 9 .   ? 43.383 5.397   0.372   1.00 23.34 ? 116 HOH T O     1 
HETATM 4261 O  O     . HOH L 9 .   ? 40.581 -3.643  -9.367  1.00 26.83 ? 117 HOH T O     1 
HETATM 4262 O  O     . HOH L 9 .   ? 38.323 -2.456  -6.504  1.00 29.04 ? 118 HOH T O     1 
HETATM 4263 O  O     . HOH L 9 .   ? 44.013 -8.733  -3.365  1.00 22.52 ? 119 HOH T O     1 
HETATM 4264 O  O     . HOH L 9 .   ? 36.732 -23.104 -5.057  1.00 22.47 ? 120 HOH T O     1 
HETATM 4265 O  O     . HOH L 9 .   ? 41.879 8.164   3.116   1.00 18.02 ? 121 HOH T O     1 
HETATM 4266 O  O     . HOH L 9 .   ? 40.102 -0.630  7.603   1.00 38.95 ? 122 HOH T O     1 
HETATM 4267 O  O     . HOH L 9 .   ? 45.338 5.407   -4.680  1.00 30.12 ? 123 HOH T O     1 
HETATM 4268 O  O     . HOH L 9 .   ? 37.541 -12.865 -11.017 1.00 29.92 ? 124 HOH T O     1 
HETATM 4269 O  O     . HOH L 9 .   ? 38.811 -0.853  10.304  1.00 41.59 ? 125 HOH T O     1 
HETATM 4270 O  O     . HOH L 9 .   ? 37.962 -21.648 -3.345  1.00 31.56 ? 126 HOH T O     1 
HETATM 4271 O  O     . HOH L 9 .   ? 34.155 -15.760 -14.233 1.00 36.67 ? 127 HOH T O     1 
HETATM 4272 O  O     . HOH L 9 .   ? 37.071 -0.103  4.638   1.00 33.78 ? 128 HOH T O     1 
HETATM 4273 O  O     . HOH L 9 .   ? 37.679 -4.164  -8.401  1.00 38.90 ? 129 HOH T O     1 
HETATM 4274 O  O     . HOH L 9 .   ? 42.469 -11.457 -11.714 1.00 36.75 ? 130 HOH T O     1 
HETATM 4275 O  O     . HOH L 9 .   ? 33.205 10.526  8.386   1.00 34.18 ? 131 HOH T O     1 
HETATM 4276 O  O     . HOH L 9 .   ? 46.570 -8.647  -4.521  1.00 23.25 ? 132 HOH T O     1 
HETATM 4277 O  O     . HOH L 9 .   ? 35.585 10.862  10.281  1.00 28.17 ? 133 HOH T O     1 
HETATM 4278 O  O     . HOH L 9 .   ? 40.847 -9.919  -11.328 1.00 38.50 ? 134 HOH T O     1 
HETATM 4279 O  O     . HOH L 9 .   ? 44.796 7.457   -10.354 1.00 18.20 ? 135 HOH T O     1 
HETATM 4280 O  O     . HOH M 9 .   ? 48.850 2.393   1.236   1.00 20.73 ? 101 HOH P O     1 
HETATM 4281 O  O     . HOH M 9 .   ? 38.007 -10.816 6.505   1.00 29.90 ? 102 HOH P O     1 
HETATM 4282 O  O     . HOH M 9 .   ? 28.317 -5.107  -10.198 1.00 37.43 ? 103 HOH P O     1 
HETATM 4283 O  O     . HOH M 9 .   ? 45.826 3.695   1.240   1.00 21.58 ? 104 HOH P O     1 
HETATM 4284 O  O     . HOH M 9 .   ? 41.324 -11.713 -0.822  1.00 20.96 ? 105 HOH P O     1 
HETATM 4285 O  O     . HOH M 9 .   ? 32.370 -7.201  -11.211 1.00 40.18 ? 106 HOH P O     1 
HETATM 4286 O  O     . HOH M 9 .   ? 42.621 -8.940  7.176   1.00 22.81 ? 107 HOH P O     1 
HETATM 4287 O  O     . HOH M 9 .   ? 45.809 -2.550  -0.721  1.00 21.59 ? 108 HOH P O     1 
HETATM 4288 O  O     . HOH M 9 .   ? 34.940 -9.313  -11.034 1.00 38.77 ? 109 HOH P O     1 
HETATM 4289 O  O     . HOH M 9 .   ? 44.612 -8.089  -0.901  1.00 22.95 ? 110 HOH P O     1 
HETATM 4290 O  O     . HOH M 9 .   ? 26.366 -12.694 -10.535 1.00 24.99 ? 111 HOH P O     1 
HETATM 4291 O  O     . HOH M 9 .   ? 47.695 -1.739  7.258   1.00 29.89 ? 112 HOH P O     1 
HETATM 4292 O  O     . HOH M 9 .   ? 31.121 -13.738 -3.055  1.00 36.31 ? 113 HOH P O     1 
HETATM 4293 O  O     . HOH M 9 .   ? 40.205 -5.304  5.608   1.00 25.97 ? 114 HOH P O     1 
HETATM 4294 O  O     . HOH M 9 .   ? 41.329 -15.718 1.929   1.00 20.22 ? 115 HOH P O     1 
HETATM 4295 O  O     . HOH M 9 .   ? 30.270 -6.022  -12.908 1.00 41.98 ? 116 HOH P O     1 
HETATM 4296 O  O     . HOH M 9 .   ? 40.226 -9.016  5.872   1.00 26.21 ? 117 HOH P O     1 
HETATM 4297 O  O     . HOH M 9 .   ? 38.343 -1.752  6.165   1.00 36.40 ? 118 HOH P O     1 
HETATM 4298 O  O     . HOH M 9 .   ? 50.356 -7.303  6.651   1.00 35.55 ? 119 HOH P O     1 
HETATM 4299 O  O     . HOH M 9 .   ? 30.829 -4.867  -9.453  1.00 41.78 ? 120 HOH P O     1 
HETATM 4300 O  O     . HOH M 9 .   ? 43.810 -12.757 -0.141  1.00 22.79 ? 121 HOH P O     1 
HETATM 4301 O  O     . HOH M 9 .   ? 45.673 -10.735 -0.119  1.00 18.39 ? 122 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   501 501 MG  MG  A . 
E 5 CA  1   502 502 CA  CA  A . 
F 4 MG  1   503 503 MG  MG  A . 
G 6 GOL 1   504 504 GOL GOL A . 
H 6 GOL 1   505 505 GOL GOL A . 
I 7 DTP 1   506 506 DTP DTP A . 
J 8 K   1   507 507 K   K   A . 
K 9 HOH 1   601 601 HOH HOH A . 
K 9 HOH 2   602 602 HOH HOH A . 
K 9 HOH 3   603 603 HOH HOH A . 
K 9 HOH 4   604 604 HOH HOH A . 
K 9 HOH 5   605 605 HOH HOH A . 
K 9 HOH 6   606 606 HOH HOH A . 
K 9 HOH 7   607 607 HOH HOH A . 
K 9 HOH 8   608 608 HOH HOH A . 
K 9 HOH 9   609 609 HOH HOH A . 
K 9 HOH 10  610 610 HOH HOH A . 
K 9 HOH 11  611 611 HOH HOH A . 
K 9 HOH 12  612 612 HOH HOH A . 
K 9 HOH 13  613 613 HOH HOH A . 
K 9 HOH 14  614 614 HOH HOH A . 
K 9 HOH 15  615 615 HOH HOH A . 
K 9 HOH 16  616 616 HOH HOH A . 
K 9 HOH 17  617 617 HOH HOH A . 
K 9 HOH 18  618 618 HOH HOH A . 
K 9 HOH 19  619 619 HOH HOH A . 
K 9 HOH 20  620 620 HOH HOH A . 
K 9 HOH 21  621 621 HOH HOH A . 
K 9 HOH 22  622 622 HOH HOH A . 
K 9 HOH 23  623 623 HOH HOH A . 
K 9 HOH 24  624 624 HOH HOH A . 
K 9 HOH 25  625 625 HOH HOH A . 
K 9 HOH 26  626 626 HOH HOH A . 
K 9 HOH 27  627 627 HOH HOH A . 
K 9 HOH 28  628 628 HOH HOH A . 
K 9 HOH 29  629 629 HOH HOH A . 
K 9 HOH 30  630 630 HOH HOH A . 
K 9 HOH 31  631 631 HOH HOH A . 
K 9 HOH 32  632 632 HOH HOH A . 
K 9 HOH 33  633 633 HOH HOH A . 
K 9 HOH 34  634 634 HOH HOH A . 
K 9 HOH 35  635 635 HOH HOH A . 
K 9 HOH 36  636 636 HOH HOH A . 
K 9 HOH 37  637 637 HOH HOH A . 
K 9 HOH 38  638 638 HOH HOH A . 
K 9 HOH 39  639 639 HOH HOH A . 
K 9 HOH 40  640 640 HOH HOH A . 
K 9 HOH 41  641 641 HOH HOH A . 
K 9 HOH 42  642 642 HOH HOH A . 
K 9 HOH 43  643 643 HOH HOH A . 
K 9 HOH 44  644 644 HOH HOH A . 
K 9 HOH 45  645 645 HOH HOH A . 
K 9 HOH 46  646 646 HOH HOH A . 
K 9 HOH 47  647 647 HOH HOH A . 
K 9 HOH 48  648 648 HOH HOH A . 
K 9 HOH 49  649 649 HOH HOH A . 
K 9 HOH 50  650 650 HOH HOH A . 
K 9 HOH 51  651 651 HOH HOH A . 
K 9 HOH 52  652 652 HOH HOH A . 
K 9 HOH 53  653 653 HOH HOH A . 
K 9 HOH 54  654 654 HOH HOH A . 
K 9 HOH 55  655 655 HOH HOH A . 
K 9 HOH 56  656 656 HOH HOH A . 
K 9 HOH 57  657 657 HOH HOH A . 
K 9 HOH 58  658 658 HOH HOH A . 
K 9 HOH 59  659 659 HOH HOH A . 
K 9 HOH 60  660 660 HOH HOH A . 
K 9 HOH 61  661 661 HOH HOH A . 
K 9 HOH 62  662 662 HOH HOH A . 
K 9 HOH 63  663 663 HOH HOH A . 
K 9 HOH 64  664 664 HOH HOH A . 
K 9 HOH 65  665 665 HOH HOH A . 
K 9 HOH 66  666 666 HOH HOH A . 
K 9 HOH 67  667 667 HOH HOH A . 
K 9 HOH 68  668 668 HOH HOH A . 
K 9 HOH 69  669 669 HOH HOH A . 
K 9 HOH 70  670 670 HOH HOH A . 
K 9 HOH 71  671 671 HOH HOH A . 
K 9 HOH 72  672 672 HOH HOH A . 
K 9 HOH 73  673 673 HOH HOH A . 
K 9 HOH 74  674 674 HOH HOH A . 
K 9 HOH 75  675 675 HOH HOH A . 
K 9 HOH 76  676 676 HOH HOH A . 
K 9 HOH 77  677 677 HOH HOH A . 
K 9 HOH 78  678 678 HOH HOH A . 
K 9 HOH 79  679 679 HOH HOH A . 
K 9 HOH 80  680 680 HOH HOH A . 
K 9 HOH 81  681 681 HOH HOH A . 
K 9 HOH 82  682 682 HOH HOH A . 
K 9 HOH 83  683 683 HOH HOH A . 
K 9 HOH 84  684 684 HOH HOH A . 
K 9 HOH 85  685 685 HOH HOH A . 
K 9 HOH 86  686 686 HOH HOH A . 
K 9 HOH 87  687 687 HOH HOH A . 
K 9 HOH 88  688 688 HOH HOH A . 
K 9 HOH 89  689 689 HOH HOH A . 
K 9 HOH 90  690 690 HOH HOH A . 
K 9 HOH 91  691 691 HOH HOH A . 
K 9 HOH 92  692 692 HOH HOH A . 
K 9 HOH 93  693 693 HOH HOH A . 
K 9 HOH 94  694 694 HOH HOH A . 
K 9 HOH 95  695 695 HOH HOH A . 
K 9 HOH 96  696 696 HOH HOH A . 
K 9 HOH 97  697 697 HOH HOH A . 
K 9 HOH 98  698 698 HOH HOH A . 
K 9 HOH 99  699 699 HOH HOH A . 
K 9 HOH 100 700 700 HOH HOH A . 
K 9 HOH 101 701 701 HOH HOH A . 
K 9 HOH 102 702 702 HOH HOH A . 
K 9 HOH 103 703 703 HOH HOH A . 
K 9 HOH 104 704 704 HOH HOH A . 
K 9 HOH 105 705 705 HOH HOH A . 
K 9 HOH 106 706 706 HOH HOH A . 
K 9 HOH 107 707 707 HOH HOH A . 
K 9 HOH 108 708 708 HOH HOH A . 
K 9 HOH 109 709 709 HOH HOH A . 
K 9 HOH 110 710 710 HOH HOH A . 
K 9 HOH 111 711 711 HOH HOH A . 
K 9 HOH 112 712 712 HOH HOH A . 
K 9 HOH 113 713 713 HOH HOH A . 
K 9 HOH 114 714 714 HOH HOH A . 
K 9 HOH 115 715 715 HOH HOH A . 
K 9 HOH 116 716 716 HOH HOH A . 
K 9 HOH 117 717 717 HOH HOH A . 
K 9 HOH 118 718 718 HOH HOH A . 
K 9 HOH 119 719 719 HOH HOH A . 
K 9 HOH 120 720 720 HOH HOH A . 
K 9 HOH 121 721 721 HOH HOH A . 
K 9 HOH 122 722 722 HOH HOH A . 
K 9 HOH 123 723 723 HOH HOH A . 
K 9 HOH 124 724 724 HOH HOH A . 
K 9 HOH 125 725 725 HOH HOH A . 
K 9 HOH 126 726 726 HOH HOH A . 
K 9 HOH 127 727 727 HOH HOH A . 
K 9 HOH 128 728 728 HOH HOH A . 
K 9 HOH 129 729 729 HOH HOH A . 
K 9 HOH 130 730 730 HOH HOH A . 
K 9 HOH 131 731 731 HOH HOH A . 
K 9 HOH 132 732 732 HOH HOH A . 
K 9 HOH 133 733 733 HOH HOH A . 
K 9 HOH 134 734 734 HOH HOH A . 
K 9 HOH 135 735 735 HOH HOH A . 
K 9 HOH 136 736 736 HOH HOH A . 
K 9 HOH 137 737 737 HOH HOH A . 
K 9 HOH 138 738 738 HOH HOH A . 
K 9 HOH 139 739 739 HOH HOH A . 
K 9 HOH 140 740 740 HOH HOH A . 
K 9 HOH 141 741 741 HOH HOH A . 
K 9 HOH 142 742 742 HOH HOH A . 
K 9 HOH 143 743 743 HOH HOH A . 
K 9 HOH 144 744 744 HOH HOH A . 
K 9 HOH 145 745 745 HOH HOH A . 
K 9 HOH 146 746 746 HOH HOH A . 
K 9 HOH 147 747 747 HOH HOH A . 
K 9 HOH 148 748 748 HOH HOH A . 
K 9 HOH 149 749 749 HOH HOH A . 
K 9 HOH 150 750 750 HOH HOH A . 
K 9 HOH 151 751 751 HOH HOH A . 
K 9 HOH 152 752 752 HOH HOH A . 
K 9 HOH 153 753 753 HOH HOH A . 
K 9 HOH 154 754 754 HOH HOH A . 
K 9 HOH 155 755 755 HOH HOH A . 
K 9 HOH 156 756 756 HOH HOH A . 
K 9 HOH 157 757 757 HOH HOH A . 
K 9 HOH 158 758 758 HOH HOH A . 
K 9 HOH 159 759 759 HOH HOH A . 
K 9 HOH 160 760 760 HOH HOH A . 
K 9 HOH 161 761 761 HOH HOH A . 
K 9 HOH 162 762 762 HOH HOH A . 
K 9 HOH 163 763 763 HOH HOH A . 
K 9 HOH 164 764 764 HOH HOH A . 
K 9 HOH 165 765 765 HOH HOH A . 
K 9 HOH 166 766 766 HOH HOH A . 
K 9 HOH 167 767 767 HOH HOH A . 
K 9 HOH 168 768 768 HOH HOH A . 
K 9 HOH 169 769 769 HOH HOH A . 
K 9 HOH 170 770 770 HOH HOH A . 
K 9 HOH 171 771 771 HOH HOH A . 
K 9 HOH 172 772 772 HOH HOH A . 
K 9 HOH 173 773 773 HOH HOH A . 
K 9 HOH 174 774 774 HOH HOH A . 
K 9 HOH 175 775 775 HOH HOH A . 
K 9 HOH 176 776 776 HOH HOH A . 
K 9 HOH 177 777 777 HOH HOH A . 
K 9 HOH 178 778 778 HOH HOH A . 
K 9 HOH 179 779 779 HOH HOH A . 
K 9 HOH 180 780 780 HOH HOH A . 
K 9 HOH 181 781 781 HOH HOH A . 
K 9 HOH 182 782 782 HOH HOH A . 
K 9 HOH 183 783 783 HOH HOH A . 
K 9 HOH 184 784 784 HOH HOH A . 
K 9 HOH 185 785 785 HOH HOH A . 
K 9 HOH 186 786 786 HOH HOH A . 
K 9 HOH 187 787 787 HOH HOH A . 
K 9 HOH 188 788 788 HOH HOH A . 
K 9 HOH 189 789 789 HOH HOH A . 
K 9 HOH 190 790 790 HOH HOH A . 
K 9 HOH 191 791 791 HOH HOH A . 
K 9 HOH 192 792 792 HOH HOH A . 
K 9 HOH 193 793 793 HOH HOH A . 
K 9 HOH 194 794 794 HOH HOH A . 
K 9 HOH 195 795 795 HOH HOH A . 
K 9 HOH 196 796 796 HOH HOH A . 
K 9 HOH 197 797 797 HOH HOH A . 
K 9 HOH 198 798 798 HOH HOH A . 
K 9 HOH 199 799 799 HOH HOH A . 
K 9 HOH 200 800 800 HOH HOH A . 
K 9 HOH 201 801 801 HOH HOH A . 
K 9 HOH 202 802 802 HOH HOH A . 
K 9 HOH 203 803 803 HOH HOH A . 
K 9 HOH 204 804 804 HOH HOH A . 
K 9 HOH 205 805 805 HOH HOH A . 
K 9 HOH 206 806 806 HOH HOH A . 
K 9 HOH 207 807 807 HOH HOH A . 
K 9 HOH 208 808 808 HOH HOH A . 
K 9 HOH 209 809 809 HOH HOH A . 
K 9 HOH 210 810 810 HOH HOH A . 
K 9 HOH 211 811 811 HOH HOH A . 
K 9 HOH 212 812 812 HOH HOH A . 
K 9 HOH 213 813 813 HOH HOH A . 
K 9 HOH 214 814 814 HOH HOH A . 
K 9 HOH 215 815 815 HOH HOH A . 
K 9 HOH 216 816 816 HOH HOH A . 
K 9 HOH 217 817 817 HOH HOH A . 
K 9 HOH 218 818 818 HOH HOH A . 
K 9 HOH 219 819 819 HOH HOH A . 
K 9 HOH 220 820 820 HOH HOH A . 
K 9 HOH 221 821 821 HOH HOH A . 
K 9 HOH 222 822 822 HOH HOH A . 
K 9 HOH 223 823 823 HOH HOH A . 
K 9 HOH 224 824 824 HOH HOH A . 
K 9 HOH 225 825 825 HOH HOH A . 
K 9 HOH 226 826 826 HOH HOH A . 
K 9 HOH 227 827 827 HOH HOH A . 
K 9 HOH 228 828 828 HOH HOH A . 
K 9 HOH 229 829 829 HOH HOH A . 
K 9 HOH 230 830 830 HOH HOH A . 
K 9 HOH 231 831 831 HOH HOH A . 
K 9 HOH 232 832 832 HOH HOH A . 
K 9 HOH 233 833 833 HOH HOH A . 
K 9 HOH 234 834 834 HOH HOH A . 
K 9 HOH 235 835 835 HOH HOH A . 
K 9 HOH 236 836 836 HOH HOH A . 
K 9 HOH 237 837 837 HOH HOH A . 
K 9 HOH 238 838 838 HOH HOH A . 
K 9 HOH 239 839 839 HOH HOH A . 
K 9 HOH 240 840 840 HOH HOH A . 
K 9 HOH 241 841 841 HOH HOH A . 
K 9 HOH 242 842 842 HOH HOH A . 
K 9 HOH 243 843 843 HOH HOH A . 
K 9 HOH 244 844 844 HOH HOH A . 
K 9 HOH 245 845 845 HOH HOH A . 
K 9 HOH 246 846 846 HOH HOH A . 
K 9 HOH 247 847 847 HOH HOH A . 
K 9 HOH 248 848 848 HOH HOH A . 
K 9 HOH 249 849 849 HOH HOH A . 
K 9 HOH 250 850 850 HOH HOH A . 
K 9 HOH 251 851 851 HOH HOH A . 
K 9 HOH 252 852 852 HOH HOH A . 
K 9 HOH 253 853 853 HOH HOH A . 
K 9 HOH 254 854 854 HOH HOH A . 
K 9 HOH 255 855 855 HOH HOH A . 
K 9 HOH 256 856 856 HOH HOH A . 
K 9 HOH 257 857 857 HOH HOH A . 
K 9 HOH 258 858 858 HOH HOH A . 
K 9 HOH 259 859 859 HOH HOH A . 
K 9 HOH 260 860 860 HOH HOH A . 
K 9 HOH 261 861 861 HOH HOH A . 
K 9 HOH 262 862 862 HOH HOH A . 
K 9 HOH 263 863 863 HOH HOH A . 
K 9 HOH 264 864 864 HOH HOH A . 
K 9 HOH 265 865 865 HOH HOH A . 
K 9 HOH 266 866 866 HOH HOH A . 
K 9 HOH 267 867 867 HOH HOH A . 
K 9 HOH 268 868 868 HOH HOH A . 
K 9 HOH 269 869 869 HOH HOH A . 
K 9 HOH 270 870 870 HOH HOH A . 
K 9 HOH 271 871 871 HOH HOH A . 
K 9 HOH 272 872 872 HOH HOH A . 
K 9 HOH 273 873 873 HOH HOH A . 
K 9 HOH 274 874 874 HOH HOH A . 
K 9 HOH 275 875 875 HOH HOH A . 
K 9 HOH 276 876 876 HOH HOH A . 
K 9 HOH 277 877 877 HOH HOH A . 
K 9 HOH 278 878 878 HOH HOH A . 
K 9 HOH 279 879 879 HOH HOH A . 
K 9 HOH 280 880 880 HOH HOH A . 
K 9 HOH 281 881 881 HOH HOH A . 
K 9 HOH 282 882 882 HOH HOH A . 
K 9 HOH 283 883 883 HOH HOH A . 
K 9 HOH 284 884 884 HOH HOH A . 
K 9 HOH 285 885 885 HOH HOH A . 
K 9 HOH 286 886 886 HOH HOH A . 
K 9 HOH 287 887 887 HOH HOH A . 
K 9 HOH 288 888 888 HOH HOH A . 
K 9 HOH 289 889 889 HOH HOH A . 
K 9 HOH 290 890 890 HOH HOH A . 
K 9 HOH 291 891 891 HOH HOH A . 
K 9 HOH 292 892 892 HOH HOH A . 
K 9 HOH 293 893 893 HOH HOH A . 
K 9 HOH 294 894 894 HOH HOH A . 
K 9 HOH 295 895 895 HOH HOH A . 
K 9 HOH 296 896 896 HOH HOH A . 
K 9 HOH 297 897 897 HOH HOH A . 
K 9 HOH 298 898 898 HOH HOH A . 
K 9 HOH 299 899 899 HOH HOH A . 
K 9 HOH 300 900 900 HOH HOH A . 
K 9 HOH 301 901 901 HOH HOH A . 
K 9 HOH 302 902 902 HOH HOH A . 
K 9 HOH 303 903 903 HOH HOH A . 
K 9 HOH 304 904 904 HOH HOH A . 
K 9 HOH 305 905 905 HOH HOH A . 
K 9 HOH 306 906 906 HOH HOH A . 
K 9 HOH 307 907 907 HOH HOH A . 
K 9 HOH 308 908 908 HOH HOH A . 
K 9 HOH 309 909 909 HOH HOH A . 
K 9 HOH 310 910 910 HOH HOH A . 
K 9 HOH 311 911 911 HOH HOH A . 
K 9 HOH 312 912 912 HOH HOH A . 
K 9 HOH 313 913 913 HOH HOH A . 
K 9 HOH 314 914 914 HOH HOH A . 
K 9 HOH 315 915 915 HOH HOH A . 
K 9 HOH 316 916 916 HOH HOH A . 
K 9 HOH 317 917 917 HOH HOH A . 
K 9 HOH 318 918 918 HOH HOH A . 
K 9 HOH 319 919 919 HOH HOH A . 
K 9 HOH 320 920 920 HOH HOH A . 
K 9 HOH 321 921 921 HOH HOH A . 
K 9 HOH 322 922 922 HOH HOH A . 
K 9 HOH 323 923 923 HOH HOH A . 
K 9 HOH 324 924 924 HOH HOH A . 
K 9 HOH 325 925 925 HOH HOH A . 
K 9 HOH 326 926 926 HOH HOH A . 
K 9 HOH 327 927 927 HOH HOH A . 
K 9 HOH 328 928 928 HOH HOH A . 
K 9 HOH 329 929 929 HOH HOH A . 
K 9 HOH 330 930 930 HOH HOH A . 
K 9 HOH 331 931 931 HOH HOH A . 
K 9 HOH 332 932 932 HOH HOH A . 
K 9 HOH 333 933 933 HOH HOH A . 
K 9 HOH 334 934 934 HOH HOH A . 
K 9 HOH 335 935 935 HOH HOH A . 
K 9 HOH 336 936 936 HOH HOH A . 
K 9 HOH 337 937 937 HOH HOH A . 
K 9 HOH 338 938 938 HOH HOH A . 
K 9 HOH 339 939 939 HOH HOH A . 
K 9 HOH 340 940 940 HOH HOH A . 
K 9 HOH 341 941 941 HOH HOH A . 
K 9 HOH 342 942 942 HOH HOH A . 
K 9 HOH 343 943 943 HOH HOH A . 
K 9 HOH 344 944 944 HOH HOH A . 
K 9 HOH 345 945 945 HOH HOH A . 
K 9 HOH 346 946 946 HOH HOH A . 
K 9 HOH 347 947 947 HOH HOH A . 
K 9 HOH 348 948 948 HOH HOH A . 
K 9 HOH 349 949 949 HOH HOH A . 
K 9 HOH 350 950 950 HOH HOH A . 
K 9 HOH 351 951 951 HOH HOH A . 
K 9 HOH 352 952 952 HOH HOH A . 
K 9 HOH 353 953 953 HOH HOH A . 
K 9 HOH 354 954 954 HOH HOH A . 
K 9 HOH 355 955 955 HOH HOH A . 
K 9 HOH 356 956 956 HOH HOH A . 
K 9 HOH 357 957 957 HOH HOH A . 
K 9 HOH 358 958 958 HOH HOH A . 
K 9 HOH 359 959 959 HOH HOH A . 
K 9 HOH 360 960 960 HOH HOH A . 
K 9 HOH 361 961 961 HOH HOH A . 
K 9 HOH 362 962 962 HOH HOH A . 
K 9 HOH 363 963 963 HOH HOH A . 
K 9 HOH 364 964 964 HOH HOH A . 
K 9 HOH 365 965 965 HOH HOH A . 
K 9 HOH 366 966 966 HOH HOH A . 
K 9 HOH 367 967 967 HOH HOH A . 
K 9 HOH 368 968 968 HOH HOH A . 
K 9 HOH 369 969 969 HOH HOH A . 
K 9 HOH 370 970 970 HOH HOH A . 
K 9 HOH 371 971 971 HOH HOH A . 
K 9 HOH 372 972 972 HOH HOH A . 
K 9 HOH 373 973 973 HOH HOH A . 
K 9 HOH 374 974 974 HOH HOH A . 
K 9 HOH 375 975 975 HOH HOH A . 
K 9 HOH 376 976 976 HOH HOH A . 
K 9 HOH 377 977 977 HOH HOH A . 
K 9 HOH 378 978 978 HOH HOH A . 
L 9 HOH 1   101 101 HOH HOH T . 
L 9 HOH 2   102 102 HOH HOH T . 
L 9 HOH 3   103 103 HOH HOH T . 
L 9 HOH 4   104 104 HOH HOH T . 
L 9 HOH 5   105 105 HOH HOH T . 
L 9 HOH 6   106 106 HOH HOH T . 
L 9 HOH 7   107 107 HOH HOH T . 
L 9 HOH 8   108 108 HOH HOH T . 
L 9 HOH 9   109 109 HOH HOH T . 
L 9 HOH 10  110 110 HOH HOH T . 
L 9 HOH 11  111 111 HOH HOH T . 
L 9 HOH 12  112 112 HOH HOH T . 
L 9 HOH 13  113 113 HOH HOH T . 
L 9 HOH 14  114 114 HOH HOH T . 
L 9 HOH 15  115 115 HOH HOH T . 
L 9 HOH 16  116 116 HOH HOH T . 
L 9 HOH 17  117 117 HOH HOH T . 
L 9 HOH 18  118 118 HOH HOH T . 
L 9 HOH 19  119 119 HOH HOH T . 
L 9 HOH 20  120 120 HOH HOH T . 
L 9 HOH 21  121 121 HOH HOH T . 
L 9 HOH 22  122 122 HOH HOH T . 
L 9 HOH 23  123 123 HOH HOH T . 
L 9 HOH 24  124 124 HOH HOH T . 
L 9 HOH 25  125 125 HOH HOH T . 
L 9 HOH 26  126 126 HOH HOH T . 
L 9 HOH 27  127 127 HOH HOH T . 
L 9 HOH 28  128 128 HOH HOH T . 
L 9 HOH 29  129 129 HOH HOH T . 
L 9 HOH 30  130 130 HOH HOH T . 
L 9 HOH 31  131 131 HOH HOH T . 
L 9 HOH 32  132 132 HOH HOH T . 
L 9 HOH 33  133 133 HOH HOH T . 
L 9 HOH 34  134 134 HOH HOH T . 
L 9 HOH 35  135 135 HOH HOH T . 
M 9 HOH 1   101 101 HOH HOH P . 
M 9 HOH 2   102 102 HOH HOH P . 
M 9 HOH 3   103 103 HOH HOH P . 
M 9 HOH 4   104 104 HOH HOH P . 
M 9 HOH 5   105 105 HOH HOH P . 
M 9 HOH 6   106 106 HOH HOH P . 
M 9 HOH 7   107 107 HOH HOH P . 
M 9 HOH 8   108 108 HOH HOH P . 
M 9 HOH 9   109 109 HOH HOH P . 
M 9 HOH 10  110 110 HOH HOH P . 
M 9 HOH 11  111 111 HOH HOH P . 
M 9 HOH 12  112 112 HOH HOH P . 
M 9 HOH 13  113 113 HOH HOH P . 
M 9 HOH 14  114 114 HOH HOH P . 
M 9 HOH 15  115 115 HOH HOH P . 
M 9 HOH 16  116 116 HOH HOH P . 
M 9 HOH 17  117 117 HOH HOH P . 
M 9 HOH 18  118 118 HOH HOH P . 
M 9 HOH 19  119 119 HOH HOH P . 
M 9 HOH 20  120 120 HOH HOH P . 
M 9 HOH 21  121 121 HOH HOH P . 
M 9 HOH 22  122 122 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5860  ? 
1 MORE         -66   ? 
1 'SSA (A^2)'  21840 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 44.7  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 71.7  ? 
3  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 106.9 ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 105.5 ? 
5  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.4  ? 
6  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.0  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 155.3 ? 
8  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 160.0 ? 
9  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 88.7  ? 
10 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 86.3  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 115.5 ? 
12 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 77.9  ? 
13 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 171.9 ? 
14 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 91.2  ? 
15 O1B   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 85.3  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 85.7  ? 
17 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 108.6 ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 96.0  ? 
19 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 167.6 ? 
20 O1B   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 81.4  ? 
21 O1A   ? I DTP .   ? A DTP 506 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 88.4  ? 
22 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 44.9  ? 
23 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 71.8  ? 
24 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 107.1 ? 
25 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 105.7 ? 
26 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.5  ? 
27 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.0  ? 
28 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 155.2 ? 
29 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 160.0 ? 
30 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 88.4  ? 
31 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1B   ? I DTP .   ? A DTP 506 ? 1_555 86.0  ? 
32 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 115.8 ? 
33 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 78.1  ? 
34 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 171.5 ? 
35 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 91.1  ? 
36 O1B   ? I DTP .   ? A DTP 506 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 85.1  ? 
37 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 85.9  ? 
38 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 108.9 ? 
39 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 96.0  ? 
40 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 167.2 ? 
41 O1B   ? I DTP .   ? A DTP 506 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 81.2  ? 
42 O1A   ? I DTP .   ? A DTP 506 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O1G   ? I DTP .   ? A DTP 506 ? 1_555 88.5  ? 
43 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 88.8  ? 
44 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 100.8 ? 
45 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 100.7 ? 
46 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 170.5 ? 
47 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 84.4  ? 
48 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 87.0  ? 
49 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 87.6  ? 
50 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 163.7 ? 
51 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 95.5  ? 
52 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 97.2  ? 
53 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 89.2  ? 
54 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 87.9  ? 
55 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 166.9 ? 
56 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 84.0  ? 
57 O     ? K HOH .   ? A HOH 804 ? 1_555 MG A D MG . ? A MG 501 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 76.2  ? 
58 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 88.8  ? 
59 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 100.8 ? 
60 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 K  B J K  . ? A K  507 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 100.7 ? 
61 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 170.5 ? 
62 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 K  B J K  . ? A K  507 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 84.4  ? 
63 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 K  B J K  . ? A K  507 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 87.0  ? 
64 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 89.2  ? 
65 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 87.9  ? 
66 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 166.9 ? 
67 "O3'" ? C DT  8   ? P DT  8   ? 1_555 K  B J K  . ? A K  507 ? 1_555 O1A   ? I DTP .   ? A DTP 506 ? 1_555 84.0  ? 
68 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 87.6  ? 
69 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 163.7 ? 
70 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 95.5  ? 
71 "O3'" ? C DT  8   ? P DT  8   ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 97.2  ? 
72 O1A   ? I DTP .   ? A DTP 506 ? 1_555 K  B J K  . ? A K  507 ? 1_555 O     ? K HOH .   ? A HOH 804 ? 1_555 76.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2016-06-29 
3 'Structure model' 1 2 2017-09-20 
4 'Structure model' 1 3 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'          
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Derived calculations'       
4 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_audit_support    
2 3 'Structure model' pdbx_struct_oper_list 
3 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_audit_support.funding_organization'  
2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 4 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .        2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG  A SER 409 ? ? O A ILE 411 ? ? 2.15 
2 1 OP2 T DC  11  ? ? O T HOH 101 ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_1             312 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_2             312 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.558 
_pdbx_validate_rmsd_bond.bond_target_value         1.474 
_pdbx_validate_rmsd_bond.bond_deviation            0.084 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.014 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" P DA 7 ? ? "C4'" P DA 7 ? ? "C3'" P DA 7 ? ? 101.71 104.50 -2.79 0.40 N 
2 1 "O4'" P DA 7 ? ? "C1'" P DA 7 ? ? N9    P DA 7 ? ? 110.30 108.30 2.00  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 36.72   55.00   
2 1 TYR A 39  ? ? 65.16   -178.97 
3 1 LYS A 40  ? ? -153.44 -37.83  
4 1 SER A 62  ? ? 71.93   -1.34   
5 1 SER A 257 ? ? 93.57   -12.85  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KFV 'double helix'        
5KFV 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.054  -0.135 -0.082 -4.844 -7.175  4.344  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.065  -0.074 0.309  -2.144 -15.579 3.617  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.126 -0.149 -0.357 -4.724 -2.987  -0.553 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.182  -0.178 0.049  3.518  -2.886  -0.136 4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.299  -0.092 -0.255 10.799 -8.721  1.604  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.463 -0.201 -0.141 -3.684 -7.790  6.595  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.038  -0.100 0.182  -6.265 -5.605  0.013  7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.060 -0.168 -0.065 13.529 0.990   1.770  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.789  -1.043 3.300 -3.059 1.540 25.564 -2.760 -2.610 3.119 3.461  6.874   
25.789 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.438 -1.040 3.358 6.322  8.512 30.061 -3.409 1.921  2.818 15.806 -11.739 
31.836 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.667 -0.449 3.178 -3.581 2.269 34.426 -1.094 0.582  3.194 3.816  6.022   
34.679 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.285  -0.609 3.181 3.125  1.255 30.873 -1.373 0.051  3.168 2.349  -5.848  
31.051 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.256 -0.507 3.751 -4.298 5.502 34.262 -1.793 -0.315 3.633 9.221  7.203   
34.945 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.670 -0.534 3.429 -3.056 1.146 36.263 -1.023 0.624  3.454 1.836  4.898   
36.405 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.256  0.274  3.043 -0.230 3.012 27.568 -0.108 -0.587 3.053 6.296  0.480   
27.730 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Intramural DK036146-08' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 'POTASSIUM ION'                     K   
9 water                               HOH 
#