data_5KG2
# 
_entry.id   5KG2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KG2         
WWPDB D_1000222149 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5KFA PDB . 
unspecified 5KFB PDB . 
unspecified 5KFC PDB . 
unspecified 5KG0 PDB . 
unspecified 5KG1 PDB . 
unspecified 5KG3 PDB . 
unspecified 5KG4 PDB . 
unspecified 5KG5 PDB . 
unspecified 5KG6 PDB . 
unspecified 5KG7 PDB . 
unspecified 5KFD PDB . 
unspecified 5KFE PDB . 
unspecified 5KFS PDB . 
unspecified 5KFT PDB . 
unspecified 5KFU PDB . 
unspecified 5KFV PDB . 
unspecified 5KFW PDB . 
unspecified 5KFX PDB . 
unspecified 5KFG PDB . 
unspecified 5KFY PDB . 
unspecified 5KFZ PDB . 
unspecified 5KFH PDB . 
unspecified 5KFK PDB . 
unspecified 5KFL PDB . 
unspecified 5KFI PDB . 
unspecified 5KFJ PDB . 
unspecified 5KFM PDB . 
unspecified 5KFN PDB . 
unspecified 5KFO PDB . 
unspecified 5KFP PDB . 
unspecified 5KFQ PDB . 
unspecified 5KFR PDB . 
unspecified 5KFF PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KG2 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gao, Y.'  1 ? 
primary 'Yang, W.' 2 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5KG2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     98.270 
_cell.length_a_esd                 ? 
_cell.length_b                     98.270 
_cell.length_b_esd                 ? 
_cell.length_c                     82.190 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5KG2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                 54.938    3   ?       ? ? ? 
5 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
6 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ? ? 
7 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
8 water       nat water                                                18.015    466 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' ? 9606 ? 
3 1 sample 1 9  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5KG2       5KG2   ? 2 ? 1 
3 PDB 5KG2       5KG2   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KG2 A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5KG2 T 1 ? 12  ? 5KG2   1 ? 12  ? 1 12  
3 3 5KG2 P 1 ? 9   ? 5KG2   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KG2 GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5KG2 PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5KG2 HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ?                               'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ?                               'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KG2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.08 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.95 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            25.310 
_reflns.entry_id                         5KG2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.600 
_reflns.d_resolution_low                 20.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       55228 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             92.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.5 
_reflns.pdbx_Rmerge_I_obs                0.062 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            22.180 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.600 1.640 ? 2.640  ? ? ? ? ? 99.900 ? ? ? ? 0.761 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1  1 ? ? 
1.640 1.690 ? 3.360  ? ? ? ? ? 99.800 ? ? ? ? 0.596 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2  1 ? ? 
1.690 1.740 ? 4.110  ? ? ? ? ? 99.800 ? ? ? ? 0.520 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3  1 ? ? 
1.740 1.790 ? 5.140  ? ? ? ? ? 99.700 ? ? ? ? 0.395 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4  1 ? ? 
1.790 1.850 ? 6.480  ? ? ? ? ? 99.800 ? ? ? ? 0.307 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5  1 ? ? 
1.850 1.910 ? 6.640  ? ? ? ? ? 76.700 ? ? ? ? 0.289 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6  1 ? ? 
1.910 1.980 ? 9.270  ? ? ? ? ? 64.000 ? ? ? ? 0.212 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7  1 ? ? 
1.980 2.070 ? 12.870 ? ? ? ? ? 96.900 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8  1 ? ? 
2.070 2.160 ? 16.720 ? ? ? ? ? 84.800 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9  1 ? ? 
2.160 2.260 ? 19.880 ? ? ? ? ? 85.600 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 ? ? 
2.260 2.390 ? 24.020 ? ? ? ? ? 97.300 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 ? ? 
2.390 2.530 ? 28.860 ? ? ? ? ? 97.800 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 ? ? 
2.530 2.700 ? 32.270 ? ? ? ? ? 90.800 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 ? ? 
2.700 2.920 ? 40.570 ? ? ? ? ? 98.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 ? ? 
2.920 3.200 ? 50.010 ? ? ? ? ? 98.300 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 ? ? 
3.200 3.580 ? 59.100 ? ? ? ? ? 93.300 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 ? ? 
3.580 4.130 ? 67.300 ? ? ? ? ? 95.400 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 ? ? 
4.130 5.060 ? 76.290 ? ? ? ? ? 97.000 ? ? ? ? 0.019 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 ? ? 
5.060 7.160 ? 75.170 ? ? ? ? ? 96.400 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 ? ? 
7.160 ?     ? 82.510 ? ? ? ? ? 90.800 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                115.980 
_refine.B_iso_mean                               25.8716 
_refine.B_iso_min                                7.330 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5KG2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.6000 
_refine.ls_d_res_low                             19.7070 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     55216 
_refine.ls_number_reflns_R_free                  4312 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.9900 
_refine.ls_percent_reflns_R_free                 7.8100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1854 
_refine.ls_R_factor_R_free                       0.2036 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1839 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4ECQ 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 19.9400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.6000 
_refine_hist.d_res_low                        19.7070 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             467 
_refine_hist.number_atoms_total               4301 
_refine_hist.pdbx_number_residues_total       451 
_refine_hist.pdbx_B_iso_mean_ligand           21.76 
_refine_hist.pdbx_B_iso_mean_solvent          31.08 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
# 
_struct.entry_id                     5KG2 
_struct.title                        
'Human DNA polymerase eta-DNA ternary complex: reaction first with 1 mM Mn2+ for 1800s then with 5 mM Mn2+ for 60s at 37 degree' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KG2 
_struct_keywords.text            
'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, replication, transferase-dna complex' 
_struct_keywords.pdbx_keywords   'replication, transferase/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 4 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 AB2 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P12 AB3 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P13 AB4 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P14 AB5 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P15 AB6 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P16 AB7 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P17 AB8 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 AB9 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 AC1 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 AC2 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E MN  . MN  B ? A ASP 13  A MN  502 1_555 ? ? ? ? ? ? ?            2.139 ? 
metalc2  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 D MN  . MN  ? ? A ASP 13  A MN  501 1_555 ? ? ? ? ? ? ?            2.135 ? 
metalc3  metalc ? ? A MET 17  O     ? ? ? 1_555 E MN  . MN  B ? A MET 14  A MN  502 1_555 ? ? ? ? ? ? ?            2.282 ? 
metalc4  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 D MN  . MN  ? ? A ASP 115 A MN  501 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc5  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E MN  . MN  B ? A ASP 115 A MN  502 1_555 ? ? ? ? ? ? ?            2.139 ? 
metalc6  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MN  . MN  ? ? A GLU 116 A MN  501 1_555 ? ? ? ? ? ? ?            2.167 ? 
metalc7  metalc ? ? C DT  8   "O3'" A ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc8  metalc ? ? C DT  8   "O3'" B ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.404 ? 
metalc9  metalc ? ? C DA  9   OP1   B ? ? 1_555 D MN  . MN  ? ? P DA  9   A MN  501 1_555 ? ? ? ? ? ? ?            2.048 ? 
metalc10 metalc ? ? C DA  9   OP1   B ? ? 1_555 E MN  . MN  B ? P DA  9   A MN  502 1_555 ? ? ? ? ? ? ?            2.457 ? 
metalc11 metalc ? ? C DA  9   OP2   B ? ? 1_555 K MN  . MN  B ? P DA  9   P MN  101 1_555 ? ? ? ? ? ? ?            1.898 ? 
metalc12 metalc ? ? D MN  .   MN    ? ? ? 1_555 L HOH . O   ? ? A MN  501 A HOH 789 1_555 ? ? ? ? ? ? ?            2.169 ? 
metalc13 metalc ? ? D MN  .   MN    ? ? ? 1_555 I DTP . O1A A ? A MN  501 A DTP 506 1_555 ? ? ? ? ? ? ?            2.249 ? 
metalc14 metalc ? ? E MN  .   MN    B ? ? 1_555 J DPO . O1  B ? A MN  502 A DPO 507 1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc15 metalc ? ? E MN  .   MN    B ? ? 1_555 J DPO . O5  B ? A MN  502 A DPO 507 1_555 ? ? ? ? ? ? ?            2.079 ? 
metalc16 metalc ? ? J DPO .   O2    B ? ? 1_555 K MN  . MN  B ? A DPO 507 P MN  101 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc17 metalc ? ? K MN  .   MN    B ? ? 1_555 L HOH . O   ? ? P MN  101 A HOH 660 1_555 ? ? ? ? ? ? ?            2.602 ? 
metalc18 metalc ? ? K MN  .   MN    B ? ? 1_555 L HOH . O   B ? P MN  101 A HOH 758 1_555 ? ? ? ? ? ? ?            2.384 ? 
metalc19 metalc ? ? K MN  .   MN    B ? ? 1_555 N HOH . O   B ? P MN  101 P HOH 221 1_555 ? ? ? ? ? ? ?            2.000 ? 
hydrog1  hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  9 N1  B ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  9 N6  B ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 0.40  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -1.48 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -5.62 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  501 ? 8  'binding site for residue MN A 501'  
AC2 Software A MN  502 ? 7  'binding site for residue MN A 502'  
AC3 Software A GOL 503 ? 8  'binding site for residue GOL A 503' 
AC4 Software A GOL 504 ? 7  'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 9  'binding site for residue GOL A 505' 
AC6 Software A DTP 506 ? 32 'binding site for residue DTP A 506' 
AC7 Software A DPO 507 ? 18 'binding site for residue DPO A 507' 
AC8 Software P MN  101 ? 8  'binding site for residue MN P 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4  AC1 8  MN  E .   ? MN  A 502 . ? 1_555 ? 
5  AC1 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
6  AC1 8  HOH L .   ? HOH A 789 . ? 1_555 ? 
7  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8  AC1 8  DA  C 9   ? DA  P 9   . ? 1_555 ? 
9  AC2 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 7  MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
12 AC2 7  MN  D .   ? MN  A 501 . ? 1_555 ? 
13 AC2 7  DTP I .   ? DTP A 506 . ? 1_555 ? 
14 AC2 7  DPO J .   ? DPO A 507 . ? 1_555 ? 
15 AC2 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
16 AC3 8  ARG A 27  ? ARG A 24  . ? 6_545 ? 
17 AC3 8  PRO A 247 ? PRO A 244 . ? 1_555 ? 
18 AC3 8  SER A 251 ? SER A 248 . ? 1_555 ? 
19 AC3 8  GLY A 279 ? GLY A 276 . ? 1_555 ? 
20 AC3 8  HOH L .   ? HOH A 646 . ? 1_555 ? 
21 AC3 8  HOH L .   ? HOH A 651 . ? 1_555 ? 
22 AC3 8  HOH L .   ? HOH A 692 . ? 1_555 ? 
23 AC3 8  HOH L .   ? HOH A 723 . ? 1_555 ? 
24 AC4 7  GLU A 97  ? GLU A 94  . ? 1_555 ? 
25 AC4 7  ALA A 98  ? ALA A 95  . ? 1_555 ? 
26 AC4 7  GLU A 101 ? GLU A 98  . ? 1_555 ? 
27 AC4 7  ARG A 306 ? ARG A 303 . ? 5_664 ? 
28 AC4 7  HOH L .   ? HOH A 643 . ? 1_555 ? 
29 AC4 7  HOH L .   ? HOH A 670 . ? 1_555 ? 
30 AC4 7  HOH L .   ? HOH A 811 . ? 1_555 ? 
31 AC5 9  ASN A 29  ? ASN A 26  . ? 1_555 ? 
32 AC5 9  HIS A 31  ? HIS A 28  . ? 1_555 ? 
33 AC5 9  GLY A 274 ? GLY A 271 . ? 5_664 ? 
34 AC5 9  GLU A 276 ? GLU A 273 . ? 5_664 ? 
35 AC5 9  TYR A 277 ? TYR A 274 . ? 5_664 ? 
36 AC5 9  GLU A 280 ? GLU A 277 . ? 5_664 ? 
37 AC5 9  HOH L .   ? HOH A 611 . ? 1_555 ? 
38 AC5 9  HOH L .   ? HOH A 627 . ? 1_555 ? 
39 AC5 9  HOH L .   ? HOH A 678 . ? 5_664 ? 
40 AC6 32 ASP A 16  ? ASP A 13  . ? 1_555 ? 
41 AC6 32 MET A 17  ? MET A 14  . ? 1_555 ? 
42 AC6 32 ASP A 18  ? ASP A 15  . ? 1_555 ? 
43 AC6 32 CYS A 19  ? CYS A 16  . ? 1_555 ? 
44 AC6 32 PHE A 20  ? PHE A 17  . ? 1_555 ? 
45 AC6 32 PHE A 21  ? PHE A 18  . ? 1_555 ? 
46 AC6 32 ILE A 51  ? ILE A 48  . ? 1_555 ? 
47 AC6 32 ALA A 52  ? ALA A 49  . ? 1_555 ? 
48 AC6 32 TYR A 55  ? TYR A 52  . ? 1_555 ? 
49 AC6 32 ARG A 58  ? ARG A 55  . ? 1_555 ? 
50 AC6 32 ARG A 64  ? ARG A 61  . ? 1_555 ? 
51 AC6 32 ASP A 118 ? ASP A 115 . ? 1_555 ? 
52 AC6 32 LYS A 234 ? LYS A 231 . ? 1_555 ? 
53 AC6 32 MN  D .   ? MN  A 501 . ? 1_555 ? 
54 AC6 32 MN  E .   ? MN  A 502 . ? 1_555 ? 
55 AC6 32 DPO J .   ? DPO A 507 . ? 1_555 ? 
56 AC6 32 HOH L .   ? HOH A 634 . ? 1_555 ? 
57 AC6 32 HOH L .   ? HOH A 660 . ? 1_555 ? 
58 AC6 32 HOH L .   ? HOH A 662 . ? 1_555 ? 
59 AC6 32 HOH L .   ? HOH A 668 . ? 1_555 ? 
60 AC6 32 HOH L .   ? HOH A 758 . ? 1_555 ? 
61 AC6 32 HOH L .   ? HOH A 789 . ? 1_555 ? 
62 AC6 32 HOH L .   ? HOH A 808 . ? 1_555 ? 
63 AC6 32 DT  C 8   ? DT  P 8   . ? 1_555 ? 
64 AC6 32 DA  C 9   ? DA  P 9   . ? 1_555 ? 
65 AC6 32 MN  K .   ? MN  P 101 . ? 1_555 ? 
66 AC6 32 HOH N .   ? HOH P 203 . ? 1_555 ? 
67 AC6 32 HOH N .   ? HOH P 212 . ? 1_555 ? 
68 AC6 32 HOH N .   ? HOH P 221 . ? 1_555 ? 
69 AC6 32 DT  B 3   ? DT  T 3   . ? 1_555 ? 
70 AC6 32 DT  B 4   ? DT  T 4   . ? 1_555 ? 
71 AC6 32 DA  B 5   ? DA  T 5   . ? 1_555 ? 
72 AC7 18 ASP A 16  ? ASP A 13  . ? 1_555 ? 
73 AC7 18 MET A 17  ? MET A 14  . ? 1_555 ? 
74 AC7 18 ASP A 18  ? ASP A 15  . ? 1_555 ? 
75 AC7 18 CYS A 19  ? CYS A 16  . ? 1_555 ? 
76 AC7 18 PHE A 20  ? PHE A 17  . ? 1_555 ? 
77 AC7 18 TYR A 55  ? TYR A 52  . ? 1_555 ? 
78 AC7 18 ARG A 58  ? ARG A 55  . ? 1_555 ? 
79 AC7 18 ARG A 64  ? ARG A 61  . ? 1_555 ? 
80 AC7 18 ASP A 118 ? ASP A 115 . ? 1_555 ? 
81 AC7 18 LYS A 234 ? LYS A 231 . ? 1_555 ? 
82 AC7 18 MN  E .   ? MN  A 502 . ? 1_555 ? 
83 AC7 18 DTP I .   ? DTP A 506 . ? 1_555 ? 
84 AC7 18 HOH L .   ? HOH A 634 . ? 1_555 ? 
85 AC7 18 HOH L .   ? HOH A 662 . ? 1_555 ? 
86 AC7 18 HOH L .   ? HOH A 668 . ? 1_555 ? 
87 AC7 18 HOH L .   ? HOH A 758 . ? 1_555 ? 
88 AC7 18 DA  C 9   ? DA  P 9   . ? 1_555 ? 
89 AC7 18 MN  K .   ? MN  P 101 . ? 1_555 ? 
90 AC8 8  ARG A 64  ? ARG A 61  . ? 1_555 ? 
91 AC8 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
92 AC8 8  DPO J .   ? DPO A 507 . ? 1_555 ? 
93 AC8 8  HOH L .   ? HOH A 660 . ? 1_555 ? 
94 AC8 8  HOH L .   ? HOH A 668 . ? 1_555 ? 
95 AC8 8  HOH L .   ? HOH A 758 . ? 1_555 ? 
96 AC8 8  DA  C 9   ? DA  P 9   . ? 1_555 ? 
97 AC8 8  HOH N .   ? HOH P 221 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KG2 
_atom_sites.fract_transf_matrix[1][1]   0.010176 
_atom_sites.fract_transf_matrix[1][2]   0.005875 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011750 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012167 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.979 -34.529 -3.995  1.00 54.22  ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.397 -34.347 -4.250  1.00 62.18  ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.666 -33.302 -5.315  1.00 61.94  ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.377 -32.124 -5.120  1.00 61.93  ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.224 -33.728 -6.456  1.00 67.69  ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.536 -32.803 -7.554  1.00 70.19  ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.299 -32.211 -8.240  1.00 69.43  ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.457 -31.389 -9.147  1.00 71.03  ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.321 -33.678 -8.542  1.00 66.32  ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.970 -35.087 -8.186  1.00 65.81  ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.721 -35.091 -6.714  1.00 62.13  ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.100 -32.605 -7.817  1.00 69.25  ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 64.881 -32.216 -8.526  1.00 70.17  ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 63.901 -31.372 -7.702  1.00 73.50  ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 62.892 -30.906 -8.236  1.00 69.08  ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.151 -33.464 -9.038  1.00 57.72  ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.045 -34.453 -9.718  1.00 55.50  ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.592 -34.231 -10.964 1.00 50.08  ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.485 -35.673 -9.326  1.00 51.59  ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.332 -35.270 -11.309 1.00 52.14  ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.283 -36.159 -10.333 1.00 49.33  ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.178 -31.178 -6.414  1.00 75.21  ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.283 -30.374 -5.584  1.00 78.83  ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.458 -28.895 -5.906  1.00 77.46  ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.518 -28.318 -5.652  1.00 76.45  ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.528 -30.615 -4.090  1.00 85.21  ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 64.956 -30.981 -3.731  1.00 88.84  ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 65.160 -31.601 -2.048  1.00 115.98 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 64.673 -30.164 -1.094  1.00 72.45  ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.419 -28.291 -6.476  1.00 76.43  ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.427 -26.862 -6.764  1.00 64.43  ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 62.575 -26.083 -5.464  1.00 57.70  ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 61.920 -26.394 -4.469  1.00 53.10  ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.162 -26.453 -7.496  1.00 63.34  ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.448 -25.083 -5.462  1.00 46.86  ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 63.734 -24.371 -4.227  1.00 38.49  ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.236 -22.938 -4.274  1.00 30.18  ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.411 -22.191 -3.313  1.00 30.59  ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.238 -24.361 -3.910  1.00 38.23  ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 65.948 -23.683 -4.953  1.00 35.08  ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 65.754 -25.786 -3.785  1.00 39.51  ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.612 -22.563 -5.389  1.00 28.73  ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.032 -21.238 -5.523  1.00 25.48  ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.068 -20.145 -5.362  1.00 22.33  ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 62.850 -19.164 -4.648  1.00 23.30  ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.210 -20.324 -6.018  1.00 19.12  ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.296 -19.350 -5.942  1.00 12.31  ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 65.652 -18.779 -7.315  1.00 17.57  ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 66.750 -18.277 -7.510  1.00 18.78  ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.545 -19.996 -5.338  1.00 20.17  ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.461 -20.334 -3.868  1.00 20.74  ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 67.626 -21.201 -3.429  1.00 23.54  ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.131 -21.070 -2.317  1.00 43.53  ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.033 -22.118 -4.292  1.00 34.00  ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 64.713 -18.867 -8.249  1.00 21.18  ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 64.937 -18.495 -9.644  1.00 22.77  ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 64.916 -16.984 -9.890  1.00 20.33  ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.519 -16.499 -10.841 1.00 21.84  ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 63.881 -19.168 -10.533 1.00 30.04  ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.466 -19.093 -9.938  1.00 38.62  ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.282 -19.435 -8.748  1.00 28.22  ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.530 -18.685 -10.665 1.00 43.38  ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.230 -16.247 -9.027  1.00 19.21  ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.031 -14.813 -9.223  1.00 17.25  ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.664 -13.972 -8.130  1.00 17.79  ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 64.869 -14.438 -7.011  1.00 16.68  ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.540 -14.471 -9.272  1.00 14.10  ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 61.731 -15.147 -10.369 1.00 17.06  ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.276 -14.714 -10.260 1.00 17.25  ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.616 -15.296 -9.093  1.00 18.45  ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.534 -14.789 -8.507  1.00 17.78  ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.004 -15.398 -7.449  1.00 15.38  ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 57.983 -13.669 -8.966  1.00 17.01  ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 64.945 -12.716 -8.454  1.00 14.55  ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.235 -11.734 -7.420  1.00 11.36  ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.095 -10.725 -7.443  1.00 12.94  ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 63.847 -10.086 -8.465  1.00 16.26  ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.583 -11.015 -7.624  1.00 14.09  ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 66.818 -10.000 -6.498  1.00 15.45  ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 67.726 -12.026 -7.688  1.00 16.43  ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.394 -10.597 -6.319  1.00 12.17  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.224 -9.726  -6.244  1.00 12.35  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.418 -8.746  -5.101  1.00 12.44  ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 62.861 -9.142  -4.024  1.00 13.09  ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 60.926 -10.532 -6.030  1.00 12.30  ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 59.736 -9.606  -5.794  1.00 14.24  ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.672 -11.452 -7.229  1.00 14.29  ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.126 -7.466  -5.338  1.00 12.42  ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.157 -6.503  -4.244  1.00 9.66   ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 60.806 -5.889  -4.008  1.00 11.47  ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 59.986 -5.791  -4.920  1.00 13.43  ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.182 -5.399  -4.499  1.00 13.17  ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.586 -5.452  -2.777  1.00 9.35   ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.425 -4.623  -2.487  1.00 9.76   ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 59.915 -3.334  -1.846  1.00 13.25  ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.616 -3.376  -0.839  1.00 12.82  ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.448 -5.372  -1.577  1.00 11.78  ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.135 -4.741  -1.093  1.00 14.09  ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.346 -3.857  0.151   1.00 14.66  ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.430 -3.965  -2.223  1.00 12.66  ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.564 -2.199  -2.450  1.00 11.62  ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 59.952 -0.890  -1.933  1.00 10.50  ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.721 -0.219  -1.365  1.00 9.01   ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.718 -0.107  -2.057  1.00 9.80   ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.565 -0.007  -3.029  1.00 12.85  ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 60.914 1.378   -2.477  1.00 11.39  ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.791 -0.694  -3.616  1.00 15.75  ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 58.788 0.196   -0.101  1.00 10.11  ? 13   ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.632 0.770   0.590   1.00 11.66  ? 13   ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 57.999 2.082   1.269   1.00 10.28  ? 13   ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 58.936 2.125   2.065   1.00 12.00  ? 13   ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.092 -0.211  1.628   1.00 9.59   ? 13   ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 55.842 0.285   2.288   1.00 10.72  ? 13   ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 55.969 1.072   3.240   1.00 11.20  ? 13   ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 54.751 -0.116  1.854   1.00 11.91  ? 13   ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.279 3.131   0.980   1.00 9.57   ? 14   MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 57.676 4.398   1.552   1.00 9.34   ? 14   MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.507 4.474   3.068   1.00 10.99  ? 14   MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.602 3.932   3.549   1.00 13.03  ? 14   MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 56.860 5.529   0.932   1.00 14.34  ? 14   MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 56.851 5.550   -0.557  1.00 12.80  ? 14   MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.510 5.596   -1.318  1.00 12.84  ? 14   MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.020 7.192   -0.763  1.00 17.15  ? 14   MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.369 5.158   3.788   1.00 9.61   ? 15   ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.182 5.341   5.207   1.00 10.70  ? 15   ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.141 6.409   5.496   1.00 11.41  ? 15   ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.151 7.425   4.893   1.00 10.53  ? 15   ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.470 5.743   5.870   1.00 11.26  ? 15   ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.579 4.711   5.688   1.00 11.65  ? 15   ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.312 3.559   5.500   1.00 12.34  ? 15   ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.690 5.101   5.784   1.00 15.97  ? 15   ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.216 6.056   6.370   1.00 8.88   ? 16   CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.182 6.982   6.873   1.00 9.82   ? 16   CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.672 7.914   5.768   1.00 9.23   ? 16   CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 54.743 9.056   5.899   1.00 10.87  ? 16   CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.451 7.651   8.208   1.00 10.71  ? 16   CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 56.976 8.569   8.320   1.00 12.74  ? 16   CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.254 7.337   4.662   1.00 9.22   ? 17   PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.273 8.090   3.419   1.00 8.22   ? 17   PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.487 9.387   3.396   1.00 9.74   ? 17   PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.035 10.330  3.049   1.00 9.91   ? 17   PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.715 7.199   2.303   1.00 10.22  ? 17   PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.723 7.806   0.945   1.00 11.05  ? 17   PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 54.814 8.470   0.466   1.00 11.95  ? 17   PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.634 7.715   0.144   1.00 12.62  ? 17   PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 54.828 9.001   -0.790  1.00 10.93  ? 17   PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.641 8.284   -1.093  1.00 13.77  ? 17   PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 53.732 8.928   -1.553  1.00 11.81  ? 17   PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.246 9.432   3.814   1.00 9.16   ? 18   PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.511 10.698  3.735   1.00 8.34   ? 18   PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.165 11.745  4.652   1.00 12.10  ? 18   PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.130 12.935  4.353   1.00 11.16  ? 18   PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.016 10.549  4.105   1.00 9.39   ? 18   PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.171 9.816   3.080   1.00 11.05  ? 18   PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 49.739 9.095   2.033   1.00 9.57   ? 18   PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 47.790 9.848   3.183   1.00 11.72  ? 18   PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 48.930 8.426   1.108   1.00 12.58  ? 18   PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 46.981 9.173   2.268   1.00 13.18  ? 18   PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.555 8.461   1.229   1.00 13.51  ? 18   PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.760 11.306  5.763   1.00 10.05  ? 19   VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.442 12.233  6.662   1.00 8.52   ? 19   VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.643 12.853  5.939   1.00 11.79  ? 19   VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 54.839 14.066  5.955   1.00 11.41  ? 19   VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 53.897 11.526  7.959   1.00 8.18   ? 19   VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 54.985 12.334  8.650   1.00 11.61  ? 19   VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.699 11.343  8.895   1.00 11.19  ? 19   VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.445 12.028  5.277   1.00 11.37  ? 20   GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.579 12.596  4.545   1.00 7.33   ? 20   GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.149 13.552  3.441   1.00 11.15  ? 20   GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 56.856 14.528  3.167   1.00 10.79  ? 20   GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.440 11.520  3.915   1.00 11.30  ? 20   GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.241 10.671  4.870   1.00 13.04  ? 20   GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.357 9.985   4.103   1.00 16.14  ? 20   GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.430 10.544  3.927   1.00 14.71  ? 20   GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.078 8.793   3.578   1.00 18.38  ? 20   GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.037 13.258  2.777   1.00 8.90   ? 21   VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.538 14.182  1.755   1.00 9.27   ? 21   VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.247 15.555  2.393   1.00 12.21  ? 21   VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.628 16.591  1.850   1.00 12.55  ? 21   VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.266 13.637  1.051   1.00 8.86   ? 21   VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.696 14.678  0.064   1.00 12.72  ? 21   VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.584 12.332  0.314   1.00 11.18  ? 21   VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.619 15.551  3.569   1.00 9.71   ? 22   GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.287 16.806  4.248   1.00 9.06   ? 22   GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.543 17.470  4.843   1.00 12.72  ? 22   GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.637 18.705  4.903   1.00 12.18  ? 22   GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.219 16.552  5.339   1.00 10.92  ? 22   GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 50.879 16.052  4.828   1.00 10.45  ? 22   GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.141 17.087  3.972   1.00 14.66  ? 22   GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.389 18.301  4.146   1.00 14.55  ? 22   GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.315 16.679  3.123   1.00 15.73  ? 22   GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.513 16.661  5.281   1.00 11.48  ? 23   GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 56.763 17.208  5.842   1.00 8.47   ? 23   GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.629 17.868  4.781   1.00 11.91  ? 23   GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.313 18.856  5.058   1.00 12.12  ? 23   GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.566 16.114  6.547   1.00 11.01  ? 23   GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 57.007 15.777  7.904   1.00 12.34  ? 23   GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.675 14.555  8.502   1.00 13.64  ? 23   GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.093 13.649  7.782   1.00 12.71  ? 23   GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 57.799 14.538  9.818   1.00 14.59  ? 23   GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.633 17.307  3.575   1.00 11.51  ? 24   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.321 17.961  2.467   1.00 9.41   ? 24   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 57.722 19.347  2.224   1.00 11.78  ? 24   ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.457 20.324  2.114   1.00 12.34  ? 24   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.239 17.118  1.189   1.00 10.71  ? 24   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 58.980 17.777  0.008   1.00 12.03  ? 24   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.032 16.860  -1.204  1.00 12.85  ? 24   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 57.746 16.752  -1.887  1.00 12.53  ? 24   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.571 16.110  -3.037  1.00 11.00  ? 24   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.596 15.494  -3.624  1.00 10.32  ? 24   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.364 16.076  -3.584  1.00 14.13  ? 24   ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.393 19.420  2.180   1.00 9.82   ? 25   GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 55.681 20.664  1.897   1.00 10.66  ? 25   GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 55.847 21.694  3.009   1.00 12.66  ? 25   GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 55.958 22.895  2.749   1.00 12.36  ? 25   GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.180 20.389  1.674   1.00 12.06  ? 25   GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.391 21.629  1.206   1.00 16.65  ? 25   GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 51.911 21.317  1.014   1.00 21.37  ? 25   GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.558 20.225  0.584   1.00 17.94  ? 25   GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.045 22.274  1.334   1.00 27.65  ? 25   GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 55.805 21.227  4.254   1.00 10.36  ? 26   ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 55.907 22.104  5.419   1.00 14.57  ? 26   ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.089 21.717  6.291   1.00 12.73  ? 26   ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 57.014 20.798  7.102   1.00 11.40  ? 26   ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.614 22.065  6.243   1.00 15.34  ? 26   ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.640 23.028  7.439   1.00 12.42  ? 26   ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.649 23.683  7.720   1.00 15.57  ? 26   ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.506 23.126  8.131   1.00 19.06  ? 26   ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.210 22.413  6.115   1.00 13.23  ? 27   PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.427 22.099  6.863   1.00 13.12  ? 27   PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.253 22.116  8.389   1.00 15.46  ? 27   PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 59.999 21.444  9.086   1.00 14.34  ? 27   PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.390 23.198  6.405   1.00 17.49  ? 27   PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 59.935 23.484  5.005   1.00 13.16  ? 27   PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.455 23.365  5.020   1.00 13.83  ? 27   PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.275 22.859  8.886   1.00 13.94  ? 28   HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.006 22.904  10.327  1.00 18.32  ? 28   HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.589 21.560  10.905  1.00 19.95  ? 28   HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 57.664 21.353  12.119  1.00 21.56  ? 28   HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 56.919 23.930  10.621  1.00 20.10  ? 28   HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.407 25.341  10.604  1.00 24.76  ? 28   HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 56.669 26.377  10.076  1.00 33.15  ? 28   HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.555 25.892  11.065  1.00 30.37  ? 28   HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.342 27.506  10.206  1.00 32.69  ? 28   HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.490 27.240  10.803  1.00 35.23  ? 28   HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.152 20.646  10.042  1.00 15.38  ? 29   LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 56.699 19.338  10.514  1.00 15.49  ? 29   LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 57.828 18.318  10.534  1.00 18.66  ? 29   LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 57.673 17.216  11.065  1.00 15.38  ? 29   LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.555 18.813  9.637   1.00 13.12  ? 29   LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.327 19.696  9.473   1.00 15.42  ? 29   LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.330 18.998  8.563   1.00 13.41  ? 29   LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 53.718 20.021  10.836  1.00 19.86  ? 29   LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 58.973 18.666  9.951   1.00 13.79  ? 30   ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.066 17.708  9.849   1.00 14.22  ? 30   ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 60.678 17.354  11.211  1.00 15.94  ? 30   ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 60.804 18.210  12.093  1.00 18.19  ? 30   ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.152 18.238  8.907   1.00 14.06  ? 30   ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.639 18.547  7.509   1.00 13.80  ? 30   ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 61.714 19.120  6.578   1.00 13.71  ? 30   ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.167 19.408  5.245   1.00 15.12  ? 30   ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 61.872 19.892  4.222   1.00 23.20  ? 30   ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.175 20.113  4.346   1.00 17.17  ? 30   ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.272 20.128  3.061   1.00 17.43  ? 30   ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.020 16.077  11.369  1.00 20.88  ? 31   ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 61.653 15.581  12.591  1.00 17.54  ? 31   ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 60.828 15.905  13.825  1.00 20.98  ? 31   ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.350 16.410  14.828  1.00 24.25  ? 31   ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.059 16.167  12.742  1.00 19.93  ? 31   ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 63.935 15.890  11.537  1.00 24.21  ? 31   ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.077 14.744  11.114  1.00 35.29  ? 31   ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.505 16.944  10.963  1.00 32.78  ? 31   ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.529 15.657  13.718  1.00 18.53  ? 32   LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.583 15.932  14.792  1.00 18.55  ? 32   LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.623 14.778  14.913  1.00 18.44  ? 32   LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.390 14.071  13.929  1.00 18.61  ? 32   LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 57.788 17.222  14.528  1.00 18.41  ? 32   LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 58.628 18.489  14.540  1.00 24.01  ? 32   LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 58.579 19.172  15.889  1.00 29.36  ? 32   LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 59.278 20.528  15.833  1.00 39.32  ? 32   LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 59.112 21.299  17.093  1.00 38.89  ? 32   LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 57.061 14.578  16.119  1.00 15.59  ? 33   PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 55.899 13.702  16.202  1.00 16.02  ? 33   PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 54.774 14.358  15.404  1.00 15.17  ? 33   PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 54.324 15.473  15.699  1.00 13.26  ? 33   PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 55.591 13.639  17.700  1.00 16.49  ? 33   PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 56.149 14.900  18.256  1.00 18.21  ? 33   PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 57.339 15.269  17.393  1.00 17.53  ? 33   PRO A CD    1 
ATOM   289  N  N     A CYS A 1 37  ? 54.340 13.683  14.356  0.49 12.86  ? 34   CYS A N     1 
ATOM   290  N  N     B CYS A 1 37  ? 54.324 13.662  14.368  0.51 12.86  ? 34   CYS A N     1 
ATOM   291  C  CA    A CYS A 1 37  ? 53.258 14.247  13.585  0.49 14.10  ? 34   CYS A CA    1 
ATOM   292  C  CA    B CYS A 1 37  ? 53.405 14.249  13.398  0.51 14.29  ? 34   CYS A CA    1 
ATOM   293  C  C     . CYS A 1 37  ? 52.468 13.177  12.867  1.00 14.34  ? 34   CYS A C     1 
ATOM   294  O  O     . CYS A 1 37  ? 52.885 12.021  12.738  1.00 16.24  ? 34   CYS A O     1 
ATOM   295  C  CB    A CYS A 1 37  ? 53.782 15.292  12.601  0.49 13.56  ? 34   CYS A CB    1 
ATOM   296  C  CB    B CYS A 1 37  ? 54.200 14.894  12.249  0.51 11.88  ? 34   CYS A CB    1 
ATOM   297  S  SG    A CYS A 1 37  ? 54.880 14.648  11.357  0.49 14.63  ? 34   CYS A SG    1 
ATOM   298  S  SG    B CYS A 1 37  ? 53.245 15.701  10.917  0.51 14.34  ? 34   CYS A SG    1 
ATOM   299  N  N     . ALA A 1 38  ? 51.249 13.552  12.508  1.00 12.00  ? 35   ALA A N     1 
ATOM   300  C  CA    . ALA A 1 38  ? 50.334 12.600  11.909  1.00 10.61  ? 35   ALA A CA    1 
ATOM   301  C  C     . ALA A 1 38  ? 49.498 13.291  10.862  1.00 10.56  ? 35   ALA A C     1 
ATOM   302  O  O     . ALA A 1 38  ? 49.342 14.518  10.899  1.00 12.54  ? 35   ALA A O     1 
ATOM   303  C  CB    . ALA A 1 38  ? 49.440 11.968  12.975  1.00 12.62  ? 35   ALA A CB    1 
ATOM   304  N  N     . VAL A 1 39  ? 48.933 12.504  9.954   1.00 10.41  ? 36   VAL A N     1 
ATOM   305  C  CA    . VAL A 1 39  ? 48.004 13.038  8.967   1.00 11.36  ? 36   VAL A CA    1 
ATOM   306  C  C     . VAL A 1 39  ? 46.590 12.589  9.309   1.00 13.12  ? 36   VAL A C     1 
ATOM   307  O  O     . VAL A 1 39  ? 46.368 11.424  9.645   1.00 12.67  ? 36   VAL A O     1 
ATOM   308  C  CB    . VAL A 1 39  ? 48.399 12.604  7.546   1.00 10.03  ? 36   VAL A CB    1 
ATOM   309  C  CG1   . VAL A 1 39  ? 47.302 12.980  6.531   1.00 14.63  ? 36   VAL A CG1   1 
ATOM   310  C  CG2   . VAL A 1 39  ? 49.728 13.265  7.161   1.00 13.18  ? 36   VAL A CG2   1 
ATOM   311  N  N     . VAL A 1 40  ? 45.643 13.529  9.280   1.00 14.52  ? 37   VAL A N     1 
ATOM   312  C  CA    . VAL A 1 40  ? 44.293 13.277  9.747   1.00 11.89  ? 37   VAL A CA    1 
ATOM   313  C  C     . VAL A 1 40  ? 43.283 13.621  8.649   1.00 16.74  ? 37   VAL A C     1 
ATOM   314  O  O     . VAL A 1 40  ? 43.545 14.493  7.882   1.00 17.67  ? 37   VAL A O     1 
ATOM   315  C  CB    . VAL A 1 40  ? 43.919 14.182  10.963  1.00 15.36  ? 37   VAL A CB    1 
ATOM   316  C  CG1   A VAL A 1 40  ? 44.729 13.614  12.237  0.44 14.57  ? 37   VAL A CG1   1 
ATOM   317  C  CG1   B VAL A 1 40  ? 43.873 15.652  10.669  0.56 15.33  ? 37   VAL A CG1   1 
ATOM   318  C  CG2   A VAL A 1 40  ? 44.372 15.637  10.785  0.44 14.48  ? 37   VAL A CG2   1 
ATOM   319  C  CG2   B VAL A 1 40  ? 42.781 13.712  11.711  0.56 13.29  ? 37   VAL A CG2   1 
ATOM   320  N  N     . GLN A 1 41  ? 42.160 12.917  8.605   1.00 15.64  ? 38   GLN A N     1 
ATOM   321  C  CA    . GLN A 1 41  ? 41.053 13.328  7.744   1.00 14.86  ? 38   GLN A CA    1 
ATOM   322  C  C     . GLN A 1 41  ? 39.867 13.725  8.572   1.00 15.12  ? 38   GLN A C     1 
ATOM   323  O  O     . GLN A 1 41  ? 39.535 13.079  9.460   1.00 15.70  ? 38   GLN A O     1 
ATOM   324  C  CB    . GLN A 1 41  ? 40.594 12.318  6.684   1.00 24.66  ? 38   GLN A CB    1 
ATOM   325  C  CG    . GLN A 1 41  ? 41.129 10.949  6.775   1.00 35.86  ? 38   GLN A CG    1 
ATOM   326  C  CD    . GLN A 1 41  ? 40.726 10.011  5.606   1.00 21.63  ? 38   GLN A CD    1 
ATOM   327  O  OE1   . GLN A 1 41  ? 40.867 10.313  4.458   1.00 22.57  ? 38   GLN A OE1   1 
ATOM   328  N  NE2   . GLN A 1 41  ? 40.228 8.894   5.959   1.00 19.98  ? 38   GLN A NE2   1 
ATOM   329  N  N     . TYR A 1 42  ? 39.331 14.874  8.221   1.00 14.42  ? 39   TYR A N     1 
ATOM   330  C  CA    . TYR A 1 42  ? 38.183 15.491  8.839   1.00 14.21  ? 39   TYR A CA    1 
ATOM   331  C  C     . TYR A 1 42  ? 38.666 15.991  10.211  1.00 19.43  ? 39   TYR A C     1 
ATOM   332  O  O     . TYR A 1 42  ? 39.822 15.871  10.497  1.00 21.65  ? 39   TYR A O     1 
ATOM   333  C  CB    . TYR A 1 42  ? 36.933 14.634  8.818   1.00 14.58  ? 39   TYR A CB    1 
ATOM   334  C  CG    . TYR A 1 42  ? 36.565 14.121  7.435   1.00 13.53  ? 39   TYR A CG    1 
ATOM   335  C  CD1   . TYR A 1 42  ? 36.235 14.963  6.437   1.00 18.72  ? 39   TYR A CD1   1 
ATOM   336  C  CD2   . TYR A 1 42  ? 36.574 12.787  7.161   1.00 15.47  ? 39   TYR A CD2   1 
ATOM   337  C  CE1   . TYR A 1 42  ? 35.909 14.497  5.200   1.00 18.64  ? 39   TYR A CE1   1 
ATOM   338  C  CE2   . TYR A 1 42  ? 36.242 12.320  5.929   1.00 16.52  ? 39   TYR A CE2   1 
ATOM   339  C  CZ    . TYR A 1 42  ? 35.918 13.189  4.950   1.00 15.52  ? 39   TYR A CZ    1 
ATOM   340  O  OH    . TYR A 1 42  ? 35.583 12.763  3.732   1.00 15.02  ? 39   TYR A OH    1 
ATOM   341  N  N     . LYS A 1 43  ? 37.796 16.588  10.980  1.00 20.12  ? 40   LYS A N     1 
ATOM   342  C  CA    . LYS A 1 43  ? 38.220 17.238  12.215  1.00 20.95  ? 40   LYS A CA    1 
ATOM   343  C  C     . LYS A 1 43  ? 37.137 17.347  13.272  1.00 25.48  ? 40   LYS A C     1 
ATOM   344  O  O     . LYS A 1 43  ? 37.418 17.329  14.419  1.00 24.77  ? 40   LYS A O     1 
ATOM   345  C  CB    . LYS A 1 43  ? 38.854 18.584  11.909  1.00 24.34  ? 40   LYS A CB    1 
ATOM   346  C  CG    . LYS A 1 43  ? 38.842 19.602  13.066  1.00 34.93  ? 40   LYS A CG    1 
ATOM   347  C  CD    . LYS A 1 43  ? 40.120 19.680  13.898  1.00 39.49  ? 40   LYS A CD    1 
ATOM   348  C  CE    . LYS A 1 43  ? 40.037 20.777  14.963  1.00 36.59  ? 40   LYS A CE    1 
ATOM   349  N  NZ    . LYS A 1 43  ? 40.745 20.399  16.187  1.00 31.92  ? 40   LYS A NZ    1 
ATOM   350  N  N     . SER A 1 44  ? 35.921 17.525  12.836  1.00 23.65  ? 41   SER A N     1 
ATOM   351  C  CA    . SER A 1 44  ? 34.851 17.771  13.737  1.00 24.44  ? 41   SER A CA    1 
ATOM   352  C  C     . SER A 1 44  ? 34.592 16.614  14.695  1.00 29.09  ? 41   SER A C     1 
ATOM   353  O  O     . SER A 1 44  ? 34.378 16.816  15.829  1.00 32.06  ? 41   SER A O     1 
ATOM   354  C  CB    . SER A 1 44  ? 33.612 18.163  12.935  1.00 31.34  ? 41   SER A CB    1 
ATOM   355  O  OG    . SER A 1 44  ? 32.830 17.049  12.697  1.00 33.01  ? 41   SER A OG    1 
ATOM   356  N  N     . TRP A 1 45  ? 34.621 15.395  14.202  1.00 28.04  ? 42   TRP A N     1 
ATOM   357  C  CA    . TRP A 1 45  ? 34.395 14.220  15.041  1.00 22.61  ? 42   TRP A CA    1 
ATOM   358  C  C     . TRP A 1 45  ? 35.707 13.751  15.667  1.00 22.30  ? 42   TRP A C     1 
ATOM   359  O  O     . TRP A 1 45  ? 36.584 13.229  14.972  1.00 21.99  ? 42   TRP A O     1 
ATOM   360  C  CB    . TRP A 1 45  ? 33.757 13.091  14.230  1.00 22.91  ? 42   TRP A CB    1 
ATOM   361  C  CG    . TRP A 1 45  ? 33.314 11.900  15.046  1.00 29.60  ? 42   TRP A CG    1 
ATOM   362  C  CD1   . TRP A 1 45  ? 34.011 10.744  15.255  1.00 31.91  ? 42   TRP A CD1   1 
ATOM   363  C  CD2   . TRP A 1 45  ? 32.063 11.740  15.725  1.00 33.49  ? 42   TRP A CD2   1 
ATOM   364  N  NE1   . TRP A 1 45  ? 33.278 9.879   16.031  1.00 35.18  ? 42   TRP A NE1   1 
ATOM   365  C  CE2   . TRP A 1 45  ? 32.077 10.467  16.333  1.00 42.25  ? 42   TRP A CE2   1 
ATOM   366  C  CE3   . TRP A 1 45  ? 30.933 12.550  15.882  1.00 37.86  ? 42   TRP A CE3   1 
ATOM   367  C  CZ2   . TRP A 1 45  ? 31.007 9.988   17.089  1.00 42.87  ? 42   TRP A CZ2   1 
ATOM   368  C  CZ3   . TRP A 1 45  ? 29.872 12.073  16.628  1.00 38.15  ? 42   TRP A CZ3   1 
ATOM   369  C  CH2   . TRP A 1 45  ? 29.915 10.803  17.221  1.00 37.74  ? 42   TRP A CH2   1 
ATOM   370  N  N     . LYS A 1 46  ? 35.820 13.987  16.974  1.00 26.13  ? 43   LYS A N     1 
ATOM   371  C  CA    . LYS A 1 46  ? 36.942 13.563  17.815  1.00 24.33  ? 43   LYS A CA    1 
ATOM   372  C  C     . LYS A 1 46  ? 38.307 13.994  17.275  1.00 24.45  ? 43   LYS A C     1 
ATOM   373  O  O     . LYS A 1 46  ? 39.316 13.301  17.473  1.00 26.17  ? 43   LYS A O     1 
ATOM   374  C  CB    . LYS A 1 46  ? 36.905 12.043  18.011  1.00 27.65  ? 43   LYS A CB    1 
ATOM   375  C  CG    . LYS A 1 46  ? 35.537 11.512  18.420  1.00 34.14  ? 43   LYS A CG    1 
ATOM   376  C  CD    . LYS A 1 46  ? 35.481 9.993   18.364  1.00 37.57  ? 43   LYS A CD    1 
ATOM   377  C  CE    . LYS A 1 46  ? 35.719 9.368   19.727  1.00 44.45  ? 43   LYS A CE    1 
ATOM   378  N  NZ    . LYS A 1 46  ? 34.717 9.823   20.735  1.00 50.57  ? 43   LYS A NZ    1 
ATOM   379  N  N     . GLY A 1 47  ? 38.331 15.140  16.603  1.00 21.70  ? 44   GLY A N     1 
ATOM   380  C  CA    . GLY A 1 47  ? 39.564 15.721  16.120  1.00 18.87  ? 44   GLY A CA    1 
ATOM   381  C  C     . GLY A 1 47  ? 40.012 15.204  14.767  1.00 15.75  ? 44   GLY A C     1 
ATOM   382  O  O     . GLY A 1 47  ? 41.003 15.685  14.235  1.00 18.44  ? 44   GLY A O     1 
ATOM   383  N  N     . GLY A 1 48  ? 39.273 14.232  14.228  1.00 21.46  ? 45   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 48  ? 39.573 13.635  12.941  1.00 20.49  ? 45   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 48  ? 40.243 12.278  13.080  1.00 20.59  ? 45   GLY A C     1 
ATOM   386  O  O     . GLY A 1 48  ? 40.791 11.949  14.136  1.00 20.87  ? 45   GLY A O     1 
ATOM   387  N  N     . GLY A 1 49  ? 40.232 11.501  12.001  1.00 17.08  ? 46   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 49  ? 40.827 10.176  12.010  1.00 15.14  ? 46   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 49  ? 42.249 10.161  11.460  1.00 16.20  ? 46   GLY A C     1 
ATOM   390  O  O     . GLY A 1 49  ? 42.504 10.652  10.366  1.00 14.97  ? 46   GLY A O     1 
ATOM   391  N  N     . ILE A 1 50  ? 43.174 9.589   12.222  1.00 13.43  ? 47   ILE A N     1 
ATOM   392  C  CA    . ILE A 1 50  ? 44.575 9.506   11.808  1.00 14.44  ? 47   ILE A CA    1 
ATOM   393  C  C     . ILE A 1 50  ? 44.784 8.415   10.759  1.00 13.83  ? 47   ILE A C     1 
ATOM   394  O  O     . ILE A 1 50  ? 44.302 7.300   10.941  1.00 17.21  ? 47   ILE A O     1 
ATOM   395  C  CB    . ILE A 1 50  ? 45.468 9.231   13.023  1.00 13.64  ? 47   ILE A CB    1 
ATOM   396  C  CG1   . ILE A 1 50  ? 45.450 10.435  13.951  1.00 20.41  ? 47   ILE A CG1   1 
ATOM   397  C  CG2   . ILE A 1 50  ? 46.900 8.877   12.599  1.00 13.57  ? 47   ILE A CG2   1 
ATOM   398  C  CD1   . ILE A 1 50  ? 46.272 10.237  15.178  1.00 26.64  ? 47   ILE A CD1   1 
ATOM   399  N  N     . ILE A 1 51  ? 45.475 8.737   9.658   1.00 12.45  ? 48   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 51  ? 45.735 7.721   8.630   1.00 13.94  ? 48   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 51  ? 47.228 7.504   8.364   1.00 11.25  ? 48   ILE A C     1 
ATOM   402  O  O     . ILE A 1 51  ? 47.595 6.560   7.662   1.00 15.36  ? 48   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 51  ? 45.007 8.042   7.289   1.00 17.43  ? 48   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 51  ? 45.403 9.397   6.710   1.00 13.45  ? 48   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 51  ? 43.479 7.986   7.478   1.00 20.72  ? 48   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 51  ? 44.841 9.619   5.299   1.00 15.71  ? 48   ILE A CD1   1 
ATOM   407  N  N     . ALA A 1 52  ? 48.088 8.338   8.956   1.00 11.83  ? 49   ALA A N     1 
ATOM   408  C  CA    . ALA A 1 52  ? 49.542 8.137   8.876   1.00 9.00   ? 49   ALA A CA    1 
ATOM   409  C  C     . ALA A 1 52  ? 50.240 8.794   10.075  1.00 10.37  ? 49   ALA A C     1 
ATOM   410  O  O     . ALA A 1 52  ? 49.782 9.825   10.572  1.00 11.69  ? 49   ALA A O     1 
ATOM   411  C  CB    . ALA A 1 52  ? 50.111 8.702   7.540   1.00 11.62  ? 49   ALA A CB    1 
ATOM   412  N  N     . VAL A 1 53  ? 51.354 8.203   10.524  1.00 9.57   ? 50   VAL A N     1 
ATOM   413  C  CA    . VAL A 1 53  ? 52.005 8.576   11.782  1.00 10.93  ? 50   VAL A CA    1 
ATOM   414  C  C     . VAL A 1 53  ? 53.520 8.543   11.643  1.00 8.94   ? 50   VAL A C     1 
ATOM   415  O  O     . VAL A 1 53  ? 54.073 7.525   11.230  1.00 11.41  ? 50   VAL A O     1 
ATOM   416  C  CB    . VAL A 1 53  ? 51.611 7.601   12.923  1.00 11.42  ? 50   VAL A CB    1 
ATOM   417  C  CG1   . VAL A 1 53  ? 52.205 8.028   14.242  1.00 14.67  ? 50   VAL A CG1   1 
ATOM   418  C  CG2   . VAL A 1 53  ? 50.095 7.465   13.027  1.00 14.92  ? 50   VAL A CG2   1 
ATOM   419  N  N     . SER A 1 54  ? 54.186 9.649   11.981  1.00 10.11  ? 51   SER A N     1 
ATOM   420  C  CA    . SER A 1 54  ? 55.641 9.700   11.929  1.00 10.60  ? 51   SER A CA    1 
ATOM   421  C  C     . SER A 1 54  ? 56.224 8.785   12.997  1.00 13.07  ? 51   SER A C     1 
ATOM   422  O  O     . SER A 1 54  ? 55.571 8.501   14.011  1.00 12.14  ? 51   SER A O     1 
ATOM   423  C  CB    . SER A 1 54  ? 56.153 11.131  12.121  1.00 13.05  ? 51   SER A CB    1 
ATOM   424  O  OG    . SER A 1 54  ? 56.182 11.511  13.497  1.00 12.87  ? 51   SER A OG    1 
ATOM   425  N  N     . TYR A 1 55  ? 57.450 8.330   12.774  1.00 11.98  ? 52   TYR A N     1 
ATOM   426  C  CA    . TYR A 1 55  ? 58.067 7.404   13.711  1.00 13.20  ? 52   TYR A CA    1 
ATOM   427  C  C     . TYR A 1 55  ? 58.299 8.046   15.077  1.00 14.64  ? 52   TYR A C     1 
ATOM   428  O  O     . TYR A 1 55  ? 58.178 7.368   16.096  1.00 13.72  ? 52   TYR A O     1 
ATOM   429  C  CB    . TYR A 1 55  ? 59.356 6.833   13.106  1.00 13.08  ? 52   TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 55  ? 59.014 5.755   12.112  1.00 12.63  ? 52   TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 55  ? 58.611 6.071   10.812  1.00 10.27  ? 52   TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 55  ? 59.025 4.419   12.486  1.00 15.15  ? 52   TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 55  ? 58.232 5.072   9.912   1.00 12.34  ? 52   TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 55  ? 58.677 3.417   11.590  1.00 14.40  ? 52   TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 55  ? 58.280 3.744   10.304  1.00 13.09  ? 52   TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 55  ? 57.922 2.743   9.408   1.00 14.56  ? 52   TYR A OH    1 
ATOM   437  N  N     . GLU A 1 56  ? 58.545 9.352   15.111  1.00 13.72  ? 53   GLU A N     1 
ATOM   438  C  CA    . GLU A 1 56  ? 58.630 10.053  16.388  1.00 15.19  ? 53   GLU A CA    1 
ATOM   439  C  C     . GLU A 1 56  ? 57.308 9.929   17.151  1.00 15.62  ? 53   GLU A C     1 
ATOM   440  O  O     . GLU A 1 56  ? 57.289 9.739   18.362  1.00 16.37  ? 53   GLU A O     1 
ATOM   441  C  CB    . GLU A 1 56  ? 58.985 11.530  16.175  1.00 14.40  ? 53   GLU A CB    1 
ATOM   442  C  CG    . GLU A 1 56  ? 60.379 11.801  15.609  1.00 19.72  ? 53   GLU A CG    1 
ATOM   443  C  CD    . GLU A 1 56  ? 60.524 11.558  14.105  1.00 27.87  ? 53   GLU A CD    1 
ATOM   444  O  OE1   . GLU A 1 56  ? 59.534 11.198  13.435  1.00 20.09  ? 53   GLU A OE1   1 
ATOM   445  O  OE2   . GLU A 1 56  ? 61.647 11.749  13.589  1.00 27.20  ? 53   GLU A OE2   1 
ATOM   446  N  N     . ALA A 1 57  ? 56.189 10.045  16.442  1.00 10.94  ? 54   ALA A N     1 
ATOM   447  C  CA    . ALA A 1 57  ? 54.892 9.950   17.099  1.00 11.12  ? 54   ALA A CA    1 
ATOM   448  C  C     . ALA A 1 57  ? 54.562 8.505   17.518  1.00 12.72  ? 54   ALA A C     1 
ATOM   449  O  O     . ALA A 1 57  ? 53.906 8.283   18.536  1.00 13.68  ? 54   ALA A O     1 
ATOM   450  C  CB    . ALA A 1 57  ? 53.794 10.518  16.185  1.00 13.34  ? 54   ALA A CB    1 
ATOM   451  N  N     . ARG A 1 58  ? 55.042 7.515   16.762  1.00 13.14  ? 55   ARG A N     1 
ATOM   452  C  CA    . ARG A 1 58  ? 54.780 6.121   17.118  1.00 13.14  ? 55   ARG A CA    1 
ATOM   453  C  C     . ARG A 1 58  ? 55.385 5.776   18.478  1.00 17.10  ? 55   ARG A C     1 
ATOM   454  O  O     . ARG A 1 58  ? 54.858 4.933   19.203  1.00 17.58  ? 55   ARG A O     1 
ATOM   455  C  CB    . ARG A 1 58  ? 55.331 5.182   16.045  1.00 12.70  ? 55   ARG A CB    1 
ATOM   456  C  CG    . ARG A 1 58  ? 54.739 5.440   14.659  1.00 15.70  ? 55   ARG A CG    1 
ATOM   457  C  CD    . ARG A 1 58  ? 55.153 4.409   13.616  1.00 14.84  ? 55   ARG A CD    1 
ATOM   458  N  NE    . ARG A 1 58  ? 54.714 4.862   12.297  1.00 12.91  ? 55   ARG A NE    1 
ATOM   459  C  CZ    . ARG A 1 58  ? 54.755 4.149   11.181  1.00 14.06  ? 55   ARG A CZ    1 
ATOM   460  N  NH1   . ARG A 1 58  ? 55.218 2.913   11.189  1.00 16.47  ? 55   ARG A NH1   1 
ATOM   461  N  NH2   . ARG A 1 58  ? 54.325 4.701   10.051  1.00 14.44  ? 55   ARG A NH2   1 
ATOM   462  N  N     . ALA A 1 59  ? 56.474 6.463   18.812  1.00 15.60  ? 56   ALA A N     1 
ATOM   463  C  CA    . ALA A 1 59  ? 57.184 6.216   20.063  1.00 19.73  ? 56   ALA A CA    1 
ATOM   464  C  C     . ALA A 1 59  ? 56.302 6.544   21.271  1.00 19.26  ? 56   ALA A C     1 
ATOM   465  O  O     . ALA A 1 59  ? 56.518 6.019   22.364  1.00 20.49  ? 56   ALA A O     1 
ATOM   466  C  CB    . ALA A 1 59  ? 58.475 7.021   20.106  1.00 15.71  ? 56   ALA A CB    1 
ATOM   467  N  N     . PHE A 1 60  ? 55.313 7.407   21.066  1.00 14.68  ? 57   PHE A N     1 
ATOM   468  C  CA    . PHE A 1 60  ? 54.342 7.754   22.109  1.00 14.30  ? 57   PHE A CA    1 
ATOM   469  C  C     . PHE A 1 60  ? 53.135 6.831   22.109  1.00 14.93  ? 57   PHE A C     1 
ATOM   470  O  O     . PHE A 1 60  ? 52.245 6.975   22.945  1.00 20.34  ? 57   PHE A O     1 
ATOM   471  C  CB    . PHE A 1 60  ? 53.837 9.191   21.943  1.00 14.02  ? 57   PHE A CB    1 
ATOM   472  C  CG    . PHE A 1 60  ? 54.853 10.248  22.278  1.00 16.28  ? 57   PHE A CG    1 
ATOM   473  C  CD1   . PHE A 1 60  ? 54.855 10.855  23.532  1.00 20.32  ? 57   PHE A CD1   1 
ATOM   474  C  CD2   . PHE A 1 60  ? 55.785 10.653  21.343  1.00 16.74  ? 57   PHE A CD2   1 
ATOM   475  C  CE1   . PHE A 1 60  ? 55.780 11.838  23.847  1.00 27.99  ? 57   PHE A CE1   1 
ATOM   476  C  CE2   . PHE A 1 60  ? 56.717 11.643  21.649  1.00 18.18  ? 57   PHE A CE2   1 
ATOM   477  C  CZ    . PHE A 1 60  ? 56.709 12.236  22.905  1.00 25.78  ? 57   PHE A CZ    1 
ATOM   478  N  N     . GLY A 1 61  ? 53.075 5.924   21.138  1.00 15.88  ? 58   GLY A N     1 
ATOM   479  C  CA    . GLY A 1 61  ? 51.954 5.004   21.021  1.00 19.37  ? 58   GLY A CA    1 
ATOM   480  C  C     . GLY A 1 61  ? 50.844 5.453   20.082  1.00 18.74  ? 58   GLY A C     1 
ATOM   481  O  O     . GLY A 1 61  ? 49.762 4.854   20.033  1.00 18.08  ? 58   GLY A O     1 
ATOM   482  N  N     . VAL A 1 62  ? 51.102 6.508   19.320  1.00 14.25  ? 59   VAL A N     1 
ATOM   483  C  CA    . VAL A 1 62  ? 50.134 6.966   18.335  1.00 17.06  ? 59   VAL A CA    1 
ATOM   484  C  C     . VAL A 1 62  ? 50.083 5.989   17.168  1.00 14.41  ? 59   VAL A C     1 
ATOM   485  O  O     . VAL A 1 62  ? 51.121 5.580   16.633  1.00 15.55  ? 59   VAL A O     1 
ATOM   486  C  CB    . VAL A 1 62  ? 50.473 8.379   17.824  1.00 12.76  ? 59   VAL A CB    1 
ATOM   487  C  CG1   . VAL A 1 62  ? 49.418 8.857   16.806  1.00 15.53  ? 59   VAL A CG1   1 
ATOM   488  C  CG2   . VAL A 1 62  ? 50.541 9.342   18.984  1.00 15.75  ? 59   VAL A CG2   1 
ATOM   489  N  N     . THR A 1 63  ? 48.873 5.622   16.761  1.00 17.19  ? 60   THR A N     1 
ATOM   490  C  CA    . THR A 1 63  ? 48.699 4.706   15.637  1.00 15.93  ? 60   THR A CA    1 
ATOM   491  C  C     . THR A 1 63  ? 47.672 5.216   14.642  1.00 22.14  ? 60   THR A C     1 
ATOM   492  O  O     . THR A 1 63  ? 46.864 6.090   14.952  1.00 20.75  ? 60   THR A O     1 
ATOM   493  C  CB    . THR A 1 63  ? 48.248 3.310   16.093  1.00 17.94  ? 60   THR A CB    1 
ATOM   494  O  OG1   . THR A 1 63  ? 46.924 3.396   16.640  1.00 22.91  ? 60   THR A OG1   1 
ATOM   495  C  CG2   . THR A 1 63  ? 49.203 2.738   17.133  1.00 19.67  ? 60   THR A CG2   1 
ATOM   496  N  N     . ARG A 1 64  ? 47.716 4.652   13.443  1.00 18.21  ? 61   ARG A N     1 
ATOM   497  C  CA    . ARG A 1 64  ? 46.656 4.815   12.455  1.00 21.77  ? 61   ARG A CA    1 
ATOM   498  C  C     . ARG A 1 64  ? 45.325 4.325   13.050  1.00 19.82  ? 61   ARG A C     1 
ATOM   499  O  O     . ARG A 1 64  ? 45.332 3.464   13.930  1.00 23.65  ? 61   ARG A O     1 
ATOM   500  C  CB    . ARG A 1 64  ? 47.031 4.048   11.179  1.00 24.69  ? 61   ARG A CB    1 
ATOM   501  C  CG    A ARG A 1 64  ? 45.890 3.818   10.207  0.49 30.26  ? 61   ARG A CG    1 
ATOM   502  C  CG    B ARG A 1 64  ? 46.067 4.175   10.021  0.51 29.81  ? 61   ARG A CG    1 
ATOM   503  C  CD    A ARG A 1 64  ? 46.370 3.137   8.941   0.49 24.09  ? 61   ARG A CD    1 
ATOM   504  C  CD    B ARG A 1 64  ? 46.457 3.173   8.959   0.51 23.95  ? 61   ARG A CD    1 
ATOM   505  N  NE    A ARG A 1 64  ? 47.390 3.927   8.262   0.49 19.88  ? 61   ARG A NE    1 
ATOM   506  N  NE    B ARG A 1 64  ? 46.934 1.942   9.584   0.51 33.26  ? 61   ARG A NE    1 
ATOM   507  C  CZ    A ARG A 1 64  ? 48.600 3.476   7.949   0.49 20.35  ? 61   ARG A CZ    1 
ATOM   508  C  CZ    B ARG A 1 64  ? 46.163 0.896   9.864   0.51 33.15  ? 61   ARG A CZ    1 
ATOM   509  N  NH1   A ARG A 1 64  ? 48.947 2.230   8.247   0.49 24.49  ? 61   ARG A NH1   1 
ATOM   510  N  NH1   B ARG A 1 64  ? 44.873 0.915   9.550   0.51 33.71  ? 61   ARG A NH1   1 
ATOM   511  N  NH2   A ARG A 1 64  ? 49.465 4.273   7.334   0.49 17.60  ? 61   ARG A NH2   1 
ATOM   512  N  NH2   B ARG A 1 64  ? 46.686 -0.178  10.440  0.51 36.79  ? 61   ARG A NH2   1 
ATOM   513  N  N     . SER A 1 65  ? 44.205 4.895   12.587  1.00 19.67  ? 62   SER A N     1 
ATOM   514  C  CA    . SER A 1 65  ? 42.835 4.584   13.038  1.00 30.60  ? 62   SER A CA    1 
ATOM   515  C  C     . SER A 1 65  ? 42.457 5.317   14.320  1.00 30.15  ? 62   SER A C     1 
ATOM   516  O  O     . SER A 1 65  ? 41.282 5.415   14.668  1.00 34.21  ? 62   SER A O     1 
ATOM   517  C  CB    . SER A 1 65  ? 42.621 3.084   13.260  1.00 36.36  ? 62   SER A CB    1 
ATOM   518  O  OG    . SER A 1 65  ? 43.090 2.710   14.545  1.00 45.36  ? 62   SER A OG    1 
ATOM   519  N  N     . MET A 1 66  ? 43.458 5.819   15.025  1.00 24.22  ? 63   MET A N     1 
ATOM   520  C  CA    . MET A 1 66  ? 43.233 6.559   16.257  1.00 20.02  ? 63   MET A CA    1 
ATOM   521  C  C     . MET A 1 66  ? 42.573 7.911   15.959  1.00 23.44  ? 63   MET A C     1 
ATOM   522  O  O     . MET A 1 66  ? 42.920 8.569   14.976  1.00 20.64  ? 63   MET A O     1 
ATOM   523  C  CB    . MET A 1 66  ? 44.570 6.745   16.971  1.00 21.88  ? 63   MET A CB    1 
ATOM   524  C  CG    . MET A 1 66  ? 44.509 7.040   18.428  1.00 29.00  ? 63   MET A CG    1 
ATOM   525  S  SD    . MET A 1 66  ? 46.193 6.961   19.075  1.00 25.83  ? 63   MET A SD    1 
ATOM   526  C  CE    . MET A 1 66  ? 46.299 5.299   19.678  1.00 22.43  ? 63   MET A CE    1 
ATOM   527  N  N     . TRP A 1 67  ? 41.609 8.318   16.786  1.00 19.14  ? 64   TRP A N     1 
ATOM   528  C  CA    . TRP A 1 67  ? 41.095 9.685   16.701  1.00 19.92  ? 64   TRP A CA    1 
ATOM   529  C  C     . TRP A 1 67  ? 42.172 10.658  17.170  1.00 17.97  ? 64   TRP A C     1 
ATOM   530  O  O     . TRP A 1 67  ? 42.894 10.370  18.124  1.00 19.38  ? 64   TRP A O     1 
ATOM   531  C  CB    . TRP A 1 67  ? 39.818 9.844   17.532  1.00 21.82  ? 64   TRP A CB    1 
ATOM   532  C  CG    . TRP A 1 67  ? 38.716 8.958   17.050  1.00 22.33  ? 64   TRP A CG    1 
ATOM   533  C  CD1   . TRP A 1 67  ? 38.174 7.893   17.706  1.00 27.27  ? 64   TRP A CD1   1 
ATOM   534  C  CD2   . TRP A 1 67  ? 38.041 9.047   15.791  1.00 22.35  ? 64   TRP A CD2   1 
ATOM   535  N  NE1   . TRP A 1 67  ? 37.190 7.320   16.936  1.00 30.76  ? 64   TRP A NE1   1 
ATOM   536  C  CE2   . TRP A 1 67  ? 37.090 8.009   15.755  1.00 34.98  ? 64   TRP A CE2   1 
ATOM   537  C  CE3   . TRP A 1 67  ? 38.146 9.907   14.692  1.00 17.54  ? 64   TRP A CE3   1 
ATOM   538  C  CZ2   . TRP A 1 67  ? 36.247 7.806   14.662  1.00 29.82  ? 64   TRP A CZ2   1 
ATOM   539  C  CZ3   . TRP A 1 67  ? 37.308 9.705   13.607  1.00 20.89  ? 64   TRP A CZ3   1 
ATOM   540  C  CH2   . TRP A 1 67  ? 36.374 8.661   13.600  1.00 28.19  ? 64   TRP A CH2   1 
ATOM   541  N  N     . ALA A 1 68  ? 42.298 11.806  16.503  1.00 14.89  ? 65   ALA A N     1 
ATOM   542  C  CA    . ALA A 1 68  ? 43.338 12.767  16.868  1.00 16.54  ? 65   ALA A CA    1 
ATOM   543  C  C     . ALA A 1 68  ? 43.193 13.240  18.315  1.00 19.90  ? 65   ALA A C     1 
ATOM   544  O  O     . ALA A 1 68  ? 44.192 13.464  19.001  1.00 17.63  ? 65   ALA A O     1 
ATOM   545  C  CB    . ALA A 1 68  ? 43.333 13.966  15.912  1.00 19.45  ? 65   ALA A CB    1 
ATOM   546  N  N     . ASP A 1 69  ? 41.962 13.384  18.794  1.00 21.96  ? 66   ASP A N     1 
ATOM   547  C  CA    . ASP A 1 69  ? 41.790 13.820  20.178  1.00 20.72  ? 66   ASP A CA    1 
ATOM   548  C  C     . ASP A 1 69  ? 42.396 12.807  21.159  1.00 19.19  ? 66   ASP A C     1 
ATOM   549  O  O     . ASP A 1 69  ? 42.941 13.186  22.198  1.00 20.40  ? 66   ASP A O     1 
ATOM   550  C  CB    . ASP A 1 69  ? 40.321 14.044  20.503  1.00 23.02  ? 66   ASP A CB    1 
ATOM   551  C  CG    . ASP A 1 69  ? 39.776 15.325  19.893  1.00 21.48  ? 66   ASP A CG    1 
ATOM   552  O  OD1   . ASP A 1 69  ? 40.566 16.151  19.382  1.00 24.31  ? 66   ASP A OD1   1 
ATOM   553  O  OD2   . ASP A 1 69  ? 38.552 15.508  19.949  1.00 28.30  ? 66   ASP A OD2   1 
ATOM   554  N  N     . ASP A 1 70  ? 42.310 11.527  20.818  1.00 16.71  ? 67   ASP A N     1 
ATOM   555  C  CA    . ASP A 1 70  ? 42.871 10.473  21.659  1.00 16.74  ? 67   ASP A CA    1 
ATOM   556  C  C     . ASP A 1 70  ? 44.384 10.395  21.497  1.00 18.48  ? 67   ASP A C     1 
ATOM   557  O  O     . ASP A 1 70  ? 45.120 10.221  22.468  1.00 15.73  ? 67   ASP A O     1 
ATOM   558  C  CB    . ASP A 1 70  ? 42.216 9.130   21.329  1.00 18.68  ? 67   ASP A CB    1 
ATOM   559  C  CG    . ASP A 1 70  ? 40.729 9.132   21.625  1.00 29.25  ? 67   ASP A CG    1 
ATOM   560  O  OD1   . ASP A 1 70  ? 40.312 9.888   22.531  1.00 24.54  ? 67   ASP A OD1   1 
ATOM   561  O  OD2   . ASP A 1 70  ? 39.980 8.406   20.939  1.00 29.90  ? 67   ASP A OD2   1 
ATOM   562  N  N     . ALA A 1 71  ? 44.864 10.555  20.270  1.00 14.44  ? 68   ALA A N     1 
ATOM   563  C  CA    . ALA A 1 71  ? 46.308 10.628  20.054  1.00 15.98  ? 68   ALA A CA    1 
ATOM   564  C  C     . ALA A 1 71  ? 46.954 11.764  20.860  1.00 16.10  ? 68   ALA A C     1 
ATOM   565  O  O     . ALA A 1 71  ? 48.040 11.604  21.398  1.00 16.17  ? 68   ALA A O     1 
ATOM   566  C  CB    . ALA A 1 71  ? 46.606 10.807  18.573  1.00 16.35  ? 68   ALA A CB    1 
ATOM   567  N  N     . LYS A 1 72  ? 46.275 12.910  20.928  1.00 13.27  ? 69   LYS A N     1 
ATOM   568  C  CA    . LYS A 1 72  ? 46.761 14.062  21.695  1.00 16.16  ? 69   LYS A CA    1 
ATOM   569  C  C     . LYS A 1 72  ? 46.906 13.753  23.191  1.00 19.21  ? 69   LYS A C     1 
ATOM   570  O  O     . LYS A 1 72  ? 47.700 14.389  23.901  1.00 17.35  ? 69   LYS A O     1 
ATOM   571  C  CB    . LYS A 1 72  ? 45.819 15.255  21.502  1.00 17.73  ? 69   LYS A CB    1 
ATOM   572  C  CG    . LYS A 1 72  ? 46.136 16.113  20.278  1.00 21.07  ? 69   LYS A CG    1 
ATOM   573  C  CD    . LYS A 1 72  ? 47.460 16.847  20.465  1.00 22.08  ? 69   LYS A CD    1 
ATOM   574  C  CE    . LYS A 1 72  ? 47.624 17.972  19.456  1.00 28.41  ? 69   LYS A CE    1 
ATOM   575  N  NZ    . LYS A 1 72  ? 48.912 18.692  19.677  1.00 23.40  ? 69   LYS A NZ    1 
ATOM   576  N  N     . LYS A 1 73  ? 46.138 12.773  23.669  1.00 16.15  ? 70   LYS A N     1 
ATOM   577  C  CA    . LYS A 1 73  ? 46.236 12.359  25.057  1.00 14.56  ? 70   LYS A CA    1 
ATOM   578  C  C     . LYS A 1 73  ? 47.560 11.643  25.300  1.00 19.09  ? 70   LYS A C     1 
ATOM   579  O  O     . LYS A 1 73  ? 48.167 11.811  26.349  1.00 21.05  ? 70   LYS A O     1 
ATOM   580  C  CB    . LYS A 1 73  ? 45.054 11.464  25.438  1.00 12.15  ? 70   LYS A CB    1 
ATOM   581  C  CG    . LYS A 1 73  ? 43.712 12.135  25.240  1.00 12.17  ? 70   LYS A CG    1 
ATOM   582  C  CD    . LYS A 1 73  ? 42.567 11.143  25.424  1.00 15.57  ? 70   LYS A CD    1 
ATOM   583  C  CE    . LYS A 1 73  ? 41.211 11.804  25.160  1.00 18.69  ? 70   LYS A CE    1 
ATOM   584  N  NZ    . LYS A 1 73  ? 40.115 10.795  25.172  1.00 21.46  ? 70   LYS A NZ    1 
ATOM   585  N  N     . LEU A 1 74  ? 48.007 10.861  24.322  1.00 18.67  ? 71   LEU A N     1 
ATOM   586  C  CA    . LEU A 1 74  ? 49.297 10.162  24.428  1.00 17.85  ? 71   LEU A CA    1 
ATOM   587  C  C     . LEU A 1 74  ? 50.470 11.078  24.111  1.00 20.66  ? 71   LEU A C     1 
ATOM   588  O  O     . LEU A 1 74  ? 51.583 10.887  24.616  1.00 21.13  ? 71   LEU A O     1 
ATOM   589  C  CB    . LEU A 1 74  ? 49.349 8.964   23.481  1.00 14.73  ? 71   LEU A CB    1 
ATOM   590  C  CG    . LEU A 1 74  ? 48.308 7.861   23.630  1.00 17.87  ? 71   LEU A CG    1 
ATOM   591  C  CD1   . LEU A 1 74  ? 48.565 6.838   22.532  1.00 20.91  ? 71   LEU A CD1   1 
ATOM   592  C  CD2   . LEU A 1 74  ? 48.407 7.205   25.007  1.00 18.71  ? 71   LEU A CD2   1 
ATOM   593  N  N     . CYS A 1 75  ? 50.212 12.065  23.258  1.00 16.39  ? 72   CYS A N     1 
ATOM   594  C  CA    . CYS A 1 75  ? 51.266 12.891  22.700  1.00 20.43  ? 72   CYS A CA    1 
ATOM   595  C  C     . CYS A 1 75  ? 50.759 14.323  22.539  1.00 24.63  ? 72   CYS A C     1 
ATOM   596  O  O     . CYS A 1 75  ? 50.338 14.724  21.463  1.00 17.56  ? 72   CYS A O     1 
ATOM   597  C  CB    . CYS A 1 75  ? 51.731 12.295  21.367  1.00 18.92  ? 72   CYS A CB    1 
ATOM   598  S  SG    . CYS A 1 75  ? 53.078 13.197  20.553  1.00 19.87  ? 72   CYS A SG    1 
ATOM   599  N  N     . PRO A 1 76  ? 50.783 15.098  23.632  1.00 19.62  ? 73   PRO A N     1 
ATOM   600  C  CA    . PRO A 1 76  ? 50.234 16.459  23.659  1.00 22.97  ? 73   PRO A CA    1 
ATOM   601  C  C     . PRO A 1 76  ? 50.811 17.370  22.572  1.00 17.65  ? 73   PRO A C     1 
ATOM   602  O  O     . PRO A 1 76  ? 50.084 18.203  22.036  1.00 22.52  ? 73   PRO A O     1 
ATOM   603  C  CB    . PRO A 1 76  ? 50.623 16.962  25.055  1.00 22.78  ? 73   PRO A CB    1 
ATOM   604  C  CG    . PRO A 1 76  ? 50.740 15.730  25.874  1.00 30.26  ? 73   PRO A CG    1 
ATOM   605  C  CD    . PRO A 1 76  ? 51.298 14.681  24.950  1.00 23.97  ? 73   PRO A CD    1 
ATOM   606  N  N     . ASP A 1 77  ? 52.086 17.192  22.244  1.00 21.79  ? 74   ASP A N     1 
ATOM   607  C  CA    . ASP A 1 77  ? 52.735 18.053  21.257  1.00 27.53  ? 74   ASP A CA    1 
ATOM   608  C  C     . ASP A 1 77  ? 52.677 17.494  19.833  1.00 19.31  ? 74   ASP A C     1 
ATOM   609  O  O     . ASP A 1 77  ? 53.348 18.018  18.945  1.00 21.34  ? 74   ASP A O     1 
ATOM   610  C  CB    . ASP A 1 77  ? 54.199 18.298  21.639  1.00 21.67  ? 74   ASP A CB    1 
ATOM   611  C  CG    . ASP A 1 77  ? 54.347 19.001  22.971  1.00 32.68  ? 74   ASP A CG    1 
ATOM   612  O  OD1   . ASP A 1 77  ? 55.241 18.604  23.750  1.00 40.59  ? 74   ASP A OD1   1 
ATOM   613  O  OD2   . ASP A 1 77  ? 53.576 19.949  23.236  1.00 34.48  ? 74   ASP A OD2   1 
ATOM   614  N  N     . LEU A 1 78  ? 51.885 16.441  19.616  1.00 17.11  ? 75   LEU A N     1 
ATOM   615  C  CA    . LEU A 1 78  ? 51.671 15.886  18.271  1.00 13.68  ? 75   LEU A CA    1 
ATOM   616  C  C     . LEU A 1 78  ? 51.259 16.962  17.280  1.00 16.58  ? 75   LEU A C     1 
ATOM   617  O  O     . LEU A 1 78  ? 50.285 17.686  17.513  1.00 16.80  ? 75   LEU A O     1 
ATOM   618  C  CB    . LEU A 1 78  ? 50.582 14.806  18.298  1.00 13.89  ? 75   LEU A CB    1 
ATOM   619  C  CG    . LEU A 1 78  ? 50.211 14.094  16.995  1.00 13.73  ? 75   LEU A CG    1 
ATOM   620  C  CD1   . LEU A 1 78  ? 51.370 13.211  16.534  1.00 13.84  ? 75   LEU A CD1   1 
ATOM   621  C  CD2   . LEU A 1 78  ? 48.951 13.266  17.198  1.00 14.09  ? 75   LEU A CD2   1 
ATOM   622  N  N     . LEU A 1 79  ? 51.980 17.050  16.167  1.00 12.30  ? 76   LEU A N     1 
ATOM   623  C  CA    . LEU A 1 79  ? 51.596 17.991  15.117  1.00 12.11  ? 76   LEU A CA    1 
ATOM   624  C  C     . LEU A 1 79  ? 50.705 17.281  14.102  1.00 17.35  ? 76   LEU A C     1 
ATOM   625  O  O     . LEU A 1 79  ? 50.830 16.080  13.891  1.00 14.90  ? 76   LEU A O     1 
ATOM   626  C  CB    . LEU A 1 79  ? 52.842 18.589  14.453  1.00 11.04  ? 76   LEU A CB    1 
ATOM   627  C  CG    . LEU A 1 79  ? 53.798 19.300  15.413  1.00 13.12  ? 76   LEU A CG    1 
ATOM   628  C  CD1   . LEU A 1 79  ? 54.981 19.866  14.647  1.00 14.65  ? 76   LEU A CD1   1 
ATOM   629  C  CD2   . LEU A 1 79  ? 53.060 20.423  16.160  1.00 14.32  ? 76   LEU A CD2   1 
ATOM   630  N  N     . LEU A 1 80  ? 49.791 18.020  13.485  1.00 15.58  ? 77   LEU A N     1 
ATOM   631  C  CA    . LEU A 1 80  ? 48.854 17.409  12.551  1.00 18.41  ? 77   LEU A CA    1 
ATOM   632  C  C     . LEU A 1 80  ? 48.814 18.147  11.233  1.00 17.95  ? 77   LEU A C     1 
ATOM   633  O  O     . LEU A 1 80  ? 48.889 19.373  11.190  1.00 23.98  ? 77   LEU A O     1 
ATOM   634  C  CB    . LEU A 1 80  ? 47.448 17.367  13.135  1.00 17.97  ? 77   LEU A CB    1 
ATOM   635  C  CG    . LEU A 1 80  ? 47.262 16.628  14.451  1.00 17.53  ? 77   LEU A CG    1 
ATOM   636  C  CD1   . LEU A 1 80  ? 45.861 16.871  14.961  1.00 17.78  ? 77   LEU A CD1   1 
ATOM   637  C  CD2   . LEU A 1 80  ? 47.527 15.139  14.246  1.00 18.43  ? 77   LEU A CD2   1 
ATOM   638  N  N     . ALA A 1 81  ? 48.694 17.383  10.159  1.00 13.76  ? 78   ALA A N     1 
ATOM   639  C  CA    . ALA A 1 81  ? 48.384 17.932  8.846   1.00 12.94  ? 78   ALA A CA    1 
ATOM   640  C  C     . ALA A 1 81  ? 47.092 17.308  8.357   1.00 13.15  ? 78   ALA A C     1 
ATOM   641  O  O     . ALA A 1 81  ? 46.899 16.097  8.479   1.00 14.12  ? 78   ALA A O     1 
ATOM   642  C  CB    . ALA A 1 81  ? 49.513 17.663  7.860   1.00 16.88  ? 78   ALA A CB    1 
ATOM   643  N  N     . GLN A 1 82  ? 46.211 18.136  7.805   1.00 17.14  ? 79   GLN A N     1 
ATOM   644  C  CA    . GLN A 1 82  ? 44.901 17.667  7.365   1.00 15.98  ? 79   GLN A CA    1 
ATOM   645  C  C     . GLN A 1 82  ? 44.879 17.329  5.886   1.00 12.40  ? 79   GLN A C     1 
ATOM   646  O  O     . GLN A 1 82  ? 45.418 18.076  5.062   1.00 16.37  ? 79   GLN A O     1 
ATOM   647  C  CB    . GLN A 1 82  ? 43.825 18.724  7.630   1.00 17.10  ? 79   GLN A CB    1 
ATOM   648  C  CG    . GLN A 1 82  ? 43.543 19.022  9.088   1.00 25.53  ? 79   GLN A CG    1 
ATOM   649  C  CD    . GLN A 1 82  ? 42.370 19.967  9.247   1.00 33.48  ? 79   GLN A CD    1 
ATOM   650  O  OE1   . GLN A 1 82  ? 42.546 21.137  9.585   1.00 32.57  ? 79   GLN A OE1   1 
ATOM   651  N  NE2   . GLN A 1 82  ? 41.163 19.466  8.984   1.00 33.89  ? 79   GLN A NE2   1 
ATOM   652  N  N     . VAL A 1 83  ? 44.239 16.210  5.563   1.00 12.67  ? 80   VAL A N     1 
ATOM   653  C  CA    . VAL A 1 83  ? 43.920 15.887  4.177   1.00 13.19  ? 80   VAL A CA    1 
ATOM   654  C  C     . VAL A 1 83  ? 43.043 16.985  3.591   1.00 14.49  ? 80   VAL A C     1 
ATOM   655  O  O     . VAL A 1 83  ? 42.156 17.492  4.247   1.00 13.78  ? 80   VAL A O     1 
ATOM   656  C  CB    . VAL A 1 83  ? 43.193 14.528  4.069   1.00 11.59  ? 80   VAL A CB    1 
ATOM   657  C  CG1   . VAL A 1 83  ? 42.781 14.224  2.633   1.00 14.57  ? 80   VAL A CG1   1 
ATOM   658  C  CG2   . VAL A 1 83  ? 44.080 13.399  4.629   1.00 13.82  ? 80   VAL A CG2   1 
ATOM   659  N  N     . ARG A 1 84  ? 43.324 17.341  2.348   1.00 13.24  ? 81   ARG A N     1 
ATOM   660  C  CA    . ARG A 1 84  ? 42.544 18.336  1.621   1.00 11.55  ? 81   ARG A CA    1 
ATOM   661  C  C     . ARG A 1 84  ? 41.084 17.941  1.540   1.00 15.52  ? 81   ARG A C     1 
ATOM   662  O  O     . ARG A 1 84  ? 40.769 16.758  1.404   1.00 13.89  ? 81   ARG A O     1 
ATOM   663  C  CB    . ARG A 1 84  ? 43.115 18.485  0.218   1.00 16.29  ? 81   ARG A CB    1 
ATOM   664  C  CG    . ARG A 1 84  ? 42.292 19.358  -0.719  1.00 19.87  ? 81   ARG A CG    1 
ATOM   665  C  CD    . ARG A 1 84  ? 42.787 19.177  -2.139  1.00 35.42  ? 81   ARG A CD    1 
ATOM   666  N  NE    . ARG A 1 84  ? 42.564 20.354  -2.969  1.00 52.77  ? 81   ARG A NE    1 
ATOM   667  C  CZ    . ARG A 1 84  ? 42.760 20.379  -4.283  1.00 58.82  ? 81   ARG A CZ    1 
ATOM   668  N  NH1   . ARG A 1 84  ? 43.180 19.287  -4.910  1.00 51.57  ? 81   ARG A NH1   1 
ATOM   669  N  NH2   . ARG A 1 84  ? 42.532 21.491  -4.969  1.00 63.10  ? 81   ARG A NH2   1 
ATOM   670  N  N     . GLU A 1 85  ? 40.195 18.927  1.622   1.00 12.52  ? 82   GLU A N     1 
ATOM   671  C  CA    . GLU A 1 85  ? 38.796 18.696  1.337   1.00 15.69  ? 82   GLU A CA    1 
ATOM   672  C  C     . GLU A 1 85  ? 38.391 19.468  0.089   1.00 13.67  ? 82   GLU A C     1 
ATOM   673  O  O     . GLU A 1 85  ? 38.677 20.663  -0.034  1.00 15.35  ? 82   GLU A O     1 
ATOM   674  C  CB    . GLU A 1 85  ? 37.930 19.086  2.544   1.00 19.57  ? 82   GLU A CB    1 
ATOM   675  C  CG    . GLU A 1 85  ? 37.951 17.999  3.626   1.00 26.64  ? 82   GLU A CG    1 
ATOM   676  C  CD    . GLU A 1 85  ? 37.232 18.377  4.917   1.00 36.14  ? 82   GLU A CD    1 
ATOM   677  O  OE1   . GLU A 1 85  ? 36.064 18.839  4.875   1.00 31.81  ? 82   GLU A OE1   1 
ATOM   678  O  OE2   . GLU A 1 85  ? 37.855 18.196  5.986   1.00 32.80  ? 82   GLU A OE2   1 
ATOM   679  N  N     . SER A 1 86  ? 37.751 18.762  -0.848  1.00 14.63  ? 83   SER A N     1 
ATOM   680  C  CA    . SER A 1 86  ? 37.151 19.361  -2.040  1.00 14.92  ? 83   SER A CA    1 
ATOM   681  C  C     . SER A 1 86  ? 35.780 18.770  -2.263  1.00 17.51  ? 83   SER A C     1 
ATOM   682  O  O     . SER A 1 86  ? 35.593 17.563  -2.095  1.00 15.75  ? 83   SER A O     1 
ATOM   683  C  CB    . SER A 1 86  ? 38.001 19.118  -3.282  1.00 14.50  ? 83   SER A CB    1 
ATOM   684  O  OG    . SER A 1 86  ? 39.330 19.542  -3.065  1.00 24.36  ? 83   SER A OG    1 
ATOM   685  N  N     . ARG A 1 87  ? 34.827 19.616  -2.651  1.00 19.74  ? 84   ARG A N     1 
ATOM   686  C  CA    . ARG A 1 87  ? 33.455 19.172  -2.894  1.00 17.02  ? 84   ARG A CA    1 
ATOM   687  C  C     . ARG A 1 87  ? 32.858 18.398  -1.728  1.00 15.85  ? 84   ARG A C     1 
ATOM   688  O  O     . ARG A 1 87  ? 32.048 17.484  -1.922  1.00 21.76  ? 84   ARG A O     1 
ATOM   689  C  CB    . ARG A 1 87  ? 33.397 18.328  -4.165  1.00 20.12  ? 84   ARG A CB    1 
ATOM   690  C  CG    . ARG A 1 87  ? 33.874 19.080  -5.398  1.00 21.67  ? 84   ARG A CG    1 
ATOM   691  C  CD    . ARG A 1 87  ? 33.765 18.209  -6.634  1.00 23.90  ? 84   ARG A CD    1 
ATOM   692  N  NE    . ARG A 1 87  ? 35.029 18.169  -7.359  1.00 34.96  ? 84   ARG A NE    1 
ATOM   693  C  CZ    . ARG A 1 87  ? 35.338 18.987  -8.359  1.00 39.84  ? 84   ARG A CZ    1 
ATOM   694  N  NH1   . ARG A 1 87  ? 34.468 19.914  -8.751  1.00 40.51  ? 84   ARG A NH1   1 
ATOM   695  N  NH2   . ARG A 1 87  ? 36.520 18.883  -8.958  1.00 36.69  ? 84   ARG A NH2   1 
ATOM   696  N  N     . GLY A 1 88  ? 33.273 18.759  -0.523  1.00 14.85  ? 85   GLY A N     1 
ATOM   697  C  CA    . GLY A 1 88  ? 32.658 18.260  0.690   1.00 16.01  ? 85   GLY A CA    1 
ATOM   698  C  C     . GLY A 1 88  ? 33.249 16.956  1.190   1.00 15.75  ? 85   GLY A C     1 
ATOM   699  O  O     . GLY A 1 88  ? 32.723 16.351  2.137   1.00 15.33  ? 85   GLY A O     1 
ATOM   700  N  N     . LYS A 1 89  ? 34.337 16.518  0.559   1.00 13.91  ? 86   LYS A N     1 
ATOM   701  C  CA    . LYS A 1 89  ? 34.935 15.230  0.895   1.00 12.45  ? 86   LYS A CA    1 
ATOM   702  C  C     . LYS A 1 89  ? 36.461 15.271  0.917   1.00 13.44  ? 86   LYS A C     1 
ATOM   703  O  O     . LYS A 1 89  ? 37.088 16.142  0.308   1.00 13.33  ? 86   LYS A O     1 
ATOM   704  C  CB    . LYS A 1 89  ? 34.486 14.150  -0.094  1.00 16.57  ? 86   LYS A CB    1 
ATOM   705  C  CG    . LYS A 1 89  ? 34.904 14.421  -1.531  1.00 16.37  ? 86   LYS A CG    1 
ATOM   706  C  CD    . LYS A 1 89  ? 34.454 13.326  -2.504  1.00 16.97  ? 86   LYS A CD    1 
ATOM   707  C  CE    . LYS A 1 89  ? 35.008 11.946  -2.137  1.00 15.20  ? 86   LYS A CE    1 
ATOM   708  N  NZ    . LYS A 1 89  ? 36.496 11.864  -2.224  1.00 14.74  ? 86   LYS A NZ    1 
ATOM   709  N  N     . ALA A 1 90  ? 37.057 14.324  1.627   1.00 17.37  ? 87   ALA A N     1 
ATOM   710  C  CA    . ALA A 1 90  ? 38.499 14.173  1.567   1.00 15.44  ? 87   ALA A CA    1 
ATOM   711  C  C     . ALA A 1 90  ? 38.938 13.917  0.125   1.00 15.81  ? 87   ALA A C     1 
ATOM   712  O  O     . ALA A 1 90  ? 38.280 13.193  -0.625  1.00 17.95  ? 87   ALA A O     1 
ATOM   713  C  CB    . ALA A 1 90  ? 38.957 13.045  2.486   1.00 16.27  ? 87   ALA A CB    1 
ATOM   714  N  N     . ASN A 1 91  ? 40.046 14.541  -0.257  1.00 12.52  ? 88   ASN A N     1 
ATOM   715  C  CA    . ASN A 1 91  ? 40.587 14.409  -1.604  1.00 13.96  ? 88   ASN A CA    1 
ATOM   716  C  C     . ASN A 1 91  ? 42.051 14.023  -1.518  1.00 13.88  ? 88   ASN A C     1 
ATOM   717  O  O     . ASN A 1 91  ? 42.859 14.782  -0.978  1.00 14.54  ? 88   ASN A O     1 
ATOM   718  C  CB    . ASN A 1 91  ? 40.426 15.716  -2.378  1.00 17.43  ? 88   ASN A CB    1 
ATOM   719  C  CG    . ASN A 1 91  ? 40.789 15.577  -3.846  1.00 19.42  ? 88   ASN A CG    1 
ATOM   720  O  OD1   . ASN A 1 91  ? 41.930 15.320  -4.182  1.00 15.83  ? 88   ASN A OD1   1 
ATOM   721  N  ND2   . ASN A 1 91  ? 39.808 15.764  -4.728  1.00 24.49  ? 88   ASN A ND2   1 
ATOM   722  N  N     . LEU A 1 92  ? 42.396 12.858  -2.059  1.00 13.48  ? 89   LEU A N     1 
ATOM   723  C  CA    . LEU A 1 92  ? 43.748 12.311  -1.861  1.00 14.17  ? 89   LEU A CA    1 
ATOM   724  C  C     . LEU A 1 92  ? 44.717 12.613  -3.005  1.00 12.71  ? 89   LEU A C     1 
ATOM   725  O  O     . LEU A 1 92  ? 45.746 11.961  -3.107  1.00 12.93  ? 89   LEU A O     1 
ATOM   726  C  CB    . LEU A 1 92  ? 43.675 10.803  -1.650  1.00 12.74  ? 89   LEU A CB    1 
ATOM   727  C  CG    . LEU A 1 92  ? 42.741 10.363  -0.520  1.00 16.02  ? 89   LEU A CG    1 
ATOM   728  C  CD1   . LEU A 1 92  ? 42.531 8.870   -0.571  1.00 18.16  ? 89   LEU A CD1   1 
ATOM   729  C  CD2   . LEU A 1 92  ? 43.329 10.780  0.827   1.00 16.03  ? 89   LEU A CD2   1 
ATOM   730  N  N     . THR A 1 93  ? 44.411 13.618  -3.825  1.00 12.43  ? 90   THR A N     1 
ATOM   731  C  CA    . THR A 1 93  ? 45.212 13.906  -5.025  1.00 11.60  ? 90   THR A CA    1 
ATOM   732  C  C     . THR A 1 93  ? 46.697 14.166  -4.731  1.00 14.91  ? 90   THR A C     1 
ATOM   733  O  O     . THR A 1 93  ? 47.562 13.662  -5.454  1.00 12.67  ? 90   THR A O     1 
ATOM   734  C  CB    . THR A 1 93  ? 44.601 15.085  -5.820  1.00 13.79  ? 90   THR A CB    1 
ATOM   735  O  OG1   . THR A 1 93  ? 43.269 14.718  -6.221  1.00 20.62  ? 90   THR A OG1   1 
ATOM   736  C  CG2   . THR A 1 93  ? 45.419 15.396  -7.073  1.00 14.18  ? 90   THR A CG2   1 
ATOM   737  N  N     . LYS A 1 94  ? 47.010 14.915  -3.675  1.00 11.99  ? 91   LYS A N     1 
ATOM   738  C  CA    . LYS A 1 94  ? 48.410 15.216  -3.368  1.00 10.63  ? 91   LYS A CA    1 
ATOM   739  C  C     . LYS A 1 94  ? 49.229 13.943  -3.195  1.00 11.15  ? 91   LYS A C     1 
ATOM   740  O  O     . LYS A 1 94  ? 50.374 13.870  -3.640  1.00 12.82  ? 91   LYS A O     1 
ATOM   741  C  CB    . LYS A 1 94  ? 48.510 16.074  -2.097  1.00 12.56  ? 91   LYS A CB    1 
ATOM   742  C  CG    . LYS A 1 94  ? 49.892 16.665  -1.844  1.00 15.94  ? 91   LYS A CG    1 
ATOM   743  C  CD    . LYS A 1 94  ? 50.002 17.162  -0.397  1.00 16.42  ? 91   LYS A CD    1 
ATOM   744  C  CE    . LYS A 1 94  ? 49.091 18.349  -0.141  1.00 19.98  ? 91   LYS A CE    1 
ATOM   745  N  NZ    . LYS A 1 94  ? 49.252 18.820  1.255   1.00 15.71  ? 91   LYS A NZ    1 
ATOM   746  N  N     . TYR A 1 95  ? 48.622 12.929  -2.584  1.00 13.49  ? 92   TYR A N     1 
ATOM   747  C  CA    . TYR A 1 95  ? 49.336 11.708  -2.258  1.00 9.36   ? 92   TYR A CA    1 
ATOM   748  C  C     . TYR A 1 95  ? 49.414 10.815  -3.483  1.00 12.98  ? 92   TYR A C     1 
ATOM   749  O  O     . TYR A 1 95  ? 50.425 10.147  -3.698  1.00 13.53  ? 92   TYR A O     1 
ATOM   750  C  CB    . TYR A 1 95  ? 48.675 10.978  -1.068  1.00 11.00  ? 92   TYR A CB    1 
ATOM   751  C  CG    . TYR A 1 95  ? 48.377 11.952  0.039   1.00 9.01   ? 92   TYR A CG    1 
ATOM   752  C  CD1   . TYR A 1 95  ? 47.076 12.350  0.287   1.00 11.51  ? 92   TYR A CD1   1 
ATOM   753  C  CD2   . TYR A 1 95  ? 49.407 12.552  0.765   1.00 10.96  ? 92   TYR A CD2   1 
ATOM   754  C  CE1   . TYR A 1 95  ? 46.795 13.286  1.252   1.00 14.81  ? 92   TYR A CE1   1 
ATOM   755  C  CE2   . TYR A 1 95  ? 49.138 13.490  1.726   1.00 13.49  ? 92   TYR A CE2   1 
ATOM   756  C  CZ    . TYR A 1 95  ? 47.825 13.855  1.963   1.00 11.40  ? 92   TYR A CZ    1 
ATOM   757  O  OH    . TYR A 1 95  ? 47.532 14.793  2.912   1.00 11.58  ? 92   TYR A OH    1 
ATOM   758  N  N     . ARG A 1 96  ? 48.377 10.836  -4.315  1.00 13.05  ? 93   ARG A N     1 
ATOM   759  C  CA    . ARG A 1 96  ? 48.440 10.108  -5.584  1.00 14.10  ? 93   ARG A CA    1 
ATOM   760  C  C     . ARG A 1 96  ? 49.527 10.686  -6.496  1.00 14.40  ? 93   ARG A C     1 
ATOM   761  O  O     . ARG A 1 96  ? 50.265 9.936   -7.155  1.00 14.54  ? 93   ARG A O     1 
ATOM   762  C  CB    . ARG A 1 96  ? 47.089 10.122  -6.311  1.00 12.72  ? 93   ARG A CB    1 
ATOM   763  C  CG    . ARG A 1 96  ? 46.054 9.243   -5.652  1.00 12.02  ? 93   ARG A CG    1 
ATOM   764  C  CD    . ARG A 1 96  ? 44.788 9.062   -6.493  1.00 15.53  ? 93   ARG A CD    1 
ATOM   765  N  NE    . ARG A 1 96  ? 43.805 8.321   -5.711  1.00 18.08  ? 93   ARG A NE    1 
ATOM   766  C  CZ    . ARG A 1 96  ? 42.749 8.885   -5.134  1.00 15.80  ? 93   ARG A CZ    1 
ATOM   767  N  NH1   . ARG A 1 96  ? 41.926 8.151   -4.391  1.00 11.37  ? 93   ARG A NH1   1 
ATOM   768  N  NH2   . ARG A 1 96  ? 42.533 10.183  -5.295  1.00 16.19  ? 93   ARG A NH2   1 
ATOM   769  N  N     . GLU A 1 97  ? 49.645 12.011  -6.523  1.00 11.17  ? 94   GLU A N     1 
ATOM   770  C  CA    . GLU A 1 97  ? 50.662 12.649  -7.367  1.00 13.65  ? 94   GLU A CA    1 
ATOM   771  C  C     . GLU A 1 97  ? 52.072 12.372  -6.814  1.00 13.56  ? 94   GLU A C     1 
ATOM   772  O  O     . GLU A 1 97  ? 52.996 12.100  -7.581  1.00 11.74  ? 94   GLU A O     1 
ATOM   773  C  CB    . GLU A 1 97  ? 50.386 14.153  -7.525  1.00 17.46  ? 94   GLU A CB    1 
ATOM   774  C  CG    . GLU A 1 97  ? 49.127 14.375  -8.367  1.00 18.43  ? 94   GLU A CG    1 
ATOM   775  C  CD    . GLU A 1 97  ? 48.725 15.830  -8.539  1.00 29.33  ? 94   GLU A CD    1 
ATOM   776  O  OE1   . GLU A 1 97  ? 49.268 16.711  -7.839  1.00 34.42  ? 94   GLU A OE1   1 
ATOM   777  O  OE2   . GLU A 1 97  ? 47.843 16.081  -9.393  1.00 26.90  ? 94   GLU A OE2   1 
ATOM   778  N  N     . ALA A 1 98  ? 52.229 12.382  -5.492  1.00 11.50  ? 95   ALA A N     1 
ATOM   779  C  CA    . ALA A 1 98  ? 53.524 12.037  -4.902  1.00 12.75  ? 95   ALA A CA    1 
ATOM   780  C  C     . ALA A 1 98  ? 53.890 10.586  -5.190  1.00 10.99  ? 95   ALA A C     1 
ATOM   781  O  O     . ALA A 1 98  ? 55.047 10.277  -5.452  1.00 12.42  ? 95   ALA A O     1 
ATOM   782  C  CB    . ALA A 1 98  ? 53.525 12.294  -3.390  1.00 10.35  ? 95   ALA A CB    1 
ATOM   783  N  N     . SER A 1 99  ? 52.892 9.707   -5.170  1.00 11.69  ? 96   SER A N     1 
ATOM   784  C  CA    . SER A 1 99  ? 53.109 8.306   -5.531  1.00 12.21  ? 96   SER A CA    1 
ATOM   785  C  C     . SER A 1 99  ? 53.672 8.162   -6.949  1.00 12.03  ? 96   SER A C     1 
ATOM   786  O  O     . SER A 1 99  ? 54.633 7.423   -7.170  1.00 13.31  ? 96   SER A O     1 
ATOM   787  C  CB    . SER A 1 99  ? 51.796 7.526   -5.418  1.00 13.33  ? 96   SER A CB    1 
ATOM   788  O  OG    . SER A 1 99  ? 51.976 6.177   -5.785  1.00 15.56  ? 96   SER A OG    1 
ATOM   789  N  N     . VAL A 1 100 ? 53.061 8.856   -7.904  1.00 10.92  ? 97   VAL A N     1 
ATOM   790  C  CA    . VAL A 1 100 ? 53.554 8.824   -9.285  1.00 12.68  ? 97   VAL A CA    1 
ATOM   791  C  C     . VAL A 1 100 ? 55.035 9.237   -9.357  1.00 13.09  ? 97   VAL A C     1 
ATOM   792  O  O     . VAL A 1 100 ? 55.812 8.621   -10.086 1.00 14.80  ? 97   VAL A O     1 
ATOM   793  C  CB    . VAL A 1 100 ? 52.700 9.726   -10.202 1.00 13.72  ? 97   VAL A CB    1 
ATOM   794  C  CG1   . VAL A 1 100 ? 53.360 9.922   -11.588 1.00 15.42  ? 97   VAL A CG1   1 
ATOM   795  C  CG2   . VAL A 1 100 ? 51.288 9.166   -10.333 1.00 20.30  ? 97   VAL A CG2   1 
ATOM   796  N  N     . GLU A 1 101 ? 55.446 10.234  -8.568  1.00 9.63   ? 98   GLU A N     1 
ATOM   797  C  CA    . GLU A 1 101 ? 56.858 10.640  -8.542  1.00 11.69  ? 98   GLU A CA    1 
ATOM   798  C  C     . GLU A 1 101 ? 57.778 9.473   -8.232  1.00 14.68  ? 98   GLU A C     1 
ATOM   799  O  O     . GLU A 1 101 ? 58.820 9.295   -8.866  1.00 15.59  ? 98   GLU A O     1 
ATOM   800  C  CB    . GLU A 1 101 ? 57.123 11.723  -7.490  1.00 14.49  ? 98   GLU A CB    1 
ATOM   801  C  CG    . GLU A 1 101 ? 56.501 13.089  -7.700  1.00 14.82  ? 98   GLU A CG    1 
ATOM   802  C  CD    . GLU A 1 101 ? 56.923 14.068  -6.597  1.00 13.62  ? 98   GLU A CD    1 
ATOM   803  O  OE1   . GLU A 1 101 ? 58.134 14.411  -6.502  1.00 16.56  ? 98   GLU A OE1   1 
ATOM   804  O  OE2   . GLU A 1 101 ? 56.036 14.502  -5.833  1.00 17.35  ? 98   GLU A OE2   1 
ATOM   805  N  N     . VAL A 1 102 ? 57.386 8.698   -7.228  1.00 12.16  ? 99   VAL A N     1 
ATOM   806  C  CA    . VAL A 1 102 ? 58.193 7.586   -6.765  1.00 12.85  ? 99   VAL A CA    1 
ATOM   807  C  C     . VAL A 1 102 ? 58.161 6.451   -7.765  1.00 11.39  ? 99   VAL A C     1 
ATOM   808  O  O     . VAL A 1 102 ? 59.204 5.849   -8.067  1.00 14.97  ? 99   VAL A O     1 
ATOM   809  C  CB    . VAL A 1 102 ? 57.712 7.084   -5.382  1.00 13.62  ? 99   VAL A CB    1 
ATOM   810  C  CG1   . VAL A 1 102 ? 58.433 5.792   -5.000  1.00 21.02  ? 99   VAL A CG1   1 
ATOM   811  C  CG2   . VAL A 1 102 ? 57.959 8.169   -4.337  1.00 15.42  ? 99   VAL A CG2   1 
ATOM   812  N  N     . MET A 1 103 ? 56.966 6.150   -8.272  1.00 10.47  ? 100  MET A N     1 
ATOM   813  C  CA    . MET A 1 103 ? 56.814 5.040   -9.218  1.00 12.07  ? 100  MET A CA    1 
ATOM   814  C  C     . MET A 1 103 ? 57.593 5.296   -10.504 1.00 16.14  ? 100  MET A C     1 
ATOM   815  O  O     . MET A 1 103 ? 58.165 4.365   -11.066 1.00 14.64  ? 100  MET A O     1 
ATOM   816  C  CB    . MET A 1 103 ? 55.345 4.797   -9.560  1.00 15.83  ? 100  MET A CB    1 
ATOM   817  C  CG    A MET A 1 103 ? 54.412 4.642   -8.353  0.40 15.34  ? 100  MET A CG    1 
ATOM   818  C  CG    B MET A 1 103 ? 54.471 4.429   -8.374  0.60 15.50  ? 100  MET A CG    1 
ATOM   819  S  SD    A MET A 1 103 ? 54.272 2.981   -7.669  0.40 14.33  ? 100  MET A SD    1 
ATOM   820  S  SD    B MET A 1 103 ? 55.164 3.048   -7.457  0.60 14.81  ? 100  MET A SD    1 
ATOM   821  C  CE    A MET A 1 103 ? 53.583 3.320   -6.047  0.40 13.09  ? 100  MET A CE    1 
ATOM   822  C  CE    B MET A 1 103 ? 54.159 3.076   -5.955  0.60 13.35  ? 100  MET A CE    1 
ATOM   823  N  N     . GLU A 1 104 ? 57.626 6.542   -10.978 1.00 12.50  ? 101  GLU A N     1 
ATOM   824  C  CA    . GLU A 1 104 ? 58.357 6.821   -12.216 1.00 16.82  ? 101  GLU A CA    1 
ATOM   825  C  C     . GLU A 1 104 ? 59.880 6.640   -12.048 1.00 16.38  ? 101  GLU A C     1 
ATOM   826  O  O     . GLU A 1 104 ? 60.556 6.154   -12.968 1.00 17.10  ? 101  GLU A O     1 
ATOM   827  C  CB    . GLU A 1 104 ? 58.000 8.228   -12.741 1.00 19.91  ? 101  GLU A CB    1 
ATOM   828  C  CG    . GLU A 1 104 ? 56.541 8.293   -13.208 1.00 21.57  ? 101  GLU A CG    1 
ATOM   829  C  CD    . GLU A 1 104 ? 56.151 9.601   -13.900 1.00 36.38  ? 101  GLU A CD    1 
ATOM   830  O  OE1   . GLU A 1 104 ? 56.885 10.606  -13.779 1.00 34.00  ? 101  GLU A OE1   1 
ATOM   831  O  OE2   . GLU A 1 104 ? 55.090 9.616   -14.560 1.00 32.10  ? 101  GLU A OE2   1 
ATOM   832  N  N     . ILE A 1 105 ? 60.413 6.998   -10.881 1.00 14.11  ? 102  ILE A N     1 
ATOM   833  C  CA    . ILE A 1 105 ? 61.825 6.741   -10.579 1.00 13.87  ? 102  ILE A CA    1 
ATOM   834  C  C     . ILE A 1 105 ? 62.110 5.238   -10.536 1.00 13.12  ? 102  ILE A C     1 
ATOM   835  O  O     . ILE A 1 105 ? 63.036 4.751   -11.183 1.00 16.89  ? 102  ILE A O     1 
ATOM   836  C  CB    . ILE A 1 105 ? 62.238 7.394   -9.252  1.00 12.12  ? 102  ILE A CB    1 
ATOM   837  C  CG1   . ILE A 1 105 ? 62.108 8.920   -9.362  1.00 15.08  ? 102  ILE A CG1   1 
ATOM   838  C  CG2   . ILE A 1 105 ? 63.650 6.986   -8.859  1.00 16.18  ? 102  ILE A CG2   1 
ATOM   839  C  CD1   . ILE A 1 105 ? 62.099 9.623   -8.038  1.00 15.06  ? 102  ILE A CD1   1 
ATOM   840  N  N     . MET A 1 106 ? 61.294 4.485   -9.815  1.00 13.73  ? 103  MET A N     1 
ATOM   841  C  CA    . MET A 1 106 ? 61.510 3.041   -9.755  1.00 15.00  ? 103  MET A CA    1 
ATOM   842  C  C     . MET A 1 106 ? 61.492 2.406   -11.142 1.00 19.20  ? 103  MET A C     1 
ATOM   843  O  O     . MET A 1 106 ? 62.254 1.478   -11.413 1.00 18.93  ? 103  MET A O     1 
ATOM   844  C  CB    . MET A 1 106 ? 60.457 2.379   -8.860  1.00 14.94  ? 103  MET A CB    1 
ATOM   845  C  CG    A MET A 1 106 ? 60.767 2.547   -7.384  0.43 13.59  ? 103  MET A CG    1 
ATOM   846  C  CG    B MET A 1 106 ? 60.549 2.762   -7.400  0.57 14.02  ? 103  MET A CG    1 
ATOM   847  S  SD    A MET A 1 106 ? 59.626 1.663   -6.311  0.43 15.05  ? 103  MET A SD    1 
ATOM   848  S  SD    B MET A 1 106 ? 59.287 1.928   -6.407  0.57 18.08  ? 103  MET A SD    1 
ATOM   849  C  CE    A MET A 1 106 ? 58.118 2.567   -6.635  0.43 18.35  ? 103  MET A CE    1 
ATOM   850  C  CE    B MET A 1 106 ? 59.739 0.211   -6.679  0.57 18.61  ? 103  MET A CE    1 
ATOM   851  N  N     . SER A 1 107 ? 60.626 2.909   -12.014 1.00 13.75  ? 104  SER A N     1 
ATOM   852  C  CA    . SER A 1 107 ? 60.455 2.318   -13.328 1.00 15.53  ? 104  SER A CA    1 
ATOM   853  C  C     . SER A 1 107 ? 61.712 2.477   -14.187 1.00 20.39  ? 104  SER A C     1 
ATOM   854  O  O     . SER A 1 107 ? 61.837 1.797   -15.198 1.00 20.35  ? 104  SER A O     1 
ATOM   855  C  CB    . SER A 1 107 ? 59.248 2.927   -14.052 1.00 21.88  ? 104  SER A CB    1 
ATOM   856  O  OG    . SER A 1 107 ? 58.047 2.620   -13.375 1.00 26.53  ? 104  SER A OG    1 
ATOM   857  N  N     . ARG A 1 108 ? 62.635 3.354   -13.785 1.00 16.96  ? 105  ARG A N     1 
ATOM   858  C  CA    . ARG A 1 108 ? 63.896 3.526   -14.522 1.00 17.59  ? 105  ARG A CA    1 
ATOM   859  C  C     . ARG A 1 108 ? 64.801 2.311   -14.343 1.00 22.82  ? 105  ARG A C     1 
ATOM   860  O  O     . ARG A 1 108 ? 65.686 2.053   -15.164 1.00 22.77  ? 105  ARG A O     1 
ATOM   861  C  CB    . ARG A 1 108 ? 64.660 4.777   -14.070 1.00 20.19  ? 105  ARG A CB    1 
ATOM   862  C  CG    . ARG A 1 108 ? 63.917 6.096   -14.197 1.00 19.88  ? 105  ARG A CG    1 
ATOM   863  C  CD    . ARG A 1 108 ? 64.883 7.265   -14.418 1.00 23.34  ? 105  ARG A CD    1 
ATOM   864  N  NE    . ARG A 1 108 ? 65.905 7.364   -13.379 1.00 28.48  ? 105  ARG A NE    1 
ATOM   865  C  CZ    . ARG A 1 108 ? 65.874 8.238   -12.375 1.00 19.70  ? 105  ARG A CZ    1 
ATOM   866  N  NH1   . ARG A 1 108 ? 66.848 8.247   -11.469 1.00 20.37  ? 105  ARG A NH1   1 
ATOM   867  N  NH2   . ARG A 1 108 ? 64.870 9.085   -12.269 1.00 20.32  ? 105  ARG A NH2   1 
ATOM   868  N  N     . PHE A 1 109 ? 64.585 1.574   -13.258 1.00 19.88  ? 106  PHE A N     1 
ATOM   869  C  CA    . PHE A 1 109 ? 65.427 0.421   -12.937 1.00 21.22  ? 106  PHE A CA    1 
ATOM   870  C  C     . PHE A 1 109 ? 64.847 -0.895  -13.444 1.00 27.57  ? 106  PHE A C     1 
ATOM   871  O  O     . PHE A 1 109 ? 65.590 -1.778  -13.881 1.00 32.07  ? 106  PHE A O     1 
ATOM   872  C  CB    . PHE A 1 109 ? 65.655 0.352   -11.425 1.00 19.58  ? 106  PHE A CB    1 
ATOM   873  C  CG    . PHE A 1 109 ? 66.417 1.525   -10.883 1.00 22.77  ? 106  PHE A CG    1 
ATOM   874  C  CD1   . PHE A 1 109 ? 65.788 2.744   -10.673 1.00 21.21  ? 106  PHE A CD1   1 
ATOM   875  C  CD2   . PHE A 1 109 ? 67.775 1.419   -10.605 1.00 18.91  ? 106  PHE A CD2   1 
ATOM   876  C  CE1   . PHE A 1 109 ? 66.489 3.828   -10.182 1.00 22.11  ? 106  PHE A CE1   1 
ATOM   877  C  CE2   . PHE A 1 109 ? 68.481 2.502   -10.116 1.00 23.22  ? 106  PHE A CE2   1 
ATOM   878  C  CZ    . PHE A 1 109 ? 67.841 3.711   -9.908  1.00 21.73  ? 106  PHE A CZ    1 
ATOM   879  N  N     . ALA A 1 110 ? 63.526 -1.024  -13.393 1.00 24.25  ? 107  ALA A N     1 
ATOM   880  C  CA    . ALA A 1 110 ? 62.848 -2.223  -13.875 1.00 20.62  ? 107  ALA A CA    1 
ATOM   881  C  C     . ALA A 1 110 ? 61.353 -1.991  -14.000 1.00 26.50  ? 107  ALA A C     1 
ATOM   882  O  O     . ALA A 1 110 ? 60.824 -0.993  -13.517 1.00 23.49  ? 107  ALA A O     1 
ATOM   883  C  CB    . ALA A 1 110 ? 63.108 -3.406  -12.953 1.00 26.79  ? 107  ALA A CB    1 
ATOM   884  N  N     . VAL A 1 111 ? 60.675 -2.926  -14.650 1.00 23.42  ? 108  VAL A N     1 
ATOM   885  C  CA    . VAL A 1 111 ? 59.232 -2.873  -14.766 1.00 23.75  ? 108  VAL A CA    1 
ATOM   886  C  C     . VAL A 1 111 ? 58.647 -3.130  -13.382 1.00 27.98  ? 108  VAL A C     1 
ATOM   887  O  O     . VAL A 1 111 ? 59.064 -4.064  -12.708 1.00 25.39  ? 108  VAL A O     1 
ATOM   888  C  CB    . VAL A 1 111 ? 58.709 -3.905  -15.772 1.00 36.69  ? 108  VAL A CB    1 
ATOM   889  C  CG1   . VAL A 1 111 ? 57.203 -3.922  -15.761 1.00 34.10  ? 108  VAL A CG1   1 
ATOM   890  C  CG2   . VAL A 1 111 ? 59.225 -3.590  -17.170 1.00 37.77  ? 108  VAL A CG2   1 
ATOM   891  N  N     . ILE A 1 112 ? 57.709 -2.297  -12.944 1.00 27.24  ? 109  ILE A N     1 
ATOM   892  C  CA    . ILE A 1 112 ? 57.202 -2.448  -11.583 1.00 24.06  ? 109  ILE A CA    1 
ATOM   893  C  C     . ILE A 1 112 ? 55.745 -2.857  -11.516 1.00 18.96  ? 109  ILE A C     1 
ATOM   894  O  O     . ILE A 1 112 ? 54.974 -2.651  -12.455 1.00 19.85  ? 109  ILE A O     1 
ATOM   895  C  CB    . ILE A 1 112 ? 57.386 -1.147  -10.753 1.00 19.57  ? 109  ILE A CB    1 
ATOM   896  C  CG1   . ILE A 1 112 ? 56.446 -0.040  -11.233 1.00 22.16  ? 109  ILE A CG1   1 
ATOM   897  C  CG2   . ILE A 1 112 ? 58.847 -0.698  -10.782 1.00 23.30  ? 109  ILE A CG2   1 
ATOM   898  C  CD1   . ILE A 1 112 ? 56.486 1.215   -10.351 1.00 22.91  ? 109  ILE A CD1   1 
ATOM   899  N  N     . GLU A 1 113 ? 55.385 -3.468  -10.393 1.00 14.68  ? 110  GLU A N     1 
ATOM   900  C  CA    . GLU A 1 113 ? 53.984 -3.698  -10.052 1.00 12.92  ? 110  GLU A CA    1 
ATOM   901  C  C     . GLU A 1 113 ? 53.569 -2.761  -8.929  1.00 15.67  ? 110  GLU A C     1 
ATOM   902  O  O     . GLU A 1 113 ? 54.013 -2.923  -7.795  1.00 14.66  ? 110  GLU A O     1 
ATOM   903  C  CB    . GLU A 1 113 ? 53.742 -5.163  -9.627  1.00 12.14  ? 110  GLU A CB    1 
ATOM   904  C  CG    . GLU A 1 113 ? 52.262 -5.433  -9.349  1.00 14.94  ? 110  GLU A CG    1 
ATOM   905  C  CD    . GLU A 1 113 ? 51.972 -6.847  -8.887  1.00 23.73  ? 110  GLU A CD    1 
ATOM   906  O  OE1   . GLU A 1 113 ? 50.882 -7.058  -8.299  1.00 24.35  ? 110  GLU A OE1   1 
ATOM   907  O  OE2   . GLU A 1 113 ? 52.819 -7.737  -9.116  1.00 19.34  ? 110  GLU A OE2   1 
ATOM   908  N  N     . ARG A 1 114 ? 52.730 -1.781  -9.238  1.00 15.78  ? 111  ARG A N     1 
ATOM   909  C  CA    . ARG A 1 114 ? 52.178 -0.904  -8.205  1.00 14.77  ? 111  ARG A CA    1 
ATOM   910  C  C     . ARG A 1 114 ? 51.267 -1.730  -7.310  1.00 15.68  ? 111  ARG A C     1 
ATOM   911  O  O     . ARG A 1 114 ? 50.266 -2.280  -7.772  1.00 21.09  ? 111  ARG A O     1 
ATOM   912  C  CB    . ARG A 1 114 ? 51.408 0.266   -8.839  1.00 17.91  ? 111  ARG A CB    1 
ATOM   913  C  CG    . ARG A 1 114 ? 50.853 1.292   -7.845  1.00 16.10  ? 111  ARG A CG    1 
ATOM   914  C  CD    . ARG A 1 114 ? 49.617 1.989   -8.419  1.00 14.27  ? 111  ARG A CD    1 
ATOM   915  N  NE    . ARG A 1 114 ? 49.245 3.208   -7.698  1.00 16.86  ? 111  ARG A NE    1 
ATOM   916  C  CZ    . ARG A 1 114 ? 48.300 3.284   -6.763  1.00 22.93  ? 111  ARG A CZ    1 
ATOM   917  N  NH1   . ARG A 1 114 ? 47.623 2.203   -6.400  1.00 22.37  ? 111  ARG A NH1   1 
ATOM   918  N  NH2   . ARG A 1 114 ? 48.033 4.453   -6.186  1.00 22.08  ? 111  ARG A NH2   1 
ATOM   919  N  N     . ALA A 1 115 ? 51.614 -1.835  -6.033  1.00 12.58  ? 112  ALA A N     1 
ATOM   920  C  CA    . ALA A 1 115 ? 50.861 -2.682  -5.125  1.00 9.70   ? 112  ALA A CA    1 
ATOM   921  C  C     . ALA A 1 115 ? 50.020 -1.885  -4.134  1.00 10.95  ? 112  ALA A C     1 
ATOM   922  O  O     . ALA A 1 115 ? 49.098 -2.423  -3.516  1.00 14.14  ? 112  ALA A O     1 
ATOM   923  C  CB    . ALA A 1 115 ? 51.801 -3.610  -4.377  1.00 12.00  ? 112  ALA A CB    1 
ATOM   924  N  N     . SER A 1 116 ? 50.337 -0.601  -3.997  1.00 12.96  ? 113  SER A N     1 
ATOM   925  C  CA    . SER A 1 116 ? 49.540 0.326   -3.201  1.00 13.80  ? 113  SER A CA    1 
ATOM   926  C  C     . SER A 1 116 ? 49.935 1.734   -3.582  1.00 11.17  ? 113  SER A C     1 
ATOM   927  O  O     . SER A 1 116 ? 50.795 1.923   -4.446  1.00 12.12  ? 113  SER A O     1 
ATOM   928  C  CB    . SER A 1 116 ? 49.745 0.126   -1.699  1.00 13.82  ? 113  SER A CB    1 
ATOM   929  O  OG    . SER A 1 116 ? 50.951 0.728   -1.247  1.00 12.46  ? 113  SER A OG    1 
ATOM   930  N  N     . ILE A 1 117 ? 49.343 2.726   -2.922  1.00 12.65  ? 114  ILE A N     1 
ATOM   931  C  CA    . ILE A 1 117 ? 49.723 4.101   -3.207  1.00 9.32   ? 114  ILE A CA    1 
ATOM   932  C  C     . ILE A 1 117 ? 51.196 4.346   -2.844  1.00 12.79  ? 114  ILE A C     1 
ATOM   933  O  O     . ILE A 1 117 ? 51.809 5.293   -3.343  1.00 12.23  ? 114  ILE A O     1 
ATOM   934  C  CB    . ILE A 1 117 ? 48.805 5.099   -2.445  1.00 12.09  ? 114  ILE A CB    1 
ATOM   935  C  CG1   . ILE A 1 117 ? 48.901 6.511   -3.017  1.00 12.12  ? 114  ILE A CG1   1 
ATOM   936  C  CG2   . ILE A 1 117 ? 49.102 5.090   -0.968  1.00 12.68  ? 114  ILE A CG2   1 
ATOM   937  C  CD1   . ILE A 1 117 ? 47.746 7.388   -2.554  1.00 11.32  ? 114  ILE A CD1   1 
ATOM   938  N  N     . ASP A 1 118 ? 51.786 3.505   -1.986  1.00 10.57  ? 115  ASP A N     1 
ATOM   939  C  CA    . ASP A 1 118 ? 53.150 3.815   -1.549  1.00 11.01  ? 115  ASP A CA    1 
ATOM   940  C  C     . ASP A 1 118 ? 54.140 2.663   -1.691  1.00 10.79  ? 115  ASP A C     1 
ATOM   941  O  O     . ASP A 1 118 ? 55.216 2.687   -1.073  1.00 10.83  ? 115  ASP A O     1 
ATOM   942  C  CB    . ASP A 1 118 ? 53.167 4.322   -0.083  1.00 11.04  ? 115  ASP A CB    1 
ATOM   943  C  CG    . ASP A 1 118 ? 53.319 3.202   0.971   1.00 11.10  ? 115  ASP A CG    1 
ATOM   944  O  OD1   . ASP A 1 118 ? 52.735 2.101   0.821   1.00 11.34  ? 115  ASP A OD1   1 
ATOM   945  O  OD2   . ASP A 1 118 ? 54.074 3.429   1.947   1.00 11.54  ? 115  ASP A OD2   1 
ATOM   946  N  N     . GLU A 1 119 ? 53.806 1.644   -2.475  1.00 9.04   ? 116  GLU A N     1 
ATOM   947  C  CA    . GLU A 1 119 ? 54.755 0.549   -2.639  1.00 9.71   ? 116  GLU A CA    1 
ATOM   948  C  C     . GLU A 1 119 ? 54.637 -0.158  -3.979  1.00 11.60  ? 116  GLU A C     1 
ATOM   949  O  O     . GLU A 1 119 ? 53.568 -0.154  -4.616  1.00 12.79  ? 116  GLU A O     1 
ATOM   950  C  CB    . GLU A 1 119 ? 54.598 -0.465  -1.508  1.00 10.99  ? 116  GLU A CB    1 
ATOM   951  C  CG    . GLU A 1 119 ? 53.400 -1.392  -1.624  1.00 9.65   ? 116  GLU A CG    1 
ATOM   952  C  CD    . GLU A 1 119 ? 52.912 -1.827  -0.257  1.00 13.69  ? 116  GLU A CD    1 
ATOM   953  O  OE1   . GLU A 1 119 ? 53.213 -2.963  0.164   1.00 17.33  ? 116  GLU A OE1   1 
ATOM   954  O  OE2   . GLU A 1 119 ? 52.257 -1.011  0.417   1.00 12.91  ? 116  GLU A OE2   1 
ATOM   955  N  N     . ALA A 1 120 ? 55.759 -0.733  -4.418  1.00 10.65  ? 117  ALA A N     1 
ATOM   956  C  CA    . ALA A 1 120 ? 55.795 -1.474  -5.661  1.00 10.97  ? 117  ALA A CA    1 
ATOM   957  C  C     . ALA A 1 120 ? 56.780 -2.631  -5.591  1.00 11.50  ? 117  ALA A C     1 
ATOM   958  O  O     . ALA A 1 120 ? 57.820 -2.548  -4.920  1.00 10.93  ? 117  ALA A O     1 
ATOM   959  C  CB    . ALA A 1 120 ? 56.145 -0.544  -6.826  1.00 14.26  ? 117  ALA A CB    1 
ATOM   960  N  N     . TYR A 1 121 ? 56.448 -3.710  -6.294  1.00 11.73  ? 118  TYR A N     1 
ATOM   961  C  CA    . TYR A 1 121 ? 57.371 -4.815  -6.448  1.00 10.54  ? 118  TYR A CA    1 
ATOM   962  C  C     . TYR A 1 121 ? 58.192 -4.617  -7.708  1.00 12.84  ? 118  TYR A C     1 
ATOM   963  O  O     . TYR A 1 121 ? 57.718 -4.027  -8.696  1.00 15.55  ? 118  TYR A O     1 
ATOM   964  C  CB    . TYR A 1 121 ? 56.629 -6.156  -6.501  1.00 10.40  ? 118  TYR A CB    1 
ATOM   965  C  CG    . TYR A 1 121 ? 55.925 -6.505  -5.211  1.00 9.59   ? 118  TYR A CG    1 
ATOM   966  C  CD1   . TYR A 1 121 ? 54.602 -6.141  -5.002  1.00 11.60  ? 118  TYR A CD1   1 
ATOM   967  C  CD2   . TYR A 1 121 ? 56.582 -7.199  -4.209  1.00 10.45  ? 118  TYR A CD2   1 
ATOM   968  C  CE1   . TYR A 1 121 ? 53.953 -6.446  -3.820  1.00 12.88  ? 118  TYR A CE1   1 
ATOM   969  C  CE2   . TYR A 1 121 ? 55.938 -7.521  -3.016  1.00 12.16  ? 118  TYR A CE2   1 
ATOM   970  C  CZ    . TYR A 1 121 ? 54.624 -7.130  -2.832  1.00 15.04  ? 118  TYR A CZ    1 
ATOM   971  O  OH    . TYR A 1 121 ? 53.972 -7.444  -1.669  1.00 16.16  ? 118  TYR A OH    1 
ATOM   972  N  N     . VAL A 1 122 ? 59.421 -5.133  -7.657  1.00 14.16  ? 119  VAL A N     1 
ATOM   973  C  CA    . VAL A 1 122 ? 60.390 -5.064  -8.739  1.00 16.29  ? 119  VAL A CA    1 
ATOM   974  C  C     . VAL A 1 122 ? 60.897 -6.475  -8.994  1.00 17.06  ? 119  VAL A C     1 
ATOM   975  O  O     . VAL A 1 122 ? 61.339 -7.129  -8.055  1.00 14.98  ? 119  VAL A O     1 
ATOM   976  C  CB    . VAL A 1 122 ? 61.603 -4.169  -8.366  1.00 20.38  ? 119  VAL A CB    1 
ATOM   977  C  CG1   . VAL A 1 122 ? 62.223 -3.588  -9.606  1.00 31.05  ? 119  VAL A CG1   1 
ATOM   978  C  CG2   . VAL A 1 122 ? 61.191 -3.069  -7.397  1.00 29.96  ? 119  VAL A CG2   1 
ATOM   979  N  N     . ASP A 1 123 ? 60.834 -6.969  -10.232 1.00 17.75  ? 120  ASP A N     1 
ATOM   980  C  CA    . ASP A 1 123 ? 61.591 -8.176  -10.571 1.00 16.59  ? 120  ASP A CA    1 
ATOM   981  C  C     . ASP A 1 123 ? 62.960 -7.754  -11.104 1.00 17.28  ? 120  ASP A C     1 
ATOM   982  O  O     . ASP A 1 123 ? 63.082 -7.242  -12.212 1.00 20.99  ? 120  ASP A O     1 
ATOM   983  C  CB    . ASP A 1 123 ? 60.848 -9.059  -11.583 1.00 21.51  ? 120  ASP A CB    1 
ATOM   984  C  CG    . ASP A 1 123 ? 61.524 -10.413 -11.785 1.00 22.97  ? 120  ASP A CG    1 
ATOM   985  O  OD1   . ASP A 1 123 ? 62.742 -10.429 -12.006 1.00 22.18  ? 120  ASP A OD1   1 
ATOM   986  O  OD2   . ASP A 1 123 ? 60.853 -11.467 -11.708 1.00 24.96  ? 120  ASP A OD2   1 
ATOM   987  N  N     . LEU A 1 124 ? 63.985 -7.979  -10.290 1.00 15.74  ? 121  LEU A N     1 
ATOM   988  C  CA    . LEU A 1 124 ? 65.340 -7.555  -10.599 1.00 14.21  ? 121  LEU A CA    1 
ATOM   989  C  C     . LEU A 1 124 ? 66.217 -8.651  -11.210 1.00 14.02  ? 121  LEU A C     1 
ATOM   990  O  O     . LEU A 1 124 ? 67.418 -8.454  -11.361 1.00 17.91  ? 121  LEU A O     1 
ATOM   991  C  CB    . LEU A 1 124 ? 66.009 -7.034  -9.330  1.00 15.55  ? 121  LEU A CB    1 
ATOM   992  C  CG    . LEU A 1 124 ? 65.396 -5.772  -8.733  1.00 18.25  ? 121  LEU A CG    1 
ATOM   993  C  CD1   . LEU A 1 124 ? 65.940 -5.522  -7.343  1.00 19.54  ? 121  LEU A CD1   1 
ATOM   994  C  CD2   . LEU A 1 124 ? 65.659 -4.587  -9.660  1.00 23.71  ? 121  LEU A CD2   1 
ATOM   995  N  N     . THR A 1 125 ? 65.618 -9.791  -11.540 1.00 15.88  ? 122  THR A N     1 
ATOM   996  C  CA    . THR A 1 125 ? 66.376 -10.936 -12.047 1.00 13.67  ? 122  THR A CA    1 
ATOM   997  C  C     . THR A 1 125 ? 67.280 -10.560 -13.228 1.00 16.72  ? 122  THR A C     1 
ATOM   998  O  O     . THR A 1 125 ? 68.461 -10.905 -13.225 1.00 18.67  ? 122  THR A O     1 
ATOM   999  C  CB    . THR A 1 125 ? 65.442 -12.066 -12.470 1.00 19.62  ? 122  THR A CB    1 
ATOM   1000 O  OG1   . THR A 1 125 ? 64.567 -12.378 -11.382 1.00 17.79  ? 122  THR A OG1   1 
ATOM   1001 C  CG2   . THR A 1 125 ? 66.238 -13.308 -12.876 1.00 19.54  ? 122  THR A CG2   1 
ATOM   1002 N  N     . SER A 1 126 ? 66.726 -9.852  -14.212 1.00 18.66  ? 123  SER A N     1 
ATOM   1003 C  CA    . SER A 1 126 ? 67.488 -9.493  -15.415 1.00 19.64  ? 123  SER A CA    1 
ATOM   1004 C  C     A SER A 1 126 ? 68.563 -8.453  -15.111 0.48 22.81  ? 123  SER A C     1 
ATOM   1005 C  C     B SER A 1 126 ? 68.562 -8.453  -15.111 0.52 22.82  ? 123  SER A C     1 
ATOM   1006 O  O     . SER A 1 126 ? 69.694 -8.562  -15.585 1.00 26.18  ? 123  SER A O     1 
ATOM   1007 C  CB    . SER A 1 126 ? 66.562 -8.973  -16.513 1.00 21.83  ? 123  SER A CB    1 
ATOM   1008 O  OG    A SER A 1 126 ? 65.793 -10.021 -17.075 0.48 25.31  ? 123  SER A OG    1 
ATOM   1009 O  OG    B SER A 1 126 ? 65.912 -7.785  -16.103 0.52 24.72  ? 123  SER A OG    1 
ATOM   1010 N  N     . ALA A 1 127 ? 68.202 -7.446  -14.323 1.00 19.60  ? 124  ALA A N     1 
ATOM   1011 C  CA    . ALA A 1 127 ? 69.138 -6.398  -13.935 1.00 19.49  ? 124  ALA A CA    1 
ATOM   1012 C  C     . ALA A 1 127 ? 70.318 -6.969  -13.148 1.00 18.95  ? 124  ALA A C     1 
ATOM   1013 O  O     . ALA A 1 127 ? 71.457 -6.515  -13.296 1.00 21.58  ? 124  ALA A O     1 
ATOM   1014 C  CB    . ALA A 1 127 ? 68.426 -5.323  -13.119 1.00 23.72  ? 124  ALA A CB    1 
ATOM   1015 N  N     . VAL A 1 128 ? 70.041 -7.958  -12.306 1.00 17.91  ? 125  VAL A N     1 
ATOM   1016 C  CA    . VAL A 1 128 ? 71.092 -8.617  -11.543 1.00 21.41  ? 125  VAL A CA    1 
ATOM   1017 C  C     . VAL A 1 128 ? 72.066 -9.357  -12.449 1.00 20.85  ? 125  VAL A C     1 
ATOM   1018 O  O     . VAL A 1 128 ? 73.275 -9.261  -12.263 1.00 24.80  ? 125  VAL A O     1 
ATOM   1019 C  CB    . VAL A 1 128 ? 70.494 -9.598  -10.512 1.00 17.54  ? 125  VAL A CB    1 
ATOM   1020 C  CG1   . VAL A 1 128 ? 71.523 -10.639 -10.085 1.00 20.20  ? 125  VAL A CG1   1 
ATOM   1021 C  CG2   . VAL A 1 128 ? 69.973 -8.811  -9.312  1.00 14.57  ? 125  VAL A CG2   1 
ATOM   1022 N  N     . GLN A 1 129 ? 71.530 -10.096 -13.416 1.00 20.94  ? 126  GLN A N     1 
ATOM   1023 C  CA    . GLN A 1 129 ? 72.367 -10.826 -14.362 1.00 27.33  ? 126  GLN A CA    1 
ATOM   1024 C  C     . GLN A 1 129 ? 73.263 -9.850  -15.091 1.00 30.39  ? 126  GLN A C     1 
ATOM   1025 O  O     . GLN A 1 129 ? 74.453 -10.101 -15.277 1.00 36.53  ? 126  GLN A O     1 
ATOM   1026 C  CB    . GLN A 1 129 ? 71.521 -11.618 -15.364 1.00 26.35  ? 126  GLN A CB    1 
ATOM   1027 C  CG    . GLN A 1 129 ? 70.880 -12.858 -14.789 1.00 34.75  ? 126  GLN A CG    1 
ATOM   1028 C  CD    . GLN A 1 129 ? 71.899 -13.771 -14.144 1.00 37.18  ? 126  GLN A CD    1 
ATOM   1029 O  OE1   . GLN A 1 129 ? 71.804 -14.084 -12.959 1.00 42.34  ? 126  GLN A OE1   1 
ATOM   1030 N  NE2   . GLN A 1 129 ? 72.894 -14.190 -14.917 1.00 46.00  ? 126  GLN A NE2   1 
ATOM   1031 N  N     . GLU A 1 130 ? 72.690 -8.718  -15.483 1.00 29.47  ? 127  GLU A N     1 
ATOM   1032 C  CA    . GLU A 1 130 ? 73.474 -7.706  -16.169 1.00 35.28  ? 127  GLU A CA    1 
ATOM   1033 C  C     . GLU A 1 130 ? 74.589 -7.166  -15.263 1.00 38.31  ? 127  GLU A C     1 
ATOM   1034 O  O     . GLU A 1 130 ? 75.749 -7.180  -15.641 1.00 37.55  ? 127  GLU A O     1 
ATOM   1035 C  CB    . GLU A 1 130 ? 72.577 -6.574  -16.663 1.00 40.43  ? 127  GLU A CB    1 
ATOM   1036 C  CG    . GLU A 1 130 ? 71.506 -7.051  -17.621 1.00 48.98  ? 127  GLU A CG    1 
ATOM   1037 C  CD    . GLU A 1 130 ? 71.233 -6.048  -18.716 1.00 70.82  ? 127  GLU A CD    1 
ATOM   1038 O  OE1   . GLU A 1 130 ? 72.196 -5.390  -19.157 1.00 74.31  ? 127  GLU A OE1   1 
ATOM   1039 O  OE2   . GLU A 1 130 ? 70.074 -5.944  -19.165 1.00 76.57  ? 127  GLU A OE2   1 
ATOM   1040 N  N     . ARG A 1 131 ? 74.247 -6.722  -14.059 1.00 26.13  ? 128  ARG A N     1 
ATOM   1041 C  CA    . ARG A 1 131 ? 75.241 -6.159  -13.141 1.00 29.77  ? 128  ARG A CA    1 
ATOM   1042 C  C     . ARG A 1 131 ? 76.334 -7.186  -12.822 1.00 33.96  ? 128  ARG A C     1 
ATOM   1043 O  O     . ARG A 1 131 ? 77.513 -6.843  -12.693 1.00 31.36  ? 128  ARG A O     1 
ATOM   1044 C  CB    . ARG A 1 131 ? 74.565 -5.674  -11.851 1.00 27.11  ? 128  ARG A CB    1 
ATOM   1045 C  CG    A ARG A 1 131 ? 75.487 -4.967  -10.862 0.50 28.11  ? 128  ARG A CG    1 
ATOM   1046 C  CG    B ARG A 1 131 ? 75.534 -5.052  -10.844 0.50 28.09  ? 128  ARG A CG    1 
ATOM   1047 C  CD    A ARG A 1 131 ? 75.998 -3.641  -11.410 0.50 25.38  ? 128  ARG A CD    1 
ATOM   1048 C  CD    B ARG A 1 131 ? 76.065 -3.722  -11.350 0.50 25.43  ? 128  ARG A CD    1 
ATOM   1049 N  NE    A ARG A 1 131 ? 76.624 -2.834  -10.369 0.50 27.72  ? 128  ARG A NE    1 
ATOM   1050 N  NE    B ARG A 1 131 ? 74.952 -2.857  -11.709 0.50 24.42  ? 128  ARG A NE    1 
ATOM   1051 C  CZ    A ARG A 1 131 ? 75.966 -1.960  -9.613  0.50 21.30  ? 128  ARG A CZ    1 
ATOM   1052 C  CZ    B ARG A 1 131 ? 74.351 -2.034  -10.859 0.50 28.05  ? 128  ARG A CZ    1 
ATOM   1053 N  NH1   A ARG A 1 131 ? 76.604 -1.260  -8.684  0.50 26.01  ? 128  ARG A NH1   1 
ATOM   1054 N  NH1   B ARG A 1 131 ? 73.330 -1.289  -11.261 0.50 29.73  ? 128  ARG A NH1   1 
ATOM   1055 N  NH2   A ARG A 1 131 ? 74.665 -1.789  -9.788  0.50 26.20  ? 128  ARG A NH2   1 
ATOM   1056 N  NH2   B ARG A 1 131 ? 74.779 -1.954  -9.607  0.50 25.88  ? 128  ARG A NH2   1 
ATOM   1057 N  N     . LEU A 1 132 ? 75.943 -8.450  -12.711 1.00 27.91  ? 129  LEU A N     1 
ATOM   1058 C  CA    . LEU A 1 132 ? 76.912 -9.522  -12.472 1.00 27.51  ? 129  LEU A CA    1 
ATOM   1059 C  C     . LEU A 1 132 ? 77.910 -9.678  -13.620 1.00 45.21  ? 129  LEU A C     1 
ATOM   1060 O  O     . LEU A 1 132 ? 79.072 -10.005 -13.385 1.00 44.62  ? 129  LEU A O     1 
ATOM   1061 C  CB    . LEU A 1 132 ? 76.198 -10.854 -12.235 1.00 34.02  ? 129  LEU A CB    1 
ATOM   1062 C  CG    . LEU A 1 132 ? 75.767 -11.140 -10.798 1.00 26.60  ? 129  LEU A CG    1 
ATOM   1063 C  CD1   . LEU A 1 132 ? 74.811 -12.315 -10.747 1.00 25.97  ? 129  LEU A CD1   1 
ATOM   1064 C  CD2   . LEU A 1 132 ? 76.983 -11.390 -9.907  1.00 24.32  ? 129  LEU A CD2   1 
ATOM   1065 N  N     . GLN A 1 133 ? 77.462 -9.447  -14.855 1.00 43.19  ? 130  GLN A N     1 
ATOM   1066 C  CA    . GLN A 1 133 ? 78.331 -9.671  -16.009 1.00 52.43  ? 130  GLN A CA    1 
ATOM   1067 C  C     . GLN A 1 133 ? 79.354 -8.541  -16.197 1.00 58.04  ? 130  GLN A C     1 
ATOM   1068 O  O     . GLN A 1 133 ? 80.458 -8.801  -16.676 1.00 71.62  ? 130  GLN A O     1 
ATOM   1069 C  CB    . GLN A 1 133 ? 77.522 -9.881  -17.299 1.00 62.50  ? 130  GLN A CB    1 
ATOM   1070 C  CG    . GLN A 1 133 ? 77.006 -8.642  -18.004 1.00 70.44  ? 130  GLN A CG    1 
ATOM   1071 C  CD    . GLN A 1 133 ? 75.900 -8.957  -19.001 1.00 72.95  ? 130  GLN A CD    1 
ATOM   1072 O  OE1   . GLN A 1 133 ? 75.451 -10.099 -19.109 1.00 76.05  ? 130  GLN A OE1   1 
ATOM   1073 N  NE2   . GLN A 1 133 ? 75.460 -7.943  -19.738 1.00 73.77  ? 130  GLN A NE2   1 
ATOM   1074 N  N     . LYS A 1 134 ? 78.972 -7.344  -15.793 1.00 57.44  ? 131  LYS A N     1 
ATOM   1075 C  CA    . LYS A 1 134 ? 79.864 -6.223  -15.636 1.00 69.17  ? 131  LYS A CA    1 
ATOM   1076 C  C     . LYS A 1 134 ? 80.864 -6.297  -14.495 1.00 73.84  ? 131  LYS A C     1 
ATOM   1077 O  O     . LYS A 1 134 ? 81.968 -5.808  -14.616 1.00 78.81  ? 131  LYS A O     1 
ATOM   1078 C  CB    . LYS A 1 134 ? 79.125 -4.877  -15.707 1.00 69.52  ? 131  LYS A CB    1 
ATOM   1079 C  CG    . LYS A 1 134 ? 78.510 -4.657  -17.090 1.00 78.41  ? 131  LYS A CG    1 
ATOM   1080 C  CD    . LYS A 1 134 ? 77.030 -4.952  -17.130 1.00 73.78  ? 131  LYS A CD    1 
ATOM   1081 C  CE    . LYS A 1 134 ? 76.685 -6.015  -18.142 1.00 75.60  ? 131  LYS A CE    1 
ATOM   1082 N  NZ    . LYS A 1 134 ? 75.409 -5.743  -18.822 1.00 78.34  ? 131  LYS A NZ    1 
ATOM   1083 N  N     . LEU A 1 135 ? 80.471 -6.890  -13.381 1.00 69.83  ? 132  LEU A N     1 
ATOM   1084 C  CA    . LEU A 1 135 ? 81.278 -6.883  -12.174 1.00 79.29  ? 132  LEU A CA    1 
ATOM   1085 C  C     . LEU A 1 135 ? 82.645 -7.587  -12.303 1.00 86.35  ? 132  LEU A C     1 
ATOM   1086 O  O     . LEU A 1 135 ? 83.634 -7.171  -11.702 1.00 89.83  ? 132  LEU A O     1 
ATOM   1087 C  CB    . LEU A 1 135 ? 80.492 -7.472  -10.996 1.00 73.43  ? 132  LEU A CB    1 
ATOM   1088 C  CG    . LEU A 1 135 ? 80.280 -6.577  -9.772  1.00 71.42  ? 132  LEU A CG    1 
ATOM   1089 C  CD1   . LEU A 1 135 ? 80.518 -5.105  -9.993  1.00 64.55  ? 132  LEU A CD1   1 
ATOM   1090 C  CD2   . LEU A 1 135 ? 78.901 -6.789  -9.260  1.00 67.68  ? 132  LEU A CD2   1 
ATOM   1091 N  N     . GLN A 1 136 ? 82.668 -8.664  -13.063 1.00 82.71  ? 133  GLN A N     1 
ATOM   1092 C  CA    . GLN A 1 136 ? 83.872 -9.475  -13.264 1.00 89.30  ? 133  GLN A CA    1 
ATOM   1093 C  C     . GLN A 1 136 ? 84.235 -10.496 -12.191 1.00 85.77  ? 133  GLN A C     1 
ATOM   1094 O  O     . GLN A 1 136 ? 85.363 -11.012 -12.169 1.00 88.83  ? 133  GLN A O     1 
ATOM   1095 C  CB    . GLN A 1 136 ? 85.119 -8.642  -13.418 1.00 94.63  ? 133  GLN A CB    1 
ATOM   1096 C  CG    . GLN A 1 136 ? 85.137 -7.433  -14.285 1.00 100.91 ? 133  GLN A CG    1 
ATOM   1097 C  CD    . GLN A 1 136 ? 86.454 -6.752  -14.051 1.00 103.13 ? 133  GLN A CD    1 
ATOM   1098 O  OE1   . GLN A 1 136 ? 86.953 -6.724  -12.916 1.00 102.53 ? 133  GLN A OE1   1 
ATOM   1099 N  NE2   . GLN A 1 136 ? 87.064 -6.257  -15.121 1.00 104.31 ? 133  GLN A NE2   1 
ATOM   1100 N  N     . GLY A 1 137 ? 83.306 -10.818 -11.327 1.00 78.61  ? 134  GLY A N     1 
ATOM   1101 C  CA    . GLY A 1 137 ? 83.601 -11.710 -10.249 1.00 70.73  ? 134  GLY A CA    1 
ATOM   1102 C  C     . GLY A 1 137 ? 84.338 -10.900 -9.217  1.00 73.25  ? 134  GLY A C     1 
ATOM   1103 O  O     . GLY A 1 137 ? 85.071 -11.450 -8.432  1.00 71.96  ? 134  GLY A O     1 
ATOM   1104 N  N     . GLN A 1 138 ? 84.174 -9.586  -9.174  1.00 73.59  ? 135  GLN A N     1 
ATOM   1105 C  CA    . GLN A 1 138 ? 84.714 -8.924  -7.972  1.00 70.35  ? 135  GLN A CA    1 
ATOM   1106 C  C     . GLN A 1 138 ? 83.779 -9.193  -6.812  1.00 60.25  ? 135  GLN A C     1 
ATOM   1107 O  O     . GLN A 1 138 ? 82.557 -9.242  -6.989  1.00 61.36  ? 135  GLN A O     1 
ATOM   1108 C  CB    . GLN A 1 138 ? 84.871 -7.395  -8.077  1.00 74.48  ? 135  GLN A CB    1 
ATOM   1109 C  CG    . GLN A 1 138 ? 84.864 -6.809  -9.427  1.00 84.88  ? 135  GLN A CG    1 
ATOM   1110 C  CD    . GLN A 1 138 ? 85.184 -5.334  -9.447  1.00 94.72  ? 135  GLN A CD    1 
ATOM   1111 O  OE1   . GLN A 1 138 ? 84.848 -4.593  -8.525  1.00 96.78  ? 135  GLN A OE1   1 
ATOM   1112 N  NE2   . GLN A 1 138 ? 85.848 -4.899  -10.506 1.00 98.96  ? 135  GLN A NE2   1 
ATOM   1113 N  N     . PRO A 1 139 ? 84.354 -9.361  -5.614  1.00 55.95  ? 136  PRO A N     1 
ATOM   1114 C  CA    . PRO A 1 139 ? 83.596 -9.365  -4.365  1.00 48.25  ? 136  PRO A CA    1 
ATOM   1115 C  C     . PRO A 1 139 ? 82.739 -8.111  -4.259  1.00 45.60  ? 136  PRO A C     1 
ATOM   1116 O  O     . PRO A 1 139 ? 83.073 -7.067  -4.821  1.00 38.24  ? 136  PRO A O     1 
ATOM   1117 C  CB    . PRO A 1 139 ? 84.691 -9.382  -3.288  1.00 51.93  ? 136  PRO A CB    1 
ATOM   1118 C  CG    . PRO A 1 139 ? 85.932 -8.909  -3.984  1.00 48.21  ? 136  PRO A CG    1 
ATOM   1119 C  CD    . PRO A 1 139 ? 85.801 -9.447  -5.371  1.00 54.07  ? 136  PRO A CD    1 
ATOM   1120 N  N     . ILE A 1 140 ? 81.623 -8.223  -3.561  1.00 38.88  ? 137  ILE A N     1 
ATOM   1121 C  CA    . ILE A 1 140 ? 80.805 -7.059  -3.301  1.00 29.96  ? 137  ILE A CA    1 
ATOM   1122 C  C     . ILE A 1 140 ? 81.268 -6.430  -2.004  1.00 29.82  ? 137  ILE A C     1 
ATOM   1123 O  O     . ILE A 1 140 ? 81.326 -7.087  -0.966  1.00 30.11  ? 137  ILE A O     1 
ATOM   1124 C  CB    . ILE A 1 140 ? 79.323 -7.423  -3.240  1.00 33.16  ? 137  ILE A CB    1 
ATOM   1125 C  CG1   . ILE A 1 140 ? 78.888 -7.913  -4.625  1.00 34.12  ? 137  ILE A CG1   1 
ATOM   1126 C  CG2   . ILE A 1 140 ? 78.501 -6.223  -2.790  1.00 26.10  ? 137  ILE A CG2   1 
ATOM   1127 C  CD1   . ILE A 1 140 ? 77.453 -8.290  -4.738  1.00 37.88  ? 137  ILE A CD1   1 
ATOM   1128 N  N     . SER A 1 141 ? 81.627 -5.157  -2.081  1.00 23.37  ? 138  SER A N     1 
ATOM   1129 C  CA    . SER A 1 141 ? 82.093 -4.424  -0.913  1.00 25.57  ? 138  SER A CA    1 
ATOM   1130 C  C     . SER A 1 141 ? 80.925 -4.062  -0.003  1.00 29.19  ? 138  SER A C     1 
ATOM   1131 O  O     . SER A 1 141 ? 79.821 -3.788  -0.480  1.00 26.84  ? 138  SER A O     1 
ATOM   1132 C  CB    . SER A 1 141 ? 82.850 -3.160  -1.354  1.00 26.15  ? 138  SER A CB    1 
ATOM   1133 O  OG    . SER A 1 141 ? 83.038 -2.258  -0.276  1.00 34.80  ? 138  SER A OG    1 
ATOM   1134 N  N     . ALA A 1 142 ? 81.173 -4.063  1.303   1.00 23.83  ? 139  ALA A N     1 
ATOM   1135 C  CA    . ALA A 1 142 ? 80.191 -3.618  2.285   1.00 26.95  ? 139  ALA A CA    1 
ATOM   1136 C  C     . ALA A 1 142 ? 79.752 -2.177  2.035   1.00 26.91  ? 139  ALA A C     1 
ATOM   1137 O  O     . ALA A 1 142 ? 78.630 -1.787  2.378   1.00 21.92  ? 139  ALA A O     1 
ATOM   1138 C  CB    . ALA A 1 142 ? 80.756 -3.755  3.685   1.00 30.06  ? 139  ALA A CB    1 
ATOM   1139 N  N     . ASP A 1 143 ? 80.643 -1.395  1.434   1.00 26.58  ? 140  ASP A N     1 
ATOM   1140 C  CA    . ASP A 1 143 ? 80.374 0.007   1.124   1.00 27.44  ? 140  ASP A CA    1 
ATOM   1141 C  C     . ASP A 1 143 ? 79.258 0.168   0.104   1.00 27.24  ? 140  ASP A C     1 
ATOM   1142 O  O     . ASP A 1 143 ? 78.675 1.245   -0.027  1.00 26.87  ? 140  ASP A O     1 
ATOM   1143 C  CB    . ASP A 1 143 ? 81.643 0.687   0.603   1.00 24.67  ? 140  ASP A CB    1 
ATOM   1144 C  CG    . ASP A 1 143 ? 82.706 0.827   1.667   1.00 42.96  ? 140  ASP A CG    1 
ATOM   1145 O  OD1   . ASP A 1 143 ? 82.354 0.778   2.866   1.00 39.23  ? 140  ASP A OD1   1 
ATOM   1146 O  OD2   . ASP A 1 143 ? 83.891 0.991   1.304   1.00 48.64  ? 140  ASP A OD2   1 
ATOM   1147 N  N     . LEU A 1 144 ? 78.971 -0.900  -0.631  1.00 19.50  ? 141  LEU A N     1 
ATOM   1148 C  CA    . LEU A 1 144 ? 77.893 -0.870  -1.604  1.00 21.67  ? 141  LEU A CA    1 
ATOM   1149 C  C     . LEU A 1 144 ? 76.544 -1.173  -0.960  1.00 19.66  ? 141  LEU A C     1 
ATOM   1150 O  O     . LEU A 1 144 ? 75.513 -1.009  -1.598  1.00 21.89  ? 141  LEU A O     1 
ATOM   1151 C  CB    . LEU A 1 144 ? 78.156 -1.862  -2.726  1.00 21.62  ? 141  LEU A CB    1 
ATOM   1152 C  CG    . LEU A 1 144 ? 79.381 -1.548  -3.591  1.00 24.77  ? 141  LEU A CG    1 
ATOM   1153 C  CD1   . LEU A 1 144 ? 79.463 -2.516  -4.762  1.00 23.02  ? 141  LEU A CD1   1 
ATOM   1154 C  CD2   . LEU A 1 144 ? 79.334 -0.106  -4.073  1.00 30.09  ? 141  LEU A CD2   1 
ATOM   1155 N  N     . LEU A 1 145 ? 76.559 -1.585  0.308   1.00 18.82  ? 142  LEU A N     1 
ATOM   1156 C  CA    . LEU A 1 145 ? 75.326 -1.944  1.012   1.00 16.61  ? 142  LEU A CA    1 
ATOM   1157 C  C     . LEU A 1 145 ? 75.185 -1.217  2.351   1.00 14.14  ? 142  LEU A C     1 
ATOM   1158 O  O     . LEU A 1 145 ? 75.029 -1.860  3.392   1.00 17.18  ? 142  LEU A O     1 
ATOM   1159 C  CB    . LEU A 1 145 ? 75.282 -3.465  1.231   1.00 16.21  ? 142  LEU A CB    1 
ATOM   1160 C  CG    . LEU A 1 145 ? 75.216 -4.318  -0.035  1.00 20.09  ? 142  LEU A CG    1 
ATOM   1161 C  CD1   . LEU A 1 145 ? 75.633 -5.755  0.255   1.00 19.48  ? 142  LEU A CD1   1 
ATOM   1162 C  CD2   . LEU A 1 145 ? 73.828 -4.288  -0.621  1.00 18.73  ? 142  LEU A CD2   1 
ATOM   1163 N  N     . PRO A 1 146 ? 75.231 0.134   2.329   1.00 18.57  ? 143  PRO A N     1 
ATOM   1164 C  CA    . PRO A 1 146 ? 75.303 0.941   3.556   1.00 19.85  ? 143  PRO A CA    1 
ATOM   1165 C  C     . PRO A 1 146 ? 74.051 0.962   4.421   1.00 17.82  ? 143  PRO A C     1 
ATOM   1166 O  O     . PRO A 1 146 ? 74.140 1.429   5.554   1.00 20.05  ? 143  PRO A O     1 
ATOM   1167 C  CB    . PRO A 1 146 ? 75.575 2.356   3.028   1.00 22.24  ? 143  PRO A CB    1 
ATOM   1168 C  CG    . PRO A 1 146 ? 74.942 2.376   1.670   1.00 18.62  ? 143  PRO A CG    1 
ATOM   1169 C  CD    . PRO A 1 146 ? 75.184 0.975   1.121   1.00 18.62  ? 143  PRO A CD    1 
ATOM   1170 N  N     . SER A 1 147 ? 72.914 0.477   3.922   1.00 18.50  ? 144  SER A N     1 
ATOM   1171 C  CA    . SER A 1 147 ? 71.693 0.495   4.726   1.00 16.16  ? 144  SER A CA    1 
ATOM   1172 C  C     . SER A 1 147 ? 71.006 -0.869  4.726   1.00 15.70  ? 144  SER A C     1 
ATOM   1173 O  O     . SER A 1 147 ? 69.828 -0.984  5.070   1.00 15.17  ? 144  SER A O     1 
ATOM   1174 C  CB    . SER A 1 147 ? 70.731 1.583   4.225   1.00 20.06  ? 144  SER A CB    1 
ATOM   1175 O  OG    . SER A 1 147 ? 70.259 1.320   2.918   1.00 20.34  ? 144  SER A OG    1 
ATOM   1176 N  N     . THR A 1 148 ? 71.776 -1.898  4.381   1.00 13.68  ? 145  THR A N     1 
ATOM   1177 C  CA    . THR A 1 148 ? 71.264 -3.269  4.263   1.00 14.88  ? 145  THR A CA    1 
ATOM   1178 C  C     . THR A 1 148 ? 71.487 -4.126  5.505   1.00 16.10  ? 145  THR A C     1 
ATOM   1179 O  O     . THR A 1 148 ? 72.598 -4.199  6.042   1.00 15.97  ? 145  THR A O     1 
ATOM   1180 C  CB    . THR A 1 148 ? 71.914 -3.990  3.063   1.00 11.60  ? 145  THR A CB    1 
ATOM   1181 O  OG1   . THR A 1 148 ? 71.546 -3.333  1.849   1.00 14.59  ? 145  THR A OG1   1 
ATOM   1182 C  CG2   . THR A 1 148 ? 71.473 -5.459  2.993   1.00 13.58  ? 145  THR A CG2   1 
ATOM   1183 N  N     . TYR A 1 149 ? 70.412 -4.769  5.940   1.00 12.35  ? 146  TYR A N     1 
ATOM   1184 C  CA    . TYR A 1 149 ? 70.416 -5.804  6.972   1.00 14.44  ? 146  TYR A CA    1 
ATOM   1185 C  C     . TYR A 1 149 ? 70.346 -7.167  6.320   1.00 16.32  ? 146  TYR A C     1 
ATOM   1186 O  O     . TYR A 1 149 ? 69.592 -7.350  5.361   1.00 13.77  ? 146  TYR A O     1 
ATOM   1187 C  CB    . TYR A 1 149 ? 69.219 -5.644  7.909   1.00 15.98  ? 146  TYR A CB    1 
ATOM   1188 C  CG    . TYR A 1 149 ? 69.425 -4.600  8.966   1.00 15.15  ? 146  TYR A CG    1 
ATOM   1189 C  CD1   . TYR A 1 149 ? 69.864 -4.959  10.229  1.00 16.26  ? 146  TYR A CD1   1 
ATOM   1190 C  CD2   . TYR A 1 149 ? 69.180 -3.252  8.705   1.00 17.56  ? 146  TYR A CD2   1 
ATOM   1191 C  CE1   . TYR A 1 149 ? 70.065 -4.012  11.205  1.00 17.63  ? 146  TYR A CE1   1 
ATOM   1192 C  CE2   . TYR A 1 149 ? 69.383 -2.295  9.680   1.00 20.22  ? 146  TYR A CE2   1 
ATOM   1193 C  CZ    . TYR A 1 149 ? 69.825 -2.686  10.929  1.00 21.42  ? 146  TYR A CZ    1 
ATOM   1194 O  OH    . TYR A 1 149 ? 70.032 -1.754  11.920  1.00 28.57  ? 146  TYR A OH    1 
ATOM   1195 N  N     . ILE A 1 150 ? 71.111 -8.129  6.832   1.00 14.17  ? 147  ILE A N     1 
ATOM   1196 C  CA    . ILE A 1 150 ? 70.938 -9.513  6.409   1.00 14.54  ? 147  ILE A CA    1 
ATOM   1197 C  C     . ILE A 1 150 ? 70.176 -10.277 7.485   1.00 15.77  ? 147  ILE A C     1 
ATOM   1198 O  O     . ILE A 1 150 ? 70.704 -10.491 8.580   1.00 16.00  ? 147  ILE A O     1 
ATOM   1199 C  CB    . ILE A 1 150 ? 72.278 -10.229 6.165   1.00 13.92  ? 147  ILE A CB    1 
ATOM   1200 C  CG1   . ILE A 1 150 ? 73.198 -9.431  5.229   1.00 11.92  ? 147  ILE A CG1   1 
ATOM   1201 C  CG2   . ILE A 1 150 ? 72.011 -11.656 5.653   1.00 16.51  ? 147  ILE A CG2   1 
ATOM   1202 C  CD1   . ILE A 1 150 ? 72.583 -9.107  3.858   1.00 14.28  ? 147  ILE A CD1   1 
ATOM   1203 N  N     . GLU A 1 151 ? 68.937 -10.671 7.201   1.00 13.47  ? 148  GLU A N     1 
ATOM   1204 C  CA    . GLU A 1 151 ? 68.107 -11.307 8.222   1.00 11.77  ? 148  GLU A CA    1 
ATOM   1205 C  C     . GLU A 1 151 ? 68.721 -12.620 8.699   1.00 15.02  ? 148  GLU A C     1 
ATOM   1206 O  O     . GLU A 1 151 ? 69.105 -13.459 7.882   1.00 15.87  ? 148  GLU A O     1 
ATOM   1207 C  CB    . GLU A 1 151 ? 66.684 -11.555 7.696   1.00 12.36  ? 148  GLU A CB    1 
ATOM   1208 C  CG    . GLU A 1 151 ? 65.797 -12.348 8.657   1.00 17.13  ? 148  GLU A CG    1 
ATOM   1209 C  CD    . GLU A 1 151 ? 65.602 -11.660 9.990   1.00 19.98  ? 148  GLU A CD    1 
ATOM   1210 O  OE1   . GLU A 1 151 ? 65.338 -12.368 10.983  1.00 19.73  ? 148  GLU A OE1   1 
ATOM   1211 O  OE2   . GLU A 1 151 ? 65.697 -10.413 10.045  1.00 20.67  ? 148  GLU A OE2   1 
ATOM   1212 N  N     . GLY A 1 152 ? 68.810 -12.768 10.022  1.00 15.41  ? 149  GLY A N     1 
ATOM   1213 C  CA    . GLY A 1 152 ? 69.374 -13.960 10.646  1.00 16.09  ? 149  GLY A CA    1 
ATOM   1214 C  C     . GLY A 1 152 ? 70.826 -13.818 11.062  1.00 20.84  ? 149  GLY A C     1 
ATOM   1215 O  O     . GLY A 1 152 ? 71.375 -14.688 11.750  1.00 20.81  ? 149  GLY A O     1 
ATOM   1216 N  N     . LEU A 1 153 ? 71.459 -12.730 10.651  1.00 15.16  ? 150  LEU A N     1 
ATOM   1217 C  CA    . LEU A 1 153 ? 72.866 -12.524 10.978  1.00 15.74  ? 150  LEU A CA    1 
ATOM   1218 C  C     . LEU A 1 153 ? 73.029 -11.213 11.747  1.00 22.81  ? 150  LEU A C     1 
ATOM   1219 O  O     . LEU A 1 153 ? 72.223 -10.307 11.608  1.00 19.62  ? 150  LEU A O     1 
ATOM   1220 C  CB    . LEU A 1 153 ? 73.719 -12.533 9.706   1.00 13.91  ? 150  LEU A CB    1 
ATOM   1221 C  CG    . LEU A 1 153 ? 73.717 -13.819 8.883   1.00 18.07  ? 150  LEU A CG    1 
ATOM   1222 C  CD1   . LEU A 1 153 ? 74.616 -13.667 7.666   1.00 17.97  ? 150  LEU A CD1   1 
ATOM   1223 C  CD2   . LEU A 1 153 ? 74.149 -15.021 9.750   1.00 18.35  ? 150  LEU A CD2   1 
ATOM   1224 N  N     . PRO A 1 154 ? 74.066 -11.113 12.594  1.00 16.53  ? 151  PRO A N     1 
ATOM   1225 C  CA    . PRO A 1 154 ? 75.103 -12.109 12.892  1.00 17.08  ? 151  PRO A CA    1 
ATOM   1226 C  C     . PRO A 1 154 ? 74.593 -13.251 13.763  1.00 18.10  ? 151  PRO A C     1 
ATOM   1227 O  O     . PRO A 1 154 ? 73.566 -13.136 14.428  1.00 24.94  ? 151  PRO A O     1 
ATOM   1228 C  CB    . PRO A 1 154 ? 76.160 -11.288 13.633  1.00 19.01  ? 151  PRO A CB    1 
ATOM   1229 C  CG    . PRO A 1 154 ? 75.363 -10.224 14.329  1.00 20.73  ? 151  PRO A CG    1 
ATOM   1230 C  CD    . PRO A 1 154 ? 74.250 -9.870  13.360  1.00 18.50  ? 151  PRO A CD    1 
ATOM   1231 N  N     . GLN A 1 155 ? 75.321 -14.358 13.748  1.00 21.53  ? 152  GLN A N     1 
ATOM   1232 C  CA    . GLN A 1 155 ? 75.011 -15.463 14.634  1.00 24.15  ? 152  GLN A CA    1 
ATOM   1233 C  C     . GLN A 1 155 ? 76.282 -16.233 14.957  1.00 34.59  ? 152  GLN A C     1 
ATOM   1234 O  O     . GLN A 1 155 ? 77.332 -15.976 14.364  1.00 32.31  ? 152  GLN A O     1 
ATOM   1235 C  CB    . GLN A 1 155 ? 73.979 -16.388 14.002  1.00 32.24  ? 152  GLN A CB    1 
ATOM   1236 C  CG    . GLN A 1 155 ? 74.529 -17.176 12.837  1.00 43.88  ? 152  GLN A CG    1 
ATOM   1237 C  CD    . GLN A 1 155 ? 73.670 -18.369 12.493  1.00 49.72  ? 152  GLN A CD    1 
ATOM   1238 O  OE1   . GLN A 1 155 ? 72.454 -18.251 12.322  1.00 55.27  ? 152  GLN A OE1   1 
ATOM   1239 N  NE2   . GLN A 1 155 ? 74.296 -19.534 12.405  1.00 48.39  ? 152  GLN A NE2   1 
ATOM   1240 N  N     . GLY A 1 156 ? 76.176 -17.167 15.898  1.00 43.64  ? 153  GLY A N     1 
ATOM   1241 C  CA    . GLY A 1 156 ? 77.276 -18.055 16.235  1.00 50.07  ? 153  GLY A CA    1 
ATOM   1242 C  C     . GLY A 1 156 ? 78.262 -17.477 17.233  1.00 52.66  ? 153  GLY A C     1 
ATOM   1243 O  O     . GLY A 1 156 ? 77.956 -16.507 17.926  1.00 54.45  ? 153  GLY A O     1 
ATOM   1244 N  N     . PRO A 1 157 ? 79.455 -18.089 17.319  1.00 60.53  ? 154  PRO A N     1 
ATOM   1245 C  CA    . PRO A 1 157 ? 80.550 -17.641 18.190  1.00 59.42  ? 154  PRO A CA    1 
ATOM   1246 C  C     . PRO A 1 157 ? 81.211 -16.351 17.699  1.00 53.93  ? 154  PRO A C     1 
ATOM   1247 O  O     . PRO A 1 157 ? 81.987 -16.378 16.744  1.00 56.04  ? 154  PRO A O     1 
ATOM   1248 C  CB    . PRO A 1 157 ? 81.538 -18.813 18.146  1.00 52.31  ? 154  PRO A CB    1 
ATOM   1249 C  CG    . PRO A 1 157 ? 81.224 -19.537 16.880  1.00 48.33  ? 154  PRO A CG    1 
ATOM   1250 C  CD    . PRO A 1 157 ? 79.754 -19.376 16.667  1.00 53.92  ? 154  PRO A CD    1 
ATOM   1251 N  N     . THR A 1 163 ? 79.792 -5.910  20.599  1.00 94.68  ? 160  THR A N     1 
ATOM   1252 C  CA    . THR A 1 163 ? 79.055 -4.722  20.182  1.00 94.35  ? 160  THR A CA    1 
ATOM   1253 C  C     . THR A 1 163 ? 77.699 -4.656  20.885  1.00 92.55  ? 160  THR A C     1 
ATOM   1254 O  O     . THR A 1 163 ? 77.043 -5.680  21.082  1.00 89.84  ? 160  THR A O     1 
ATOM   1255 C  CB    . THR A 1 163 ? 78.849 -4.698  18.647  1.00 92.45  ? 160  THR A CB    1 
ATOM   1256 O  OG1   . THR A 1 163 ? 80.122 -4.671  17.990  1.00 93.99  ? 160  THR A OG1   1 
ATOM   1257 C  CG2   . THR A 1 163 ? 78.053 -3.480  18.222  1.00 84.63  ? 160  THR A CG2   1 
ATOM   1258 N  N     . VAL A 1 164 ? 77.292 -3.451  21.277  1.00 87.70  ? 161  VAL A N     1 
ATOM   1259 C  CA    . VAL A 1 164 ? 75.975 -3.239  21.873  1.00 83.67  ? 161  VAL A CA    1 
ATOM   1260 C  C     . VAL A 1 164 ? 75.212 -2.099  21.177  1.00 75.07  ? 161  VAL A C     1 
ATOM   1261 O  O     . VAL A 1 164 ? 74.217 -1.599  21.704  1.00 69.93  ? 161  VAL A O     1 
ATOM   1262 C  CB    . VAL A 1 164 ? 76.079 -2.936  23.392  1.00 70.34  ? 161  VAL A CB    1 
ATOM   1263 C  CG1   . VAL A 1 164 ? 76.635 -4.139  24.153  1.00 59.38  ? 161  VAL A CG1   1 
ATOM   1264 C  CG2   . VAL A 1 164 ? 76.938 -1.706  23.639  1.00 71.41  ? 161  VAL A CG2   1 
ATOM   1265 N  N     . GLN A 1 165 ? 75.681 -1.698  19.994  1.00 65.61  ? 162  GLN A N     1 
ATOM   1266 C  CA    . GLN A 1 165 ? 75.036 -0.639  19.213  1.00 60.58  ? 162  GLN A CA    1 
ATOM   1267 C  C     . GLN A 1 165 ? 74.321 -1.234  18.002  1.00 53.33  ? 162  GLN A C     1 
ATOM   1268 O  O     . GLN A 1 165 ? 74.681 -2.309  17.528  1.00 46.78  ? 162  GLN A O     1 
ATOM   1269 C  CB    . GLN A 1 165 ? 76.060 0.404   18.757  1.00 61.76  ? 162  GLN A CB    1 
ATOM   1270 C  CG    . GLN A 1 165 ? 77.131 -0.153  17.829  1.00 62.82  ? 162  GLN A CG    1 
ATOM   1271 C  CD    . GLN A 1 165 ? 78.163 0.878   17.413  1.00 63.18  ? 162  GLN A CD    1 
ATOM   1272 O  OE1   . GLN A 1 165 ? 77.829 1.912   16.835  1.00 69.70  ? 162  GLN A OE1   1 
ATOM   1273 N  NE2   . GLN A 1 165 ? 79.427 0.596   17.700  1.00 58.34  ? 162  GLN A NE2   1 
ATOM   1274 N  N     . LYS A 1 166 ? 73.313 -0.539  17.494  1.00 43.87  ? 163  LYS A N     1 
ATOM   1275 C  CA    . LYS A 1 166 ? 72.508 -1.101  16.415  1.00 42.66  ? 163  LYS A CA    1 
ATOM   1276 C  C     . LYS A 1 166 ? 73.216 -1.115  15.051  1.00 32.06  ? 163  LYS A C     1 
ATOM   1277 O  O     . LYS A 1 166 ? 73.152 -2.113  14.331  1.00 25.91  ? 163  LYS A O     1 
ATOM   1278 C  CB    . LYS A 1 166 ? 71.176 -0.355  16.324  1.00 45.77  ? 163  LYS A CB    1 
ATOM   1279 C  CG    . LYS A 1 166 ? 71.281 1.036   15.747  1.00 52.45  ? 163  LYS A CG    1 
ATOM   1280 C  CD    . LYS A 1 166 ? 69.969 1.471   15.153  1.00 58.84  ? 163  LYS A CD    1 
ATOM   1281 C  CE    . LYS A 1 166 ? 70.194 2.165   13.827  1.00 57.73  ? 163  LYS A CE    1 
ATOM   1282 N  NZ    . LYS A 1 166 ? 68.983 2.078   12.973  1.00 62.01  ? 163  LYS A NZ    1 
ATOM   1283 N  N     . GLU A 1 167 ? 73.899 -0.031  14.697  1.00 32.64  ? 164  GLU A N     1 
ATOM   1284 C  CA    . GLU A 1 167 ? 74.596 0.031   13.415  1.00 32.23  ? 164  GLU A CA    1 
ATOM   1285 C  C     . GLU A 1 167 ? 75.759 -0.956  13.409  1.00 32.69  ? 164  GLU A C     1 
ATOM   1286 O  O     . GLU A 1 167 ? 76.129 -1.494  12.359  1.00 29.17  ? 164  GLU A O     1 
ATOM   1287 C  CB    . GLU A 1 167 ? 75.084 1.455   13.126  1.00 37.18  ? 164  GLU A CB    1 
ATOM   1288 C  CG    . GLU A 1 167 ? 76.098 1.587   11.985  1.00 26.15  ? 164  GLU A CG    1 
ATOM   1289 C  CD    . GLU A 1 167 ? 75.530 1.260   10.606  1.00 29.39  ? 164  GLU A CD    1 
ATOM   1290 O  OE1   . GLU A 1 167 ? 76.335 1.162   9.648   1.00 34.66  ? 164  GLU A OE1   1 
ATOM   1291 O  OE2   . GLU A 1 167 ? 74.291 1.106   10.471  1.00 35.16  ? 164  GLU A OE2   1 
ATOM   1292 N  N     . GLY A 1 168 ? 76.313 -1.205  14.593  1.00 36.70  ? 165  GLY A N     1 
ATOM   1293 C  CA    . GLY A 1 168 ? 77.392 -2.160  14.754  1.00 42.33  ? 165  GLY A CA    1 
ATOM   1294 C  C     . GLY A 1 168 ? 76.943 -3.572  14.445  1.00 26.68  ? 165  GLY A C     1 
ATOM   1295 O  O     . GLY A 1 168 ? 77.643 -4.312  13.750  1.00 31.63  ? 165  GLY A O     1 
ATOM   1296 N  N     . MET A 1 169 ? 75.778 -3.945  14.972  1.00 33.13  ? 166  MET A N     1 
ATOM   1297 C  CA    . MET A 1 169 ? 75.172 -5.246  14.702  1.00 28.39  ? 166  MET A CA    1 
ATOM   1298 C  C     . MET A 1 169 ? 74.871 -5.431  13.215  1.00 25.65  ? 166  MET A C     1 
ATOM   1299 O  O     . MET A 1 169 ? 75.113 -6.504  12.663  1.00 24.16  ? 166  MET A O     1 
ATOM   1300 C  CB    . MET A 1 169 ? 73.880 -5.429  15.509  1.00 35.67  ? 166  MET A CB    1 
ATOM   1301 C  CG    . MET A 1 169 ? 74.085 -5.668  16.998  1.00 50.92  ? 166  MET A CG    1 
ATOM   1302 S  SD    . MET A 1 169 ? 74.644 -7.344  17.381  1.00 79.25  ? 166  MET A SD    1 
ATOM   1303 C  CE    . MET A 1 169 ? 73.191 -8.308  16.940  1.00 43.88  ? 166  MET A CE    1 
ATOM   1304 N  N     . ARG A 1 170 ? 74.347 -4.392  12.569  1.00 25.79  ? 167  ARG A N     1 
ATOM   1305 C  CA    . ARG A 1 170 ? 74.032 -4.489  11.148  1.00 21.29  ? 167  ARG A CA    1 
ATOM   1306 C  C     . ARG A 1 170 ? 75.283 -4.829  10.357  1.00 19.72  ? 167  ARG A C     1 
ATOM   1307 O  O     . ARG A 1 170 ? 75.263 -5.715  9.506   1.00 20.15  ? 167  ARG A O     1 
ATOM   1308 C  CB    . ARG A 1 170 ? 73.421 -3.189  10.606  1.00 23.09  ? 167  ARG A CB    1 
ATOM   1309 C  CG    . ARG A 1 170 ? 73.064 -3.279  9.119   1.00 19.38  ? 167  ARG A CG    1 
ATOM   1310 C  CD    . ARG A 1 170 ? 72.884 -1.895  8.463   1.00 18.57  ? 167  ARG A CD    1 
ATOM   1311 N  NE    . ARG A 1 170 ? 74.142 -1.160  8.282   1.00 22.22  ? 167  ARG A NE    1 
ATOM   1312 C  CZ    . ARG A 1 170 ? 74.943 -1.284  7.224   1.00 17.79  ? 167  ARG A CZ    1 
ATOM   1313 N  NH1   . ARG A 1 170 ? 74.644 -2.131  6.243   1.00 17.55  ? 167  ARG A NH1   1 
ATOM   1314 N  NH2   . ARG A 1 170 ? 76.049 -0.563  7.139   1.00 24.02  ? 167  ARG A NH2   1 
ATOM   1315 N  N     . LYS A 1 171 ? 76.372 -4.120  10.644  1.00 21.41  ? 168  LYS A N     1 
ATOM   1316 C  CA    . LYS A 1 171 ? 77.633 -4.339  9.939   1.00 23.07  ? 168  LYS A CA    1 
ATOM   1317 C  C     . LYS A 1 171 ? 78.219 -5.721  10.211  1.00 22.22  ? 168  LYS A C     1 
ATOM   1318 O  O     . LYS A 1 171 ? 78.776 -6.347  9.311   1.00 20.96  ? 168  LYS A O     1 
ATOM   1319 C  CB    . LYS A 1 171 ? 78.650 -3.262  10.323  1.00 26.09  ? 168  LYS A CB    1 
ATOM   1320 C  CG    . LYS A 1 171 ? 78.553 -1.989  9.497   1.00 37.17  ? 168  LYS A CG    1 
ATOM   1321 C  CD    . LYS A 1 171 ? 79.511 -0.928  10.031  1.00 42.54  ? 168  LYS A CD    1 
ATOM   1322 C  CE    . LYS A 1 171 ? 79.816 0.133   8.988   1.00 50.46  ? 168  LYS A CE    1 
ATOM   1323 N  NZ    . LYS A 1 171 ? 80.825 -0.359  8.008   1.00 63.21  ? 168  LYS A NZ    1 
ATOM   1324 N  N     . GLN A 1 172 ? 78.102 -6.193  11.449  1.00 25.49  ? 169  GLN A N     1 
ATOM   1325 C  CA    . GLN A 1 172 ? 78.584 -7.531  11.783  1.00 24.02  ? 169  GLN A CA    1 
ATOM   1326 C  C     . GLN A 1 172 ? 77.867 -8.573  10.932  1.00 21.27  ? 169  GLN A C     1 
ATOM   1327 O  O     . GLN A 1 172 ? 78.495 -9.467  10.366  1.00 19.37  ? 169  GLN A O     1 
ATOM   1328 C  CB    . GLN A 1 172 ? 78.385 -7.838  13.266  1.00 24.96  ? 169  GLN A CB    1 
ATOM   1329 C  CG    . GLN A 1 172 ? 79.372 -7.137  14.181  1.00 38.86  ? 169  GLN A CG    1 
ATOM   1330 C  CD    . GLN A 1 172 ? 79.110 -7.428  15.645  1.00 58.34  ? 169  GLN A CD    1 
ATOM   1331 O  OE1   . GLN A 1 172 ? 77.989 -7.765  16.030  1.00 57.61  ? 169  GLN A OE1   1 
ATOM   1332 N  NE2   . GLN A 1 172 ? 80.144 -7.296  16.472  1.00 64.44  ? 169  GLN A NE2   1 
ATOM   1333 N  N     . GLY A 1 173 ? 76.546 -8.444  10.828  1.00 19.87  ? 170  GLY A N     1 
ATOM   1334 C  CA    . GLY A 1 173 ? 75.780 -9.390  10.041  1.00 15.51  ? 170  GLY A CA    1 
ATOM   1335 C  C     . GLY A 1 173 ? 76.146 -9.333  8.572   1.00 18.70  ? 170  GLY A C     1 
ATOM   1336 O  O     . GLY A 1 173 ? 76.287 -10.373 7.917   1.00 17.73  ? 170  GLY A O     1 
ATOM   1337 N  N     . LEU A 1 174 ? 76.309 -8.119  8.056   1.00 17.83  ? 171  LEU A N     1 
ATOM   1338 C  CA    . LEU A 1 174 ? 76.664 -7.925  6.660   1.00 15.31  ? 171  LEU A CA    1 
ATOM   1339 C  C     . LEU A 1 174 ? 78.044 -8.519  6.390   1.00 18.39  ? 171  LEU A C     1 
ATOM   1340 O  O     . LEU A 1 174 ? 78.270 -9.151  5.355   1.00 18.42  ? 171  LEU A O     1 
ATOM   1341 C  CB    . LEU A 1 174 ? 76.631 -6.431  6.299   1.00 17.03  ? 171  LEU A CB    1 
ATOM   1342 C  CG    . LEU A 1 174 ? 76.980 -6.052  4.863   1.00 18.89  ? 171  LEU A CG    1 
ATOM   1343 C  CD1   . LEU A 1 174 ? 76.035 -6.704  3.858   1.00 17.47  ? 171  LEU A CD1   1 
ATOM   1344 C  CD2   . LEU A 1 174 ? 76.978 -4.541  4.708   1.00 23.07  ? 171  LEU A CD2   1 
ATOM   1345 N  N     . PHE A 1 175 ? 78.958 -8.318  7.334   1.00 20.30  ? 172  PHE A N     1 
ATOM   1346 C  CA    . PHE A 1 175 ? 80.311 -8.843  7.196   1.00 24.07  ? 172  PHE A CA    1 
ATOM   1347 C  C     . PHE A 1 175 ? 80.283 -10.364 7.119   1.00 20.11  ? 172  PHE A C     1 
ATOM   1348 O  O     . PHE A 1 175 ? 80.915 -10.955 6.241   1.00 25.67  ? 172  PHE A O     1 
ATOM   1349 C  CB    . PHE A 1 175 ? 81.191 -8.379  8.352   1.00 18.92  ? 172  PHE A CB    1 
ATOM   1350 C  CG    . PHE A 1 175 ? 81.710 -6.981  8.189   1.00 39.06  ? 172  PHE A CG    1 
ATOM   1351 C  CD1   . PHE A 1 175 ? 82.021 -6.488  6.931   1.00 48.61  ? 172  PHE A CD1   1 
ATOM   1352 C  CD2   . PHE A 1 175 ? 81.891 -6.160  9.291   1.00 41.89  ? 172  PHE A CD2   1 
ATOM   1353 C  CE1   . PHE A 1 175 ? 82.501 -5.200  6.773   1.00 50.38  ? 172  PHE A CE1   1 
ATOM   1354 C  CE2   . PHE A 1 175 ? 82.372 -4.870  9.141   1.00 54.96  ? 172  PHE A CE2   1 
ATOM   1355 C  CZ    . PHE A 1 175 ? 82.676 -4.389  7.880   1.00 56.64  ? 172  PHE A CZ    1 
ATOM   1356 N  N     . GLN A 1 176 ? 79.537 -10.998 8.023   1.00 19.44  ? 173  GLN A N     1 
ATOM   1357 C  CA    . GLN A 1 176 ? 79.425 -12.460 8.021   1.00 18.67  ? 173  GLN A CA    1 
ATOM   1358 C  C     . GLN A 1 176 ? 78.856 -12.950 6.703   1.00 25.51  ? 173  GLN A C     1 
ATOM   1359 O  O     . GLN A 1 176 ? 79.302 -13.955 6.144   1.00 23.31  ? 173  GLN A O     1 
ATOM   1360 C  CB    . GLN A 1 176 ? 78.549 -12.957 9.177   1.00 22.52  ? 173  GLN A CB    1 
ATOM   1361 C  CG    . GLN A 1 176 ? 79.176 -12.815 10.557  1.00 22.51  ? 173  GLN A CG    1 
ATOM   1362 C  CD    . GLN A 1 176 ? 78.397 -13.540 11.640  1.00 24.05  ? 173  GLN A CD    1 
ATOM   1363 O  OE1   . GLN A 1 176 ? 77.299 -14.034 11.407  1.00 27.20  ? 173  GLN A OE1   1 
ATOM   1364 N  NE2   . GLN A 1 176 ? 78.977 -13.620 12.832  1.00 30.86  ? 173  GLN A NE2   1 
ATOM   1365 N  N     . TRP A 1 177 ? 77.856 -12.225 6.214   1.00 17.26  ? 174  TRP A N     1 
ATOM   1366 C  CA    . TRP A 1 177 ? 77.200 -12.567 4.959   1.00 16.37  ? 174  TRP A CA    1 
ATOM   1367 C  C     . TRP A 1 177 ? 78.172 -12.477 3.789   1.00 16.73  ? 174  TRP A C     1 
ATOM   1368 O  O     . TRP A 1 177 ? 78.287 -13.413 2.999   1.00 18.59  ? 174  TRP A O     1 
ATOM   1369 C  CB    . TRP A 1 177 ? 76.001 -11.641 4.715   1.00 14.13  ? 174  TRP A CB    1 
ATOM   1370 C  CG    . TRP A 1 177 ? 75.327 -11.819 3.380   1.00 16.65  ? 174  TRP A CG    1 
ATOM   1371 C  CD1   . TRP A 1 177 ? 75.418 -10.993 2.294   1.00 16.21  ? 174  TRP A CD1   1 
ATOM   1372 C  CD2   . TRP A 1 177 ? 74.448 -12.886 2.999   1.00 16.97  ? 174  TRP A CD2   1 
ATOM   1373 N  NE1   . TRP A 1 177 ? 74.652 -11.478 1.262   1.00 16.23  ? 174  TRP A NE1   1 
ATOM   1374 C  CE2   . TRP A 1 177 ? 74.046 -12.641 1.670   1.00 17.94  ? 174  TRP A CE2   1 
ATOM   1375 C  CE3   . TRP A 1 177 ? 73.971 -14.030 3.651   1.00 15.23  ? 174  TRP A CE3   1 
ATOM   1376 C  CZ2   . TRP A 1 177 ? 73.179 -13.491 0.983   1.00 15.37  ? 174  TRP A CZ2   1 
ATOM   1377 C  CZ3   . TRP A 1 177 ? 73.104 -14.881 2.963   1.00 18.87  ? 174  TRP A CZ3   1 
ATOM   1378 C  CH2   . TRP A 1 177 ? 72.727 -14.607 1.641   1.00 19.76  ? 174  TRP A CH2   1 
ATOM   1379 N  N     . LEU A 1 178 ? 78.877 -11.356 3.688   1.00 19.35  ? 175  LEU A N     1 
ATOM   1380 C  CA    . LEU A 1 178 ? 79.749 -11.124 2.542   1.00 17.21  ? 175  LEU A CA    1 
ATOM   1381 C  C     . LEU A 1 178 ? 80.888 -12.139 2.520   1.00 25.02  ? 175  LEU A C     1 
ATOM   1382 O  O     . LEU A 1 178 ? 81.257 -12.654 1.467   1.00 28.11  ? 175  LEU A O     1 
ATOM   1383 C  CB    . LEU A 1 178 ? 80.301 -9.698  2.551   1.00 19.40  ? 175  LEU A CB    1 
ATOM   1384 C  CG    . LEU A 1 178 ? 79.222 -8.639  2.302   1.00 22.40  ? 175  LEU A CG    1 
ATOM   1385 C  CD1   . LEU A 1 178 ? 79.791 -7.236  2.390   1.00 23.03  ? 175  LEU A CD1   1 
ATOM   1386 C  CD2   . LEU A 1 178 ? 78.554 -8.866  0.948   1.00 19.95  ? 175  LEU A CD2   1 
ATOM   1387 N  N     . ASP A 1 179 ? 81.420 -12.438 3.696   1.00 29.17  ? 176  ASP A N     1 
ATOM   1388 C  CA    . ASP A 1 179 ? 82.529 -13.376 3.803   1.00 34.30  ? 176  ASP A CA    1 
ATOM   1389 C  C     . ASP A 1 179 ? 82.126 -14.792 3.445   1.00 36.66  ? 176  ASP A C     1 
ATOM   1390 O  O     . ASP A 1 179 ? 82.964 -15.590 3.038   1.00 39.46  ? 176  ASP A O     1 
ATOM   1391 C  CB    . ASP A 1 179 ? 83.125 -13.346 5.209   1.00 31.84  ? 176  ASP A CB    1 
ATOM   1392 C  CG    . ASP A 1 179 ? 84.176 -12.272 5.362   1.00 47.88  ? 176  ASP A CG    1 
ATOM   1393 O  OD1   . ASP A 1 179 ? 84.115 -11.265 4.627   1.00 54.72  ? 176  ASP A OD1   1 
ATOM   1394 O  OD2   . ASP A 1 179 ? 85.070 -12.439 6.211   1.00 63.51  ? 176  ASP A OD2   1 
ATOM   1395 N  N     . SER A 1 180 ? 80.848 -15.112 3.600   1.00 29.56  ? 177  SER A N     1 
ATOM   1396 C  CA    . SER A 1 180 ? 80.360 -16.436 3.228   1.00 31.95  ? 177  SER A CA    1 
ATOM   1397 C  C     . SER A 1 180 ? 80.060 -16.552 1.734   1.00 34.00  ? 177  SER A C     1 
ATOM   1398 O  O     . SER A 1 180 ? 79.803 -17.644 1.230   1.00 43.53  ? 177  SER A O     1 
ATOM   1399 C  CB    . SER A 1 180 ? 79.112 -16.786 4.033   1.00 30.98  ? 177  SER A CB    1 
ATOM   1400 O  OG    . SER A 1 180 ? 79.397 -16.786 5.419   1.00 40.40  ? 177  SER A OG    1 
ATOM   1401 N  N     . LEU A 1 181 ? 80.044 -15.432 1.019   1.00 27.79  ? 178  LEU A N     1 
ATOM   1402 C  CA    . LEU A 1 181 ? 79.590 -15.449 -0.374  1.00 24.93  ? 178  LEU A CA    1 
ATOM   1403 C  C     . LEU A 1 181 ? 80.513 -16.216 -1.311  1.00 42.05  ? 178  LEU A C     1 
ATOM   1404 O  O     . LEU A 1 181 ? 81.707 -16.353 -1.047  1.00 44.30  ? 178  LEU A O     1 
ATOM   1405 C  CB    . LEU A 1 181 ? 79.422 -14.022 -0.897  1.00 31.16  ? 178  LEU A CB    1 
ATOM   1406 C  CG    . LEU A 1 181 ? 78.085 -13.368 -0.566  1.00 32.05  ? 178  LEU A CG    1 
ATOM   1407 C  CD1   . LEU A 1 181 ? 77.964 -12.016 -1.256  1.00 22.35  ? 178  LEU A CD1   1 
ATOM   1408 C  CD2   . LEU A 1 181 ? 76.943 -14.290 -0.973  1.00 23.88  ? 178  LEU A CD2   1 
ATOM   1409 N  N     . GLN A 1 182 ? 79.951 -16.720 -2.406  1.00 39.72  ? 179  GLN A N     1 
ATOM   1410 C  CA    . GLN A 1 182 ? 80.770 -17.249 -3.487  1.00 51.62  ? 179  GLN A CA    1 
ATOM   1411 C  C     . GLN A 1 182 ? 80.543 -16.444 -4.764  1.00 50.94  ? 179  GLN A C     1 
ATOM   1412 O  O     . GLN A 1 182 ? 79.691 -16.782 -5.587  1.00 52.21  ? 179  GLN A O     1 
ATOM   1413 C  CB    . GLN A 1 182 ? 80.482 -18.728 -3.731  1.00 48.54  ? 179  GLN A CB    1 
ATOM   1414 C  CG    . GLN A 1 182 ? 81.469 -19.366 -4.693  1.00 57.59  ? 179  GLN A CG    1 
ATOM   1415 C  CD    . GLN A 1 182 ? 82.911 -18.995 -4.374  1.00 63.32  ? 179  GLN A CD    1 
ATOM   1416 O  OE1   . GLN A 1 182 ? 83.465 -18.054 -4.946  1.00 57.50  ? 179  GLN A OE1   1 
ATOM   1417 N  NE2   . GLN A 1 182 ? 83.523 -19.734 -3.453  1.00 60.63  ? 179  GLN A NE2   1 
ATOM   1418 N  N     . ILE A 1 183 ? 81.326 -15.381 -4.923  1.00 50.90  ? 180  ILE A N     1 
ATOM   1419 C  CA    . ILE A 1 183 ? 81.163 -14.450 -6.035  1.00 53.06  ? 180  ILE A CA    1 
ATOM   1420 C  C     . ILE A 1 183 ? 81.641 -15.037 -7.362  1.00 56.33  ? 180  ILE A C     1 
ATOM   1421 O  O     . ILE A 1 183 ? 81.529 -14.402 -8.412  1.00 55.79  ? 180  ILE A O     1 
ATOM   1422 C  CB    . ILE A 1 183 ? 81.907 -13.127 -5.760  1.00 51.67  ? 180  ILE A CB    1 
ATOM   1423 C  CG1   . ILE A 1 183 ? 83.256 -13.387 -5.082  1.00 53.14  ? 180  ILE A CG1   1 
ATOM   1424 C  CG2   . ILE A 1 183 ? 81.074 -12.236 -4.864  1.00 48.05  ? 180  ILE A CG2   1 
ATOM   1425 C  CD1   . ILE A 1 183 ? 84.386 -13.715 -6.030  1.00 57.34  ? 180  ILE A CD1   1 
ATOM   1426 N  N     . ASP A 1 184 ? 82.166 -16.254 -7.300  1.00 59.63  ? 181  ASP A N     1 
ATOM   1427 C  CA    . ASP A 1 184 ? 82.686 -16.944 -8.471  1.00 61.26  ? 181  ASP A CA    1 
ATOM   1428 C  C     . ASP A 1 184 ? 81.562 -17.577 -9.291  1.00 61.28  ? 181  ASP A C     1 
ATOM   1429 O  O     . ASP A 1 184 ? 81.743 -17.898 -10.465 1.00 64.25  ? 181  ASP A O     1 
ATOM   1430 C  CB    . ASP A 1 184 ? 83.695 -18.011 -8.038  1.00 65.32  ? 181  ASP A CB    1 
ATOM   1431 C  CG    . ASP A 1 184 ? 84.441 -18.624 -9.202  1.00 76.11  ? 181  ASP A CG    1 
ATOM   1432 O  OD1   . ASP A 1 184 ? 84.690 -17.908 -10.195 1.00 76.12  ? 181  ASP A OD1   1 
ATOM   1433 O  OD2   . ASP A 1 184 ? 84.786 -19.822 -9.119  1.00 75.48  ? 181  ASP A OD2   1 
ATOM   1434 N  N     . ASN A 1 185 ? 80.400 -17.745 -8.667  1.00 57.04  ? 182  ASN A N     1 
ATOM   1435 C  CA    . ASN A 1 185 ? 79.277 -18.429 -9.303  1.00 50.94  ? 182  ASN A CA    1 
ATOM   1436 C  C     . ASN A 1 185 ? 78.137 -17.475 -9.666  1.00 47.42  ? 182  ASN A C     1 
ATOM   1437 O  O     . ASN A 1 185 ? 77.400 -17.017 -8.796  1.00 48.53  ? 182  ASN A O     1 
ATOM   1438 C  CB    . ASN A 1 185 ? 78.765 -19.544 -8.385  1.00 46.03  ? 182  ASN A CB    1 
ATOM   1439 C  CG    . ASN A 1 185 ? 77.659 -20.368 -9.018  1.00 45.91  ? 182  ASN A CG    1 
ATOM   1440 O  OD1   . ASN A 1 185 ? 77.399 -20.269 -10.218 1.00 50.18  ? 182  ASN A OD1   1 
ATOM   1441 N  ND2   . ASN A 1 185 ? 77.005 -21.197 -8.210  1.00 47.64  ? 182  ASN A ND2   1 
ATOM   1442 N  N     . LEU A 1 186 ? 77.985 -17.200 -10.959 1.00 42.74  ? 183  LEU A N     1 
ATOM   1443 C  CA    . LEU A 1 186 ? 76.993 -16.238 -11.439 1.00 44.23  ? 183  LEU A CA    1 
ATOM   1444 C  C     . LEU A 1 186 ? 75.559 -16.764 -11.346 1.00 40.65  ? 183  LEU A C     1 
ATOM   1445 O  O     . LEU A 1 186 ? 74.607 -16.047 -11.660 1.00 41.45  ? 183  LEU A O     1 
ATOM   1446 C  CB    . LEU A 1 186 ? 77.303 -15.836 -12.886 1.00 38.63  ? 183  LEU A CB    1 
ATOM   1447 C  CG    . LEU A 1 186 ? 78.286 -14.680 -13.116 1.00 48.53  ? 183  LEU A CG    1 
ATOM   1448 C  CD1   . LEU A 1 186 ? 79.690 -15.029 -12.640 1.00 52.86  ? 183  LEU A CD1   1 
ATOM   1449 C  CD2   . LEU A 1 186 ? 78.306 -14.278 -14.584 1.00 44.58  ? 183  LEU A CD2   1 
ATOM   1450 N  N     . THR A 1 187 ? 75.406 -18.012 -10.918 1.00 42.77  ? 184  THR A N     1 
ATOM   1451 C  CA    . THR A 1 187 ? 74.083 -18.614 -10.785 1.00 36.55  ? 184  THR A CA    1 
ATOM   1452 C  C     . THR A 1 187 ? 73.725 -18.884 -9.324  1.00 37.57  ? 184  THR A C     1 
ATOM   1453 O  O     . THR A 1 187 ? 72.661 -19.429 -9.033  1.00 42.97  ? 184  THR A O     1 
ATOM   1454 C  CB    . THR A 1 187 ? 73.981 -19.933 -11.576 1.00 44.91  ? 184  THR A CB    1 
ATOM   1455 O  OG1   . THR A 1 187 ? 74.825 -20.924 -10.976 1.00 50.69  ? 184  THR A OG1   1 
ATOM   1456 C  CG2   . THR A 1 187 ? 74.400 -19.720 -13.026 1.00 48.48  ? 184  THR A CG2   1 
ATOM   1457 N  N     . SER A 1 188 ? 74.618 -18.509 -8.409  1.00 29.53  ? 185  SER A N     1 
ATOM   1458 C  CA    . SER A 1 188 ? 74.361 -18.667 -6.977  1.00 24.24  ? 185  SER A CA    1 
ATOM   1459 C  C     . SER A 1 188 ? 73.277 -17.707 -6.498  1.00 22.43  ? 185  SER A C     1 
ATOM   1460 O  O     . SER A 1 188 ? 73.448 -16.495 -6.584  1.00 17.29  ? 185  SER A O     1 
ATOM   1461 C  CB    . SER A 1 188 ? 75.642 -18.438 -6.173  1.00 34.06  ? 185  SER A CB    1 
ATOM   1462 O  OG    . SER A 1 188 ? 75.351 -18.299 -4.791  1.00 31.13  ? 185  SER A OG    1 
ATOM   1463 N  N     . PRO A 1 189 ? 72.161 -18.245 -5.983  1.00 19.89  ? 186  PRO A N     1 
ATOM   1464 C  CA    . PRO A 1 189 ? 71.051 -17.389 -5.542  1.00 18.77  ? 186  PRO A CA    1 
ATOM   1465 C  C     . PRO A 1 189 ? 71.436 -16.375 -4.460  1.00 19.63  ? 186  PRO A C     1 
ATOM   1466 O  O     . PRO A 1 189 ? 70.925 -15.256 -4.486  1.00 16.16  ? 186  PRO A O     1 
ATOM   1467 C  CB    . PRO A 1 189 ? 70.036 -18.399 -4.992  1.00 16.95  ? 186  PRO A CB    1 
ATOM   1468 C  CG    . PRO A 1 189 ? 70.292 -19.629 -5.795  1.00 18.62  ? 186  PRO A CG    1 
ATOM   1469 C  CD    . PRO A 1 189 ? 71.778 -19.672 -5.952  1.00 18.88  ? 186  PRO A CD    1 
ATOM   1470 N  N     . ASP A 1 190 ? 72.305 -16.745 -3.525  1.00 14.64  ? 187  ASP A N     1 
ATOM   1471 C  CA    . ASP A 1 190 ? 72.676 -15.793 -2.480  1.00 14.75  ? 187  ASP A CA    1 
ATOM   1472 C  C     . ASP A 1 190 ? 73.403 -14.608 -3.089  1.00 15.21  ? 187  ASP A C     1 
ATOM   1473 O  O     . ASP A 1 190 ? 73.182 -13.465 -2.677  1.00 15.10  ? 187  ASP A O     1 
ATOM   1474 C  CB    . ASP A 1 190 ? 73.562 -16.443 -1.408  1.00 14.87  ? 187  ASP A CB    1 
ATOM   1475 C  CG    . ASP A 1 190 ? 72.800 -17.406 -0.512  1.00 20.28  ? 187  ASP A CG    1 
ATOM   1476 O  OD1   . ASP A 1 190 ? 71.561 -17.347 -0.463  1.00 14.76  ? 187  ASP A OD1   1 
ATOM   1477 O  OD2   . ASP A 1 190 ? 73.456 -18.218 0.169   1.00 19.76  ? 187  ASP A OD2   1 
ATOM   1478 N  N     . LEU A 1 191 ? 74.280 -14.889 -4.053  1.00 15.32  ? 188  LEU A N     1 
ATOM   1479 C  CA    . LEU A 1 191 ? 75.015 -13.832 -4.747  1.00 16.93  ? 188  LEU A CA    1 
ATOM   1480 C  C     . LEU A 1 191 ? 74.040 -12.945 -5.515  1.00 14.67  ? 188  LEU A C     1 
ATOM   1481 O  O     . LEU A 1 191 ? 74.148 -11.723 -5.487  1.00 14.32  ? 188  LEU A O     1 
ATOM   1482 C  CB    . LEU A 1 191 ? 76.065 -14.421 -5.704  1.00 18.50  ? 188  LEU A CB    1 
ATOM   1483 C  CG    . LEU A 1 191 ? 76.825 -13.398 -6.565  1.00 22.94  ? 188  LEU A CG    1 
ATOM   1484 C  CD1   . LEU A 1 191 ? 77.525 -12.359 -5.719  1.00 19.25  ? 188  LEU A CD1   1 
ATOM   1485 C  CD2   . LEU A 1 191 ? 77.832 -14.095 -7.479  1.00 25.25  ? 188  LEU A CD2   1 
ATOM   1486 N  N     . GLN A 1 192 ? 73.084 -13.568 -6.197  1.00 17.14  ? 189  GLN A N     1 
ATOM   1487 C  CA    . GLN A 1 192 ? 72.083 -12.826 -6.954  1.00 17.50  ? 189  GLN A CA    1 
ATOM   1488 C  C     . GLN A 1 192 ? 71.268 -11.894 -6.054  1.00 16.55  ? 189  GLN A C     1 
ATOM   1489 O  O     . GLN A 1 192 ? 70.993 -10.754 -6.424  1.00 15.28  ? 189  GLN A O     1 
ATOM   1490 C  CB    . GLN A 1 192 ? 71.159 -13.788 -7.695  1.00 19.36  ? 189  GLN A CB    1 
ATOM   1491 C  CG    . GLN A 1 192 ? 71.861 -14.484 -8.854  1.00 19.37  ? 189  GLN A CG    1 
ATOM   1492 C  CD    . GLN A 1 192 ? 71.134 -15.713 -9.349  1.00 32.03  ? 189  GLN A CD    1 
ATOM   1493 O  OE1   . GLN A 1 192 ? 70.092 -16.094 -8.818  1.00 37.41  ? 189  GLN A OE1   1 
ATOM   1494 N  NE2   . GLN A 1 192 ? 71.685 -16.343 -10.381 1.00 43.16  ? 189  GLN A NE2   1 
ATOM   1495 N  N     . LEU A 1 193 ? 70.889 -12.369 -4.869  1.00 13.50  ? 190  LEU A N     1 
ATOM   1496 C  CA    . LEU A 1 193 ? 70.171 -11.514 -3.917  1.00 11.02  ? 190  LEU A CA    1 
ATOM   1497 C  C     . LEU A 1 193 ? 71.023 -10.327 -3.474  1.00 14.07  ? 190  LEU A C     1 
ATOM   1498 O  O     . LEU A 1 193 ? 70.518 -9.228  -3.288  1.00 16.82  ? 190  LEU A O     1 
ATOM   1499 C  CB    . LEU A 1 193 ? 69.727 -12.301 -2.670  1.00 11.56  ? 190  LEU A CB    1 
ATOM   1500 C  CG    . LEU A 1 193 ? 68.662 -13.380 -2.800  1.00 11.57  ? 190  LEU A CG    1 
ATOM   1501 C  CD1   . LEU A 1 193 ? 68.345 -13.954 -1.424  1.00 13.81  ? 190  LEU A CD1   1 
ATOM   1502 C  CD2   . LEU A 1 193 ? 67.406 -12.802 -3.459  1.00 13.48  ? 190  LEU A CD2   1 
ATOM   1503 N  N     . THR A 1 194 ? 72.314 -10.572 -3.272  1.00 14.79  ? 191  THR A N     1 
ATOM   1504 C  CA    . THR A 1 194 ? 73.224 -9.543  -2.812  1.00 14.36  ? 191  THR A CA    1 
ATOM   1505 C  C     . THR A 1 194 ? 73.337 -8.431  -3.840  1.00 15.51  ? 191  THR A C     1 
ATOM   1506 O  O     . THR A 1 194 ? 73.272 -7.253  -3.496  1.00 16.32  ? 191  THR A O     1 
ATOM   1507 C  CB    . THR A 1 194 ? 74.615 -10.128 -2.538  1.00 16.57  ? 191  THR A CB    1 
ATOM   1508 O  OG1   . THR A 1 194 ? 74.485 -11.175 -1.576  1.00 16.20  ? 191  THR A OG1   1 
ATOM   1509 C  CG2   . THR A 1 194 ? 75.540 -9.053  -1.976  1.00 13.10  ? 191  THR A CG2   1 
ATOM   1510 N  N     . VAL A 1 195 ? 73.483 -8.821  -5.105  1.00 15.62  ? 192  VAL A N     1 
ATOM   1511 C  CA    . VAL A 1 195 ? 73.542 -7.851  -6.195  1.00 14.98  ? 192  VAL A CA    1 
ATOM   1512 C  C     . VAL A 1 195 ? 72.186 -7.138  -6.312  1.00 16.97  ? 192  VAL A C     1 
ATOM   1513 O  O     . VAL A 1 195 ? 72.118 -5.927  -6.543  1.00 14.89  ? 192  VAL A O     1 
ATOM   1514 C  CB    . VAL A 1 195 ? 73.924 -8.522  -7.529  1.00 13.80  ? 192  VAL A CB    1 
ATOM   1515 C  CG1   . VAL A 1 195 ? 73.807 -7.525  -8.683  1.00 17.14  ? 192  VAL A CG1   1 
ATOM   1516 C  CG2   . VAL A 1 195 ? 75.338 -9.082  -7.459  1.00 15.72  ? 192  VAL A CG2   1 
ATOM   1517 N  N     . GLY A 1 196 ? 71.102 -7.886  -6.134  1.00 12.67  ? 193  GLY A N     1 
ATOM   1518 C  CA    . GLY A 1 196 ? 69.786 -7.262  -6.048  1.00 12.89  ? 193  GLY A CA    1 
ATOM   1519 C  C     . GLY A 1 196 ? 69.768 -6.153  -5.007  1.00 15.97  ? 193  GLY A C     1 
ATOM   1520 O  O     . GLY A 1 196 ? 69.260 -5.051  -5.249  1.00 14.54  ? 193  GLY A O     1 
ATOM   1521 N  N     . ALA A 1 197 ? 70.346 -6.437  -3.843  1.00 14.21  ? 194  ALA A N     1 
ATOM   1522 C  CA    . ALA A 1 197 ? 70.373 -5.466  -2.755  1.00 10.37  ? 194  ALA A CA    1 
ATOM   1523 C  C     . ALA A 1 197 ? 71.209 -4.228  -3.107  1.00 14.91  ? 194  ALA A C     1 
ATOM   1524 O  O     . ALA A 1 197 ? 70.855 -3.112  -2.729  1.00 14.27  ? 194  ALA A O     1 
ATOM   1525 C  CB    . ALA A 1 197 ? 70.883 -6.118  -1.481  1.00 16.93  ? 194  ALA A CB    1 
ATOM   1526 N  N     . VAL A 1 198 ? 72.302 -4.431  -3.835  1.00 13.17  ? 195  VAL A N     1 
ATOM   1527 C  CA    . VAL A 1 198 ? 73.112 -3.318  -4.326  1.00 11.79  ? 195  VAL A CA    1 
ATOM   1528 C  C     . VAL A 1 198 ? 72.279 -2.394  -5.219  1.00 15.88  ? 195  VAL A C     1 
ATOM   1529 O  O     . VAL A 1 198 ? 72.319 -1.172  -5.077  1.00 18.55  ? 195  VAL A O     1 
ATOM   1530 C  CB    . VAL A 1 198 ? 74.342 -3.812  -5.116  1.00 14.91  ? 195  VAL A CB    1 
ATOM   1531 C  CG1   . VAL A 1 198 ? 75.077 -2.625  -5.750  1.00 19.36  ? 195  VAL A CG1   1 
ATOM   1532 C  CG2   . VAL A 1 198 ? 75.282 -4.592  -4.218  1.00 16.80  ? 195  VAL A CG2   1 
ATOM   1533 N  N     . ILE A 1 199 ? 71.525 -2.985  -6.136  1.00 13.02  ? 196  ILE A N     1 
ATOM   1534 C  CA    . ILE A 1 199 ? 70.673 -2.208  -7.028  1.00 15.37  ? 196  ILE A CA    1 
ATOM   1535 C  C     . ILE A 1 199 ? 69.597 -1.466  -6.237  1.00 18.39  ? 196  ILE A C     1 
ATOM   1536 O  O     . ILE A 1 199 ? 69.298 -0.312  -6.519  1.00 14.78  ? 196  ILE A O     1 
ATOM   1537 C  CB    . ILE A 1 199 ? 70.036 -3.115  -8.101  1.00 12.38  ? 196  ILE A CB    1 
ATOM   1538 C  CG1   . ILE A 1 199 ? 71.128 -3.616  -9.062  1.00 15.26  ? 196  ILE A CG1   1 
ATOM   1539 C  CG2   . ILE A 1 199 ? 68.938 -2.379  -8.865  1.00 12.35  ? 196  ILE A CG2   1 
ATOM   1540 C  CD1   . ILE A 1 199 ? 70.659 -4.731  -9.965  1.00 18.72  ? 196  ILE A CD1   1 
ATOM   1541 N  N     . VAL A 1 200 ? 69.037 -2.114  -5.221  1.00 14.89  ? 197  VAL A N     1 
ATOM   1542 C  CA    . VAL A 1 200 ? 67.981 -1.477  -4.445  1.00 13.00  ? 197  VAL A CA    1 
ATOM   1543 C  C     . VAL A 1 200 ? 68.522 -0.314  -3.604  1.00 14.75  ? 197  VAL A C     1 
ATOM   1544 O  O     . VAL A 1 200 ? 67.821 0.694   -3.415  1.00 13.08  ? 197  VAL A O     1 
ATOM   1545 C  CB    . VAL A 1 200 ? 67.252 -2.525  -3.573  1.00 10.70  ? 197  VAL A CB    1 
ATOM   1546 C  CG1   . VAL A 1 200 ? 66.246 -1.854  -2.642  1.00 14.09  ? 197  VAL A CG1   1 
ATOM   1547 C  CG2   . VAL A 1 200 ? 66.522 -3.486  -4.495  1.00 11.62  ? 197  VAL A CG2   1 
ATOM   1548 N  N     . GLU A 1 201 ? 69.766 -0.415  -3.137  1.00 13.46  ? 198  GLU A N     1 
ATOM   1549 C  CA    . GLU A 1 201 ? 70.405 0.739   -2.500  1.00 15.38  ? 198  GLU A CA    1 
ATOM   1550 C  C     . GLU A 1 201 ? 70.405 1.908   -3.477  1.00 16.01  ? 198  GLU A C     1 
ATOM   1551 O  O     . GLU A 1 201 ? 70.137 3.059   -3.102  1.00 15.53  ? 198  GLU A O     1 
ATOM   1552 C  CB    . GLU A 1 201 ? 71.855 0.439   -2.080  1.00 14.34  ? 198  GLU A CB    1 
ATOM   1553 C  CG    . GLU A 1 201 ? 72.028 -0.588  -0.960  1.00 15.35  ? 198  GLU A CG    1 
ATOM   1554 C  CD    . GLU A 1 201 ? 71.908 -0.018  0.452   1.00 13.84  ? 198  GLU A CD    1 
ATOM   1555 O  OE1   . GLU A 1 201 ? 71.542 1.170   0.624   1.00 17.62  ? 198  GLU A OE1   1 
ATOM   1556 O  OE2   . GLU A 1 201 ? 72.180 -0.765  1.416   1.00 17.39  ? 198  GLU A OE2   1 
ATOM   1557 N  N     . GLU A 1 202 ? 70.726 1.607   -4.732  1.00 16.43  ? 199  GLU A N     1 
ATOM   1558 C  CA    . GLU A 1 202 ? 70.810 2.639   -5.759  1.00 16.21  ? 199  GLU A CA    1 
ATOM   1559 C  C     . GLU A 1 202 ? 69.425 3.228   -6.014  1.00 18.01  ? 199  GLU A C     1 
ATOM   1560 O  O     . GLU A 1 202 ? 69.262 4.454   -6.101  1.00 17.91  ? 199  GLU A O     1 
ATOM   1561 C  CB    . GLU A 1 202 ? 71.413 2.063   -7.042  1.00 19.15  ? 199  GLU A CB    1 
ATOM   1562 C  CG    . GLU A 1 202 ? 72.855 1.623   -6.856  1.00 17.00  ? 199  GLU A CG    1 
ATOM   1563 C  CD    . GLU A 1 202 ? 73.391 0.833   -8.041  1.00 22.65  ? 199  GLU A CD    1 
ATOM   1564 O  OE1   . GLU A 1 202 ? 74.583 0.460   -8.016  1.00 29.26  ? 199  GLU A OE1   1 
ATOM   1565 O  OE2   . GLU A 1 202 ? 72.625 0.601   -9.000  1.00 30.77  ? 199  GLU A OE2   1 
ATOM   1566 N  N     . MET A 1 203 ? 68.430 2.346   -6.111  1.00 13.51  ? 200  MET A N     1 
ATOM   1567 C  CA    . MET A 1 203 ? 67.047 2.775   -6.297  1.00 15.55  ? 200  MET A CA    1 
ATOM   1568 C  C     . MET A 1 203 ? 66.580 3.675   -5.175  1.00 13.25  ? 200  MET A C     1 
ATOM   1569 O  O     . MET A 1 203 ? 65.984 4.744   -5.425  1.00 15.38  ? 200  MET A O     1 
ATOM   1570 C  CB    . MET A 1 203 ? 66.117 1.568   -6.395  1.00 15.70  ? 200  MET A CB    1 
ATOM   1571 C  CG    A MET A 1 203 ? 64.726 1.937   -6.830  0.39 15.54  ? 200  MET A CG    1 
ATOM   1572 C  CG    B MET A 1 203 ? 66.411 0.634   -7.541  0.61 16.85  ? 200  MET A CG    1 
ATOM   1573 S  SD    A MET A 1 203 ? 63.596 0.542   -6.790  0.39 19.80  ? 200  MET A SD    1 
ATOM   1574 S  SD    B MET A 1 203 ? 65.175 -0.677  -7.626  0.61 15.95  ? 200  MET A SD    1 
ATOM   1575 C  CE    A MET A 1 203 ? 64.110 -0.393  -8.225  0.39 16.93  ? 200  MET A CE    1 
ATOM   1576 C  CE    B MET A 1 203 ? 63.705 0.326   -7.804  0.61 10.09  ? 200  MET A CE    1 
ATOM   1577 N  N     . ARG A 1 204 ? 66.830 3.253   -3.938  1.00 12.14  ? 201  ARG A N     1 
ATOM   1578 C  CA    . ARG A 1 204 ? 66.393 4.026   -2.784  1.00 11.05  ? 201  ARG A CA    1 
ATOM   1579 C  C     . ARG A 1 204 ? 67.140 5.353   -2.658  1.00 15.23  ? 201  ARG A C     1 
ATOM   1580 O  O     . ARG A 1 204 ? 66.555 6.354   -2.233  1.00 15.97  ? 201  ARG A O     1 
ATOM   1581 C  CB    . ARG A 1 204 ? 66.534 3.212   -1.504  1.00 14.02  ? 201  ARG A CB    1 
ATOM   1582 C  CG    . ARG A 1 204 ? 65.566 2.012   -1.484  1.00 14.50  ? 201  ARG A CG    1 
ATOM   1583 C  CD    . ARG A 1 204 ? 65.680 1.160   -0.217  1.00 12.47  ? 201  ARG A CD    1 
ATOM   1584 N  NE    . ARG A 1 204 ? 65.707 1.993   0.979   1.00 13.44  ? 201  ARG A NE    1 
ATOM   1585 C  CZ    . ARG A 1 204 ? 66.782 2.165   1.743   1.00 14.41  ? 201  ARG A CZ    1 
ATOM   1586 N  NH1   . ARG A 1 204 ? 66.725 2.977   2.792   1.00 13.59  ? 201  ARG A NH1   1 
ATOM   1587 N  NH2   . ARG A 1 204 ? 67.911 1.516   1.466   1.00 15.83  ? 201  ARG A NH2   1 
ATOM   1588 N  N     . ALA A 1 205 ? 68.409 5.368   -3.041  1.00 14.86  ? 202  ALA A N     1 
ATOM   1589 C  CA    . ALA A 1 205 ? 69.155 6.631   -3.035  1.00 17.27  ? 202  ALA A CA    1 
ATOM   1590 C  C     . ALA A 1 205 ? 68.547 7.611   -4.045  1.00 13.42  ? 202  ALA A C     1 
ATOM   1591 O  O     . ALA A 1 205 ? 68.422 8.811   -3.771  1.00 16.10  ? 202  ALA A O     1 
ATOM   1592 C  CB    . ALA A 1 205 ? 70.641 6.385   -3.345  1.00 13.02  ? 202  ALA A CB    1 
ATOM   1593 N  N     . ALA A 1 206 ? 68.166 7.089   -5.208  1.00 13.34  ? 203  ALA A N     1 
ATOM   1594 C  CA    . ALA A 1 206 ? 67.565 7.908   -6.257  1.00 14.56  ? 203  ALA A CA    1 
ATOM   1595 C  C     . ALA A 1 206 ? 66.226 8.466   -5.805  1.00 14.15  ? 203  ALA A C     1 
ATOM   1596 O  O     . ALA A 1 206 ? 65.916 9.639   -6.047  1.00 15.72  ? 203  ALA A O     1 
ATOM   1597 C  CB    . ALA A 1 206 ? 67.400 7.096   -7.543  1.00 19.64  ? 203  ALA A CB    1 
ATOM   1598 N  N     . ILE A 1 207 ? 65.427 7.618   -5.154  1.00 12.68  ? 204  ILE A N     1 
ATOM   1599 C  CA    . ILE A 1 207 ? 64.128 8.072   -4.685  1.00 13.13  ? 204  ILE A CA    1 
ATOM   1600 C  C     . ILE A 1 207 ? 64.325 9.224   -3.710  1.00 16.15  ? 204  ILE A C     1 
ATOM   1601 O  O     . ILE A 1 207 ? 63.666 10.257  -3.823  1.00 12.93  ? 204  ILE A O     1 
ATOM   1602 C  CB    . ILE A 1 207 ? 63.331 6.932   -4.020  1.00 10.52  ? 204  ILE A CB    1 
ATOM   1603 C  CG1   . ILE A 1 207 ? 62.932 5.920   -5.084  1.00 13.13  ? 204  ILE A CG1   1 
ATOM   1604 C  CG2   . ILE A 1 207 ? 62.104 7.472   -3.312  1.00 12.16  ? 204  ILE A CG2   1 
ATOM   1605 C  CD1   . ILE A 1 207 ? 62.229 4.682   -4.526  1.00 15.21  ? 204  ILE A CD1   1 
ATOM   1606 N  N     . GLU A 1 208 ? 65.250 9.069   -2.768  1.00 16.18  ? 205  GLU A N     1 
ATOM   1607 C  CA    . GLU A 1 208 ? 65.440 10.118  -1.768  1.00 12.57  ? 205  GLU A CA    1 
ATOM   1608 C  C     . GLU A 1 208 ? 66.049 11.384  -2.382  1.00 14.60  ? 205  GLU A C     1 
ATOM   1609 O  O     . GLU A 1 208 ? 65.613 12.496  -2.078  1.00 14.62  ? 205  GLU A O     1 
ATOM   1610 C  CB    . GLU A 1 208 ? 66.320 9.628   -0.618  1.00 16.29  ? 205  GLU A CB    1 
ATOM   1611 C  CG    . GLU A 1 208 ? 66.456 10.691  0.484   1.00 16.25  ? 205  GLU A CG    1 
ATOM   1612 C  CD    . GLU A 1 208 ? 67.203 10.190  1.702   1.00 17.01  ? 205  GLU A CD    1 
ATOM   1613 O  OE1   . GLU A 1 208 ? 67.178 10.911  2.724   1.00 19.56  ? 205  GLU A OE1   1 
ATOM   1614 O  OE2   . GLU A 1 208 ? 67.830 9.105   1.626   1.00 19.81  ? 205  GLU A OE2   1 
ATOM   1615 N  N     . ARG A 1 209 ? 67.045 11.213  -3.254  1.00 15.39  ? 206  ARG A N     1 
ATOM   1616 C  CA    . ARG A 1 209 ? 67.669 12.359  -3.926  1.00 15.85  ? 206  ARG A CA    1 
ATOM   1617 C  C     . ARG A 1 209 ? 66.635 13.170  -4.692  1.00 17.37  ? 206  ARG A C     1 
ATOM   1618 O  O     . ARG A 1 209 ? 66.640 14.395  -4.630  1.00 17.15  ? 206  ARG A O     1 
ATOM   1619 C  CB    . ARG A 1 209 ? 68.793 11.925  -4.894  1.00 16.82  ? 206  ARG A CB    1 
ATOM   1620 C  CG    . ARG A 1 209 ? 69.584 13.140  -5.459  1.00 19.86  ? 206  ARG A CG    1 
ATOM   1621 C  CD    . ARG A 1 209 ? 70.653 12.779  -6.498  1.00 25.39  ? 206  ARG A CD    1 
ATOM   1622 N  NE    . ARG A 1 209 ? 70.088 12.503  -7.821  1.00 28.00  ? 206  ARG A NE    1 
ATOM   1623 C  CZ    . ARG A 1 209 ? 69.677 13.431  -8.684  1.00 25.54  ? 206  ARG A CZ    1 
ATOM   1624 N  NH1   . ARG A 1 209 ? 69.180 13.061  -9.857  1.00 23.86  ? 206  ARG A NH1   1 
ATOM   1625 N  NH2   . ARG A 1 209 ? 69.756 14.725  -8.384  1.00 20.68  ? 206  ARG A NH2   1 
ATOM   1626 N  N     . GLU A 1 210 ? 65.741 12.492  -5.409  1.00 13.64  ? 207  GLU A N     1 
ATOM   1627 C  CA    . GLU A 1 210 ? 64.900 13.184  -6.385  1.00 12.41  ? 207  GLU A CA    1 
ATOM   1628 C  C     . GLU A 1 210 ? 63.524 13.564  -5.851  1.00 11.66  ? 207  GLU A C     1 
ATOM   1629 O  O     . GLU A 1 210 ? 62.804 14.338  -6.501  1.00 13.40  ? 207  GLU A O     1 
ATOM   1630 C  CB    . GLU A 1 210 ? 64.760 12.338  -7.652  1.00 15.77  ? 207  GLU A CB    1 
ATOM   1631 C  CG    . GLU A 1 210 ? 66.099 12.017  -8.263  1.00 12.89  ? 207  GLU A CG    1 
ATOM   1632 C  CD    . GLU A 1 210 ? 66.011 11.172  -9.516  1.00 22.72  ? 207  GLU A CD    1 
ATOM   1633 O  OE1   . GLU A 1 210 ? 64.980 11.226  -10.219 1.00 18.88  ? 207  GLU A OE1   1 
ATOM   1634 O  OE2   . GLU A 1 210 ? 66.998 10.471  -9.805  1.00 25.01  ? 207  GLU A OE2   1 
ATOM   1635 N  N     . THR A 1 211 ? 63.163 13.063  -4.670  1.00 12.92  ? 208  THR A N     1 
ATOM   1636 C  CA    . THR A 1 211 ? 61.873 13.439  -4.104  1.00 10.38  ? 208  THR A CA    1 
ATOM   1637 C  C     . THR A 1 211 ? 61.955 14.001  -2.705  1.00 14.32  ? 208  THR A C     1 
ATOM   1638 O  O     . THR A 1 211 ? 61.023 14.659  -2.274  1.00 15.33  ? 208  THR A O     1 
ATOM   1639 C  CB    . THR A 1 211 ? 60.879 12.241  -4.062  1.00 13.21  ? 208  THR A CB    1 
ATOM   1640 O  OG1   . THR A 1 211 ? 61.284 11.292  -3.072  1.00 12.67  ? 208  THR A OG1   1 
ATOM   1641 C  CG2   . THR A 1 211 ? 60.783 11.567  -5.415  1.00 11.02  ? 208  THR A CG2   1 
ATOM   1642 N  N     . GLY A 1 212 ? 63.035 13.703  -1.984  1.00 12.30  ? 209  GLY A N     1 
ATOM   1643 C  CA    . GLY A 1 212 ? 63.108 14.003  -0.565  1.00 12.84  ? 209  GLY A CA    1 
ATOM   1644 C  C     . GLY A 1 212 ? 62.503 12.940  0.340   1.00 16.53  ? 209  GLY A C     1 
ATOM   1645 O  O     . GLY A 1 212 ? 62.581 13.049  1.564   1.00 20.36  ? 209  GLY A O     1 
ATOM   1646 N  N     . PHE A 1 213 ? 61.901 11.909  -0.250  1.00 14.61  ? 210  PHE A N     1 
ATOM   1647 C  CA    . PHE A 1 213 ? 61.202 10.890  0.538   1.00 13.19  ? 210  PHE A CA    1 
ATOM   1648 C  C     . PHE A 1 213 ? 62.122 9.712   0.841   1.00 13.74  ? 210  PHE A C     1 
ATOM   1649 O  O     . PHE A 1 213 ? 62.832 9.230   -0.040  1.00 16.84  ? 210  PHE A O     1 
ATOM   1650 C  CB    . PHE A 1 213 ? 59.968 10.350  -0.196  1.00 12.05  ? 210  PHE A CB    1 
ATOM   1651 C  CG    . PHE A 1 213 ? 58.966 11.393  -0.610  1.00 11.23  ? 210  PHE A CG    1 
ATOM   1652 C  CD1   . PHE A 1 213 ? 58.303 11.263  -1.824  1.00 12.89  ? 210  PHE A CD1   1 
ATOM   1653 C  CD2   . PHE A 1 213 ? 58.655 12.468  0.205   1.00 11.38  ? 210  PHE A CD2   1 
ATOM   1654 C  CE1   . PHE A 1 213 ? 57.353 12.188  -2.224  1.00 10.97  ? 210  PHE A CE1   1 
ATOM   1655 C  CE2   . PHE A 1 213 ? 57.715 13.411  -0.202  1.00 11.75  ? 210  PHE A CE2   1 
ATOM   1656 C  CZ    . PHE A 1 213 ? 57.064 13.265  -1.410  1.00 12.93  ? 210  PHE A CZ    1 
ATOM   1657 N  N     . GLN A 1 214 ? 62.072 9.242   2.081   1.00 10.69  ? 211  GLN A N     1 
ATOM   1658 C  CA    . GLN A 1 214 ? 62.763 8.015   2.482   1.00 12.71  ? 211  GLN A CA    1 
ATOM   1659 C  C     . GLN A 1 214 ? 61.853 6.798   2.403   1.00 12.94  ? 211  GLN A C     1 
ATOM   1660 O  O     . GLN A 1 214 ? 60.623 6.909   2.526   1.00 12.63  ? 211  GLN A O     1 
ATOM   1661 C  CB    . GLN A 1 214 ? 63.319 8.161   3.893   1.00 12.74  ? 211  GLN A CB    1 
ATOM   1662 C  CG    . GLN A 1 214 ? 64.586 9.011   3.903   1.00 14.77  ? 211  GLN A CG    1 
ATOM   1663 C  CD    . GLN A 1 214 ? 65.140 9.228   5.292   1.00 16.61  ? 211  GLN A CD    1 
ATOM   1664 O  OE1   . GLN A 1 214 ? 64.563 8.785   6.282   1.00 16.75  ? 211  GLN A OE1   1 
ATOM   1665 N  NE2   . GLN A 1 214 ? 66.293 9.886   5.364   1.00 18.10  ? 211  GLN A NE2   1 
ATOM   1666 N  N     . CYS A 1 215 ? 62.473 5.640   2.189   1.00 11.30  ? 212  CYS A N     1 
ATOM   1667 C  CA    . CYS A 1 215 ? 61.714 4.402   2.076   1.00 9.07   ? 212  CYS A CA    1 
ATOM   1668 C  C     . CYS A 1 215 ? 62.512 3.223   2.594   1.00 11.30  ? 212  CYS A C     1 
ATOM   1669 O  O     . CYS A 1 215 ? 63.722 3.312   2.836   1.00 15.64  ? 212  CYS A O     1 
ATOM   1670 C  CB    . CYS A 1 215 ? 61.298 4.150   0.621   1.00 11.31  ? 212  CYS A CB    1 
ATOM   1671 S  SG    . CYS A 1 215 ? 62.740 3.962   -0.509  1.00 16.43  ? 212  CYS A SG    1 
ATOM   1672 N  N     . SER A 1 216 ? 61.817 2.112   2.766   1.00 10.23  ? 213  SER A N     1 
ATOM   1673 C  CA    . SER A 1 216 ? 62.459 0.858   3.137   1.00 10.67  ? 213  SER A CA    1 
ATOM   1674 C  C     . SER A 1 216 ? 62.252 -0.147  2.029   1.00 10.48  ? 213  SER A C     1 
ATOM   1675 O  O     . SER A 1 216 ? 61.482 0.111   1.105   1.00 10.79  ? 213  SER A O     1 
ATOM   1676 C  CB    . SER A 1 216 ? 61.899 0.346   4.449   1.00 13.00  ? 213  SER A CB    1 
ATOM   1677 O  OG    . SER A 1 216 ? 62.189 1.290   5.469   1.00 12.68  ? 213  SER A OG    1 
ATOM   1678 N  N     . ALA A 1 217 ? 62.947 -1.286  2.096   1.00 10.01  ? 214  ALA A N     1 
ATOM   1679 C  CA    . ALA A 1 217 ? 62.770 -2.300  1.058   1.00 9.59   ? 214  ALA A CA    1 
ATOM   1680 C  C     . ALA A 1 217 ? 63.129 -3.667  1.547   1.00 10.27  ? 214  ALA A C     1 
ATOM   1681 O  O     . ALA A 1 217 ? 63.951 -3.809  2.445   1.00 11.29  ? 214  ALA A O     1 
ATOM   1682 C  CB    . ALA A 1 217 ? 63.623 -1.980  -0.187  1.00 9.07   ? 214  ALA A CB    1 
ATOM   1683 N  N     . GLY A 1 218 ? 62.544 -4.647  0.913   1.00 9.73   ? 215  GLY A N     1 
ATOM   1684 C  CA    . GLY A 1 218 ? 62.949 -6.012  1.068   1.00 11.94  ? 215  GLY A CA    1 
ATOM   1685 C  C     . GLY A 1 218 ? 63.403 -6.647  -0.229  1.00 11.51  ? 215  GLY A C     1 
ATOM   1686 O  O     . GLY A 1 218 ? 62.899 -6.362  -1.246  1.00 12.21  ? 215  GLY A O     1 
ATOM   1687 N  N     . ILE A 1 219 ? 64.404 -7.506  -0.097  1.00 9.13   ? 216  ILE A N     1 
ATOM   1688 C  CA    . ILE A 1 219 ? 64.952 -8.207  -1.221  1.00 10.06  ? 216  ILE A CA    1 
ATOM   1689 C  C     . ILE A 1 219 ? 64.916 -9.713  -0.912  1.00 13.53  ? 216  ILE A C     1 
ATOM   1690 O  O     . ILE A 1 219 ? 65.449 -10.150 0.034   1.00 12.72  ? 216  ILE A O     1 
ATOM   1691 C  CB    . ILE A 1 219 ? 66.402 -7.804  -1.511  1.00 11.47  ? 216  ILE A CB    1 
ATOM   1692 C  CG1   . ILE A 1 219 ? 66.539 -6.298  -1.697  1.00 13.55  ? 216  ILE A CG1   1 
ATOM   1693 C  CG2   . ILE A 1 219 ? 66.906 -8.501  -2.764  1.00 14.04  ? 216  ILE A CG2   1 
ATOM   1694 C  CD1   . ILE A 1 219 ? 66.962 -5.505  -0.484  1.00 14.25  ? 216  ILE A CD1   1 
ATOM   1695 N  N     . SER A 1 220 ? 64.246 -10.452 -1.758  1.00 12.09  ? 217  SER A N     1 
ATOM   1696 C  CA    . SER A 1 220 ? 64.187 -11.888 -1.602  1.00 10.02  ? 217  SER A CA    1 
ATOM   1697 C  C     . SER A 1 220 ? 63.920 -12.546 -2.935  1.00 11.54  ? 217  SER A C     1 
ATOM   1698 O  O     . SER A 1 220 ? 64.206 -11.983 -3.929  1.00 14.73  ? 217  SER A O     1 
ATOM   1699 C  CB    . SER A 1 220 ? 63.165 -12.312 -0.564  1.00 14.70  ? 217  SER A CB    1 
ATOM   1700 O  OG    . SER A 1 220 ? 63.388 -13.616 -0.160  1.00 12.54  ? 217  SER A OG    1 
ATOM   1701 N  N     . HIS A 1 221 ? 63.461 -13.775 -2.917  1.00 13.22  ? 218  HIS A N     1 
ATOM   1702 C  CA    . HIS A 1 221 ? 63.223 -14.508 -4.120  1.00 12.60  ? 218  HIS A CA    1 
ATOM   1703 C  C     . HIS A 1 221 ? 61.787 -14.470 -4.619  1.00 12.86  ? 218  HIS A C     1 
ATOM   1704 O  O     . HIS A 1 221 ? 61.535 -14.942 -5.636  1.00 13.84  ? 218  HIS A O     1 
ATOM   1705 C  CB    . HIS A 1 221 ? 63.654 -15.975 -3.946  1.00 13.48  ? 218  HIS A CB    1 
ATOM   1706 C  CG    . HIS A 1 221 ? 65.127 -16.168 -3.844  1.00 15.27  ? 218  HIS A CG    1 
ATOM   1707 N  ND1   . HIS A 1 221 ? 65.996 -15.824 -4.842  1.00 14.23  ? 218  HIS A ND1   1 
ATOM   1708 C  CD2   . HIS A 1 221 ? 65.878 -16.691 -2.857  1.00 12.48  ? 218  HIS A CD2   1 
ATOM   1709 C  CE1   . HIS A 1 221 ? 67.218 -16.132 -4.469  1.00 14.17  ? 218  HIS A CE1   1 
ATOM   1710 N  NE2   . HIS A 1 221 ? 67.170 -16.656 -3.271  1.00 13.56  ? 218  HIS A NE2   1 
ATOM   1711 N  N     . ASN A 1 222 ? 60.882 -13.894 -3.865  1.00 10.86  ? 219  ASN A N     1 
ATOM   1712 C  CA    . ASN A 1 222 ? 59.484 -13.769 -4.269  1.00 12.89  ? 219  ASN A CA    1 
ATOM   1713 C  C     . ASN A 1 222 ? 58.808 -12.591 -3.561  1.00 11.47  ? 219  ASN A C     1 
ATOM   1714 O  O     . ASN A 1 222 ? 59.394 -11.970 -2.669  1.00 13.25  ? 219  ASN A O     1 
ATOM   1715 C  CB    . ASN A 1 222 ? 58.730 -15.075 -3.991  1.00 10.60  ? 219  ASN A CB    1 
ATOM   1716 C  CG    . ASN A 1 222 ? 58.887 -15.532 -2.565  1.00 13.46  ? 219  ASN A CG    1 
ATOM   1717 O  OD1   . ASN A 1 222 ? 58.465 -14.843 -1.642  1.00 11.95  ? 219  ASN A OD1   1 
ATOM   1718 N  ND2   . ASN A 1 222 ? 59.481 -16.703 -2.373  1.00 14.74  ? 219  ASN A ND2   1 
ATOM   1719 N  N     . LYS A 1 223 ? 57.575 -12.284 -3.952  1.00 13.05  ? 220  LYS A N     1 
ATOM   1720 C  CA    . LYS A 1 223 ? 56.871 -11.118 -3.416  1.00 12.82  ? 220  LYS A CA    1 
ATOM   1721 C  C     . LYS A 1 223 ? 56.543 -11.220 -1.921  1.00 10.74  ? 220  LYS A C     1 
ATOM   1722 O  O     . LYS A 1 223 ? 56.676 -10.229 -1.182  1.00 10.61  ? 220  LYS A O     1 
ATOM   1723 C  CB    . LYS A 1 223 ? 55.588 -10.876 -4.225  1.00 12.68  ? 220  LYS A CB    1 
ATOM   1724 C  CG    . LYS A 1 223 ? 55.847 -10.385 -5.642  1.00 15.29  ? 220  LYS A CG    1 
ATOM   1725 C  CD    . LYS A 1 223 ? 54.645 -10.649 -6.558  1.00 24.59  ? 220  LYS A CD    1 
ATOM   1726 C  CE    . LYS A 1 223 ? 53.525 -9.688  -6.319  1.00 28.20  ? 220  LYS A CE    1 
ATOM   1727 N  NZ    . LYS A 1 223 ? 52.371 -9.925  -7.268  1.00 20.65  ? 220  LYS A NZ    1 
ATOM   1728 N  N     . VAL A 1 224 ? 56.103 -12.397 -1.455  1.00 10.69  ? 221  VAL A N     1 
ATOM   1729 C  CA    . VAL A 1 224 ? 55.714 -12.517 -0.055  1.00 11.44  ? 221  VAL A CA    1 
ATOM   1730 C  C     . VAL A 1 224 ? 56.939 -12.335 0.850   1.00 9.30   ? 221  VAL A C     1 
ATOM   1731 O  O     . VAL A 1 224 ? 56.861 -11.622 1.852   1.00 12.71  ? 221  VAL A O     1 
ATOM   1732 C  CB    . VAL A 1 224 ? 55.045 -13.871 0.247   1.00 12.04  ? 221  VAL A CB    1 
ATOM   1733 C  CG1   . VAL A 1 224 ? 55.010 -14.142 1.733   1.00 17.05  ? 221  VAL A CG1   1 
ATOM   1734 C  CG2   . VAL A 1 224 ? 53.646 -13.908 -0.338  1.00 13.67  ? 221  VAL A CG2   1 
ATOM   1735 N  N     . LEU A 1 225 ? 58.072 -12.944 0.487   1.00 9.94   ? 222  LEU A N     1 
ATOM   1736 C  CA    . LEU A 1 225 ? 59.267 -12.779 1.327   1.00 9.78   ? 222  LEU A CA    1 
ATOM   1737 C  C     . LEU A 1 225 ? 59.824 -11.360 1.220   1.00 10.92  ? 222  LEU A C     1 
ATOM   1738 O  O     . LEU A 1 225 ? 60.319 -10.811 2.201   1.00 11.93  ? 222  LEU A O     1 
ATOM   1739 C  CB    . LEU A 1 225 ? 60.362 -13.789 0.974   1.00 10.53  ? 222  LEU A CB    1 
ATOM   1740 C  CG    . LEU A 1 225 ? 60.028 -15.240 1.332   1.00 12.93  ? 222  LEU A CG    1 
ATOM   1741 C  CD1   . LEU A 1 225 ? 61.211 -16.117 0.938   1.00 11.48  ? 222  LEU A CD1   1 
ATOM   1742 C  CD2   . LEU A 1 225 ? 59.730 -15.369 2.814   1.00 11.74  ? 222  LEU A CD2   1 
ATOM   1743 N  N     . ALA A 1 226 ? 59.749 -10.759 0.037   1.00 9.95   ? 223  ALA A N     1 
ATOM   1744 C  CA    . ALA A 1 226 ? 60.207 -9.379  -0.099  1.00 9.47   ? 223  ALA A CA    1 
ATOM   1745 C  C     . ALA A 1 226 ? 59.386 -8.413  0.753   1.00 10.45  ? 223  ALA A C     1 
ATOM   1746 O  O     . ALA A 1 226 ? 59.941 -7.516  1.392   1.00 11.39  ? 223  ALA A O     1 
ATOM   1747 C  CB    . ALA A 1 226 ? 60.177 -8.960  -1.559  1.00 9.20   ? 223  ALA A CB    1 
ATOM   1748 N  N     . LYS A 1 227 ? 58.071 -8.600  0.766   1.00 11.17  ? 224  LYS A N     1 
ATOM   1749 C  CA    . LYS A 1 227 ? 57.179 -7.755  1.570   1.00 9.81   ? 224  LYS A CA    1 
ATOM   1750 C  C     . LYS A 1 227 ? 57.484 -7.918  3.060   1.00 11.73  ? 224  LYS A C     1 
ATOM   1751 O  O     . LYS A 1 227 ? 57.586 -6.934  3.807   1.00 13.12  ? 224  LYS A O     1 
ATOM   1752 C  CB    . LYS A 1 227 ? 55.707 -8.092  1.297   1.00 11.87  ? 224  LYS A CB    1 
ATOM   1753 C  CG    . LYS A 1 227 ? 54.740 -7.337  2.197   1.00 13.10  ? 224  LYS A CG    1 
ATOM   1754 C  CD    . LYS A 1 227 ? 54.834 -5.825  2.005   1.00 20.42  ? 224  LYS A CD    1 
ATOM   1755 C  CE    . LYS A 1 227 ? 53.789 -5.088  2.847   1.00 21.52  ? 224  LYS A CE    1 
ATOM   1756 N  NZ    . LYS A 1 227 ? 53.816 -3.589  2.663   1.00 14.47  ? 224  LYS A NZ    1 
ATOM   1757 N  N     . LEU A 1 228 ? 57.651 -9.166  3.481   1.00 11.21  ? 225  LEU A N     1 
ATOM   1758 C  CA    . LEU A 1 228 ? 57.931 -9.465  4.869   1.00 13.41  ? 225  LEU A CA    1 
ATOM   1759 C  C     . LEU A 1 228 ? 59.272 -8.853  5.288   1.00 13.46  ? 225  LEU A C     1 
ATOM   1760 O  O     . LEU A 1 228 ? 59.383 -8.202  6.344   1.00 13.25  ? 225  LEU A O     1 
ATOM   1761 C  CB    . LEU A 1 228 ? 57.927 -10.982 5.085   1.00 11.25  ? 225  LEU A CB    1 
ATOM   1762 C  CG    . LEU A 1 228 ? 58.089 -11.398 6.546   1.00 17.96  ? 225  LEU A CG    1 
ATOM   1763 C  CD1   . LEU A 1 228 ? 56.834 -10.979 7.326   1.00 25.22  ? 225  LEU A CD1   1 
ATOM   1764 C  CD2   . LEU A 1 228 ? 58.360 -12.887 6.661   1.00 15.17  ? 225  LEU A CD2   1 
ATOM   1765 N  N     . ALA A 1 229 ? 60.276 -9.047  4.436   1.00 12.19  ? 226  ALA A N     1 
ATOM   1766 C  CA    . ALA A 1 229 ? 61.622 -8.505  4.658   1.00 10.37  ? 226  ALA A CA    1 
ATOM   1767 C  C     . ALA A 1 229 ? 61.591 -6.995  4.829   1.00 12.30  ? 226  ALA A C     1 
ATOM   1768 O  O     . ALA A 1 229 ? 62.244 -6.454  5.722   1.00 14.89  ? 226  ALA A O     1 
ATOM   1769 C  CB    . ALA A 1 229 ? 62.552 -8.874  3.503   1.00 12.07  ? 226  ALA A CB    1 
ATOM   1770 N  N     . CYS A 1 230 ? 60.832 -6.320  3.966   1.00 10.86  ? 227  CYS A N     1 
ATOM   1771 C  CA    . CYS A 1 230 ? 60.767 -4.855  3.987   1.00 12.20  ? 227  CYS A CA    1 
ATOM   1772 C  C     . CYS A 1 230 ? 60.428 -4.297  5.372   1.00 11.30  ? 227  CYS A C     1 
ATOM   1773 O  O     . CYS A 1 230 ? 61.036 -3.317  5.821   1.00 13.76  ? 227  CYS A O     1 
ATOM   1774 C  CB    . CYS A 1 230 ? 59.735 -4.364  2.969   1.00 9.48   ? 227  CYS A CB    1 
ATOM   1775 S  SG    . CYS A 1 230 ? 59.644 -2.539  2.843   1.00 12.57  ? 227  CYS A SG    1 
ATOM   1776 N  N     . GLY A 1 231 ? 59.480 -4.931  6.055   1.00 12.38  ? 228  GLY A N     1 
ATOM   1777 C  CA    . GLY A 1 231 ? 59.047 -4.463  7.359   1.00 13.35  ? 228  GLY A CA    1 
ATOM   1778 C  C     . GLY A 1 231 ? 59.997 -4.742  8.522   1.00 14.76  ? 228  GLY A C     1 
ATOM   1779 O  O     . GLY A 1 231 ? 59.852 -4.152  9.592   1.00 19.47  ? 228  GLY A O     1 
ATOM   1780 N  N     . LEU A 1 232 ? 60.985 -5.602  8.314   1.00 14.50  ? 229  LEU A N     1 
ATOM   1781 C  CA    . LEU A 1 232 ? 61.807 -6.081  9.421   1.00 14.70  ? 229  LEU A CA    1 
ATOM   1782 C  C     . LEU A 1 232 ? 62.703 -4.996  10.009  1.00 15.43  ? 229  LEU A C     1 
ATOM   1783 O  O     . LEU A 1 232 ? 63.044 -5.042  11.192  1.00 17.96  ? 229  LEU A O     1 
ATOM   1784 C  CB    . LEU A 1 232 ? 62.672 -7.268  8.982   1.00 15.75  ? 229  LEU A CB    1 
ATOM   1785 C  CG    . LEU A 1 232 ? 61.874 -8.550  8.730   1.00 20.62  ? 229  LEU A CG    1 
ATOM   1786 C  CD1   . LEU A 1 232 ? 62.786 -9.677  8.251   1.00 16.75  ? 229  LEU A CD1   1 
ATOM   1787 C  CD2   . LEU A 1 232 ? 61.085 -8.959  9.976   1.00 22.51  ? 229  LEU A CD2   1 
ATOM   1788 N  N     . ASN A 1 233 ? 63.095 -4.025  9.190   1.00 13.08  ? 230  ASN A N     1 
ATOM   1789 C  CA    . ASN A 1 233 ? 63.999 -2.987  9.671   1.00 13.89  ? 230  ASN A CA    1 
ATOM   1790 C  C     . ASN A 1 233 ? 63.630 -1.567  9.250   1.00 14.24  ? 230  ASN A C     1 
ATOM   1791 O  O     . ASN A 1 233 ? 64.509 -0.691  9.157   1.00 18.58  ? 230  ASN A O     1 
ATOM   1792 C  CB    . ASN A 1 233 ? 65.428 -3.290  9.227   1.00 16.95  ? 230  ASN A CB    1 
ATOM   1793 C  CG    . ASN A 1 233 ? 66.003 -4.509  9.923   1.00 15.68  ? 230  ASN A CG    1 
ATOM   1794 O  OD1   . ASN A 1 233 ? 66.411 -4.436  11.087  1.00 17.81  ? 230  ASN A OD1   1 
ATOM   1795 N  ND2   . ASN A 1 233 ? 66.065 -5.631  9.207   1.00 14.33  ? 230  ASN A ND2   1 
ATOM   1796 N  N     . LYS A 1 234 ? 62.343 -1.335  9.032   1.00 18.69  ? 231  LYS A N     1 
ATOM   1797 C  CA    . LYS A 1 234 ? 61.812 0.025   8.866   1.00 15.63  ? 231  LYS A CA    1 
ATOM   1798 C  C     . LYS A 1 234 ? 62.112 0.906   10.081  1.00 16.88  ? 231  LYS A C     1 
ATOM   1799 O  O     . LYS A 1 234 ? 62.114 0.412   11.211  1.00 22.59  ? 231  LYS A O     1 
ATOM   1800 C  CB    . LYS A 1 234 ? 60.295 -0.022  8.643   1.00 20.65  ? 231  LYS A CB    1 
ATOM   1801 C  CG    . LYS A 1 234 ? 59.886 -0.143  7.190   1.00 19.43  ? 231  LYS A CG    1 
ATOM   1802 C  CD    . LYS A 1 234 ? 58.380 0.052   6.987   1.00 19.86  ? 231  LYS A CD    1 
ATOM   1803 C  CE    . LYS A 1 234 ? 58.042 0.169   5.490   1.00 18.34  ? 231  LYS A CE    1 
ATOM   1804 N  NZ    . LYS A 1 234 ? 58.049 1.619   5.065   1.00 15.99  ? 231  LYS A NZ    1 
ATOM   1805 N  N     . PRO A 1 235 ? 62.319 2.222   9.871   1.00 14.89  ? 232  PRO A N     1 
ATOM   1806 C  CA    . PRO A 1 235 ? 62.330 2.968   8.606   1.00 14.09  ? 232  PRO A CA    1 
ATOM   1807 C  C     . PRO A 1 235 ? 63.730 3.151   8.009   1.00 13.26  ? 232  PRO A C     1 
ATOM   1808 O  O     . PRO A 1 235 ? 64.748 2.943   8.690   1.00 15.00  ? 232  PRO A O     1 
ATOM   1809 C  CB    . PRO A 1 235 ? 61.762 4.324   9.016   1.00 17.16  ? 232  PRO A CB    1 
ATOM   1810 C  CG    . PRO A 1 235 ? 62.332 4.527   10.380  1.00 21.40  ? 232  PRO A CG    1 
ATOM   1811 C  CD    . PRO A 1 235 ? 62.372 3.143   11.022  1.00 17.40  ? 232  PRO A CD    1 
ATOM   1812 N  N     . ASN A 1 236 ? 63.755 3.537   6.736   1.00 11.72  ? 233  ASN A N     1 
ATOM   1813 C  CA    . ASN A 1 236 ? 64.968 3.971   6.050   1.00 10.72  ? 233  ASN A CA    1 
ATOM   1814 C  C     . ASN A 1 236 ? 66.057 2.912   6.017   1.00 12.48  ? 233  ASN A C     1 
ATOM   1815 O  O     . ASN A 1 236 ? 67.234 3.237   6.023   1.00 14.29  ? 233  ASN A O     1 
ATOM   1816 C  CB    . ASN A 1 236 ? 65.503 5.260   6.702   1.00 11.55  ? 233  ASN A CB    1 
ATOM   1817 C  CG    . ASN A 1 236 ? 66.515 5.988   5.817   1.00 13.75  ? 233  ASN A CG    1 
ATOM   1818 O  OD1   . ASN A 1 236 ? 66.448 5.907   4.594   1.00 18.38  ? 233  ASN A OD1   1 
ATOM   1819 N  ND2   . ASN A 1 236 ? 67.464 6.690   6.439   1.00 17.26  ? 233  ASN A ND2   1 
ATOM   1820 N  N     . ARG A 1 237 ? 65.655 1.646   5.959   1.00 13.58  ? 234  ARG A N     1 
ATOM   1821 C  CA    . ARG A 1 237 ? 66.622 0.555   5.821   1.00 15.63  ? 234  ARG A CA    1 
ATOM   1822 C  C     . ARG A 1 237 ? 66.078 -0.492  4.871   1.00 13.95  ? 234  ARG A C     1 
ATOM   1823 O  O     . ARG A 1 237 ? 64.884 -0.515  4.599   1.00 13.44  ? 234  ARG A O     1 
ATOM   1824 C  CB    . ARG A 1 237 ? 66.936 -0.098  7.171   1.00 14.76  ? 234  ARG A CB    1 
ATOM   1825 C  CG    . ARG A 1 237 ? 67.623 0.795   8.188   1.00 15.03  ? 234  ARG A CG    1 
ATOM   1826 C  CD    . ARG A 1 237 ? 69.037 1.138   7.759   1.00 18.08  ? 234  ARG A CD    1 
ATOM   1827 N  NE    . ARG A 1 237 ? 69.755 1.884   8.791   1.00 22.10  ? 234  ARG A NE    1 
ATOM   1828 C  CZ    . ARG A 1 237 ? 69.860 3.210   8.819   1.00 24.02  ? 234  ARG A CZ    1 
ATOM   1829 N  NH1   . ARG A 1 237 ? 69.291 3.953   7.873   1.00 23.27  ? 234  ARG A NH1   1 
ATOM   1830 N  NH2   . ARG A 1 237 ? 70.539 3.797   9.795   1.00 28.85  ? 234  ARG A NH2   1 
ATOM   1831 N  N     . GLN A 1 238 ? 66.952 -1.355  4.365   1.00 13.57  ? 235  GLN A N     1 
ATOM   1832 C  CA    . GLN A 1 238 ? 66.506 -2.473  3.549   1.00 10.43  ? 235  GLN A CA    1 
ATOM   1833 C  C     . GLN A 1 238 ? 67.022 -3.786  4.104   1.00 12.21  ? 235  GLN A C     1 
ATOM   1834 O  O     . GLN A 1 238 ? 68.066 -3.831  4.755   1.00 13.38  ? 235  GLN A O     1 
ATOM   1835 C  CB    . GLN A 1 238 ? 66.946 -2.303  2.096   1.00 12.43  ? 235  GLN A CB    1 
ATOM   1836 C  CG    . GLN A 1 238 ? 68.434 -2.041  1.908   1.00 12.34  ? 235  GLN A CG    1 
ATOM   1837 C  CD    . GLN A 1 238 ? 68.764 -1.852  0.446   1.00 13.60  ? 235  GLN A CD    1 
ATOM   1838 O  OE1   . GLN A 1 238 ? 68.316 -0.878  -0.183  1.00 12.85  ? 235  GLN A OE1   1 
ATOM   1839 N  NE2   . GLN A 1 238 ? 69.520 -2.785  -0.118  1.00 11.14  ? 235  GLN A NE2   1 
ATOM   1840 N  N     . THR A 1 239 ? 66.280 -4.860  3.848   1.00 11.52  ? 236  THR A N     1 
ATOM   1841 C  CA    . THR A 1 239 ? 66.571 -6.152  4.454   1.00 11.99  ? 236  THR A CA    1 
ATOM   1842 C  C     . THR A 1 239 ? 66.584 -7.239  3.392   1.00 13.30  ? 236  THR A C     1 
ATOM   1843 O  O     . THR A 1 239 ? 65.649 -7.327  2.586   1.00 12.91  ? 236  THR A O     1 
ATOM   1844 C  CB    . THR A 1 239 ? 65.524 -6.502  5.527   1.00 13.79  ? 236  THR A CB    1 
ATOM   1845 O  OG1   . THR A 1 239 ? 65.447 -5.438  6.475   1.00 14.54  ? 236  THR A OG1   1 
ATOM   1846 C  CG2   . THR A 1 239 ? 65.902 -7.807  6.256   1.00 14.97  ? 236  THR A CG2   1 
ATOM   1847 N  N     . LEU A 1 240 ? 67.639 -8.058  3.404   1.00 8.98   ? 237  LEU A N     1 
ATOM   1848 C  CA    . LEU A 1 240 ? 67.770 -9.205  2.523   1.00 10.51  ? 237  LEU A CA    1 
ATOM   1849 C  C     . LEU A 1 240 ? 67.331 -10.464 3.276   1.00 13.38  ? 237  LEU A C     1 
ATOM   1850 O  O     . LEU A 1 240 ? 67.874 -10.800 4.331   1.00 13.35  ? 237  LEU A O     1 
ATOM   1851 C  CB    . LEU A 1 240 ? 69.221 -9.331  2.024   1.00 12.38  ? 237  LEU A CB    1 
ATOM   1852 C  CG    . LEU A 1 240 ? 69.569 -10.338 0.928   1.00 13.33  ? 237  LEU A CG    1 
ATOM   1853 C  CD1   . LEU A 1 240 ? 70.885 -9.925  0.295   1.00 13.07  ? 237  LEU A CD1   1 
ATOM   1854 C  CD2   . LEU A 1 240 ? 69.680 -11.771 1.459   1.00 13.02  ? 237  LEU A CD2   1 
ATOM   1855 N  N     . VAL A 1 241 ? 66.319 -11.143 2.749   1.00 8.92   ? 238  VAL A N     1 
ATOM   1856 C  CA    . VAL A 1 241 ? 65.877 -12.415 3.322   1.00 13.21  ? 238  VAL A CA    1 
ATOM   1857 C  C     . VAL A 1 241 ? 66.229 -13.526 2.353   1.00 12.27  ? 238  VAL A C     1 
ATOM   1858 O  O     . VAL A 1 241 ? 65.621 -13.670 1.282   1.00 13.31  ? 238  VAL A O     1 
ATOM   1859 C  CB    . VAL A 1 241 ? 64.370 -12.411 3.641   1.00 11.97  ? 238  VAL A CB    1 
ATOM   1860 C  CG1   . VAL A 1 241 ? 63.833 -13.838 3.864   1.00 11.08  ? 238  VAL A CG1   1 
ATOM   1861 C  CG2   . VAL A 1 241 ? 64.117 -11.573 4.877   1.00 12.73  ? 238  VAL A CG2   1 
ATOM   1862 N  N     . SER A 1 242 ? 67.254 -14.286 2.726   1.00 11.10  ? 239  SER A N     1 
ATOM   1863 C  CA    . SER A 1 242 ? 67.756 -15.352 1.887   1.00 11.41  ? 239  SER A CA    1 
ATOM   1864 C  C     . SER A 1 242 ? 66.878 -16.589 2.000   1.00 10.30  ? 239  SER A C     1 
ATOM   1865 O  O     . SER A 1 242 ? 66.102 -16.739 2.963   1.00 11.22  ? 239  SER A O     1 
ATOM   1866 C  CB    . SER A 1 242 ? 69.196 -15.692 2.270   1.00 14.45  ? 239  SER A CB    1 
ATOM   1867 O  OG    . SER A 1 242 ? 69.230 -16.234 3.580   1.00 15.05  ? 239  SER A OG    1 
ATOM   1868 N  N     . HIS A 1 243 ? 67.013 -17.500 1.037   1.00 12.54  ? 240  HIS A N     1 
ATOM   1869 C  CA    . HIS A 1 243 ? 66.269 -18.742 1.109   1.00 11.29  ? 240  HIS A CA    1 
ATOM   1870 C  C     . HIS A 1 243 ? 66.655 -19.489 2.380   1.00 14.51  ? 240  HIS A C     1 
ATOM   1871 O  O     . HIS A 1 243 ? 65.797 -20.061 3.056   1.00 11.55  ? 240  HIS A O     1 
ATOM   1872 C  CB    . HIS A 1 243 ? 66.535 -19.614 -0.118  1.00 14.23  ? 240  HIS A CB    1 
ATOM   1873 C  CG    . HIS A 1 243 ? 65.788 -20.912 -0.108  1.00 14.63  ? 240  HIS A CG    1 
ATOM   1874 N  ND1   . HIS A 1 243 ? 64.446 -20.994 -0.400  1.00 19.66  ? 240  HIS A ND1   1 
ATOM   1875 C  CD2   . HIS A 1 243 ? 66.196 -22.179 0.148   1.00 19.85  ? 240  HIS A CD2   1 
ATOM   1876 C  CE1   . HIS A 1 243 ? 64.055 -22.255 -0.320  1.00 22.39  ? 240  HIS A CE1   1 
ATOM   1877 N  NE2   . HIS A 1 243 ? 65.098 -22.994 0.010   1.00 18.32  ? 240  HIS A NE2   1 
ATOM   1878 N  N     . GLY A 1 244 ? 67.946 -19.455 2.712   1.00 14.25  ? 241  GLY A N     1 
ATOM   1879 C  CA    . GLY A 1 244 ? 68.446 -20.192 3.860   1.00 15.15  ? 241  GLY A CA    1 
ATOM   1880 C  C     . GLY A 1 244 ? 67.949 -19.643 5.187   1.00 12.95  ? 241  GLY A C     1 
ATOM   1881 O  O     . GLY A 1 244 ? 67.891 -20.364 6.185   1.00 16.50  ? 241  GLY A O     1 
ATOM   1882 N  N     . SER A 1 245 ? 67.576 -18.369 5.203   1.00 11.55  ? 242  SER A N     1 
ATOM   1883 C  CA    . SER A 1 245 ? 67.105 -17.745 6.431   1.00 13.00  ? 242  SER A CA    1 
ATOM   1884 C  C     . SER A 1 245 ? 65.668 -18.121 6.781   1.00 12.79  ? 242  SER A C     1 
ATOM   1885 O  O     . SER A 1 245 ? 65.198 -17.835 7.893   1.00 12.97  ? 242  SER A O     1 
ATOM   1886 C  CB    . SER A 1 245 ? 67.210 -16.220 6.334   1.00 12.41  ? 242  SER A CB    1 
ATOM   1887 O  OG    . SER A 1 245 ? 66.158 -15.671 5.544   1.00 11.58  ? 242  SER A OG    1 
ATOM   1888 N  N     . VAL A 1 246 ? 64.963 -18.764 5.856   1.00 10.06  ? 243  VAL A N     1 
ATOM   1889 C  CA    . VAL A 1 246 ? 63.532 -18.988 6.067   1.00 10.20  ? 243  VAL A CA    1 
ATOM   1890 C  C     . VAL A 1 246 ? 63.169 -19.941 7.233   1.00 13.67  ? 243  VAL A C     1 
ATOM   1891 O  O     . VAL A 1 246 ? 62.293 -19.605 8.034   1.00 12.79  ? 243  VAL A O     1 
ATOM   1892 C  CB    . VAL A 1 246 ? 62.877 -19.468 4.744   1.00 10.98  ? 243  VAL A CB    1 
ATOM   1893 C  CG1   . VAL A 1 246 ? 61.406 -19.873 4.957   1.00 12.06  ? 243  VAL A CG1   1 
ATOM   1894 C  CG2   . VAL A 1 246 ? 62.960 -18.343 3.717   1.00 13.61  ? 243  VAL A CG2   1 
ATOM   1895 N  N     . PRO A 1 247 ? 63.832 -21.110 7.361   1.00 12.41  ? 244  PRO A N     1 
ATOM   1896 C  CA    . PRO A 1 247 ? 63.441 -21.968 8.500   1.00 10.77  ? 244  PRO A CA    1 
ATOM   1897 C  C     . PRO A 1 247 ? 63.504 -21.280 9.879   1.00 10.69  ? 244  PRO A C     1 
ATOM   1898 O  O     . PRO A 1 247 ? 62.552 -21.414 10.653  1.00 14.06  ? 244  PRO A O     1 
ATOM   1899 C  CB    . PRO A 1 247 ? 64.452 -23.123 8.424   1.00 9.94   ? 244  PRO A CB    1 
ATOM   1900 C  CG    . PRO A 1 247 ? 64.705 -23.239 6.913   1.00 12.91  ? 244  PRO A CG    1 
ATOM   1901 C  CD    . PRO A 1 247 ? 64.809 -21.787 6.476   1.00 10.71  ? 244  PRO A CD    1 
ATOM   1902 N  N     . GLN A 1 248 ? 64.585 -20.566 10.191  1.00 13.07  ? 245  GLN A N     1 
ATOM   1903 C  CA    . GLN A 1 248 ? 64.639 -19.870 11.475  1.00 13.81  ? 245  GLN A CA    1 
ATOM   1904 C  C     . GLN A 1 248 ? 63.610 -18.737 11.543  1.00 13.24  ? 245  GLN A C     1 
ATOM   1905 O  O     . GLN A 1 248 ? 62.871 -18.609 12.522  1.00 14.97  ? 245  GLN A O     1 
ATOM   1906 C  CB    . GLN A 1 248 ? 66.048 -19.329 11.750  1.00 16.81  ? 245  GLN A CB    1 
ATOM   1907 C  CG    . GLN A 1 248 ? 67.071 -20.435 11.996  1.00 23.86  ? 245  GLN A CG    1 
ATOM   1908 C  CD    . GLN A 1 248 ? 68.196 -20.025 12.942  1.00 27.54  ? 245  GLN A CD    1 
ATOM   1909 O  OE1   . GLN A 1 248 ? 69.385 -20.066 12.582  1.00 25.24  ? 245  GLN A OE1   1 
ATOM   1910 N  NE2   . GLN A 1 248 ? 67.830 -19.649 14.163  1.00 33.60  ? 245  GLN A NE2   1 
ATOM   1911 N  N     . LEU A 1 249 ? 63.569 -17.915 10.503  1.00 11.81  ? 246  LEU A N     1 
ATOM   1912 C  CA    . LEU A 1 249 ? 62.598 -16.821 10.448  1.00 13.47  ? 246  LEU A CA    1 
ATOM   1913 C  C     . LEU A 1 249 ? 61.180 -17.319 10.668  1.00 12.25  ? 246  LEU A C     1 
ATOM   1914 O  O     . LEU A 1 249 ? 60.424 -16.762 11.464  1.00 13.54  ? 246  LEU A O     1 
ATOM   1915 C  CB    . LEU A 1 249 ? 62.713 -16.097 9.108   1.00 12.93  ? 246  LEU A CB    1 
ATOM   1916 C  CG    . LEU A 1 249 ? 61.786 -14.889 8.924   1.00 14.93  ? 246  LEU A CG    1 
ATOM   1917 C  CD1   . LEU A 1 249 ? 62.062 -13.810 9.976   1.00 15.51  ? 246  LEU A CD1   1 
ATOM   1918 C  CD2   . LEU A 1 249 ? 61.924 -14.329 7.515   1.00 15.72  ? 246  LEU A CD2   1 
ATOM   1919 N  N     . PHE A 1 250 ? 60.825 -18.393 9.982   1.00 12.16  ? 247  PHE A N     1 
ATOM   1920 C  CA    . PHE A 1 250 ? 59.442 -18.865 10.032  1.00 12.92  ? 247  PHE A CA    1 
ATOM   1921 C  C     . PHE A 1 250 ? 59.109 -19.660 11.288  1.00 10.81  ? 247  PHE A C     1 
ATOM   1922 O  O     . PHE A 1 250 ? 57.931 -19.825 11.607  1.00 11.46  ? 247  PHE A O     1 
ATOM   1923 C  CB    . PHE A 1 250 ? 59.127 -19.696 8.793   1.00 13.68  ? 247  PHE A CB    1 
ATOM   1924 C  CG    . PHE A 1 250 ? 58.676 -18.872 7.601   1.00 11.19  ? 247  PHE A CG    1 
ATOM   1925 C  CD1   . PHE A 1 250 ? 58.190 -19.507 6.472   1.00 13.60  ? 247  PHE A CD1   1 
ATOM   1926 C  CD2   . PHE A 1 250 ? 58.732 -17.470 7.620   1.00 13.90  ? 247  PHE A CD2   1 
ATOM   1927 C  CE1   . PHE A 1 250 ? 57.757 -18.796 5.379   1.00 13.78  ? 247  PHE A CE1   1 
ATOM   1928 C  CE2   . PHE A 1 250 ? 58.318 -16.747 6.520   1.00 12.48  ? 247  PHE A CE2   1 
ATOM   1929 C  CZ    . PHE A 1 250 ? 57.828 -17.419 5.389   1.00 13.31  ? 247  PHE A CZ    1 
ATOM   1930 N  N     . SER A 1 251 ? 60.127 -20.129 12.010  1.00 10.12  ? 248  SER A N     1 
ATOM   1931 C  CA    . SER A 1 251 ? 59.887 -20.974 13.182  1.00 13.13  ? 248  SER A CA    1 
ATOM   1932 C  C     . SER A 1 251 ? 59.178 -20.218 14.302  1.00 11.12  ? 248  SER A C     1 
ATOM   1933 O  O     . SER A 1 251 ? 58.528 -20.827 15.129  1.00 10.19  ? 248  SER A O     1 
ATOM   1934 C  CB    . SER A 1 251 ? 61.206 -21.570 13.698  1.00 13.09  ? 248  SER A CB    1 
ATOM   1935 O  OG    . SER A 1 251 ? 62.017 -20.589 14.330  1.00 13.88  ? 248  SER A OG    1 
ATOM   1936 N  N     . GLN A 1 252 ? 59.283 -18.890 14.313  1.00 13.44  ? 249  GLN A N     1 
ATOM   1937 C  CA    . GLN A 1 252 ? 58.572 -18.097 15.307  1.00 12.97  ? 249  GLN A CA    1 
ATOM   1938 C  C     . GLN A 1 252 ? 57.718 -16.997 14.683  1.00 12.83  ? 249  GLN A C     1 
ATOM   1939 O  O     . GLN A 1 252 ? 57.383 -16.020 15.356  1.00 16.32  ? 249  GLN A O     1 
ATOM   1940 C  CB    . GLN A 1 252 ? 59.539 -17.465 16.287  1.00 17.59  ? 249  GLN A CB    1 
ATOM   1941 C  CG    . GLN A 1 252 ? 60.294 -18.449 17.134  1.00 23.27  ? 249  GLN A CG    1 
ATOM   1942 C  CD    . GLN A 1 252 ? 61.124 -17.725 18.158  1.00 22.46  ? 249  GLN A CD    1 
ATOM   1943 O  OE1   . GLN A 1 252 ? 60.696 -17.544 19.304  1.00 23.41  ? 249  GLN A OE1   1 
ATOM   1944 N  NE2   . GLN A 1 252 ? 62.302 -17.267 17.747  1.00 27.83  ? 249  GLN A NE2   1 
ATOM   1945 N  N     . MET A 1 253 ? 57.370 -17.157 13.412  1.00 12.10  ? 250  MET A N     1 
ATOM   1946 C  CA    . MET A 1 253 ? 56.618 -16.122 12.693  1.00 13.56  ? 250  MET A CA    1 
ATOM   1947 C  C     . MET A 1 253 ? 55.132 -16.418 12.770  1.00 11.85  ? 250  MET A C     1 
ATOM   1948 O  O     . MET A 1 253 ? 54.680 -17.397 12.202  1.00 12.83  ? 250  MET A O     1 
ATOM   1949 C  CB    . MET A 1 253 ? 57.070 -16.043 11.224  1.00 16.47  ? 250  MET A CB    1 
ATOM   1950 C  CG    . MET A 1 253 ? 56.350 -14.968 10.398  1.00 19.55  ? 250  MET A CG    1 
ATOM   1951 S  SD    . MET A 1 253 ? 56.762 -13.277 10.870  1.00 20.98  ? 250  MET A SD    1 
ATOM   1952 C  CE    . MET A 1 253 ? 58.558 -13.266 10.678  1.00 19.55  ? 250  MET A CE    1 
ATOM   1953 N  N     . PRO A 1 254 ? 54.355 -15.571 13.472  1.00 15.10  ? 251  PRO A N     1 
ATOM   1954 C  CA    . PRO A 1 254 ? 52.904 -15.805 13.473  1.00 15.66  ? 251  PRO A CA    1 
ATOM   1955 C  C     . PRO A 1 254 ? 52.346 -15.862 12.063  1.00 14.84  ? 251  PRO A C     1 
ATOM   1956 O  O     . PRO A 1 254 ? 52.732 -15.077 11.211  1.00 14.48  ? 251  PRO A O     1 
ATOM   1957 C  CB    . PRO A 1 254 ? 52.341 -14.591 14.230  1.00 15.80  ? 251  PRO A CB    1 
ATOM   1958 C  CG    . PRO A 1 254 ? 53.495 -14.127 15.089  1.00 16.00  ? 251  PRO A CG    1 
ATOM   1959 C  CD    . PRO A 1 254 ? 54.720 -14.360 14.230  1.00 15.61  ? 251  PRO A CD    1 
ATOM   1960 N  N     . ILE A 1 255 ? 51.449 -16.807 11.840  1.00 13.39  ? 252  ILE A N     1 
ATOM   1961 C  CA    . ILE A 1 255 ? 50.885 -17.031 10.524  1.00 14.83  ? 252  ILE A CA    1 
ATOM   1962 C  C     . ILE A 1 255 ? 50.269 -15.734 9.963   1.00 14.31  ? 252  ILE A C     1 
ATOM   1963 O  O     . ILE A 1 255 ? 50.416 -15.453 8.783   1.00 12.39  ? 252  ILE A O     1 
ATOM   1964 C  CB    . ILE A 1 255 ? 49.869 -18.197 10.581  1.00 14.15  ? 252  ILE A CB    1 
ATOM   1965 C  CG1   . ILE A 1 255 ? 50.636 -19.535 10.538  1.00 17.23  ? 252  ILE A CG1   1 
ATOM   1966 C  CG2   . ILE A 1 255 ? 48.886 -18.143 9.437   1.00 15.15  ? 252  ILE A CG2   1 
ATOM   1967 C  CD1   . ILE A 1 255 ? 49.941 -20.675 11.234  1.00 18.85  ? 252  ILE A CD1   1 
ATOM   1968 N  N     . ARG A 1 256 ? 49.657 -14.911 10.818  1.00 15.03  ? 253  ARG A N     1 
ATOM   1969 C  CA    . ARG A 1 256 ? 48.950 -13.717 10.342  1.00 13.36  ? 253  ARG A CA    1 
ATOM   1970 C  C     . ARG A 1 256 ? 49.865 -12.661 9.711   1.00 15.63  ? 253  ARG A C     1 
ATOM   1971 O  O     . ARG A 1 256 ? 49.402 -11.741 9.028   1.00 16.53  ? 253  ARG A O     1 
ATOM   1972 C  CB    . ARG A 1 256 ? 48.161 -13.072 11.494  1.00 17.32  ? 253  ARG A CB    1 
ATOM   1973 C  CG    . ARG A 1 256 ? 49.058 -12.440 12.547  1.00 19.24  ? 253  ARG A CG    1 
ATOM   1974 C  CD    . ARG A 1 256 ? 48.273 -11.850 13.723  1.00 30.54  ? 253  ARG A CD    1 
ATOM   1975 N  NE    . ARG A 1 256 ? 49.170 -11.381 14.783  1.00 33.00  ? 253  ARG A NE    1 
ATOM   1976 C  CZ    . ARG A 1 256 ? 49.590 -12.130 15.799  1.00 31.00  ? 253  ARG A CZ    1 
ATOM   1977 N  NH1   . ARG A 1 256 ? 49.186 -13.391 15.916  1.00 24.29  ? 253  ARG A NH1   1 
ATOM   1978 N  NH2   . ARG A 1 256 ? 50.409 -11.615 16.711  1.00 30.65  ? 253  ARG A NH2   1 
ATOM   1979 N  N     . LYS A 1 257 ? 51.168 -12.771 9.938   1.00 15.36  ? 254  LYS A N     1 
ATOM   1980 C  CA    . LYS A 1 257 ? 52.076 -11.755 9.433   1.00 15.63  ? 254  LYS A CA    1 
ATOM   1981 C  C     . LYS A 1 257 ? 52.315 -11.879 7.945   1.00 12.56  ? 254  LYS A C     1 
ATOM   1982 O  O     . LYS A 1 257 ? 52.848 -10.963 7.332   1.00 16.89  ? 254  LYS A O     1 
ATOM   1983 C  CB    . LYS A 1 257 ? 53.427 -11.816 10.145  1.00 13.56  ? 254  LYS A CB    1 
ATOM   1984 C  CG    . LYS A 1 257 ? 53.374 -11.601 11.646  1.00 23.51  ? 254  LYS A CG    1 
ATOM   1985 C  CD    . LYS A 1 257 ? 52.777 -10.256 12.006  1.00 24.73  ? 254  LYS A CD    1 
ATOM   1986 C  CE    . LYS A 1 257 ? 52.778 -10.050 13.517  1.00 37.86  ? 254  LYS A CE    1 
ATOM   1987 N  NZ    . LYS A 1 257 ? 52.206 -8.724  13.897  1.00 35.24  ? 254  LYS A NZ    1 
ATOM   1988 N  N     . ILE A 1 258 ? 51.969 -13.013 7.356   1.00 13.35  ? 255  ILE A N     1 
ATOM   1989 C  CA    . ILE A 1 258 ? 52.259 -13.269 5.946   1.00 12.54  ? 255  ILE A CA    1 
ATOM   1990 C  C     . ILE A 1 258 ? 51.146 -12.685 5.102   1.00 14.76  ? 255  ILE A C     1 
ATOM   1991 O  O     . ILE A 1 258 ? 50.033 -12.812 5.449   1.00 15.27  ? 255  ILE A O     1 
ATOM   1992 C  CB    . ILE A 1 258 ? 52.431 -14.799 5.665   1.00 14.36  ? 255  ILE A CB    1 
ATOM   1993 C  CG1   . ILE A 1 258 ? 53.880 -15.208 5.895   1.00 25.28  ? 255  ILE A CG1   1 
ATOM   1994 C  CG2   . ILE A 1 258 ? 52.206 -15.178 4.228   1.00 15.08  ? 255  ILE A CG2   1 
ATOM   1995 C  CD1   . ILE A 1 258 ? 54.357 -15.023 7.271   1.00 23.05  ? 255  ILE A CD1   1 
ATOM   1996 N  N     . ARG A 1 259 ? 51.496 -12.019 4.012   1.00 14.78  ? 256  ARG A N     1 
ATOM   1997 C  CA    . ARG A 1 259 ? 50.486 -11.366 3.249   1.00 16.62  ? 256  ARG A CA    1 
ATOM   1998 C  C     . ARG A 1 259 ? 49.495 -12.356 2.690   1.00 17.30  ? 256  ARG A C     1 
ATOM   1999 O  O     . ARG A 1 259 ? 49.860 -13.249 2.068   1.00 17.88  ? 256  ARG A O     1 
ATOM   2000 C  CB    . ARG A 1 259 ? 51.124 -10.571 2.115   1.00 15.35  ? 256  ARG A CB    1 
ATOM   2001 C  CG    . ARG A 1 259 ? 50.177 -9.644  1.383   1.00 21.62  ? 256  ARG A CG    1 
ATOM   2002 C  CD    . ARG A 1 259 ? 50.843 -8.933  0.221   1.00 25.55  ? 256  ARG A CD    1 
ATOM   2003 N  NE    . ARG A 1 259 ? 49.891 -8.067  -0.451  1.00 23.46  ? 256  ARG A NE    1 
ATOM   2004 C  CZ    . ARG A 1 259 ? 49.031 -8.507  -1.342  1.00 37.04  ? 256  ARG A CZ    1 
ATOM   2005 N  NH1   . ARG A 1 259 ? 48.170 -7.693  -1.908  1.00 32.64  ? 256  ARG A NH1   1 
ATOM   2006 N  NH2   . ARG A 1 259 ? 49.063 -9.768  -1.697  1.00 40.16  ? 256  ARG A NH2   1 
ATOM   2007 N  N     . SER A 1 260 ? 48.235 -12.046 2.910   1.00 15.05  ? 257  SER A N     1 
ATOM   2008 C  CA    . SER A 1 260 ? 47.043 -12.814 2.580   1.00 17.96  ? 257  SER A CA    1 
ATOM   2009 C  C     . SER A 1 260 ? 46.530 -13.705 3.694   1.00 18.50  ? 257  SER A C     1 
ATOM   2010 O  O     . SER A 1 260 ? 45.471 -14.223 3.571   1.00 16.74  ? 257  SER A O     1 
ATOM   2011 C  CB    . SER A 1 260 ? 47.180 -13.637 1.291   1.00 13.98  ? 257  SER A CB    1 
ATOM   2012 O  OG    . SER A 1 260 ? 47.768 -14.872 1.493   1.00 17.95  ? 257  SER A OG    1 
ATOM   2013 N  N     . LEU A 1 261 ? 47.298 -13.876 4.753   1.00 13.83  ? 258  LEU A N     1 
ATOM   2014 C  CA    . LEU A 1 261 ? 46.888 -14.697 5.887   1.00 16.21  ? 258  LEU A CA    1 
ATOM   2015 C  C     . LEU A 1 261 ? 46.506 -13.886 7.124   1.00 14.51  ? 258  LEU A C     1 
ATOM   2016 O  O     . LEU A 1 261 ? 46.353 -14.410 8.186   1.00 14.15  ? 258  LEU A O     1 
ATOM   2017 C  CB    . LEU A 1 261 ? 47.970 -15.710 6.245   1.00 14.70  ? 258  LEU A CB    1 
ATOM   2018 C  CG    . LEU A 1 261 ? 48.441 -16.629 5.125   1.00 13.56  ? 258  LEU A CG    1 
ATOM   2019 C  CD1   . LEU A 1 261 ? 49.499 -17.585 5.621   1.00 13.63  ? 258  LEU A CD1   1 
ATOM   2020 C  CD2   . LEU A 1 261 ? 47.294 -17.460 4.591   1.00 15.88  ? 258  LEU A CD2   1 
ATOM   2021 N  N     . GLY A 1 262 ? 46.351 -12.583 6.919   1.00 15.13  ? 259  GLY A N     1 
ATOM   2022 C  CA    . GLY A 1 262 ? 46.007 -11.701 8.018   1.00 14.95  ? 259  GLY A CA    1 
ATOM   2023 C  C     . GLY A 1 262 ? 44.539 -11.688 8.416   1.00 17.68  ? 259  GLY A C     1 
ATOM   2024 O  O     . GLY A 1 262 ? 44.183 -11.048 9.396   1.00 19.14  ? 259  GLY A O     1 
ATOM   2025 N  N     . GLY A 1 263 ? 43.698 -12.393 7.663   1.00 17.39  ? 260  GLY A N     1 
ATOM   2026 C  CA    . GLY A 1 263 ? 42.260 -12.394 7.895   1.00 15.61  ? 260  GLY A CA    1 
ATOM   2027 C  C     . GLY A 1 263 ? 41.695 -13.759 8.267   1.00 18.55  ? 260  GLY A C     1 
ATOM   2028 O  O     . GLY A 1 263 ? 42.306 -14.517 9.025   1.00 16.85  ? 260  GLY A O     1 
ATOM   2029 N  N     . LYS A 1 264 ? 40.517 -14.079 7.741   1.00 16.04  ? 261  LYS A N     1 
ATOM   2030 C  CA    . LYS A 1 264 ? 39.814 -15.304 8.112   1.00 15.33  ? 261  LYS A CA    1 
ATOM   2031 C  C     . LYS A 1 264 ? 40.542 -16.602 7.724   1.00 16.44  ? 261  LYS A C     1 
ATOM   2032 O  O     . LYS A 1 264 ? 40.502 -17.577 8.478   1.00 20.06  ? 261  LYS A O     1 
ATOM   2033 C  CB    . LYS A 1 264 ? 38.412 -15.299 7.486   1.00 17.35  ? 261  LYS A CB    1 
ATOM   2034 C  CG    . LYS A 1 264 ? 37.533 -14.180 8.003   1.00 23.98  ? 261  LYS A CG    1 
ATOM   2035 C  CD    . LYS A 1 264 ? 36.132 -14.224 7.394   1.00 23.31  ? 261  LYS A CD    1 
ATOM   2036 C  CE    . LYS A 1 264 ? 35.301 -13.023 7.834   1.00 37.62  ? 261  LYS A CE    1 
ATOM   2037 N  NZ    . LYS A 1 264 ? 33.995 -12.957 7.122   1.00 40.71  ? 261  LYS A NZ    1 
ATOM   2038 N  N     . LEU A 1 265 ? 41.179 -16.623 6.553   1.00 17.19  ? 262  LEU A N     1 
ATOM   2039 C  CA    . LEU A 1 265 ? 41.909 -17.811 6.123   1.00 11.85  ? 262  LEU A CA    1 
ATOM   2040 C  C     . LEU A 1 265 ? 43.012 -18.136 7.128   1.00 14.59  ? 262  LEU A C     1 
ATOM   2041 O  O     . LEU A 1 265 ? 43.152 -19.291 7.563   1.00 15.33  ? 262  LEU A O     1 
ATOM   2042 C  CB    . LEU A 1 265 ? 42.510 -17.632 4.732   1.00 14.73  ? 262  LEU A CB    1 
ATOM   2043 C  CG    . LEU A 1 265 ? 43.365 -18.792 4.195   1.00 16.65  ? 262  LEU A CG    1 
ATOM   2044 C  CD1   . LEU A 1 265 ? 42.595 -20.121 4.151   1.00 18.29  ? 262  LEU A CD1   1 
ATOM   2045 C  CD2   . LEU A 1 265 ? 43.897 -18.465 2.823   1.00 14.09  ? 262  LEU A CD2   1 
ATOM   2046 N  N     . GLY A 1 266 ? 43.784 -17.119 7.492   1.00 15.11  ? 263  GLY A N     1 
ATOM   2047 C  CA    . GLY A 1 266 ? 44.874 -17.306 8.434   1.00 13.17  ? 263  GLY A CA    1 
ATOM   2048 C  C     . GLY A 1 266 ? 44.377 -17.789 9.779   1.00 16.80  ? 263  GLY A C     1 
ATOM   2049 O  O     . GLY A 1 266 ? 44.987 -18.661 10.409  1.00 16.62  ? 263  GLY A O     1 
ATOM   2050 N  N     . ALA A 1 267 ? 43.263 -17.217 10.233  1.00 15.15  ? 264  ALA A N     1 
ATOM   2051 C  CA    . ALA A 1 267 ? 42.665 -17.659 11.484  1.00 15.97  ? 264  ALA A CA    1 
ATOM   2052 C  C     . ALA A 1 267 ? 42.208 -19.110 11.384  1.00 15.28  ? 264  ALA A C     1 
ATOM   2053 O  O     . ALA A 1 267 ? 42.291 -19.864 12.361  1.00 18.45  ? 264  ALA A O     1 
ATOM   2054 C  CB    . ALA A 1 267 ? 41.487 -16.745 11.871  1.00 18.37  ? 264  ALA A CB    1 
ATOM   2055 N  N     . SER A 1 268 ? 41.745 -19.518 10.204  1.00 15.36  ? 265  SER A N     1 
ATOM   2056 C  CA    . SER A 1 268 ? 41.270 -20.882 10.050  1.00 16.50  ? 265  SER A CA    1 
ATOM   2057 C  C     . SER A 1 268 ? 42.470 -21.844 10.011  1.00 17.23  ? 265  SER A C     1 
ATOM   2058 O  O     . SER A 1 268 ? 42.380 -22.965 10.504  1.00 17.10  ? 265  SER A O     1 
ATOM   2059 C  CB    . SER A 1 268 ? 40.391 -21.040 8.805   1.00 19.92  ? 265  SER A CB    1 
ATOM   2060 O  OG    . SER A 1 268 ? 41.150 -21.048 7.614   1.00 26.64  ? 265  SER A OG    1 
ATOM   2061 N  N     . VAL A 1 269 ? 43.597 -21.399 9.454   1.00 14.53  ? 266  VAL A N     1 
ATOM   2062 C  CA    . VAL A 1 269 ? 44.800 -22.242 9.449   1.00 15.03  ? 266  VAL A CA    1 
ATOM   2063 C  C     . VAL A 1 269 ? 45.186 -22.546 10.899  1.00 16.82  ? 266  VAL A C     1 
ATOM   2064 O  O     . VAL A 1 269 ? 45.416 -23.698 11.269  1.00 17.68  ? 266  VAL A O     1 
ATOM   2065 C  CB    . VAL A 1 269 ? 45.984 -21.592 8.703   1.00 15.39  ? 266  VAL A CB    1 
ATOM   2066 C  CG1   . VAL A 1 269 ? 47.231 -22.464 8.845   1.00 19.67  ? 266  VAL A CG1   1 
ATOM   2067 C  CG2   . VAL A 1 269 ? 45.651 -21.399 7.213   1.00 15.97  ? 266  VAL A CG2   1 
ATOM   2068 N  N     . ILE A 1 270 ? 45.216 -21.502 11.719  1.00 17.08  ? 267  ILE A N     1 
ATOM   2069 C  CA    . ILE A 1 270 ? 45.545 -21.619 13.138  1.00 19.61  ? 267  ILE A CA    1 
ATOM   2070 C  C     . ILE A 1 270 ? 44.560 -22.518 13.879  1.00 17.35  ? 267  ILE A C     1 
ATOM   2071 O  O     . ILE A 1 270 ? 44.957 -23.436 14.613  1.00 19.56  ? 267  ILE A O     1 
ATOM   2072 C  CB    . ILE A 1 270 ? 45.561 -20.221 13.790  1.00 18.33  ? 267  ILE A CB    1 
ATOM   2073 C  CG1   . ILE A 1 270 ? 46.751 -19.410 13.277  1.00 16.52  ? 267  ILE A CG1   1 
ATOM   2074 C  CG2   . ILE A 1 270 ? 45.565 -20.307 15.308  1.00 24.08  ? 267  ILE A CG2   1 
ATOM   2075 C  CD1   . ILE A 1 270 ? 46.653 -17.919 13.578  1.00 20.67  ? 267  ILE A CD1   1 
ATOM   2076 N  N     . GLU A 1 271 ? 43.267 -22.278 13.678  1.00 17.87  ? 268  GLU A N     1 
ATOM   2077 C  CA    . GLU A 1 271 ? 42.257 -23.040 14.409  1.00 20.74  ? 268  GLU A CA    1 
ATOM   2078 C  C     . GLU A 1 271 ? 42.189 -24.499 13.983  1.00 21.18  ? 268  GLU A C     1 
ATOM   2079 O  O     . GLU A 1 271 ? 42.185 -25.392 14.825  1.00 23.15  ? 268  GLU A O     1 
ATOM   2080 C  CB    . GLU A 1 271 ? 40.878 -22.400 14.250  1.00 27.38  ? 268  GLU A CB    1 
ATOM   2081 C  CG    . GLU A 1 271 ? 39.764 -23.166 14.951  1.00 42.28  ? 268  GLU A CG    1 
ATOM   2082 C  CD    . GLU A 1 271 ? 39.264 -22.457 16.195  1.00 53.32  ? 268  GLU A CD    1 
ATOM   2083 O  OE1   . GLU A 1 271 ? 40.068 -21.753 16.846  1.00 56.68  ? 268  GLU A OE1   1 
ATOM   2084 O  OE2   . GLU A 1 271 ? 38.070 -22.614 16.527  1.00 61.34  ? 268  GLU A OE2   1 
ATOM   2085 N  N     . ILE A 1 272 ? 42.122 -24.738 12.677  1.00 19.71  ? 269  ILE A N     1 
ATOM   2086 C  CA    . ILE A 1 272 ? 41.951 -26.085 12.152  1.00 17.65  ? 269  ILE A CA    1 
ATOM   2087 C  C     . ILE A 1 272 ? 43.167 -26.970 12.448  1.00 19.82  ? 269  ILE A C     1 
ATOM   2088 O  O     . ILE A 1 272 ? 43.024 -28.114 12.878  1.00 22.70  ? 269  ILE A O     1 
ATOM   2089 C  CB    . ILE A 1 272 ? 41.676 -26.053 10.633  1.00 16.89  ? 269  ILE A CB    1 
ATOM   2090 C  CG1   . ILE A 1 272 ? 40.264 -25.497 10.371  1.00 19.81  ? 269  ILE A CG1   1 
ATOM   2091 C  CG2   . ILE A 1 272 ? 41.831 -27.447 10.035  1.00 20.78  ? 269  ILE A CG2   1 
ATOM   2092 C  CD1   . ILE A 1 272 ? 39.858 -25.441 8.902   1.00 26.84  ? 269  ILE A CD1   1 
ATOM   2093 N  N     . LEU A 1 273 ? 44.362 -26.430 12.244  1.00 20.63  ? 270  LEU A N     1 
ATOM   2094 C  CA    . LEU A 1 273 ? 45.578 -27.231 12.382  1.00 16.90  ? 270  LEU A CA    1 
ATOM   2095 C  C     . LEU A 1 273 ? 46.131 -27.207 13.801  1.00 18.19  ? 270  LEU A C     1 
ATOM   2096 O  O     . LEU A 1 273 ? 46.965 -28.034 14.159  1.00 22.56  ? 270  LEU A O     1 
ATOM   2097 C  CB    . LEU A 1 273 ? 46.644 -26.742 11.405  1.00 21.02  ? 270  LEU A CB    1 
ATOM   2098 C  CG    . LEU A 1 273 ? 46.239 -26.886 9.937   1.00 18.98  ? 270  LEU A CG    1 
ATOM   2099 C  CD1   . LEU A 1 273 ? 47.308 -26.303 9.019   1.00 20.09  ? 270  LEU A CD1   1 
ATOM   2100 C  CD2   . LEU A 1 273 ? 45.953 -28.354 9.587   1.00 23.74  ? 270  LEU A CD2   1 
ATOM   2101 N  N     . GLY A 1 274 ? 45.685 -26.248 14.604  1.00 15.54  ? 271  GLY A N     1 
ATOM   2102 C  CA    . GLY A 1 274 ? 46.168 -26.135 15.972  1.00 16.12  ? 271  GLY A CA    1 
ATOM   2103 C  C     . GLY A 1 274 ? 47.624 -25.720 16.038  1.00 22.93  ? 271  GLY A C     1 
ATOM   2104 O  O     . GLY A 1 274 ? 48.402 -26.222 16.859  1.00 21.87  ? 271  GLY A O     1 
ATOM   2105 N  N     . ILE A 1 275 ? 47.991 -24.794 15.162  1.00 17.41  ? 272  ILE A N     1 
ATOM   2106 C  CA    . ILE A 1 275 ? 49.356 -24.278 15.092  1.00 14.94  ? 272  ILE A CA    1 
ATOM   2107 C  C     . ILE A 1 275 ? 49.394 -22.759 15.244  1.00 14.10  ? 272  ILE A C     1 
ATOM   2108 O  O     . ILE A 1 275 ? 48.358 -22.105 15.255  1.00 18.42  ? 272  ILE A O     1 
ATOM   2109 C  CB    . ILE A 1 275 ? 50.025 -24.673 13.760  1.00 14.01  ? 272  ILE A CB    1 
ATOM   2110 C  CG1   . ILE A 1 275 ? 49.286 -24.074 12.562  1.00 18.27  ? 272  ILE A CG1   1 
ATOM   2111 C  CG2   . ILE A 1 275 ? 50.088 -26.188 13.644  1.00 13.68  ? 272  ILE A CG2   1 
ATOM   2112 C  CD1   . ILE A 1 275 ? 49.992 -24.372 11.235  1.00 16.06  ? 272  ILE A CD1   1 
ATOM   2113 N  N     . GLU A 1 276 ? 50.591 -22.195 15.358  1.00 15.24  ? 273  GLU A N     1 
ATOM   2114 C  CA    . GLU A 1 276 ? 50.750 -20.749 15.533  1.00 15.51  ? 273  GLU A CA    1 
ATOM   2115 C  C     . GLU A 1 276 ? 51.687 -20.096 14.517  1.00 16.34  ? 273  GLU A C     1 
ATOM   2116 O  O     . GLU A 1 276 ? 51.530 -18.933 14.156  1.00 16.22  ? 273  GLU A O     1 
ATOM   2117 C  CB    . GLU A 1 276 ? 51.305 -20.428 16.917  1.00 15.13  ? 273  GLU A CB    1 
ATOM   2118 C  CG    . GLU A 1 276 ? 50.418 -20.782 18.094  1.00 26.60  ? 273  GLU A CG    1 
ATOM   2119 C  CD    . GLU A 1 276 ? 51.084 -20.463 19.427  1.00 41.25  ? 273  GLU A CD    1 
ATOM   2120 O  OE1   . GLU A 1 276 ? 51.116 -21.347 20.309  1.00 50.13  ? 273  GLU A OE1   1 
ATOM   2121 O  OE2   . GLU A 1 276 ? 51.581 -19.328 19.589  1.00 46.73  ? 273  GLU A OE2   1 
ATOM   2122 N  N     . TYR A 1 277 ? 52.709 -20.836 14.108  1.00 17.59  ? 274  TYR A N     1 
ATOM   2123 C  CA    . TYR A 1 277 ? 53.796 -20.239 13.345  1.00 12.87  ? 274  TYR A CA    1 
ATOM   2124 C  C     . TYR A 1 277 ? 53.888 -20.823 11.945  1.00 14.69  ? 274  TYR A C     1 
ATOM   2125 O  O     . TYR A 1 277 ? 53.546 -21.986 11.716  1.00 14.36  ? 274  TYR A O     1 
ATOM   2126 C  CB    . TYR A 1 277 ? 55.134 -20.433 14.074  1.00 14.26  ? 274  TYR A CB    1 
ATOM   2127 C  CG    . TYR A 1 277 ? 55.122 -19.943 15.505  1.00 14.02  ? 274  TYR A CG    1 
ATOM   2128 C  CD1   . TYR A 1 277 ? 55.325 -20.822 16.568  1.00 15.93  ? 274  TYR A CD1   1 
ATOM   2129 C  CD2   . TYR A 1 277 ? 54.885 -18.604 15.793  1.00 16.26  ? 274  TYR A CD2   1 
ATOM   2130 C  CE1   . TYR A 1 277 ? 55.310 -20.378 17.877  1.00 18.26  ? 274  TYR A CE1   1 
ATOM   2131 C  CE2   . TYR A 1 277 ? 54.849 -18.149 17.103  1.00 19.83  ? 274  TYR A CE2   1 
ATOM   2132 C  CZ    . TYR A 1 277 ? 55.065 -19.048 18.142  1.00 20.75  ? 274  TYR A CZ    1 
ATOM   2133 O  OH    . TYR A 1 277 ? 55.044 -18.619 19.451  1.00 20.82  ? 274  TYR A OH    1 
ATOM   2134 N  N     . MET A 1 278 ? 54.356 -19.997 11.015  1.00 11.42  ? 275  MET A N     1 
ATOM   2135 C  CA    . MET A 1 278 ? 54.464 -20.386 9.619   1.00 13.39  ? 275  MET A CA    1 
ATOM   2136 C  C     . MET A 1 278 ? 55.226 -21.696 9.443   1.00 11.79  ? 275  MET A C     1 
ATOM   2137 O  O     . MET A 1 278 ? 54.839 -22.554 8.648   1.00 13.48  ? 275  MET A O     1 
ATOM   2138 C  CB    . MET A 1 278 ? 55.146 -19.263 8.827   1.00 17.67  ? 275  MET A CB    1 
ATOM   2139 C  CG    . MET A 1 278 ? 54.729 -19.180 7.381   1.00 22.68  ? 275  MET A CG    1 
ATOM   2140 S  SD    . MET A 1 278 ? 52.952 -18.887 7.137   1.00 18.25  ? 275  MET A SD    1 
ATOM   2141 C  CE    . MET A 1 278 ? 52.838 -19.384 5.421   1.00 29.68  ? 275  MET A CE    1 
ATOM   2142 N  N     . GLY A 1 279 ? 56.302 -21.861 10.208  1.00 12.86  ? 276  GLY A N     1 
ATOM   2143 C  CA    . GLY A 1 279 ? 57.140 -23.038 10.058  1.00 12.51  ? 276  GLY A CA    1 
ATOM   2144 C  C     . GLY A 1 279 ? 56.427 -24.340 10.398  1.00 14.20  ? 276  GLY A C     1 
ATOM   2145 O  O     . GLY A 1 279 ? 56.758 -25.400 9.859   1.00 15.28  ? 276  GLY A O     1 
ATOM   2146 N  N     . GLU A 1 280 ? 55.433 -24.282 11.283  1.00 11.47  ? 277  GLU A N     1 
ATOM   2147 C  CA    . GLU A 1 280 ? 54.705 -25.491 11.650  1.00 11.72  ? 277  GLU A CA    1 
ATOM   2148 C  C     . GLU A 1 280 ? 53.910 -26.081 10.479  1.00 15.43  ? 277  GLU A C     1 
ATOM   2149 O  O     . GLU A 1 280 ? 53.530 -27.247 10.518  1.00 14.17  ? 277  GLU A O     1 
ATOM   2150 C  CB    . GLU A 1 280 ? 53.757 -25.205 12.825  1.00 12.24  ? 277  GLU A CB    1 
ATOM   2151 C  CG    . GLU A 1 280 ? 54.469 -24.811 14.108  1.00 15.26  ? 277  GLU A CG    1 
ATOM   2152 C  CD    . GLU A 1 280 ? 53.483 -24.546 15.230  1.00 19.24  ? 277  GLU A CD    1 
ATOM   2153 O  OE1   . GLU A 1 280 ? 53.188 -23.368 15.465  1.00 18.24  ? 277  GLU A OE1   1 
ATOM   2154 O  OE2   . GLU A 1 280 ? 53.016 -25.503 15.874  1.00 19.55  ? 277  GLU A OE2   1 
ATOM   2155 N  N     . LEU A 1 281 ? 53.665 -25.285 9.440   1.00 13.05  ? 278  LEU A N     1 
ATOM   2156 C  CA    . LEU A 1 281 ? 52.952 -25.785 8.253   1.00 12.22  ? 278  LEU A CA    1 
ATOM   2157 C  C     . LEU A 1 281 ? 53.711 -26.877 7.495   1.00 11.94  ? 278  LEU A C     1 
ATOM   2158 O  O     . LEU A 1 281 ? 53.103 -27.652 6.749   1.00 12.37  ? 278  LEU A O     1 
ATOM   2159 C  CB    . LEU A 1 281 ? 52.643 -24.626 7.296   1.00 12.77  ? 278  LEU A CB    1 
ATOM   2160 C  CG    . LEU A 1 281 ? 51.460 -23.748 7.711   1.00 15.24  ? 278  LEU A CG    1 
ATOM   2161 C  CD1   . LEU A 1 281 ? 51.452 -22.441 6.915   1.00 16.44  ? 278  LEU A CD1   1 
ATOM   2162 C  CD2   . LEU A 1 281 ? 50.154 -24.512 7.505   1.00 16.31  ? 278  LEU A CD2   1 
ATOM   2163 N  N     . THR A 1 282 ? 55.034 -26.937 7.665   1.00 14.68  ? 279  THR A N     1 
ATOM   2164 C  CA    . THR A 1 282 ? 55.826 -27.872 6.860   1.00 16.17  ? 279  THR A CA    1 
ATOM   2165 C  C     . THR A 1 282 ? 55.469 -29.323 7.168   1.00 15.79  ? 279  THR A C     1 
ATOM   2166 O  O     . THR A 1 282 ? 55.753 -30.202 6.370   1.00 16.07  ? 279  THR A O     1 
ATOM   2167 C  CB    . THR A 1 282 ? 57.364 -27.709 7.063   1.00 15.84  ? 279  THR A CB    1 
ATOM   2168 O  OG1   . THR A 1 282 ? 57.717 -28.006 8.427   1.00 16.52  ? 279  THR A OG1   1 
ATOM   2169 C  CG2   . THR A 1 282 ? 57.847 -26.316 6.676   1.00 12.93  ? 279  THR A CG2   1 
ATOM   2170 N  N     . GLN A 1 283 ? 54.862 -29.581 8.323   1.00 15.88  ? 280  GLN A N     1 
ATOM   2171 C  CA    . GLN A 1 283 ? 54.564 -30.962 8.714   1.00 15.92  ? 280  GLN A CA    1 
ATOM   2172 C  C     . GLN A 1 283 ? 53.305 -31.552 8.105   1.00 20.84  ? 280  GLN A C     1 
ATOM   2173 O  O     . GLN A 1 283 ? 52.939 -32.686 8.407   1.00 25.63  ? 280  GLN A O     1 
ATOM   2174 C  CB    . GLN A 1 283 ? 54.464 -31.044 10.235  1.00 18.56  ? 280  GLN A CB    1 
ATOM   2175 C  CG    A GLN A 1 283 ? 55.800 -30.825 10.858  0.54 17.25  ? 280  GLN A CG    1 
ATOM   2176 C  CG    B GLN A 1 283 ? 53.219 -30.394 10.788  0.46 20.70  ? 280  GLN A CG    1 
ATOM   2177 C  CD    A GLN A 1 283 ? 56.873 -31.603 10.122  0.54 19.92  ? 280  GLN A CD    1 
ATOM   2178 C  CD    B GLN A 1 283 ? 53.313 -30.129 12.274  0.46 28.98  ? 280  GLN A CD    1 
ATOM   2179 O  OE1   A GLN A 1 283 ? 56.898 -32.831 10.164  0.54 18.90  ? 280  GLN A OE1   1 
ATOM   2180 O  OE1   B GLN A 1 283 ? 53.743 -30.988 13.046  0.46 31.18  ? 280  GLN A OE1   1 
ATOM   2181 N  NE2   A GLN A 1 283 ? 57.754 -30.888 9.418   0.54 19.97  ? 280  GLN A NE2   1 
ATOM   2182 N  NE2   B GLN A 1 283 ? 52.905 -28.933 12.685  0.46 15.26  ? 280  GLN A NE2   1 
ATOM   2183 N  N     . PHE A 1 284 ? 52.641 -30.795 7.249   1.00 15.65  ? 281  PHE A N     1 
ATOM   2184 C  CA    . PHE A 1 284 ? 51.432 -31.276 6.609   1.00 14.59  ? 281  PHE A CA    1 
ATOM   2185 C  C     . PHE A 1 284 ? 51.736 -31.569 5.143   1.00 17.31  ? 281  PHE A C     1 
ATOM   2186 O  O     . PHE A 1 284 ? 52.574 -30.903 4.534   1.00 21.91  ? 281  PHE A O     1 
ATOM   2187 C  CB    . PHE A 1 284 ? 50.308 -30.252 6.782   1.00 15.72  ? 281  PHE A CB    1 
ATOM   2188 C  CG    . PHE A 1 284 ? 49.984 -29.987 8.222   1.00 16.23  ? 281  PHE A CG    1 
ATOM   2189 C  CD1   . PHE A 1 284 ? 49.173 -30.865 8.925   1.00 19.41  ? 281  PHE A CD1   1 
ATOM   2190 C  CD2   . PHE A 1 284 ? 50.522 -28.900 8.893   1.00 16.28  ? 281  PHE A CD2   1 
ATOM   2191 C  CE1   . PHE A 1 284 ? 48.888 -30.650 10.263  1.00 20.03  ? 281  PHE A CE1   1 
ATOM   2192 C  CE2   . PHE A 1 284 ? 50.240 -28.682 10.229  1.00 18.13  ? 281  PHE A CE2   1 
ATOM   2193 C  CZ    . PHE A 1 284 ? 49.422 -29.559 10.914  1.00 19.50  ? 281  PHE A CZ    1 
ATOM   2194 N  N     . THR A 1 285 ? 51.094 -32.591 4.588   1.00 19.85  ? 282  THR A N     1 
ATOM   2195 C  CA    . THR A 1 285 ? 51.264 -32.888 3.170   1.00 18.49  ? 282  THR A CA    1 
ATOM   2196 C  C     . THR A 1 285 ? 50.528 -31.844 2.373   1.00 14.41  ? 282  THR A C     1 
ATOM   2197 O  O     . THR A 1 285 ? 49.647 -31.176 2.899   1.00 15.83  ? 282  THR A O     1 
ATOM   2198 C  CB    . THR A 1 285 ? 50.730 -34.282 2.781   1.00 15.98  ? 282  THR A CB    1 
ATOM   2199 O  OG1   . THR A 1 285 ? 49.309 -34.312 2.940   1.00 18.64  ? 282  THR A OG1   1 
ATOM   2200 C  CG2   . THR A 1 285 ? 51.367 -35.339 3.659   1.00 24.93  ? 282  THR A CG2   1 
ATOM   2201 N  N     . GLU A 1 286 ? 50.886 -31.714 1.102   1.00 16.44  ? 283  GLU A N     1 
ATOM   2202 C  CA    . GLU A 1 286 ? 50.198 -30.777 0.229   1.00 16.22  ? 283  GLU A CA    1 
ATOM   2203 C  C     . GLU A 1 286 ? 48.718 -31.135 0.149   1.00 15.24  ? 283  GLU A C     1 
ATOM   2204 O  O     . GLU A 1 286 ? 47.853 -30.253 0.159   1.00 16.63  ? 283  GLU A O     1 
ATOM   2205 C  CB    . GLU A 1 286 ? 50.833 -30.765 -1.161  1.00 15.46  ? 283  GLU A CB    1 
ATOM   2206 C  CG    . GLU A 1 286 ? 50.254 -29.693 -2.058  1.00 15.82  ? 283  GLU A CG    1 
ATOM   2207 C  CD    . GLU A 1 286 ? 50.960 -29.599 -3.391  1.00 25.67  ? 283  GLU A CD    1 
ATOM   2208 O  OE1   . GLU A 1 286 ? 51.830 -30.448 -3.666  1.00 25.77  ? 283  GLU A OE1   1 
ATOM   2209 O  OE2   . GLU A 1 286 ? 50.650 -28.660 -4.156  1.00 25.41  ? 283  GLU A OE2   1 
ATOM   2210 N  N     A SER A 1 287 ? 48.429 -32.432 0.088   0.76 15.06  ? 284  SER A N     1 
ATOM   2211 N  N     B SER A 1 287 ? 48.425 -32.431 0.092   0.24 15.09  ? 284  SER A N     1 
ATOM   2212 C  CA    . SER A 1 287 ? 47.041 -32.890 0.028   1.00 14.91  ? 284  SER A CA    1 
ATOM   2213 C  C     . SER A 1 287 ? 46.282 -32.557 1.307   1.00 17.11  ? 284  SER A C     1 
ATOM   2214 O  O     . SER A 1 287 ? 45.097 -32.199 1.254   1.00 16.63  ? 284  SER A O     1 
ATOM   2215 C  CB    . SER A 1 287 ? 46.979 -34.399 -0.245  1.00 20.88  ? 284  SER A CB    1 
ATOM   2216 O  OG    A SER A 1 287 ? 47.536 -34.706 -1.505  0.76 22.74  ? 284  SER A OG    1 
ATOM   2217 O  OG    B SER A 1 287 ? 47.707 -35.130 0.727   0.24 19.14  ? 284  SER A OG    1 
ATOM   2218 N  N     . GLN A 1 288 ? 46.952 -32.641 2.452   1.00 18.11  ? 285  GLN A N     1 
ATOM   2219 C  CA    . GLN A 1 288 ? 46.280 -32.294 3.701   1.00 16.24  ? 285  GLN A CA    1 
ATOM   2220 C  C     . GLN A 1 288 ? 45.880 -30.822 3.680   1.00 13.58  ? 285  GLN A C     1 
ATOM   2221 O  O     . GLN A 1 288 ? 44.747 -30.465 4.017   1.00 16.91  ? 285  GLN A O     1 
ATOM   2222 C  CB    . GLN A 1 288 ? 47.169 -32.578 4.909   1.00 14.59  ? 285  GLN A CB    1 
ATOM   2223 C  CG    . GLN A 1 288 ? 47.257 -34.028 5.297   1.00 20.34  ? 285  GLN A CG    1 
ATOM   2224 C  CD    . GLN A 1 288 ? 48.149 -34.232 6.503   1.00 21.74  ? 285  GLN A CD    1 
ATOM   2225 O  OE1   . GLN A 1 288 ? 49.318 -33.850 6.496   1.00 19.69  ? 285  GLN A OE1   1 
ATOM   2226 N  NE2   . GLN A 1 288 ? 47.596 -34.830 7.554   1.00 32.51  ? 285  GLN A NE2   1 
ATOM   2227 N  N     . LEU A 1 289 ? 46.817 -29.964 3.282   1.00 15.76  ? 286  LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 289 ? 46.520 -28.538 3.234   1.00 14.25  ? 286  LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 289 ? 45.420 -28.220 2.217   1.00 15.31  ? 286  LEU A C     1 
ATOM   2230 O  O     . LEU A 1 289 ? 44.555 -27.377 2.463   1.00 16.21  ? 286  LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 289 ? 47.790 -27.747 2.922   1.00 13.59  ? 286  LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 289 ? 48.889 -27.856 3.985   1.00 11.91  ? 286  LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 289 ? 50.110 -27.040 3.572   1.00 13.29  ? 286  LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 289 ? 48.368 -27.446 5.367   1.00 15.06  ? 286  LEU A CD2   1 
ATOM   2235 N  N     . GLN A 1 290 ? 45.453 -28.893 1.071   1.00 15.90  ? 287  GLN A N     1 
ATOM   2236 C  CA    . GLN A 1 290 ? 44.419 -28.697 0.064   1.00 17.23  ? 287  GLN A CA    1 
ATOM   2237 C  C     . GLN A 1 290 ? 43.049 -29.136 0.558   1.00 16.70  ? 287  GLN A C     1 
ATOM   2238 O  O     . GLN A 1 290 ? 42.026 -28.547 0.197   1.00 19.63  ? 287  GLN A O     1 
ATOM   2239 C  CB    . GLN A 1 290 ? 44.773 -29.459 -1.208  1.00 16.28  ? 287  GLN A CB    1 
ATOM   2240 C  CG    . GLN A 1 290 ? 45.898 -28.846 -2.009  1.00 20.40  ? 287  GLN A CG    1 
ATOM   2241 C  CD    . GLN A 1 290 ? 46.347 -29.754 -3.138  1.00 21.00  ? 287  GLN A CD    1 
ATOM   2242 O  OE1   . GLN A 1 290 ? 46.291 -30.984 -3.024  1.00 22.50  ? 287  GLN A OE1   1 
ATOM   2243 N  NE2   . GLN A 1 290 ? 46.805 -29.155 -4.234  1.00 27.17  ? 287  GLN A NE2   1 
ATOM   2244 N  N     . SER A 1 291 ? 43.025 -30.169 1.391   1.00 16.52  ? 288  SER A N     1 
ATOM   2245 C  CA    . SER A 1 291 ? 41.759 -30.685 1.891   1.00 17.26  ? 288  SER A CA    1 
ATOM   2246 C  C     . SER A 1 291 ? 41.086 -29.668 2.808   1.00 19.92  ? 288  SER A C     1 
ATOM   2247 O  O     . SER A 1 291 ? 39.858 -29.556 2.831   1.00 29.00  ? 288  SER A O     1 
ATOM   2248 C  CB    . SER A 1 291 ? 41.965 -32.015 2.627   1.00 19.95  ? 288  SER A CB    1 
ATOM   2249 O  OG    A SER A 1 291 ? 42.515 -31.820 3.921   0.60 21.94  ? 288  SER A OG    1 
ATOM   2250 O  OG    B SER A 1 291 ? 40.730 -32.657 2.884   0.40 18.26  ? 288  SER A OG    1 
ATOM   2251 N  N     . HIS A 1 292 ? 41.889 -28.912 3.550   1.00 22.61  ? 289  HIS A N     1 
ATOM   2252 C  CA    . HIS A 1 292 ? 41.340 -27.921 4.462   1.00 21.97  ? 289  HIS A CA    1 
ATOM   2253 C  C     . HIS A 1 292 ? 41.070 -26.577 3.800   1.00 21.24  ? 289  HIS A C     1 
ATOM   2254 O  O     . HIS A 1 292 ? 40.060 -25.936 4.092   1.00 25.25  ? 289  HIS A O     1 
ATOM   2255 C  CB    . HIS A 1 292 ? 42.282 -27.695 5.645   1.00 22.51  ? 289  HIS A CB    1 
ATOM   2256 C  CG    . HIS A 1 292 ? 42.444 -28.885 6.537   1.00 23.16  ? 289  HIS A CG    1 
ATOM   2257 N  ND1   . HIS A 1 292 ? 41.391 -29.453 7.224   1.00 26.10  ? 289  HIS A ND1   1 
ATOM   2258 C  CD2   . HIS A 1 292 ? 43.545 -29.593 6.882   1.00 23.01  ? 289  HIS A CD2   1 
ATOM   2259 C  CE1   . HIS A 1 292 ? 41.837 -30.466 7.945   1.00 22.44  ? 289  HIS A CE1   1 
ATOM   2260 N  NE2   . HIS A 1 292 ? 43.139 -30.577 7.751   1.00 29.28  ? 289  HIS A NE2   1 
ATOM   2261 N  N     . PHE A 1 293 ? 41.973 -26.140 2.922   1.00 18.49  ? 290  PHE A N     1 
ATOM   2262 C  CA    . PHE A 1 293 ? 41.945 -24.752 2.478   1.00 20.20  ? 290  PHE A CA    1 
ATOM   2263 C  C     . PHE A 1 293 ? 41.722 -24.607 0.980   1.00 20.48  ? 290  PHE A C     1 
ATOM   2264 O  O     . PHE A 1 293 ? 41.770 -23.499 0.438   1.00 20.87  ? 290  PHE A O     1 
ATOM   2265 C  CB    . PHE A 1 293 ? 43.246 -24.065 2.925   1.00 13.43  ? 290  PHE A CB    1 
ATOM   2266 C  CG    . PHE A 1 293 ? 43.561 -24.319 4.378   1.00 17.74  ? 290  PHE A CG    1 
ATOM   2267 C  CD1   . PHE A 1 293 ? 42.725 -23.813 5.369   1.00 18.65  ? 290  PHE A CD1   1 
ATOM   2268 C  CD2   . PHE A 1 293 ? 44.642 -25.101 4.755   1.00 19.25  ? 290  PHE A CD2   1 
ATOM   2269 C  CE1   . PHE A 1 293 ? 42.969 -24.064 6.705   1.00 17.71  ? 290  PHE A CE1   1 
ATOM   2270 C  CE2   . PHE A 1 293 ? 44.897 -25.353 6.108   1.00 20.37  ? 290  PHE A CE2   1 
ATOM   2271 C  CZ    . PHE A 1 293 ? 44.057 -24.833 7.075   1.00 17.52  ? 290  PHE A CZ    1 
ATOM   2272 N  N     . GLY A 1 294 ? 41.438 -25.725 0.314   1.00 19.58  ? 291  GLY A N     1 
ATOM   2273 C  CA    . GLY A 1 294 ? 41.186 -25.688 -1.113  1.00 18.84  ? 291  GLY A CA    1 
ATOM   2274 C  C     . GLY A 1 294 ? 42.437 -25.973 -1.905  1.00 22.06  ? 291  GLY A C     1 
ATOM   2275 O  O     . GLY A 1 294 ? 43.548 -25.856 -1.384  1.00 19.07  ? 291  GLY A O     1 
ATOM   2276 N  N     . GLU A 1 295 ? 42.251 -26.335 -3.169  1.00 17.54  ? 292  GLU A N     1 
ATOM   2277 C  CA    . GLU A 1 295 ? 43.342 -26.709 -4.057  1.00 19.04  ? 292  GLU A CA    1 
ATOM   2278 C  C     . GLU A 1 295 ? 44.414 -25.619 -4.182  1.00 19.74  ? 292  GLU A C     1 
ATOM   2279 O  O     . GLU A 1 295 ? 45.598 -25.892 -3.992  1.00 18.73  ? 292  GLU A O     1 
ATOM   2280 C  CB    . GLU A 1 295 ? 42.784 -27.057 -5.444  1.00 19.74  ? 292  GLU A CB    1 
ATOM   2281 C  CG    . GLU A 1 295 ? 43.829 -27.532 -6.434  1.00 25.32  ? 292  GLU A CG    1 
ATOM   2282 C  CD    . GLU A 1 295 ? 43.235 -27.888 -7.783  1.00 48.92  ? 292  GLU A CD    1 
ATOM   2283 O  OE1   . GLU A 1 295 ? 44.008 -28.044 -8.753  1.00 60.95  ? 292  GLU A OE1   1 
ATOM   2284 O  OE2   . GLU A 1 295 ? 41.995 -28.019 -7.873  1.00 40.54  ? 292  GLU A OE2   1 
ATOM   2285 N  N     . LYS A 1 296 ? 43.995 -24.393 -4.491  1.00 18.28  ? 293  LYS A N     1 
ATOM   2286 C  CA    . LYS A 1 296 ? 44.937 -23.296 -4.697  1.00 17.16  ? 293  LYS A CA    1 
ATOM   2287 C  C     . LYS A 1 296 ? 45.614 -22.873 -3.393  1.00 15.43  ? 293  LYS A C     1 
ATOM   2288 O  O     . LYS A 1 296 ? 46.849 -22.777 -3.328  1.00 16.40  ? 293  LYS A O     1 
ATOM   2289 C  CB    . LYS A 1 296 ? 44.228 -22.093 -5.331  1.00 22.07  ? 293  LYS A CB    1 
ATOM   2290 C  CG    . LYS A 1 296 ? 43.669 -22.373 -6.718  1.00 25.59  ? 293  LYS A CG    1 
ATOM   2291 C  CD    . LYS A 1 296 ? 44.752 -22.899 -7.659  1.00 42.90  ? 293  LYS A CD    1 
ATOM   2292 C  CE    . LYS A 1 296 ? 44.307 -24.175 -8.359  1.00 44.30  ? 293  LYS A CE    1 
ATOM   2293 N  NZ    . LYS A 1 296 ? 45.044 -24.420 -9.629  1.00 52.39  ? 293  LYS A NZ    1 
ATOM   2294 N  N     . ASN A 1 297 ? 44.815 -22.627 -2.359  1.00 18.74  ? 294  ASN A N     1 
ATOM   2295 C  CA    . ASN A 1 297 ? 45.383 -22.218 -1.074  1.00 16.85  ? 294  ASN A CA    1 
ATOM   2296 C  C     . ASN A 1 297 ? 46.298 -23.281 -0.500  1.00 16.04  ? 294  ASN A C     1 
ATOM   2297 O  O     . ASN A 1 297 ? 47.317 -22.956 0.104   1.00 16.16  ? 294  ASN A O     1 
ATOM   2298 C  CB    . ASN A 1 297 ? 44.305 -21.926 -0.031  1.00 18.49  ? 294  ASN A CB    1 
ATOM   2299 C  CG    . ASN A 1 297 ? 43.566 -20.627 -0.275  1.00 21.54  ? 294  ASN A CG    1 
ATOM   2300 O  OD1   . ASN A 1 297 ? 44.101 -19.679 -0.849  1.00 21.03  ? 294  ASN A OD1   1 
ATOM   2301 N  ND2   . ASN A 1 297 ? 42.326 -20.576 0.194   1.00 22.46  ? 294  ASN A ND2   1 
ATOM   2302 N  N     . GLY A 1 298 ? 45.919 -24.552 -0.655  1.00 16.55  ? 295  GLY A N     1 
ATOM   2303 C  CA    . GLY A 1 298 ? 46.698 -25.644 -0.096  1.00 15.23  ? 295  GLY A CA    1 
ATOM   2304 C  C     . GLY A 1 298 ? 48.078 -25.755 -0.739  1.00 13.40  ? 295  GLY A C     1 
ATOM   2305 O  O     . GLY A 1 298 ? 49.092 -25.939 -0.049  1.00 14.73  ? 295  GLY A O     1 
ATOM   2306 N  N     . SER A 1 299 ? 48.122 -25.670 -2.069  1.00 14.16  ? 296  SER A N     1 
ATOM   2307 C  CA    . SER A 1 299 ? 49.385 -25.698 -2.794  1.00 14.59  ? 296  SER A CA    1 
ATOM   2308 C  C     . SER A 1 299 ? 50.214 -24.469 -2.441  1.00 14.13  ? 296  SER A C     1 
ATOM   2309 O  O     . SER A 1 299 ? 51.426 -24.562 -2.251  1.00 15.40  ? 296  SER A O     1 
ATOM   2310 C  CB    . SER A 1 299 ? 49.148 -25.764 -4.309  1.00 20.37  ? 296  SER A CB    1 
ATOM   2311 O  OG    . SER A 1 299 ? 48.725 -27.060 -4.715  1.00 17.72  ? 296  SER A OG    1 
ATOM   2312 N  N     . TRP A 1 300 ? 49.555 -23.321 -2.337  1.00 12.66  ? 297  TRP A N     1 
ATOM   2313 C  CA    . TRP A 1 300 ? 50.248 -22.075 -2.020  1.00 12.23  ? 297  TRP A CA    1 
ATOM   2314 C  C     . TRP A 1 300 ? 50.881 -22.157 -0.644  1.00 15.18  ? 297  TRP A C     1 
ATOM   2315 O  O     . TRP A 1 300 ? 52.062 -21.823 -0.495  1.00 14.17  ? 297  TRP A O     1 
ATOM   2316 C  CB    . TRP A 1 300 ? 49.293 -20.883 -2.100  1.00 12.53  ? 297  TRP A CB    1 
ATOM   2317 C  CG    . TRP A 1 300 ? 49.961 -19.549 -1.879  1.00 14.86  ? 297  TRP A CG    1 
ATOM   2318 C  CD1   . TRP A 1 300 ? 50.562 -18.766 -2.826  1.00 21.97  ? 297  TRP A CD1   1 
ATOM   2319 C  CD2   . TRP A 1 300 ? 50.053 -18.819 -0.641  1.00 14.04  ? 297  TRP A CD2   1 
ATOM   2320 N  NE1   . TRP A 1 300 ? 51.041 -17.611 -2.252  1.00 23.25  ? 297  TRP A NE1   1 
ATOM   2321 C  CE2   . TRP A 1 300 ? 50.734 -17.616 -0.915  1.00 17.12  ? 297  TRP A CE2   1 
ATOM   2322 C  CE3   . TRP A 1 300 ? 49.626 -19.068 0.666   1.00 17.39  ? 297  TRP A CE3   1 
ATOM   2323 C  CZ2   . TRP A 1 300 ? 51.006 -16.666 0.077   1.00 17.73  ? 297  TRP A CZ2   1 
ATOM   2324 C  CZ3   . TRP A 1 300 ? 49.894 -18.125 1.643   1.00 18.74  ? 297  TRP A CZ3   1 
ATOM   2325 C  CH2   . TRP A 1 300 ? 50.584 -16.946 1.344   1.00 16.74  ? 297  TRP A CH2   1 
ATOM   2326 N  N     . LEU A 1 301 ? 50.123 -22.634 0.347   1.00 13.08  ? 298  LEU A N     1 
ATOM   2327 C  CA    . LEU A 1 301 ? 50.665 -22.777 1.710   1.00 15.17  ? 298  LEU A CA    1 
ATOM   2328 C  C     . LEU A 1 301 ? 51.806 -23.784 1.791   1.00 14.17  ? 298  LEU A C     1 
ATOM   2329 O  O     . LEU A 1 301 ? 52.792 -23.558 2.503   1.00 12.03  ? 298  LEU A O     1 
ATOM   2330 C  CB    . LEU A 1 301 ? 49.565 -23.192 2.693   1.00 10.42  ? 298  LEU A CB    1 
ATOM   2331 C  CG    . LEU A 1 301 ? 48.499 -22.127 2.996   1.00 12.97  ? 298  LEU A CG    1 
ATOM   2332 C  CD1   . LEU A 1 301 ? 47.279 -22.748 3.638   1.00 15.63  ? 298  LEU A CD1   1 
ATOM   2333 C  CD2   . LEU A 1 301 ? 49.070 -21.025 3.893   1.00 16.58  ? 298  LEU A CD2   1 
ATOM   2334 N  N     . TYR A 1 302 ? 51.672 -24.895 1.074   1.00 12.33  ? 299  TYR A N     1 
ATOM   2335 C  CA    . TYR A 1 302 ? 52.699 -25.937 1.072   1.00 13.53  ? 299  TYR A CA    1 
ATOM   2336 C  C     . TYR A 1 302 ? 54.048 -25.387 0.599   1.00 15.01  ? 299  TYR A C     1 
ATOM   2337 O  O     . TYR A 1 302 ? 55.104 -25.650 1.203   1.00 13.77  ? 299  TYR A O     1 
ATOM   2338 C  CB    . TYR A 1 302 ? 52.260 -27.107 0.181   1.00 12.13  ? 299  TYR A CB    1 
ATOM   2339 C  CG    . TYR A 1 302 ? 53.255 -28.233 0.191   1.00 15.23  ? 299  TYR A CG    1 
ATOM   2340 C  CD1   . TYR A 1 302 ? 53.214 -29.198 1.183   1.00 16.68  ? 299  TYR A CD1   1 
ATOM   2341 C  CD2   . TYR A 1 302 ? 54.266 -28.302 -0.760  1.00 16.89  ? 299  TYR A CD2   1 
ATOM   2342 C  CE1   . TYR A 1 302 ? 54.139 -30.232 1.216   1.00 17.93  ? 299  TYR A CE1   1 
ATOM   2343 C  CE2   . TYR A 1 302 ? 55.200 -29.320 -0.732  1.00 24.73  ? 299  TYR A CE2   1 
ATOM   2344 C  CZ    . TYR A 1 302 ? 55.131 -30.281 0.258   1.00 21.13  ? 299  TYR A CZ    1 
ATOM   2345 O  OH    . TYR A 1 302 ? 56.058 -31.298 0.285   1.00 31.85  ? 299  TYR A OH    1 
ATOM   2346 N  N     . ALA A 1 303 ? 54.014 -24.622 -0.484  1.00 14.31  ? 300  ALA A N     1 
ATOM   2347 C  CA    . ALA A 1 303 ? 55.227 -23.987 -0.987  1.00 12.64  ? 300  ALA A CA    1 
ATOM   2348 C  C     . ALA A 1 303 ? 55.650 -22.799 -0.110  1.00 12.13  ? 300  ALA A C     1 
ATOM   2349 O  O     . ALA A 1 303 ? 56.842 -22.647 0.186   1.00 13.24  ? 300  ALA A O     1 
ATOM   2350 C  CB    . ALA A 1 303 ? 55.025 -23.526 -2.447  1.00 15.72  ? 300  ALA A CB    1 
ATOM   2351 N  N     . MET A 1 304 ? 54.692 -21.957 0.293   1.00 11.17  ? 301  MET A N     1 
ATOM   2352 C  CA    . MET A 1 304 ? 55.028 -20.732 1.029   1.00 10.13  ? 301  MET A CA    1 
ATOM   2353 C  C     . MET A 1 304 ? 55.738 -21.007 2.344   1.00 12.13  ? 301  MET A C     1 
ATOM   2354 O  O     . MET A 1 304 ? 56.666 -20.282 2.707   1.00 11.77  ? 301  MET A O     1 
ATOM   2355 C  CB    . MET A 1 304 ? 53.781 -19.890 1.320   1.00 12.95  ? 301  MET A CB    1 
ATOM   2356 C  CG    . MET A 1 304 ? 54.112 -18.458 1.786   1.00 18.39  ? 301  MET A CG    1 
ATOM   2357 S  SD    . MET A 1 304 ? 54.898 -17.525 0.461   1.00 17.02  ? 301  MET A SD    1 
ATOM   2358 C  CE    . MET A 1 304 ? 56.597 -17.425 1.065   1.00 13.83  ? 301  MET A CE    1 
ATOM   2359 N  N     . CYS A 1 305 ? 55.320 -22.048 3.064   1.00 12.22  ? 302  CYS A N     1 
ATOM   2360 C  CA    . CYS A 1 305 ? 55.949 -22.301 4.360   1.00 15.21  ? 302  CYS A CA    1 
ATOM   2361 C  C     . CYS A 1 305 ? 57.394 -22.800 4.195   1.00 14.60  ? 302  CYS A C     1 
ATOM   2362 O  O     . CYS A 1 305 ? 58.155 -22.811 5.162   1.00 15.17  ? 302  CYS A O     1 
ATOM   2363 C  CB    . CYS A 1 305 ? 55.136 -23.293 5.187   1.00 13.49  ? 302  CYS A CB    1 
ATOM   2364 S  SG    . CYS A 1 305 ? 55.171 -24.999 4.590   1.00 12.39  ? 302  CYS A SG    1 
ATOM   2365 N  N     . ARG A 1 306 ? 57.770 -23.151 2.968   1.00 10.37  ? 303  ARG A N     1 
ATOM   2366 C  CA    . ARG A 1 306 ? 59.151 -23.511 2.641   1.00 10.43  ? 303  ARG A CA    1 
ATOM   2367 C  C     . ARG A 1 306 ? 59.900 -22.339 1.964   1.00 12.81  ? 303  ARG A C     1 
ATOM   2368 O  O     . ARG A 1 306 ? 61.052 -22.491 1.543   1.00 16.50  ? 303  ARG A O     1 
ATOM   2369 C  CB    . ARG A 1 306 ? 59.182 -24.765 1.750   1.00 12.42  ? 303  ARG A CB    1 
ATOM   2370 C  CG    . ARG A 1 306 ? 58.697 -26.017 2.464   1.00 13.20  ? 303  ARG A CG    1 
ATOM   2371 C  CD    . ARG A 1 306 ? 58.323 -27.146 1.517   1.00 16.17  ? 303  ARG A CD    1 
ATOM   2372 N  NE    . ARG A 1 306 ? 58.096 -28.381 2.267   1.00 17.52  ? 303  ARG A NE    1 
ATOM   2373 C  CZ    . ARG A 1 306 ? 56.993 -28.658 2.958   1.00 15.97  ? 303  ARG A CZ    1 
ATOM   2374 N  NH1   . ARG A 1 306 ? 56.899 -29.815 3.612   1.00 17.87  ? 303  ARG A NH1   1 
ATOM   2375 N  NH2   . ARG A 1 306 ? 55.977 -27.796 2.990   1.00 13.12  ? 303  ARG A NH2   1 
ATOM   2376 N  N     . GLY A 1 307 ? 59.259 -21.174 1.878   1.00 11.48  ? 304  GLY A N     1 
ATOM   2377 C  CA    . GLY A 1 307 ? 59.898 -19.979 1.350   1.00 12.46  ? 304  GLY A CA    1 
ATOM   2378 C  C     . GLY A 1 307 ? 59.699 -19.816 -0.146  1.00 12.01  ? 304  GLY A C     1 
ATOM   2379 O  O     . GLY A 1 307 ? 60.365 -18.996 -0.792  1.00 12.95  ? 304  GLY A O     1 
ATOM   2380 N  N     . ILE A 1 308 ? 58.776 -20.589 -0.698  1.00 12.66  ? 305  ILE A N     1 
ATOM   2381 C  CA    . ILE A 1 308 ? 58.614 -20.677 -2.149  1.00 10.10  ? 305  ILE A CA    1 
ATOM   2382 C  C     . ILE A 1 308 ? 57.260 -20.138 -2.583  1.00 14.71  ? 305  ILE A C     1 
ATOM   2383 O  O     . ILE A 1 308 ? 56.227 -20.532 -2.067  1.00 13.60  ? 305  ILE A O     1 
ATOM   2384 C  CB    . ILE A 1 308 ? 58.773 -22.136 -2.633  1.00 18.60  ? 305  ILE A CB    1 
ATOM   2385 C  CG1   . ILE A 1 308 ? 60.187 -22.613 -2.313  1.00 19.10  ? 305  ILE A CG1   1 
ATOM   2386 C  CG2   . ILE A 1 308 ? 58.454 -22.246 -4.119  1.00 15.84  ? 305  ILE A CG2   1 
ATOM   2387 C  CD1   . ILE A 1 308 ? 60.423 -24.081 -2.569  1.00 22.03  ? 305  ILE A CD1   1 
ATOM   2388 N  N     . GLU A 1 309 ? 57.278 -19.237 -3.555  1.00 11.93  ? 306  GLU A N     1 
ATOM   2389 C  CA    . GLU A 1 309 ? 56.046 -18.670 -4.088  1.00 17.89  ? 306  GLU A CA    1 
ATOM   2390 C  C     . GLU A 1 309 ? 56.300 -18.196 -5.513  1.00 18.81  ? 306  GLU A C     1 
ATOM   2391 O  O     . GLU A 1 309 ? 57.382 -17.690 -5.809  1.00 20.02  ? 306  GLU A O     1 
ATOM   2392 C  CB    . GLU A 1 309 ? 55.559 -17.513 -3.222  1.00 25.80  ? 306  GLU A CB    1 
ATOM   2393 C  CG    . GLU A 1 309 ? 54.182 -17.056 -3.595  1.00 30.84  ? 306  GLU A CG    1 
ATOM   2394 C  CD    . GLU A 1 309 ? 53.975 -15.569 -3.449  1.00 26.96  ? 306  GLU A CD    1 
ATOM   2395 O  OE1   . GLU A 1 309 ? 54.966 -14.791 -3.421  1.00 19.67  ? 306  GLU A OE1   1 
ATOM   2396 O  OE2   . GLU A 1 309 ? 52.793 -15.180 -3.361  1.00 35.22  ? 306  GLU A OE2   1 
ATOM   2397 N  N     . HIS A 1 310 ? 55.316 -18.344 -6.396  1.00 23.52  ? 307  HIS A N     1 
ATOM   2398 C  CA    . HIS A 1 310 ? 55.580 -18.110 -7.812  1.00 24.16  ? 307  HIS A CA    1 
ATOM   2399 C  C     . HIS A 1 310 ? 54.861 -16.896 -8.411  1.00 21.64  ? 307  HIS A C     1 
ATOM   2400 O  O     . HIS A 1 310 ? 55.082 -16.575 -9.575  1.00 22.19  ? 307  HIS A O     1 
ATOM   2401 C  CB    . HIS A 1 310 ? 55.233 -19.370 -8.602  1.00 29.97  ? 307  HIS A CB    1 
ATOM   2402 C  CG    . HIS A 1 310 ? 56.131 -20.528 -8.295  1.00 41.17  ? 307  HIS A CG    1 
ATOM   2403 N  ND1   . HIS A 1 310 ? 57.468 -20.374 -7.993  1.00 38.31  ? 307  HIS A ND1   1 
ATOM   2404 C  CD2   . HIS A 1 310 ? 55.882 -21.859 -8.213  1.00 42.64  ? 307  HIS A CD2   1 
ATOM   2405 C  CE1   . HIS A 1 310 ? 58.007 -21.556 -7.756  1.00 38.20  ? 307  HIS A CE1   1 
ATOM   2406 N  NE2   . HIS A 1 310 ? 57.062 -22.474 -7.881  1.00 36.89  ? 307  HIS A NE2   1 
ATOM   2407 N  N     . ASP A 1 311 ? 54.050 -16.206 -7.609  1.00 16.03  ? 308  ASP A N     1 
ATOM   2408 C  CA    . ASP A 1 311 ? 53.247 -15.077 -8.094  1.00 18.08  ? 308  ASP A CA    1 
ATOM   2409 C  C     . ASP A 1 311 ? 54.140 -14.051 -8.790  1.00 20.24  ? 308  ASP A C     1 
ATOM   2410 O  O     . ASP A 1 311 ? 55.052 -13.511 -8.173  1.00 16.27  ? 308  ASP A O     1 
ATOM   2411 C  CB    . ASP A 1 311 ? 52.493 -14.433 -6.932  1.00 23.73  ? 308  ASP A CB    1 
ATOM   2412 C  CG    . ASP A 1 311 ? 51.596 -13.289 -7.370  1.00 28.05  ? 308  ASP A CG    1 
ATOM   2413 O  OD1   . ASP A 1 311 ? 51.510 -12.291 -6.633  1.00 34.70  ? 308  ASP A OD1   1 
ATOM   2414 O  OD2   . ASP A 1 311 ? 50.962 -13.393 -8.439  1.00 32.98  ? 308  ASP A OD2   1 
ATOM   2415 N  N     . PRO A 1 312 ? 53.906 -13.802 -10.090 1.00 15.81  ? 309  PRO A N     1 
ATOM   2416 C  CA    . PRO A 1 312 ? 54.815 -12.909 -10.815 1.00 15.66  ? 309  PRO A CA    1 
ATOM   2417 C  C     . PRO A 1 312 ? 54.658 -11.438 -10.463 1.00 15.10  ? 309  PRO A C     1 
ATOM   2418 O  O     . PRO A 1 312 ? 53.583 -11.004 -10.047 1.00 17.08  ? 309  PRO A O     1 
ATOM   2419 C  CB    . PRO A 1 312 ? 54.436 -13.142 -12.284 1.00 19.38  ? 309  PRO A CB    1 
ATOM   2420 C  CG    . PRO A 1 312 ? 53.024 -13.585 -12.229 1.00 19.00  ? 309  PRO A CG    1 
ATOM   2421 C  CD    . PRO A 1 312 ? 52.964 -14.472 -11.004 1.00 20.72  ? 309  PRO A CD    1 
ATOM   2422 N  N     . VAL A 1 313 ? 55.701 -10.665 -10.682 1.00 16.10  ? 310  VAL A N     1 
ATOM   2423 C  CA    . VAL A 1 313 ? 55.607 -9.254  -10.560 1.00 14.26  ? 310  VAL A CA    1 
ATOM   2424 C  C     . VAL A 1 313 ? 54.918 -8.821  -11.838 1.00 17.11  ? 310  VAL A C     1 
ATOM   2425 O  O     . VAL A 1 313 ? 55.450 -8.970  -12.857 1.00 19.32  ? 310  VAL A O     1 
ATOM   2426 C  CB    . VAL A 1 313 ? 56.999 -8.599  -10.511 1.00 14.84  ? 310  VAL A CB    1 
ATOM   2427 C  CG1   . VAL A 1 313 ? 56.893 -7.103  -10.431 1.00 16.14  ? 310  VAL A CG1   1 
ATOM   2428 C  CG2   . VAL A 1 313 ? 57.774 -9.043  -9.294  1.00 16.19  ? 310  VAL A CG2   1 
ATOM   2429 N  N     . LYS A 1 314 ? 53.713 -8.326  -11.718 1.00 15.64  ? 311  LYS A N     1 
ATOM   2430 C  CA    . LYS A 1 314 ? 52.970 -7.854  -12.853 1.00 18.51  ? 311  LYS A CA    1 
ATOM   2431 C  C     . LYS A 1 314 ? 53.429 -6.529  -13.341 1.00 17.84  ? 311  LYS A C     1 
ATOM   2432 O  O     . LYS A 1 314 ? 53.593 -5.609  -12.637 1.00 19.21  ? 311  LYS A O     1 
ATOM   2433 C  CB    . LYS A 1 314 ? 51.516 -7.712  -12.525 1.00 20.61  ? 311  LYS A CB    1 
ATOM   2434 C  CG    . LYS A 1 314 ? 50.839 -8.995  -12.101 1.00 26.50  ? 311  LYS A CG    1 
ATOM   2435 C  CD    . LYS A 1 314 ? 49.355 -8.769  -11.886 1.00 29.21  ? 311  LYS A CD    1 
ATOM   2436 C  CE    . LYS A 1 314 ? 48.615 -9.982  -11.343 1.00 37.94  ? 311  LYS A CE    1 
ATOM   2437 N  NZ    . LYS A 1 314 ? 47.251 -10.079 -11.919 1.00 46.20  ? 311  LYS A NZ    1 
ATOM   2438 N  N     . PRO A 1 315 ? 53.527 -6.516  -14.724 1.00 15.38  ? 312  PRO A N     1 
ATOM   2439 C  CA    . PRO A 1 315 ? 53.910 -5.231  -15.281 1.00 16.44  ? 312  PRO A CA    1 
ATOM   2440 C  C     . PRO A 1 315 ? 52.704 -4.296  -15.351 1.00 21.77  ? 312  PRO A C     1 
ATOM   2441 O  O     . PRO A 1 315 ? 52.059 -4.184  -16.337 1.00 20.83  ? 312  PRO A O     1 
ATOM   2442 C  CB    . PRO A 1 315 ? 54.377 -5.590  -16.680 1.00 25.22  ? 312  PRO A CB    1 
ATOM   2443 C  CG    . PRO A 1 315 ? 53.475 -6.668  -17.097 1.00 19.46  ? 312  PRO A CG    1 
ATOM   2444 C  CD    . PRO A 1 315 ? 53.461 -7.529  -15.907 1.00 17.30  ? 312  PRO A CD    1 
ATOM   2445 N  N     . ARG A 1 316 ? 52.409 -3.673  -14.220 1.00 16.51  ? 313  ARG A N     1 
ATOM   2446 C  CA    . ARG A 1 316 ? 51.318 -2.689  -14.120 1.00 19.22  ? 313  ARG A CA    1 
ATOM   2447 C  C     . ARG A 1 316 ? 51.671 -1.571  -13.149 1.00 21.10  ? 313  ARG A C     1 
ATOM   2448 O  O     . ARG A 1 316 ? 51.720 -1.780  -11.995 1.00 19.67  ? 313  ARG A O     1 
ATOM   2449 C  CB    . ARG A 1 316 ? 50.062 -3.373  -13.636 1.00 20.16  ? 313  ARG A CB    1 
ATOM   2450 C  CG    A ARG A 1 316 ? 48.852 -2.512  -13.437 0.57 20.80  ? 313  ARG A CG    1 
ATOM   2451 C  CG    B ARG A 1 316 ? 48.815 -2.540  -13.657 0.43 20.74  ? 313  ARG A CG    1 
ATOM   2452 C  CD    A ARG A 1 316 ? 47.682 -3.239  -12.768 0.57 23.92  ? 313  ARG A CD    1 
ATOM   2453 C  CD    B ARG A 1 316 ? 47.638 -3.190  -12.947 0.43 23.77  ? 313  ARG A CD    1 
ATOM   2454 N  NE    A ARG A 1 316 ? 48.025 -3.747  -11.440 0.57 24.97  ? 313  ARG A NE    1 
ATOM   2455 N  NE    B ARG A 1 316 ? 47.998 -3.628  -11.602 0.43 24.73  ? 313  ARG A NE    1 
ATOM   2456 C  CZ    A ARG A 1 316 ? 48.154 -5.036  -11.138 0.57 27.99  ? 313  ARG A CZ    1 
ATOM   2457 C  CZ    B ARG A 1 316 ? 48.047 -2.833  -10.537 0.43 22.38  ? 313  ARG A CZ    1 
ATOM   2458 N  NH1   A ARG A 1 316 ? 48.473 -5.405  -9.902  0.57 29.78  ? 313  ARG A NH1   1 
ATOM   2459 N  NH1   B ARG A 1 316 ? 48.389 -3.334  -9.359  0.43 22.71  ? 313  ARG A NH1   1 
ATOM   2460 N  NH2   A ARG A 1 316 ? 47.962 -5.959  -12.070 0.57 27.47  ? 313  ARG A NH2   1 
ATOM   2461 N  NH2   B ARG A 1 316 ? 47.753 -1.538  -10.645 0.43 22.79  ? 313  ARG A NH2   1 
ATOM   2462 N  N     . GLN A 1 317 ? 51.894 -0.382  -13.668 1.00 20.59  ? 314  GLN A N     1 
ATOM   2463 C  CA    . GLN A 1 317 ? 52.347 0.756   -12.878 1.00 21.17  ? 314  GLN A CA    1 
ATOM   2464 C  C     . GLN A 1 317 ? 51.176 1.675   -12.516 1.00 21.19  ? 314  GLN A C     1 
ATOM   2465 O  O     . GLN A 1 317 ? 51.246 2.466   -11.572 1.00 27.38  ? 314  GLN A O     1 
ATOM   2466 C  CB    . GLN A 1 317 ? 53.415 1.515   -13.665 1.00 32.04  ? 314  GLN A CB    1 
ATOM   2467 C  CG    . GLN A 1 317 ? 53.946 2.757   -13.019 1.00 35.77  ? 314  GLN A CG    1 
ATOM   2468 C  CD    . GLN A 1 317 ? 54.967 3.441   -13.894 1.00 32.42  ? 314  GLN A CD    1 
ATOM   2469 O  OE1   . GLN A 1 317 ? 55.368 2.906   -14.931 1.00 36.33  ? 314  GLN A OE1   1 
ATOM   2470 N  NE2   . GLN A 1 317 ? 55.395 4.630   -13.487 1.00 27.50  ? 314  GLN A NE2   1 
ATOM   2471 N  N     . LEU A 1 318 ? 50.089 1.550   -13.265 1.00 17.60  ? 315  LEU A N     1 
ATOM   2472 C  CA    . LEU A 1 318 ? 48.916 2.392   -13.060 1.00 18.65  ? 315  LEU A CA    1 
ATOM   2473 C  C     . LEU A 1 318 ? 47.769 1.626   -12.408 1.00 16.40  ? 315  LEU A C     1 
ATOM   2474 O  O     . LEU A 1 318 ? 47.566 0.452   -12.700 1.00 19.14  ? 315  LEU A O     1 
ATOM   2475 C  CB    . LEU A 1 318 ? 48.435 2.959   -14.397 1.00 20.41  ? 315  LEU A CB    1 
ATOM   2476 C  CG    . LEU A 1 318 ? 49.447 3.661   -15.298 1.00 20.75  ? 315  LEU A CG    1 
ATOM   2477 C  CD1   . LEU A 1 318 ? 48.817 3.931   -16.664 1.00 19.49  ? 315  LEU A CD1   1 
ATOM   2478 C  CD2   . LEU A 1 318 ? 49.903 4.958   -14.638 1.00 24.02  ? 315  LEU A CD2   1 
ATOM   2479 N  N     . PRO A 1 319 ? 46.999 2.294   -11.533 1.00 15.68  ? 316  PRO A N     1 
ATOM   2480 C  CA    . PRO A 1 319 ? 45.793 1.621   -11.026 1.00 15.07  ? 316  PRO A CA    1 
ATOM   2481 C  C     . PRO A 1 319 ? 44.835 1.271   -12.169 1.00 18.80  ? 316  PRO A C     1 
ATOM   2482 O  O     . PRO A 1 319 ? 44.808 1.987   -13.166 1.00 24.13  ? 316  PRO A O     1 
ATOM   2483 C  CB    . PRO A 1 319 ? 45.184 2.646   -10.060 1.00 20.77  ? 316  PRO A CB    1 
ATOM   2484 C  CG    . PRO A 1 319 ? 45.914 3.934   -10.302 1.00 28.00  ? 316  PRO A CG    1 
ATOM   2485 C  CD    . PRO A 1 319 ? 47.238 3.602   -10.900 1.00 20.68  ? 316  PRO A CD    1 
ATOM   2486 N  N     . LYS A 1 320 ? 44.090 0.174   -12.043 1.00 21.08  ? 317  LYS A N     1 
ATOM   2487 C  CA    . LYS A 1 320 ? 43.181 -0.235  -13.118 1.00 16.69  ? 317  LYS A CA    1 
ATOM   2488 C  C     . LYS A 1 320 ? 41.724 0.137   -12.817 1.00 24.10  ? 317  LYS A C     1 
ATOM   2489 O  O     . LYS A 1 320 ? 40.810 -0.210  -13.562 1.00 22.75  ? 317  LYS A O     1 
ATOM   2490 C  CB    . LYS A 1 320 ? 43.299 -1.738  -13.385 1.00 28.62  ? 317  LYS A CB    1 
ATOM   2491 C  CG    . LYS A 1 320 ? 43.094 -2.623  -12.174 1.00 30.09  ? 317  LYS A CG    1 
ATOM   2492 C  CD    . LYS A 1 320 ? 42.905 -4.090  -12.582 1.00 36.24  ? 317  LYS A CD    1 
ATOM   2493 C  CE    . LYS A 1 320 ? 44.140 -4.641  -13.265 1.00 37.88  ? 317  LYS A CE    1 
ATOM   2494 N  NZ    . LYS A 1 320 ? 44.072 -6.119  -13.460 1.00 39.56  ? 317  LYS A NZ    1 
ATOM   2495 N  N     . THR A 1 321 ? 41.514 0.841   -11.713 1.00 18.68  ? 318  THR A N     1 
ATOM   2496 C  CA    . THR A 1 321 ? 40.212 1.431   -11.424 1.00 19.91  ? 318  THR A CA    1 
ATOM   2497 C  C     . THR A 1 321 ? 40.444 2.804   -10.845 1.00 18.01  ? 318  THR A C     1 
ATOM   2498 O  O     . THR A 1 321 ? 41.479 3.067   -10.245 1.00 23.46  ? 318  THR A O     1 
ATOM   2499 C  CB    . THR A 1 321 ? 39.357 0.585   -10.431 1.00 20.44  ? 318  THR A CB    1 
ATOM   2500 O  OG1   . THR A 1 321 ? 40.070 0.423   -9.196  1.00 21.04  ? 318  THR A OG1   1 
ATOM   2501 C  CG2   . THR A 1 321 ? 38.995 -0.782  -11.007 1.00 19.71  ? 318  THR A CG2   1 
ATOM   2502 N  N     . ILE A 1 322 ? 39.481 3.693   -11.056 1.00 15.89  ? 319  ILE A N     1 
ATOM   2503 C  CA    . ILE A 1 322 ? 39.517 5.019   -10.465 1.00 17.40  ? 319  ILE A CA    1 
ATOM   2504 C  C     . ILE A 1 322 ? 38.176 5.246   -9.766  1.00 16.23  ? 319  ILE A C     1 
ATOM   2505 O  O     . ILE A 1 322 ? 37.136 5.235   -10.413 1.00 18.45  ? 319  ILE A O     1 
ATOM   2506 C  CB    . ILE A 1 322 ? 39.771 6.103   -11.534 1.00 19.15  ? 319  ILE A CB    1 
ATOM   2507 C  CG1   . ILE A 1 322 ? 41.142 5.883   -12.184 1.00 20.21  ? 319  ILE A CG1   1 
ATOM   2508 C  CG2   . ILE A 1 322 ? 39.670 7.497   -10.933 1.00 20.14  ? 319  ILE A CG2   1 
ATOM   2509 C  CD1   . ILE A 1 322 ? 41.494 6.949   -13.192 1.00 19.13  ? 319  ILE A CD1   1 
ATOM   2510 N  N     . GLY A 1 323 ? 38.210 5.401   -8.446  1.00 15.81  ? 320  GLY A N     1 
ATOM   2511 C  CA    . GLY A 1 323 ? 36.992 5.437   -7.650  1.00 14.76  ? 320  GLY A CA    1 
ATOM   2512 C  C     . GLY A 1 323 ? 36.940 6.580   -6.668  1.00 16.64  ? 320  GLY A C     1 
ATOM   2513 O  O     . GLY A 1 323 ? 37.973 7.115   -6.273  1.00 15.73  ? 320  GLY A O     1 
ATOM   2514 N  N     . CYS A 1 324 ? 35.713 6.947   -6.295  1.00 16.66  ? 321  CYS A N     1 
ATOM   2515 C  CA    . CYS A 1 324 ? 35.418 8.035   -5.369  1.00 16.39  ? 321  CYS A CA    1 
ATOM   2516 C  C     . CYS A 1 324 ? 34.419 7.503   -4.357  1.00 17.21  ? 321  CYS A C     1 
ATOM   2517 O  O     . CYS A 1 324 ? 33.391 6.959   -4.748  1.00 16.02  ? 321  CYS A O     1 
ATOM   2518 C  CB    . CYS A 1 324 ? 34.844 9.249   -6.112  1.00 17.72  ? 321  CYS A CB    1 
ATOM   2519 S  SG    A CYS A 1 324 ? 35.276 10.832  -5.440  0.30 21.85  ? 321  CYS A SG    1 
ATOM   2520 S  SG    B CYS A 1 324 ? 35.972 9.970   -7.293  0.70 21.65  ? 321  CYS A SG    1 
ATOM   2521 N  N     . SER A 1 325 ? 34.687 7.651   -3.069  1.00 14.61  ? 322  SER A N     1 
ATOM   2522 C  CA    A SER A 1 325 ? 33.734 7.143   -2.094  0.45 14.52  ? 322  SER A CA    1 
ATOM   2523 C  CA    B SER A 1 325 ? 33.857 7.046   -2.025  0.55 14.51  ? 322  SER A CA    1 
ATOM   2524 C  C     . SER A 1 325 ? 33.650 8.001   -0.841  1.00 16.60  ? 322  SER A C     1 
ATOM   2525 O  O     . SER A 1 325 ? 34.588 8.699   -0.453  1.00 18.95  ? 322  SER A O     1 
ATOM   2526 C  CB    A SER A 1 325 ? 34.069 5.701   -1.710  0.45 16.38  ? 322  SER A CB    1 
ATOM   2527 C  CB    B SER A 1 325 ? 34.515 5.739   -1.550  0.55 15.42  ? 322  SER A CB    1 
ATOM   2528 O  OG    A SER A 1 325 ? 35.247 5.626   -0.938  0.45 16.53  ? 322  SER A OG    1 
ATOM   2529 O  OG    B SER A 1 325 ? 33.939 5.214   -0.361  0.55 17.34  ? 322  SER A OG    1 
ATOM   2530 N  N     . LYS A 1 326 ? 32.463 7.992   -0.238  1.00 17.66  ? 323  LYS A N     1 
ATOM   2531 C  CA    . LYS A 1 326 ? 32.259 8.735   0.998   1.00 13.76  ? 323  LYS A CA    1 
ATOM   2532 C  C     . LYS A 1 326 ? 31.257 8.053   1.914   1.00 16.85  ? 323  LYS A C     1 
ATOM   2533 O  O     . LYS A 1 326 ? 30.178 7.655   1.474   1.00 15.47  ? 323  LYS A O     1 
ATOM   2534 C  CB    . LYS A 1 326 ? 31.792 10.163  0.714   1.00 14.20  ? 323  LYS A CB    1 
ATOM   2535 C  CG    . LYS A 1 326 ? 31.760 11.008  1.988   1.00 18.36  ? 323  LYS A CG    1 
ATOM   2536 C  CD    . LYS A 1 326 ? 31.631 12.488  1.678   1.00 24.85  ? 323  LYS A CD    1 
ATOM   2537 C  CE    . LYS A 1 326 ? 31.336 13.277  2.940   1.00 26.65  ? 323  LYS A CE    1 
ATOM   2538 N  NZ    . LYS A 1 326 ? 31.814 12.564  4.146   1.00 34.06  ? 323  LYS A NZ    1 
ATOM   2539 N  N     . ASN A 1 327 ? 31.631 7.936   3.185   1.00 15.72  ? 324  ASN A N     1 
ATOM   2540 C  CA    . ASN A 1 327 ? 30.741 7.495   4.249   1.00 18.55  ? 324  ASN A CA    1 
ATOM   2541 C  C     . ASN A 1 327 ? 29.895 8.639   4.781   1.00 18.37  ? 324  ASN A C     1 
ATOM   2542 O  O     . ASN A 1 327 ? 30.322 9.789   4.795   1.00 17.50  ? 324  ASN A O     1 
ATOM   2543 C  CB    . ASN A 1 327 ? 31.523 6.907   5.424   1.00 20.51  ? 324  ASN A CB    1 
ATOM   2544 C  CG    . ASN A 1 327 ? 32.145 5.572   5.117   1.00 23.68  ? 324  ASN A CG    1 
ATOM   2545 O  OD1   . ASN A 1 327 ? 31.890 4.969   4.075   1.00 27.54  ? 324  ASN A OD1   1 
ATOM   2546 N  ND2   . ASN A 1 327 ? 32.961 5.086   6.048   1.00 26.39  ? 324  ASN A ND2   1 
ATOM   2547 N  N     . PHE A 1 328 ? 28.697 8.307   5.248   1.00 19.88  ? 325  PHE A N     1 
ATOM   2548 C  CA    . PHE A 1 328 ? 27.837 9.281   5.893   1.00 20.99  ? 325  PHE A CA    1 
ATOM   2549 C  C     . PHE A 1 328 ? 27.353 8.666   7.193   1.00 27.83  ? 325  PHE A C     1 
ATOM   2550 O  O     . PHE A 1 328 ? 26.246 8.126   7.260   1.00 30.47  ? 325  PHE A O     1 
ATOM   2551 C  CB    . PHE A 1 328 ? 26.677 9.664   4.973   1.00 22.83  ? 325  PHE A CB    1 
ATOM   2552 C  CG    . PHE A 1 328 ? 27.126 10.185  3.641   1.00 21.65  ? 325  PHE A CG    1 
ATOM   2553 C  CD1   . PHE A 1 328 ? 27.301 9.324   2.569   1.00 20.51  ? 325  PHE A CD1   1 
ATOM   2554 C  CD2   . PHE A 1 328 ? 27.408 11.527  3.467   1.00 20.71  ? 325  PHE A CD2   1 
ATOM   2555 C  CE1   . PHE A 1 328 ? 27.728 9.798   1.349   1.00 14.92  ? 325  PHE A CE1   1 
ATOM   2556 C  CE2   . PHE A 1 328 ? 27.819 12.012  2.238   1.00 20.67  ? 325  PHE A CE2   1 
ATOM   2557 C  CZ    . PHE A 1 328 ? 27.987 11.145  1.182   1.00 21.30  ? 325  PHE A CZ    1 
ATOM   2558 N  N     . PRO A 1 329 ? 28.206 8.720   8.224   1.00 27.55  ? 326  PRO A N     1 
ATOM   2559 C  CA    . PRO A 1 329 ? 28.018 7.994   9.483   1.00 32.02  ? 326  PRO A CA    1 
ATOM   2560 C  C     . PRO A 1 329 ? 26.997 8.643   10.397  1.00 36.95  ? 326  PRO A C     1 
ATOM   2561 O  O     . PRO A 1 329 ? 26.633 9.801   10.182  1.00 31.61  ? 326  PRO A O     1 
ATOM   2562 C  CB    . PRO A 1 329 ? 29.406 8.042   10.117  1.00 36.64  ? 326  PRO A CB    1 
ATOM   2563 C  CG    . PRO A 1 329 ? 29.981 9.325   9.615   1.00 34.81  ? 326  PRO A CG    1 
ATOM   2564 C  CD    . PRO A 1 329 ? 29.479 9.464   8.204   1.00 27.43  ? 326  PRO A CD    1 
ATOM   2565 N  N     . GLY A 1 330 ? 26.558 7.890   11.403  1.00 45.47  ? 327  GLY A N     1 
ATOM   2566 C  CA    . GLY A 1 330 ? 25.678 8.394   12.439  1.00 47.89  ? 327  GLY A CA    1 
ATOM   2567 C  C     . GLY A 1 330 ? 24.445 9.101   11.921  1.00 37.17  ? 327  GLY A C     1 
ATOM   2568 O  O     . GLY A 1 330 ? 23.638 8.519   11.200  1.00 42.75  ? 327  GLY A O     1 
ATOM   2569 N  N     . LYS A 1 331 ? 24.309 10.371  12.284  1.00 40.69  ? 328  LYS A N     1 
ATOM   2570 C  CA    . LYS A 1 331 ? 23.131 11.141  11.920  1.00 39.85  ? 328  LYS A CA    1 
ATOM   2571 C  C     . LYS A 1 331 ? 23.364 11.996  10.676  1.00 39.30  ? 328  LYS A C     1 
ATOM   2572 O  O     . LYS A 1 331 ? 22.568 12.885  10.368  1.00 42.68  ? 328  LYS A O     1 
ATOM   2573 C  CB    . LYS A 1 331 ? 22.694 12.019  13.096  1.00 53.91  ? 328  LYS A CB    1 
ATOM   2574 C  CG    . LYS A 1 331 ? 22.205 11.222  14.299  1.00 57.73  ? 328  LYS A CG    1 
ATOM   2575 C  CD    . LYS A 1 331 ? 21.601 12.117  15.369  1.00 66.23  ? 328  LYS A CD    1 
ATOM   2576 C  CE    . LYS A 1 331 ? 20.296 12.744  14.902  1.00 67.20  ? 328  LYS A CE    1 
ATOM   2577 N  NZ    . LYS A 1 331 ? 19.206 11.739  14.778  1.00 71.94  ? 328  LYS A NZ    1 
ATOM   2578 N  N     . THR A 1 332 ? 24.454 11.725  9.961   1.00 34.00  ? 329  THR A N     1 
ATOM   2579 C  CA    . THR A 1 332 ? 24.741 12.435  8.716   1.00 32.06  ? 329  THR A CA    1 
ATOM   2580 C  C     . THR A 1 332 ? 24.262 11.636  7.502   1.00 23.64  ? 329  THR A C     1 
ATOM   2581 O  O     . THR A 1 332 ? 24.403 12.088  6.362   1.00 27.49  ? 329  THR A O     1 
ATOM   2582 C  CB    . THR A 1 332 ? 26.246 12.722  8.544   1.00 28.94  ? 329  THR A CB    1 
ATOM   2583 O  OG1   . THR A 1 332 ? 26.946 11.493  8.309   1.00 29.84  ? 329  THR A OG1   1 
ATOM   2584 C  CG2   . THR A 1 332 ? 26.810 13.393  9.786   1.00 29.96  ? 329  THR A CG2   1 
ATOM   2585 N  N     . ALA A 1 333 ? 23.710 10.452  7.759   1.00 25.92  ? 330  ALA A N     1 
ATOM   2586 C  CA    . ALA A 1 333 ? 23.181 9.589   6.702   1.00 26.35  ? 330  ALA A CA    1 
ATOM   2587 C  C     . ALA A 1 333 ? 22.162 10.315  5.821   1.00 31.28  ? 330  ALA A C     1 
ATOM   2588 O  O     . ALA A 1 333 ? 21.368 11.125  6.308   1.00 34.04  ? 330  ALA A O     1 
ATOM   2589 C  CB    . ALA A 1 333 ? 22.563 8.339   7.312   1.00 28.13  ? 330  ALA A CB    1 
ATOM   2590 N  N     . LEU A 1 334 ? 22.188 10.021  4.524   1.00 20.68  ? 331  LEU A N     1 
ATOM   2591 C  CA    . LEU A 1 334 ? 21.376 10.746  3.553   1.00 27.14  ? 331  LEU A CA    1 
ATOM   2592 C  C     . LEU A 1 334 ? 19.932 10.243  3.554   1.00 29.54  ? 331  LEU A C     1 
ATOM   2593 O  O     . LEU A 1 334 ? 19.674 9.059   3.350   1.00 27.65  ? 331  LEU A O     1 
ATOM   2594 C  CB    . LEU A 1 334 ? 21.985 10.626  2.155   1.00 24.77  ? 331  LEU A CB    1 
ATOM   2595 C  CG    . LEU A 1 334 ? 23.499 10.837  2.101   1.00 25.37  ? 331  LEU A CG    1 
ATOM   2596 C  CD1   . LEU A 1 334 ? 23.977 10.755  0.661   1.00 22.49  ? 331  LEU A CD1   1 
ATOM   2597 C  CD2   . LEU A 1 334 ? 23.877 12.174  2.736   1.00 20.99  ? 331  LEU A CD2   1 
ATOM   2598 N  N     . ALA A 1 335 ? 18.990 11.151  3.781   1.00 29.40  ? 332  ALA A N     1 
ATOM   2599 C  CA    . ALA A 1 335 ? 17.607 10.736  4.000   1.00 28.07  ? 332  ALA A CA    1 
ATOM   2600 C  C     . ALA A 1 335 ? 16.630 11.426  3.053   1.00 32.72  ? 332  ALA A C     1 
ATOM   2601 O  O     . ALA A 1 335 ? 15.417 11.234  3.153   1.00 33.41  ? 332  ALA A O     1 
ATOM   2602 C  CB    . ALA A 1 335 ? 17.220 10.995  5.440   1.00 29.99  ? 332  ALA A CB    1 
ATOM   2603 N  N     . THR A 1 336 ? 17.159 12.240  2.145   1.00 24.60  ? 333  THR A N     1 
ATOM   2604 C  CA    . THR A 1 336 ? 16.344 12.888  1.125   1.00 32.20  ? 333  THR A CA    1 
ATOM   2605 C  C     . THR A 1 336 ? 16.920 12.689  -0.268  1.00 39.50  ? 333  THR A C     1 
ATOM   2606 O  O     . THR A 1 336 ? 18.118 12.447  -0.431  1.00 32.60  ? 333  THR A O     1 
ATOM   2607 C  CB    . THR A 1 336 ? 16.192 14.405  1.369   1.00 37.67  ? 333  THR A CB    1 
ATOM   2608 O  OG1   . THR A 1 336 ? 17.403 15.088  1.004   1.00 25.93  ? 333  THR A OG1   1 
ATOM   2609 C  CG2   . THR A 1 336 ? 15.845 14.691  2.817   1.00 38.77  ? 333  THR A CG2   1 
ATOM   2610 N  N     . ARG A 1 337 ? 16.052 12.808  -1.268  1.00 38.11  ? 334  ARG A N     1 
ATOM   2611 C  CA    . ARG A 1 337 ? 16.448 12.676  -2.662  1.00 36.67  ? 334  ARG A CA    1 
ATOM   2612 C  C     . ARG A 1 337 ? 17.438 13.764  -3.056  1.00 34.56  ? 334  ARG A C     1 
ATOM   2613 O  O     . ARG A 1 337 ? 18.434 13.491  -3.724  1.00 35.83  ? 334  ARG A O     1 
ATOM   2614 C  CB    . ARG A 1 337 ? 15.220 12.729  -3.575  1.00 38.77  ? 334  ARG A CB    1 
ATOM   2615 C  CG    . ARG A 1 337 ? 15.551 12.856  -5.053  1.00 40.80  ? 334  ARG A CG    1 
ATOM   2616 C  CD    . ARG A 1 337 ? 14.296 12.809  -5.917  1.00 46.76  ? 334  ARG A CD    1 
ATOM   2617 N  NE    . ARG A 1 337 ? 13.602 14.095  -5.935  1.00 46.26  ? 334  ARG A NE    1 
ATOM   2618 C  CZ    . ARG A 1 337 ? 12.452 14.314  -6.565  1.00 57.69  ? 334  ARG A CZ    1 
ATOM   2619 N  NH1   . ARG A 1 337 ? 11.863 13.332  -7.235  1.00 57.32  ? 334  ARG A NH1   1 
ATOM   2620 N  NH2   . ARG A 1 337 ? 11.891 15.516  -6.529  1.00 57.03  ? 334  ARG A NH2   1 
ATOM   2621 N  N     . GLU A 1 338 ? 17.166 14.999  -2.641  1.00 37.91  ? 335  GLU A N     1 
ATOM   2622 C  CA    . GLU A 1 338 ? 18.048 16.107  -2.988  1.00 32.78  ? 335  GLU A CA    1 
ATOM   2623 C  C     . GLU A 1 338 ? 19.449 15.893  -2.402  1.00 26.10  ? 335  GLU A C     1 
ATOM   2624 O  O     . GLU A 1 338 ? 20.448 16.218  -3.039  1.00 28.07  ? 335  GLU A O     1 
ATOM   2625 C  CB    . GLU A 1 338 ? 17.459 17.437  -2.515  1.00 37.46  ? 335  GLU A CB    1 
ATOM   2626 C  CG    . GLU A 1 338 ? 17.600 18.551  -3.546  1.00 53.86  ? 335  GLU A CG    1 
ATOM   2627 C  CD    . GLU A 1 338 ? 16.593 18.433  -4.677  1.00 64.89  ? 335  GLU A CD    1 
ATOM   2628 O  OE1   . GLU A 1 338 ? 15.463 17.967  -4.422  1.00 70.36  ? 335  GLU A OE1   1 
ATOM   2629 O  OE2   . GLU A 1 338 ? 16.937 18.790  -5.825  1.00 67.90  ? 335  GLU A OE2   1 
ATOM   2630 N  N     . GLN A 1 339 ? 19.506 15.330  -1.198  1.00 29.88  ? 336  GLN A N     1 
ATOM   2631 C  CA    . GLN A 1 339 ? 20.765 14.994  -0.537  1.00 29.66  ? 336  GLN A CA    1 
ATOM   2632 C  C     . GLN A 1 339 ? 21.531 13.943  -1.317  1.00 29.66  ? 336  GLN A C     1 
ATOM   2633 O  O     . GLN A 1 339 ? 22.730 14.084  -1.571  1.00 23.89  ? 336  GLN A O     1 
ATOM   2634 C  CB    . GLN A 1 339 ? 20.502 14.477  0.874   1.00 30.45  ? 336  GLN A CB    1 
ATOM   2635 C  CG    . GLN A 1 339 ? 21.101 15.300  1.987   1.00 32.16  ? 336  GLN A CG    1 
ATOM   2636 C  CD    . GLN A 1 339 ? 20.869 14.657  3.336   1.00 29.12  ? 336  GLN A CD    1 
ATOM   2637 O  OE1   . GLN A 1 339 ? 19.888 13.934  3.532   1.00 24.71  ? 336  GLN A OE1   1 
ATOM   2638 N  NE2   . GLN A 1 339 ? 21.765 14.913  4.273   1.00 26.95  ? 336  GLN A NE2   1 
ATOM   2639 N  N     . VAL A 1 340 ? 20.832 12.875  -1.688  1.00 22.89  ? 337  VAL A N     1 
ATOM   2640 C  CA    . VAL A 1 340 ? 21.472 11.780  -2.401  1.00 26.94  ? 337  VAL A CA    1 
ATOM   2641 C  C     . VAL A 1 340 ? 22.012 12.272  -3.737  1.00 24.65  ? 337  VAL A C     1 
ATOM   2642 O  O     . VAL A 1 340 ? 23.144 11.966  -4.119  1.00 25.34  ? 337  VAL A O     1 
ATOM   2643 C  CB    . VAL A 1 340 ? 20.501 10.613  -2.625  1.00 24.71  ? 337  VAL A CB    1 
ATOM   2644 C  CG1   . VAL A 1 340 ? 21.125 9.575   -3.553  1.00 23.08  ? 337  VAL A CG1   1 
ATOM   2645 C  CG2   . VAL A 1 340 ? 20.146 9.974   -1.298  1.00 23.72  ? 337  VAL A CG2   1 
ATOM   2646 N  N     . GLN A 1 341 ? 21.210 13.057  -4.438  1.00 26.91  ? 338  GLN A N     1 
ATOM   2647 C  CA    . GLN A 1 341 ? 21.620 13.577  -5.727  1.00 20.91  ? 338  GLN A CA    1 
ATOM   2648 C  C     . GLN A 1 341 ? 22.751 14.594  -5.609  1.00 22.75  ? 338  GLN A C     1 
ATOM   2649 O  O     . GLN A 1 341 ? 23.633 14.643  -6.467  1.00 27.27  ? 338  GLN A O     1 
ATOM   2650 C  CB    . GLN A 1 341 ? 20.416 14.183  -6.447  1.00 29.44  ? 338  GLN A CB    1 
ATOM   2651 C  CG    . GLN A 1 341 ? 19.401 13.121  -6.836  1.00 27.25  ? 338  GLN A CG    1 
ATOM   2652 C  CD    . GLN A 1 341 ? 18.159 13.690  -7.497  1.00 35.79  ? 338  GLN A CD    1 
ATOM   2653 O  OE1   . GLN A 1 341 ? 17.911 14.894  -7.452  1.00 36.83  ? 338  GLN A OE1   1 
ATOM   2654 N  NE2   . GLN A 1 341 ? 17.375 12.819  -8.126  1.00 35.36  ? 338  GLN A NE2   1 
ATOM   2655 N  N     . TRP A 1 342 ? 22.734 15.398  -4.551  1.00 22.78  ? 339  TRP A N     1 
ATOM   2656 C  CA    . TRP A 1 342 ? 23.798 16.378  -4.361  1.00 21.98  ? 339  TRP A CA    1 
ATOM   2657 C  C     . TRP A 1 342 ? 25.147 15.681  -4.184  1.00 18.70  ? 339  TRP A C     1 
ATOM   2658 O  O     . TRP A 1 342 ? 26.143 16.070  -4.794  1.00 19.88  ? 339  TRP A O     1 
ATOM   2659 C  CB    . TRP A 1 342 ? 23.511 17.291  -3.169  1.00 21.81  ? 339  TRP A CB    1 
ATOM   2660 C  CG    . TRP A 1 342 ? 24.485 18.428  -3.102  1.00 23.27  ? 339  TRP A CG    1 
ATOM   2661 C  CD1   . TRP A 1 342 ? 24.453 19.581  -3.835  1.00 23.70  ? 339  TRP A CD1   1 
ATOM   2662 C  CD2   . TRP A 1 342 ? 25.648 18.510  -2.278  1.00 24.48  ? 339  TRP A CD2   1 
ATOM   2663 N  NE1   . TRP A 1 342 ? 25.523 20.375  -3.515  1.00 30.60  ? 339  TRP A NE1   1 
ATOM   2664 C  CE2   . TRP A 1 342 ? 26.273 19.743  -2.558  1.00 21.91  ? 339  TRP A CE2   1 
ATOM   2665 C  CE3   . TRP A 1 342 ? 26.220 17.664  -1.325  1.00 27.56  ? 339  TRP A CE3   1 
ATOM   2666 C  CZ2   . TRP A 1 342 ? 27.442 20.149  -1.923  1.00 26.43  ? 339  TRP A CZ2   1 
ATOM   2667 C  CZ3   . TRP A 1 342 ? 27.382 18.071  -0.692  1.00 23.58  ? 339  TRP A CZ3   1 
ATOM   2668 C  CH2   . TRP A 1 342 ? 27.983 19.300  -0.997  1.00 28.62  ? 339  TRP A CH2   1 
ATOM   2669 N  N     . TRP A 1 343 ? 25.172 14.646  -3.357  1.00 20.09  ? 340  TRP A N     1 
ATOM   2670 C  CA    . TRP A 1 343 ? 26.425 13.961  -3.077  1.00 17.84  ? 340  TRP A CA    1 
ATOM   2671 C  C     . TRP A 1 343 ? 26.872 13.095  -4.240  1.00 17.78  ? 340  TRP A C     1 
ATOM   2672 O  O     . TRP A 1 343 ? 28.072 12.953  -4.474  1.00 20.46  ? 340  TRP A O     1 
ATOM   2673 C  CB    . TRP A 1 343 ? 26.310 13.126  -1.810  1.00 18.10  ? 340  TRP A CB    1 
ATOM   2674 C  CG    . TRP A 1 343 ? 26.440 13.948  -0.574  1.00 19.62  ? 340  TRP A CG    1 
ATOM   2675 C  CD1   . TRP A 1 343 ? 25.446 14.310  0.291   1.00 23.09  ? 340  TRP A CD1   1 
ATOM   2676 C  CD2   . TRP A 1 343 ? 27.643 14.534  -0.076  1.00 18.02  ? 340  TRP A CD2   1 
ATOM   2677 N  NE1   . TRP A 1 343 ? 25.964 15.080  1.307   1.00 20.60  ? 340  TRP A NE1   1 
ATOM   2678 C  CE2   . TRP A 1 343 ? 27.312 15.229  1.105   1.00 19.13  ? 340  TRP A CE2   1 
ATOM   2679 C  CE3   . TRP A 1 343 ? 28.975 14.525  -0.506  1.00 20.10  ? 340  TRP A CE3   1 
ATOM   2680 C  CZ2   . TRP A 1 343 ? 28.266 15.913  1.863   1.00 19.56  ? 340  TRP A CZ2   1 
ATOM   2681 C  CZ3   . TRP A 1 343 ? 29.915 15.213  0.239   1.00 19.66  ? 340  TRP A CZ3   1 
ATOM   2682 C  CH2   . TRP A 1 343 ? 29.558 15.893  1.415   1.00 25.95  ? 340  TRP A CH2   1 
ATOM   2683 N  N     . LEU A 1 344 ? 25.928 12.530  -4.991  1.00 16.58  ? 341  LEU A N     1 
ATOM   2684 C  CA    . LEU A 1 344 ? 26.321 11.758  -6.169  1.00 17.74  ? 341  LEU A CA    1 
ATOM   2685 C  C     . LEU A 1 344 ? 27.017 12.678  -7.154  1.00 15.59  ? 341  LEU A C     1 
ATOM   2686 O  O     . LEU A 1 344 ? 27.974 12.277  -7.816  1.00 18.42  ? 341  LEU A O     1 
ATOM   2687 C  CB    . LEU A 1 344 ? 25.119 11.082  -6.839  1.00 16.72  ? 341  LEU A CB    1 
ATOM   2688 C  CG    . LEU A 1 344 ? 24.545 9.837   -6.158  1.00 18.93  ? 341  LEU A CG    1 
ATOM   2689 C  CD1   . LEU A 1 344 ? 23.248 9.410   -6.829  1.00 22.45  ? 341  LEU A CD1   1 
ATOM   2690 C  CD2   . LEU A 1 344 ? 25.525 8.686   -6.166  1.00 17.50  ? 341  LEU A CD2   1 
ATOM   2691 N  N     . LEU A 1 345 ? 26.542 13.918  -7.253  1.00 15.69  ? 342  LEU A N     1 
ATOM   2692 C  CA    . LEU A 1 345 ? 27.166 14.901  -8.130  1.00 17.18  ? 342  LEU A CA    1 
ATOM   2693 C  C     . LEU A 1 345 ? 28.573 15.273  -7.643  1.00 18.34  ? 342  LEU A C     1 
ATOM   2694 O  O     . LEU A 1 345 ? 29.494 15.421  -8.450  1.00 20.61  ? 342  LEU A O     1 
ATOM   2695 C  CB    . LEU A 1 345 ? 26.294 16.161  -8.241  1.00 21.52  ? 342  LEU A CB    1 
ATOM   2696 C  CG    . LEU A 1 345 ? 26.847 17.272  -9.135  1.00 21.77  ? 342  LEU A CG    1 
ATOM   2697 C  CD1   . LEU A 1 345 ? 27.107 16.730  -10.538 1.00 26.29  ? 342  LEU A CD1   1 
ATOM   2698 C  CD2   . LEU A 1 345 ? 25.863 18.433  -9.195  1.00 30.01  ? 342  LEU A CD2   1 
ATOM   2699 N  N     . GLN A 1 346 ? 28.733 15.433  -6.332  1.00 16.69  ? 343  GLN A N     1 
ATOM   2700 C  CA    . GLN A 1 346 ? 30.042 15.776  -5.778  1.00 14.43  ? 343  GLN A CA    1 
ATOM   2701 C  C     . GLN A 1 346 ? 31.043 14.684  -6.108  1.00 15.82  ? 343  GLN A C     1 
ATOM   2702 O  O     . GLN A 1 346 ? 32.137 14.962  -6.601  1.00 17.01  ? 343  GLN A O     1 
ATOM   2703 C  CB    . GLN A 1 346 ? 29.982 15.975  -4.257  1.00 18.86  ? 343  GLN A CB    1 
ATOM   2704 C  CG    . GLN A 1 346 ? 29.093 17.137  -3.803  1.00 19.24  ? 343  GLN A CG    1 
ATOM   2705 C  CD    . GLN A 1 346 ? 29.056 18.285  -4.802  1.00 22.56  ? 343  GLN A CD    1 
ATOM   2706 O  OE1   . GLN A 1 346 ? 30.007 19.061  -4.917  1.00 23.90  ? 343  GLN A OE1   1 
ATOM   2707 N  NE2   . GLN A 1 346 ? 27.942 18.407  -5.521  1.00 23.36  ? 343  GLN A NE2   1 
ATOM   2708 N  N     . LEU A 1 347 ? 30.659 13.444  -5.833  1.00 16.46  ? 344  LEU A N     1 
ATOM   2709 C  CA    . LEU A 1 347 ? 31.513 12.310  -6.167  1.00 17.87  ? 344  LEU A CA    1 
ATOM   2710 C  C     . LEU A 1 347 ? 31.803 12.264  -7.666  1.00 15.79  ? 344  LEU A C     1 
ATOM   2711 O  O     . LEU A 1 347 ? 32.938 12.013  -8.077  1.00 16.34  ? 344  LEU A O     1 
ATOM   2712 C  CB    . LEU A 1 347 ? 30.869 10.993  -5.722  1.00 14.83  ? 344  LEU A CB    1 
ATOM   2713 C  CG    . LEU A 1 347 ? 30.873 10.637  -4.241  1.00 22.14  ? 344  LEU A CG    1 
ATOM   2714 C  CD1   . LEU A 1 347 ? 30.287 9.255   -4.044  1.00 24.15  ? 344  LEU A CD1   1 
ATOM   2715 C  CD2   . LEU A 1 347 ? 32.261 10.652  -3.722  1.00 24.05  ? 344  LEU A CD2   1 
ATOM   2716 N  N     . ALA A 1 348 ? 30.777 12.510  -8.478  1.00 15.88  ? 345  ALA A N     1 
ATOM   2717 C  CA    . ALA A 1 348 ? 30.912 12.376  -9.922  1.00 15.47  ? 345  ALA A CA    1 
ATOM   2718 C  C     . ALA A 1 348 ? 31.816 13.462  -10.483 1.00 15.72  ? 345  ALA A C     1 
ATOM   2719 O  O     . ALA A 1 348 ? 32.541 13.222  -11.438 1.00 16.62  ? 345  ALA A O     1 
ATOM   2720 C  CB    . ALA A 1 348 ? 29.536 12.416  -10.608 1.00 14.03  ? 345  ALA A CB    1 
ATOM   2721 N  N     . GLN A 1 349 ? 31.778 14.651  -9.880  1.00 16.65  ? 346  GLN A N     1 
ATOM   2722 C  CA    . GLN A 1 349 ? 32.638 15.742  -10.320 1.00 14.14  ? 346  GLN A CA    1 
ATOM   2723 C  C     . GLN A 1 349 ? 34.110 15.454  -10.003 1.00 14.78  ? 346  GLN A C     1 
ATOM   2724 O  O     . GLN A 1 349 ? 34.985 15.721  -10.830 1.00 18.86  ? 346  GLN A O     1 
ATOM   2725 C  CB    . GLN A 1 349 ? 32.205 17.070  -9.697  1.00 20.20  ? 346  GLN A CB    1 
ATOM   2726 C  CG    . GLN A 1 349 ? 30.973 17.672  -10.384 1.00 23.87  ? 346  GLN A CG    1 
ATOM   2727 C  CD    . GLN A 1 349 ? 30.422 18.888  -9.659  1.00 34.28  ? 346  GLN A CD    1 
ATOM   2728 O  OE1   . GLN A 1 349 ? 31.020 19.388  -8.708  1.00 35.27  ? 346  GLN A OE1   1 
ATOM   2729 N  NE2   . GLN A 1 349 ? 29.271 19.367  -10.109 1.00 37.13  ? 346  GLN A NE2   1 
ATOM   2730 N  N     . GLU A 1 350 ? 34.384 14.891  -8.831  1.00 14.52  ? 347  GLU A N     1 
ATOM   2731 C  CA    . GLU A 1 350 ? 35.762 14.491  -8.542  1.00 14.32  ? 347  GLU A CA    1 
ATOM   2732 C  C     . GLU A 1 350 ? 36.194 13.375  -9.492  1.00 15.95  ? 347  GLU A C     1 
ATOM   2733 O  O     . GLU A 1 350 ? 37.325 13.377  -9.984  1.00 17.11  ? 347  GLU A O     1 
ATOM   2734 C  CB    . GLU A 1 350 ? 35.948 14.045  -7.092  1.00 15.55  ? 347  GLU A CB    1 
ATOM   2735 C  CG    . GLU A 1 350 ? 37.389 13.553  -6.853  1.00 16.81  ? 347  GLU A CG    1 
ATOM   2736 C  CD    . GLU A 1 350 ? 37.649 13.013  -5.457  1.00 23.14  ? 347  GLU A CD    1 
ATOM   2737 O  OE1   . GLU A 1 350 ? 36.964 13.401  -4.493  1.00 20.99  ? 347  GLU A OE1   1 
ATOM   2738 O  OE2   . GLU A 1 350 ? 38.546 12.170  -5.323  1.00 16.58  ? 347  GLU A OE2   1 
ATOM   2739 N  N     . LEU A 1 351 ? 35.296 12.430  -9.756  1.00 15.14  ? 348  LEU A N     1 
ATOM   2740 C  CA    . LEU A 1 351 ? 35.605 11.335  -10.666 1.00 14.13  ? 348  LEU A CA    1 
ATOM   2741 C  C     . LEU A 1 351 ? 35.890 11.862  -12.064 1.00 18.20  ? 348  LEU A C     1 
ATOM   2742 O  O     . LEU A 1 351 ? 36.847 11.433  -12.698 1.00 18.19  ? 348  LEU A O     1 
ATOM   2743 C  CB    . LEU A 1 351 ? 34.468 10.305  -10.709 1.00 14.70  ? 348  LEU A CB    1 
ATOM   2744 C  CG    . LEU A 1 351 ? 34.773 8.948   -11.383 1.00 16.01  ? 348  LEU A CG    1 
ATOM   2745 C  CD1   . LEU A 1 351 ? 36.011 8.258   -10.774 1.00 18.77  ? 348  LEU A CD1   1 
ATOM   2746 C  CD2   . LEU A 1 351 ? 33.557 8.015   -11.332 1.00 22.98  ? 348  LEU A CD2   1 
ATOM   2747 N  N     . GLU A 1 352 ? 35.064 12.792  -12.544 1.00 16.59  ? 349  GLU A N     1 
ATOM   2748 C  CA    . GLU A 1 352 ? 35.295 13.379  -13.862 1.00 18.36  ? 349  GLU A CA    1 
ATOM   2749 C  C     . GLU A 1 352 ? 36.675 14.008  -13.938 1.00 16.75  ? 349  GLU A C     1 
ATOM   2750 O  O     . GLU A 1 352 ? 37.392 13.853  -14.930 1.00 17.89  ? 349  GLU A O     1 
ATOM   2751 C  CB    . GLU A 1 352 ? 34.240 14.432  -14.200 1.00 22.08  ? 349  GLU A CB    1 
ATOM   2752 C  CG    . GLU A 1 352 ? 34.376 14.919  -15.639 1.00 22.13  ? 349  GLU A CG    1 
ATOM   2753 C  CD    . GLU A 1 352 ? 33.479 16.100  -15.962 1.00 37.77  ? 349  GLU A CD    1 
ATOM   2754 O  OE1   . GLU A 1 352 ? 33.996 17.103  -16.499 1.00 40.31  ? 349  GLU A OE1   1 
ATOM   2755 O  OE2   . GLU A 1 352 ? 32.262 16.025  -15.688 1.00 30.93  ? 349  GLU A OE2   1 
ATOM   2756 N  N     . GLU A 1 353 ? 37.048 14.701  -12.872 1.00 19.27  ? 350  GLU A N     1 
ATOM   2757 C  CA    . GLU A 1 353 ? 38.322 15.401  -12.834 1.00 15.99  ? 350  GLU A CA    1 
ATOM   2758 C  C     . GLU A 1 353 ? 39.467 14.404  -12.947 1.00 20.47  ? 350  GLU A C     1 
ATOM   2759 O  O     . GLU A 1 353 ? 40.392 14.569  -13.752 1.00 21.28  ? 350  GLU A O     1 
ATOM   2760 C  CB    . GLU A 1 353 ? 38.444 16.209  -11.547 1.00 22.24  ? 350  GLU A CB    1 
ATOM   2761 C  CG    . GLU A 1 353 ? 39.677 17.075  -11.484 1.00 29.39  ? 350  GLU A CG    1 
ATOM   2762 C  CD    . GLU A 1 353 ? 39.693 17.949  -10.250 1.00 39.38  ? 350  GLU A CD    1 
ATOM   2763 O  OE1   . GLU A 1 353 ? 38.745 17.849  -9.443  1.00 47.93  ? 350  GLU A OE1   1 
ATOM   2764 O  OE2   . GLU A 1 353 ? 40.652 18.732  -10.089 1.00 54.82  ? 350  GLU A OE2   1 
ATOM   2765 N  N     . ARG A 1 354 ? 39.386 13.344  -12.158 1.00 17.11  ? 351  ARG A N     1 
ATOM   2766 C  CA    . ARG A 1 354 ? 40.474 12.374  -12.135 1.00 18.64  ? 351  ARG A CA    1 
ATOM   2767 C  C     . ARG A 1 354 ? 40.498 11.585  -13.430 1.00 17.34  ? 351  ARG A C     1 
ATOM   2768 O  O     . ARG A 1 354 ? 41.573 11.275  -13.952 1.00 18.64  ? 351  ARG A O     1 
ATOM   2769 C  CB    . ARG A 1 354 ? 40.338 11.444  -10.932 1.00 15.78  ? 351  ARG A CB    1 
ATOM   2770 C  CG    A ARG A 1 354 ? 40.821 12.126  -9.642  0.79 19.03  ? 351  ARG A CG    1 
ATOM   2771 C  CG    B ARG A 1 354 ? 40.561 12.083  -9.575  0.21 19.48  ? 351  ARG A CG    1 
ATOM   2772 C  CD    A ARG A 1 354 ? 40.300 11.452  -8.380  0.79 17.80  ? 351  ARG A CD    1 
ATOM   2773 C  CD    B ARG A 1 354 ? 40.449 11.020  -8.491  0.21 17.09  ? 351  ARG A CD    1 
ATOM   2774 N  NE    A ARG A 1 354 ? 40.758 10.075  -8.287  0.79 15.42  ? 351  ARG A NE    1 
ATOM   2775 N  NE    B ARG A 1 354 ? 41.401 9.933   -8.711  0.21 13.17  ? 351  ARG A NE    1 
ATOM   2776 C  CZ    A ARG A 1 354 ? 40.294 9.187   -7.415  0.79 17.95  ? 351  ARG A CZ    1 
ATOM   2777 C  CZ    B ARG A 1 354 ? 41.276 8.708   -8.209  0.21 14.55  ? 351  ARG A CZ    1 
ATOM   2778 N  NH1   A ARG A 1 354 ? 39.350 9.534   -6.526  0.79 11.46  ? 351  ARG A NH1   1 
ATOM   2779 N  NH1   B ARG A 1 354 ? 40.225 8.396   -7.463  0.21 16.35  ? 351  ARG A NH1   1 
ATOM   2780 N  NH2   A ARG A 1 354 ? 40.784 7.947   -7.439  0.79 13.28  ? 351  ARG A NH2   1 
ATOM   2781 N  NH2   B ARG A 1 354 ? 42.197 7.788   -8.468  0.21 15.06  ? 351  ARG A NH2   1 
ATOM   2782 N  N     . LEU A 1 355 ? 39.314 11.282  -13.964 1.00 18.22  ? 352  LEU A N     1 
ATOM   2783 C  CA    . LEU A 1 355 ? 39.227 10.522  -15.208 1.00 16.93  ? 352  LEU A CA    1 
ATOM   2784 C  C     . LEU A 1 355 ? 39.792 11.306  -16.389 1.00 21.15  ? 352  LEU A C     1 
ATOM   2785 O  O     . LEU A 1 355 ? 40.498 10.744  -17.239 1.00 22.50  ? 352  LEU A O     1 
ATOM   2786 C  CB    . LEU A 1 355 ? 37.783 10.115  -15.513 1.00 19.97  ? 352  LEU A CB    1 
ATOM   2787 C  CG    . LEU A 1 355 ? 37.193 8.913   -14.781 1.00 20.97  ? 352  LEU A CG    1 
ATOM   2788 C  CD1   . LEU A 1 355 ? 35.719 8.795   -15.127 1.00 19.68  ? 352  LEU A CD1   1 
ATOM   2789 C  CD2   . LEU A 1 355 ? 37.941 7.624   -15.144 1.00 19.48  ? 352  LEU A CD2   1 
ATOM   2790 N  N     . THR A 1 356 ? 39.478 12.597  -16.450 1.00 19.99  ? 353  THR A N     1 
ATOM   2791 C  CA    . THR A 1 356 ? 39.953 13.426  -17.551 1.00 20.65  ? 353  THR A CA    1 
ATOM   2792 C  C     . THR A 1 356 ? 41.475 13.560  -17.495 1.00 20.99  ? 353  THR A C     1 
ATOM   2793 O  O     . THR A 1 356 ? 42.149 13.423  -18.518 1.00 25.01  ? 353  THR A O     1 
ATOM   2794 C  CB    . THR A 1 356 ? 39.270 14.805  -17.542 1.00 22.05  ? 353  THR A CB    1 
ATOM   2795 O  OG1   . THR A 1 356 ? 37.865 14.614  -17.752 1.00 22.43  ? 353  THR A OG1   1 
ATOM   2796 C  CG2   . THR A 1 356 ? 39.812 15.682  -18.648 1.00 21.82  ? 353  THR A CG2   1 
ATOM   2797 N  N     . LYS A 1 357 ? 42.016 13.793  -16.302 1.00 19.71  ? 354  LYS A N     1 
ATOM   2798 C  CA    . LYS A 1 357 ? 43.464 13.811  -16.129 1.00 19.67  ? 354  LYS A CA    1 
ATOM   2799 C  C     . LYS A 1 357 ? 44.080 12.478  -16.548 1.00 16.88  ? 354  LYS A C     1 
ATOM   2800 O  O     . LYS A 1 357 ? 45.127 12.430  -17.211 1.00 21.86  ? 354  LYS A O     1 
ATOM   2801 C  CB    . LYS A 1 357 ? 43.824 14.110  -14.679 1.00 19.14  ? 354  LYS A CB    1 
ATOM   2802 C  CG    . LYS A 1 357 ? 45.318 14.137  -14.407 1.00 26.46  ? 354  LYS A CG    1 
ATOM   2803 C  CD    . LYS A 1 357 ? 45.971 15.309  -15.116 1.00 32.62  ? 354  LYS A CD    1 
ATOM   2804 C  CE    . LYS A 1 357 ? 47.110 15.873  -14.286 1.00 39.80  ? 354  LYS A CE    1 
ATOM   2805 N  NZ    . LYS A 1 357 ? 48.105 14.813  -13.986 1.00 33.44  ? 354  LYS A NZ    1 
ATOM   2806 N  N     . ASP A 1 358 ? 43.423 11.392  -16.165 1.00 19.28  ? 355  ASP A N     1 
ATOM   2807 C  CA    . ASP A 1 358 ? 43.919 10.059  -16.495 1.00 21.32  ? 355  ASP A CA    1 
ATOM   2808 C  C     . ASP A 1 358 ? 43.959 9.818   -17.999 1.00 24.28  ? 355  ASP A C     1 
ATOM   2809 O  O     . ASP A 1 358 ? 44.913 9.221   -18.500 1.00 24.68  ? 355  ASP A O     1 
ATOM   2810 C  CB    . ASP A 1 358 ? 43.062 8.983   -15.818 1.00 18.96  ? 355  ASP A CB    1 
ATOM   2811 C  CG    . ASP A 1 358 ? 43.600 7.579   -16.049 1.00 25.64  ? 355  ASP A CG    1 
ATOM   2812 O  OD1   . ASP A 1 358 ? 44.541 7.174   -15.335 1.00 21.17  ? 355  ASP A OD1   1 
ATOM   2813 O  OD2   . ASP A 1 358 ? 43.088 6.878   -16.948 1.00 21.42  ? 355  ASP A OD2   1 
ATOM   2814 N  N     . ARG A 1 359 ? 42.927 10.270  -18.716 1.00 19.91  ? 356  ARG A N     1 
ATOM   2815 C  CA    . ARG A 1 359 ? 42.849 10.046  -20.159 1.00 23.45  ? 356  ARG A CA    1 
ATOM   2816 C  C     . ARG A 1 359 ? 43.980 10.776  -20.873 1.00 19.83  ? 356  ARG A C     1 
ATOM   2817 O  O     . ARG A 1 359 ? 44.566 10.255  -21.825 1.00 25.91  ? 356  ARG A O     1 
ATOM   2818 C  CB    . ARG A 1 359 ? 41.492 10.505  -20.717 1.00 25.86  ? 356  ARG A CB    1 
ATOM   2819 C  CG    . ARG A 1 359 ? 41.210 10.070  -22.161 1.00 29.71  ? 356  ARG A CG    1 
ATOM   2820 C  CD    . ARG A 1 359 ? 39.852 10.564  -22.646 1.00 30.15  ? 356  ARG A CD    1 
ATOM   2821 N  NE    . ARG A 1 359 ? 39.707 12.011  -22.509 1.00 28.19  ? 356  ARG A NE    1 
ATOM   2822 C  CZ    . ARG A 1 359 ? 38.545 12.639  -22.340 1.00 37.03  ? 356  ARG A CZ    1 
ATOM   2823 N  NH1   . ARG A 1 359 ? 37.413 11.950  -22.281 1.00 41.04  ? 356  ARG A NH1   1 
ATOM   2824 N  NH2   . ARG A 1 359 ? 38.517 13.961  -22.224 1.00 35.89  ? 356  ARG A NH2   1 
ATOM   2825 N  N     . ASN A 1 360 ? 44.294 11.977  -20.399 1.00 23.82  ? 357  ASN A N     1 
ATOM   2826 C  CA    . ASN A 1 360 ? 45.358 12.778  -20.999 1.00 19.94  ? 357  ASN A CA    1 
ATOM   2827 C  C     . ASN A 1 360 ? 46.756 12.237  -20.694 1.00 23.03  ? 357  ASN A C     1 
ATOM   2828 O  O     . ASN A 1 360 ? 47.635 12.250  -21.554 1.00 24.84  ? 357  ASN A O     1 
ATOM   2829 C  CB    . ASN A 1 360 ? 45.251 14.223  -20.525 1.00 19.14  ? 357  ASN A CB    1 
ATOM   2830 C  CG    . ASN A 1 360 ? 44.072 14.941  -21.138 1.00 28.57  ? 357  ASN A CG    1 
ATOM   2831 O  OD1   . ASN A 1 360 ? 43.770 14.755  -22.317 1.00 26.50  ? 357  ASN A OD1   1 
ATOM   2832 N  ND2   . ASN A 1 360 ? 43.404 15.769  -20.350 1.00 27.14  ? 357  ASN A ND2   1 
ATOM   2833 N  N     . ASP A 1 361 ? 46.955 11.782  -19.459 1.00 21.72  ? 358  ASP A N     1 
ATOM   2834 C  CA    . ASP A 1 361 ? 48.259 11.292  -19.023 1.00 30.25  ? 358  ASP A CA    1 
ATOM   2835 C  C     . ASP A 1 361 ? 48.554 9.923   -19.593 1.00 24.74  ? 358  ASP A C     1 
ATOM   2836 O  O     . ASP A 1 361 ? 49.692 9.628   -19.946 1.00 23.42  ? 358  ASP A O     1 
ATOM   2837 C  CB    . ASP A 1 361 ? 48.336 11.225  -17.490 1.00 19.46  ? 358  ASP A CB    1 
ATOM   2838 C  CG    . ASP A 1 361 ? 48.443 12.606  -16.849 1.00 37.01  ? 358  ASP A CG    1 
ATOM   2839 O  OD1   . ASP A 1 361 ? 48.609 13.607  -17.590 1.00 25.88  ? 358  ASP A OD1   1 
ATOM   2840 O  OD2   . ASP A 1 361 ? 48.363 12.686  -15.604 1.00 33.43  ? 358  ASP A OD2   1 
ATOM   2841 N  N     . ASN A 1 362 ? 47.526 9.086   -19.670 1.00 21.61  ? 359  ASN A N     1 
ATOM   2842 C  CA    . ASN A 1 362 ? 47.747 7.651   -19.818 1.00 20.88  ? 359  ASN A CA    1 
ATOM   2843 C  C     . ASN A 1 362 ? 47.111 7.021   -21.046 1.00 20.09  ? 359  ASN A C     1 
ATOM   2844 O  O     . ASN A 1 362 ? 47.200 5.810   -21.216 1.00 24.50  ? 359  ASN A O     1 
ATOM   2845 C  CB    . ASN A 1 362 ? 47.257 6.925   -18.557 1.00 21.63  ? 359  ASN A CB    1 
ATOM   2846 C  CG    . ASN A 1 362 ? 48.015 7.353   -17.301 1.00 26.24  ? 359  ASN A CG    1 
ATOM   2847 O  OD1   . ASN A 1 362 ? 49.242 7.492   -17.317 1.00 19.41  ? 359  ASN A OD1   1 
ATOM   2848 N  ND2   . ASN A 1 362 ? 47.291 7.530   -16.203 1.00 17.67  ? 359  ASN A ND2   1 
ATOM   2849 N  N     . ASP A 1 363 ? 46.489 7.831   -21.901 1.00 25.21  ? 360  ASP A N     1 
ATOM   2850 C  CA    . ASP A 1 363 ? 45.981 7.337   -23.185 1.00 20.28  ? 360  ASP A CA    1 
ATOM   2851 C  C     . ASP A 1 363 ? 45.052 6.145   -23.024 1.00 26.78  ? 360  ASP A C     1 
ATOM   2852 O  O     . ASP A 1 363 ? 45.272 5.095   -23.625 1.00 24.14  ? 360  ASP A O     1 
ATOM   2853 C  CB    . ASP A 1 363 ? 47.140 6.940   -24.112 1.00 32.18  ? 360  ASP A CB    1 
ATOM   2854 C  CG    . ASP A 1 363 ? 48.101 8.085   -24.373 1.00 37.42  ? 360  ASP A CG    1 
ATOM   2855 O  OD1   . ASP A 1 363 ? 47.629 9.185   -24.733 1.00 37.83  ? 360  ASP A OD1   1 
ATOM   2856 O  OD2   . ASP A 1 363 ? 49.328 7.879   -24.222 1.00 41.11  ? 360  ASP A OD2   1 
ATOM   2857 N  N     . ARG A 1 364 ? 44.029 6.299   -22.189 1.00 21.76  ? 361  ARG A N     1 
ATOM   2858 C  CA    . ARG A 1 364 ? 43.040 5.246   -21.989 1.00 25.66  ? 361  ARG A CA    1 
ATOM   2859 C  C     . ARG A 1 364 ? 41.711 5.839   -21.551 1.00 21.24  ? 361  ARG A C     1 
ATOM   2860 O  O     . ARG A 1 364 ? 41.666 6.964   -21.054 1.00 24.05  ? 361  ARG A O     1 
ATOM   2861 C  CB    . ARG A 1 364 ? 43.522 4.234   -20.949 1.00 20.58  ? 361  ARG A CB    1 
ATOM   2862 C  CG    . ARG A 1 364 ? 43.846 4.853   -19.593 1.00 23.71  ? 361  ARG A CG    1 
ATOM   2863 C  CD    . ARG A 1 364 ? 44.265 3.786   -18.577 1.00 18.25  ? 361  ARG A CD    1 
ATOM   2864 N  NE    . ARG A 1 364 ? 44.297 4.322   -17.224 1.00 19.55  ? 361  ARG A NE    1 
ATOM   2865 C  CZ    . ARG A 1 364 ? 44.626 3.610   -16.150 1.00 23.54  ? 361  ARG A CZ    1 
ATOM   2866 N  NH1   . ARG A 1 364 ? 44.614 4.174   -14.949 1.00 17.74  ? 361  ARG A NH1   1 
ATOM   2867 N  NH2   . ARG A 1 364 ? 44.982 2.344   -16.282 1.00 22.39  ? 361  ARG A NH2   1 
ATOM   2868 N  N     . VAL A 1 365 ? 40.639 5.075   -21.727 1.00 21.50  ? 362  VAL A N     1 
ATOM   2869 C  CA    . VAL A 1 365 ? 39.297 5.501   -21.328 1.00 26.15  ? 362  VAL A CA    1 
ATOM   2870 C  C     . VAL A 1 365 ? 38.547 4.404   -20.576 1.00 30.09  ? 362  VAL A C     1 
ATOM   2871 O  O     . VAL A 1 365 ? 38.517 3.255   -21.005 1.00 24.99  ? 362  VAL A O     1 
ATOM   2872 C  CB    . VAL A 1 365 ? 38.447 5.921   -22.552 1.00 33.74  ? 362  VAL A CB    1 
ATOM   2873 C  CG1   . VAL A 1 365 ? 38.917 7.247   -23.095 1.00 41.76  ? 362  VAL A CG1   1 
ATOM   2874 C  CG2   . VAL A 1 365 ? 38.500 4.857   -23.642 1.00 41.44  ? 362  VAL A CG2   1 
ATOM   2875 N  N     . ALA A 1 366 ? 37.938 4.764   -19.452 1.00 26.87  ? 363  ALA A N     1 
ATOM   2876 C  CA    . ALA A 1 366 ? 37.096 3.829   -18.715 1.00 24.14  ? 363  ALA A CA    1 
ATOM   2877 C  C     . ALA A 1 366 ? 35.771 3.604   -19.460 1.00 25.22  ? 363  ALA A C     1 
ATOM   2878 O  O     . ALA A 1 366 ? 35.274 4.502   -20.146 1.00 27.12  ? 363  ALA A O     1 
ATOM   2879 C  CB    . ALA A 1 366 ? 36.849 4.347   -17.292 1.00 20.42  ? 363  ALA A CB    1 
ATOM   2880 N  N     . THR A 1 367 ? 35.203 2.406   -19.339 1.00 24.40  ? 364  THR A N     1 
ATOM   2881 C  CA    . THR A 1 367 ? 33.978 2.077   -20.067 1.00 20.81  ? 364  THR A CA    1 
ATOM   2882 C  C     . THR A 1 367 ? 32.829 1.558   -19.201 1.00 25.69  ? 364  THR A C     1 
ATOM   2883 O  O     . THR A 1 367 ? 31.711 1.390   -19.686 1.00 24.08  ? 364  THR A O     1 
ATOM   2884 C  CB    . THR A 1 367 ? 34.253 1.027   -21.177 1.00 25.16  ? 364  THR A CB    1 
ATOM   2885 O  OG1   . THR A 1 367 ? 34.442 -0.275  -20.593 1.00 26.11  ? 364  THR A OG1   1 
ATOM   2886 C  CG2   . THR A 1 367 ? 35.487 1.426   -21.997 1.00 25.95  ? 364  THR A CG2   1 
ATOM   2887 N  N     . GLN A 1 368 ? 33.092 1.292   -17.927 1.00 24.76  ? 365  GLN A N     1 
ATOM   2888 C  CA    . GLN A 1 368 ? 32.029 0.822   -17.047 1.00 23.58  ? 365  GLN A CA    1 
ATOM   2889 C  C     . GLN A 1 368 ? 32.011 1.657   -15.778 1.00 21.69  ? 365  GLN A C     1 
ATOM   2890 O  O     . GLN A 1 368 ? 33.061 1.971   -15.225 1.00 23.29  ? 365  GLN A O     1 
ATOM   2891 C  CB    . GLN A 1 368 ? 32.211 -0.659  -16.704 1.00 26.82  ? 365  GLN A CB    1 
ATOM   2892 C  CG    . GLN A 1 368 ? 31.067 -1.238  -15.897 1.00 31.58  ? 365  GLN A CG    1 
ATOM   2893 C  CD    . GLN A 1 368 ? 31.095 -2.754  -15.847 1.00 26.95  ? 365  GLN A CD    1 
ATOM   2894 O  OE1   . GLN A 1 368 ? 31.817 -3.344  -15.046 1.00 40.21  ? 365  GLN A OE1   1 
ATOM   2895 N  NE2   . GLN A 1 368 ? 30.312 -3.391  -16.711 1.00 39.60  ? 365  GLN A NE2   1 
ATOM   2896 N  N     . LEU A 1 369 ? 30.816 2.054   -15.350 1.00 21.13  ? 366  LEU A N     1 
ATOM   2897 C  CA    . LEU A 1 369 ? 30.650 2.774   -14.086 1.00 21.79  ? 366  LEU A CA    1 
ATOM   2898 C  C     . LEU A 1 369 ? 29.997 1.862   -13.068 1.00 19.33  ? 366  LEU A C     1 
ATOM   2899 O  O     . LEU A 1 369 ? 28.907 1.330   -13.304 1.00 23.48  ? 366  LEU A O     1 
ATOM   2900 C  CB    . LEU A 1 369 ? 29.804 4.035   -14.270 1.00 17.06  ? 366  LEU A CB    1 
ATOM   2901 C  CG    . LEU A 1 369 ? 29.506 4.839   -12.997 1.00 20.82  ? 366  LEU A CG    1 
ATOM   2902 C  CD1   . LEU A 1 369 ? 30.748 5.599   -12.549 1.00 23.39  ? 366  LEU A CD1   1 
ATOM   2903 C  CD2   . LEU A 1 369 ? 28.335 5.792   -13.227 1.00 24.18  ? 366  LEU A CD2   1 
ATOM   2904 N  N     . VAL A 1 370 ? 30.677 1.658   -11.947 1.00 18.44  ? 367  VAL A N     1 
ATOM   2905 C  CA    . VAL A 1 370 ? 30.136 0.856   -10.870 1.00 21.49  ? 367  VAL A CA    1 
ATOM   2906 C  C     . VAL A 1 370 ? 29.626 1.770   -9.765  1.00 23.09  ? 367  VAL A C     1 
ATOM   2907 O  O     . VAL A 1 370 ? 30.337 2.672   -9.328  1.00 21.90  ? 367  VAL A O     1 
ATOM   2908 C  CB    . VAL A 1 370 ? 31.186 -0.103  -10.297 1.00 24.98  ? 367  VAL A CB    1 
ATOM   2909 C  CG1   . VAL A 1 370 ? 30.603 -0.865  -9.126  1.00 28.78  ? 367  VAL A CG1   1 
ATOM   2910 C  CG2   . VAL A 1 370 ? 31.695 -1.053  -11.383 1.00 24.94  ? 367  VAL A CG2   1 
ATOM   2911 N  N     . VAL A 1 371 ? 28.395 1.541   -9.320  1.00 18.94  ? 368  VAL A N     1 
ATOM   2912 C  CA    . VAL A 1 371 ? 27.804 2.347   -8.262  1.00 18.51  ? 368  VAL A CA    1 
ATOM   2913 C  C     . VAL A 1 371 ? 27.530 1.478   -7.045  1.00 22.18  ? 368  VAL A C     1 
ATOM   2914 O  O     . VAL A 1 371 ? 26.949 0.405   -7.163  1.00 21.64  ? 368  VAL A O     1 
ATOM   2915 C  CB    . VAL A 1 371 ? 26.506 3.014   -8.739  1.00 19.49  ? 368  VAL A CB    1 
ATOM   2916 C  CG1   . VAL A 1 371 ? 25.946 3.952   -7.671  1.00 25.07  ? 368  VAL A CG1   1 
ATOM   2917 C  CG2   . VAL A 1 371 ? 26.758 3.748   -10.050 1.00 19.26  ? 368  VAL A CG2   1 
ATOM   2918 N  N     . SER A 1 372 ? 27.974 1.921   -5.876  1.00 18.68  ? 369  SER A N     1 
ATOM   2919 C  CA    . SER A 1 372 ? 27.793 1.126   -4.674  1.00 21.60  ? 369  SER A CA    1 
ATOM   2920 C  C     . SER A 1 372 ? 27.245 1.977   -3.551  1.00 17.99  ? 369  SER A C     1 
ATOM   2921 O  O     . SER A 1 372 ? 27.601 3.143   -3.417  1.00 18.30  ? 369  SER A O     1 
ATOM   2922 C  CB    . SER A 1 372 ? 29.112 0.477   -4.246  1.00 29.37  ? 369  SER A CB    1 
ATOM   2923 O  OG    . SER A 1 372 ? 28.892 -0.430  -3.179  1.00 34.71  ? 369  SER A OG    1 
ATOM   2924 N  N     . ILE A 1 373 ? 26.346 1.401   -2.762  1.00 22.40  ? 370  ILE A N     1 
ATOM   2925 C  CA    . ILE A 1 373 ? 25.813 2.107   -1.610  1.00 20.89  ? 370  ILE A CA    1 
ATOM   2926 C  C     . ILE A 1 373 ? 25.818 1.202   -0.384  1.00 30.13  ? 370  ILE A C     1 
ATOM   2927 O  O     . ILE A 1 373 ? 25.935 -0.029  -0.488  1.00 25.26  ? 370  ILE A O     1 
ATOM   2928 C  CB    . ILE A 1 373 ? 24.375 2.636   -1.864  1.00 26.55  ? 370  ILE A CB    1 
ATOM   2929 C  CG1   . ILE A 1 373 ? 23.384 1.478   -2.001  1.00 28.34  ? 370  ILE A CG1   1 
ATOM   2930 C  CG2   . ILE A 1 373 ? 24.346 3.545   -3.091  1.00 17.61  ? 370  ILE A CG2   1 
ATOM   2931 C  CD1   . ILE A 1 373 ? 21.952 1.923   -2.213  1.00 34.70  ? 370  ILE A CD1   1 
ATOM   2932 N  N     . ARG A 1 374 ? 25.719 1.822   0.785   1.00 27.42  ? 371  ARG A N     1 
ATOM   2933 C  CA    . ARG A 1 374 ? 25.508 1.066   2.005   1.00 30.35  ? 371  ARG A CA    1 
ATOM   2934 C  C     . ARG A 1 374 ? 24.250 1.605   2.646   1.00 30.50  ? 371  ARG A C     1 
ATOM   2935 O  O     . ARG A 1 374 ? 23.982 2.811   2.597   1.00 27.85  ? 371  ARG A O     1 
ATOM   2936 C  CB    . ARG A 1 374 ? 26.696 1.169   2.955   1.00 35.70  ? 371  ARG A CB    1 
ATOM   2937 C  CG    . ARG A 1 374 ? 26.588 0.260   4.170   1.00 40.37  ? 371  ARG A CG    1 
ATOM   2938 C  CD    . ARG A 1 374 ? 27.780 0.432   5.089   1.00 44.77  ? 371  ARG A CD    1 
ATOM   2939 N  NE    . ARG A 1 374 ? 27.719 -0.444  6.256   1.00 52.35  ? 371  ARG A NE    1 
ATOM   2940 C  CZ    . ARG A 1 374 ? 28.491 -0.301  7.329   1.00 53.75  ? 371  ARG A CZ    1 
ATOM   2941 N  NH1   . ARG A 1 374 ? 29.377 0.684   7.383   1.00 48.13  ? 371  ARG A NH1   1 
ATOM   2942 N  NH2   . ARG A 1 374 ? 28.377 -1.138  8.350   1.00 65.21  ? 371  ARG A NH2   1 
ATOM   2943 N  N     . VAL A 1 375 ? 23.461 0.702   3.216   1.00 29.24  ? 372  VAL A N     1 
ATOM   2944 C  CA    . VAL A 1 375 ? 22.227 1.085   3.877   1.00 38.82  ? 372  VAL A CA    1 
ATOM   2945 C  C     . VAL A 1 375 ? 22.389 0.977   5.388   1.00 33.51  ? 372  VAL A C     1 
ATOM   2946 O  O     . VAL A 1 375 ? 23.119 0.117   5.897   1.00 35.29  ? 372  VAL A O     1 
ATOM   2947 C  CB    . VAL A 1 375 ? 21.038 0.226   3.394   1.00 44.20  ? 372  VAL A CB    1 
ATOM   2948 C  CG1   . VAL A 1 375 ? 20.960 0.254   1.881   1.00 40.80  ? 372  VAL A CG1   1 
ATOM   2949 C  CG2   . VAL A 1 375 ? 21.186 -1.211  3.868   1.00 51.39  ? 372  VAL A CG2   1 
ATOM   2950 N  N     . GLN A 1 376 ? 21.736 1.891   6.095   1.00 42.71  ? 373  GLN A N     1 
ATOM   2951 C  CA    . GLN A 1 376 ? 21.772 1.919   7.547   1.00 46.65  ? 373  GLN A CA    1 
ATOM   2952 C  C     . GLN A 1 376 ? 21.252 0.609   8.120   1.00 47.84  ? 373  GLN A C     1 
ATOM   2953 O  O     . GLN A 1 376 ? 20.134 0.197   7.818   1.00 53.80  ? 373  GLN A O     1 
ATOM   2954 C  CB    . GLN A 1 376 ? 20.948 3.094   8.063   1.00 44.54  ? 373  GLN A CB    1 
ATOM   2955 C  CG    . GLN A 1 376 ? 21.460 3.694   9.353   1.00 56.66  ? 373  GLN A CG    1 
ATOM   2956 C  CD    . GLN A 1 376 ? 20.502 4.717   9.922   1.00 57.64  ? 373  GLN A CD    1 
ATOM   2957 O  OE1   . GLN A 1 376 ? 20.789 5.913   9.928   1.00 57.02  ? 373  GLN A OE1   1 
ATOM   2958 N  NE2   . GLN A 1 376 ? 19.349 4.253   10.396  1.00 67.08  ? 373  GLN A NE2   1 
ATOM   2959 N  N     . GLY A 1 377 ? 22.071 -0.051  8.931   1.00 50.94  ? 374  GLY A N     1 
ATOM   2960 C  CA    . GLY A 1 377 ? 21.687 -1.322  9.517   1.00 57.69  ? 374  GLY A CA    1 
ATOM   2961 C  C     . GLY A 1 377 ? 22.505 -2.497  9.011   1.00 64.29  ? 374  GLY A C     1 
ATOM   2962 O  O     . GLY A 1 377 ? 22.584 -3.536  9.667   1.00 60.82  ? 374  GLY A O     1 
ATOM   2963 N  N     . ASP A 1 378 ? 23.115 -2.330  7.841   1.00 59.29  ? 375  ASP A N     1 
ATOM   2964 C  CA    . ASP A 1 378 ? 23.938 -3.374  7.238   1.00 57.92  ? 375  ASP A CA    1 
ATOM   2965 C  C     . ASP A 1 378 ? 25.375 -3.295  7.756   1.00 67.06  ? 375  ASP A C     1 
ATOM   2966 O  O     . ASP A 1 378 ? 26.004 -2.236  7.713   1.00 65.44  ? 375  ASP A O     1 
ATOM   2967 C  CB    . ASP A 1 378 ? 23.899 -3.254  5.709   1.00 60.09  ? 375  ASP A CB    1 
ATOM   2968 C  CG    . ASP A 1 378 ? 24.550 -4.435  5.000   1.00 61.88  ? 375  ASP A CG    1 
ATOM   2969 O  OD1   . ASP A 1 378 ? 25.137 -5.309  5.671   1.00 59.43  ? 375  ASP A OD1   1 
ATOM   2970 O  OD2   . ASP A 1 378 ? 24.461 -4.490  3.756   1.00 60.49  ? 375  ASP A OD2   1 
ATOM   2971 N  N     . LYS A 1 379 ? 25.892 -4.417  8.248   1.00 71.87  ? 376  LYS A N     1 
ATOM   2972 C  CA    . LYS A 1 379 ? 27.247 -4.444  8.788   1.00 77.58  ? 376  LYS A CA    1 
ATOM   2973 C  C     . LYS A 1 379 ? 28.271 -4.506  7.658   1.00 78.27  ? 376  LYS A C     1 
ATOM   2974 O  O     . LYS A 1 379 ? 29.391 -4.008  7.793   1.00 82.95  ? 376  LYS A O     1 
ATOM   2975 C  CB    . LYS A 1 379 ? 27.430 -5.626  9.750   1.00 83.80  ? 376  LYS A CB    1 
ATOM   2976 C  CG    . LYS A 1 379 ? 28.785 -6.323  9.652   1.00 86.02  ? 376  LYS A CG    1 
ATOM   2977 C  CD    . LYS A 1 379 ? 29.243 -6.868  10.999  1.00 87.88  ? 376  LYS A CD    1 
ATOM   2978 C  CE    . LYS A 1 379 ? 30.156 -8.074  10.833  1.00 84.57  ? 376  LYS A CE    1 
ATOM   2979 N  NZ    . LYS A 1 379 ? 30.531 -8.671  12.144  1.00 79.66  ? 376  LYS A NZ    1 
ATOM   2980 N  N     . ARG A 1 380 ? 27.874 -5.105  6.540   1.00 72.11  ? 377  ARG A N     1 
ATOM   2981 C  CA    . ARG A 1 380 ? 28.749 -5.222  5.377   1.00 70.36  ? 377  ARG A CA    1 
ATOM   2982 C  C     . ARG A 1 380 ? 29.261 -3.866  4.896   1.00 68.53  ? 377  ARG A C     1 
ATOM   2983 O  O     . ARG A 1 380 ? 28.554 -2.860  4.987   1.00 65.61  ? 377  ARG A O     1 
ATOM   2984 C  CB    . ARG A 1 380 ? 28.021 -5.927  4.231   1.00 67.00  ? 377  ARG A CB    1 
ATOM   2985 C  CG    . ARG A 1 380 ? 27.683 -7.379  4.503   1.00 62.89  ? 377  ARG A CG    1 
ATOM   2986 C  CD    . ARG A 1 380 ? 26.874 -7.955  3.361   1.00 54.28  ? 377  ARG A CD    1 
ATOM   2987 N  NE    . ARG A 1 380 ? 25.620 -7.234  3.170   1.00 51.08  ? 377  ARG A NE    1 
ATOM   2988 C  CZ    . ARG A 1 380 ? 24.789 -7.444  2.156   1.00 51.08  ? 377  ARG A CZ    1 
ATOM   2989 N  NH1   . ARG A 1 380 ? 25.083 -8.351  1.235   1.00 52.23  ? 377  ARG A NH1   1 
ATOM   2990 N  NH2   . ARG A 1 380 ? 23.667 -6.745  2.058   1.00 52.20  ? 377  ARG A NH2   1 
ATOM   2991 N  N     . LEU A 1 381 ? 30.498 -3.855  4.403   1.00 68.14  ? 378  LEU A N     1 
ATOM   2992 C  CA    . LEU A 1 381 ? 31.095 -2.684  3.767   1.00 63.25  ? 378  LEU A CA    1 
ATOM   2993 C  C     . LEU A 1 381 ? 30.150 -2.118  2.711   1.00 61.33  ? 378  LEU A C     1 
ATOM   2994 O  O     . LEU A 1 381 ? 29.824 -0.929  2.723   1.00 60.72  ? 378  LEU A O     1 
ATOM   2995 C  CB    . LEU A 1 381 ? 32.445 -3.052  3.135   1.00 67.97  ? 378  LEU A CB    1 
ATOM   2996 C  CG    . LEU A 1 381 ? 33.107 -2.151  2.076   1.00 68.58  ? 378  LEU A CG    1 
ATOM   2997 C  CD1   . LEU A 1 381 ? 33.131 -0.669  2.463   1.00 66.29  ? 378  LEU A CD1   1 
ATOM   2998 C  CD2   . LEU A 1 381 ? 34.509 -2.645  1.728   1.00 62.46  ? 378  LEU A CD2   1 
ATOM   2999 N  N     . SER A 1 382 ? 29.712 -2.981  1.801   1.00 60.98  ? 379  SER A N     1 
ATOM   3000 C  CA    . SER A 1 382 ? 28.793 -2.578  0.748   1.00 54.13  ? 379  SER A CA    1 
ATOM   3001 C  C     . SER A 1 382 ? 27.495 -3.356  0.852   1.00 54.36  ? 379  SER A C     1 
ATOM   3002 O  O     . SER A 1 382 ? 27.498 -4.558  1.119   1.00 54.24  ? 379  SER A O     1 
ATOM   3003 C  CB    . SER A 1 382 ? 29.419 -2.787  -0.634  1.00 48.45  ? 379  SER A CB    1 
ATOM   3004 O  OG    . SER A 1 382 ? 28.432 -2.707  -1.651  1.00 47.70  ? 379  SER A OG    1 
ATOM   3005 N  N     . SER A 1 383 ? 26.385 -2.659  0.635   1.00 46.04  ? 380  SER A N     1 
ATOM   3006 C  CA    . SER A 1 383 ? 25.068 -3.276  0.682   1.00 50.73  ? 380  SER A CA    1 
ATOM   3007 C  C     . SER A 1 383 ? 24.601 -3.653  -0.717  1.00 53.44  ? 380  SER A C     1 
ATOM   3008 O  O     . SER A 1 383 ? 23.873 -4.628  -0.898  1.00 53.14  ? 380  SER A O     1 
ATOM   3009 C  CB    . SER A 1 383 ? 24.055 -2.331  1.336   1.00 53.35  ? 380  SER A CB    1 
ATOM   3010 O  OG    . SER A 1 383 ? 24.449 -1.985  2.653   1.00 53.75  ? 380  SER A OG    1 
ATOM   3011 N  N     . LEU A 1 384 ? 25.033 -2.876  -1.704  1.00 45.79  ? 381  LEU A N     1 
ATOM   3012 C  CA    . LEU A 1 384 ? 24.573 -3.052  -3.074  1.00 39.58  ? 381  LEU A CA    1 
ATOM   3013 C  C     . LEU A 1 384 ? 25.564 -2.507  -4.094  1.00 37.11  ? 381  LEU A C     1 
ATOM   3014 O  O     . LEU A 1 384 ? 26.025 -1.383  -3.961  1.00 29.98  ? 381  LEU A O     1 
ATOM   3015 C  CB    . LEU A 1 384 ? 23.237 -2.354  -3.272  1.00 38.82  ? 381  LEU A CB    1 
ATOM   3016 C  CG    . LEU A 1 384 ? 22.897 -2.299  -4.757  1.00 43.37  ? 381  LEU A CG    1 
ATOM   3017 C  CD1   . LEU A 1 384 ? 22.308 -3.624  -5.143  1.00 48.13  ? 381  LEU A CD1   1 
ATOM   3018 C  CD2   . LEU A 1 384 ? 21.978 -1.159  -5.117  1.00 45.35  ? 381  LEU A CD2   1 
ATOM   3019 N  N     . ARG A 1 385 ? 25.869 -3.293  -5.123  1.00 31.34  ? 382  ARG A N     1 
ATOM   3020 C  CA    . ARG A 1 385 ? 26.773 -2.853  -6.177  1.00 23.80  ? 382  ARG A CA    1 
ATOM   3021 C  C     . ARG A 1 385 ? 26.174 -3.133  -7.549  1.00 30.15  ? 382  ARG A C     1 
ATOM   3022 O  O     . ARG A 1 385 ? 25.855 -4.275  -7.870  1.00 36.77  ? 382  ARG A O     1 
ATOM   3023 C  CB    . ARG A 1 385 ? 28.130 -3.544  -6.042  1.00 36.77  ? 382  ARG A CB    1 
ATOM   3024 C  CG    . ARG A 1 385 ? 29.029 -3.340  -7.241  1.00 42.99  ? 382  ARG A CG    1 
ATOM   3025 C  CD    . ARG A 1 385 ? 30.413 -3.918  -7.015  1.00 54.45  ? 382  ARG A CD    1 
ATOM   3026 N  NE    . ARG A 1 385 ? 30.879 -3.721  -5.644  1.00 61.69  ? 382  ARG A NE    1 
ATOM   3027 C  CZ    . ARG A 1 385 ? 31.955 -3.012  -5.314  1.00 66.41  ? 382  ARG A CZ    1 
ATOM   3028 N  NH1   . ARG A 1 385 ? 32.306 -2.892  -4.042  1.00 66.24  ? 382  ARG A NH1   1 
ATOM   3029 N  NH2   . ARG A 1 385 ? 32.681 -2.422  -6.255  1.00 62.83  ? 382  ARG A NH2   1 
ATOM   3030 N  N     . ARG A 1 386 ? 26.013 -2.086  -8.349  1.00 25.69  ? 383  ARG A N     1 
ATOM   3031 C  CA    . ARG A 1 386 ? 25.405 -2.213  -9.670  1.00 29.27  ? 383  ARG A CA    1 
ATOM   3032 C  C     . ARG A 1 386 ? 26.268 -1.501  -10.701 1.00 27.47  ? 383  ARG A C     1 
ATOM   3033 O  O     . ARG A 1 386 ? 26.795 -0.431  -10.436 1.00 23.68  ? 383  ARG A O     1 
ATOM   3034 C  CB    . ARG A 1 386 ? 23.992 -1.626  -9.680  1.00 31.92  ? 383  ARG A CB    1 
ATOM   3035 C  CG    . ARG A 1 386 ? 23.008 -2.302  -8.739  1.00 39.35  ? 383  ARG A CG    1 
ATOM   3036 C  CD    . ARG A 1 386 ? 22.417 -3.542  -9.376  1.00 31.34  ? 383  ARG A CD    1 
ATOM   3037 N  NE    . ARG A 1 386 ? 21.211 -3.994  -8.692  1.00 27.95  ? 383  ARG A NE    1 
ATOM   3038 C  CZ    . ARG A 1 386 ? 21.167 -5.015  -7.843  1.00 40.90  ? 383  ARG A CZ    1 
ATOM   3039 N  NH1   . ARG A 1 386 ? 22.271 -5.703  -7.561  1.00 38.91  ? 383  ARG A NH1   1 
ATOM   3040 N  NH2   . ARG A 1 386 ? 20.015 -5.350  -7.274  1.00 40.31  ? 383  ARG A NH2   1 
ATOM   3041 N  N     A CYS A 1 387 ? 26.423 -2.105  -11.874 0.70 27.18  ? 384  CYS A N     1 
ATOM   3042 N  N     B CYS A 1 387 ? 26.419 -2.102  -11.876 0.30 27.10  ? 384  CYS A N     1 
ATOM   3043 C  CA    . CYS A 1 387 ? 27.188 -1.467  -12.939 1.00 23.78  ? 384  CYS A CA    1 
ATOM   3044 C  C     . CYS A 1 387 ? 26.267 -0.911  -14.019 1.00 26.41  ? 384  CYS A C     1 
ATOM   3045 O  O     . CYS A 1 387 ? 25.141 -1.375  -14.188 1.00 29.12  ? 384  CYS A O     1 
ATOM   3046 C  CB    . CYS A 1 387 ? 28.182 -2.454  -13.555 1.00 26.01  ? 384  CYS A CB    1 
ATOM   3047 S  SG    A CYS A 1 387 ? 27.436 -3.741  -14.580 0.70 28.01  ? 384  CYS A SG    1 
ATOM   3048 S  SG    B CYS A 1 387 ? 29.209 -3.330  -12.359 0.30 33.08  ? 384  CYS A SG    1 
ATOM   3049 N  N     . CYS A 1 388 ? 26.751 0.100   -14.731 1.00 26.15  ? 385  CYS A N     1 
ATOM   3050 C  CA    . CYS A 1 388 ? 26.104 0.591   -15.947 1.00 30.47  ? 385  CYS A CA    1 
ATOM   3051 C  C     . CYS A 1 388 ? 27.176 1.120   -16.899 1.00 27.25  ? 385  CYS A C     1 
ATOM   3052 O  O     . CYS A 1 388 ? 28.346 1.179   -16.541 1.00 25.55  ? 385  CYS A O     1 
ATOM   3053 C  CB    . CYS A 1 388 ? 25.072 1.673   -15.630 1.00 23.47  ? 385  CYS A CB    1 
ATOM   3054 S  SG    . CYS A 1 388 ? 25.769 3.128   -14.831 1.00 28.78  ? 385  CYS A SG    1 
ATOM   3055 N  N     . ALA A 1 389 ? 26.786 1.508   -18.109 1.00 28.40  ? 386  ALA A N     1 
ATOM   3056 C  CA    . ALA A 1 389 ? 27.766 1.975   -19.088 1.00 26.20  ? 386  ALA A CA    1 
ATOM   3057 C  C     . ALA A 1 389 ? 28.341 3.338   -18.715 1.00 30.73  ? 386  ALA A C     1 
ATOM   3058 O  O     . ALA A 1 389 ? 27.640 4.197   -18.181 1.00 33.90  ? 386  ALA A O     1 
ATOM   3059 C  CB    . ALA A 1 389 ? 27.138 2.030   -20.481 1.00 26.60  ? 386  ALA A CB    1 
ATOM   3060 N  N     . LEU A 1 390 ? 29.627 3.525   -18.986 1.00 24.30  ? 387  LEU A N     1 
ATOM   3061 C  CA    . LEU A 1 390 ? 30.259 4.833   -18.871 1.00 26.00  ? 387  LEU A CA    1 
ATOM   3062 C  C     . LEU A 1 390 ? 30.727 5.259   -20.259 1.00 26.82  ? 387  LEU A C     1 
ATOM   3063 O  O     . LEU A 1 390 ? 31.767 4.807   -20.731 1.00 26.29  ? 387  LEU A O     1 
ATOM   3064 C  CB    . LEU A 1 390 ? 31.434 4.788   -17.895 1.00 25.17  ? 387  LEU A CB    1 
ATOM   3065 C  CG    . LEU A 1 390 ? 31.889 6.021   -17.108 1.00 24.18  ? 387  LEU A CG    1 
ATOM   3066 C  CD1   . LEU A 1 390 ? 33.026 5.608   -16.177 1.00 25.19  ? 387  LEU A CD1   1 
ATOM   3067 C  CD2   . LEU A 1 390 ? 32.325 7.179   -18.002 1.00 24.33  ? 387  LEU A CD2   1 
ATOM   3068 N  N     . THR A 1 391 ? 29.959 6.124   -20.913 1.00 29.48  ? 388  THR A N     1 
ATOM   3069 C  CA    . THR A 1 391 ? 30.228 6.453   -22.311 1.00 35.69  ? 388  THR A CA    1 
ATOM   3070 C  C     . THR A 1 391 ? 30.767 7.869   -22.504 1.00 33.15  ? 388  THR A C     1 
ATOM   3071 O  O     . THR A 1 391 ? 31.378 8.177   -23.530 1.00 37.87  ? 388  THR A O     1 
ATOM   3072 C  CB    . THR A 1 391 ? 28.959 6.287   -23.164 1.00 39.78  ? 388  THR A CB    1 
ATOM   3073 O  OG1   . THR A 1 391 ? 27.964 7.220   -22.724 1.00 44.80  ? 388  THR A OG1   1 
ATOM   3074 C  CG2   . THR A 1 391 ? 28.416 4.864   -23.040 1.00 33.68  ? 388  THR A CG2   1 
ATOM   3075 N  N     . ARG A 1 392 ? 30.524 8.729   -21.522 1.00 35.33  ? 389  ARG A N     1 
ATOM   3076 C  CA    . ARG A 1 392 ? 31.023 10.097  -21.559 1.00 28.19  ? 389  ARG A CA    1 
ATOM   3077 C  C     . ARG A 1 392 ? 31.585 10.503  -20.207 1.00 29.05  ? 389  ARG A C     1 
ATOM   3078 O  O     . ARG A 1 392 ? 30.997 10.210  -19.167 1.00 34.97  ? 389  ARG A O     1 
ATOM   3079 C  CB    . ARG A 1 392 ? 29.920 11.077  -21.964 1.00 37.93  ? 389  ARG A CB    1 
ATOM   3080 C  CG    . ARG A 1 392 ? 29.760 11.260  -23.460 1.00 46.73  ? 389  ARG A CG    1 
ATOM   3081 C  CD    . ARG A 1 392 ? 28.976 12.526  -23.765 1.00 51.98  ? 389  ARG A CD    1 
ATOM   3082 N  NE    . ARG A 1 392 ? 28.617 12.611  -25.177 1.00 62.36  ? 389  ARG A NE    1 
ATOM   3083 C  CZ    . ARG A 1 392 ? 27.513 12.088  -25.700 1.00 57.60  ? 389  ARG A CZ    1 
ATOM   3084 N  NH1   . ARG A 1 392 ? 27.270 12.211  -26.999 1.00 51.49  ? 389  ARG A NH1   1 
ATOM   3085 N  NH2   . ARG A 1 392 ? 26.651 11.442  -24.924 1.00 54.57  ? 389  ARG A NH2   1 
ATOM   3086 N  N     . TYR A 1 393 ? 32.725 11.181  -20.230 1.00 26.47  ? 390  TYR A N     1 
ATOM   3087 C  CA    . TYR A 1 393 ? 33.287 11.764  -19.020 1.00 26.21  ? 390  TYR A CA    1 
ATOM   3088 C  C     . TYR A 1 393 ? 32.536 13.048  -18.697 1.00 31.98  ? 390  TYR A C     1 
ATOM   3089 O  O     . TYR A 1 393 ? 33.037 14.158  -18.922 1.00 27.14  ? 390  TYR A O     1 
ATOM   3090 C  CB    . TYR A 1 393 ? 34.784 12.033  -19.183 1.00 27.35  ? 390  TYR A CB    1 
ATOM   3091 C  CG    . TYR A 1 393 ? 35.658 10.796  -19.105 1.00 29.05  ? 390  TYR A CG    1 
ATOM   3092 C  CD1   . TYR A 1 393 ? 37.041 10.904  -19.075 1.00 26.25  ? 390  TYR A CD1   1 
ATOM   3093 C  CD2   . TYR A 1 393 ? 35.102 9.525   -19.052 1.00 28.20  ? 390  TYR A CD2   1 
ATOM   3094 C  CE1   . TYR A 1 393 ? 37.845 9.780   -19.001 1.00 19.16  ? 390  TYR A CE1   1 
ATOM   3095 C  CE2   . TYR A 1 393 ? 35.900 8.396   -18.976 1.00 29.10  ? 390  TYR A CE2   1 
ATOM   3096 C  CZ    . TYR A 1 393 ? 37.272 8.531   -18.948 1.00 25.92  ? 390  TYR A CZ    1 
ATOM   3097 O  OH    . TYR A 1 393 ? 38.070 7.408   -18.866 1.00 25.89  ? 390  TYR A OH    1 
ATOM   3098 N  N     . ASP A 1 394 ? 31.318 12.882  -18.194 1.00 23.50  ? 391  ASP A N     1 
ATOM   3099 C  CA    . ASP A 1 394 ? 30.479 14.007  -17.812 1.00 27.14  ? 391  ASP A CA    1 
ATOM   3100 C  C     . ASP A 1 394 ? 29.886 13.718  -16.443 1.00 20.76  ? 391  ASP A C     1 
ATOM   3101 O  O     . ASP A 1 394 ? 29.153 12.737  -16.274 1.00 25.89  ? 391  ASP A O     1 
ATOM   3102 C  CB    . ASP A 1 394 ? 29.376 14.241  -18.846 1.00 28.60  ? 391  ASP A CB    1 
ATOM   3103 C  CG    . ASP A 1 394 ? 28.621 15.528  -18.605 1.00 33.91  ? 391  ASP A CG    1 
ATOM   3104 O  OD1   . ASP A 1 394 ? 27.917 15.621  -17.580 1.00 30.91  ? 391  ASP A OD1   1 
ATOM   3105 O  OD2   . ASP A 1 394 ? 28.733 16.449  -19.441 1.00 59.43  ? 391  ASP A OD2   1 
ATOM   3106 N  N     . ALA A 1 395 ? 30.221 14.558  -15.470 1.00 23.50  ? 392  ALA A N     1 
ATOM   3107 C  CA    . ALA A 1 395 ? 29.784 14.359  -14.088 1.00 21.09  ? 392  ALA A CA    1 
ATOM   3108 C  C     . ALA A 1 395 ? 28.255 14.338  -13.931 1.00 20.70  ? 392  ALA A C     1 
ATOM   3109 O  O     . ALA A 1 395 ? 27.722 13.522  -13.188 1.00 19.91  ? 392  ALA A O     1 
ATOM   3110 C  CB    . ALA A 1 395 ? 30.385 15.429  -13.190 1.00 21.28  ? 392  ALA A CB    1 
ATOM   3111 N  N     . HIS A 1 396 ? 27.549 15.231  -14.619 1.00 28.62  ? 393  HIS A N     1 
ATOM   3112 C  CA    . HIS A 1 396 ? 26.095 15.266  -14.477 1.00 27.76  ? 393  HIS A CA    1 
ATOM   3113 C  C     . HIS A 1 396 ? 25.459 13.997  -15.047 1.00 21.09  ? 393  HIS A C     1 
ATOM   3114 O  O     . HIS A 1 396 ? 24.514 13.451  -14.464 1.00 23.99  ? 393  HIS A O     1 
ATOM   3115 C  CB    . HIS A 1 396 ? 25.513 16.525  -15.134 1.00 26.96  ? 393  HIS A CB    1 
ATOM   3116 C  CG    . HIS A 1 396 ? 25.699 17.766  -14.313 1.00 31.37  ? 393  HIS A CG    1 
ATOM   3117 N  ND1   . HIS A 1 396 ? 26.706 18.679  -14.549 1.00 37.08  ? 393  HIS A ND1   1 
ATOM   3118 C  CD2   . HIS A 1 396 ? 25.029 18.222  -13.227 1.00 32.73  ? 393  HIS A CD2   1 
ATOM   3119 C  CE1   . HIS A 1 396 ? 26.633 19.656  -13.662 1.00 32.33  ? 393  HIS A CE1   1 
ATOM   3120 N  NE2   . HIS A 1 396 ? 25.627 19.399  -12.845 1.00 35.23  ? 393  HIS A NE2   1 
ATOM   3121 N  N     . LYS A 1 397 ? 25.987 13.513  -16.167 1.00 21.89  ? 394  LYS A N     1 
ATOM   3122 C  CA    . LYS A 1 397 ? 25.502 12.250  -16.725 1.00 25.10  ? 394  LYS A CA    1 
ATOM   3123 C  C     . LYS A 1 397 ? 25.798 11.065  -15.812 1.00 20.21  ? 394  LYS A C     1 
ATOM   3124 O  O     . LYS A 1 397 ? 24.932 10.217  -15.577 1.00 23.33  ? 394  LYS A O     1 
ATOM   3125 C  CB    . LYS A 1 397 ? 26.099 11.988  -18.104 1.00 27.71  ? 394  LYS A CB    1 
ATOM   3126 C  CG    . LYS A 1 397 ? 25.720 10.612  -18.638 1.00 36.85  ? 394  LYS A CG    1 
ATOM   3127 C  CD    . LYS A 1 397 ? 26.157 10.390  -20.073 1.00 42.15  ? 394  LYS A CD    1 
ATOM   3128 C  CE    . LYS A 1 397 ? 25.855 8.961   -20.502 1.00 42.98  ? 394  LYS A CE    1 
ATOM   3129 N  NZ    . LYS A 1 397 ? 24.452 8.565   -20.174 1.00 45.40  ? 394  LYS A NZ    1 
ATOM   3130 N  N     . MET A 1 398 ? 27.022 11.002  -15.296 1.00 22.53  ? 395  MET A N     1 
ATOM   3131 C  CA    . MET A 1 398 ? 27.397 9.904   -14.419 1.00 21.23  ? 395  MET A CA    1 
ATOM   3132 C  C     . MET A 1 398 ? 26.561 9.896   -13.138 1.00 21.07  ? 395  MET A C     1 
ATOM   3133 O  O     . MET A 1 398 ? 26.152 8.833   -12.682 1.00 23.13  ? 395  MET A O     1 
ATOM   3134 C  CB    . MET A 1 398 ? 28.893 9.965   -14.087 1.00 19.59  ? 395  MET A CB    1 
ATOM   3135 C  CG    . MET A 1 398 ? 29.791 9.580   -15.259 1.00 16.82  ? 395  MET A CG    1 
ATOM   3136 S  SD    . MET A 1 398 ? 31.485 9.281   -14.740 1.00 23.72  ? 395  MET A SD    1 
ATOM   3137 C  CE    . MET A 1 398 ? 32.023 10.939  -14.330 1.00 25.56  ? 395  MET A CE    1 
ATOM   3138 N  N     . SER A 1 399 ? 26.296 11.071  -12.571 1.00 24.74  ? 396  SER A N     1 
ATOM   3139 C  CA    . SER A 1 399 ? 25.528 11.139  -11.328 1.00 20.86  ? 396  SER A CA    1 
ATOM   3140 C  C     . SER A 1 399 ? 24.054 10.841  -11.586 1.00 17.15  ? 396  SER A C     1 
ATOM   3141 O  O     . SER A 1 399 ? 23.389 10.213  -10.762 1.00 20.76  ? 396  SER A O     1 
ATOM   3142 C  CB    . SER A 1 399 ? 25.682 12.511  -10.647 1.00 21.15  ? 396  SER A CB    1 
ATOM   3143 O  OG    . SER A 1 399 ? 25.171 13.572  -11.435 1.00 28.93  ? 396  SER A OG    1 
ATOM   3144 N  N     . HIS A 1 400 ? 23.552 11.275  -12.736 1.00 23.25  ? 397  HIS A N     1 
ATOM   3145 C  CA    . HIS A 1 400 ? 22.182 10.938  -13.108 1.00 23.84  ? 397  HIS A CA    1 
ATOM   3146 C  C     . HIS A 1 400 ? 22.046 9.429   -13.333 1.00 24.94  ? 397  HIS A C     1 
ATOM   3147 O  O     . HIS A 1 400 ? 21.093 8.805   -12.881 1.00 28.61  ? 397  HIS A O     1 
ATOM   3148 C  CB    . HIS A 1 400 ? 21.759 11.713  -14.355 1.00 28.20  ? 397  HIS A CB    1 
ATOM   3149 C  CG    . HIS A 1 400 ? 20.370 11.401  -14.807 1.00 36.24  ? 397  HIS A CG    1 
ATOM   3150 N  ND1   . HIS A 1 400 ? 20.104 10.512  -15.828 1.00 35.81  ? 397  HIS A ND1   1 
ATOM   3151 C  CD2   . HIS A 1 400 ? 19.169 11.837  -14.363 1.00 36.59  ? 397  HIS A CD2   1 
ATOM   3152 C  CE1   . HIS A 1 400 ? 18.797 10.425  -16.000 1.00 39.27  ? 397  HIS A CE1   1 
ATOM   3153 N  NE2   . HIS A 1 400 ? 18.206 11.218  -15.125 1.00 38.34  ? 397  HIS A NE2   1 
ATOM   3154 N  N     . ASP A 1 401 ? 23.025 8.844   -14.012 1.00 27.01  ? 398  ASP A N     1 
ATOM   3155 C  CA    . ASP A 1 401 ? 23.052 7.401   -14.230 1.00 24.52  ? 398  ASP A CA    1 
ATOM   3156 C  C     . ASP A 1 401 ? 23.152 6.608   -12.930 1.00 24.66  ? 398  ASP A C     1 
ATOM   3157 O  O     . ASP A 1 401 ? 22.503 5.571   -12.786 1.00 28.00  ? 398  ASP A O     1 
ATOM   3158 C  CB    . ASP A 1 401 ? 24.212 7.020   -15.149 1.00 20.61  ? 398  ASP A CB    1 
ATOM   3159 C  CG    . ASP A 1 401 ? 23.970 7.427   -16.598 1.00 36.06  ? 398  ASP A CG    1 
ATOM   3160 O  OD1   . ASP A 1 401 ? 22.809 7.722   -16.943 1.00 31.50  ? 398  ASP A OD1   1 
ATOM   3161 O  OD2   . ASP A 1 401 ? 24.935 7.442   -17.394 1.00 29.01  ? 398  ASP A OD2   1 
ATOM   3162 N  N     . ALA A 1 402 ? 23.967 7.081   -11.987 1.00 23.43  ? 399  ALA A N     1 
ATOM   3163 C  CA    . ALA A 1 402 ? 24.134 6.366   -10.729 1.00 24.75  ? 399  ALA A CA    1 
ATOM   3164 C  C     . ALA A 1 402 ? 22.831 6.350   -9.943  1.00 19.17  ? 399  ALA A C     1 
ATOM   3165 O  O     . ALA A 1 402 ? 22.491 5.344   -9.311  1.00 22.98  ? 399  ALA A O     1 
ATOM   3166 C  CB    . ALA A 1 402 ? 25.250 6.993   -9.894  1.00 23.20  ? 399  ALA A CB    1 
ATOM   3167 N  N     . PHE A 1 403 ? 22.118 7.475   -9.975  1.00 22.13  ? 400  PHE A N     1 
ATOM   3168 C  CA    . PHE A 1 403 ? 20.839 7.608   -9.285  1.00 25.25  ? 400  PHE A CA    1 
ATOM   3169 C  C     . PHE A 1 403 ? 19.812 6.645   -9.869  1.00 27.76  ? 400  PHE A C     1 
ATOM   3170 O  O     . PHE A 1 403 ? 19.075 5.991   -9.135  1.00 29.90  ? 400  PHE A O     1 
ATOM   3171 C  CB    . PHE A 1 403 ? 20.339 9.048   -9.377  1.00 19.35  ? 400  PHE A CB    1 
ATOM   3172 C  CG    . PHE A 1 403 ? 19.068 9.303   -8.616  1.00 39.43  ? 400  PHE A CG    1 
ATOM   3173 C  CD1   . PHE A 1 403 ? 17.882 9.558   -9.285  1.00 34.33  ? 400  PHE A CD1   1 
ATOM   3174 C  CD2   . PHE A 1 403 ? 19.056 9.272   -7.229  1.00 36.32  ? 400  PHE A CD2   1 
ATOM   3175 C  CE1   . PHE A 1 403 ? 16.710 9.799   -8.584  1.00 42.83  ? 400  PHE A CE1   1 
ATOM   3176 C  CE2   . PHE A 1 403 ? 17.884 9.506   -6.523  1.00 43.48  ? 400  PHE A CE2   1 
ATOM   3177 C  CZ    . PHE A 1 403 ? 16.712 9.770   -7.204  1.00 38.74  ? 400  PHE A CZ    1 
ATOM   3178 N  N     . THR A 1 404 ? 19.785 6.557   -11.192 1.00 27.76  ? 401  THR A N     1 
ATOM   3179 C  CA    . THR A 1 404 ? 18.900 5.628   -11.881 1.00 34.38  ? 401  THR A CA    1 
ATOM   3180 C  C     . THR A 1 404 ? 19.122 4.180   -11.438 1.00 30.99  ? 401  THR A C     1 
ATOM   3181 O  O     . THR A 1 404 ? 18.161 3.435   -11.231 1.00 37.04  ? 401  THR A O     1 
ATOM   3182 C  CB    . THR A 1 404 ? 19.077 5.723   -13.413 1.00 30.11  ? 401  THR A CB    1 
ATOM   3183 O  OG1   . THR A 1 404 ? 18.748 7.051   -13.845 1.00 31.66  ? 401  THR A OG1   1 
ATOM   3184 C  CG2   . THR A 1 404 ? 18.171 4.728   -14.121 1.00 35.69  ? 401  THR A CG2   1 
ATOM   3185 N  N     . VAL A 1 405 ? 20.374 3.767   -11.274 1.00 29.21  ? 402  VAL A N     1 
ATOM   3186 C  CA    . VAL A 1 405 ? 20.612 2.368   -10.944 1.00 31.16  ? 402  VAL A CA    1 
ATOM   3187 C  C     . VAL A 1 405 ? 20.381 2.075   -9.459  1.00 36.31  ? 402  VAL A C     1 
ATOM   3188 O  O     . VAL A 1 405 ? 20.180 0.920   -9.093  1.00 37.68  ? 402  VAL A O     1 
ATOM   3189 C  CB    . VAL A 1 405 ? 22.030 1.904   -11.353 1.00 39.32  ? 402  VAL A CB    1 
ATOM   3190 C  CG1   . VAL A 1 405 ? 22.344 2.365   -12.765 1.00 33.17  ? 402  VAL A CG1   1 
ATOM   3191 C  CG2   . VAL A 1 405 ? 23.072 2.409   -10.382 1.00 39.67  ? 402  VAL A CG2   1 
ATOM   3192 N  N     . ILE A 1 406 ? 20.384 3.101   -8.607  1.00 30.05  ? 403  ILE A N     1 
ATOM   3193 C  CA    . ILE A 1 406 ? 20.085 2.879   -7.190  1.00 39.26  ? 403  ILE A CA    1 
ATOM   3194 C  C     . ILE A 1 406 ? 18.676 3.317   -6.771  1.00 38.41  ? 403  ILE A C     1 
ATOM   3195 O  O     . ILE A 1 406 ? 18.256 3.045   -5.648  1.00 34.05  ? 403  ILE A O     1 
ATOM   3196 C  CB    . ILE A 1 406 ? 21.101 3.598   -6.264  1.00 37.28  ? 403  ILE A CB    1 
ATOM   3197 C  CG1   . ILE A 1 406 ? 20.847 5.108   -6.236  1.00 28.05  ? 403  ILE A CG1   1 
ATOM   3198 C  CG2   . ILE A 1 406 ? 22.524 3.266   -6.666  1.00 25.19  ? 403  ILE A CG2   1 
ATOM   3199 C  CD1   . ILE A 1 406 ? 21.662 5.839   -5.160  1.00 31.37  ? 403  ILE A CD1   1 
ATOM   3200 N  N     . LYS A 1 407 ? 17.949 3.976   -7.669  1.00 37.38  ? 404  LYS A N     1 
ATOM   3201 C  CA    . LYS A 1 407 ? 16.637 4.555   -7.344  1.00 45.83  ? 404  LYS A CA    1 
ATOM   3202 C  C     . LYS A 1 407 ? 15.683 3.617   -6.605  1.00 47.94  ? 404  LYS A C     1 
ATOM   3203 O  O     . LYS A 1 407 ? 14.987 4.025   -5.670  1.00 46.59  ? 404  LYS A O     1 
ATOM   3204 C  CB    . LYS A 1 407 ? 15.942 5.035   -8.615  1.00 44.80  ? 404  LYS A CB    1 
ATOM   3205 C  CG    . LYS A 1 407 ? 15.906 6.532   -8.728  1.00 52.56  ? 404  LYS A CG    1 
ATOM   3206 C  CD    . LYS A 1 407 ? 14.994 7.013   -9.847  1.00 63.29  ? 404  LYS A CD    1 
ATOM   3207 C  CE    . LYS A 1 407 ? 13.533 6.731   -9.540  1.00 68.01  ? 404  LYS A CE    1 
ATOM   3208 N  NZ    . LYS A 1 407 ? 12.710 6.693   -10.781 1.00 74.01  ? 404  LYS A NZ    1 
ATOM   3209 N  N     . ASN A 1 408 ? 15.661 2.362   -7.032  1.00 43.31  ? 405  ASN A N     1 
ATOM   3210 C  CA    . ASN A 1 408 ? 14.713 1.386   -6.514  1.00 49.78  ? 405  ASN A CA    1 
ATOM   3211 C  C     . ASN A 1 408 ? 15.105 0.816   -5.157  1.00 49.35  ? 405  ASN A C     1 
ATOM   3212 O  O     . ASN A 1 408 ? 14.489 -0.133  -4.677  1.00 46.22  ? 405  ASN A O     1 
ATOM   3213 C  CB    . ASN A 1 408 ? 14.553 0.246   -7.515  1.00 54.86  ? 405  ASN A CB    1 
ATOM   3214 C  CG    . ASN A 1 408 ? 15.887 -0.311  -7.974  1.00 64.44  ? 405  ASN A CG    1 
ATOM   3215 O  OD1   . ASN A 1 408 ? 16.864 0.425   -8.128  1.00 57.75  ? 405  ASN A OD1   1 
ATOM   3216 N  ND2   . ASN A 1 408 ? 15.940 -1.621  -8.170  1.00 70.00  ? 405  ASN A ND2   1 
ATOM   3217 N  N     . CYS A 1 409 ? 16.139 1.384   -4.546  1.00 48.28  ? 406  CYS A N     1 
ATOM   3218 C  CA    . CYS A 1 409 ? 16.572 0.947   -3.224  1.00 46.73  ? 406  CYS A CA    1 
ATOM   3219 C  C     . CYS A 1 409 ? 15.834 1.689   -2.131  1.00 44.43  ? 406  CYS A C     1 
ATOM   3220 O  O     . CYS A 1 409 ? 15.784 1.235   -0.990  1.00 52.87  ? 406  CYS A O     1 
ATOM   3221 C  CB    . CYS A 1 409 ? 18.073 1.149   -3.048  1.00 50.98  ? 406  CYS A CB    1 
ATOM   3222 S  SG    . CYS A 1 409 ? 19.051 0.034   -4.033  1.00 49.68  ? 406  CYS A SG    1 
ATOM   3223 N  N     . ASN A 1 410 ? 15.279 2.842   -2.483  1.00 40.76  ? 407  ASN A N     1 
ATOM   3224 C  CA    . ASN A 1 410 ? 14.464 3.610   -1.557  1.00 44.66  ? 407  ASN A CA    1 
ATOM   3225 C  C     . ASN A 1 410 ? 13.166 2.858   -1.250  1.00 50.32  ? 407  ASN A C     1 
ATOM   3226 O  O     . ASN A 1 410 ? 12.299 2.730   -2.112  1.00 50.67  ? 407  ASN A O     1 
ATOM   3227 C  CB    . ASN A 1 410 ? 14.171 4.995   -2.136  1.00 33.69  ? 407  ASN A CB    1 
ATOM   3228 C  CG    . ASN A 1 410 ? 13.539 5.923   -1.130  1.00 42.81  ? 407  ASN A CG    1 
ATOM   3229 O  OD1   . ASN A 1 410 ? 13.426 5.593   0.051   1.00 51.80  ? 407  ASN A OD1   1 
ATOM   3230 N  ND2   . ASN A 1 410 ? 13.130 7.102   -1.589  1.00 45.44  ? 407  ASN A ND2   1 
ATOM   3231 N  N     . THR A 1 411 ? 13.052 2.345   -0.028  1.00 54.18  ? 408  THR A N     1 
ATOM   3232 C  CA    . THR A 1 411 ? 11.888 1.558   0.372   1.00 55.54  ? 408  THR A CA    1 
ATOM   3233 C  C     . THR A 1 411 ? 10.744 2.456   0.806   1.00 61.68  ? 408  THR A C     1 
ATOM   3234 O  O     . THR A 1 411 ? 9.657  1.979   1.128   1.00 68.19  ? 408  THR A O     1 
ATOM   3235 C  CB    . THR A 1 411 ? 12.219 0.582   1.526   1.00 57.13  ? 408  THR A CB    1 
ATOM   3236 O  OG1   . THR A 1 411 ? 12.292 1.299   2.766   1.00 58.02  ? 408  THR A OG1   1 
ATOM   3237 C  CG2   . THR A 1 411 ? 13.531 -0.147  1.270   1.00 60.87  ? 408  THR A CG2   1 
ATOM   3238 N  N     . SER A 1 412 ? 10.996 3.758   0.820   1.00 60.16  ? 409  SER A N     1 
ATOM   3239 C  CA    . SER A 1 412 ? 9.986  4.717   1.224   1.00 68.42  ? 409  SER A CA    1 
ATOM   3240 C  C     . SER A 1 412 ? 8.904  4.787   0.156   1.00 75.52  ? 409  SER A C     1 
ATOM   3241 O  O     . SER A 1 412 ? 9.196  4.696   -1.037  1.00 73.64  ? 409  SER A O     1 
ATOM   3242 C  CB    . SER A 1 412 ? 10.612 6.091   1.454   1.00 67.91  ? 409  SER A CB    1 
ATOM   3243 O  OG    . SER A 1 412 ? 9.770  6.906   2.245   1.00 74.36  ? 409  SER A OG    1 
ATOM   3244 N  N     . GLY A 1 413 ? 7.655  4.923   0.585   1.00 81.02  ? 410  GLY A N     1 
ATOM   3245 C  CA    . GLY A 1 413 ? 6.559  5.070   -0.351  1.00 83.88  ? 410  GLY A CA    1 
ATOM   3246 C  C     . GLY A 1 413 ? 6.704  6.384   -1.090  1.00 83.46  ? 410  GLY A C     1 
ATOM   3247 O  O     . GLY A 1 413 ? 6.555  6.449   -2.309  1.00 81.27  ? 410  GLY A O     1 
ATOM   3248 N  N     . ILE A 1 414 ? 7.007  7.428   -0.322  1.00 87.08  ? 411  ILE A N     1 
ATOM   3249 C  CA    . ILE A 1 414 ? 7.194  8.780   -0.832  1.00 90.64  ? 411  ILE A CA    1 
ATOM   3250 C  C     . ILE A 1 414 ? 8.453  8.878   -1.687  1.00 90.13  ? 411  ILE A C     1 
ATOM   3251 O  O     . ILE A 1 414 ? 9.413  8.123   -1.512  1.00 84.12  ? 411  ILE A O     1 
ATOM   3252 C  CB    . ILE A 1 414 ? 7.241  9.809   0.337   1.00 87.08  ? 411  ILE A CB    1 
ATOM   3253 C  CG1   . ILE A 1 414 ? 7.631  11.214  -0.142  1.00 82.81  ? 411  ILE A CG1   1 
ATOM   3254 C  CG2   . ILE A 1 414 ? 8.132  9.322   1.447   1.00 85.18  ? 411  ILE A CG2   1 
ATOM   3255 C  CD1   . ILE A 1 414 ? 7.199  12.318  0.771   1.00 82.32  ? 411  ILE A CD1   1 
ATOM   3256 N  N     . GLN A 1 415 ? 8.431  9.808   -2.631  1.00 95.80  ? 412  GLN A N     1 
ATOM   3257 C  CA    . GLN A 1 415 ? 9.493  9.980   -3.609  1.00 92.11  ? 412  GLN A CA    1 
ATOM   3258 C  C     . GLN A 1 415 ? 10.634 10.810  -2.989  1.00 84.49  ? 412  GLN A C     1 
ATOM   3259 O  O     . GLN A 1 415 ? 11.811 10.565  -3.243  1.00 80.19  ? 412  GLN A O     1 
ATOM   3260 C  CB    . GLN A 1 415 ? 8.922  10.666  -4.863  1.00 97.67  ? 412  GLN A CB    1 
ATOM   3261 C  CG    . GLN A 1 415 ? 7.410  10.417  -5.076  1.00 106.98 ? 412  GLN A CG    1 
ATOM   3262 C  CD    . GLN A 1 415 ? 6.553  11.282  -4.145  1.00 110.51 ? 412  GLN A CD    1 
ATOM   3263 O  OE1   . GLN A 1 415 ? 7.078  12.060  -3.336  1.00 107.67 ? 412  GLN A OE1   1 
ATOM   3264 N  NE2   . GLN A 1 415 ? 5.240  11.164  -4.273  1.00 113.22 ? 412  GLN A NE2   1 
ATOM   3265 N  N     . THR A 1 416 ? 10.249 11.755  -2.132  1.00 78.54  ? 413  THR A N     1 
ATOM   3266 C  CA    . THR A 1 416 ? 11.112 12.813  -1.616  1.00 71.47  ? 413  THR A CA    1 
ATOM   3267 C  C     . THR A 1 416 ? 12.049 12.323  -0.517  1.00 64.36  ? 413  THR A C     1 
ATOM   3268 O  O     . THR A 1 416 ? 13.165 12.815  -0.371  1.00 57.44  ? 413  THR A O     1 
ATOM   3269 C  CB    . THR A 1 416 ? 10.252 13.966  -1.067  1.00 67.55  ? 413  THR A CB    1 
ATOM   3270 O  OG1   . THR A 1 416 ? 9.322  14.382  -2.075  1.00 75.21  ? 413  THR A OG1   1 
ATOM   3271 C  CG2   . THR A 1 416 ? 11.116 15.136  -0.668  1.00 68.48  ? 413  THR A CG2   1 
ATOM   3272 N  N     . GLU A 1 417 ? 11.588 11.340  0.247   1.00 64.96  ? 414  GLU A N     1 
ATOM   3273 C  CA    . GLU A 1 417 ? 12.372 10.773  1.337   1.00 56.95  ? 414  GLU A CA    1 
ATOM   3274 C  C     . GLU A 1 417 ? 13.163 9.581   0.850   1.00 55.83  ? 414  GLU A C     1 
ATOM   3275 O  O     . GLU A 1 417 ? 12.742 8.876   -0.067  1.00 58.59  ? 414  GLU A O     1 
ATOM   3276 C  CB    . GLU A 1 417 ? 11.470 10.356  2.499   1.00 62.51  ? 414  GLU A CB    1 
ATOM   3277 C  CG    . GLU A 1 417 ? 10.560 11.467  2.964   1.00 66.37  ? 414  GLU A CG    1 
ATOM   3278 C  CD    . GLU A 1 417 ? 11.309 12.762  3.190   1.00 68.60  ? 414  GLU A CD    1 
ATOM   3279 O  OE1   . GLU A 1 417 ? 12.109 12.823  4.149   1.00 65.43  ? 414  GLU A OE1   1 
ATOM   3280 O  OE2   . GLU A 1 417 ? 11.089 13.721  2.418   1.00 68.46  ? 414  GLU A OE2   1 
ATOM   3281 N  N     . TRP A 1 418 ? 14.321 9.366   1.459   1.00 41.28  ? 415  TRP A N     1 
ATOM   3282 C  CA    . TRP A 1 418 ? 15.079 8.164   1.200   1.00 38.02  ? 415  TRP A CA    1 
ATOM   3283 C  C     . TRP A 1 418 ? 15.153 7.332   2.469   1.00 38.67  ? 415  TRP A C     1 
ATOM   3284 O  O     . TRP A 1 418 ? 15.609 7.808   3.509   1.00 41.38  ? 415  TRP A O     1 
ATOM   3285 C  CB    . TRP A 1 418 ? 16.482 8.492   0.696   1.00 39.14  ? 415  TRP A CB    1 
ATOM   3286 C  CG    . TRP A 1 418 ? 17.087 7.332   0.012   1.00 37.66  ? 415  TRP A CG    1 
ATOM   3287 C  CD1   . TRP A 1 418 ? 17.543 6.192   0.594   1.00 25.44  ? 415  TRP A CD1   1 
ATOM   3288 C  CD2   . TRP A 1 418 ? 17.280 7.174   -1.395  1.00 29.80  ? 415  TRP A CD2   1 
ATOM   3289 N  NE1   . TRP A 1 418 ? 18.016 5.329   -0.361  1.00 32.62  ? 415  TRP A NE1   1 
ATOM   3290 C  CE2   . TRP A 1 418 ? 17.869 5.910   -1.592  1.00 30.68  ? 415  TRP A CE2   1 
ATOM   3291 C  CE3   . TRP A 1 418 ? 17.021 7.980   -2.506  1.00 35.04  ? 415  TRP A CE3   1 
ATOM   3292 C  CZ2   . TRP A 1 418 ? 18.204 5.430   -2.858  1.00 36.01  ? 415  TRP A CZ2   1 
ATOM   3293 C  CZ3   . TRP A 1 418 ? 17.354 7.501   -3.765  1.00 38.11  ? 415  TRP A CZ3   1 
ATOM   3294 C  CH2   . TRP A 1 418 ? 17.942 6.240   -3.928  1.00 30.93  ? 415  TRP A CH2   1 
ATOM   3295 N  N     . SER A 1 419 ? 14.691 6.091   2.383   1.00 45.93  ? 416  SER A N     1 
ATOM   3296 C  CA    . SER A 1 419 ? 14.727 5.195   3.527   1.00 45.70  ? 416  SER A CA    1 
ATOM   3297 C  C     . SER A 1 419 ? 14.920 3.754   3.062   1.00 49.54  ? 416  SER A C     1 
ATOM   3298 O  O     . SER A 1 419 ? 14.388 3.366   2.020   1.00 46.72  ? 416  SER A O     1 
ATOM   3299 C  CB    . SER A 1 419 ? 13.447 5.328   4.355   1.00 59.22  ? 416  SER A CB    1 
ATOM   3300 O  OG    . SER A 1 419 ? 13.462 4.451   5.467   1.00 63.00  ? 416  SER A OG    1 
ATOM   3301 N  N     . PRO A 1 420 ? 15.709 2.963   3.816   1.00 49.72  ? 417  PRO A N     1 
ATOM   3302 C  CA    . PRO A 1 420 ? 16.488 3.408   4.980   1.00 49.75  ? 417  PRO A CA    1 
ATOM   3303 C  C     . PRO A 1 420 ? 17.676 4.259   4.543   1.00 39.72  ? 417  PRO A C     1 
ATOM   3304 O  O     . PRO A 1 420 ? 18.227 4.005   3.472   1.00 42.64  ? 417  PRO A O     1 
ATOM   3305 C  CB    . PRO A 1 420 ? 16.962 2.098   5.618   1.00 49.47  ? 417  PRO A CB    1 
ATOM   3306 C  CG    . PRO A 1 420 ? 16.910 1.096   4.523   1.00 52.01  ? 417  PRO A CG    1 
ATOM   3307 C  CD    . PRO A 1 420 ? 15.790 1.505   3.621   1.00 53.89  ? 417  PRO A CD    1 
ATOM   3308 N  N     . PRO A 1 421 ? 18.061 5.249   5.364   1.00 36.04  ? 418  PRO A N     1 
ATOM   3309 C  CA    . PRO A 1 421 ? 19.071 6.259   5.017   1.00 31.82  ? 418  PRO A CA    1 
ATOM   3310 C  C     . PRO A 1 421 ? 20.390 5.655   4.541   1.00 24.71  ? 418  PRO A C     1 
ATOM   3311 O  O     . PRO A 1 421 ? 20.795 4.594   5.020   1.00 26.84  ? 418  PRO A O     1 
ATOM   3312 C  CB    . PRO A 1 421 ? 19.272 7.018   6.332   1.00 36.21  ? 418  PRO A CB    1 
ATOM   3313 C  CG    . PRO A 1 421 ? 18.032 6.764   7.118   1.00 39.69  ? 418  PRO A CG    1 
ATOM   3314 C  CD    . PRO A 1 421 ? 17.615 5.378   6.761   1.00 41.20  ? 418  PRO A CD    1 
ATOM   3315 N  N     . LEU A 1 422 ? 21.045 6.344   3.609   1.00 28.07  ? 419  LEU A N     1 
ATOM   3316 C  CA    . LEU A 1 422 ? 22.296 5.872   3.017   1.00 25.29  ? 419  LEU A CA    1 
ATOM   3317 C  C     . LEU A 1 422 ? 23.496 6.302   3.841   1.00 20.69  ? 419  LEU A C     1 
ATOM   3318 O  O     . LEU A 1 422 ? 23.635 7.478   4.191   1.00 25.63  ? 419  LEU A O     1 
ATOM   3319 C  CB    . LEU A 1 422 ? 22.439 6.391   1.583   1.00 20.80  ? 419  LEU A CB    1 
ATOM   3320 C  CG    . LEU A 1 422 ? 21.317 5.976   0.623   1.00 24.89  ? 419  LEU A CG    1 
ATOM   3321 C  CD1   . LEU A 1 422 ? 21.621 6.395   -0.812  1.00 27.65  ? 419  LEU A CD1   1 
ATOM   3322 C  CD2   . LEU A 1 422 ? 21.074 4.480   0.710   1.00 28.18  ? 419  LEU A CD2   1 
ATOM   3323 N  N     . THR A 1 423 ? 24.369 5.348   4.133   1.00 25.80  ? 420  THR A N     1 
ATOM   3324 C  CA    . THR A 1 423 ? 25.548 5.618   4.953   1.00 20.90  ? 420  THR A CA    1 
ATOM   3325 C  C     . THR A 1 423 ? 26.846 5.520   4.140   1.00 21.02  ? 420  THR A C     1 
ATOM   3326 O  O     . THR A 1 423 ? 27.943 5.656   4.687   1.00 20.82  ? 420  THR A O     1 
ATOM   3327 C  CB    . THR A 1 423 ? 25.610 4.655   6.154   1.00 26.24  ? 420  THR A CB    1 
ATOM   3328 O  OG1   . THR A 1 423 ? 25.452 3.304   5.696   1.00 30.22  ? 420  THR A OG1   1 
ATOM   3329 C  CG2   . THR A 1 423 ? 24.489 4.974   7.136   1.00 28.45  ? 420  THR A CG2   1 
ATOM   3330 N  N     . MET A 1 424 ? 26.712 5.263   2.840   1.00 19.22  ? 421  MET A N     1 
ATOM   3331 C  CA    . MET A 1 424 ? 27.867 5.276   1.943   1.00 20.46  ? 421  MET A CA    1 
ATOM   3332 C  C     . MET A 1 424 ? 27.436 5.404   0.487   1.00 23.31  ? 421  MET A C     1 
ATOM   3333 O  O     . MET A 1 424 ? 26.445 4.809   0.060   1.00 22.02  ? 421  MET A O     1 
ATOM   3334 C  CB    . MET A 1 424 ? 28.719 4.013   2.129   1.00 22.29  ? 421  MET A CB    1 
ATOM   3335 C  CG    . MET A 1 424 ? 30.007 3.970   1.294   1.00 23.38  ? 421  MET A CG    1 
ATOM   3336 S  SD    . MET A 1 424 ? 29.735 3.247   -0.344  1.00 21.94  ? 421  MET A SD    1 
ATOM   3337 C  CE    . MET A 1 424 ? 29.291 1.547   0.065   1.00 25.33  ? 421  MET A CE    1 
ATOM   3338 N  N     . LEU A 1 425 ? 28.196 6.194   -0.265  1.00 16.55  ? 422  LEU A N     1 
ATOM   3339 C  CA    . LEU A 1 425 ? 28.083 6.266   -1.712  1.00 15.66  ? 422  LEU A CA    1 
ATOM   3340 C  C     . LEU A 1 425 ? 29.465 6.001   -2.309  1.00 16.50  ? 422  LEU A C     1 
ATOM   3341 O  O     . LEU A 1 425 ? 30.481 6.429   -1.746  1.00 18.93  ? 422  LEU A O     1 
ATOM   3342 C  CB    . LEU A 1 425 ? 27.574 7.631   -2.166  1.00 17.14  ? 422  LEU A CB    1 
ATOM   3343 C  CG    . LEU A 1 425 ? 26.194 8.033   -1.672  1.00 19.73  ? 422  LEU A CG    1 
ATOM   3344 C  CD1   . LEU A 1 425 ? 25.903 9.466   -2.082  1.00 19.46  ? 422  LEU A CD1   1 
ATOM   3345 C  CD2   . LEU A 1 425 ? 25.149 7.081   -2.241  1.00 19.10  ? 422  LEU A CD2   1 
ATOM   3346 N  N     . PHE A 1 426 ? 29.500 5.297   -3.436  1.00 16.56  ? 423  PHE A N     1 
ATOM   3347 C  CA    . PHE A 1 426 ? 30.752 4.896   -4.073  1.00 18.99  ? 423  PHE A CA    1 
ATOM   3348 C  C     . PHE A 1 426 ? 30.563 4.909   -5.577  1.00 19.05  ? 423  PHE A C     1 
ATOM   3349 O  O     . PHE A 1 426 ? 29.643 4.271   -6.093  1.00 21.19  ? 423  PHE A O     1 
ATOM   3350 C  CB    . PHE A 1 426 ? 31.170 3.499   -3.589  1.00 18.69  ? 423  PHE A CB    1 
ATOM   3351 C  CG    . PHE A 1 426 ? 32.455 2.986   -4.184  1.00 23.05  ? 423  PHE A CG    1 
ATOM   3352 C  CD1   . PHE A 1 426 ? 32.621 1.629   -4.409  1.00 43.77  ? 423  PHE A CD1   1 
ATOM   3353 C  CD2   . PHE A 1 426 ? 33.505 3.836   -4.475  1.00 21.43  ? 423  PHE A CD2   1 
ATOM   3354 C  CE1   . PHE A 1 426 ? 33.797 1.138   -4.945  1.00 36.07  ? 423  PHE A CE1   1 
ATOM   3355 C  CE2   . PHE A 1 426 ? 34.687 3.353   -5.008  1.00 26.65  ? 423  PHE A CE2   1 
ATOM   3356 C  CZ    . PHE A 1 426 ? 34.831 2.004   -5.242  1.00 32.35  ? 423  PHE A CZ    1 
ATOM   3357 N  N     . LEU A 1 427 ? 31.407 5.659   -6.278  1.00 14.68  ? 424  LEU A N     1 
ATOM   3358 C  CA    . LEU A 1 427 ? 31.421 5.643   -7.732  1.00 17.62  ? 424  LEU A CA    1 
ATOM   3359 C  C     . LEU A 1 427 ? 32.774 5.155   -8.201  1.00 16.95  ? 424  LEU A C     1 
ATOM   3360 O  O     . LEU A 1 427 ? 33.800 5.652   -7.740  1.00 20.48  ? 424  LEU A O     1 
ATOM   3361 C  CB    . LEU A 1 427 ? 31.151 7.027   -8.311  1.00 16.84  ? 424  LEU A CB    1 
ATOM   3362 C  CG    . LEU A 1 427 ? 29.765 7.617   -8.088  1.00 19.23  ? 424  LEU A CG    1 
ATOM   3363 C  CD1   . LEU A 1 427 ? 29.687 8.956   -8.804  1.00 19.27  ? 424  LEU A CD1   1 
ATOM   3364 C  CD2   . LEU A 1 427 ? 28.655 6.664   -8.567  1.00 22.53  ? 424  LEU A CD2   1 
ATOM   3365 N  N     . CYS A 1 428 ? 32.792 4.204   -9.130  1.00 16.65  ? 425  CYS A N     1 
ATOM   3366 C  CA    . CYS A 1 428 ? 34.065 3.684   -9.609  1.00 18.09  ? 425  CYS A CA    1 
ATOM   3367 C  C     . CYS A 1 428 ? 34.058 3.449   -11.114 1.00 17.81  ? 425  CYS A C     1 
ATOM   3368 O  O     . CYS A 1 428 ? 33.156 2.810   -11.644 1.00 22.51  ? 425  CYS A O     1 
ATOM   3369 C  CB    . CYS A 1 428 ? 34.409 2.387   -8.879  1.00 19.93  ? 425  CYS A CB    1 
ATOM   3370 S  SG    . CYS A 1 428 ? 36.095 1.768   -9.175  1.00 25.65  ? 425  CYS A SG    1 
ATOM   3371 N  N     . ALA A 1 429 ? 35.089 3.920   -11.775 1.00 16.12  ? 426  ALA A N     1 
ATOM   3372 C  CA    . ALA A 1 429 ? 35.260 3.771   -13.182 1.00 16.20  ? 426  ALA A CA    1 
ATOM   3373 C  C     . ALA A 1 429 ? 36.214 2.598   -13.426 1.00 20.61  ? 426  ALA A C     1 
ATOM   3374 O  O     . ALA A 1 429 ? 37.235 2.522   -12.826 1.00 20.74  ? 426  ALA A O     1 
ATOM   3375 C  CB    . ALA A 1 429 ? 35.833 5.042   -13.772 1.00 18.81  ? 426  ALA A CB    1 
ATOM   3376 N  N     . THR A 1 430 ? 35.823 1.726   -14.340 1.00 19.19  ? 427  THR A N     1 
ATOM   3377 C  CA    . THR A 1 430 ? 36.513 0.467   -14.570 1.00 21.34  ? 427  THR A CA    1 
ATOM   3378 C  C     . THR A 1 430 ? 36.522 0.083   -16.049 1.00 25.16  ? 427  THR A C     1 
ATOM   3379 O  O     . THR A 1 430 ? 36.018 0.782   -16.848 1.00 22.82  ? 427  THR A O     1 
ATOM   3380 C  CB    . THR A 1 430 ? 35.851 -0.664  -13.773 1.00 21.51  ? 427  THR A CB    1 
ATOM   3381 O  OG1   . THR A 1 430 ? 34.604 -0.959  -14.353 1.00 25.87  ? 427  THR A OG1   1 
ATOM   3382 C  CG2   . THR A 1 430 ? 35.579 -0.272  -12.350 1.00 23.65  ? 427  THR A CG2   1 
ATOM   3383 N  N     . LYS A 1 431 ? 37.148 -1.046  -16.352 1.00 24.05  ? 428  LYS A N     1 
ATOM   3384 C  CA    . LYS A 1 431 ? 37.235 -1.572  -17.712 1.00 27.09  ? 428  LYS A CA    1 
ATOM   3385 C  C     . LYS A 1 431 ? 37.835 -0.625  -18.739 1.00 23.67  ? 428  LYS A C     1 
ATOM   3386 O  O     . LYS A 1 431 ? 37.155 -0.142  -19.602 1.00 24.65  ? 428  LYS A O     1 
ATOM   3387 C  CB    . LYS A 1 431 ? 35.909 -2.098  -18.170 1.00 23.76  ? 428  LYS A CB    1 
ATOM   3388 C  CG    . LYS A 1 431 ? 35.373 -3.159  -17.251 1.00 32.90  ? 428  LYS A CG    1 
ATOM   3389 C  CD    . LYS A 1 431 ? 34.189 -3.867  -17.861 1.00 34.92  ? 428  LYS A CD    1 
ATOM   3390 C  CE    . LYS A 1 431 ? 33.480 -4.843  -16.953 1.00 47.50  ? 428  LYS A CE    1 
ATOM   3391 N  NZ    . LYS A 1 431 ? 34.350 -5.857  -16.351 1.00 42.67  ? 428  LYS A NZ    1 
ATOM   3392 N  N     . PHE A 1 432 ? 39.089 -0.290  -18.551 1.00 21.04  ? 429  PHE A N     1 
ATOM   3393 C  CA    . PHE A 1 432 ? 39.792 0.630   -19.434 1.00 16.02  ? 429  PHE A CA    1 
ATOM   3394 C  C     . PHE A 1 432 ? 40.133 0.054   -20.802 1.00 27.71  ? 429  PHE A C     1 
ATOM   3395 O  O     . PHE A 1 432 ? 40.419 -1.095  -20.912 1.00 31.19  ? 429  PHE A O     1 
ATOM   3396 C  CB    . PHE A 1 432 ? 41.039 1.199   -18.790 1.00 22.43  ? 429  PHE A CB    1 
ATOM   3397 C  CG    . PHE A 1 432 ? 40.761 2.175   -17.680 1.00 25.13  ? 429  PHE A CG    1 
ATOM   3398 C  CD1   . PHE A 1 432 ? 40.887 3.497   -17.887 1.00 21.28  ? 429  PHE A CD1   1 
ATOM   3399 C  CD2   . PHE A 1 432 ? 40.346 1.754   -16.454 1.00 30.32  ? 429  PHE A CD2   1 
ATOM   3400 C  CE1   . PHE A 1 432 ? 40.635 4.412   -16.906 1.00 28.77  ? 429  PHE A CE1   1 
ATOM   3401 C  CE2   . PHE A 1 432 ? 40.088 2.661   -15.445 1.00 25.20  ? 429  PHE A CE2   1 
ATOM   3402 C  CZ    . PHE A 1 432 ? 40.253 4.006   -15.671 1.00 27.37  ? 429  PHE A CZ    1 
ATOM   3403 N  N     . SER A 1 433 ? 40.091 0.915   -21.807 1.00 23.93  ? 430  SER A N     1 
ATOM   3404 C  CA    . SER A 1 433 ? 40.550 0.569   -23.150 1.00 23.59  ? 430  SER A CA    1 
ATOM   3405 C  C     . SER A 1 433 ? 41.546 1.619   -23.622 1.00 23.07  ? 430  SER A C     1 
ATOM   3406 O  O     . SER A 1 433 ? 41.482 2.777   -23.195 1.00 26.84  ? 430  SER A O     1 
ATOM   3407 C  CB    . SER A 1 433 ? 39.373 0.468   -24.124 1.00 31.67  ? 430  SER A CB    1 
ATOM   3408 O  OG    . SER A 1 433 ? 38.385 -0.430  -23.649 1.00 45.86  ? 430  SER A OG    1 
ATOM   3409 N  N     . ALA A 1 434 ? 42.473 1.223   -24.489 1.00 27.25  ? 431  ALA A N     1 
ATOM   3410 C  CA    . ALA A 1 434 ? 43.443 2.170   -25.024 1.00 35.73  ? 431  ALA A CA    1 
ATOM   3411 C  C     . ALA A 1 434 ? 42.721 3.222   -25.862 1.00 41.54  ? 431  ALA A C     1 
ATOM   3412 O  O     . ALA A 1 434 ? 41.740 2.915   -26.541 1.00 41.36  ? 431  ALA A O     1 
ATOM   3413 C  CB    . ALA A 1 434 ? 44.500 1.451   -25.849 1.00 29.68  ? 431  ALA A CB    1 
ATOM   3414 N  N     . SER A 1 435 ? 43.196 4.461   -25.800 1.00 36.95  ? 432  SER A N     1 
ATOM   3415 C  CA    . SER A 1 435 ? 42.581 5.542   -26.567 1.00 40.42  ? 432  SER A CA    1 
ATOM   3416 C  C     . SER A 1 435 ? 43.604 6.603   -26.970 1.00 40.42  ? 432  SER A C     1 
ATOM   3417 O  O     . SER A 1 435 ? 43.268 7.576   -27.640 1.00 51.55  ? 432  SER A O     1 
ATOM   3418 C  CB    . SER A 1 435 ? 41.442 6.182   -25.770 1.00 44.12  ? 432  SER A CB    1 
ATOM   3419 O  OG    . SER A 1 435 ? 41.943 7.021   -24.744 1.00 48.79  ? 432  SER A OG    1 
ATOM   3420 O  OXT   . SER A 1 435 ? 44.786 6.522   -26.642 1.00 41.06  ? 432  SER A OXT   1 
ATOM   3421 O  "O3'" . DC  B 2 1   ? 27.434 4.886   11.827  1.00 65.30  ? 1    DC  T "O3'" 1 
ATOM   3422 P  P     . DA  B 2 2   ? 27.924 4.448   13.295  1.00 92.29  ? 2    DA  T P     1 
ATOM   3423 O  OP1   . DA  B 2 2   ? 27.989 2.968   13.335  1.00 91.98  ? 2    DA  T OP1   1 
ATOM   3424 O  OP2   . DA  B 2 2   ? 27.096 5.178   14.281  1.00 90.34  ? 2    DA  T OP2   1 
ATOM   3425 O  "O5'" . DA  B 2 2   ? 29.410 5.032   13.396  1.00 75.43  ? 2    DA  T "O5'" 1 
ATOM   3426 C  "C5'" . DA  B 2 2   ? 30.449 4.507   12.576  1.00 68.14  ? 2    DA  T "C5'" 1 
ATOM   3427 C  "C4'" . DA  B 2 2   ? 31.784 5.157   12.908  1.00 60.14  ? 2    DA  T "C4'" 1 
ATOM   3428 O  "O4'" . DA  B 2 2   ? 31.720 6.576   12.618  1.00 54.52  ? 2    DA  T "O4'" 1 
ATOM   3429 C  "C3'" . DA  B 2 2   ? 32.208 5.059   14.368  1.00 62.37  ? 2    DA  T "C3'" 1 
ATOM   3430 O  "O3'" . DA  B 2 2   ? 33.617 5.024   14.454  1.00 61.92  ? 2    DA  T "O3'" 1 
ATOM   3431 C  "C2'" . DA  B 2 2   ? 31.652 6.345   14.966  1.00 55.58  ? 2    DA  T "C2'" 1 
ATOM   3432 C  "C1'" . DA  B 2 2   ? 31.848 7.323   13.815  1.00 50.91  ? 2    DA  T "C1'" 1 
ATOM   3433 N  N9    . DA  B 2 2   ? 30.862 8.396   13.792  1.00 44.76  ? 2    DA  T N9    1 
ATOM   3434 C  C8    . DA  B 2 2   ? 29.635 8.408   14.396  1.00 48.88  ? 2    DA  T C8    1 
ATOM   3435 N  N7    . DA  B 2 2   ? 28.960 9.517   14.198  1.00 45.38  ? 2    DA  T N7    1 
ATOM   3436 C  C5    . DA  B 2 2   ? 29.805 10.282  13.410  1.00 41.54  ? 2    DA  T C5    1 
ATOM   3437 C  C6    . DA  B 2 2   ? 29.680 11.571  12.854  1.00 41.94  ? 2    DA  T C6    1 
ATOM   3438 N  N6    . DA  B 2 2   ? 28.601 12.345  13.020  1.00 43.54  ? 2    DA  T N6    1 
ATOM   3439 N  N1    . DA  B 2 2   ? 30.709 12.034  12.119  1.00 41.27  ? 2    DA  T N1    1 
ATOM   3440 C  C2    . DA  B 2 2   ? 31.786 11.257  11.954  1.00 34.41  ? 2    DA  T C2    1 
ATOM   3441 N  N3    . DA  B 2 2   ? 32.017 10.037  12.423  1.00 36.11  ? 2    DA  T N3    1 
ATOM   3442 C  C4    . DA  B 2 2   ? 30.980 9.604   13.153  1.00 40.59  ? 2    DA  T C4    1 
ATOM   3443 P  P     . DT  B 2 3   ? 34.349 3.730   15.051  1.00 61.32  ? 3    DT  T P     1 
ATOM   3444 O  OP1   . DT  B 2 3   ? 33.317 2.680   15.207  1.00 66.42  ? 3    DT  T OP1   1 
ATOM   3445 O  OP2   . DT  B 2 3   ? 35.150 4.175   16.214  1.00 62.99  ? 3    DT  T OP2   1 
ATOM   3446 O  "O5'" . DT  B 2 3   ? 35.364 3.288   13.892  1.00 74.41  ? 3    DT  T "O5'" 1 
ATOM   3447 C  "C5'" . DT  B 2 3   ? 36.701 3.797   13.870  1.00 67.63  ? 3    DT  T "C5'" 1 
ATOM   3448 C  "C4'" . DT  B 2 3   ? 36.866 4.851   12.788  1.00 62.42  ? 3    DT  T "C4'" 1 
ATOM   3449 O  "O4'" . DT  B 2 3   ? 38.272 4.971   12.450  1.00 64.38  ? 3    DT  T "O4'" 1 
ATOM   3450 C  "C3'" . DT  B 2 3   ? 36.127 4.550   11.480  1.00 62.03  ? 3    DT  T "C3'" 1 
ATOM   3451 O  "O3'" . DT  B 2 3   ? 35.302 5.634   11.105  1.00 42.71  ? 3    DT  T "O3'" 1 
ATOM   3452 C  "C2'" . DT  B 2 3   ? 37.233 4.328   10.457  1.00 61.71  ? 3    DT  T "C2'" 1 
ATOM   3453 C  "C1'" . DT  B 2 3   ? 38.419 5.063   11.053  1.00 65.46  ? 3    DT  T "C1'" 1 
ATOM   3454 N  N1    . DT  B 2 3   ? 39.705 4.428   10.668  1.00 67.29  ? 3    DT  T N1    1 
ATOM   3455 C  C2    . DT  B 2 3   ? 40.718 5.195   10.135  1.00 65.53  ? 3    DT  T C2    1 
ATOM   3456 O  O2    . DT  B 2 3   ? 40.637 6.403   9.978   1.00 61.10  ? 3    DT  T O2    1 
ATOM   3457 N  N3    . DT  B 2 3   ? 41.848 4.492   9.803   1.00 68.05  ? 3    DT  T N3    1 
ATOM   3458 C  C4    . DT  B 2 3   ? 42.054 3.127   9.939   1.00 69.31  ? 3    DT  T C4    1 
ATOM   3459 O  O4    . DT  B 2 3   ? 43.104 2.586   9.614   1.00 71.22  ? 3    DT  T O4    1 
ATOM   3460 C  C5    . DT  B 2 3   ? 40.945 2.386   10.492  1.00 69.21  ? 3    DT  T C5    1 
ATOM   3461 C  C7    . DT  B 2 3   ? 41.049 0.901   10.691  1.00 71.49  ? 3    DT  T C7    1 
ATOM   3462 C  C6    . DT  B 2 3   ? 39.841 3.064   10.823  1.00 67.62  ? 3    DT  T C6    1 
ATOM   3463 P  P     . DT  B 2 4   ? 34.472 5.561   9.732   1.00 46.35  ? 4    DT  T P     1 
ATOM   3464 O  OP1   . DT  B 2 4   ? 33.295 6.445   9.853   1.00 44.19  ? 4    DT  T OP1   1 
ATOM   3465 O  OP2   . DT  B 2 4   ? 34.350 4.142   9.344   1.00 40.66  ? 4    DT  T OP2   1 
ATOM   3466 O  "O5'" . DT  B 2 4   ? 35.429 6.223   8.649   1.00 24.08  ? 4    DT  T "O5'" 1 
ATOM   3467 C  "C5'" . DT  B 2 4   ? 35.663 7.617   8.659   1.00 16.22  ? 4    DT  T "C5'" 1 
ATOM   3468 C  "C4'" . DT  B 2 4   ? 36.417 8.016   7.408   1.00 15.98  ? 4    DT  T "C4'" 1 
ATOM   3469 O  "O4'" . DT  B 2 4   ? 37.659 7.279   7.343   1.00 16.11  ? 4    DT  T "O4'" 1 
ATOM   3470 C  "C3'" . DT  B 2 4   ? 35.701 7.727   6.094   1.00 17.82  ? 4    DT  T "C3'" 1 
ATOM   3471 O  "O3'" . DT  B 2 4   ? 36.010 8.769   5.191   1.00 15.82  ? 4    DT  T "O3'" 1 
ATOM   3472 C  "C2'" . DT  B 2 4   ? 36.302 6.389   5.659   1.00 18.53  ? 4    DT  T "C2'" 1 
ATOM   3473 C  "C1'" . DT  B 2 4   ? 37.735 6.575   6.119   1.00 17.23  ? 4    DT  T "C1'" 1 
ATOM   3474 N  N1    . DT  B 2 4   ? 38.493 5.328   6.366   1.00 15.64  ? 4    DT  T N1    1 
ATOM   3475 C  C2    . DT  B 2 4   ? 39.797 5.290   5.957   1.00 17.82  ? 4    DT  T C2    1 
ATOM   3476 O  O2    . DT  B 2 4   ? 40.335 6.213   5.365   1.00 16.43  ? 4    DT  T O2    1 
ATOM   3477 N  N3    . DT  B 2 4   ? 40.457 4.141   6.250   1.00 17.10  ? 4    DT  T N3    1 
ATOM   3478 C  C4    . DT  B 2 4   ? 39.972 3.041   6.912   1.00 19.39  ? 4    DT  T C4    1 
ATOM   3479 O  O4    . DT  B 2 4   ? 40.663 2.059   7.121   1.00 19.72  ? 4    DT  T O4    1 
ATOM   3480 C  C5    . DT  B 2 4   ? 38.595 3.141   7.347   1.00 19.99  ? 4    DT  T C5    1 
ATOM   3481 C  C7    . DT  B 2 4   ? 37.954 1.993   8.077   1.00 18.99  ? 4    DT  T C7    1 
ATOM   3482 C  C6    . DT  B 2 4   ? 37.923 4.276   7.057   1.00 17.74  ? 4    DT  T C6    1 
ATOM   3483 P  P     . DA  B 2 5   ? 35.383 8.800   3.715   1.00 16.54  ? 5    DA  T P     1 
ATOM   3484 O  OP1   . DA  B 2 5   ? 35.106 10.222  3.411   1.00 20.26  ? 5    DA  T OP1   1 
ATOM   3485 O  OP2   . DA  B 2 5   ? 34.321 7.773   3.625   1.00 16.65  ? 5    DA  T OP2   1 
ATOM   3486 O  "O5'" . DA  B 2 5   ? 36.597 8.309   2.798   1.00 15.93  ? 5    DA  T "O5'" 1 
ATOM   3487 C  "C5'" . DA  B 2 5   ? 37.733 9.138   2.634   1.00 15.47  ? 5    DA  T "C5'" 1 
ATOM   3488 C  "C4'" . DA  B 2 5   ? 38.678 8.532   1.626   1.00 14.44  ? 5    DA  T "C4'" 1 
ATOM   3489 O  "O4'" . DA  B 2 5   ? 39.285 7.336   2.193   1.00 16.92  ? 5    DA  T "O4'" 1 
ATOM   3490 C  "C3'" . DA  B 2 5   ? 38.030 8.092   0.314   1.00 14.35  ? 5    DA  T "C3'" 1 
ATOM   3491 O  "O3'" . DA  B 2 5   ? 38.914 8.370   -0.753  1.00 14.27  ? 5    DA  T "O3'" 1 
ATOM   3492 C  "C2'" . DA  B 2 5   ? 37.864 6.582   0.508   1.00 16.48  ? 5    DA  T "C2'" 1 
ATOM   3493 C  "C1'" . DA  B 2 5   ? 39.134 6.267   1.287   1.00 18.15  ? 5    DA  T "C1'" 1 
ATOM   3494 N  N9    . DA  B 2 5   ? 39.071 5.033   2.053   1.00 13.97  ? 5    DA  T N9    1 
ATOM   3495 C  C8    . DA  B 2 5   ? 38.004 4.539   2.751   1.00 17.07  ? 5    DA  T C8    1 
ATOM   3496 N  N7    . DA  B 2 5   ? 38.256 3.409   3.366   1.00 17.97  ? 5    DA  T N7    1 
ATOM   3497 C  C5    . DA  B 2 5   ? 39.587 3.159   3.055   1.00 15.08  ? 5    DA  T C5    1 
ATOM   3498 C  C6    . DA  B 2 5   ? 40.449 2.112   3.398   1.00 17.50  ? 5    DA  T C6    1 
ATOM   3499 N  N6    . DA  B 2 5   ? 40.083 1.091   4.172   1.00 21.87  ? 5    DA  T N6    1 
ATOM   3500 N  N1    . DA  B 2 5   ? 41.713 2.161   2.922   1.00 17.18  ? 5    DA  T N1    1 
ATOM   3501 C  C2    . DA  B 2 5   ? 42.072 3.193   2.149   1.00 15.09  ? 5    DA  T C2    1 
ATOM   3502 N  N3    . DA  B 2 5   ? 41.345 4.239   1.758   1.00 17.08  ? 5    DA  T N3    1 
ATOM   3503 C  C4    . DA  B 2 5   ? 40.098 4.151   2.254   1.00 15.07  ? 5    DA  T C4    1 
ATOM   3504 P  P     . DT  B 2 6   ? 38.403 8.391   -2.274  1.00 14.18  ? 6    DT  T P     1 
ATOM   3505 O  OP1   . DT  B 2 6   ? 39.549 8.821   -3.091  1.00 17.35  ? 6    DT  T OP1   1 
ATOM   3506 O  OP2   . DT  B 2 6   ? 37.127 9.126   -2.332  1.00 14.65  ? 6    DT  T OP2   1 
ATOM   3507 O  "O5'" . DT  B 2 6   ? 37.993 6.862   -2.532  1.00 16.49  ? 6    DT  T "O5'" 1 
ATOM   3508 C  "C5'" . DT  B 2 6   ? 38.670 6.078   -3.475  1.00 17.55  ? 6    DT  T "C5'" 1 
ATOM   3509 C  "C4'" . DT  B 2 6   ? 39.919 5.425   -2.905  1.00 19.25  ? 6    DT  T "C4'" 1 
ATOM   3510 O  "O4'" . DT  B 2 6   ? 39.619 4.731   -1.674  1.00 18.70  ? 6    DT  T "O4'" 1 
ATOM   3511 C  "C3'" . DT  B 2 6   ? 40.500 4.377   -3.839  1.00 20.81  ? 6    DT  T "C3'" 1 
ATOM   3512 O  "O3'" . DT  B 2 6   ? 41.617 4.899   -4.488  1.00 17.35  ? 6    DT  T "O3'" 1 
ATOM   3513 C  "C2'" . DT  B 2 6   ? 40.871 3.185   -2.953  1.00 22.92  ? 6    DT  T "C2'" 1 
ATOM   3514 C  "C1'" . DT  B 2 6   ? 40.493 3.633   -1.548  1.00 20.27  ? 6    DT  T "C1'" 1 
ATOM   3515 N  N1    . DT  B 2 6   ? 39.819 2.575   -0.766  1.00 17.70  ? 6    DT  T N1    1 
ATOM   3516 C  C2    . DT  B 2 6   ? 40.550 1.495   -0.358  1.00 14.05  ? 6    DT  T C2    1 
ATOM   3517 O  O2    . DT  B 2 6   ? 41.730 1.352   -0.621  1.00 20.31  ? 6    DT  T O2    1 
ATOM   3518 N  N3    . DT  B 2 6   ? 39.857 0.579   0.377   1.00 17.32  ? 6    DT  T N3    1 
ATOM   3519 C  C4    . DT  B 2 6   ? 38.523 0.627   0.732   1.00 19.49  ? 6    DT  T C4    1 
ATOM   3520 O  O4    . DT  B 2 6   ? 37.992 -0.248  1.406   1.00 21.66  ? 6    DT  T O4    1 
ATOM   3521 C  C5    . DT  B 2 6   ? 37.811 1.793   0.280   1.00 20.66  ? 6    DT  T C5    1 
ATOM   3522 C  C7    . DT  B 2 6   ? 36.358 1.954   0.611   1.00 22.15  ? 6    DT  T C7    1 
ATOM   3523 C  C6    . DT  B 2 6   ? 38.482 2.699   -0.446  1.00 17.96  ? 6    DT  T C6    1 
ATOM   3524 P  P     . DG  B 2 7   ? 41.809 4.600   -6.041  1.00 18.00  ? 7    DG  T P     1 
ATOM   3525 O  OP1   . DG  B 2 7   ? 43.013 5.356   -6.455  1.00 20.22  ? 7    DG  T OP1   1 
ATOM   3526 O  OP2   . DG  B 2 7   ? 40.541 4.693   -6.764  1.00 14.88  ? 7    DG  T OP2   1 
ATOM   3527 O  "O5'" . DG  B 2 7   ? 42.113 3.025   -6.082  1.00 18.72  ? 7    DG  T "O5'" 1 
ATOM   3528 C  "C5'" . DG  B 2 7   ? 43.382 2.562   -5.755  1.00 21.25  ? 7    DG  T "C5'" 1 
ATOM   3529 C  "C4'" . DG  B 2 7   ? 43.394 1.052   -5.731  1.00 15.33  ? 7    DG  T "C4'" 1 
ATOM   3530 O  "O4'" . DG  B 2 7   ? 42.697 0.579   -4.573  1.00 16.98  ? 7    DG  T "O4'" 1 
ATOM   3531 C  "C3'" . DG  B 2 7   ? 42.743 0.372   -6.938  1.00 21.01  ? 7    DG  T "C3'" 1 
ATOM   3532 O  "O3'" . DG  B 2 7   ? 43.732 -0.405  -7.591  1.00 21.37  ? 7    DG  T "O3'" 1 
ATOM   3533 C  "C2'" . DG  B 2 7   ? 41.635 -0.500  -6.315  1.00 21.57  ? 7    DG  T "C2'" 1 
ATOM   3534 C  "C1'" . DG  B 2 7   ? 42.141 -0.659  -4.892  1.00 21.49  ? 7    DG  T "C1'" 1 
ATOM   3535 N  N9    . DG  B 2 7   ? 41.108 -0.985  -3.913  1.00 21.90  ? 7    DG  T N9    1 
ATOM   3536 C  C8    . DG  B 2 7   ? 39.912 -0.338  -3.702  1.00 18.45  ? 7    DG  T C8    1 
ATOM   3537 N  N7    . DG  B 2 7   ? 39.201 -0.865  -2.742  1.00 20.62  ? 7    DG  T N7    1 
ATOM   3538 C  C5    . DG  B 2 7   ? 39.969 -1.944  -2.302  1.00 18.87  ? 7    DG  T C5    1 
ATOM   3539 C  C6    . DG  B 2 7   ? 39.706 -2.897  -1.289  1.00 15.79  ? 7    DG  T C6    1 
ATOM   3540 O  O6    . DG  B 2 7   ? 38.704 -2.985  -0.550  1.00 16.81  ? 7    DG  T O6    1 
ATOM   3541 N  N1    . DG  B 2 7   ? 40.745 -3.820  -1.169  1.00 15.36  ? 7    DG  T N1    1 
ATOM   3542 C  C2    . DG  B 2 7   ? 41.899 -3.816  -1.931  1.00 14.38  ? 7    DG  T C2    1 
ATOM   3543 N  N2    . DG  B 2 7   ? 42.799 -4.783  -1.666  1.00 16.87  ? 7    DG  T N2    1 
ATOM   3544 N  N3    . DG  B 2 7   ? 42.152 -2.929  -2.885  1.00 15.41  ? 7    DG  T N3    1 
ATOM   3545 C  C4    . DG  B 2 7   ? 41.144 -2.026  -3.012  1.00 17.37  ? 7    DG  T C4    1 
ATOM   3546 P  P     . DA  B 2 8   ? 43.387 -1.353  -8.838  1.00 18.47  ? 8    DA  T P     1 
ATOM   3547 O  OP1   . DA  B 2 8   ? 44.464 -1.095  -9.816  1.00 21.85  ? 8    DA  T OP1   1 
ATOM   3548 O  OP2   . DA  B 2 8   ? 41.962 -1.268  -9.265  1.00 20.30  ? 8    DA  T OP2   1 
ATOM   3549 O  "O5'" . DA  B 2 8   ? 43.678 -2.812  -8.263  1.00 17.49  ? 8    DA  T "O5'" 1 
ATOM   3550 C  "C5'" . DA  B 2 8   ? 44.998 -3.125  -7.829  1.00 17.97  ? 8    DA  T "C5'" 1 
ATOM   3551 C  "C4'" . DA  B 2 8   ? 45.058 -4.556  -7.356  1.00 19.69  ? 8    DA  T "C4'" 1 
ATOM   3552 O  "O4'" . DA  B 2 8   ? 44.186 -4.697  -6.207  1.00 22.47  ? 8    DA  T "O4'" 1 
ATOM   3553 C  "C3'" . DA  B 2 8   ? 44.593 -5.577  -8.396  1.00 25.43  ? 8    DA  T "C3'" 1 
ATOM   3554 O  "O3'" . DA  B 2 8   ? 45.470 -6.672  -8.430  1.00 23.82  ? 8    DA  T "O3'" 1 
ATOM   3555 C  "C2'" . DA  B 2 8   ? 43.208 -5.991  -7.912  1.00 20.96  ? 8    DA  T "C2'" 1 
ATOM   3556 C  "C1'" . DA  B 2 8   ? 43.295 -5.774  -6.406  1.00 19.00  ? 8    DA  T "C1'" 1 
ATOM   3557 N  N9    . DA  B 2 8   ? 42.011 -5.410  -5.834  1.00 17.41  ? 8    DA  T N9    1 
ATOM   3558 C  C8    . DA  B 2 8   ? 41.201 -4.376  -6.233  1.00 18.35  ? 8    DA  T C8    1 
ATOM   3559 N  N7    . DA  B 2 8   ? 40.094 -4.279  -5.546  1.00 16.62  ? 8    DA  T N7    1 
ATOM   3560 C  C5    . DA  B 2 8   ? 40.170 -5.326  -4.636  1.00 17.19  ? 8    DA  T C5    1 
ATOM   3561 C  C6    . DA  B 2 8   ? 39.295 -5.765  -3.620  1.00 17.67  ? 8    DA  T C6    1 
ATOM   3562 N  N6    . DA  B 2 8   ? 38.116 -5.174  -3.352  1.00 15.65  ? 8    DA  T N6    1 
ATOM   3563 N  N1    . DA  B 2 8   ? 39.671 -6.841  -2.885  1.00 18.69  ? 8    DA  T N1    1 
ATOM   3564 C  C2    . DA  B 2 8   ? 40.843 -7.430  -3.158  1.00 14.12  ? 8    DA  T C2    1 
ATOM   3565 N  N3    . DA  B 2 8   ? 41.760 -7.107  -4.082  1.00 15.87  ? 8    DA  T N3    1 
ATOM   3566 C  C4    . DA  B 2 8   ? 41.350 -6.030  -4.799  1.00 15.97  ? 8    DA  T C4    1 
ATOM   3567 P  P     . DC  B 2 9   ? 45.360 -7.772  -9.602  1.00 23.08  ? 9    DC  T P     1 
ATOM   3568 O  OP1   . DC  B 2 9   ? 46.736 -8.233  -9.872  1.00 25.00  ? 9    DC  T OP1   1 
ATOM   3569 O  OP2   . DC  B 2 9   ? 44.515 -7.280  -10.710 1.00 29.83  ? 9    DC  T OP2   1 
ATOM   3570 O  "O5'" . DC  B 2 9   ? 44.569 -8.955  -8.901  1.00 20.58  ? 9    DC  T "O5'" 1 
ATOM   3571 C  "C5'" . DC  B 2 9   ? 45.091 -9.480  -7.708  1.00 18.43  ? 9    DC  T "C5'" 1 
ATOM   3572 C  "C4'" . DC  B 2 9   ? 44.084 -10.382 -7.067  1.00 19.44  ? 9    DC  T "C4'" 1 
ATOM   3573 O  "O4'" . DC  B 2 9   ? 42.988 -9.587  -6.547  1.00 23.98  ? 9    DC  T "O4'" 1 
ATOM   3574 C  "C3'" . DC  B 2 9   ? 43.455 -11.404 -8.018  1.00 25.11  ? 9    DC  T "C3'" 1 
ATOM   3575 O  "O3'" . DC  B 2 9   ? 43.455 -12.645 -7.378  1.00 28.40  ? 9    DC  T "O3'" 1 
ATOM   3576 C  "C2'" . DC  B 2 9   ? 42.033 -10.869 -8.207  1.00 23.19  ? 9    DC  T "C2'" 1 
ATOM   3577 C  "C1'" . DC  B 2 9   ? 41.794 -10.263 -6.841  1.00 26.76  ? 9    DC  T "C1'" 1 
ATOM   3578 N  N1    . DC  B 2 9   ? 40.657 -9.308  -6.781  1.00 21.92  ? 9    DC  T N1    1 
ATOM   3579 C  C2    . DC  B 2 9   ? 39.728 -9.433  -5.752  1.00 20.89  ? 9    DC  T C2    1 
ATOM   3580 O  O2    . DC  B 2 9   ? 39.884 -10.333 -4.913  1.00 20.60  ? 9    DC  T O2    1 
ATOM   3581 N  N3    . DC  B 2 9   ? 38.686 -8.566  -5.695  1.00 19.36  ? 9    DC  T N3    1 
ATOM   3582 C  C4    . DC  B 2 9   ? 38.554 -7.613  -6.620  1.00 22.13  ? 9    DC  T C4    1 
ATOM   3583 N  N4    . DC  B 2 9   ? 37.502 -6.784  -6.524  1.00 21.06  ? 9    DC  T N4    1 
ATOM   3584 C  C5    . DC  B 2 9   ? 39.494 -7.470  -7.685  1.00 20.09  ? 9    DC  T C5    1 
ATOM   3585 C  C6    . DC  B 2 9   ? 40.522 -8.333  -7.726  1.00 20.83  ? 9    DC  T C6    1 
ATOM   3586 P  P     . DG  B 2 10  ? 43.180 -14.005 -8.181  1.00 26.01  ? 10   DG  T P     1 
ATOM   3587 O  OP1   . DG  B 2 10  ? 44.444 -14.755 -8.121  1.00 32.88  ? 10   DG  T OP1   1 
ATOM   3588 O  OP2   . DG  B 2 10  ? 42.489 -13.733 -9.460  1.00 29.04  ? 10   DG  T OP2   1 
ATOM   3589 O  "O5'" . DG  B 2 10  ? 42.136 -14.738 -7.246  1.00 24.79  ? 10   DG  T "O5'" 1 
ATOM   3590 C  "C5'" . DG  B 2 10  ? 42.306 -14.718 -5.848  1.00 23.12  ? 10   DG  T "C5'" 1 
ATOM   3591 C  "C4'" . DG  B 2 10  ? 41.100 -15.335 -5.180  1.00 25.70  ? 10   DG  T "C4'" 1 
ATOM   3592 O  "O4'" . DG  B 2 10  ? 40.080 -14.320 -4.999  1.00 27.85  ? 10   DG  T "O4'" 1 
ATOM   3593 C  "C3'" . DG  B 2 10  ? 40.441 -16.461 -5.979  1.00 34.74  ? 10   DG  T "C3'" 1 
ATOM   3594 O  "O3'" . DG  B 2 10  ? 39.975 -17.462 -5.100  1.00 34.34  ? 10   DG  T "O3'" 1 
ATOM   3595 C  "C2'" . DG  B 2 10  ? 39.291 -15.759 -6.698  1.00 34.30  ? 10   DG  T "C2'" 1 
ATOM   3596 C  "C1'" . DG  B 2 10  ? 38.901 -14.676 -5.703  1.00 28.18  ? 10   DG  T "C1'" 1 
ATOM   3597 N  N9    . DG  B 2 10  ? 38.370 -13.474 -6.344  1.00 24.22  ? 10   DG  T N9    1 
ATOM   3598 C  C8    . DG  B 2 10  ? 38.976 -12.727 -7.330  1.00 23.73  ? 10   DG  T C8    1 
ATOM   3599 N  N7    . DG  B 2 10  ? 38.264 -11.710 -7.724  1.00 21.21  ? 10   DG  T N7    1 
ATOM   3600 C  C5    . DG  B 2 10  ? 37.109 -11.785 -6.952  1.00 18.63  ? 10   DG  T C5    1 
ATOM   3601 C  C6    . DG  B 2 10  ? 35.973 -10.946 -6.930  1.00 19.04  ? 10   DG  T C6    1 
ATOM   3602 O  O6    . DG  B 2 10  ? 35.753 -9.934  -7.614  1.00 23.88  ? 10   DG  T O6    1 
ATOM   3603 N  N1    . DG  B 2 10  ? 35.031 -11.378 -6.002  1.00 23.47  ? 10   DG  T N1    1 
ATOM   3604 C  C2    . DG  B 2 10  ? 35.168 -12.486 -5.193  1.00 24.37  ? 10   DG  T C2    1 
ATOM   3605 N  N2    . DG  B 2 10  ? 34.147 -12.743 -4.360  1.00 26.16  ? 10   DG  T N2    1 
ATOM   3606 N  N3    . DG  B 2 10  ? 36.228 -13.280 -5.196  1.00 21.78  ? 10   DG  T N3    1 
ATOM   3607 C  C4    . DG  B 2 10  ? 37.161 -12.868 -6.096  1.00 20.11  ? 10   DG  T C4    1 
ATOM   3608 P  P     . DC  B 2 11  ? 39.312 -18.812 -5.665  1.00 36.65  ? 11   DC  T P     1 
ATOM   3609 O  OP1   . DC  B 2 11  ? 39.746 -19.888 -4.750  1.00 43.53  ? 11   DC  T OP1   1 
ATOM   3610 O  OP2   . DC  B 2 11  ? 39.560 -18.964 -7.113  1.00 35.44  ? 11   DC  T OP2   1 
ATOM   3611 O  "O5'" . DC  B 2 11  ? 37.749 -18.554 -5.488  1.00 31.34  ? 11   DC  T "O5'" 1 
ATOM   3612 C  "C5'" . DC  B 2 11  ? 37.222 -18.282 -4.219  1.00 25.45  ? 11   DC  T "C5'" 1 
ATOM   3613 C  "C4'" . DC  B 2 11  ? 35.709 -18.202 -4.288  1.00 23.15  ? 11   DC  T "C4'" 1 
ATOM   3614 O  "O4'" . DC  B 2 11  ? 35.311 -16.947 -4.890  1.00 22.83  ? 11   DC  T "O4'" 1 
ATOM   3615 C  "C3'" . DC  B 2 11  ? 35.033 -19.311 -5.101  1.00 17.49  ? 11   DC  T "C3'" 1 
ATOM   3616 O  "O3'" . DC  B 2 11  ? 33.946 -19.838 -4.328  1.00 17.56  ? 11   DC  T "O3'" 1 
ATOM   3617 C  "C2'" . DC  B 2 11  ? 34.559 -18.588 -6.384  1.00 20.06  ? 11   DC  T "C2'" 1 
ATOM   3618 C  "C1'" . DC  B 2 11  ? 34.332 -17.167 -5.885  1.00 21.66  ? 11   DC  T "C1'" 1 
ATOM   3619 N  N1    . DC  B 2 11  ? 34.501 -16.074 -6.917  1.00 18.01  ? 11   DC  T N1    1 
ATOM   3620 C  C2    . DC  B 2 11  ? 33.484 -15.121 -7.102  1.00 15.92  ? 11   DC  T C2    1 
ATOM   3621 O  O2    . DC  B 2 11  ? 32.430 -15.224 -6.462  1.00 21.23  ? 11   DC  T O2    1 
ATOM   3622 N  N3    . DC  B 2 11  ? 33.677 -14.110 -7.998  1.00 19.48  ? 11   DC  T N3    1 
ATOM   3623 C  C4    . DC  B 2 11  ? 34.825 -14.034 -8.680  1.00 16.27  ? 11   DC  T C4    1 
ATOM   3624 N  N4    . DC  B 2 11  ? 34.970 -13.020 -9.554  1.00 16.94  ? 11   DC  T N4    1 
ATOM   3625 C  C5    . DC  B 2 11  ? 35.873 -14.985 -8.502  1.00 14.00  ? 11   DC  T C5    1 
ATOM   3626 C  C6    . DC  B 2 11  ? 35.678 -15.973 -7.608  1.00 18.46  ? 11   DC  T C6    1 
ATOM   3627 P  P     . DT  B 2 12  ? 33.210 -21.212 -4.737  1.00 17.62  ? 12   DT  T P     1 
ATOM   3628 O  OP1   . DT  B 2 12  ? 32.612 -21.746 -3.489  1.00 19.78  ? 12   DT  T OP1   1 
ATOM   3629 O  OP2   . DT  B 2 12  ? 34.089 -22.037 -5.572  1.00 18.81  ? 12   DT  T OP2   1 
ATOM   3630 O  "O5'" . DT  B 2 12  ? 32.017 -20.716 -5.640  1.00 18.58  ? 12   DT  T "O5'" 1 
ATOM   3631 C  "C5'" . DT  B 2 12  ? 30.907 -20.105 -5.031  1.00 16.91  ? 12   DT  T "C5'" 1 
ATOM   3632 C  "C4'" . DT  B 2 12  ? 29.907 -19.673 -6.071  1.00 21.48  ? 12   DT  T "C4'" 1 
ATOM   3633 O  "O4'" . DT  B 2 12  ? 30.444 -18.550 -6.814  1.00 23.96  ? 12   DT  T "O4'" 1 
ATOM   3634 C  "C3'" . DT  B 2 12  ? 29.566 -20.736 -7.121  1.00 20.57  ? 12   DT  T "C3'" 1 
ATOM   3635 O  "O3'" . DT  B 2 12  ? 28.185 -20.662 -7.432  1.00 21.58  ? 12   DT  T "O3'" 1 
ATOM   3636 C  "C2'" . DT  B 2 12  ? 30.409 -20.306 -8.317  1.00 16.14  ? 12   DT  T "C2'" 1 
ATOM   3637 C  "C1'" . DT  B 2 12  ? 30.253 -18.808 -8.180  1.00 20.05  ? 12   DT  T "C1'" 1 
ATOM   3638 N  N1    . DT  B 2 12  ? 31.208 -18.002 -8.956  1.00 21.88  ? 12   DT  T N1    1 
ATOM   3639 C  C2    . DT  B 2 12  ? 30.817 -16.748 -9.342  1.00 21.48  ? 12   DT  T C2    1 
ATOM   3640 O  O2    . DT  B 2 12  ? 29.731 -16.283 -9.071  1.00 26.10  ? 12   DT  T O2    1 
ATOM   3641 N  N3    . DT  B 2 12  ? 31.742 -16.055 -10.053 1.00 18.47  ? 12   DT  T N3    1 
ATOM   3642 C  C4    . DT  B 2 12  ? 32.994 -16.479 -10.429 1.00 14.97  ? 12   DT  T C4    1 
ATOM   3643 O  O4    . DT  B 2 12  ? 33.749 -15.768 -11.090 1.00 21.28  ? 12   DT  T O4    1 
ATOM   3644 C  C5    . DT  B 2 12  ? 33.362 -17.805 -9.990  1.00 15.72  ? 12   DT  T C5    1 
ATOM   3645 C  C7    . DT  B 2 12  ? 34.712 -18.367 -10.339 1.00 18.50  ? 12   DT  T C7    1 
ATOM   3646 C  C6    . DT  B 2 12  ? 32.456 -18.506 -9.280  1.00 17.56  ? 12   DT  T C6    1 
ATOM   3647 O  "O5'" . DA  C 3 1   ? 29.292 -7.674  -15.094 1.00 40.07  ? 1    DA  P "O5'" 1 
ATOM   3648 C  "C5'" . DA  C 3 1   ? 28.002 -7.980  -15.595 1.00 27.90  ? 1    DA  P "C5'" 1 
ATOM   3649 C  "C4'" . DA  C 3 1   ? 27.075 -8.445  -14.483 1.00 27.07  ? 1    DA  P "C4'" 1 
ATOM   3650 O  "O4'" . DA  C 3 1   ? 27.396 -9.806  -14.115 1.00 31.31  ? 1    DA  P "O4'" 1 
ATOM   3651 C  "C3'" . DA  C 3 1   ? 27.117 -7.623  -13.195 1.00 22.42  ? 1    DA  P "C3'" 1 
ATOM   3652 O  "O3'" A DA  C 3 1   ? 25.805 -7.507  -12.648 0.56 23.36  ? 1    DA  P "O3'" 1 
ATOM   3653 O  "O3'" B DA  C 3 1   ? 25.810 -7.508  -12.648 0.44 23.08  ? 1    DA  P "O3'" 1 
ATOM   3654 C  "C2'" . DA  C 3 1   ? 28.038 -8.423  -12.278 1.00 27.89  ? 1    DA  P "C2'" 1 
ATOM   3655 C  "C1'" . DA  C 3 1   ? 27.949 -9.855  -12.818 1.00 27.19  ? 1    DA  P "C1'" 1 
ATOM   3656 N  N9    . DA  C 3 1   ? 29.253 -10.503 -12.907 1.00 22.92  ? 1    DA  P N9    1 
ATOM   3657 C  C8    . DA  C 3 1   ? 30.296 -10.145 -13.712 1.00 25.17  ? 1    DA  P C8    1 
ATOM   3658 N  N7    . DA  C 3 1   ? 31.356 -10.912 -13.573 1.00 22.48  ? 1    DA  P N7    1 
ATOM   3659 C  C5    . DA  C 3 1   ? 30.979 -11.829 -12.608 1.00 20.42  ? 1    DA  P C5    1 
ATOM   3660 C  C6    . DA  C 3 1   ? 31.654 -12.908 -12.016 1.00 21.55  ? 1    DA  P C6    1 
ATOM   3661 N  N6    . DA  C 3 1   ? 32.902 -13.247 -12.328 1.00 22.78  ? 1    DA  P N6    1 
ATOM   3662 N  N1    . DA  C 3 1   ? 30.988 -13.633 -11.090 1.00 19.57  ? 1    DA  P N1    1 
ATOM   3663 C  C2    . DA  C 3 1   ? 29.731 -13.290 -10.779 1.00 17.94  ? 1    DA  P C2    1 
ATOM   3664 N  N3    . DA  C 3 1   ? 28.994 -12.295 -11.267 1.00 19.98  ? 1    DA  P N3    1 
ATOM   3665 C  C4    . DA  C 3 1   ? 29.687 -11.595 -12.185 1.00 18.25  ? 1    DA  P C4    1 
ATOM   3666 P  P     A DG  C 3 2   ? 25.433 -6.284  -11.670 0.65 29.67  ? 2    DG  P P     1 
ATOM   3667 P  P     B DG  C 3 2   ? 25.443 -6.275  -11.682 0.35 29.67  ? 2    DG  P P     1 
ATOM   3668 O  OP1   A DG  C 3 2   ? 23.977 -6.044  -11.779 0.65 30.87  ? 2    DG  P OP1   1 
ATOM   3669 O  OP1   B DG  C 3 2   ? 23.990 -6.023  -11.811 0.35 31.05  ? 2    DG  P OP1   1 
ATOM   3670 O  OP2   A DG  C 3 2   ? 26.398 -5.187  -11.913 0.65 26.41  ? 2    DG  P OP2   1 
ATOM   3671 O  OP2   B DG  C 3 2   ? 26.414 -5.188  -11.940 0.35 26.53  ? 2    DG  P OP2   1 
ATOM   3672 O  "O5'" A DG  C 3 2   ? 25.743 -6.859  -10.216 0.65 28.07  ? 2    DG  P "O5'" 1 
ATOM   3673 O  "O5'" B DG  C 3 2   ? 25.736 -6.839  -10.217 0.35 28.08  ? 2    DG  P "O5'" 1 
ATOM   3674 C  "C5'" A DG  C 3 2   ? 24.856 -7.787  -9.640  0.65 27.36  ? 2    DG  P "C5'" 1 
ATOM   3675 C  "C5'" B DG  C 3 2   ? 24.855 -7.788  -9.645  0.35 27.36  ? 2    DG  P "C5'" 1 
ATOM   3676 C  "C4'" . DG  C 3 2   ? 25.495 -8.470  -8.453  1.00 18.55  ? 2    DG  P "C4'" 1 
ATOM   3677 O  "O4'" . DG  C 3 2   ? 26.710 -9.132  -8.865  1.00 22.68  ? 2    DG  P "O4'" 1 
ATOM   3678 C  "C3'" . DG  C 3 2   ? 25.872 -7.538  -7.302  1.00 27.95  ? 2    DG  P "C3'" 1 
ATOM   3679 O  "O3'" . DG  C 3 2   ? 25.287 -8.059  -6.127  1.00 27.44  ? 2    DG  P "O3'" 1 
ATOM   3680 C  "C2'" . DG  C 3 2   ? 27.407 -7.599  -7.269  1.00 22.29  ? 2    DG  P "C2'" 1 
ATOM   3681 C  "C1'" . DG  C 3 2   ? 27.666 -8.982  -7.852  1.00 19.75  ? 2    DG  P "C1'" 1 
ATOM   3682 N  N9    . DG  C 3 2   ? 28.994 -9.166  -8.433  1.00 20.82  ? 2    DG  P N9    1 
ATOM   3683 C  C8    . DG  C 3 2   ? 29.678 -8.300  -9.261  1.00 25.06  ? 2    DG  P C8    1 
ATOM   3684 N  N7    . DG  C 3 2   ? 30.848 -8.749  -9.634  1.00 21.61  ? 2    DG  P N7    1 
ATOM   3685 C  C5    . DG  C 3 2   ? 30.942 -10.006 -9.014  1.00 17.59  ? 2    DG  P C5    1 
ATOM   3686 C  C6    . DG  C 3 2   ? 31.987 -10.966 -9.031  1.00 16.96  ? 2    DG  P C6    1 
ATOM   3687 O  O6    . DG  C 3 2   ? 33.080 -10.916 -9.624  1.00 18.03  ? 2    DG  P O6    1 
ATOM   3688 N  N1    . DG  C 3 2   ? 31.670 -12.087 -8.258  1.00 21.26  ? 2    DG  P N1    1 
ATOM   3689 C  C2    . DG  C 3 2   ? 30.493 -12.256 -7.567  1.00 22.52  ? 2    DG  P C2    1 
ATOM   3690 N  N2    . DG  C 3 2   ? 30.361 -13.409 -6.888  1.00 24.14  ? 2    DG  P N2    1 
ATOM   3691 N  N3    . DG  C 3 2   ? 29.511 -11.367 -7.544  1.00 21.14  ? 2    DG  P N3    1 
ATOM   3692 C  C4    . DG  C 3 2   ? 29.804 -10.268 -8.282  1.00 20.14  ? 2    DG  P C4    1 
ATOM   3693 P  P     . DC  C 3 3   ? 25.370 -7.295  -4.721  1.00 32.45  ? 3    DC  P P     1 
ATOM   3694 O  OP1   . DC  C 3 3   ? 24.012 -7.349  -4.150  1.00 36.97  ? 3    DC  P OP1   1 
ATOM   3695 O  OP2   . DC  C 3 3   ? 26.114 -6.025  -4.848  1.00 39.34  ? 3    DC  P OP2   1 
ATOM   3696 O  "O5'" . DC  C 3 3   ? 26.308 -8.255  -3.852  1.00 37.20  ? 3    DC  P "O5'" 1 
ATOM   3697 C  "C5'" . DC  C 3 3   ? 26.124 -9.671  -3.909  1.00 38.49  ? 3    DC  P "C5'" 1 
ATOM   3698 C  "C4'" . DC  C 3 3   ? 27.309 -10.393 -3.294  1.00 37.08  ? 3    DC  P "C4'" 1 
ATOM   3699 O  "O4'" . DC  C 3 3   ? 28.382 -10.460 -4.257  1.00 33.51  ? 3    DC  P "O4'" 1 
ATOM   3700 C  "C3'" . DC  C 3 3   ? 27.889 -9.724  -2.041  1.00 34.37  ? 3    DC  P "C3'" 1 
ATOM   3701 O  "O3'" . DC  C 3 3   ? 27.769 -10.593 -0.926  1.00 39.12  ? 3    DC  P "O3'" 1 
ATOM   3702 C  "C2'" . DC  C 3 3   ? 29.358 -9.447  -2.389  1.00 35.61  ? 3    DC  P "C2'" 1 
ATOM   3703 C  "C1'" . DC  C 3 3   ? 29.611 -10.347 -3.591  1.00 35.31  ? 3    DC  P "C1'" 1 
ATOM   3704 N  N1    . DC  C 3 3   ? 30.596 -9.765  -4.538  1.00 31.45  ? 3    DC  P N1    1 
ATOM   3705 C  C2    . DC  C 3 3   ? 31.754 -10.475 -4.860  1.00 20.91  ? 3    DC  P C2    1 
ATOM   3706 O  O2    . DC  C 3 3   ? 31.936 -11.593 -4.361  1.00 34.31  ? 3    DC  P O2    1 
ATOM   3707 N  N3    . DC  C 3 3   ? 32.644 -9.918  -5.718  1.00 27.84  ? 3    DC  P N3    1 
ATOM   3708 C  C4    . DC  C 3 3   ? 32.410 -8.711  -6.231  1.00 22.19  ? 3    DC  P C4    1 
ATOM   3709 N  N4    . DC  C 3 3   ? 33.312 -8.203  -7.074  1.00 24.79  ? 3    DC  P N4    1 
ATOM   3710 C  C5    . DC  C 3 3   ? 31.234 -7.973  -5.909  1.00 31.71  ? 3    DC  P C5    1 
ATOM   3711 C  C6    . DC  C 3 3   ? 30.368 -8.531  -5.065  1.00 24.00  ? 3    DC  P C6    1 
ATOM   3712 P  P     . DG  C 3 4   ? 28.341 -10.155 0.509   1.00 36.21  ? 4    DG  P P     1 
ATOM   3713 O  OP1   . DG  C 3 4   ? 27.521 -10.862 1.518   1.00 48.37  ? 4    DG  P OP1   1 
ATOM   3714 O  OP2   . DG  C 3 4   ? 28.489 -8.683  0.575   1.00 36.35  ? 4    DG  P OP2   1 
ATOM   3715 O  "O5'" . DG  C 3 4   ? 29.834 -10.742 0.516   1.00 31.51  ? 4    DG  P "O5'" 1 
ATOM   3716 C  "C5'" . DG  C 3 4   ? 30.058 -12.093 0.122   1.00 31.30  ? 4    DG  P "C5'" 1 
ATOM   3717 C  "C4'" . DG  C 3 4   ? 31.524 -12.472 0.264   1.00 35.17  ? 4    DG  P "C4'" 1 
ATOM   3718 O  "O4'" . DG  C 3 4   ? 32.285 -11.960 -0.862  1.00 34.49  ? 4    DG  P "O4'" 1 
ATOM   3719 C  "C3'" . DG  C 3 4   ? 32.209 -11.957 1.529   1.00 33.82  ? 4    DG  P "C3'" 1 
ATOM   3720 O  "O3'" . DG  C 3 4   ? 32.915 -13.022 2.136   1.00 36.34  ? 4    DG  P "O3'" 1 
ATOM   3721 C  "C2'" . DG  C 3 4   ? 33.147 -10.857 1.023   1.00 29.88  ? 4    DG  P "C2'" 1 
ATOM   3722 C  "C1'" . DG  C 3 4   ? 33.447 -11.298 -0.401  1.00 24.45  ? 4    DG  P "C1'" 1 
ATOM   3723 N  N9    . DG  C 3 4   ? 33.711 -10.181 -1.311  1.00 22.04  ? 4    DG  P N9    1 
ATOM   3724 C  C8    . DG  C 3 4   ? 32.879 -9.121  -1.573  1.00 22.49  ? 4    DG  P C8    1 
ATOM   3725 N  N7    . DG  C 3 4   ? 33.361 -8.284  -2.451  1.00 26.82  ? 4    DG  P N7    1 
ATOM   3726 C  C5    . DG  C 3 4   ? 34.592 -8.825  -2.795  1.00 22.48  ? 4    DG  P C5    1 
ATOM   3727 C  C6    . DG  C 3 4   ? 35.556 -8.359  -3.706  1.00 18.27  ? 4    DG  P C6    1 
ATOM   3728 O  O6    . DG  C 3 4   ? 35.519 -7.331  -4.400  1.00 22.55  ? 4    DG  P O6    1 
ATOM   3729 N  N1    . DG  C 3 4   ? 36.660 -9.212  -3.771  1.00 20.38  ? 4    DG  P N1    1 
ATOM   3730 C  C2    . DG  C 3 4   ? 36.803 -10.372 -3.040  1.00 17.24  ? 4    DG  P C2    1 
ATOM   3731 N  N2    . DG  C 3 4   ? 37.937 -11.061 -3.234  1.00 18.52  ? 4    DG  P N2    1 
ATOM   3732 N  N3    . DG  C 3 4   ? 35.895 -10.825 -2.181  1.00 17.83  ? 4    DG  P N3    1 
ATOM   3733 C  C4    . DG  C 3 4   ? 34.819 -10.001 -2.113  1.00 18.67  ? 4    DG  P C4    1 
ATOM   3734 P  P     . DT  C 3 5   ? 33.694 -12.818 3.523   1.00 39.58  ? 5    DT  P P     1 
ATOM   3735 O  OP1   . DT  C 3 5   ? 33.578 -14.099 4.248   1.00 42.95  ? 5    DT  P OP1   1 
ATOM   3736 O  OP2   . DT  C 3 5   ? 33.308 -11.551 4.173   1.00 28.55  ? 5    DT  P OP2   1 
ATOM   3737 O  "O5'" . DT  C 3 5   ? 35.201 -12.603 3.051   1.00 33.05  ? 5    DT  P "O5'" 1 
ATOM   3738 C  "C5'" . DT  C 3 5   ? 35.814 -13.555 2.227   1.00 20.31  ? 5    DT  P "C5'" 1 
ATOM   3739 C  "C4'" . DT  C 3 5   ? 37.216 -13.112 1.888   1.00 19.42  ? 5    DT  P "C4'" 1 
ATOM   3740 O  "O4'" . DT  C 3 5   ? 37.169 -12.046 0.918   1.00 21.61  ? 5    DT  P "O4'" 1 
ATOM   3741 C  "C3'" . DT  C 3 5   ? 38.016 -12.582 3.072   1.00 23.58  ? 5    DT  P "C3'" 1 
ATOM   3742 O  "O3'" . DT  C 3 5   ? 39.233 -13.298 3.139   1.00 20.26  ? 5    DT  P "O3'" 1 
ATOM   3743 C  "C2'" . DT  C 3 5   ? 38.239 -11.092 2.744   1.00 18.92  ? 5    DT  P "C2'" 1 
ATOM   3744 C  "C1'" . DT  C 3 5   ? 38.169 -11.097 1.234   1.00 17.92  ? 5    DT  P "C1'" 1 
ATOM   3745 N  N1    . DT  C 3 5   ? 37.758 -9.810  0.631   1.00 17.59  ? 5    DT  P N1    1 
ATOM   3746 C  C2    . DT  C 3 5   ? 38.575 -9.227  -0.313  1.00 16.70  ? 5    DT  P C2    1 
ATOM   3747 O  O2    . DT  C 3 5   ? 39.651 -9.698  -0.661  1.00 18.23  ? 5    DT  P O2    1 
ATOM   3748 N  N3    . DT  C 3 5   ? 38.092 -8.070  -0.849  1.00 17.24  ? 5    DT  P N3    1 
ATOM   3749 C  C4    . DT  C 3 5   ? 36.901 -7.445  -0.559  1.00 17.93  ? 5    DT  P C4    1 
ATOM   3750 O  O4    . DT  C 3 5   ? 36.564 -6.394  -1.108  1.00 20.69  ? 5    DT  P O4    1 
ATOM   3751 C  C5    . DT  C 3 5   ? 36.081 -8.101  0.435   1.00 18.95  ? 5    DT  P C5    1 
ATOM   3752 C  C7    . DT  C 3 5   ? 34.770 -7.504  0.835   1.00 21.18  ? 5    DT  P C7    1 
ATOM   3753 C  C6    . DT  C 3 5   ? 36.539 -9.253  0.975   1.00 17.77  ? 5    DT  P C6    1 
ATOM   3754 P  P     . DC  C 3 6   ? 40.187 -13.161 4.420   1.00 18.75  ? 6    DC  P P     1 
ATOM   3755 O  OP1   . DC  C 3 6   ? 40.874 -14.476 4.501   1.00 17.68  ? 6    DC  P OP1   1 
ATOM   3756 O  OP2   . DC  C 3 6   ? 39.438 -12.668 5.587   1.00 17.45  ? 6    DC  P OP2   1 
ATOM   3757 O  "O5'" . DC  C 3 6   ? 41.223 -12.037 3.985   1.00 17.22  ? 6    DC  P "O5'" 1 
ATOM   3758 C  "C5'" . DC  C 3 6   ? 42.091 -12.271 2.902   1.00 15.03  ? 6    DC  P "C5'" 1 
ATOM   3759 C  "C4'" . DC  C 3 6   ? 42.807 -10.998 2.541   1.00 18.55  ? 6    DC  P "C4'" 1 
ATOM   3760 O  "O4'" . DC  C 3 6   ? 41.878 -10.083 1.928   1.00 17.19  ? 6    DC  P "O4'" 1 
ATOM   3761 C  "C3'" . DC  C 3 6   ? 43.404 -10.247 3.729   1.00 16.23  ? 6    DC  P "C3'" 1 
ATOM   3762 O  "O3'" . DC  C 3 6   ? 44.817 -10.413 3.692   1.00 15.11  ? 6    DC  P "O3'" 1 
ATOM   3763 C  "C2'" . DC  C 3 6   ? 42.976 -8.778  3.507   1.00 15.94  ? 6    DC  P "C2'" 1 
ATOM   3764 C  "C1'" . DC  C 3 6   ? 42.376 -8.798  2.099   1.00 15.55  ? 6    DC  P "C1'" 1 
ATOM   3765 N  N1    . DC  C 3 6   ? 41.268 -7.830  1.902   1.00 14.95  ? 6    DC  P N1    1 
ATOM   3766 C  C2    . DC  C 3 6   ? 41.365 -6.887  0.878   1.00 16.29  ? 6    DC  P C2    1 
ATOM   3767 O  O2    . DC  C 3 6   ? 42.361 -6.900  0.148   1.00 17.28  ? 6    DC  P O2    1 
ATOM   3768 N  N3    . DC  C 3 6   ? 40.353 -6.002  0.705   1.00 16.30  ? 6    DC  P N3    1 
ATOM   3769 C  C4    . DC  C 3 6   ? 39.291 -6.029  1.519   1.00 16.96  ? 6    DC  P C4    1 
ATOM   3770 N  N4    . DC  C 3 6   ? 38.315 -5.131  1.309   1.00 18.53  ? 6    DC  P N4    1 
ATOM   3771 C  C5    . DC  C 3 6   ? 39.176 -6.981  2.578   1.00 14.97  ? 6    DC  P C5    1 
ATOM   3772 C  C6    . DC  C 3 6   ? 40.182 -7.854  2.731   1.00 17.26  ? 6    DC  P C6    1 
ATOM   3773 P  P     . DA  C 3 7   ? 45.791 -9.646  4.721   1.00 16.05  ? 7    DA  P P     1 
ATOM   3774 O  OP1   . DA  C 3 7   ? 47.018 -10.488 4.829   1.00 15.91  ? 7    DA  P OP1   1 
ATOM   3775 O  OP2   . DA  C 3 7   ? 45.064 -9.289  5.951   1.00 18.57  ? 7    DA  P OP2   1 
ATOM   3776 O  "O5'" . DA  C 3 7   ? 46.102 -8.274  3.984   1.00 17.02  ? 7    DA  P "O5'" 1 
ATOM   3777 C  "C5'" . DA  C 3 7   ? 46.635 -8.279  2.678   1.00 17.73  ? 7    DA  P "C5'" 1 
ATOM   3778 C  "C4'" . DA  C 3 7   ? 46.581 -6.879  2.110   1.00 17.84  ? 7    DA  P "C4'" 1 
ATOM   3779 O  "O4'" . DA  C 3 7   ? 45.207 -6.533  1.870   1.00 16.03  ? 7    DA  P "O4'" 1 
ATOM   3780 C  "C3'" . DA  C 3 7   ? 47.039 -5.795  3.074   1.00 22.30  ? 7    DA  P "C3'" 1 
ATOM   3781 O  "O3'" . DA  C 3 7   ? 48.446 -5.593  3.026   1.00 42.97  ? 7    DA  P "O3'" 1 
ATOM   3782 C  "C2'" . DA  C 3 7   ? 46.297 -4.558  2.585   1.00 19.67  ? 7    DA  P "C2'" 1 
ATOM   3783 C  "C1'" . DA  C 3 7   ? 45.141 -5.126  1.780   1.00 18.27  ? 7    DA  P "C1'" 1 
ATOM   3784 N  N9    . DA  C 3 7   ? 43.853 -4.670  2.252   1.00 12.72  ? 7    DA  P N9    1 
ATOM   3785 C  C8    . DA  C 3 7   ? 43.064 -5.234  3.210   1.00 18.70  ? 7    DA  P C8    1 
ATOM   3786 N  N7    . DA  C 3 7   ? 41.933 -4.583  3.411   1.00 17.26  ? 7    DA  P N7    1 
ATOM   3787 C  C5    . DA  C 3 7   ? 41.994 -3.535  2.513   1.00 14.97  ? 7    DA  P C5    1 
ATOM   3788 C  C6    . DA  C 3 7   ? 41.120 -2.476  2.229   1.00 16.00  ? 7    DA  P C6    1 
ATOM   3789 N  N6    . DA  C 3 7   ? 39.942 -2.305  2.835   1.00 19.44  ? 7    DA  P N6    1 
ATOM   3790 N  N1    . DA  C 3 7   ? 41.500 -1.598  1.282   1.00 13.93  ? 7    DA  P N1    1 
ATOM   3791 C  C2    . DA  C 3 7   ? 42.685 -1.756  0.679   1.00 17.32  ? 7    DA  P C2    1 
ATOM   3792 N  N3    . DA  C 3 7   ? 43.597 -2.711  0.867   1.00 13.21  ? 7    DA  P N3    1 
ATOM   3793 C  C4    . DA  C 3 7   ? 43.185 -3.568  1.806   1.00 16.63  ? 7    DA  P C4    1 
ATOM   3794 P  P     A DT  C 3 8   ? 49.129 -4.608  4.100   0.75 39.59  ? 8    DT  P P     1 
ATOM   3795 P  P     B DT  C 3 8   ? 49.156 -4.580  4.058   0.25 38.37  ? 8    DT  P P     1 
ATOM   3796 O  OP1   A DT  C 3 8   ? 50.567 -4.946  4.211   0.75 41.46  ? 8    DT  P OP1   1 
ATOM   3797 O  OP1   B DT  C 3 8   ? 50.618 -4.798  3.978   0.25 39.84  ? 8    DT  P OP1   1 
ATOM   3798 O  OP2   A DT  C 3 8   ? 48.252 -4.530  5.293   0.75 35.74  ? 8    DT  P OP2   1 
ATOM   3799 O  OP2   B DT  C 3 8   ? 48.452 -4.688  5.355   0.25 37.63  ? 8    DT  P OP2   1 
ATOM   3800 O  "O5'" A DT  C 3 8   ? 49.010 -3.179  3.435   0.75 28.94  ? 8    DT  P "O5'" 1 
ATOM   3801 O  "O5'" B DT  C 3 8   ? 48.831 -3.124  3.485   0.25 28.25  ? 8    DT  P "O5'" 1 
ATOM   3802 C  "C5'" A DT  C 3 8   ? 49.368 -2.970  2.083   0.75 22.24  ? 8    DT  P "C5'" 1 
ATOM   3803 C  "C5'" B DT  C 3 8   ? 49.376 -2.689  2.241   0.25 22.49  ? 8    DT  P "C5'" 1 
ATOM   3804 C  "C4'" A DT  C 3 8   ? 49.033 -1.543  1.746   0.75 14.86  ? 8    DT  P "C4'" 1 
ATOM   3805 C  "C4'" B DT  C 3 8   ? 48.960 -1.255  1.977   0.25 16.82  ? 8    DT  P "C4'" 1 
ATOM   3806 O  "O4'" A DT  C 3 8   ? 47.587 -1.402  1.820   0.75 14.09  ? 8    DT  P "O4'" 1 
ATOM   3807 O  "O4'" B DT  C 3 8   ? 47.519 -1.212  1.874   0.25 15.84  ? 8    DT  P "O4'" 1 
ATOM   3808 C  "C3'" A DT  C 3 8   ? 49.613 -0.555  2.767   0.75 15.35  ? 8    DT  P "C3'" 1 
ATOM   3809 C  "C3'" B DT  C 3 8   ? 49.331 -0.290  3.107   0.25 15.61  ? 8    DT  P "C3'" 1 
ATOM   3810 O  "O3'" A DT  C 3 8   ? 50.304 0.521   2.123   0.75 11.07  ? 8    DT  P "O3'" 1 
ATOM   3811 O  "O3'" B DT  C 3 8   ? 50.375 0.613   2.717   0.25 12.34  ? 8    DT  P "O3'" 1 
ATOM   3812 C  "C2'" A DT  C 3 8   ? 48.393 -0.081  3.567   0.75 14.63  ? 8    DT  P "C2'" 1 
ATOM   3813 C  "C2'" B DT  C 3 8   ? 48.037 0.458   3.449   0.25 16.68  ? 8    DT  P "C2'" 1 
ATOM   3814 C  "C1'" A DT  C 3 8   ? 47.266 -0.248  2.570   0.75 16.66  ? 8    DT  P "C1'" 1 
ATOM   3815 C  "C1'" B DT  C 3 8   ? 47.045 0.012   2.384   0.25 16.42  ? 8    DT  P "C1'" 1 
ATOM   3816 N  N1    A DT  C 3 8   ? 45.936 -0.430  3.217   0.75 15.74  ? 8    DT  P N1    1 
ATOM   3817 N  N1    B DT  C 3 8   ? 45.693 -0.195  2.948   0.25 16.28  ? 8    DT  P N1    1 
ATOM   3818 C  C2    A DT  C 3 8   ? 44.935 0.474   2.952   0.75 14.23  ? 8    DT  P C2    1 
ATOM   3819 C  C2    B DT  C 3 8   ? 44.662 0.626   2.555   0.25 14.66  ? 8    DT  P C2    1 
ATOM   3820 O  O2    A DT  C 3 8   ? 45.072 1.410   2.191   0.75 15.49  ? 8    DT  P O2    1 
ATOM   3821 O  O2    B DT  C 3 8   ? 44.789 1.507   1.723   0.25 16.52  ? 8    DT  P O2    1 
ATOM   3822 N  N3    A DT  C 3 8   ? 43.759 0.230   3.599   0.75 14.23  ? 8    DT  P N3    1 
ATOM   3823 N  N3    B DT  C 3 8   ? 43.462 0.360   3.157   0.25 15.51  ? 8    DT  P N3    1 
ATOM   3824 C  C4    A DT  C 3 8   ? 43.488 -0.796  4.479   0.75 15.41  ? 8    DT  P C4    1 
ATOM   3825 C  C4    B DT  C 3 8   ? 43.201 -0.612  4.107   0.25 14.18  ? 8    DT  P C4    1 
ATOM   3826 O  O4    A DT  C 3 8   ? 42.403 -0.928  5.015   0.75 16.15  ? 8    DT  P O4    1 
ATOM   3827 O  O4    B DT  C 3 8   ? 42.088 -0.772  4.592   0.25 18.31  ? 8    DT  P O4    1 
ATOM   3828 C  C5    A DT  C 3 8   ? 44.579 -1.704  4.723   0.75 13.53  ? 8    DT  P C5    1 
ATOM   3829 C  C5    B DT  C 3 8   ? 44.332 -1.426  4.484   0.25 15.17  ? 8    DT  P C5    1 
ATOM   3830 C  C7    A DT  C 3 8   ? 44.400 -2.859  5.662   0.75 19.81  ? 8    DT  P C7    1 
ATOM   3831 C  C7    B DT  C 3 8   ? 44.176 -2.514  5.505   0.25 18.46  ? 8    DT  P C7    1 
ATOM   3832 C  C6    A DT  C 3 8   ? 45.742 -1.476  4.092   0.75 15.87  ? 8    DT  P C6    1 
ATOM   3833 C  C6    B DT  C 3 8   ? 45.509 -1.173  3.899   0.25 15.32  ? 8    DT  P C6    1 
ATOM   3834 P  P     B DA  C 3 9   ? 51.026 1.575   3.830   0.25 12.78  ? 9    DA  P P     1 
ATOM   3835 O  OP1   B DA  C 3 9   ? 52.465 1.749   3.528   0.25 11.93  ? 9    DA  P OP1   1 
ATOM   3836 O  OP2   B DA  C 3 9   ? 50.632 1.011   5.142   0.25 13.54  ? 9    DA  P OP2   1 
ATOM   3837 O  "O5'" B DA  C 3 9   ? 50.239 2.953   3.678   0.25 11.51  ? 9    DA  P "O5'" 1 
ATOM   3838 C  "C5'" B DA  C 3 9   ? 50.814 4.035   2.970   0.25 12.05  ? 9    DA  P "C5'" 1 
ATOM   3839 C  "C4'" B DA  C 3 9   ? 49.932 5.264   3.088   0.25 10.98  ? 9    DA  P "C4'" 1 
ATOM   3840 O  "O4'" B DA  C 3 9   ? 48.573 4.906   2.715   0.25 11.90  ? 9    DA  P "O4'" 1 
ATOM   3841 C  "C3'" B DA  C 3 9   ? 49.815 5.834   4.492   0.25 10.33  ? 9    DA  P "C3'" 1 
ATOM   3842 O  "O3'" B DA  C 3 9   ? 50.878 6.764   4.744   0.25 10.35  ? 9    DA  P "O3'" 1 
ATOM   3843 C  "C2'" B DA  C 3 9   ? 48.455 6.528   4.437   0.25 10.37  ? 9    DA  P "C2'" 1 
ATOM   3844 C  "C1'" B DA  C 3 9   ? 47.648 5.572   3.559   0.25 12.76  ? 9    DA  P "C1'" 1 
ATOM   3845 N  N9    B DA  C 3 9   ? 46.893 4.572   4.316   0.25 13.07  ? 9    DA  P N9    1 
ATOM   3846 C  C8    B DA  C 3 9   ? 47.376 3.430   4.895   0.25 13.52  ? 9    DA  P C8    1 
ATOM   3847 N  N7    B DA  C 3 9   ? 46.458 2.720   5.512   0.25 14.51  ? 9    DA  P N7    1 
ATOM   3848 C  C5    B DA  C 3 9   ? 45.294 3.449   5.324   0.25 15.10  ? 9    DA  P C5    1 
ATOM   3849 C  C6    B DA  C 3 9   ? 43.964 3.236   5.734   0.25 14.29  ? 9    DA  P C6    1 
ATOM   3850 N  N6    B DA  C 3 9   ? 43.575 2.178   6.450   0.25 14.94  ? 9    DA  P N6    1 
ATOM   3851 N  N1    B DA  C 3 9   ? 43.044 4.160   5.378   0.25 13.96  ? 9    DA  P N1    1 
ATOM   3852 C  C2    B DA  C 3 9   ? 43.436 5.219   4.662   0.25 13.70  ? 9    DA  P C2    1 
ATOM   3853 N  N3    B DA  C 3 9   ? 44.656 5.527   4.219   0.25 13.66  ? 9    DA  P N3    1 
ATOM   3854 C  C4    B DA  C 3 9   ? 45.546 4.591   4.588   0.25 13.35  ? 9    DA  P C4    1 
HETATM 3855 MN MN    . MN  D 4 .   ? 52.673 0.319   2.077   1.00 11.66  ? 501  MN  A MN    1 
HETATM 3856 MN MN    B MN  E 4 .   ? 54.711 2.691   3.851   1.00 10.95  ? 502  MN  A MN    1 
HETATM 3857 C  C1    . GOL F 5 .   ? 60.376 -25.227 11.798  1.00 35.22  ? 503  GOL A C1    1 
HETATM 3858 O  O1    . GOL F 5 .   ? 59.279 -24.591 12.409  1.00 16.37  ? 503  GOL A O1    1 
HETATM 3859 C  C2    . GOL F 5 .   ? 60.886 -24.435 10.595  1.00 36.68  ? 503  GOL A C2    1 
HETATM 3860 O  O2    . GOL F 5 .   ? 60.440 -23.103 10.628  1.00 19.52  ? 503  GOL A O2    1 
HETATM 3861 C  C3    . GOL F 5 .   ? 60.364 -25.072 9.318   1.00 38.62  ? 503  GOL A C3    1 
HETATM 3862 O  O3    . GOL F 5 .   ? 61.362 -24.970 8.334   1.00 20.03  ? 503  GOL A O3    1 
HETATM 3863 C  C1    . GOL G 5 .   ? 54.058 16.640  -7.158  1.00 39.90  ? 504  GOL A C1    1 
HETATM 3864 O  O1    . GOL G 5 .   ? 53.667 15.374  -6.660  1.00 19.24  ? 504  GOL A O1    1 
HETATM 3865 C  C2    . GOL G 5 .   ? 54.552 16.478  -8.595  1.00 41.28  ? 504  GOL A C2    1 
HETATM 3866 O  O2    . GOL G 5 .   ? 53.531 15.896  -9.374  1.00 33.94  ? 504  GOL A O2    1 
HETATM 3867 C  C3    . GOL G 5 .   ? 54.923 17.833  -9.192  1.00 43.83  ? 504  GOL A C3    1 
HETATM 3868 O  O3    . GOL G 5 .   ? 55.406 17.650  -10.508 1.00 46.25  ? 504  GOL A O3    1 
HETATM 3869 C  C1    . GOL H 5 .   ? 53.666 28.355  4.736   1.00 38.71  ? 505  GOL A C1    1 
HETATM 3870 O  O1    . GOL H 5 .   ? 52.449 27.829  4.244   1.00 32.47  ? 505  GOL A O1    1 
HETATM 3871 C  C2    . GOL H 5 .   ? 54.286 27.426  5.779   1.00 50.71  ? 505  GOL A C2    1 
HETATM 3872 O  O2    . GOL H 5 .   ? 53.544 26.228  5.875   1.00 50.92  ? 505  GOL A O2    1 
HETATM 3873 C  C3    . GOL H 5 .   ? 55.744 27.122  5.430   1.00 39.27  ? 505  GOL A C3    1 
HETATM 3874 O  O3    . GOL H 5 .   ? 56.340 26.286  6.410   1.00 31.92  ? 505  GOL A O3    1 
HETATM 3875 P  PG    A DTP I 6 .   ? 55.204 2.646   7.163   0.75 11.41  ? 506  DTP A PG    1 
HETATM 3876 O  O1G   A DTP I 6 .   ? 55.112 1.951   5.845   0.75 11.29  ? 506  DTP A O1G   1 
HETATM 3877 O  O2G   A DTP I 6 .   ? 56.543 3.339   7.336   0.75 11.83  ? 506  DTP A O2G   1 
HETATM 3878 O  O3G   A DTP I 6 .   ? 54.850 1.757   8.357   0.75 12.67  ? 506  DTP A O3G   1 
HETATM 3879 P  PB    A DTP I 6 .   ? 53.023 4.127   6.049   0.75 10.69  ? 506  DTP A PB    1 
HETATM 3880 O  O1B   A DTP I 6 .   ? 53.772 4.380   4.749   0.75 9.84   ? 506  DTP A O1B   1 
HETATM 3881 O  O2B   A DTP I 6 .   ? 52.239 5.330   6.512   0.75 10.87  ? 506  DTP A O2B   1 
HETATM 3882 O  O3B   A DTP I 6 .   ? 54.094 3.804   7.209   0.75 9.16   ? 506  DTP A O3B   1 
HETATM 3883 P  PA    A DTP I 6 .   ? 51.545 2.066   4.812   0.75 10.65  ? 506  DTP A PA    1 
HETATM 3884 O  O1A   A DTP I 6 .   ? 52.672 1.603   3.923   0.75 12.01  ? 506  DTP A O1A   1 
HETATM 3885 O  O2A   A DTP I 6 .   ? 50.770 0.909   5.398   0.75 13.58  ? 506  DTP A O2A   1 
HETATM 3886 O  O3A   A DTP I 6 .   ? 52.079 2.849   6.063   0.75 10.51  ? 506  DTP A O3A   1 
HETATM 3887 O  "O5'" A DTP I 6 .   ? 50.534 2.976   4.009   0.75 10.19  ? 506  DTP A "O5'" 1 
HETATM 3888 C  "C5'" A DTP I 6 .   ? 50.978 3.983   3.144   0.75 13.03  ? 506  DTP A "C5'" 1 
HETATM 3889 C  "C4'" A DTP I 6 .   ? 50.012 5.171   3.125   0.75 10.65  ? 506  DTP A "C4'" 1 
HETATM 3890 O  "O4'" A DTP I 6 .   ? 48.740 4.708   2.699   0.75 11.49  ? 506  DTP A "O4'" 1 
HETATM 3891 C  "C3'" A DTP I 6 .   ? 49.833 5.773   4.429   0.75 10.28  ? 506  DTP A "C3'" 1 
HETATM 3892 O  "O3'" A DTP I 6 .   ? 50.809 6.812   4.662   0.75 10.67  ? 506  DTP A "O3'" 1 
HETATM 3893 C  "C2'" A DTP I 6 .   ? 48.459 6.291   4.435   0.75 10.34  ? 506  DTP A "C2'" 1 
HETATM 3894 C  "C1'" A DTP I 6 .   ? 47.750 5.371   3.512   0.75 13.28  ? 506  DTP A "C1'" 1 
HETATM 3895 N  N9    A DTP I 6 .   ? 47.006 4.404   4.234   0.75 13.04  ? 506  DTP A N9    1 
HETATM 3896 C  C8    A DTP I 6 .   ? 47.449 3.230   4.738   0.75 13.19  ? 506  DTP A C8    1 
HETATM 3897 N  N7    A DTP I 6 .   ? 46.458 2.592   5.342   0.75 13.60  ? 506  DTP A N7    1 
HETATM 3898 C  C5    A DTP I 6 .   ? 45.341 3.337   5.246   0.75 14.98  ? 506  DTP A C5    1 
HETATM 3899 C  C6    A DTP I 6 .   ? 44.026 3.197   5.679   0.75 14.34  ? 506  DTP A C6    1 
HETATM 3900 N  N6    A DTP I 6 .   ? 43.638 2.033   6.413   0.75 14.52  ? 506  DTP A N6    1 
HETATM 3901 N  N1    A DTP I 6 .   ? 43.139 4.155   5.404   0.75 13.75  ? 506  DTP A N1    1 
HETATM 3902 C  C2    A DTP I 6 .   ? 43.464 5.271   4.719   0.75 13.60  ? 506  DTP A C2    1 
HETATM 3903 N  N3    A DTP I 6 .   ? 44.746 5.446   4.278   0.75 13.68  ? 506  DTP A N3    1 
HETATM 3904 C  C4    A DTP I 6 .   ? 45.671 4.503   4.535   0.75 13.31  ? 506  DTP A C4    1 
HETATM 3905 P  P1    B DPO J 7 .   ? 52.990 4.161   6.349   0.25 11.85  ? 507  DPO A P1    1 
HETATM 3906 O  O1    B DPO J 7 .   ? 53.592 4.362   4.978   0.25 10.97  ? 507  DPO A O1    1 
HETATM 3907 O  O2    B DPO J 7 .   ? 52.041 2.985   6.349   0.25 11.13  ? 507  DPO A O2    1 
HETATM 3908 O  O3    B DPO J 7 .   ? 52.250 5.402   6.782   0.25 11.21  ? 507  DPO A O3    1 
HETATM 3909 O  O4    B DPO J 7 .   ? 54.114 3.859   7.387   0.25 9.50   ? 507  DPO A O4    1 
HETATM 3910 P  P2    B DPO J 7 .   ? 55.097 2.658   7.195   0.25 12.00  ? 507  DPO A P2    1 
HETATM 3911 O  O5    B DPO J 7 .   ? 54.904 2.067   5.825   0.25 11.21  ? 507  DPO A O5    1 
HETATM 3912 O  O6    B DPO J 7 .   ? 54.786 1.631   8.262   0.25 13.01  ? 507  DPO A O6    1 
HETATM 3913 O  O7    B DPO J 7 .   ? 56.508 3.175   7.343   0.25 11.95  ? 507  DPO A O7    1 
HETATM 3914 MN MN    B MN  K 4 .   ? 51.083 0.983   6.985   0.25 19.40  ? 101  MN  P MN    1 
HETATM 3915 O  O     . HOH L 8 .   ? 67.431 1.799   11.545  1.00 40.90  ? 601  HOH A O     1 
HETATM 3916 O  O     . HOH L 8 .   ? 57.333 11.976  -12.177 1.00 38.14  ? 602  HOH A O     1 
HETATM 3917 O  O     . HOH L 8 .   ? 31.458 -1.315  -2.776  1.00 28.34  ? 603  HOH A O     1 
HETATM 3918 O  O     . HOH L 8 .   ? 65.333 -25.246 -0.291  1.00 19.85  ? 604  HOH A O     1 
HETATM 3919 O  O     . HOH L 8 .   ? 37.080 17.299  -6.563  1.00 32.80  ? 605  HOH A O     1 
HETATM 3920 O  O     . HOH L 8 .   ? 80.323 -15.932 7.424   1.00 38.82  ? 606  HOH A O     1 
HETATM 3921 O  O     . HOH L 8 .   ? 57.043 -34.630 8.604   1.00 29.11  ? 607  HOH A O     1 
HETATM 3922 O  O     . HOH L 8 .   ? 68.019 -15.845 -7.661  1.00 28.74  ? 608  HOH A O     1 
HETATM 3923 O  O     . HOH L 8 .   ? 43.346 9.771   -10.090 1.00 23.99  ? 609  HOH A O     1 
HETATM 3924 O  O     . HOH L 8 .   ? 34.506 -1.714  -7.638  1.00 52.83  ? 610  HOH A O     1 
HETATM 3925 O  O     . HOH L 8 .   ? 50.246 28.287  5.107   1.00 58.90  ? 611  HOH A O     1 
HETATM 3926 O  O     . HOH L 8 .   ? 39.730 6.936   13.592  1.00 31.45  ? 612  HOH A O     1 
HETATM 3927 O  O     . HOH L 8 .   ? 61.235 -17.994 -12.976 1.00 35.30  ? 613  HOH A O     1 
HETATM 3928 O  O     . HOH L 8 .   ? 63.849 -24.221 -7.706  1.00 51.14  ? 614  HOH A O     1 
HETATM 3929 O  O     . HOH L 8 .   ? 76.246 0.810   -6.263  1.00 30.60  ? 615  HOH A O     1 
HETATM 3930 O  O     . HOH L 8 .   ? 48.569 13.428  28.148  1.00 31.99  ? 616  HOH A O     1 
HETATM 3931 O  O     . HOH L 8 .   ? 60.811 20.673  12.141  1.00 32.88  ? 617  HOH A O     1 
HETATM 3932 O  O     . HOH L 8 .   ? 43.000 5.503   -8.965  1.00 21.03  ? 618  HOH A O     1 
HETATM 3933 O  O     . HOH L 8 .   ? 42.341 -20.789 16.993  1.00 41.38  ? 619  HOH A O     1 
HETATM 3934 O  O     . HOH L 8 .   ? 13.806 11.472  5.340   1.00 66.11  ? 620  HOH A O     1 
HETATM 3935 O  O     . HOH L 8 .   ? 70.253 -17.117 12.478  1.00 30.33  ? 621  HOH A O     1 
HETATM 3936 O  O     . HOH L 8 .   ? 58.957 -32.441 7.900   1.00 34.54  ? 622  HOH A O     1 
HETATM 3937 O  O     . HOH L 8 .   ? 50.866 -11.623 -10.177 1.00 33.54  ? 623  HOH A O     1 
HETATM 3938 O  O     . HOH L 8 .   ? 44.090 23.242  -5.807  1.00 38.59  ? 624  HOH A O     1 
HETATM 3939 O  O     . HOH L 8 .   ? 64.842 -34.735 -6.209  1.00 44.53  ? 625  HOH A O     1 
HETATM 3940 O  O     . HOH L 8 .   ? 37.712 7.824   21.816  1.00 35.57  ? 626  HOH A O     1 
HETATM 3941 O  O     . HOH L 8 .   ? 52.956 24.295  4.401   1.00 35.01  ? 627  HOH A O     1 
HETATM 3942 O  O     . HOH L 8 .   ? 33.961 5.882   -21.769 1.00 32.21  ? 628  HOH A O     1 
HETATM 3943 O  O     . HOH L 8 .   ? 34.758 5.523   1.985   1.00 18.67  ? 629  HOH A O     1 
HETATM 3944 O  O     . HOH L 8 .   ? 28.125 9.978   -27.746 1.00 59.19  ? 630  HOH A O     1 
HETATM 3945 O  O     . HOH L 8 .   ? 65.288 -32.343 -12.607 1.00 56.93  ? 631  HOH A O     1 
HETATM 3946 O  O     . HOH L 8 .   ? 65.412 -6.801  -13.836 1.00 21.45  ? 632  HOH A O     1 
HETATM 3947 O  O     . HOH L 8 .   ? 25.882 11.516  13.900  1.00 49.41  ? 633  HOH A O     1 
HETATM 3948 O  O     . HOH L 8 .   ? 51.817 5.744   9.256   1.00 12.84  ? 634  HOH A O     1 
HETATM 3949 O  O     . HOH L 8 .   ? 56.958 -16.504 -11.281 1.00 25.17  ? 635  HOH A O     1 
HETATM 3950 O  O     . HOH L 8 .   ? 59.086 -18.393 -10.025 1.00 40.38  ? 636  HOH A O     1 
HETATM 3951 O  O     . HOH L 8 .   ? 62.707 9.558   -13.543 1.00 40.28  ? 637  HOH A O     1 
HETATM 3952 O  O     . HOH L 8 .   ? 60.598 -15.291 13.555  1.00 30.94  ? 638  HOH A O     1 
HETATM 3953 O  O     . HOH L 8 .   ? 46.814 -22.628 17.234  1.00 32.16  ? 639  HOH A O     1 
HETATM 3954 O  O     . HOH L 8 .   ? 48.217 -36.681 2.713   1.00 26.40  ? 640  HOH A O     1 
HETATM 3955 O  O     . HOH L 8 .   ? 62.998 12.769  -10.774 1.00 27.68  ? 641  HOH A O     1 
HETATM 3956 O  O     . HOH L 8 .   ? 44.357 10.615  -24.367 1.00 34.08  ? 642  HOH A O     1 
HETATM 3957 O  O     . HOH L 8 .   ? 53.339 13.415  -10.055 1.00 21.68  ? 643  HOH A O     1 
HETATM 3958 O  O     . HOH L 8 .   ? 70.891 3.464   -0.363  1.00 18.96  ? 644  HOH A O     1 
HETATM 3959 O  O     . HOH L 8 .   ? 65.074 -9.195  12.235  1.00 42.56  ? 645  HOH A O     1 
HETATM 3960 O  O     . HOH L 8 .   ? 60.273 -28.043 8.797   1.00 31.30  ? 646  HOH A O     1 
HETATM 3961 O  O     . HOH L 8 .   ? 73.230 -20.631 1.067   1.00 27.29  ? 647  HOH A O     1 
HETATM 3962 O  O     . HOH L 8 .   ? 44.487 -32.836 -3.093  1.00 41.21  ? 648  HOH A O     1 
HETATM 3963 O  O     . HOH L 8 .   ? 67.158 -8.297  9.741   1.00 20.90  ? 649  HOH A O     1 
HETATM 3964 O  O     . HOH L 8 .   ? 69.242 9.864   -8.659  1.00 27.37  ? 650  HOH A O     1 
HETATM 3965 O  O     . HOH L 8 .   ? 63.041 -26.417 6.987   1.00 22.31  ? 651  HOH A O     1 
HETATM 3966 O  O     . HOH L 8 .   ? 66.178 -2.441  12.729  1.00 35.85  ? 652  HOH A O     1 
HETATM 3967 O  O     . HOH L 8 .   ? 56.078 -13.860 -5.814  1.00 16.10  ? 653  HOH A O     1 
HETATM 3968 O  O     . HOH L 8 .   ? 52.855 19.339  -1.487  1.00 29.33  ? 654  HOH A O     1 
HETATM 3969 O  O     . HOH L 8 .   ? 42.824 -1.304  -24.995 1.00 29.01  ? 655  HOH A O     1 
HETATM 3970 O  O     . HOH L 8 .   ? 47.918 -33.169 -3.571  1.00 29.58  ? 656  HOH A O     1 
HETATM 3971 O  O     . HOH L 8 .   ? 75.115 0.537   -3.656  1.00 31.78  ? 657  HOH A O     1 
HETATM 3972 O  O     . HOH L 8 .   ? 36.895 15.114  -20.542 1.00 50.69  ? 658  HOH A O     1 
HETATM 3973 O  O     . HOH L 8 .   ? 36.935 15.990  -4.120  1.00 21.02  ? 659  HOH A O     1 
HETATM 3974 O  O     . HOH L 8 .   ? 50.395 -1.465  6.431   1.00 29.69  ? 660  HOH A O     1 
HETATM 3975 O  O     . HOH L 8 .   ? 59.551 14.088  -8.680  1.00 22.00  ? 661  HOH A O     1 
HETATM 3976 O  O     . HOH L 8 .   ? 55.599 -0.629  9.305   1.00 26.67  ? 662  HOH A O     1 
HETATM 3977 O  O     . HOH L 8 .   ? 68.172 -1.497  -14.230 1.00 38.76  ? 663  HOH A O     1 
HETATM 3978 O  O     . HOH L 8 .   ? 66.269 3.920   10.593  1.00 28.75  ? 664  HOH A O     1 
HETATM 3979 O  O     . HOH L 8 .   ? 46.815 -0.370  -8.488  1.00 26.36  ? 665  HOH A O     1 
HETATM 3980 O  O     . HOH L 8 .   ? 57.688 -7.311  8.142   1.00 20.18  ? 666  HOH A O     1 
HETATM 3981 O  O     . HOH L 8 .   ? 33.714 3.229   3.333   1.00 34.77  ? 667  HOH A O     1 
HETATM 3982 O  O     . HOH L 8 .   ? 52.480 1.304   9.482   1.00 18.11  ? 668  HOH A O     1 
HETATM 3983 O  O     . HOH L 8 .   ? 65.802 13.149  2.854   1.00 31.30  ? 669  HOH A O     1 
HETATM 3984 O  O     . HOH L 8 .   ? 52.116 15.794  -4.575  1.00 17.82  ? 670  HOH A O     1 
HETATM 3985 O  O     . HOH L 8 .   ? 53.457 -32.345 -2.833  1.00 33.43  ? 671  HOH A O     1 
HETATM 3986 O  O     . HOH L 8 .   ? 83.283 -8.093  0.486   1.00 43.24  ? 672  HOH A O     1 
HETATM 3987 O  O     . HOH L 8 .   ? 35.623 10.856  0.665   1.00 20.03  ? 673  HOH A O     1 
HETATM 3988 O  O     . HOH L 8 .   ? 27.468 6.827   -16.961 1.00 24.64  ? 674  HOH A O     1 
HETATM 3989 O  O     . HOH L 8 .   ? 48.859 2.686   21.245  1.00 24.39  ? 675  HOH A O     1 
HETATM 3990 O  O     . HOH L 8 .   ? 50.961 6.165   -18.834 1.00 32.40  ? 676  HOH A O     1 
HETATM 3991 O  O     . HOH L 8 .   ? 27.201 20.775  -6.455  1.00 32.63  ? 677  HOH A O     1 
HETATM 3992 O  O     . HOH L 8 .   ? 55.159 -20.577 21.236  1.00 26.22  ? 678  HOH A O     1 
HETATM 3993 O  O     . HOH L 8 .   ? 41.328 15.544  -22.992 1.00 30.83  ? 679  HOH A O     1 
HETATM 3994 O  O     . HOH L 8 .   ? 72.104 -7.655  11.625  1.00 20.67  ? 680  HOH A O     1 
HETATM 3995 O  O     . HOH L 8 .   ? 67.246 -6.358  12.723  1.00 26.17  ? 681  HOH A O     1 
HETATM 3996 O  O     . HOH L 8 .   ? 80.874 -10.999 -8.066  1.00 46.26  ? 682  HOH A O     1 
HETATM 3997 O  O     . HOH L 8 .   ? 39.164 -2.172  -14.309 1.00 32.99  ? 683  HOH A O     1 
HETATM 3998 O  O     . HOH L 8 .   ? 53.599 -28.431 4.244   1.00 15.12  ? 684  HOH A O     1 
HETATM 3999 O  O     . HOH L 8 .   ? 49.372 -9.263  -8.343  1.00 25.44  ? 685  HOH A O     1 
HETATM 4000 O  O     . HOH L 8 .   ? 62.253 14.789  -9.079  1.00 14.86  ? 686  HOH A O     1 
HETATM 4001 O  O     . HOH L 8 .   ? 30.584 1.721   -22.090 1.00 38.71  ? 687  HOH A O     1 
HETATM 4002 O  O     A HOH L 8 .   ? 48.403 0.122   9.807   0.60 33.51  ? 688  HOH A O     1 
HETATM 4003 O  O     . HOH L 8 .   ? 50.148 -14.777 -3.495  1.00 42.42  ? 689  HOH A O     1 
HETATM 4004 O  O     . HOH L 8 .   ? 48.230 19.838  4.544   1.00 28.56  ? 690  HOH A O     1 
HETATM 4005 O  O     . HOH L 8 .   ? 21.446 13.729  6.940   1.00 31.37  ? 691  HOH A O     1 
HETATM 4006 O  O     . HOH L 8 .   ? 60.588 -23.481 6.241   1.00 22.89  ? 692  HOH A O     1 
HETATM 4007 O  O     . HOH L 8 .   ? 62.490 -17.033 -7.019  1.00 25.98  ? 693  HOH A O     1 
HETATM 4008 O  O     . HOH L 8 .   ? 52.403 -5.340  -0.781  1.00 17.48  ? 694  HOH A O     1 
HETATM 4009 O  O     . HOH L 8 .   ? 52.507 -12.536 -3.734  1.00 32.98  ? 695  HOH A O     1 
HETATM 4010 O  O     . HOH L 8 .   ? 81.353 -18.604 5.700   1.00 41.16  ? 696  HOH A O     1 
HETATM 4011 O  O     . HOH L 8 .   ? 40.435 11.366  -3.590  1.00 15.27  ? 697  HOH A O     1 
HETATM 4012 O  O     . HOH L 8 .   ? 60.119 6.338   -15.614 1.00 30.28  ? 698  HOH A O     1 
HETATM 4013 O  O     . HOH L 8 .   ? 63.175 -17.015 15.217  1.00 37.45  ? 699  HOH A O     1 
HETATM 4014 O  O     . HOH L 8 .   ? 57.721 -27.368 11.418  1.00 23.05  ? 700  HOH A O     1 
HETATM 4015 O  O     . HOH L 8 .   ? 39.970 22.091  -2.481  1.00 44.19  ? 701  HOH A O     1 
HETATM 4016 O  O     . HOH L 8 .   ? 55.858 18.654  18.202  1.00 20.78  ? 702  HOH A O     1 
HETATM 4017 O  O     . HOH L 8 .   ? 40.835 7.677   -18.592 1.00 21.68  ? 703  HOH A O     1 
HETATM 4018 O  O     . HOH L 8 .   ? 42.374 12.973  -23.782 1.00 31.58  ? 704  HOH A O     1 
HETATM 4019 O  O     . HOH L 8 .   ? 52.164 20.160  4.969   1.00 19.80  ? 705  HOH A O     1 
HETATM 4020 O  O     . HOH L 8 .   ? 63.015 -7.115  12.920  1.00 33.86  ? 706  HOH A O     1 
HETATM 4021 O  O     . HOH L 8 .   ? 62.074 12.031  5.468   1.00 26.63  ? 707  HOH A O     1 
HETATM 4022 O  O     . HOH L 8 .   ? 67.430 6.616   0.657   1.00 24.95  ? 708  HOH A O     1 
HETATM 4023 O  O     . HOH L 8 .   ? 41.204 16.895  -14.866 1.00 25.14  ? 709  HOH A O     1 
HETATM 4024 O  O     . HOH L 8 .   ? 58.664 4.547   23.102  1.00 27.24  ? 710  HOH A O     1 
HETATM 4025 O  O     . HOH L 8 .   ? 61.654 -31.596 -10.541 1.00 54.16  ? 711  HOH A O     1 
HETATM 4026 O  O     . HOH L 8 .   ? 59.491 13.060  11.470  1.00 23.74  ? 712  HOH A O     1 
HETATM 4027 O  O     . HOH L 8 .   ? 61.963 -13.304 -13.361 1.00 31.65  ? 713  HOH A O     1 
HETATM 4028 O  O     . HOH L 8 .   ? 70.453 -18.925 1.441   1.00 19.61  ? 714  HOH A O     1 
HETATM 4029 O  O     . HOH L 8 .   ? 37.246 13.668  21.450  1.00 32.95  ? 715  HOH A O     1 
HETATM 4030 O  O     . HOH L 8 .   ? 49.995 -17.141 15.489  1.00 20.82  ? 716  HOH A O     1 
HETATM 4031 O  O     . HOH L 8 .   ? 65.343 5.962   2.119   1.00 23.16  ? 717  HOH A O     1 
HETATM 4032 O  O     . HOH L 8 .   ? 62.752 -23.710 3.271   1.00 28.30  ? 718  HOH A O     1 
HETATM 4033 O  O     . HOH L 8 .   ? 34.697 17.624  -12.743 1.00 30.28  ? 719  HOH A O     1 
HETATM 4034 O  O     . HOH L 8 .   ? 43.191 -33.140 -0.434  1.00 18.60  ? 720  HOH A O     1 
HETATM 4035 O  O     . HOH L 8 .   ? 41.899 8.146   3.190   1.00 16.12  ? 721  HOH A O     1 
HETATM 4036 O  O     . HOH L 8 .   ? 38.445 -17.963 10.208  1.00 25.66  ? 722  HOH A O     1 
HETATM 4037 O  O     . HOH L 8 .   ? 57.642 -23.392 14.216  1.00 12.17  ? 723  HOH A O     1 
HETATM 4038 O  O     . HOH L 8 .   ? 53.105 -28.163 15.323  1.00 19.11  ? 724  HOH A O     1 
HETATM 4039 O  O     . HOH L 8 .   ? 46.631 16.273  25.545  1.00 27.53  ? 725  HOH A O     1 
HETATM 4040 O  O     . HOH L 8 .   ? 45.708 7.326   -12.883 1.00 32.32  ? 726  HOH A O     1 
HETATM 4041 O  O     . HOH L 8 .   ? 71.239 0.756   10.773  1.00 52.38  ? 727  HOH A O     1 
HETATM 4042 O  O     . HOH L 8 .   ? 58.230 -12.111 -11.313 1.00 18.56  ? 728  HOH A O     1 
HETATM 4043 O  O     . HOH L 8 .   ? 42.028 -18.859 14.886  1.00 26.74  ? 729  HOH A O     1 
HETATM 4044 O  O     . HOH L 8 .   ? 45.923 -9.603  10.926  1.00 29.97  ? 730  HOH A O     1 
HETATM 4045 O  O     . HOH L 8 .   ? 40.427 16.667  6.193   1.00 23.47  ? 731  HOH A O     1 
HETATM 4046 O  O     . HOH L 8 .   ? 52.511 -19.664 22.136  1.00 32.96  ? 732  HOH A O     1 
HETATM 4047 O  O     . HOH L 8 .   ? 47.502 -26.907 -7.155  1.00 26.71  ? 733  HOH A O     1 
HETATM 4048 O  O     . HOH L 8 .   ? 62.281 7.535   7.121   1.00 14.48  ? 734  HOH A O     1 
HETATM 4049 O  O     . HOH L 8 .   ? 66.742 -16.483 9.705   1.00 16.50  ? 735  HOH A O     1 
HETATM 4050 O  O     . HOH L 8 .   ? 40.991 6.631   19.112  1.00 22.17  ? 736  HOH A O     1 
HETATM 4051 O  O     . HOH L 8 .   ? 46.400 -0.202  -15.093 1.00 22.67  ? 737  HOH A O     1 
HETATM 4052 O  O     . HOH L 8 .   ? 55.694 -33.055 2.361   1.00 34.15  ? 738  HOH A O     1 
HETATM 4053 O  O     . HOH L 8 .   ? 34.505 19.788  -16.242 1.00 29.24  ? 739  HOH A O     1 
HETATM 4054 O  O     . HOH L 8 .   ? 63.809 -9.511  -14.366 1.00 22.05  ? 740  HOH A O     1 
HETATM 4055 O  O     . HOH L 8 .   ? 45.233 17.914  -3.703  1.00 36.86  ? 741  HOH A O     1 
HETATM 4056 O  O     . HOH L 8 .   ? 55.232 17.356  -0.721  1.00 14.32  ? 742  HOH A O     1 
HETATM 4057 O  O     . HOH L 8 .   ? 69.579 -13.057 -11.711 1.00 30.00  ? 743  HOH A O     1 
HETATM 4058 O  O     . HOH L 8 .   ? 48.375 -22.196 -5.541  1.00 24.17  ? 744  HOH A O     1 
HETATM 4059 O  O     . HOH L 8 .   ? 64.977 19.665  6.378   1.00 34.19  ? 745  HOH A O     1 
HETATM 4060 O  O     . HOH L 8 .   ? 48.800 -34.384 9.989   1.00 40.20  ? 746  HOH A O     1 
HETATM 4061 O  O     . HOH L 8 .   ? 47.260 -16.473 -0.688  1.00 23.25  ? 747  HOH A O     1 
HETATM 4062 O  O     . HOH L 8 .   ? 55.098 -1.045  -14.688 1.00 29.75  ? 748  HOH A O     1 
HETATM 4063 O  O     . HOH L 8 .   ? 52.787 -26.355 -3.839  1.00 25.83  ? 749  HOH A O     1 
HETATM 4064 O  O     . HOH L 8 .   ? 60.373 14.054  6.289   1.00 22.92  ? 750  HOH A O     1 
HETATM 4065 O  O     . HOH L 8 .   ? 33.017 10.563  5.612   1.00 23.23  ? 751  HOH A O     1 
HETATM 4066 O  O     . HOH L 8 .   ? 34.362 14.851  11.509  1.00 21.94  ? 752  HOH A O     1 
HETATM 4067 O  O     . HOH L 8 .   ? 51.184 5.140   -10.886 1.00 24.12  ? 753  HOH A O     1 
HETATM 4068 O  O     . HOH L 8 .   ? 68.921 -13.425 5.124   1.00 12.46  ? 754  HOH A O     1 
HETATM 4069 O  O     . HOH L 8 .   ? 68.534 16.303  -3.984  1.00 16.81  ? 755  HOH A O     1 
HETATM 4070 O  O     . HOH L 8 .   ? 40.176 8.831   27.122  1.00 28.24  ? 756  HOH A O     1 
HETATM 4071 O  O     . HOH L 8 .   ? 42.911 -25.585 17.490  1.00 36.78  ? 757  HOH A O     1 
HETATM 4072 O  O     A HOH L 8 .   ? 54.435 -0.733  5.774   0.73 12.99  ? 758  HOH A O     1 
HETATM 4073 O  O     B HOH L 8 .   ? 53.148 -0.068  6.426   0.27 11.93  ? 758  HOH A O     1 
HETATM 4074 O  O     . HOH L 8 .   ? 63.857 -3.208  6.066   1.00 13.48  ? 759  HOH A O     1 
HETATM 4075 O  O     . HOH L 8 .   ? 59.137 4.843   16.714  1.00 23.61  ? 760  HOH A O     1 
HETATM 4076 O  O     . HOH L 8 .   ? 68.913 -17.500 -1.271  1.00 14.73  ? 761  HOH A O     1 
HETATM 4077 O  O     . HOH L 8 .   ? 40.262 -28.527 -9.979  1.00 32.82  ? 762  HOH A O     1 
HETATM 4078 O  O     . HOH L 8 .   ? 52.533 3.536   17.871  1.00 33.93  ? 763  HOH A O     1 
HETATM 4079 O  O     . HOH L 8 .   ? 42.507 15.479  23.713  1.00 26.78  ? 764  HOH A O     1 
HETATM 4080 O  O     . HOH L 8 .   ? 44.681 -14.164 10.431  1.00 16.94  ? 765  HOH A O     1 
HETATM 4081 O  O     . HOH L 8 .   ? 71.798 -3.809  -13.848 1.00 29.71  ? 766  HOH A O     1 
HETATM 4082 O  O     . HOH L 8 .   ? 53.383 6.079   -12.223 1.00 26.14  ? 767  HOH A O     1 
HETATM 4083 O  O     . HOH L 8 .   ? 42.899 19.853  -11.291 1.00 42.71  ? 768  HOH A O     1 
HETATM 4084 O  O     . HOH L 8 .   ? 50.981 8.685   -15.499 1.00 27.63  ? 769  HOH A O     1 
HETATM 4085 O  O     . HOH L 8 .   ? 23.047 14.413  -9.181  1.00 30.73  ? 770  HOH A O     1 
HETATM 4086 O  O     . HOH L 8 .   ? 50.862 5.548   -8.260  1.00 18.70  ? 771  HOH A O     1 
HETATM 4087 O  O     . HOH L 8 .   ? 53.396 -20.332 -2.434  1.00 19.67  ? 772  HOH A O     1 
HETATM 4088 O  O     . HOH L 8 .   ? 47.050 20.753  7.338   1.00 22.13  ? 773  HOH A O     1 
HETATM 4089 O  O     . HOH L 8 .   ? 43.272 12.103  -7.188  1.00 16.38  ? 774  HOH A O     1 
HETATM 4090 O  O     . HOH L 8 .   ? 67.164 -20.592 8.870   1.00 12.58  ? 775  HOH A O     1 
HETATM 4091 O  O     . HOH L 8 .   ? 63.025 -18.927 -1.641  1.00 19.33  ? 776  HOH A O     1 
HETATM 4092 O  O     . HOH L 8 .   ? 55.363 -32.662 5.088   1.00 33.25  ? 777  HOH A O     1 
HETATM 4093 O  O     . HOH L 8 .   ? 57.956 -17.907 19.762  1.00 23.34  ? 778  HOH A O     1 
HETATM 4094 O  O     . HOH L 8 .   ? 50.765 5.842   -22.942 1.00 42.05  ? 779  HOH A O     1 
HETATM 4095 O  O     . HOH L 8 .   ? 63.325 -11.534 12.747  1.00 42.46  ? 780  HOH A O     1 
HETATM 4096 O  O     . HOH L 8 .   ? 50.084 14.016  -19.939 1.00 39.74  ? 781  HOH A O     1 
HETATM 4097 O  O     . HOH L 8 .   ? 21.701 11.979  -9.386  1.00 27.80  ? 782  HOH A O     1 
HETATM 4098 O  O     . HOH L 8 .   ? 59.106 11.143  8.535   1.00 16.51  ? 783  HOH A O     1 
HETATM 4099 O  O     . HOH L 8 .   ? 45.365 15.934  -1.503  1.00 17.28  ? 784  HOH A O     1 
HETATM 4100 O  O     . HOH L 8 .   ? 72.930 2.151   7.983   1.00 26.26  ? 785  HOH A O     1 
HETATM 4101 O  O     B HOH L 8 .   ? 49.309 4.340   7.510   0.51 17.24  ? 786  HOH A O     1 
HETATM 4102 O  O     . HOH L 8 .   ? 52.299 8.498   25.914  1.00 37.31  ? 787  HOH A O     1 
HETATM 4103 O  O     . HOH L 8 .   ? 71.352 -19.163 14.744  1.00 45.39  ? 788  HOH A O     1 
HETATM 4104 O  O     . HOH L 8 .   ? 52.654 -1.195  3.630   1.00 12.86  ? 789  HOH A O     1 
HETATM 4105 O  O     . HOH L 8 .   ? 50.250 -34.656 -0.757  1.00 24.04  ? 790  HOH A O     1 
HETATM 4106 O  O     . HOH L 8 .   ? 59.734 11.521  -10.329 1.00 18.01  ? 791  HOH A O     1 
HETATM 4107 O  O     . HOH L 8 .   ? 76.532 2.617   6.452   1.00 29.67  ? 792  HOH A O     1 
HETATM 4108 O  O     . HOH L 8 .   ? 41.121 21.478  2.381   1.00 25.08  ? 793  HOH A O     1 
HETATM 4109 O  O     . HOH L 8 .   ? 49.433 -15.732 -8.807  1.00 34.33  ? 794  HOH A O     1 
HETATM 4110 O  O     . HOH L 8 .   ? 65.644 -15.091 11.646  1.00 21.42  ? 795  HOH A O     1 
HETATM 4111 O  O     . HOH L 8 .   ? 53.826 -9.267  5.303   1.00 19.74  ? 796  HOH A O     1 
HETATM 4112 O  O     . HOH L 8 .   ? 48.615 -9.411  10.416  1.00 27.57  ? 797  HOH A O     1 
HETATM 4113 O  O     . HOH L 8 .   ? 50.865 -8.691  -5.222  1.00 28.56  ? 798  HOH A O     1 
HETATM 4114 O  O     . HOH L 8 .   ? 33.621 7.358   17.258  1.00 41.73  ? 799  HOH A O     1 
HETATM 4115 O  O     . HOH L 8 .   ? 49.618 -3.160  -17.333 1.00 23.55  ? 800  HOH A O     1 
HETATM 4116 O  O     . HOH L 8 .   ? 53.277 7.456   -14.789 1.00 33.95  ? 801  HOH A O     1 
HETATM 4117 O  O     . HOH L 8 .   ? 64.519 6.559   -0.277  1.00 23.24  ? 802  HOH A O     1 
HETATM 4118 O  O     . HOH L 8 .   ? 77.942 -0.894  5.057   1.00 24.33  ? 803  HOH A O     1 
HETATM 4119 O  O     . HOH L 8 .   ? 65.292 -22.844 3.238   1.00 15.21  ? 804  HOH A O     1 
HETATM 4120 O  O     . HOH L 8 .   ? 69.512 -18.776 -9.532  1.00 36.54  ? 805  HOH A O     1 
HETATM 4121 O  O     . HOH L 8 .   ? 54.019 15.432  23.344  1.00 35.28  ? 806  HOH A O     1 
HETATM 4122 O  O     . HOH L 8 .   ? 60.109 -18.437 -4.541  1.00 16.09  ? 807  HOH A O     1 
HETATM 4123 O  O     . HOH L 8 .   ? 46.099 0.344   7.050   1.00 25.26  ? 808  HOH A O     1 
HETATM 4124 O  O     . HOH L 8 .   ? 70.501 16.119  -6.021  1.00 17.60  ? 809  HOH A O     1 
HETATM 4125 O  O     . HOH L 8 .   ? 41.977 -22.448 -2.501  1.00 19.61  ? 810  HOH A O     1 
HETATM 4126 O  O     . HOH L 8 .   ? 51.569 17.956  -9.505  1.00 28.29  ? 811  HOH A O     1 
HETATM 4127 O  O     . HOH L 8 .   ? 40.618 -29.627 13.062  1.00 34.95  ? 812  HOH A O     1 
HETATM 4128 O  O     . HOH L 8 .   ? 50.007 3.057   12.862  1.00 27.04  ? 813  HOH A O     1 
HETATM 4129 O  O     . HOH L 8 .   ? 59.590 10.457  19.891  1.00 22.55  ? 814  HOH A O     1 
HETATM 4130 O  O     . HOH L 8 .   ? 32.913 2.542   -0.359  1.00 27.16  ? 815  HOH A O     1 
HETATM 4131 O  O     . HOH L 8 .   ? 43.806 -15.062 1.391   1.00 18.87  ? 816  HOH A O     1 
HETATM 4132 O  O     . HOH L 8 .   ? 44.483 -16.883 -0.334  1.00 26.99  ? 817  HOH A O     1 
HETATM 4133 O  O     . HOH L 8 .   ? 37.020 18.585  16.969  1.00 35.13  ? 818  HOH A O     1 
HETATM 4134 O  O     . HOH L 8 .   ? 71.224 6.101   -7.400  1.00 21.78  ? 819  HOH A O     1 
HETATM 4135 O  O     . HOH L 8 .   ? 56.158 1.169   13.272  1.00 30.87  ? 820  HOH A O     1 
HETATM 4136 O  O     . HOH L 8 .   ? 43.784 11.028  -12.131 1.00 27.37  ? 821  HOH A O     1 
HETATM 4137 O  O     . HOH L 8 .   ? 68.558 -10.882 12.186  1.00 30.58  ? 822  HOH A O     1 
HETATM 4138 O  O     . HOH L 8 .   ? 45.596 17.770  -10.036 1.00 46.41  ? 823  HOH A O     1 
HETATM 4139 O  O     . HOH L 8 .   ? 49.575 -9.018  12.753  1.00 34.49  ? 824  HOH A O     1 
HETATM 4140 O  O     . HOH L 8 .   ? 56.117 -2.695  4.156   1.00 23.29  ? 825  HOH A O     1 
HETATM 4141 O  O     . HOH L 8 .   ? 49.008 -37.688 0.433   1.00 30.97  ? 826  HOH A O     1 
HETATM 4142 O  O     . HOH L 8 .   ? 29.345 3.895   6.493   1.00 33.31  ? 827  HOH A O     1 
HETATM 4143 O  O     . HOH L 8 .   ? 40.480 -1.685  -16.441 1.00 32.84  ? 828  HOH A O     1 
HETATM 4144 O  O     . HOH L 8 .   ? 72.912 -7.345  8.953   1.00 16.15  ? 829  HOH A O     1 
HETATM 4145 O  O     . HOH L 8 .   ? 41.234 20.164  4.871   1.00 24.51  ? 830  HOH A O     1 
HETATM 4146 O  O     . HOH L 8 .   ? 52.947 -33.362 -0.093  1.00 27.97  ? 831  HOH A O     1 
HETATM 4147 O  O     . HOH L 8 .   ? 46.440 19.453  1.558   1.00 24.89  ? 832  HOH A O     1 
HETATM 4148 O  O     . HOH L 8 .   ? 37.863 10.967  21.417  1.00 39.87  ? 833  HOH A O     1 
HETATM 4149 O  O     . HOH L 8 .   ? 65.251 3.361   -17.717 1.00 45.74  ? 834  HOH A O     1 
HETATM 4150 O  O     . HOH L 8 .   ? 65.245 -4.337  -15.207 1.00 30.95  ? 835  HOH A O     1 
HETATM 4151 O  O     . HOH L 8 .   ? 45.967 1.909   18.950  1.00 48.54  ? 836  HOH A O     1 
HETATM 4152 O  O     . HOH L 8 .   ? 59.749 14.467  3.481   1.00 25.94  ? 837  HOH A O     1 
HETATM 4153 O  O     . HOH L 8 .   ? 44.874 0.607   -18.622 1.00 24.72  ? 838  HOH A O     1 
HETATM 4154 O  O     . HOH L 8 .   ? 50.198 -12.741 -0.785  1.00 24.14  ? 839  HOH A O     1 
HETATM 4155 O  O     . HOH L 8 .   ? 42.682 -2.737  -20.075 1.00 26.61  ? 840  HOH A O     1 
HETATM 4156 O  O     . HOH L 8 .   ? 49.202 -14.771 18.492  1.00 30.56  ? 841  HOH A O     1 
HETATM 4157 O  O     . HOH L 8 .   ? 80.511 -3.751  13.772  1.00 37.17  ? 842  HOH A O     1 
HETATM 4158 O  O     . HOH L 8 .   ? 82.538 -3.867  -4.542  1.00 33.06  ? 843  HOH A O     1 
HETATM 4159 O  O     . HOH L 8 .   ? 40.869 -3.034  -23.059 1.00 26.99  ? 844  HOH A O     1 
HETATM 4160 O  O     . HOH L 8 .   ? 65.568 8.711   9.034   1.00 33.63  ? 845  HOH A O     1 
HETATM 4161 O  O     . HOH L 8 .   ? 55.561 -35.272 11.108  1.00 32.25  ? 846  HOH A O     1 
HETATM 4162 O  O     . HOH L 8 .   ? 43.667 -28.996 15.608  1.00 37.52  ? 847  HOH A O     1 
HETATM 4163 O  O     . HOH L 8 .   ? 45.972 16.711  1.234   1.00 14.73  ? 848  HOH A O     1 
HETATM 4164 O  O     . HOH L 8 .   ? 69.121 8.100   4.070   1.00 34.83  ? 849  HOH A O     1 
HETATM 4165 O  O     . HOH L 8 .   ? 37.996 -25.182 6.049   1.00 40.67  ? 850  HOH A O     1 
HETATM 4166 O  O     . HOH L 8 .   ? 50.444 -6.511  -5.440  1.00 28.24  ? 851  HOH A O     1 
HETATM 4167 O  O     . HOH L 8 .   ? 48.901 7.390   -7.736  1.00 23.48  ? 852  HOH A O     1 
HETATM 4168 O  O     . HOH L 8 .   ? 61.357 14.625  8.826   1.00 25.45  ? 853  HOH A O     1 
HETATM 4169 O  O     . HOH L 8 .   ? 41.172 -23.687 -5.050  1.00 25.38  ? 854  HOH A O     1 
HETATM 4170 O  O     . HOH L 8 .   ? 69.518 -8.687  10.621  1.00 32.08  ? 855  HOH A O     1 
HETATM 4171 O  O     . HOH L 8 .   ? 39.332 18.571  18.055  1.00 35.52  ? 856  HOH A O     1 
HETATM 4172 O  O     . HOH L 8 .   ? 69.048 4.454   3.928   1.00 20.63  ? 857  HOH A O     1 
HETATM 4173 O  O     . HOH L 8 .   ? 40.677 -29.434 -2.307  1.00 30.01  ? 858  HOH A O     1 
HETATM 4174 O  O     . HOH L 8 .   ? 40.543 -18.260 0.780   1.00 35.83  ? 859  HOH A O     1 
HETATM 4175 O  O     . HOH L 8 .   ? 47.127 2.377   -0.952  1.00 16.95  ? 860  HOH A O     1 
HETATM 4176 O  O     . HOH L 8 .   ? 35.254 20.734  0.524   1.00 23.02  ? 861  HOH A O     1 
HETATM 4177 O  O     . HOH L 8 .   ? 54.325 -11.202 3.480   1.00 15.03  ? 862  HOH A O     1 
HETATM 4178 O  O     . HOH L 8 .   ? 65.404 -22.352 -7.880  1.00 32.52  ? 863  HOH A O     1 
HETATM 4179 O  O     . HOH L 8 .   ? 83.556 -5.512  2.420   1.00 32.74  ? 864  HOH A O     1 
HETATM 4180 O  O     . HOH L 8 .   ? 25.520 14.678  5.318   1.00 26.07  ? 865  HOH A O     1 
HETATM 4181 O  O     . HOH L 8 .   ? 59.387 9.546   10.820  1.00 14.15  ? 866  HOH A O     1 
HETATM 4182 O  O     . HOH L 8 .   ? 35.278 22.530  -3.266  1.00 32.54  ? 867  HOH A O     1 
HETATM 4183 O  O     . HOH L 8 .   ? 17.194 -2.962  -5.781  1.00 56.60  ? 868  HOH A O     1 
HETATM 4184 O  O     . HOH L 8 .   ? 61.548 -2.412  12.099  1.00 40.25  ? 869  HOH A O     1 
HETATM 4185 O  O     . HOH L 8 .   ? 42.050 -8.945  9.754   1.00 31.19  ? 870  HOH A O     1 
HETATM 4186 O  O     . HOH L 8 .   ? 51.343 -33.598 10.800  1.00 46.23  ? 871  HOH A O     1 
HETATM 4187 O  O     . HOH L 8 .   ? 57.094 0.101   -14.747 1.00 22.97  ? 872  HOH A O     1 
HETATM 4188 O  O     . HOH L 8 .   ? 48.888 -15.478 13.749  1.00 20.06  ? 873  HOH A O     1 
HETATM 4189 O  O     . HOH L 8 .   ? 57.220 0.023   10.534  1.00 31.21  ? 874  HOH A O     1 
HETATM 4190 O  O     . HOH L 8 .   ? 36.477 12.867  11.969  1.00 27.47  ? 875  HOH A O     1 
HETATM 4191 O  O     . HOH L 8 .   ? 38.055 10.439  9.567   1.00 22.53  ? 876  HOH A O     1 
HETATM 4192 O  O     . HOH L 8 .   ? 30.842 21.552  -3.409  1.00 30.50  ? 877  HOH A O     1 
HETATM 4193 O  O     . HOH L 8 .   ? 58.930 -13.413 15.338  1.00 38.75  ? 878  HOH A O     1 
HETATM 4194 O  O     . HOH L 8 .   ? 51.010 21.696  7.171   1.00 26.04  ? 879  HOH A O     1 
HETATM 4195 O  O     . HOH L 8 .   ? 54.299 -33.949 12.685  1.00 36.86  ? 880  HOH A O     1 
HETATM 4196 O  O     . HOH L 8 .   ? 46.706 0.762   13.720  1.00 35.38  ? 881  HOH A O     1 
HETATM 4197 O  O     . HOH L 8 .   ? 59.785 -18.040 -7.643  1.00 23.26  ? 882  HOH A O     1 
HETATM 4198 O  O     . HOH L 8 .   ? 78.879 3.495   2.016   1.00 36.53  ? 883  HOH A O     1 
HETATM 4199 O  O     . HOH L 8 .   ? 64.838 19.387  1.884   1.00 24.45  ? 884  HOH A O     1 
HETATM 4200 O  O     . HOH L 8 .   ? 49.853 21.140  8.881   1.00 39.27  ? 885  HOH A O     1 
HETATM 4201 O  O     . HOH L 8 .   ? 28.757 8.149   -18.793 1.00 25.60  ? 886  HOH A O     1 
HETATM 4202 O  O     . HOH L 8 .   ? 46.474 -14.368 14.853  1.00 37.29  ? 887  HOH A O     1 
HETATM 4203 O  O     . HOH L 8 .   ? 14.365 15.499  -1.479  1.00 38.47  ? 888  HOH A O     1 
HETATM 4204 O  O     . HOH L 8 .   ? 39.405 23.093  16.850  1.00 30.44  ? 889  HOH A O     1 
HETATM 4205 O  O     . HOH L 8 .   ? 53.253 -8.325  8.879   1.00 27.71  ? 890  HOH A O     1 
HETATM 4206 O  O     . HOH L 8 .   ? 43.226 17.202  18.213  1.00 28.46  ? 891  HOH A O     1 
HETATM 4207 O  O     . HOH L 8 .   ? 56.264 21.392  18.324  1.00 27.44  ? 892  HOH A O     1 
HETATM 4208 O  O     . HOH L 8 .   ? 46.675 -8.546  -4.506  1.00 24.68  ? 893  HOH A O     1 
HETATM 4209 O  O     . HOH L 8 .   ? 67.781 -14.473 -10.140 1.00 23.90  ? 894  HOH A O     1 
HETATM 4210 O  O     . HOH L 8 .   ? 61.498 15.896  2.239   1.00 27.81  ? 895  HOH A O     1 
HETATM 4211 O  O     . HOH L 8 .   ? 33.639 14.806  19.060  1.00 38.12  ? 896  HOH A O     1 
HETATM 4212 O  O     . HOH L 8 .   ? 57.377 5.492   -15.767 1.00 32.41  ? 897  HOH A O     1 
HETATM 4213 O  O     . HOH L 8 .   ? 44.686 7.252   -10.312 1.00 19.24  ? 898  HOH A O     1 
HETATM 4214 O  O     . HOH L 8 .   ? 18.897 14.446  6.473   1.00 44.02  ? 899  HOH A O     1 
HETATM 4215 O  O     . HOH L 8 .   ? 74.587 -22.345 -6.548  1.00 40.94  ? 900  HOH A O     1 
HETATM 4216 O  O     . HOH L 8 .   ? 38.706 -3.569  -19.926 1.00 30.67  ? 901  HOH A O     1 
HETATM 4217 O  O     . HOH L 8 .   ? 61.317 1.777   13.974  1.00 44.82  ? 902  HOH A O     1 
HETATM 4218 O  O     . HOH L 8 .   ? 53.491 17.342  -3.048  1.00 21.37  ? 903  HOH A O     1 
HETATM 4219 O  O     . HOH L 8 .   ? 31.041 19.173  11.122  1.00 37.08  ? 904  HOH A O     1 
HETATM 4220 O  O     . HOH L 8 .   ? 51.062 3.486   10.314  1.00 18.97  ? 905  HOH A O     1 
HETATM 4221 O  O     . HOH L 8 .   ? 61.519 16.283  4.557   1.00 42.40  ? 906  HOH A O     1 
HETATM 4222 O  O     . HOH L 8 .   ? 47.399 -30.700 -6.996  1.00 51.81  ? 907  HOH A O     1 
HETATM 4223 O  O     . HOH L 8 .   ? 51.780 -18.047 -6.221  1.00 46.94  ? 908  HOH A O     1 
HETATM 4224 O  O     . HOH L 8 .   ? 47.332 21.745  9.576   1.00 29.62  ? 909  HOH A O     1 
HETATM 4225 O  O     . HOH L 8 .   ? 43.302 -30.891 -10.205 1.00 37.07  ? 910  HOH A O     1 
HETATM 4226 O  O     . HOH L 8 .   ? 48.957 8.494   -13.554 1.00 28.95  ? 911  HOH A O     1 
HETATM 4227 O  O     . HOH L 8 .   ? 67.691 -4.996  -17.127 1.00 37.66  ? 912  HOH A O     1 
HETATM 4228 O  O     . HOH L 8 .   ? 61.326 4.491   -16.992 1.00 41.73  ? 913  HOH A O     1 
HETATM 4229 O  O     . HOH L 8 .   ? 52.258 -9.911  -2.982  1.00 27.48  ? 914  HOH A O     1 
HETATM 4230 O  O     . HOH L 8 .   ? 45.175 17.254  -18.013 1.00 33.83  ? 915  HOH A O     1 
HETATM 4231 O  O     . HOH L 8 .   ? 61.583 24.228  9.865   1.00 25.23  ? 916  HOH A O     1 
HETATM 4232 O  O     . HOH L 8 .   ? 80.835 -4.237  23.291  1.00 48.88  ? 917  HOH A O     1 
HETATM 4233 O  O     . HOH L 8 .   ? 33.505 22.088  -0.435  1.00 50.55  ? 918  HOH A O     1 
HETATM 4234 O  O     . HOH L 8 .   ? 52.842 -20.120 -5.027  1.00 28.11  ? 919  HOH A O     1 
HETATM 4235 O  O     . HOH L 8 .   ? 49.562 26.452  3.239   1.00 38.22  ? 920  HOH A O     1 
HETATM 4236 O  O     . HOH L 8 .   ? 40.826 7.480   -29.936 1.00 39.74  ? 921  HOH A O     1 
HETATM 4237 O  O     . HOH L 8 .   ? 50.991 4.602   24.960  1.00 31.58  ? 922  HOH A O     1 
HETATM 4238 O  O     . HOH L 8 .   ? 35.270 -1.755  -23.492 1.00 49.82  ? 923  HOH A O     1 
HETATM 4239 O  O     . HOH L 8 .   ? 57.096 -18.913 22.120  1.00 28.69  ? 924  HOH A O     1 
HETATM 4240 O  O     . HOH L 8 .   ? 38.387 -27.881 6.842   1.00 44.04  ? 925  HOH A O     1 
HETATM 4241 O  O     . HOH L 8 .   ? 46.542 -18.674 -3.047  1.00 36.91  ? 926  HOH A O     1 
HETATM 4242 O  O     . HOH L 8 .   ? 61.567 7.894   16.370  1.00 28.11  ? 927  HOH A O     1 
HETATM 4243 O  O     . HOH L 8 .   ? 68.294 -21.108 -8.713  1.00 38.22  ? 928  HOH A O     1 
HETATM 4244 O  O     . HOH L 8 .   ? 38.570 13.674  24.059  1.00 36.82  ? 929  HOH A O     1 
HETATM 4245 O  O     . HOH L 8 .   ? 61.767 -25.286 4.914   1.00 29.71  ? 930  HOH A O     1 
HETATM 4246 O  O     . HOH L 8 .   ? 38.847 -18.890 5.315   1.00 36.76  ? 931  HOH A O     1 
HETATM 4247 O  O     . HOH L 8 .   ? 42.744 10.593  -25.964 1.00 45.77  ? 932  HOH A O     1 
HETATM 4248 O  O     . HOH L 8 .   ? 51.427 -17.984 -9.124  1.00 43.25  ? 933  HOH A O     1 
HETATM 4249 O  O     . HOH L 8 .   ? 59.430 -29.109 -8.167  1.00 47.56  ? 934  HOH A O     1 
HETATM 4250 O  O     . HOH L 8 .   ? 58.986 30.491  12.091  1.00 58.24  ? 935  HOH A O     1 
HETATM 4251 O  O     . HOH L 8 .   ? 47.706 10.648  -9.490  1.00 27.42  ? 936  HOH A O     1 
HETATM 4252 O  O     . HOH L 8 .   ? 39.067 4.444   17.829  1.00 45.35  ? 937  HOH A O     1 
HETATM 4253 O  O     . HOH L 8 .   ? 61.138 10.035  7.391   1.00 34.96  ? 938  HOH A O     1 
HETATM 4254 O  O     . HOH L 8 .   ? 46.650 10.621  -13.232 1.00 54.81  ? 939  HOH A O     1 
HETATM 4255 O  O     . HOH L 8 .   ? 53.369 5.433   -16.532 1.00 43.55  ? 940  HOH A O     1 
HETATM 4256 O  O     . HOH L 8 .   ? 22.026 18.013  -6.927  1.00 49.70  ? 941  HOH A O     1 
HETATM 4257 O  O     . HOH L 8 .   ? 42.727 17.258  -17.005 1.00 25.54  ? 942  HOH A O     1 
HETATM 4258 O  O     . HOH L 8 .   ? 64.034 -15.423 13.788  1.00 35.29  ? 943  HOH A O     1 
HETATM 4259 O  O     . HOH L 8 .   ? 48.449 -23.978 19.702  1.00 45.95  ? 944  HOH A O     1 
HETATM 4260 O  O     . HOH L 8 .   ? 51.349 -15.904 17.388  1.00 31.92  ? 945  HOH A O     1 
HETATM 4261 O  O     . HOH L 8 .   ? 70.095 -21.579 0.697   1.00 26.92  ? 946  HOH A O     1 
HETATM 4262 O  O     . HOH L 8 .   ? 61.841 12.290  9.567   1.00 39.85  ? 947  HOH A O     1 
HETATM 4263 O  O     . HOH L 8 .   ? 54.814 -17.226 -13.176 1.00 37.09  ? 948  HOH A O     1 
HETATM 4264 O  O     . HOH L 8 .   ? 38.620 -19.748 12.418  1.00 35.63  ? 949  HOH A O     1 
HETATM 4265 O  O     . HOH L 8 .   ? 32.008 2.819   -23.814 1.00 43.69  ? 950  HOH A O     1 
HETATM 4266 O  O     . HOH L 8 .   ? 52.317 -18.063 -11.507 1.00 38.53  ? 951  HOH A O     1 
HETATM 4267 O  O     . HOH L 8 .   ? 40.177 -18.065 -1.453  1.00 31.91  ? 952  HOH A O     1 
HETATM 4268 O  O     . HOH L 8 .   ? 70.887 9.010   -6.825  1.00 30.42  ? 953  HOH A O     1 
HETATM 4269 O  O     . HOH L 8 .   ? 55.542 13.193  -11.483 1.00 29.33  ? 954  HOH A O     1 
HETATM 4270 O  O     . HOH L 8 .   ? 39.427 -18.813 14.499  1.00 36.06  ? 955  HOH A O     1 
HETATM 4271 O  O     . HOH L 8 .   ? 29.830 15.858  10.754  1.00 35.80  ? 956  HOH A O     1 
HETATM 4272 O  O     . HOH L 8 .   ? 48.707 12.084  -11.459 1.00 30.57  ? 957  HOH A O     1 
HETATM 4273 O  O     . HOH L 8 .   ? 43.903 0.489   -21.078 1.00 28.94  ? 958  HOH A O     1 
HETATM 4274 O  O     . HOH L 8 .   ? 58.258 15.173  -10.619 1.00 27.87  ? 959  HOH A O     1 
HETATM 4275 O  O     . HOH L 8 .   ? 59.353 -27.939 -2.090  1.00 35.95  ? 960  HOH A O     1 
HETATM 4276 O  O     . HOH L 8 .   ? 52.908 -0.024  12.052  1.00 33.00  ? 961  HOH A O     1 
HETATM 4277 O  O     . HOH L 8 .   ? 43.083 -16.376 -2.548  1.00 33.84  ? 962  HOH A O     1 
HETATM 4278 O  O     . HOH L 8 .   ? 55.142 -7.264  6.807   1.00 25.26  ? 963  HOH A O     1 
HETATM 4279 O  O     . HOH L 8 .   ? 73.391 4.461   -1.505  1.00 31.94  ? 964  HOH A O     1 
HETATM 4280 O  O     . HOH L 8 .   ? 67.679 -25.846 -0.655  1.00 41.05  ? 965  HOH A O     1 
HETATM 4281 O  O     . HOH L 8 .   ? 45.004 -1.795  -24.589 1.00 37.96  ? 966  HOH A O     1 
HETATM 4282 O  O     . HOH L 8 .   ? 49.991 0.919   20.210  1.00 32.62  ? 967  HOH A O     1 
HETATM 4283 O  O     . HOH L 8 .   ? 22.518 15.036  -17.476 1.00 47.16  ? 968  HOH A O     1 
HETATM 4284 O  O     . HOH L 8 .   ? 48.894 -0.382  -16.499 1.00 31.68  ? 969  HOH A O     1 
HETATM 4285 O  O     . HOH L 8 .   ? 69.394 5.322   0.973   1.00 27.88  ? 970  HOH A O     1 
HETATM 4286 O  O     . HOH L 8 .   ? 47.247 -20.136 18.546  1.00 30.41  ? 971  HOH A O     1 
HETATM 4287 O  O     . HOH L 8 .   ? 57.643 -14.234 -12.961 1.00 28.83  ? 972  HOH A O     1 
HETATM 4288 O  O     . HOH L 8 .   ? 42.481 5.178   20.731  1.00 43.64  ? 973  HOH A O     1 
HETATM 4289 O  O     . HOH L 8 .   ? 61.302 11.637  -12.091 1.00 30.64  ? 974  HOH A O     1 
HETATM 4290 O  O     . HOH L 8 .   ? 51.009 13.249  -11.447 1.00 33.22  ? 975  HOH A O     1 
HETATM 4291 O  O     . HOH L 8 .   ? 38.211 -22.701 10.749  1.00 36.50  ? 976  HOH A O     1 
HETATM 4292 O  O     . HOH L 8 .   ? 71.105 -6.655  13.951  1.00 36.75  ? 977  HOH A O     1 
HETATM 4293 O  O     . HOH L 8 .   ? 42.913 3.130   18.712  1.00 46.90  ? 978  HOH A O     1 
HETATM 4294 O  O     . HOH L 8 .   ? 78.667 2.073   4.529   1.00 30.84  ? 979  HOH A O     1 
HETATM 4295 O  O     . HOH L 8 .   ? 45.255 11.722  -9.267  1.00 27.66  ? 980  HOH A O     1 
HETATM 4296 O  O     . HOH L 8 .   ? 47.420 7.843   -9.584  1.00 20.33  ? 981  HOH A O     1 
HETATM 4297 O  O     . HOH L 8 .   ? 62.651 -29.248 -12.227 1.00 37.45  ? 982  HOH A O     1 
HETATM 4298 O  O     . HOH L 8 .   ? 55.897 -3.251  8.043   1.00 30.74  ? 983  HOH A O     1 
HETATM 4299 O  O     . HOH L 8 .   ? 43.788 15.537  26.059  1.00 31.66  ? 984  HOH A O     1 
HETATM 4300 O  O     . HOH L 8 .   ? 69.856 1.620   -14.006 1.00 34.13  ? 985  HOH A O     1 
HETATM 4301 O  O     . HOH L 8 .   ? 34.687 14.065  21.727  1.00 36.13  ? 986  HOH A O     1 
HETATM 4302 O  O     . HOH L 8 .   ? 61.560 9.112   18.991  1.00 36.30  ? 987  HOH A O     1 
HETATM 4303 O  O     . HOH L 8 .   ? 47.687 -18.929 -5.255  1.00 36.80  ? 988  HOH A O     1 
HETATM 4304 O  O     . HOH L 8 .   ? 55.461 -26.951 -3.970  1.00 40.81  ? 989  HOH A O     1 
HETATM 4305 O  O     . HOH L 8 .   ? 54.100 -35.185 1.434   1.00 33.02  ? 990  HOH A O     1 
HETATM 4306 O  O     . HOH L 8 .   ? 47.976 -17.805 17.352  1.00 36.78  ? 991  HOH A O     1 
HETATM 4307 O  O     . HOH L 8 .   ? 59.331 9.524   22.714  1.00 33.63  ? 992  HOH A O     1 
HETATM 4308 O  O     . HOH L 8 .   ? 57.561 -26.366 -3.299  1.00 50.83  ? 993  HOH A O     1 
HETATM 4309 O  O     . HOH L 8 .   ? 40.160 15.316  25.377  1.00 36.58  ? 994  HOH A O     1 
HETATM 4310 O  O     . HOH L 8 .   ? 37.463 -4.687  -22.247 1.00 33.87  ? 995  HOH A O     1 
HETATM 4311 O  O     . HOH L 8 .   ? 57.808 17.647  19.971  1.00 30.15  ? 996  HOH A O     1 
HETATM 4312 O  O     . HOH L 8 .   ? 44.224 13.159  -10.587 1.00 34.74  ? 997  HOH A O     1 
HETATM 4313 O  O     . HOH L 8 .   ? 48.650 6.703   -11.795 1.00 22.25  ? 998  HOH A O     1 
HETATM 4314 O  O     . HOH L 8 .   ? 61.547 8.085   9.838   1.00 25.16  ? 999  HOH A O     1 
HETATM 4315 O  O     . HOH L 8 .   ? 37.303 -28.941 9.626   1.00 59.85  ? 1000 HOH A O     1 
HETATM 4316 O  O     . HOH L 8 .   ? 38.086 -15.646 12.108  1.00 42.61  ? 1001 HOH A O     1 
HETATM 4317 O  O     . HOH L 8 .   ? 62.805 4.632   14.038  1.00 48.03  ? 1002 HOH A O     1 
HETATM 4318 O  O     . HOH L 8 .   ? 64.958 5.187   13.040  1.00 48.12  ? 1003 HOH A O     1 
HETATM 4319 O  O     . HOH L 8 .   ? 47.467 16.850  28.134  1.00 31.02  ? 1004 HOH A O     1 
HETATM 4320 O  O     . HOH L 8 .   ? 41.488 -29.087 18.119  1.00 44.94  ? 1005 HOH A O     1 
HETATM 4321 O  O     . HOH L 8 .   ? 50.947 -3.018  10.317  1.00 42.01  ? 1006 HOH A O     1 
HETATM 4322 O  O     . HOH M 8 .   ? 41.578 -19.877 -3.465  1.00 31.74  ? 101  HOH T O     1 
HETATM 4323 O  O     . HOH M 8 .   ? 34.884 5.683   17.907  1.00 52.97  ? 102  HOH T O     1 
HETATM 4324 O  O     . HOH M 8 .   ? 38.407 -10.292 -9.709  1.00 37.52  ? 103  HOH T O     1 
HETATM 4325 O  O     . HOH M 8 .   ? 30.958 -16.421 -4.751  1.00 30.30  ? 104  HOH T O     1 
HETATM 4326 O  O     . HOH M 8 .   ? 43.869 1.261   -2.020  1.00 27.23  ? 105  HOH T O     1 
HETATM 4327 O  O     . HOH M 8 .   ? 41.949 -7.681  -10.639 1.00 30.86  ? 106  HOH T O     1 
HETATM 4328 O  O     . HOH M 8 .   ? 28.909 0.547   13.588  1.00 64.59  ? 107  HOH T O     1 
HETATM 4329 O  O     . HOH M 8 .   ? 36.485 -23.009 -5.187  1.00 26.85  ? 108  HOH T O     1 
HETATM 4330 O  O     . HOH M 8 .   ? 36.284 -2.153  -1.098  1.00 30.61  ? 109  HOH T O     1 
HETATM 4331 O  O     . HOH M 8 .   ? 39.127 2.533   -7.211  1.00 27.67  ? 110  HOH T O     1 
HETATM 4332 O  O     . HOH M 8 .   ? 39.884 8.675   8.830   1.00 29.23  ? 111  HOH T O     1 
HETATM 4333 O  O     . HOH M 8 .   ? 36.026 2.560   4.669   1.00 25.55  ? 112  HOH T O     1 
HETATM 4334 O  O     . HOH M 8 .   ? 44.774 -2.813  -3.600  1.00 32.98  ? 113  HOH T O     1 
HETATM 4335 O  O     . HOH M 8 .   ? 31.940 14.049  10.718  1.00 25.45  ? 114  HOH T O     1 
HETATM 4336 O  O     . HOH M 8 .   ? 38.378 -2.369  -6.589  1.00 34.97  ? 115  HOH T O     1 
HETATM 4337 O  O     . HOH M 8 .   ? 43.869 -8.803  -3.434  1.00 21.91  ? 116  HOH T O     1 
HETATM 4338 O  O     . HOH M 8 .   ? 28.648 4.240   9.373   1.00 51.33  ? 117  HOH T O     1 
HETATM 4339 O  O     . HOH M 8 .   ? 40.066 -22.096 -6.523  1.00 35.80  ? 118  HOH T O     1 
HETATM 4340 O  O     . HOH M 8 .   ? 40.376 -3.630  -9.513  1.00 27.77  ? 119  HOH T O     1 
HETATM 4341 O  O     . HOH M 8 .   ? 45.344 -5.408  -2.817  1.00 37.59  ? 120  HOH T O     1 
HETATM 4342 O  O     . HOH M 8 .   ? 43.540 5.473   0.336   1.00 20.73  ? 121  HOH T O     1 
HETATM 4343 O  O     . HOH M 8 .   ? 38.025 -21.780 -3.342  1.00 34.68  ? 122  HOH T O     1 
HETATM 4344 O  O     . HOH M 8 .   ? 25.826 -19.023 -6.803  1.00 30.65  ? 123  HOH T O     1 
HETATM 4345 O  O     . HOH M 8 .   ? 45.405 5.033   -4.704  1.00 25.88  ? 124  HOH T O     1 
HETATM 4346 O  O     . HOH M 8 .   ? 36.274 -3.073  -4.414  1.00 30.70  ? 125  HOH T O     1 
HETATM 4347 O  O     . HOH M 8 .   ? 37.511 -12.878 -11.151 1.00 32.40  ? 126  HOH T O     1 
HETATM 4348 O  O     . HOH M 8 .   ? 40.431 -0.944  7.579   1.00 38.29  ? 127  HOH T O     1 
HETATM 4349 O  O     . HOH M 8 .   ? 42.440 -11.447 -3.379  1.00 37.56  ? 128  HOH T O     1 
HETATM 4350 O  O     . HOH M 8 .   ? 37.105 -0.148  4.646   1.00 31.65  ? 129  HOH T O     1 
HETATM 4351 O  O     . HOH M 8 .   ? 33.219 10.494  8.489   1.00 33.32  ? 130  HOH T O     1 
HETATM 4352 O  O     . HOH M 8 .   ? 35.723 10.867  10.450  1.00 24.49  ? 131  HOH T O     1 
HETATM 4353 O  O     . HOH M 8 .   ? 40.433 -10.120 -11.377 1.00 47.35  ? 132  HOH T O     1 
HETATM 4354 O  O     . HOH N 8 .   ? 38.417 -10.760 6.511   1.00 39.96  ? 201  HOH P O     1 
HETATM 4355 O  O     . HOH N 8 .   ? 30.379 -6.318  -13.319 1.00 39.93  ? 202  HOH P O     1 
HETATM 4356 O  O     . HOH N 8 .   ? 48.834 2.340   1.179   1.00 16.83  ? 203  HOH P O     1 
HETATM 4357 O  O     . HOH N 8 .   ? 32.265 -7.455  -11.355 1.00 34.20  ? 204  HOH P O     1 
HETATM 4358 O  O     . HOH N 8 .   ? 46.148 -7.946  7.896   1.00 38.55  ? 205  HOH P O     1 
HETATM 4359 O  O     . HOH N 8 .   ? 45.741 3.818   0.957   1.00 19.44  ? 206  HOH P O     1 
HETATM 4360 O  O     . HOH N 8 .   ? 48.915 -10.034 6.702   1.00 24.32  ? 207  HOH P O     1 
HETATM 4361 O  O     . HOH N 8 .   ? 34.590 -9.328  -11.220 1.00 30.92  ? 208  HOH P O     1 
HETATM 4362 O  O     . HOH N 8 .   ? 44.547 -8.119  -0.981  1.00 21.68  ? 209  HOH P O     1 
HETATM 4363 O  O     . HOH N 8 .   ? 41.485 -11.717 -1.016  1.00 23.91  ? 210  HOH P O     1 
HETATM 4364 O  O     . HOH N 8 .   ? 36.450 -4.474  3.260   1.00 27.06  ? 211  HOH P O     1 
HETATM 4365 O  O     . HOH N 8 .   ? 44.298 7.303   2.103   1.00 16.65  ? 212  HOH P O     1 
HETATM 4366 O  O     . HOH N 8 .   ? 46.244 -5.075  7.178   1.00 67.69  ? 213  HOH P O     1 
HETATM 4367 O  O     . HOH N 8 .   ? 44.448 -6.542  5.878   1.00 38.16  ? 214  HOH P O     1 
HETATM 4368 O  O     . HOH N 8 .   ? 42.600 -8.866  7.248   1.00 21.90  ? 215  HOH P O     1 
HETATM 4369 O  O     . HOH N 8 .   ? 43.486 -14.419 5.645   1.00 15.83  ? 216  HOH P O     1 
HETATM 4370 O  O     . HOH N 8 .   ? 45.864 -2.601  -0.878  1.00 20.80  ? 217  HOH P O     1 
HETATM 4371 O  O     . HOH N 8 .   ? 40.192 -5.481  5.537   1.00 32.34  ? 218  HOH P O     1 
HETATM 4372 O  O     . HOH N 8 .   ? 26.222 -12.659 -10.530 1.00 22.87  ? 219  HOH P O     1 
HETATM 4373 O  O     . HOH N 8 .   ? 41.203 -15.584 1.787   1.00 23.06  ? 220  HOH P O     1 
HETATM 4374 O  O     B HOH N 8 .   ? 49.390 1.724   7.750   0.70 21.88  ? 221  HOH P O     1 
HETATM 4375 O  O     . HOH N 8 .   ? 38.286 -4.198  4.911   1.00 31.33  ? 222  HOH P O     1 
HETATM 4376 O  O     . HOH N 8 .   ? 47.762 -1.811  7.182   1.00 26.16  ? 223  HOH P O     1 
HETATM 4377 O  O     . HOH N 8 .   ? 39.976 -14.011 -0.086  1.00 33.51  ? 224  HOH P O     1 
HETATM 4378 O  O     . HOH N 8 .   ? 51.228 -8.271  4.670   1.00 30.67  ? 225  HOH P O     1 
HETATM 4379 O  O     . HOH N 8 .   ? 40.342 -8.855  5.801   1.00 25.25  ? 226  HOH P O     1 
HETATM 4380 O  O     . HOH N 8 .   ? 45.586 -10.744 -0.046  1.00 20.17  ? 227  HOH P O     1 
HETATM 4381 O  O     . HOH N 8 .   ? 43.775 -12.764 -0.233  1.00 21.97  ? 228  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1   501  501  MN  MN  A . 
E 4 MN  1   502  503  MN  MN  A . 
F 5 GOL 1   503  506  GOL GOL A . 
G 5 GOL 1   504  507  GOL GOL A . 
H 5 GOL 1   505  508  GOL GOL A . 
I 6 DTP 1   506  504  DTP DTP A . 
J 7 DPO 1   507  505  DPO DPO A . 
K 4 MN  1   101  506  MN  MN  P . 
L 8 HOH 1   601  843  HOH HOH A . 
L 8 HOH 2   602  797  HOH HOH A . 
L 8 HOH 3   603  882  HOH HOH A . 
L 8 HOH 4   604  840  HOH HOH A . 
L 8 HOH 5   605  999  HOH HOH A . 
L 8 HOH 6   606  831  HOH HOH A . 
L 8 HOH 7   607  724  HOH HOH A . 
L 8 HOH 8   608  644  HOH HOH A . 
L 8 HOH 9   609  977  HOH HOH A . 
L 8 HOH 10  610  991  HOH HOH A . 
L 8 HOH 11  611  865  HOH HOH A . 
L 8 HOH 12  612  791  HOH HOH A . 
L 8 HOH 13  613  884  HOH HOH A . 
L 8 HOH 14  614  975  HOH HOH A . 
L 8 HOH 15  615  759  HOH HOH A . 
L 8 HOH 16  616  730  HOH HOH A . 
L 8 HOH 17  617  834  HOH HOH A . 
L 8 HOH 18  618  110  HOH HOH A . 
L 8 HOH 19  619  989  HOH HOH A . 
L 8 HOH 20  620  995  HOH HOH A . 
L 8 HOH 21  621  808  HOH HOH A . 
L 8 HOH 22  622  783  HOH HOH A . 
L 8 HOH 23  623  735  HOH HOH A . 
L 8 HOH 24  624  801  HOH HOH A . 
L 8 HOH 25  625  827  HOH HOH A . 
L 8 HOH 26  626  1002 HOH HOH A . 
L 8 HOH 27  627  803  HOH HOH A . 
L 8 HOH 28  628  819  HOH HOH A . 
L 8 HOH 29  629  640  HOH HOH A . 
L 8 HOH 30  630  994  HOH HOH A . 
L 8 HOH 31  631  932  HOH HOH A . 
L 8 HOH 32  632  657  HOH HOH A . 
L 8 HOH 33  633  979  HOH HOH A . 
L 8 HOH 34  634  611  HOH HOH A . 
L 8 HOH 35  635  722  HOH HOH A . 
L 8 HOH 36  636  773  HOH HOH A . 
L 8 HOH 37  637  760  HOH HOH A . 
L 8 HOH 38  638  778  HOH HOH A . 
L 8 HOH 39  639  896  HOH HOH A . 
L 8 HOH 40  640  658  HOH HOH A . 
L 8 HOH 41  641  671  HOH HOH A . 
L 8 HOH 42  642  745  HOH HOH A . 
L 8 HOH 43  643  642  HOH HOH A . 
L 8 HOH 44  644  638  HOH HOH A . 
L 8 HOH 45  645  825  HOH HOH A . 
L 8 HOH 46  646  824  HOH HOH A . 
L 8 HOH 47  647  852  HOH HOH A . 
L 8 HOH 48  648  838  HOH HOH A . 
L 8 HOH 49  649  687  HOH HOH A . 
L 8 HOH 50  650  776  HOH HOH A . 
L 8 HOH 51  651  688  HOH HOH A . 
L 8 HOH 52  652  998  HOH HOH A . 
L 8 HOH 53  653  605  HOH HOH A . 
L 8 HOH 54  654  769  HOH HOH A . 
L 8 HOH 55  655  677  HOH HOH A . 
L 8 HOH 56  656  842  HOH HOH A . 
L 8 HOH 57  657  707  HOH HOH A . 
L 8 HOH 58  658  875  HOH HOH A . 
L 8 HOH 59  659  686  HOH HOH A . 
L 8 HOH 60  660  841  HOH HOH A . 
L 8 HOH 61  661  678  HOH HOH A . 
L 8 HOH 62  662  939  HOH HOH A . 
L 8 HOH 63  663  863  HOH HOH A . 
L 8 HOH 64  664  782  HOH HOH A . 
L 8 HOH 65  665  105  HOH HOH A . 
L 8 HOH 66  666  689  HOH HOH A . 
L 8 HOH 67  667  917  HOH HOH A . 
L 8 HOH 68  668  653  HOH HOH A . 
L 8 HOH 69  669  793  HOH HOH A . 
L 8 HOH 70  670  647  HOH HOH A . 
L 8 HOH 71  671  790  HOH HOH A . 
L 8 HOH 72  672  938  HOH HOH A . 
L 8 HOH 73  673  107  HOH HOH A . 
L 8 HOH 74  674  890  HOH HOH A . 
L 8 HOH 75  675  685  HOH HOH A . 
L 8 HOH 76  676  737  HOH HOH A . 
L 8 HOH 77  677  935  HOH HOH A . 
L 8 HOH 78  678  771  HOH HOH A . 
L 8 HOH 79  679  712  HOH HOH A . 
L 8 HOH 80  680  752  HOH HOH A . 
L 8 HOH 81  681  717  HOH HOH A . 
L 8 HOH 82  682  921  HOH HOH A . 
L 8 HOH 83  683  913  HOH HOH A . 
L 8 HOH 84  684  618  HOH HOH A . 
L 8 HOH 85  685  704  HOH HOH A . 
L 8 HOH 86  686  626  HOH HOH A . 
L 8 HOH 87  687  899  HOH HOH A . 
L 8 HOH 88  688  601  HOH HOH A . 
L 8 HOH 89  689  925  HOH HOH A . 
L 8 HOH 90  690  775  HOH HOH A . 
L 8 HOH 91  691  813  HOH HOH A . 
L 8 HOH 92  692  627  HOH HOH A . 
L 8 HOH 93  693  727  HOH HOH A . 
L 8 HOH 94  694  853  HOH HOH A . 
L 8 HOH 95  695  741  HOH HOH A . 
L 8 HOH 96  696  919  HOH HOH A . 
L 8 HOH 97  697  622  HOH HOH A . 
L 8 HOH 98  698  768  HOH HOH A . 
L 8 HOH 99  699  805  HOH HOH A . 
L 8 HOH 100 700  703  HOH HOH A . 
L 8 HOH 101 701  944  HOH HOH A . 
L 8 HOH 102 702  736  HOH HOH A . 
L 8 HOH 103 703  669  HOH HOH A . 
L 8 HOH 104 704  846  HOH HOH A . 
L 8 HOH 105 705  645  HOH HOH A . 
L 8 HOH 106 706  877  HOH HOH A . 
L 8 HOH 107 707  740  HOH HOH A . 
L 8 HOH 108 708  888  HOH HOH A . 
L 8 HOH 109 709  670  HOH HOH A . 
L 8 HOH 110 710  766  HOH HOH A . 
L 8 HOH 111 711  758  HOH HOH A . 
L 8 HOH 112 712  705  HOH HOH A . 
L 8 HOH 113 713  781  HOH HOH A . 
L 8 HOH 114 714  650  HOH HOH A . 
L 8 HOH 115 715  855  HOH HOH A . 
L 8 HOH 116 716  656  HOH HOH A . 
L 8 HOH 117 717  692  HOH HOH A . 
L 8 HOH 118 718  814  HOH HOH A . 
L 8 HOH 119 719  850  HOH HOH A . 
L 8 HOH 120 720  639  HOH HOH A . 
L 8 HOH 121 721  676  HOH HOH A . 
L 8 HOH 122 722  780  HOH HOH A . 
L 8 HOH 123 723  609  HOH HOH A . 
L 8 HOH 124 724  667  HOH HOH A . 
L 8 HOH 125 725  715  HOH HOH A . 
L 8 HOH 126 726  858  HOH HOH A . 
L 8 HOH 127 727  725  HOH HOH A . 
L 8 HOH 128 728  617  HOH HOH A . 
L 8 HOH 129 729  757  HOH HOH A . 
L 8 HOH 130 730  777  HOH HOH A . 
L 8 HOH 131 731  661  HOH HOH A . 
L 8 HOH 132 732  763  HOH HOH A . 
L 8 HOH 133 733  679  HOH HOH A . 
L 8 HOH 134 734  634  HOH HOH A . 
L 8 HOH 135 735  619  HOH HOH A . 
L 8 HOH 136 736  635  HOH HOH A . 
L 8 HOH 137 737  682  HOH HOH A . 
L 8 HOH 138 738  958  HOH HOH A . 
L 8 HOH 139 739  755  HOH HOH A . 
L 8 HOH 140 740  659  HOH HOH A . 
L 8 HOH 141 741  746  HOH HOH A . 
L 8 HOH 142 742  625  HOH HOH A . 
L 8 HOH 143 743  742  HOH HOH A . 
L 8 HOH 144 744  649  HOH HOH A . 
L 8 HOH 145 745  923  HOH HOH A . 
L 8 HOH 146 746  826  HOH HOH A . 
L 8 HOH 147 747  973  HOH HOH A . 
L 8 HOH 148 748  822  HOH HOH A . 
L 8 HOH 149 749  721  HOH HOH A . 
L 8 HOH 150 750  904  HOH HOH A . 
L 8 HOH 151 751  646  HOH HOH A . 
L 8 HOH 152 752  810  HOH HOH A . 
L 8 HOH 153 753  674  HOH HOH A . 
L 8 HOH 154 754  613  HOH HOH A . 
L 8 HOH 155 755  616  HOH HOH A . 
L 8 HOH 156 756  668  HOH HOH A . 
L 8 HOH 157 757  990  HOH HOH A . 
L 8 HOH 158 758  889  HOH HOH A . 
L 8 HOH 159 759  606  HOH HOH A . 
L 8 HOH 160 760  694  HOH HOH A . 
L 8 HOH 161 761  608  HOH HOH A . 
L 8 HOH 162 762  885  HOH HOH A . 
L 8 HOH 163 763  788  HOH HOH A . 
L 8 HOH 164 764  663  HOH HOH A . 
L 8 HOH 165 765  628  HOH HOH A . 
L 8 HOH 166 766  728  HOH HOH A . 
L 8 HOH 167 767  743  HOH HOH A . 
L 8 HOH 168 768  902  HOH HOH A . 
L 8 HOH 169 769  750  HOH HOH A . 
L 8 HOH 170 770  680  HOH HOH A . 
L 8 HOH 171 771  648  HOH HOH A . 
L 8 HOH 172 772  621  HOH HOH A . 
L 8 HOH 173 773  714  HOH HOH A . 
L 8 HOH 174 774  633  HOH HOH A . 
L 8 HOH 175 775  607  HOH HOH A . 
L 8 HOH 176 776  651  HOH HOH A . 
L 8 HOH 177 777  779  HOH HOH A . 
L 8 HOH 178 778  701  HOH HOH A . 
L 8 HOH 179 779  870  HOH HOH A . 
L 8 HOH 180 780  906  HOH HOH A . 
L 8 HOH 181 781  980  HOH HOH A . 
L 8 HOH 182 782  894  HOH HOH A . 
L 8 HOH 183 783  665  HOH HOH A . 
L 8 HOH 184 784  630  HOH HOH A . 
L 8 HOH 185 785  719  HOH HOH A . 
L 8 HOH 186 786  603  HOH HOH A . 
L 8 HOH 187 787  786  HOH HOH A . 
L 8 HOH 188 788  806  HOH HOH A . 
L 8 HOH 189 789  604  HOH HOH A . 
L 8 HOH 190 790  681  HOH HOH A . 
L 8 HOH 191 791  632  HOH HOH A . 
L 8 HOH 192 792  729  HOH HOH A . 
L 8 HOH 193 793  789  HOH HOH A . 
L 8 HOH 194 794  956  HOH HOH A . 
L 8 HOH 195 795  655  HOH HOH A . 
L 8 HOH 196 796  623  HOH HOH A . 
L 8 HOH 197 797  684  HOH HOH A . 
L 8 HOH 198 798  739  HOH HOH A . 
L 8 HOH 199 799  848  HOH HOH A . 
L 8 HOH 200 800  695  HOH HOH A . 
L 8 HOH 201 801  820  HOH HOH A . 
L 8 HOH 202 802  672  HOH HOH A . 
L 8 HOH 203 803  660  HOH HOH A . 
L 8 HOH 204 804  631  HOH HOH A . 
L 8 HOH 205 805  950  HOH HOH A . 
L 8 HOH 206 806  744  HOH HOH A . 
L 8 HOH 207 807  620  HOH HOH A . 
L 8 HOH 208 808  867  HOH HOH A . 
L 8 HOH 209 809  629  HOH HOH A . 
L 8 HOH 210 810  652  HOH HOH A . 
L 8 HOH 211 811  972  HOH HOH A . 
L 8 HOH 212 812  868  HOH HOH A . 
L 8 HOH 213 813  702  HOH HOH A . 
L 8 HOH 214 814  683  HOH HOH A . 
L 8 HOH 215 815  794  HOH HOH A . 
L 8 HOH 216 816  636  HOH HOH A . 
L 8 HOH 217 817  799  HOH HOH A . 
L 8 HOH 218 818  900  HOH HOH A . 
L 8 HOH 219 819  643  HOH HOH A . 
L 8 HOH 220 820  815  HOH HOH A . 
L 8 HOH 221 821  662  HOH HOH A . 
L 8 HOH 222 822  968  HOH HOH A . 
L 8 HOH 223 823  862  HOH HOH A . 
L 8 HOH 224 824  733  HOH HOH A . 
L 8 HOH 225 825  886  HOH HOH A . 
L 8 HOH 226 826  856  HOH HOH A . 
L 8 HOH 227 827  976  HOH HOH A . 
L 8 HOH 228 828  818  HOH HOH A . 
L 8 HOH 229 829  612  HOH HOH A . 
L 8 HOH 230 830  762  HOH HOH A . 
L 8 HOH 231 831  654  HOH HOH A . 
L 8 HOH 232 832  708  HOH HOH A . 
L 8 HOH 233 833  784  HOH HOH A . 
L 8 HOH 234 834  881  HOH HOH A . 
L 8 HOH 235 835  804  HOH HOH A . 
L 8 HOH 236 836  835  HOH HOH A . 
L 8 HOH 237 837  859  HOH HOH A . 
L 8 HOH 238 838  749  HOH HOH A . 
L 8 HOH 239 839  891  HOH HOH A . 
L 8 HOH 240 840  754  HOH HOH A . 
L 8 HOH 241 841  817  HOH HOH A . 
L 8 HOH 242 842  949  HOH HOH A . 
L 8 HOH 243 843  984  HOH HOH A . 
L 8 HOH 244 844  847  HOH HOH A . 
L 8 HOH 245 845  796  HOH HOH A . 
L 8 HOH 246 846  829  HOH HOH A . 
L 8 HOH 247 847  816  HOH HOH A . 
L 8 HOH 248 848  624  HOH HOH A . 
L 8 HOH 249 849  926  HOH HOH A . 
L 8 HOH 250 850  830  HOH HOH A . 
L 8 HOH 251 851  872  HOH HOH A . 
L 8 HOH 252 852  675  HOH HOH A . 
L 8 HOH 253 853  718  HOH HOH A . 
L 8 HOH 254 854  713  HOH HOH A . 
L 8 HOH 255 855  809  HOH HOH A . 
L 8 HOH 256 856  849  HOH HOH A . 
L 8 HOH 257 857  699  HOH HOH A . 
L 8 HOH 258 858  966  HOH HOH A . 
L 8 HOH 259 859  929  HOH HOH A . 
L 8 HOH 260 860  709  HOH HOH A . 
L 8 HOH 261 861  833  HOH HOH A . 
L 8 HOH 262 862  614  HOH HOH A . 
L 8 HOH 263 863  800  HOH HOH A . 
L 8 HOH 264 864  720  HOH HOH A . 
L 8 HOH 265 865  216  HOH HOH A . 
L 8 HOH 266 866  615  HOH HOH A . 
L 8 HOH 267 867  967  HOH HOH A . 
L 8 HOH 268 868  996  HOH HOH A . 
L 8 HOH 269 869  951  HOH HOH A . 
L 8 HOH 270 870  767  HOH HOH A . 
L 8 HOH 271 871  946  HOH HOH A . 
L 8 HOH 272 872  901  HOH HOH A . 
L 8 HOH 273 873  637  HOH HOH A . 
L 8 HOH 274 874  844  HOH HOH A . 
L 8 HOH 275 875  710  HOH HOH A . 
L 8 HOH 276 876  774  HOH HOH A . 
L 8 HOH 277 877  1000 HOH HOH A . 
L 8 HOH 278 878  969  HOH HOH A . 
L 8 HOH 279 879  732  HOH HOH A . 
L 8 HOH 280 880  960  HOH HOH A . 
L 8 HOH 281 881  933  HOH HOH A . 
L 8 HOH 282 882  964  HOH HOH A . 
L 8 HOH 283 883  772  HOH HOH A . 
L 8 HOH 284 884  747  HOH HOH A . 
L 8 HOH 285 885  928  HOH HOH A . 
L 8 HOH 286 886  734  HOH HOH A . 
L 8 HOH 287 887  731  HOH HOH A . 
L 8 HOH 288 888  936  HOH HOH A . 
L 8 HOH 289 889  970  HOH HOH A . 
L 8 HOH 290 890  873  HOH HOH A . 
L 8 HOH 291 891  912  HOH HOH A . 
L 8 HOH 292 892  887  HOH HOH A . 
L 8 HOH 293 893  124  HOH HOH A . 
L 8 HOH 294 894  723  HOH HOH A . 
L 8 HOH 295 895  756  HOH HOH A . 
L 8 HOH 296 896  934  HOH HOH A . 
L 8 HOH 297 897  1001 HOH HOH A . 
L 8 HOH 298 898  666  HOH HOH A . 
L 8 HOH 299 899  854  HOH HOH A . 
L 8 HOH 300 900  931  HOH HOH A . 
L 8 HOH 301 901  787  HOH HOH A . 
L 8 HOH 302 902  861  HOH HOH A . 
L 8 HOH 303 903  641  HOH HOH A . 
L 8 HOH 304 904  133  HOH HOH A . 
L 8 HOH 305 905  706  HOH HOH A . 
L 8 HOH 306 906  942  HOH HOH A . 
L 8 HOH 307 907  963  HOH HOH A . 
L 8 HOH 308 908  915  HOH HOH A . 
L 8 HOH 309 909  811  HOH HOH A . 
L 8 HOH 310 910  941  HOH HOH A . 
L 8 HOH 311 911  711  HOH HOH A . 
L 8 HOH 312 912  981  HOH HOH A . 
L 8 HOH 313 913  988  HOH HOH A . 
L 8 HOH 314 914  3    HOH HOH A . 
L 8 HOH 315 915  761  HOH HOH A . 
L 8 HOH 316 916  892  HOH HOH A . 
L 8 HOH 317 917  997  HOH HOH A . 
L 8 HOH 318 918  993  HOH HOH A . 
L 8 HOH 319 919  716  HOH HOH A . 
L 8 HOH 320 920  878  HOH HOH A . 
L 8 HOH 321 921  930  HOH HOH A . 
L 8 HOH 322 922  910  HOH HOH A . 
L 8 HOH 323 923  957  HOH HOH A . 
L 8 HOH 324 924  785  HOH HOH A . 
L 8 HOH 325 925  907  HOH HOH A . 
L 8 HOH 326 926  914  HOH HOH A . 
L 8 HOH 327 927  770  HOH HOH A . 
L 8 HOH 328 928  965  HOH HOH A . 
L 8 HOH 329 929  802  HOH HOH A . 
L 8 HOH 330 930  807  HOH HOH A . 
L 8 HOH 331 931  971  HOH HOH A . 
L 8 HOH 332 932  908  HOH HOH A . 
L 8 HOH 333 933  983  HOH HOH A . 
L 8 HOH 334 934  920  HOH HOH A . 
L 8 HOH 335 935  945  HOH HOH A . 
L 8 HOH 336 936  690  HOH HOH A . 
L 8 HOH 337 937  874  HOH HOH A . 
L 8 HOH 338 938  857  HOH HOH A . 
L 8 HOH 339 939  947  HOH HOH A . 
L 8 HOH 340 940  978  HOH HOH A . 
L 8 HOH 341 941  952  HOH HOH A . 
L 8 HOH 342 942  812  HOH HOH A . 
L 8 HOH 343 943  909  HOH HOH A . 
L 8 HOH 344 944  916  HOH HOH A . 
L 8 HOH 345 945  836  HOH HOH A . 
L 8 HOH 346 946  860  HOH HOH A . 
L 8 HOH 347 947  922  HOH HOH A . 
L 8 HOH 348 948  924  HOH HOH A . 
L 8 HOH 349 949  753  HOH HOH A . 
L 8 HOH 350 950  992  HOH HOH A . 
L 8 HOH 351 951  764  HOH HOH A . 
L 8 HOH 352 952  798  HOH HOH A . 
L 8 HOH 353 953  903  HOH HOH A . 
L 8 HOH 354 954  751  HOH HOH A . 
L 8 HOH 355 955  927  HOH HOH A . 
L 8 HOH 356 956  129  HOH HOH A . 
L 8 HOH 357 957  792  HOH HOH A . 
L 8 HOH 358 958  866  HOH HOH A . 
L 8 HOH 359 959  693  HOH HOH A . 
L 8 HOH 360 960  982  HOH HOH A . 
L 8 HOH 361 961  974  HOH HOH A . 
L 8 HOH 362 962  828  HOH HOH A . 
L 8 HOH 363 963  765  HOH HOH A . 
L 8 HOH 364 964  893  HOH HOH A . 
L 8 HOH 365 965  869  HOH HOH A . 
L 8 HOH 366 966  898  HOH HOH A . 
L 8 HOH 367 967  895  HOH HOH A . 
L 8 HOH 368 968  937  HOH HOH A . 
L 8 HOH 369 969  897  HOH HOH A . 
L 8 HOH 370 970  726  HOH HOH A . 
L 8 HOH 371 971  795  HOH HOH A . 
L 8 HOH 372 972  664  HOH HOH A . 
L 8 HOH 373 973  953  HOH HOH A . 
L 8 HOH 374 974  823  HOH HOH A . 
L 8 HOH 375 975  837  HOH HOH A . 
L 8 HOH 376 976  876  HOH HOH A . 
L 8 HOH 377 977  748  HOH HOH A . 
L 8 HOH 378 978  1003 HOH HOH A . 
L 8 HOH 379 979  961  HOH HOH A . 
L 8 HOH 380 980  905  HOH HOH A . 
L 8 HOH 381 981  697  HOH HOH A . 
L 8 HOH 382 982  821  HOH HOH A . 
L 8 HOH 383 983  948  HOH HOH A . 
L 8 HOH 384 984  696  HOH HOH A . 
L 8 HOH 385 985  962  HOH HOH A . 
L 8 HOH 386 986  851  HOH HOH A . 
L 8 HOH 387 987  839  HOH HOH A . 
L 8 HOH 388 988  943  HOH HOH A . 
L 8 HOH 389 989  911  HOH HOH A . 
L 8 HOH 390 990  880  HOH HOH A . 
L 8 HOH 391 991  738  HOH HOH A . 
L 8 HOH 392 992  864  HOH HOH A . 
L 8 HOH 393 993  954  HOH HOH A . 
L 8 HOH 394 994  883  HOH HOH A . 
L 8 HOH 395 995  987  HOH HOH A . 
L 8 HOH 396 996  879  HOH HOH A . 
L 8 HOH 397 997  955  HOH HOH A . 
L 8 HOH 398 998  691  HOH HOH A . 
L 8 HOH 399 999  700  HOH HOH A . 
L 8 HOH 400 1000 959  HOH HOH A . 
L 8 HOH 401 1001 940  HOH HOH A . 
L 8 HOH 402 1002 986  HOH HOH A . 
L 8 HOH 403 1003 985  HOH HOH A . 
L 8 HOH 404 1004 845  HOH HOH A . 
L 8 HOH 405 1005 918  HOH HOH A . 
L 8 HOH 406 1006 2    HOH HOH A . 
M 8 HOH 1   101  109  HOH HOH T . 
M 8 HOH 2   102  106  HOH HOH T . 
M 8 HOH 3   103  125  HOH HOH T . 
M 8 HOH 4   104  111  HOH HOH T . 
M 8 HOH 5   105  119  HOH HOH T . 
M 8 HOH 6   106  103  HOH HOH T . 
M 8 HOH 7   107  120  HOH HOH T . 
M 8 HOH 8   108  102  HOH HOH T . 
M 8 HOH 9   109  123  HOH HOH T . 
M 8 HOH 10  110  113  HOH HOH T . 
M 8 HOH 11  111  115  HOH HOH T . 
M 8 HOH 12  112  108  HOH HOH T . 
M 8 HOH 13  113  135  HOH HOH T . 
M 8 HOH 14  114  128  HOH HOH T . 
M 8 HOH 15  115  116  HOH HOH T . 
M 8 HOH 16  116  104  HOH HOH T . 
M 8 HOH 17  117  136  HOH HOH T . 
M 8 HOH 18  118  114  HOH HOH T . 
M 8 HOH 19  119  101  HOH HOH T . 
M 8 HOH 20  120  117  HOH HOH T . 
M 8 HOH 21  121  127  HOH HOH T . 
M 8 HOH 22  122  118  HOH HOH T . 
M 8 HOH 23  123  122  HOH HOH T . 
M 8 HOH 24  124  132  HOH HOH T . 
M 8 HOH 25  125  112  HOH HOH T . 
M 8 HOH 26  126  121  HOH HOH T . 
M 8 HOH 27  127  130  HOH HOH T . 
M 8 HOH 28  128  134  HOH HOH T . 
M 8 HOH 29  129  126  HOH HOH T . 
M 8 HOH 30  130  832  HOH HOH T . 
M 8 HOH 31  131  871  HOH HOH T . 
M 8 HOH 32  132  131  HOH HOH T . 
N 8 HOH 1   201  215  HOH HOH P . 
N 8 HOH 2   202  219  HOH HOH P . 
N 8 HOH 3   203  1    HOH HOH P . 
N 8 HOH 4   204  217  HOH HOH P . 
N 8 HOH 5   205  214  HOH HOH P . 
N 8 HOH 6   206  211  HOH HOH P . 
N 8 HOH 7   207  201  HOH HOH P . 
N 8 HOH 8   208  221  HOH HOH P . 
N 8 HOH 9   209  204  HOH HOH P . 
N 8 HOH 10  210  202  HOH HOH P . 
N 8 HOH 11  211  222  HOH HOH P . 
N 8 HOH 12  212  673  HOH HOH P . 
N 8 HOH 13  213  218  HOH HOH P . 
N 8 HOH 14  214  223  HOH HOH P . 
N 8 HOH 15  215  203  HOH HOH P . 
N 8 HOH 16  216  610  HOH HOH P . 
N 8 HOH 17  217  210  HOH HOH P . 
N 8 HOH 18  218  220  HOH HOH P . 
N 8 HOH 19  219  209  HOH HOH P . 
N 8 HOH 20  220  205  HOH HOH P . 
N 8 HOH 21  221  602  HOH HOH P . 
N 8 HOH 22  222  224  HOH HOH P . 
N 8 HOH 23  223  212  HOH HOH P . 
N 8 HOH 24  224  213  HOH HOH P . 
N 8 HOH 25  225  698  HOH HOH P . 
N 8 HOH 26  226  207  HOH HOH P . 
N 8 HOH 27  227  208  HOH HOH P . 
N 8 HOH 28  228  206  HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6450  ? 
1 MORE         -56   ? 
1 'SSA (A^2)'  22090 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 83.5  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 100.5 ? 
3  O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 86.6  ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 102.1 ? 
5  O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 161.6 ? 
6  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 75.1  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O1    B J DPO .   ? A DPO 507 ? 1_555 166.8 ? 
8  O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O1    B J DPO .   ? A DPO 507 ? 1_555 94.2  ? 
9  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O1    B J DPO .   ? A DPO 507 ? 1_555 92.3  ? 
10 OP1   B C DA  9   ? P DA  9   ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O1    B J DPO .   ? A DPO 507 ? 1_555 84.2  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 89.4  ? 
12 O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 102.2 ? 
13 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 167.5 ? 
14 OP1   B C DA  9   ? P DA  9   ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 95.4  ? 
15 O1    B J DPO .   ? A DPO 507 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 78.4  ? 
16 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 94.5  ? 
17 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 89.0  ? 
18 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 93.8  ? 
19 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 171.5 ? 
20 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 88.3  ? 
21 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 82.9  ? 
22 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 169.6 ? 
23 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 94.6  ? 
24 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 95.5  ? 
25 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 14.5  ? 
26 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 108.4 ? 
27 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 80.8  ? 
28 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 162.1 ? 
29 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 80.0  ? 
30 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 68.2  ? 
31 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 789 ? 1_555 86.6  ? 
32 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 789 ? 1_555 169.4 ? 
33 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 789 ? 1_555 96.8  ? 
34 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 789 ? 1_555 92.1  ? 
35 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 789 ? 1_555 83.5  ? 
36 OP1   B C DA  9   ? P DA  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 789 ? 1_555 88.8  ? 
37 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 101.7 ? 
38 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 90.4  ? 
39 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 168.3 ? 
40 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 86.3  ? 
41 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 73.2  ? 
42 OP1   B C DA  9   ? P DA  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 11.3  ? 
43 O     ? L HOH .   ? A HOH 789 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 79.1  ? 
44 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O2    B J DPO .   ? A DPO 507 ? 1_555 79.5  ? 
45 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     ? L HOH .   ? A HOH 660 ? 1_555 75.2  ? 
46 O2    B J DPO .   ? A DPO 507 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     ? L HOH .   ? A HOH 660 ? 1_555 150.1 ? 
47 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B L HOH .   ? A HOH 758 ? 1_555 89.1  ? 
48 O2    B J DPO .   ? A DPO 507 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B L HOH .   ? A HOH 758 ? 1_555 87.6  ? 
49 O     ? L HOH .   ? A HOH 660 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B L HOH .   ? A HOH 758 ? 1_555 76.4  ? 
50 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B N HOH .   ? P HOH 221 ? 1_555 99.5  ? 
51 O2    B J DPO .   ? A DPO 507 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B N HOH .   ? P HOH 221 ? 1_555 97.8  ? 
52 O     ? L HOH .   ? A HOH 660 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B N HOH .   ? P HOH 221 ? 1_555 101.9 ? 
53 O     B L HOH .   ? A HOH 758 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B N HOH .   ? P HOH 221 ? 1_555 170.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Database references'        
3 2 'Structure model' 'Derived calculations'       
4 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' pdbx_audit_support    
3 2 'Structure model' pdbx_struct_oper_list 
4 3 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_CSD'                  
2 2 'Structure model' '_pdbx_audit_support.funding_organization'  
3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 3 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .        1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ  A LYS 163 ? ? O A HOH 601 ? ? 2.13 
2 1 O   A HOH 662 ? ? O A HOH 874 ? ? 2.14 
3 1 O   A HOH 879 ? ? O A HOH 885 ? ? 2.14 
4 1 OE1 A GLU 101 ? ? O A HOH 602 ? ? 2.15 
5 1 NH1 A ARG 382 ? ? O A HOH 603 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 741 ? ? 1_555 O A HOH 846 ? ? 5_664 2.14 
2 1 O A HOH 648 ? ? 1_555 O A HOH 885 ? ? 5_554 2.14 
3 1 O A HOH 630 ? ? 1_555 O A HOH 822 ? ? 4_654 2.17 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_1             312 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_2             312 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.559 
_pdbx_validate_rmsd_bond.bond_target_value         1.474 
_pdbx_validate_rmsd_bond.bond_deviation            0.085 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.014 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 38.45   52.81   
2 1 TYR A 39  ? ? 72.09   -179.54 
3 1 LYS A 40  ? ? -154.64 -33.99  
4 1 SER A 62  ? ? 82.11   -17.12  
5 1 GLN A 133 ? ? 81.40   15.97   
6 1 SER A 257 ? ? 93.79   -10.66  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KG2 'double helix'        
5KG2 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 4  1_555 C DA 9 1_555 0.043  -0.205 0.046  -6.768 -6.232  3.852  1 T_DT4:DA9_P  T 4  ? P 9 ? 20 1 
1 B DA 5  1_555 C DT 8 1_555 -0.089 -0.054 0.108  -1.804 -4.418  3.408  2 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.055  -0.085 0.286  -1.313 -14.282 2.864  3 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.127 -0.136 -0.355 -3.640 -0.940  -0.956 4 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.119  -0.086 0.103  5.133  -3.201  0.244  5 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.260  -0.137 -0.215 11.122 -6.609  1.957  6 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.278 -0.165 -0.129 -4.869 -8.524  5.445  7 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.075  -0.139 0.156  -7.794 -4.861  -0.910 8 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.178 -0.173 -0.147 15.118 2.015   1.895  9 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 4  1_555 C DA 9 1_555 B DA 5  1_555 C DT 8 1_555 0.599  -0.082 3.238 -1.427 7.168 38.377 -0.974 -1.066 3.150 10.784 2.147   
39.041 1 TT_DT4DA5:DT8DA9_PP   T 4  ? P 9 ? T 5  ? P 8 ? 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.755  -0.964 3.415 -2.262 2.018 25.857 -2.706 -2.311 3.255 4.489  5.032   
26.031 2 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.462 -1.032 3.335 6.534  8.725 29.513 -3.481 2.034  2.763 16.438 -12.310 
31.420 3 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.628 -0.451 3.183 -3.572 1.056 34.601 -0.912 0.516  3.215 1.768  5.984   
34.794 4 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.346  -0.632 3.217 3.120  0.649 30.443 -1.325 -0.046 3.222 1.231  -5.922  
30.605 5 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.345 -0.524 3.744 -3.459 5.984 35.490 -1.805 0.001  3.628 9.703  5.609   
36.135 6 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.588 -0.574 3.426 -2.434 2.259 35.993 -1.259 0.587  3.416 3.646  3.928   
36.141 7 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.262  0.261  2.967 -0.483 2.709 26.716 -0.073 -0.678 2.973 5.843  1.041   
26.855 8 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Intramural DK036146-08' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION'                MN  
5 GLYCEROL                            GOL 
6 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
7 DIPHOSPHATE                         DPO 
8 water                               HOH 
#