data_5KG5
# 
_entry.id   5KG5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.285 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KG5         
WWPDB D_1000222152 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5KFA PDB . 
unspecified 5KFB PDB . 
unspecified 5KFC PDB . 
unspecified 5KG0 PDB . 
unspecified 5KG1 PDB . 
unspecified 5KG2 PDB . 
unspecified 5KG3 PDB . 
unspecified 5KG4 PDB . 
unspecified 5KG6 PDB . 
unspecified 5KG7 PDB . 
unspecified 5KFD PDB . 
unspecified 5KFE PDB . 
unspecified 5KFS PDB . 
unspecified 5KFT PDB . 
unspecified 5KFU PDB . 
unspecified 5KFV PDB . 
unspecified 5KFW PDB . 
unspecified 5KFX PDB . 
unspecified 5KFG PDB . 
unspecified 5KFY PDB . 
unspecified 5KFZ PDB . 
unspecified 5KFH PDB . 
unspecified 5KFK PDB . 
unspecified 5KFL PDB . 
unspecified 5KFI PDB . 
unspecified 5KFJ PDB . 
unspecified 5KFM PDB . 
unspecified 5KFN PDB . 
unspecified 5KFO PDB . 
unspecified 5KFP PDB . 
unspecified 5KFQ PDB . 
unspecified 5KFR PDB . 
unspecified 5KFF PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KG5 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gao, Y.'  1 
primary 'Yang, W.' 2 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5KG5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     98.210 
_cell.length_a_esd                 ? 
_cell.length_b                     98.210 
_cell.length_b_esd                 ? 
_cell.length_c                     82.090 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5KG5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                 54.938    3   ?       ? ? ? 
5 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
6 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ? ? 
7 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
8 water       nat water                                                18.015    464 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' ? 9606 ? 
3 1 sample 1 9  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5KG5       5KG5   ? 2 ? 1 
3 PDB 5KG5       5KG5   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KG5 A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5KG5 T 1 ? 12  ? 5KG5   1 ? 12  ? 1 12  
3 3 5KG5 P 1 ? 9   ? 5KG5   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KG5 GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5KG5 PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5KG5 HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ?                               'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ?                               'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KG5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.08 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.81 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            24.124 
_reflns.entry_id                         5KG5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.600 
_reflns.d_resolution_low                 20.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       57165 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             96.400 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.4 
_reflns.pdbx_Rmerge_I_obs                0.077 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.920 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.600 1.640 ? 2.460  ? ? ? ? ? 100.000 ? ? ? ? 0.797 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1  1 ? ? 
1.640 1.690 ? 3.090  ? ? ? ? ? 100.000 ? ? ? ? 0.633 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2  1 ? ? 
1.690 1.740 ? 3.810  ? ? ? ? ? 100.000 ? ? ? ? 0.540 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3  1 ? ? 
1.740 1.790 ? 4.540  ? ? ? ? ? 100.000 ? ? ? ? 0.429 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4  1 ? ? 
1.790 1.850 ? 5.620  ? ? ? ? ? 100.000 ? ? ? ? 0.349 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5  1 ? ? 
1.850 1.910 ? 6.260  ? ? ? ? ? 93.800  ? ? ? ? 0.331 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6  1 ? ? 
1.910 1.980 ? 8.630  ? ? ? ? ? 82.800  ? ? ? ? 0.242 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7  1 ? ? 
1.980 2.070 ? 10.890 ? ? ? ? ? 94.700  ? ? ? ? 0.177 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8  1 ? ? 
2.070 2.160 ? 14.160 ? ? ? ? ? 87.400  ? ? ? ? 0.137 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9  1 ? ? 
2.160 2.260 ? 16.710 ? ? ? ? ? 85.300  ? ? ? ? 0.111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 ? ? 
2.260 2.390 ? 20.170 ? ? ? ? ? 98.800  ? ? ? ? 0.091 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 ? ? 
2.390 2.530 ? 23.790 ? ? ? ? ? 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 ? ? 
2.530 2.700 ? 26.710 ? ? ? ? ? 99.800  ? ? ? ? 0.069 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 ? ? 
2.700 2.920 ? 32.770 ? ? ? ? ? 100.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 ? ? 
2.920 3.200 ? 39.620 ? ? ? ? ? 100.000 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 ? ? 
3.200 3.580 ? 46.560 ? ? ? ? ? 96.400  ? ? ? ? 0.037 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 ? ? 
3.580 4.130 ? 51.190 ? ? ? ? ? 98.000  ? ? ? ? 0.034 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 ? ? 
4.130 5.060 ? 58.180 ? ? ? ? ? 100.000 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 ? ? 
5.060 7.160 ? 57.040 ? ? ? ? ? 100.000 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 ? ? 
7.160 ?     ? 62.610 ? ? ? ? ? 95.100  ? ? ? ? 0.025 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                101.040 
_refine.B_iso_mean                               24.6855 
_refine.B_iso_min                                7.110 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5KG5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.6000 
_refine.ls_d_res_low                             19.9500 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     57157 
_refine.ls_number_reflns_R_free                  4458 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.4600 
_refine.ls_percent_reflns_R_free                 7.8000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1868 
_refine.ls_R_factor_R_free                       0.2188 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1841 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4ECQ 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.2600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1700 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.6000 
_refine_hist.d_res_low                        19.9500 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             465 
_refine_hist.number_atoms_total               4299 
_refine_hist.pdbx_number_residues_total       451 
_refine_hist.pdbx_B_iso_mean_ligand           19.30 
_refine_hist.pdbx_B_iso_mean_solvent          29.74 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
# 
_struct.entry_id                     5KG5 
_struct.title                        
'Human DNA polymerase eta-DNA ternary complex: reaction first with 1 mM Mn2+ for 1800s then with 10 mM Cd2+ for 60s' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KG5 
_struct_keywords.text            
'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, replication, transferase-dna complex' 
_struct_keywords.pdbx_keywords   'replication, transferase/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 4 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 AB2 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P12 AB3 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P13 AB4 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P14 AB5 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P15 AB6 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P16 AB7 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P17 AB8 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 AB9 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 AC1 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 AC2 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E MN  . MN  B ? A ASP 13  A MN  502 1_555 ? ? ? ? ? ? ?            2.111 ? 
metalc2  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 D MN  . MN  ? ? A ASP 13  A MN  501 1_555 ? ? ? ? ? ? ?            2.113 ? 
metalc3  metalc ? ? A MET 17  O     ? ? ? 1_555 E MN  . MN  B ? A MET 14  A MN  502 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc4  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 D MN  . MN  ? ? A ASP 115 A MN  501 1_555 ? ? ? ? ? ? ?            2.190 ? 
metalc5  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E MN  . MN  B ? A ASP 115 A MN  502 1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc6  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MN  . MN  ? ? A GLU 116 A MN  501 1_555 ? ? ? ? ? ? ?            2.157 ? 
metalc7  metalc ? ? C DT  8   "O3'" A ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc8  metalc ? ? C DT  8   "O3'" B ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.495 ? 
metalc9  metalc ? ? C DA  9   OP1   B ? ? 1_555 D MN  . MN  ? ? P DA  9   A MN  501 1_555 ? ? ? ? ? ? ?            1.962 ? 
metalc10 metalc ? ? C DA  9   OP1   B ? ? 1_555 E MN  . MN  B ? P DA  9   A MN  502 1_555 ? ? ? ? ? ? ?            2.566 ? 
metalc11 metalc ? ? C DA  9   OP2   B ? ? 1_555 K MN  . MN  B ? P DA  9   P MN  101 1_555 ? ? ? ? ? ? ?            2.019 ? 
metalc12 metalc ? ? D MN  .   MN    ? ? ? 1_555 L HOH . O   ? ? A MN  501 A HOH 799 1_555 ? ? ? ? ? ? ?            2.183 ? 
metalc13 metalc ? ? D MN  .   MN    ? ? ? 1_555 I DTP . O1A A ? A MN  501 A DTP 506 1_555 ? ? ? ? ? ? ?            2.213 ? 
metalc14 metalc ? ? E MN  .   MN    B ? ? 1_555 J DPO . O1  B ? A MN  502 A DPO 507 1_555 ? ? ? ? ? ? ?            2.353 ? 
metalc15 metalc ? ? E MN  .   MN    B ? ? 1_555 J DPO . O5  B ? A MN  502 A DPO 507 1_555 ? ? ? ? ? ? ?            2.150 ? 
metalc16 metalc ? ? J DPO .   O2    B ? ? 1_555 K MN  . MN  B ? A DPO 507 P MN  101 1_555 ? ? ? ? ? ? ?            2.502 ? 
metalc17 metalc ? ? K MN  .   MN    B ? ? 1_555 L HOH . O   B ? P MN  101 A HOH 764 1_555 ? ? ? ? ? ? ?            2.445 ? 
metalc18 metalc ? ? K MN  .   MN    B ? ? 1_555 N HOH . O   B ? P MN  101 P HOH 215 1_555 ? ? ? ? ? ? ?            1.997 ? 
metalc19 metalc ? ? K MN  .   MN    B ? ? 1_555 L HOH . O   ? ? P MN  101 A HOH 667 1_555 ? ? ? ? ? ? ?            2.718 ? 
hydrog1  hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  9 N1  B ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  9 N6  B ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 1.22   
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -0.18  
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -10.38 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ALA A 217 ? N ALA A 214 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  501 ? 8  'binding site for residue MN A 501'  
AC2 Software A MN  502 ? 7  'binding site for residue MN A 502'  
AC3 Software A GOL 503 ? 9  'binding site for residue GOL A 503' 
AC4 Software A GOL 504 ? 7  'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 10 'binding site for residue GOL A 505' 
AC6 Software A DTP 506 ? 33 'binding site for residue DTP A 506' 
AC7 Software A DPO 507 ? 18 'binding site for residue DPO A 507' 
AC8 Software P MN  101 ? 8  'binding site for residue MN P 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2   AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3   AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4   AC1 8  MN  E .   ? MN  A 502 . ? 1_555 ? 
5   AC1 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
6   AC1 8  HOH L .   ? HOH A 799 . ? 1_555 ? 
7   AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8   AC1 8  DA  C 9   ? DA  P 9   . ? 1_555 ? 
9   AC2 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
10  AC2 7  MET A 17  ? MET A 14  . ? 1_555 ? 
11  AC2 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
12  AC2 7  MN  D .   ? MN  A 501 . ? 1_555 ? 
13  AC2 7  DTP I .   ? DTP A 506 . ? 1_555 ? 
14  AC2 7  DPO J .   ? DPO A 507 . ? 1_555 ? 
15  AC2 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
16  AC3 9  ARG A 27  ? ARG A 24  . ? 6_545 ? 
17  AC3 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
18  AC3 9  PHE A 250 ? PHE A 247 . ? 1_555 ? 
19  AC3 9  SER A 251 ? SER A 248 . ? 1_555 ? 
20  AC3 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
21  AC3 9  HOH L .   ? HOH A 649 . ? 1_555 ? 
22  AC3 9  HOH L .   ? HOH A 662 . ? 1_555 ? 
23  AC3 9  HOH L .   ? HOH A 684 . ? 1_555 ? 
24  AC3 9  HOH L .   ? HOH A 709 . ? 1_555 ? 
25  AC4 7  GLU A 97  ? GLU A 94  . ? 1_555 ? 
26  AC4 7  ALA A 98  ? ALA A 95  . ? 1_555 ? 
27  AC4 7  GLU A 101 ? GLU A 98  . ? 1_555 ? 
28  AC4 7  ARG A 306 ? ARG A 303 . ? 5_664 ? 
29  AC4 7  HOH L .   ? HOH A 633 . ? 1_555 ? 
30  AC4 7  HOH L .   ? HOH A 655 . ? 1_555 ? 
31  AC4 7  HOH L .   ? HOH A 809 . ? 1_555 ? 
32  AC5 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
33  AC5 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
34  AC5 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
35  AC5 10 ILE A 275 ? ILE A 272 . ? 5_664 ? 
36  AC5 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
37  AC5 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
38  AC5 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
39  AC5 10 HOH L .   ? HOH A 607 . ? 1_555 ? 
40  AC5 10 HOH L .   ? HOH A 609 . ? 1_555 ? 
41  AC5 10 HOH L .   ? HOH A 755 . ? 5_664 ? 
42  AC6 33 ASP A 16  ? ASP A 13  . ? 1_555 ? 
43  AC6 33 MET A 17  ? MET A 14  . ? 1_555 ? 
44  AC6 33 ASP A 18  ? ASP A 15  . ? 1_555 ? 
45  AC6 33 CYS A 19  ? CYS A 16  . ? 1_555 ? 
46  AC6 33 PHE A 20  ? PHE A 17  . ? 1_555 ? 
47  AC6 33 PHE A 21  ? PHE A 18  . ? 1_555 ? 
48  AC6 33 ILE A 51  ? ILE A 48  . ? 1_555 ? 
49  AC6 33 ALA A 52  ? ALA A 49  . ? 1_555 ? 
50  AC6 33 TYR A 55  ? TYR A 52  . ? 1_555 ? 
51  AC6 33 ARG A 58  ? ARG A 55  . ? 1_555 ? 
52  AC6 33 ARG A 64  ? ARG A 61  . ? 1_555 ? 
53  AC6 33 ILE A 117 ? ILE A 114 . ? 1_555 ? 
54  AC6 33 ASP A 118 ? ASP A 115 . ? 1_555 ? 
55  AC6 33 LYS A 234 ? LYS A 231 . ? 1_555 ? 
56  AC6 33 MN  D .   ? MN  A 501 . ? 1_555 ? 
57  AC6 33 MN  E .   ? MN  A 502 . ? 1_555 ? 
58  AC6 33 DPO J .   ? DPO A 507 . ? 1_555 ? 
59  AC6 33 HOH L .   ? HOH A 632 . ? 1_555 ? 
60  AC6 33 HOH L .   ? HOH A 643 . ? 1_555 ? 
61  AC6 33 HOH L .   ? HOH A 667 . ? 1_555 ? 
62  AC6 33 HOH L .   ? HOH A 712 . ? 1_555 ? 
63  AC6 33 HOH L .   ? HOH A 764 . ? 1_555 ? 
64  AC6 33 HOH L .   ? HOH A 799 . ? 1_555 ? 
65  AC6 33 HOH L .   ? HOH A 815 . ? 1_555 ? 
66  AC6 33 DT  C 8   ? DT  P 8   . ? 1_555 ? 
67  AC6 33 DA  C 9   ? DA  P 9   . ? 1_555 ? 
68  AC6 33 MN  K .   ? MN  P 101 . ? 1_555 ? 
69  AC6 33 HOH N .   ? HOH P 204 . ? 1_555 ? 
70  AC6 33 HOH N .   ? HOH P 208 . ? 1_555 ? 
71  AC6 33 HOH N .   ? HOH P 215 . ? 1_555 ? 
72  AC6 33 DT  B 3   ? DT  T 3   . ? 1_555 ? 
73  AC6 33 DT  B 4   ? DT  T 4   . ? 1_555 ? 
74  AC6 33 DA  B 5   ? DA  T 5   . ? 1_555 ? 
75  AC7 18 ASP A 16  ? ASP A 13  . ? 1_555 ? 
76  AC7 18 MET A 17  ? MET A 14  . ? 1_555 ? 
77  AC7 18 ASP A 18  ? ASP A 15  . ? 1_555 ? 
78  AC7 18 CYS A 19  ? CYS A 16  . ? 1_555 ? 
79  AC7 18 PHE A 20  ? PHE A 17  . ? 1_555 ? 
80  AC7 18 TYR A 55  ? TYR A 52  . ? 1_555 ? 
81  AC7 18 ARG A 58  ? ARG A 55  . ? 1_555 ? 
82  AC7 18 ARG A 64  ? ARG A 61  . ? 1_555 ? 
83  AC7 18 ASP A 118 ? ASP A 115 . ? 1_555 ? 
84  AC7 18 LYS A 234 ? LYS A 231 . ? 1_555 ? 
85  AC7 18 MN  E .   ? MN  A 502 . ? 1_555 ? 
86  AC7 18 DTP I .   ? DTP A 506 . ? 1_555 ? 
87  AC7 18 HOH L .   ? HOH A 632 . ? 1_555 ? 
88  AC7 18 HOH L .   ? HOH A 643 . ? 1_555 ? 
89  AC7 18 HOH L .   ? HOH A 667 . ? 1_555 ? 
90  AC7 18 HOH L .   ? HOH A 764 . ? 1_555 ? 
91  AC7 18 DA  C 9   ? DA  P 9   . ? 1_555 ? 
92  AC7 18 MN  K .   ? MN  P 101 . ? 1_555 ? 
93  AC8 8  ARG A 64  ? ARG A 61  . ? 1_555 ? 
94  AC8 8  DTP I .   ? DTP A 506 . ? 1_555 ? 
95  AC8 8  DPO J .   ? DPO A 507 . ? 1_555 ? 
96  AC8 8  HOH L .   ? HOH A 667 . ? 1_555 ? 
97  AC8 8  HOH L .   ? HOH A 712 . ? 1_555 ? 
98  AC8 8  HOH L .   ? HOH A 764 . ? 1_555 ? 
99  AC8 8  DA  C 9   ? DA  P 9   . ? 1_555 ? 
100 AC8 8  HOH N .   ? HOH P 215 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KG5 
_atom_sites.fract_transf_matrix[1][1]   0.010182 
_atom_sites.fract_transf_matrix[1][2]   0.005879 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011757 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012182 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.935 -34.381 -3.962  1.00 51.14  ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.314 -33.928 -3.982  1.00 57.74  ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.596 -33.002 -5.149  1.00 61.37  ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.380 -31.793 -5.054  1.00 62.74  ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.076 -33.571 -6.265  1.00 61.81  ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.420 -32.814 -7.475  1.00 60.52  ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.201 -32.244 -8.203  1.00 56.75  ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.367 -31.512 -9.180  1.00 58.77  ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.127 -33.858 -8.349  1.00 57.49  ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.585 -35.169 -7.881  1.00 54.33  ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.356 -35.010 -6.412  1.00 54.10  ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 65.999 -32.567 -7.733  1.00 56.94  ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 64.781 -32.206 -8.458  1.00 56.45  ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 63.794 -31.366 -7.653  1.00 59.93  ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 62.837 -30.835 -8.216  1.00 52.96  ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.074 -33.470 -8.949  1.00 45.54  ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 64.981 -34.428 -9.654  1.00 45.96  ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.553 -34.147 -10.877 1.00 43.87  ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.419 -35.661 -9.308  1.00 40.99  ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.302 -35.168 -11.255 1.00 44.58  ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.239 -36.098 -10.320 1.00 40.55  ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.010 -31.250 -6.345  1.00 64.66  ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.097 -30.475 -5.511  1.00 65.83  ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.289 -28.976 -5.736  1.00 65.25  ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.294 -28.400 -5.312  1.00 55.38  ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.275 -30.822 -4.026  1.00 72.24  ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 64.708 -31.070 -3.576  1.00 75.79  ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 64.790 -32.286 -2.243  1.00 100.75 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 64.231 -31.306 -0.851  1.00 67.85  ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.320 -28.360 -6.411  1.00 69.00  ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.359 -26.928 -6.696  1.00 63.18  ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 62.485 -26.136 -5.404  1.00 57.34  ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 61.790 -26.413 -4.426  1.00 59.64  ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.123 -26.499 -7.464  1.00 65.76  ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.385 -25.161 -5.397  1.00 50.15  ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 63.677 -24.422 -4.177  1.00 41.47  ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.162 -22.988 -4.234  1.00 30.75  ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.324 -22.235 -3.277  1.00 30.32  ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.185 -24.404 -3.887  1.00 39.17  ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 65.887 -23.924 -5.041  1.00 39.35  ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 65.673 -25.805 -3.557  1.00 39.04  ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.536 -22.622 -5.351  1.00 28.59  ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 61.957 -21.294 -5.498  1.00 23.36  ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.002 -20.203 -5.366  1.00 20.03  ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 62.807 -19.228 -4.642  1.00 22.62  ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.124 -20.368 -6.060  1.00 17.98  ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.232 -19.412 -5.946  1.00 12.70  ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 65.629 -18.816 -7.293  1.00 13.94  ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 66.715 -18.264 -7.430  1.00 15.55  ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.459 -20.083 -5.320  1.00 17.92  ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.302 -20.485 -3.866  1.00 20.09  ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 67.544 -21.206 -3.359  1.00 20.16  ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 67.720 -22.398 -3.604  1.00 26.94  ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.421 -20.479 -2.673  1.00 25.89  ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 64.719 -18.921 -8.259  1.00 15.73  ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 64.958 -18.527 -9.644  1.00 17.69  ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 64.895 -17.018 -9.883  1.00 18.28  ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.488 -16.514 -10.826 1.00 18.92  ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 63.945 -19.233 -10.562 1.00 27.99  ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.521 -19.238 -9.988  1.00 30.79  ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.347 -19.486 -8.772  1.00 29.99  ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.565 -18.993 -10.757 1.00 44.78  ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.174 -16.303 -9.027  1.00 16.44  ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 63.955 -14.876 -9.224  1.00 15.30  ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.606 -14.030 -8.143  1.00 17.12  ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 64.841 -14.500 -7.025  1.00 16.63  ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.457 -14.554 -9.241  1.00 13.42  ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 61.660 -15.204 -10.367 1.00 16.73  ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.185 -14.801 -10.275 1.00 14.38  ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.519 -15.372 -9.099  1.00 15.83  ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.431 -14.870 -8.518  1.00 18.32  ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 57.905 -15.474 -7.453  1.00 13.44  ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 57.869 -13.763 -8.978  1.00 17.92  ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 64.874 -12.772 -8.473  1.00 14.06  ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.154 -11.788 -7.431  1.00 9.60   ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.023 -10.783 -7.437  1.00 12.40  ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 63.768 -10.141 -8.452  1.00 14.67  ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.493 -11.062 -7.620  1.00 11.53  ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 66.718 -10.070 -6.480  1.00 11.72  ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 67.632 -12.066 -7.668  1.00 14.93  ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.349 -10.635 -6.299  1.00 10.49  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.190 -9.750  -6.225  1.00 12.22  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.376 -8.787  -5.070  1.00 10.10  ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 62.803 -9.194  -3.984  1.00 10.85  ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 60.873 -10.540 -6.042  1.00 11.29  ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 59.681 -9.617  -5.780  1.00 14.41  ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.615 -11.438 -7.262  1.00 13.48  ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.063 -7.515  -5.301  1.00 12.11  ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.088 -6.536  -4.218  1.00 10.06  ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 60.734 -5.905  -4.013  1.00 10.02  ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 59.925 -5.812  -4.934  1.00 12.48  ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.126 -5.455  -4.480  1.00 11.64  ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.503 -5.468  -2.785  1.00 8.90   ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.328 -4.659  -2.481  1.00 7.89   ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 59.830 -3.377  -1.858  1.00 12.54  ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.549 -3.422  -0.859  1.00 11.81  ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.389 -5.411  -1.553  1.00 11.64  ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.062 -4.819  -1.067  1.00 12.25  ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.244 -3.938  0.176   1.00 12.82  ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.316 -4.064  -2.185  1.00 11.25  ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.489 -2.241  -2.470  1.00 10.81  ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 59.867 -0.937  -1.920  1.00 10.69  ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.632 -0.287  -1.332  1.00 9.90   ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.624 -0.165  -2.014  1.00 10.01  ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.480 -0.039  -3.000  1.00 12.63  ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 60.870 1.333   -2.431  1.00 10.45  ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.690 -0.728  -3.600  1.00 11.88  ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 58.701 0.110   -0.061  1.00 10.16  ? 13   ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.540 0.688   0.614   1.00 11.14  ? 13   ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 57.923 2.003   1.282   1.00 9.83   ? 13   ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 58.865 2.039   2.055   1.00 11.15  ? 13   ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 56.991 -0.289  1.655   1.00 8.41   ? 13   ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 55.744 0.221   2.304   1.00 10.70  ? 13   ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 55.872 1.026   3.235   1.00 11.28  ? 13   ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 54.641 -0.173  1.889   1.00 12.74  ? 13   ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.206 3.058   0.995   1.00 9.17   ? 14   MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 57.583 4.333   1.570   1.00 10.31  ? 14   MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.405 4.403   3.090   1.00 10.63  ? 14   MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.516 3.853   3.564   1.00 10.85  ? 14   MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 56.793 5.490   0.950   1.00 12.09  ? 14   MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 56.782 5.511   -0.541  1.00 12.42  ? 14   MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.431 5.541   -1.298  1.00 11.12  ? 14   MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 58.900 7.187   -0.826  1.00 16.13  ? 14   MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.259 5.115   3.808   1.00 9.62   ? 15   ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.090 5.259   5.237   1.00 9.61   ? 15   ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.051 6.331   5.513   1.00 10.18  ? 15   ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.100 7.363   4.928   1.00 9.08   ? 15   ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.375 5.700   5.884   1.00 10.55  ? 15   ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.519 4.691   5.709   1.00 11.89  ? 15   ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.276 3.539   5.506   1.00 13.97  ? 15   ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.631 5.087   5.828   1.00 15.08  ? 15   ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.109 5.980   6.369   1.00 8.93   ? 16   CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.077 6.898   6.873   1.00 8.21   ? 16   CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.603 7.834   5.764   1.00 8.45   ? 16   CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 54.730 8.972   5.899   1.00 9.83   ? 16   CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.377 7.583   8.207   1.00 10.13  ? 16   CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 56.921 8.523   8.322   1.00 12.65  ? 16   CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.179 7.290   4.644   1.00 8.62   ? 17   PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.199 8.062   3.408   1.00 7.11   ? 17   PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.418 9.357   3.402   1.00 10.14  ? 17   PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 53.974 10.310  3.063   1.00 8.90   ? 17   PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.610 7.176   2.275   1.00 8.63   ? 17   PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.662 7.770   0.909   1.00 10.69  ? 17   PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 54.756 8.444   0.477   1.00 10.33  ? 17   PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.589 7.691   0.078   1.00 10.92  ? 17   PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 54.811 8.978   -0.767  1.00 11.51  ? 17   PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.642 8.246   -1.155  1.00 11.63  ? 17   PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 53.740 8.903   -1.564  1.00 11.15  ? 17   PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.168 9.386   3.825   1.00 9.72   ? 18   PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.416 10.647  3.740   1.00 8.90   ? 18   PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.064 11.690  4.662   1.00 10.60  ? 18   PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.012 12.884  4.390   1.00 10.99  ? 18   PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 49.917 10.498  4.117   1.00 8.95   ? 18   PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.064 9.748   3.111   1.00 9.48   ? 18   PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 49.621 9.018   2.063   1.00 10.13  ? 18   PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 47.680 9.768   3.229   1.00 11.85  ? 18   PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 48.803 8.324   1.159   1.00 12.04  ? 18   PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 46.866 9.078   2.321   1.00 11.65  ? 18   PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.426 8.357   1.299   1.00 10.33  ? 18   PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.659 11.244  5.771   1.00 10.55  ? 19   VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.379 12.163  6.652   1.00 8.63   ? 19   VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.588 12.775  5.941   1.00 11.21  ? 19   VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 54.785 13.988  5.982   1.00 12.05  ? 19   VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 53.839 11.467  7.942   1.00 8.33   ? 19   VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 54.940 12.282  8.626   1.00 10.72  ? 19   VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.646 11.274  8.861   1.00 10.75  ? 19   VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.387 11.948  5.274   1.00 10.09  ? 20   GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.533 12.508  4.551   1.00 8.34   ? 20   GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.092 13.478  3.455   1.00 9.76   ? 20   GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 56.792 14.474  3.197   1.00 10.83  ? 20   GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.380 11.421  3.939   1.00 11.37  ? 20   GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.186 10.610  4.903   1.00 13.12  ? 20   GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.278 9.927   4.124   1.00 15.35  ? 20   GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.339 10.499  3.912   1.00 15.12  ? 20   GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 58.995 8.726   3.624   1.00 18.95  ? 20   GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 54.969 13.195  2.792   1.00 8.64   ? 21   VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.482 14.120  1.765   1.00 8.47   ? 21   VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.175 15.480  2.419   1.00 10.04  ? 21   VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.535 16.530  1.885   1.00 11.37  ? 21   VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.216 13.597  1.037   1.00 9.49   ? 21   VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.672 14.655  0.063   1.00 10.67  ? 21   VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.511 12.280  0.303   1.00 8.69   ? 21   VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.545 15.460  3.594   1.00 9.70   ? 22   GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.224 16.708  4.271   1.00 9.58   ? 22   GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.475 17.374  4.869   1.00 11.33  ? 22   GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.550 18.604  4.928   1.00 10.26  ? 22   GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.159 16.472  5.367   1.00 9.39   ? 22   GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 50.816 15.984  4.841   1.00 10.17  ? 22   GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.073 17.015  3.979   1.00 12.59  ? 22   GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.298 18.229  4.178   1.00 14.46  ? 22   GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.252 16.612  3.118   1.00 13.35  ? 22   GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.444 16.578  5.326   1.00 10.28  ? 23   GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 56.685 17.142  5.866   1.00 8.12   ? 23   GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.555 17.792  4.783   1.00 10.57  ? 23   GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.235 18.785  5.049   1.00 11.71  ? 23   GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.481 16.066  6.598   1.00 10.52  ? 23   GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 56.879 15.682  7.937   1.00 12.10  ? 23   GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.597 14.492  8.529   1.00 13.25  ? 23   GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.023 13.601  7.801   1.00 11.92  ? 23   GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 57.779 14.494  9.840   1.00 12.97  ? 23   GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.553 17.235  3.572   1.00 10.87  ? 24   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.248 17.899  2.469   1.00 9.80   ? 24   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 57.621 19.285  2.235   1.00 11.73  ? 24   ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.339 20.274  2.122   1.00 11.47  ? 24   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.207 17.057  1.187   1.00 11.13  ? 24   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 58.916 17.718  -0.001  1.00 11.05  ? 24   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 58.943 16.776  -1.206  1.00 13.27  ? 24   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 57.642 16.677  -1.857  1.00 10.30  ? 24   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.455 16.086  -3.035  1.00 10.47  ? 24   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.479 15.502  -3.656  1.00 10.22  ? 24   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.245 16.057  -3.577  1.00 12.67  ? 24   ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.292 19.350  2.190   1.00 9.24   ? 25   GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 55.593 20.606  1.927   1.00 10.11  ? 25   GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 55.779 21.649  3.031   1.00 12.17  ? 25   GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 55.870 22.853  2.770   1.00 12.20  ? 25   GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.092 20.349  1.736   1.00 10.28  ? 25   GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.305 21.578  1.235   1.00 12.75  ? 25   GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 51.832 21.246  1.011   1.00 17.02  ? 25   GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.502 20.151  0.580   1.00 15.16  ? 25   GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 50.949 22.200  1.291   1.00 23.57  ? 25   GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 55.771 21.175  4.273   1.00 11.39  ? 26   ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 55.827 22.030  5.449   1.00 11.79  ? 26   ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.003 21.623  6.317   1.00 10.84  ? 26   ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 56.901 20.711  7.147   1.00 11.43  ? 26   ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.534 21.956  6.263   1.00 12.20  ? 26   ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.523 22.938  7.448   1.00 11.65  ? 26   ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.505 23.631  7.713   1.00 14.63  ? 26   ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.395 22.999  8.152   1.00 16.80  ? 26   ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.134 22.299  6.123   1.00 11.74  ? 27   PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.361 22.024  6.862   1.00 14.33  ? 27   PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.166 22.079  8.378   1.00 15.48  ? 27   PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 59.927 21.441  9.074   1.00 13.74  ? 27   PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.307 23.133  6.390   1.00 16.64  ? 27   PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 59.804 23.449  5.011   1.00 13.32  ? 27   PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.331 23.296  5.058   1.00 14.09  ? 27   PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.162 22.810  8.864   1.00 13.50  ? 28   HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 57.900 22.883  10.307  1.00 15.41  ? 28   HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.482 21.534  10.902  1.00 14.63  ? 28   HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 57.542 21.339  12.116  1.00 18.77  ? 28   HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 56.811 23.912  10.595  1.00 18.85  ? 28   HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.304 25.322  10.635  1.00 24.64  ? 28   HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 56.576 26.377  10.127  1.00 32.52  ? 28   HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.441 25.857  11.138  1.00 28.59  ? 28   HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.246 27.500  10.309  1.00 34.14  ? 28   HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.383 27.212  10.919  1.00 28.65  ? 28   HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.050 20.604  10.051  1.00 13.64  ? 29   LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 56.627 19.288  10.531  1.00 12.00  ? 29   LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 57.753 18.273  10.533  1.00 15.03  ? 29   LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 57.594 17.163  11.034  1.00 13.44  ? 29   LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.471 18.743  9.678   1.00 9.91   ? 29   LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.250 19.632  9.499   1.00 13.05  ? 29   LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.251 18.944  8.568   1.00 13.24  ? 29   LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 53.609 19.964  10.850  1.00 18.84  ? 29   LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 58.896 18.626  9.959   1.00 11.92  ? 30   ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 59.994 17.667  9.862   1.00 12.47  ? 30   ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 60.598 17.316  11.225  1.00 14.84  ? 30   ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 60.698 18.170  12.107  1.00 16.73  ? 30   ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.090 18.203  8.935   1.00 13.73  ? 30   ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.568 18.517  7.531   1.00 14.36  ? 30   ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 61.646 19.023  6.578   1.00 13.29  ? 30   ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.075 19.339  5.255   1.00 14.20  ? 30   ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 61.769 19.858  4.245   1.00 17.89  ? 30   ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.065 20.108  4.386   1.00 15.87  ? 30   ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.172 20.115  3.085   1.00 15.98  ? 30   ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 60.952 16.039  11.383  1.00 17.17  ? 31   ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 61.593 15.542  12.605  1.00 16.35  ? 31   ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 60.781 15.873  13.839  1.00 15.13  ? 31   ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.300 16.391  14.832  1.00 20.36  ? 31   ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.001 16.122  12.739  1.00 23.07  ? 31   ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 63.851 15.846  11.519  1.00 24.25  ? 31   ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.022 14.694  11.127  1.00 30.80  ? 31   ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.366 16.904  10.897  1.00 29.99  ? 31   ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.486 15.625  13.738  1.00 14.05  ? 32   LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.555 15.908  14.817  1.00 14.74  ? 32   LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.591 14.756  14.943  1.00 17.88  ? 32   LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.374 14.026  13.976  1.00 16.19  ? 32   LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 57.781 17.205  14.560  1.00 19.18  ? 32   LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 58.645 18.455  14.563  1.00 25.66  ? 32   LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 58.581 19.165  15.903  1.00 26.92  ? 32   LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 59.321 20.498  15.853  1.00 35.40  ? 32   LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 59.203 21.262  17.130  1.00 37.38  ? 32   LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 57.007 14.580  16.141  1.00 12.97  ? 33   PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 55.860 13.683  16.206  1.00 13.32  ? 33   PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 54.734 14.319  15.407  1.00 12.46  ? 33   PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 54.284 15.435  15.718  1.00 13.73  ? 33   PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 55.530 13.610  17.704  1.00 14.49  ? 33   PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 56.102 14.857  18.290  1.00 17.47  ? 33   PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 57.252 15.295  17.409  1.00 16.63  ? 33   PRO A CD    1 
ATOM   289  N  N     A CYS A 1 37  ? 54.306 13.653  14.346  0.43 11.46  ? 34   CYS A N     1 
ATOM   290  N  N     B CYS A 1 37  ? 54.277 13.623  14.370  0.57 11.51  ? 34   CYS A N     1 
ATOM   291  C  CA    A CYS A 1 37  ? 53.220 14.212  13.575  0.43 14.09  ? 34   CYS A CA    1 
ATOM   292  C  CA    B CYS A 1 37  ? 53.353 14.212  13.411  0.57 14.16  ? 34   CYS A CA    1 
ATOM   293  C  C     . CYS A 1 37  ? 52.416 13.140  12.882  1.00 13.46  ? 34   CYS A C     1 
ATOM   294  O  O     . CYS A 1 37  ? 52.840 11.997  12.731  1.00 14.27  ? 34   CYS A O     1 
ATOM   295  C  CB    A CYS A 1 37  ? 53.736 15.233  12.562  0.43 13.90  ? 34   CYS A CB    1 
ATOM   296  C  CB    B CYS A 1 37  ? 54.142 14.873  12.266  0.57 13.43  ? 34   CYS A CB    1 
ATOM   297  S  SG    A CYS A 1 37  ? 54.840 14.558  11.343  0.43 14.16  ? 34   CYS A SG    1 
ATOM   298  S  SG    B CYS A 1 37  ? 53.180 15.629  10.915  0.57 13.71  ? 34   CYS A SG    1 
ATOM   299  N  N     . ALA A 1 38  ? 51.182 13.502  12.566  1.00 8.79   ? 35   ALA A N     1 
ATOM   300  C  CA    . ALA A 1 38  ? 50.276 12.551  11.953  1.00 10.69  ? 35   ALA A CA    1 
ATOM   301  C  C     . ALA A 1 38  ? 49.458 13.250  10.893  1.00 10.63  ? 35   ALA A C     1 
ATOM   302  O  O     . ALA A 1 38  ? 49.356 14.480  10.896  1.00 11.55  ? 35   ALA A O     1 
ATOM   303  C  CB    . ALA A 1 38  ? 49.366 11.902  13.008  1.00 11.68  ? 35   ALA A CB    1 
ATOM   304  N  N     . VAL A 1 39  ? 48.899 12.464  9.980   1.00 8.55   ? 36   VAL A N     1 
ATOM   305  C  CA    . VAL A 1 39  ? 47.979 12.987  8.981   1.00 9.88   ? 36   VAL A CA    1 
ATOM   306  C  C     . VAL A 1 39  ? 46.576 12.526  9.339   1.00 11.61  ? 36   VAL A C     1 
ATOM   307  O  O     . VAL A 1 39  ? 46.365 11.355  9.678   1.00 12.31  ? 36   VAL A O     1 
ATOM   308  C  CB    . VAL A 1 39  ? 48.368 12.533  7.571   1.00 8.44   ? 36   VAL A CB    1 
ATOM   309  C  CG1   . VAL A 1 39  ? 47.245 12.842  6.574   1.00 13.74  ? 36   VAL A CG1   1 
ATOM   310  C  CG2   . VAL A 1 39  ? 49.673 13.223  7.157   1.00 13.17  ? 36   VAL A CG2   1 
ATOM   311  N  N     . VAL A 1 40  ? 45.627 13.465  9.288   1.00 12.29  ? 37   VAL A N     1 
ATOM   312  C  CA    . VAL A 1 40  ? 44.287 13.235  9.768   1.00 12.24  ? 37   VAL A CA    1 
ATOM   313  C  C     . VAL A 1 40  ? 43.260 13.570  8.696   1.00 15.12  ? 37   VAL A C     1 
ATOM   314  O  O     . VAL A 1 40  ? 43.498 14.444  7.940   1.00 16.98  ? 37   VAL A O     1 
ATOM   315  C  CB    . VAL A 1 40  ? 43.935 14.162  10.971  1.00 14.08  ? 37   VAL A CB    1 
ATOM   316  C  CG1   A VAL A 1 40  ? 44.746 13.555  12.252  0.36 12.64  ? 37   VAL A CG1   1 
ATOM   317  C  CG1   B VAL A 1 40  ? 43.810 15.580  10.716  0.64 12.95  ? 37   VAL A CG1   1 
ATOM   318  C  CG2   A VAL A 1 40  ? 44.398 15.570  10.822  0.36 11.64  ? 37   VAL A CG2   1 
ATOM   319  C  CG2   B VAL A 1 40  ? 42.846 13.582  11.842  0.64 12.46  ? 37   VAL A CG2   1 
ATOM   320  N  N     . GLN A 1 41  ? 42.142 12.853  8.668   1.00 13.76  ? 38   GLN A N     1 
ATOM   321  C  CA    . GLN A 1 41  ? 41.041 13.246  7.787   1.00 14.71  ? 38   GLN A CA    1 
ATOM   322  C  C     . GLN A 1 41  ? 39.842 13.666  8.603   1.00 13.39  ? 38   GLN A C     1 
ATOM   323  O  O     . GLN A 1 41  ? 39.499 13.020  9.485   1.00 14.87  ? 38   GLN A O     1 
ATOM   324  C  CB    . GLN A 1 41  ? 40.587 12.238  6.721   1.00 24.91  ? 38   GLN A CB    1 
ATOM   325  C  CG    . GLN A 1 41  ? 41.120 10.870  6.796   1.00 32.41  ? 38   GLN A CG    1 
ATOM   326  C  CD    . GLN A 1 41  ? 40.627 9.948   5.657   1.00 20.80  ? 38   GLN A CD    1 
ATOM   327  O  OE1   . GLN A 1 41  ? 40.803 10.227  4.506   1.00 20.08  ? 38   GLN A OE1   1 
ATOM   328  N  NE2   . GLN A 1 41  ? 40.050 8.884   6.021   1.00 18.45  ? 38   GLN A NE2   1 
ATOM   329  N  N     . TYR A 1 42  ? 39.325 14.816  8.239   1.00 15.09  ? 39   TYR A N     1 
ATOM   330  C  CA    . TYR A 1 42  ? 38.182 15.442  8.840   1.00 12.56  ? 39   TYR A CA    1 
ATOM   331  C  C     . TYR A 1 42  ? 38.668 15.975  10.206  1.00 21.41  ? 39   TYR A C     1 
ATOM   332  O  O     . TYR A 1 42  ? 39.816 15.828  10.530  1.00 19.94  ? 39   TYR A O     1 
ATOM   333  C  CB    . TYR A 1 42  ? 36.963 14.536  8.857   1.00 15.96  ? 39   TYR A CB    1 
ATOM   334  C  CG    . TYR A 1 42  ? 36.566 14.038  7.478   1.00 13.51  ? 39   TYR A CG    1 
ATOM   335  C  CD1   . TYR A 1 42  ? 36.191 14.897  6.515   1.00 16.48  ? 39   TYR A CD1   1 
ATOM   336  C  CD2   . TYR A 1 42  ? 36.580 12.710  7.170   1.00 16.14  ? 39   TYR A CD2   1 
ATOM   337  C  CE1   . TYR A 1 42  ? 35.829 14.462  5.273   1.00 18.46  ? 39   TYR A CE1   1 
ATOM   338  C  CE2   . TYR A 1 42  ? 36.205 12.268  5.927   1.00 16.18  ? 39   TYR A CE2   1 
ATOM   339  C  CZ    . TYR A 1 42  ? 35.841 13.147  4.971   1.00 15.48  ? 39   TYR A CZ    1 
ATOM   340  O  OH    . TYR A 1 42  ? 35.455 12.732  3.753   1.00 13.82  ? 39   TYR A OH    1 
ATOM   341  N  N     . LYS A 1 43  ? 37.794 16.599  10.944  1.00 19.58  ? 40   LYS A N     1 
ATOM   342  C  CA    . LYS A 1 43  ? 38.176 17.208  12.212  1.00 16.73  ? 40   LYS A CA    1 
ATOM   343  C  C     . LYS A 1 43  ? 37.057 17.252  13.252  1.00 23.44  ? 40   LYS A C     1 
ATOM   344  O  O     . LYS A 1 43  ? 37.283 17.098  14.416  1.00 24.56  ? 40   LYS A O     1 
ATOM   345  C  CB    . LYS A 1 43  ? 38.773 18.594  11.981  1.00 19.59  ? 40   LYS A CB    1 
ATOM   346  C  CG    . LYS A 1 43  ? 38.867 19.450  13.246  1.00 33.08  ? 40   LYS A CG    1 
ATOM   347  C  CD    . LYS A 1 43  ? 40.292 19.516  13.794  1.00 32.97  ? 40   LYS A CD    1 
ATOM   348  C  CE    . LYS A 1 43  ? 40.433 20.256  15.139  1.00 36.65  ? 40   LYS A CE    1 
ATOM   349  N  NZ    . LYS A 1 43  ? 39.435 21.305  15.168  1.00 37.21  ? 40   LYS A NZ    1 
ATOM   350  N  N     . SER A 1 44  ? 35.840 17.423  12.790  1.00 24.67  ? 41   SER A N     1 
ATOM   351  C  CA    . SER A 1 44  ? 34.733 17.606  13.684  1.00 21.87  ? 41   SER A CA    1 
ATOM   352  C  C     . SER A 1 44  ? 34.502 16.447  14.626  1.00 28.08  ? 41   SER A C     1 
ATOM   353  O  O     . SER A 1 44  ? 34.286 16.629  15.769  1.00 27.77  ? 41   SER A O     1 
ATOM   354  C  CB    . SER A 1 44  ? 33.469 17.904  12.840  1.00 29.00  ? 41   SER A CB    1 
ATOM   355  O  OG    . SER A 1 44  ? 32.364 17.100  13.145  1.00 34.19  ? 41   SER A OG    1 
ATOM   356  N  N     . TRP A 1 45  ? 34.518 15.247  14.105  1.00 21.97  ? 42   TRP A N     1 
ATOM   357  C  CA    . TRP A 1 45  ? 34.300 14.078  14.954  1.00 22.33  ? 42   TRP A CA    1 
ATOM   358  C  C     . TRP A 1 45  ? 35.606 13.625  15.600  1.00 21.84  ? 42   TRP A C     1 
ATOM   359  O  O     . TRP A 1 45  ? 36.497 13.113  14.923  1.00 22.36  ? 42   TRP A O     1 
ATOM   360  C  CB    . TRP A 1 45  ? 33.678 12.940  14.144  1.00 26.89  ? 42   TRP A CB    1 
ATOM   361  C  CG    . TRP A 1 45  ? 33.248 11.758  14.969  1.00 30.78  ? 42   TRP A CG    1 
ATOM   362  C  CD1   . TRP A 1 45  ? 33.955 10.609  15.189  1.00 29.78  ? 42   TRP A CD1   1 
ATOM   363  C  CD2   . TRP A 1 45  ? 32.006 11.603  15.665  1.00 33.35  ? 42   TRP A CD2   1 
ATOM   364  N  NE1   . TRP A 1 45  ? 33.234 9.754   15.989  1.00 30.98  ? 42   TRP A NE1   1 
ATOM   365  C  CE2   . TRP A 1 45  ? 32.033 10.337  16.288  1.00 36.92  ? 42   TRP A CE2   1 
ATOM   366  C  CE3   . TRP A 1 45  ? 30.874 12.408  15.820  1.00 36.41  ? 42   TRP A CE3   1 
ATOM   367  C  CZ2   . TRP A 1 45  ? 30.973 9.864   17.061  1.00 42.30  ? 42   TRP A CZ2   1 
ATOM   368  C  CZ3   . TRP A 1 45  ? 29.821 11.934  16.583  1.00 40.93  ? 42   TRP A CZ3   1 
ATOM   369  C  CH2   . TRP A 1 45  ? 29.877 10.672  17.192  1.00 38.78  ? 42   TRP A CH2   1 
ATOM   370  N  N     . LYS A 1 46  ? 35.701 13.844  16.911  1.00 22.90  ? 43   LYS A N     1 
ATOM   371  C  CA    . LYS A 1 46  ? 36.832 13.428  17.743  1.00 20.77  ? 43   LYS A CA    1 
ATOM   372  C  C     . LYS A 1 46  ? 38.201 13.872  17.215  1.00 22.16  ? 43   LYS A C     1 
ATOM   373  O  O     . LYS A 1 46  ? 39.205 13.178  17.400  1.00 21.44  ? 43   LYS A O     1 
ATOM   374  C  CB    . LYS A 1 46  ? 36.809 11.910  17.924  1.00 21.99  ? 43   LYS A CB    1 
ATOM   375  C  CG    . LYS A 1 46  ? 35.564 11.413  18.634  1.00 28.96  ? 43   LYS A CG    1 
ATOM   376  C  CD    . LYS A 1 46  ? 35.537 9.904   18.741  1.00 33.53  ? 43   LYS A CD    1 
ATOM   377  C  CE    . LYS A 1 46  ? 34.428 9.450   19.676  1.00 38.39  ? 43   LYS A CE    1 
ATOM   378  N  NZ    . LYS A 1 46  ? 34.217 7.975   19.617  1.00 46.67  ? 43   LYS A NZ    1 
ATOM   379  N  N     . GLY A 1 47  ? 38.238 15.032  16.569  1.00 19.72  ? 44   GLY A N     1 
ATOM   380  C  CA    . GLY A 1 47  ? 39.491 15.607  16.129  1.00 17.93  ? 44   GLY A CA    1 
ATOM   381  C  C     . GLY A 1 47  ? 39.968 15.115  14.779  1.00 15.95  ? 44   GLY A C     1 
ATOM   382  O  O     . GLY A 1 47  ? 40.970 15.610  14.277  1.00 18.07  ? 44   GLY A O     1 
ATOM   383  N  N     . GLY A 1 48  ? 39.248 14.144  14.207  1.00 17.70  ? 45   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 48  ? 39.566 13.576  12.909  1.00 19.19  ? 45   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 48  ? 40.198 12.204  13.051  1.00 17.15  ? 45   GLY A C     1 
ATOM   386  O  O     . GLY A 1 48  ? 40.690 11.860  14.117  1.00 16.66  ? 45   GLY A O     1 
ATOM   387  N  N     . GLY A 1 49  ? 40.209 11.425  11.975  1.00 13.68  ? 46   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 49  ? 40.764 10.085  12.038  1.00 13.50  ? 46   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 49  ? 42.184 10.064  11.501  1.00 16.44  ? 46   GLY A C     1 
ATOM   390  O  O     . GLY A 1 49  ? 42.450 10.567  10.412  1.00 15.21  ? 46   GLY A O     1 
ATOM   391  N  N     . ILE A 1 50  ? 43.097 9.472   12.264  1.00 12.73  ? 47   ILE A N     1 
ATOM   392  C  CA    . ILE A 1 50  ? 44.499 9.416   11.864  1.00 12.75  ? 47   ILE A CA    1 
ATOM   393  C  C     . ILE A 1 50  ? 44.718 8.310   10.836  1.00 11.46  ? 47   ILE A C     1 
ATOM   394  O  O     . ILE A 1 50  ? 44.251 7.181   11.027  1.00 15.88  ? 47   ILE A O     1 
ATOM   395  C  CB    . ILE A 1 50  ? 45.405 9.175   13.072  1.00 12.91  ? 47   ILE A CB    1 
ATOM   396  C  CG1   . ILE A 1 50  ? 45.357 10.378  14.002  1.00 19.31  ? 47   ILE A CG1   1 
ATOM   397  C  CG2   . ILE A 1 50  ? 46.845 8.914   12.630  1.00 11.72  ? 47   ILE A CG2   1 
ATOM   398  C  CD1   . ILE A 1 50  ? 46.188 10.185  15.222  1.00 25.00  ? 47   ILE A CD1   1 
ATOM   399  N  N     . ILE A 1 51  ? 45.412 8.632   9.744   1.00 10.78  ? 48   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 51  ? 45.662 7.626   8.713   1.00 11.85  ? 48   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 51  ? 47.154 7.427   8.423   1.00 12.01  ? 48   ILE A C     1 
ATOM   402  O  O     . ILE A 1 51  ? 47.524 6.506   7.697   1.00 12.57  ? 48   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 51  ? 44.918 7.948   7.391   1.00 13.93  ? 48   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 51  ? 45.333 9.308   6.812   1.00 12.89  ? 48   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 51  ? 43.400 7.875   7.604   1.00 17.62  ? 48   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 51  ? 44.841 9.518   5.376   1.00 17.49  ? 48   ILE A CD1   1 
ATOM   407  N  N     . ALA A 1 52  ? 48.011 8.246   9.032   1.00 11.49  ? 49   ALA A N     1 
ATOM   408  C  CA    . ALA A 1 52  ? 49.466 8.046   8.920   1.00 8.84   ? 49   ALA A CA    1 
ATOM   409  C  C     . ALA A 1 52  ? 50.174 8.736   10.083  1.00 11.67  ? 49   ALA A C     1 
ATOM   410  O  O     . ALA A 1 52  ? 49.729 9.788   10.560  1.00 11.30  ? 49   ALA A O     1 
ATOM   411  C  CB    . ALA A 1 52  ? 50.005 8.568   7.568   1.00 9.48   ? 49   ALA A CB    1 
ATOM   412  N  N     . VAL A 1 53  ? 51.275 8.134   10.537  1.00 9.87   ? 50   VAL A N     1 
ATOM   413  C  CA    . VAL A 1 53  ? 51.958 8.513   11.778  1.00 8.31   ? 50   VAL A CA    1 
ATOM   414  C  C     . VAL A 1 53  ? 53.485 8.471   11.647  1.00 8.26   ? 50   VAL A C     1 
ATOM   415  O  O     . VAL A 1 53  ? 54.058 7.447   11.237  1.00 10.24  ? 50   VAL A O     1 
ATOM   416  C  CB    . VAL A 1 53  ? 51.550 7.572   12.938  1.00 9.31   ? 50   VAL A CB    1 
ATOM   417  C  CG1   . VAL A 1 53  ? 52.041 8.110   14.259  1.00 13.37  ? 50   VAL A CG1   1 
ATOM   418  C  CG2   . VAL A 1 53  ? 50.042 7.397   12.978  1.00 12.35  ? 50   VAL A CG2   1 
ATOM   419  N  N     . SER A 1 54  ? 54.146 9.573   11.993  1.00 9.90   ? 51   SER A N     1 
ATOM   420  C  CA    . SER A 1 54  ? 55.608 9.635   11.936  1.00 9.84   ? 51   SER A CA    1 
ATOM   421  C  C     . SER A 1 54  ? 56.189 8.738   13.019  1.00 13.33  ? 51   SER A C     1 
ATOM   422  O  O     . SER A 1 54  ? 55.519 8.458   14.024  1.00 10.44  ? 51   SER A O     1 
ATOM   423  C  CB    . SER A 1 54  ? 56.107 11.070  12.096  1.00 11.55  ? 51   SER A CB    1 
ATOM   424  O  OG    . SER A 1 54  ? 56.159 11.434  13.470  1.00 11.28  ? 51   SER A OG    1 
ATOM   425  N  N     . TYR A 1 55  ? 57.420 8.280   12.812  1.00 12.08  ? 52   TYR A N     1 
ATOM   426  C  CA    . TYR A 1 55  ? 58.018 7.318   13.742  1.00 10.18  ? 52   TYR A CA    1 
ATOM   427  C  C     . TYR A 1 55  ? 58.262 7.951   15.110  1.00 12.70  ? 52   TYR A C     1 
ATOM   428  O  O     . TYR A 1 55  ? 58.181 7.263   16.131  1.00 14.28  ? 52   TYR A O     1 
ATOM   429  C  CB    . TYR A 1 55  ? 59.304 6.727   13.144  1.00 13.09  ? 52   TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 55  ? 58.960 5.652   12.141  1.00 13.11  ? 52   TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 55  ? 58.538 5.982   10.856  1.00 10.06  ? 52   TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 55  ? 58.990 4.308   12.498  1.00 15.47  ? 52   TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 55  ? 58.166 4.989   9.950   1.00 12.97  ? 52   TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 55  ? 58.642 3.308   11.602  1.00 14.21  ? 52   TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 55  ? 58.227 3.650   10.324  1.00 12.33  ? 52   TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 55  ? 57.871 2.652   9.423   1.00 12.56  ? 52   TYR A OH    1 
ATOM   437  N  N     . GLU A 1 56  ? 58.510 9.258   15.142  1.00 12.46  ? 53   GLU A N     1 
ATOM   438  C  CA    . GLU A 1 56  ? 58.565 9.975   16.424  1.00 14.48  ? 53   GLU A CA    1 
ATOM   439  C  C     . GLU A 1 56  ? 57.245 9.862   17.184  1.00 14.19  ? 53   GLU A C     1 
ATOM   440  O  O     . GLU A 1 56  ? 57.223 9.676   18.406  1.00 14.82  ? 53   GLU A O     1 
ATOM   441  C  CB    . GLU A 1 56  ? 58.912 11.445  16.191  1.00 12.50  ? 53   GLU A CB    1 
ATOM   442  C  CG    . GLU A 1 56  ? 60.322 11.683  15.615  1.00 18.18  ? 53   GLU A CG    1 
ATOM   443  C  CD    . GLU A 1 56  ? 60.446 11.517  14.094  1.00 24.24  ? 53   GLU A CD    1 
ATOM   444  O  OE1   . GLU A 1 56  ? 59.478 11.085  13.428  1.00 18.64  ? 53   GLU A OE1   1 
ATOM   445  O  OE2   . GLU A 1 56  ? 61.537 11.830  13.563  1.00 29.25  ? 53   GLU A OE2   1 
ATOM   446  N  N     . ALA A 1 57  ? 56.135 10.011  16.471  1.00 10.48  ? 54   ALA A N     1 
ATOM   447  C  CA    . ALA A 1 57  ? 54.835 9.929   17.108  1.00 10.48  ? 54   ALA A CA    1 
ATOM   448  C  C     . ALA A 1 57  ? 54.517 8.488   17.521  1.00 12.10  ? 54   ALA A C     1 
ATOM   449  O  O     . ALA A 1 57  ? 53.862 8.262   18.531  1.00 12.29  ? 54   ALA A O     1 
ATOM   450  C  CB    . ALA A 1 57  ? 53.746 10.475  16.182  1.00 13.17  ? 54   ALA A CB    1 
ATOM   451  N  N     . ARG A 1 58  ? 54.989 7.505   16.755  1.00 11.90  ? 55   ARG A N     1 
ATOM   452  C  CA    . ARG A 1 58  ? 54.702 6.115   17.105  1.00 11.51  ? 55   ARG A CA    1 
ATOM   453  C  C     . ARG A 1 58  ? 55.293 5.744   18.463  1.00 11.76  ? 55   ARG A C     1 
ATOM   454  O  O     . ARG A 1 58  ? 54.740 4.912   19.183  1.00 15.60  ? 55   ARG A O     1 
ATOM   455  C  CB    . ARG A 1 58  ? 55.241 5.181   16.037  1.00 11.93  ? 55   ARG A CB    1 
ATOM   456  C  CG    . ARG A 1 58  ? 54.566 5.355   14.707  1.00 13.55  ? 55   ARG A CG    1 
ATOM   457  C  CD    . ARG A 1 58  ? 55.093 4.387   13.662  1.00 11.18  ? 55   ARG A CD    1 
ATOM   458  N  NE    . ARG A 1 58  ? 54.643 4.790   12.325  1.00 11.10  ? 55   ARG A NE    1 
ATOM   459  C  CZ    . ARG A 1 58  ? 54.711 4.025   11.243  1.00 14.64  ? 55   ARG A CZ    1 
ATOM   460  N  NH1   . ARG A 1 58  ? 55.198 2.798   11.329  1.00 16.50  ? 55   ARG A NH1   1 
ATOM   461  N  NH2   . ARG A 1 58  ? 54.285 4.504   10.073  1.00 13.95  ? 55   ARG A NH2   1 
ATOM   462  N  N     . ALA A 1 59  ? 56.398 6.401   18.791  1.00 14.10  ? 56   ALA A N     1 
ATOM   463  C  CA    . ALA A 1 59  ? 57.099 6.194   20.059  1.00 13.96  ? 56   ALA A CA    1 
ATOM   464  C  C     . ALA A 1 59  ? 56.194 6.513   21.253  1.00 16.51  ? 56   ALA A C     1 
ATOM   465  O  O     . ALA A 1 59  ? 56.383 5.970   22.345  1.00 18.49  ? 56   ALA A O     1 
ATOM   466  C  CB    . ALA A 1 59  ? 58.359 7.045   20.102  1.00 15.86  ? 56   ALA A CB    1 
ATOM   467  N  N     . PHE A 1 60  ? 55.216 7.393   21.045  1.00 12.99  ? 57   PHE A N     1 
ATOM   468  C  CA    . PHE A 1 60  ? 54.258 7.766   22.084  1.00 14.36  ? 57   PHE A CA    1 
ATOM   469  C  C     . PHE A 1 60  ? 53.061 6.829   22.113  1.00 12.75  ? 57   PHE A C     1 
ATOM   470  O  O     . PHE A 1 60  ? 52.186 6.956   22.971  1.00 16.67  ? 57   PHE A O     1 
ATOM   471  C  CB    . PHE A 1 60  ? 53.751 9.194   21.875  1.00 14.30  ? 57   PHE A CB    1 
ATOM   472  C  CG    . PHE A 1 60  ? 54.748 10.257  22.226  1.00 12.97  ? 57   PHE A CG    1 
ATOM   473  C  CD1   . PHE A 1 60  ? 54.700 10.890  23.465  1.00 20.00  ? 57   PHE A CD1   1 
ATOM   474  C  CD2   . PHE A 1 60  ? 55.726 10.646  21.323  1.00 15.43  ? 57   PHE A CD2   1 
ATOM   475  C  CE1   . PHE A 1 60  ? 55.616 11.888  23.796  1.00 22.19  ? 57   PHE A CE1   1 
ATOM   476  C  CE2   . PHE A 1 60  ? 56.644 11.637  21.651  1.00 18.12  ? 57   PHE A CE2   1 
ATOM   477  C  CZ    . PHE A 1 60  ? 56.587 12.257  22.894  1.00 24.62  ? 57   PHE A CZ    1 
ATOM   478  N  N     . GLY A 1 61  ? 52.987 5.925   21.140  1.00 12.54  ? 58   GLY A N     1 
ATOM   479  C  CA    . GLY A 1 61  ? 51.861 5.011   21.026  1.00 18.43  ? 58   GLY A CA    1 
ATOM   480  C  C     . GLY A 1 61  ? 50.765 5.460   20.073  1.00 14.11  ? 58   GLY A C     1 
ATOM   481  O  O     . GLY A 1 61  ? 49.696 4.850   20.011  1.00 15.22  ? 58   GLY A O     1 
ATOM   482  N  N     . VAL A 1 62  ? 51.019 6.524   19.313  1.00 13.05  ? 59   VAL A N     1 
ATOM   483  C  CA    . VAL A 1 62  ? 50.039 6.990   18.335  1.00 14.67  ? 59   VAL A CA    1 
ATOM   484  C  C     . VAL A 1 62  ? 49.990 5.997   17.181  1.00 14.20  ? 59   VAL A C     1 
ATOM   485  O  O     . VAL A 1 62  ? 51.029 5.548   16.697  1.00 13.80  ? 59   VAL A O     1 
ATOM   486  C  CB    . VAL A 1 62  ? 50.378 8.404   17.821  1.00 11.78  ? 59   VAL A CB    1 
ATOM   487  C  CG1   . VAL A 1 62  ? 49.342 8.867   16.794  1.00 13.51  ? 59   VAL A CG1   1 
ATOM   488  C  CG2   . VAL A 1 62  ? 50.427 9.387   18.986  1.00 14.87  ? 59   VAL A CG2   1 
ATOM   489  N  N     . THR A 1 63  ? 48.782 5.635   16.752  1.00 14.69  ? 60   THR A N     1 
ATOM   490  C  CA    . THR A 1 63  ? 48.627 4.702   15.641  1.00 17.45  ? 60   THR A CA    1 
ATOM   491  C  C     . THR A 1 63  ? 47.588 5.169   14.641  1.00 22.25  ? 60   THR A C     1 
ATOM   492  O  O     . THR A 1 63  ? 46.754 6.019   14.937  1.00 18.79  ? 60   THR A O     1 
ATOM   493  C  CB    . THR A 1 63  ? 48.216 3.277   16.115  1.00 19.20  ? 60   THR A CB    1 
ATOM   494  O  OG1   . THR A 1 63  ? 46.885 3.306   16.641  1.00 21.43  ? 60   THR A OG1   1 
ATOM   495  C  CG2   . THR A 1 63  ? 49.163 2.745   17.177  1.00 21.39  ? 60   THR A CG2   1 
ATOM   496  N  N     . ARG A 1 64  ? 47.650 4.591   13.447  1.00 18.25  ? 61   ARG A N     1 
ATOM   497  C  CA    . ARG A 1 64  ? 46.572 4.687   12.468  1.00 21.14  ? 61   ARG A CA    1 
ATOM   498  C  C     . ARG A 1 64  ? 45.261 4.197   13.091  1.00 21.51  ? 61   ARG A C     1 
ATOM   499  O  O     . ARG A 1 64  ? 45.283 3.360   13.996  1.00 22.75  ? 61   ARG A O     1 
ATOM   500  C  CB    . ARG A 1 64  ? 46.946 3.877   11.216  1.00 23.78  ? 61   ARG A CB    1 
ATOM   501  C  CG    A ARG A 1 64  ? 45.810 3.536   10.277  0.80 30.03  ? 61   ARG A CG    1 
ATOM   502  C  CG    B ARG A 1 64  ? 46.003 4.051   10.039  0.20 25.30  ? 61   ARG A CG    1 
ATOM   503  C  CD    A ARG A 1 64  ? 46.344 2.881   9.010   0.80 23.32  ? 61   ARG A CD    1 
ATOM   504  C  CD    B ARG A 1 64  ? 46.403 3.120   8.911   0.20 22.82  ? 61   ARG A CD    1 
ATOM   505  N  NE    A ARG A 1 64  ? 47.350 3.730   8.388   0.80 19.14  ? 61   ARG A NE    1 
ATOM   506  N  NE    B ARG A 1 64  ? 46.903 1.854   9.439   0.20 26.36  ? 61   ARG A NE    1 
ATOM   507  C  CZ    A ARG A 1 64  ? 48.569 3.331   8.026   0.80 23.33  ? 61   ARG A CZ    1 
ATOM   508  C  CZ    B ARG A 1 64  ? 46.135 0.816   9.752   0.20 28.55  ? 61   ARG A CZ    1 
ATOM   509  N  NH1   A ARG A 1 64  ? 48.957 2.069   8.196   0.80 24.83  ? 61   ARG A NH1   1 
ATOM   510  N  NH1   B ARG A 1 64  ? 44.822 0.881   9.575   0.20 28.92  ? 61   ARG A NH1   1 
ATOM   511  N  NH2   A ARG A 1 64  ? 49.399 4.204   7.478   0.80 18.62  ? 61   ARG A NH2   1 
ATOM   512  N  NH2   B ARG A 1 64  ? 46.683 -0.292  10.231  0.20 28.77  ? 61   ARG A NH2   1 
ATOM   513  N  N     . SER A 1 65  ? 44.140 4.754   12.624  1.00 19.87  ? 62   SER A N     1 
ATOM   514  C  CA    . SER A 1 65  ? 42.773 4.401   13.048  1.00 27.57  ? 62   SER A CA    1 
ATOM   515  C  C     . SER A 1 65  ? 42.366 5.115   14.332  1.00 31.81  ? 62   SER A C     1 
ATOM   516  O  O     . SER A 1 65  ? 41.195 5.124   14.703  1.00 38.38  ? 62   SER A O     1 
ATOM   517  C  CB    . SER A 1 65  ? 42.604 2.899   13.244  1.00 35.94  ? 62   SER A CB    1 
ATOM   518  O  OG    . SER A 1 65  ? 42.965 2.538   14.565  1.00 41.82  ? 62   SER A OG    1 
ATOM   519  N  N     . MET A 1 66  ? 43.341 5.703   15.009  1.00 22.03  ? 63   MET A N     1 
ATOM   520  C  CA    . MET A 1 66  ? 43.101 6.462   16.230  1.00 19.31  ? 63   MET A CA    1 
ATOM   521  C  C     . MET A 1 66  ? 42.432 7.807   15.932  1.00 20.89  ? 63   MET A C     1 
ATOM   522  O  O     . MET A 1 66  ? 42.741 8.443   14.925  1.00 19.13  ? 63   MET A O     1 
ATOM   523  C  CB    . MET A 1 66  ? 44.436 6.671   16.938  1.00 22.43  ? 63   MET A CB    1 
ATOM   524  C  CG    . MET A 1 66  ? 44.383 7.061   18.369  1.00 25.63  ? 63   MET A CG    1 
ATOM   525  S  SD    . MET A 1 66  ? 46.081 6.952   18.978  1.00 23.07  ? 63   MET A SD    1 
ATOM   526  C  CE    . MET A 1 66  ? 46.225 5.241   19.457  1.00 21.88  ? 63   MET A CE    1 
ATOM   527  N  N     . TRP A 1 67  ? 41.515 8.243   16.795  1.00 17.15  ? 64   TRP A N     1 
ATOM   528  C  CA    . TRP A 1 67  ? 40.985 9.600   16.671  1.00 15.11  ? 64   TRP A CA    1 
ATOM   529  C  C     . TRP A 1 67  ? 42.051 10.579  17.145  1.00 17.06  ? 64   TRP A C     1 
ATOM   530  O  O     . TRP A 1 67  ? 42.739 10.308  18.127  1.00 15.52  ? 64   TRP A O     1 
ATOM   531  C  CB    . TRP A 1 67  ? 39.703 9.771   17.488  1.00 21.30  ? 64   TRP A CB    1 
ATOM   532  C  CG    . TRP A 1 67  ? 38.583 8.898   17.030  1.00 19.66  ? 64   TRP A CG    1 
ATOM   533  C  CD1   . TRP A 1 67  ? 38.000 7.884   17.728  1.00 24.88  ? 64   TRP A CD1   1 
ATOM   534  C  CD2   . TRP A 1 67  ? 37.900 8.971   15.771  1.00 21.42  ? 64   TRP A CD2   1 
ATOM   535  N  NE1   . TRP A 1 67  ? 36.995 7.314   16.980  1.00 29.74  ? 64   TRP A NE1   1 
ATOM   536  C  CE2   . TRP A 1 67  ? 36.918 7.959   15.772  1.00 34.97  ? 64   TRP A CE2   1 
ATOM   537  C  CE3   . TRP A 1 67  ? 38.034 9.782   14.638  1.00 20.14  ? 64   TRP A CE3   1 
ATOM   538  C  CZ2   . TRP A 1 67  ? 36.067 7.744   14.686  1.00 31.50  ? 64   TRP A CZ2   1 
ATOM   539  C  CZ3   . TRP A 1 67  ? 37.190 9.567   13.563  1.00 22.98  ? 64   TRP A CZ3   1 
ATOM   540  C  CH2   . TRP A 1 67  ? 36.223 8.555   13.593  1.00 29.40  ? 64   TRP A CH2   1 
ATOM   541  N  N     . ALA A 1 68  ? 42.200 11.713  16.462  1.00 13.68  ? 65   ALA A N     1 
ATOM   542  C  CA    . ALA A 1 68  ? 43.214 12.686  16.864  1.00 15.93  ? 65   ALA A CA    1 
ATOM   543  C  C     . ALA A 1 68  ? 43.029 13.156  18.313  1.00 16.09  ? 65   ALA A C     1 
ATOM   544  O  O     . ALA A 1 68  ? 44.009 13.457  18.995  1.00 16.28  ? 65   ALA A O     1 
ATOM   545  C  CB    . ALA A 1 68  ? 43.219 13.891  15.912  1.00 15.58  ? 65   ALA A CB    1 
ATOM   546  N  N     . ASP A 1 69  ? 41.791 13.222  18.797  1.00 17.04  ? 66   ASP A N     1 
ATOM   547  C  CA    . ASP A 1 69  ? 41.612 13.662  20.182  1.00 17.27  ? 66   ASP A CA    1 
ATOM   548  C  C     . ASP A 1 69  ? 42.278 12.683  21.151  1.00 17.12  ? 66   ASP A C     1 
ATOM   549  O  O     . ASP A 1 69  ? 42.833 13.093  22.179  1.00 17.24  ? 66   ASP A O     1 
ATOM   550  C  CB    . ASP A 1 69  ? 40.138 13.808  20.542  1.00 19.99  ? 66   ASP A CB    1 
ATOM   551  C  CG    . ASP A 1 69  ? 39.497 15.055  19.945  1.00 20.88  ? 66   ASP A CG    1 
ATOM   552  O  OD1   . ASP A 1 69  ? 40.204 15.949  19.417  1.00 20.78  ? 66   ASP A OD1   1 
ATOM   553  O  OD2   . ASP A 1 69  ? 38.260 15.136  20.028  1.00 27.97  ? 66   ASP A OD2   1 
ATOM   554  N  N     . ASP A 1 70  ? 42.232 11.398  20.817  1.00 15.95  ? 67   ASP A N     1 
ATOM   555  C  CA    . ASP A 1 70  ? 42.798 10.375  21.682  1.00 15.18  ? 67   ASP A CA    1 
ATOM   556  C  C     . ASP A 1 70  ? 44.308 10.314  21.506  1.00 13.68  ? 67   ASP A C     1 
ATOM   557  O  O     . ASP A 1 70  ? 45.048 10.140  22.470  1.00 13.29  ? 67   ASP A O     1 
ATOM   558  C  CB    . ASP A 1 70  ? 42.161 9.019   21.383  1.00 19.00  ? 67   ASP A CB    1 
ATOM   559  C  CG    . ASP A 1 70  ? 40.664 9.020   21.634  1.00 30.15  ? 67   ASP A CG    1 
ATOM   560  O  OD1   . ASP A 1 70  ? 40.207 9.801   22.504  1.00 22.74  ? 67   ASP A OD1   1 
ATOM   561  O  OD2   . ASP A 1 70  ? 39.946 8.267   20.944  1.00 29.16  ? 67   ASP A OD2   1 
ATOM   562  N  N     . ALA A 1 71  ? 44.773 10.481  20.268  1.00 13.29  ? 68   ALA A N     1 
ATOM   563  C  CA    . ALA A 1 71  ? 46.217 10.570  20.046  1.00 11.35  ? 68   ALA A CA    1 
ATOM   564  C  C     . ALA A 1 71  ? 46.838 11.728  20.825  1.00 14.47  ? 68   ALA A C     1 
ATOM   565  O  O     . ALA A 1 71  ? 47.950 11.601  21.324  1.00 14.11  ? 68   ALA A O     1 
ATOM   566  C  CB    . ALA A 1 71  ? 46.527 10.720  18.568  1.00 12.68  ? 68   ALA A CB    1 
ATOM   567  N  N     . LYS A 1 72  ? 46.118 12.845  20.927  1.00 12.89  ? 69   LYS A N     1 
ATOM   568  C  CA    . LYS A 1 72  ? 46.594 14.007  21.683  1.00 15.60  ? 69   LYS A CA    1 
ATOM   569  C  C     . LYS A 1 72  ? 46.736 13.712  23.175  1.00 16.65  ? 69   LYS A C     1 
ATOM   570  O  O     . LYS A 1 72  ? 47.535 14.342  23.879  1.00 15.98  ? 69   LYS A O     1 
ATOM   571  C  CB    . LYS A 1 72  ? 45.648 15.193  21.484  1.00 15.36  ? 69   LYS A CB    1 
ATOM   572  C  CG    . LYS A 1 72  ? 45.914 16.006  20.214  1.00 19.76  ? 69   LYS A CG    1 
ATOM   573  C  CD    . LYS A 1 72  ? 47.258 16.684  20.305  1.00 18.17  ? 69   LYS A CD    1 
ATOM   574  C  CE    . LYS A 1 72  ? 47.408 17.799  19.287  1.00 23.86  ? 69   LYS A CE    1 
ATOM   575  N  NZ    . LYS A 1 72  ? 48.678 18.547  19.563  1.00 19.91  ? 69   LYS A NZ    1 
ATOM   576  N  N     . LYS A 1 73  ? 45.965 12.743  23.657  1.00 11.46  ? 70   LYS A N     1 
ATOM   577  C  CA    . LYS A 1 73  ? 46.104 12.320  25.047  1.00 14.15  ? 70   LYS A CA    1 
ATOM   578  C  C     . LYS A 1 73  ? 47.446 11.615  25.267  1.00 18.05  ? 70   LYS A C     1 
ATOM   579  O  O     . LYS A 1 73  ? 48.065 11.767  26.312  1.00 18.68  ? 70   LYS A O     1 
ATOM   580  C  CB    . LYS A 1 73  ? 44.946 11.405  25.443  1.00 10.83  ? 70   LYS A CB    1 
ATOM   581  C  CG    . LYS A 1 73  ? 43.587 12.036  25.283  1.00 12.40  ? 70   LYS A CG    1 
ATOM   582  C  CD    . LYS A 1 73  ? 42.459 11.010  25.467  1.00 14.69  ? 70   LYS A CD    1 
ATOM   583  C  CE    . LYS A 1 73  ? 41.086 11.638  25.180  1.00 18.69  ? 70   LYS A CE    1 
ATOM   584  N  NZ    . LYS A 1 73  ? 40.020 10.603  25.085  1.00 21.96  ? 70   LYS A NZ    1 
ATOM   585  N  N     . LEU A 1 74  ? 47.897 10.856  24.274  1.00 16.27  ? 71   LEU A N     1 
ATOM   586  C  CA    . LEU A 1 74  ? 49.186 10.160  24.385  1.00 15.33  ? 71   LEU A CA    1 
ATOM   587  C  C     . LEU A 1 74  ? 50.370 11.079  24.110  1.00 18.41  ? 71   LEU A C     1 
ATOM   588  O  O     . LEU A 1 74  ? 51.468 10.881  24.645  1.00 22.23  ? 71   LEU A O     1 
ATOM   589  C  CB    . LEU A 1 74  ? 49.242 8.974   23.416  1.00 13.74  ? 71   LEU A CB    1 
ATOM   590  C  CG    . LEU A 1 74  ? 48.204 7.881   23.614  1.00 13.56  ? 71   LEU A CG    1 
ATOM   591  C  CD1   . LEU A 1 74  ? 48.326 6.893   22.460  1.00 18.52  ? 71   LEU A CD1   1 
ATOM   592  C  CD2   . LEU A 1 74  ? 48.426 7.159   24.956  1.00 16.81  ? 71   LEU A CD2   1 
ATOM   593  N  N     . CYS A 1 75  ? 50.132 12.077  23.264  1.00 14.15  ? 72   CYS A N     1 
ATOM   594  C  CA    . CYS A 1 75  ? 51.184 12.910  22.717  1.00 17.96  ? 72   CYS A CA    1 
ATOM   595  C  C     . CYS A 1 75  ? 50.644 14.326  22.540  1.00 19.31  ? 72   CYS A C     1 
ATOM   596  O  O     . CYS A 1 75  ? 50.185 14.700  21.469  1.00 16.40  ? 72   CYS A O     1 
ATOM   597  C  CB    . CYS A 1 75  ? 51.677 12.315  21.398  1.00 13.59  ? 72   CYS A CB    1 
ATOM   598  S  SG    . CYS A 1 75  ? 52.998 13.236  20.578  1.00 18.44  ? 72   CYS A SG    1 
ATOM   599  N  N     . PRO A 1 76  ? 50.677 15.116  23.618  1.00 16.22  ? 73   PRO A N     1 
ATOM   600  C  CA    . PRO A 1 76  ? 50.096 16.463  23.642  1.00 18.29  ? 73   PRO A CA    1 
ATOM   601  C  C     . PRO A 1 76  ? 50.677 17.399  22.578  1.00 15.72  ? 73   PRO A C     1 
ATOM   602  O  O     . PRO A 1 76  ? 49.952 18.262  22.077  1.00 19.66  ? 73   PRO A O     1 
ATOM   603  C  CB    . PRO A 1 76  ? 50.433 16.959  25.058  1.00 20.19  ? 73   PRO A CB    1 
ATOM   604  C  CG    . PRO A 1 76  ? 50.531 15.720  25.861  1.00 24.24  ? 73   PRO A CG    1 
ATOM   605  C  CD    . PRO A 1 76  ? 51.134 14.681  24.952  1.00 23.57  ? 73   PRO A CD    1 
ATOM   606  N  N     . ASP A 1 77  ? 51.947 17.211  22.239  1.00 17.72  ? 74   ASP A N     1 
ATOM   607  C  CA    . ASP A 1 77  ? 52.603 18.055  21.244  1.00 21.86  ? 74   ASP A CA    1 
ATOM   608  C  C     . ASP A 1 77  ? 52.515 17.500  19.826  1.00 18.64  ? 74   ASP A C     1 
ATOM   609  O  O     . ASP A 1 77  ? 53.216 17.988  18.941  1.00 17.33  ? 74   ASP A O     1 
ATOM   610  C  CB    . ASP A 1 77  ? 54.077 18.249  21.586  1.00 19.96  ? 74   ASP A CB    1 
ATOM   611  C  CG    . ASP A 1 77  ? 54.285 18.904  22.939  1.00 32.44  ? 74   ASP A CG    1 
ATOM   612  O  OD1   . ASP A 1 77  ? 55.215 18.485  23.661  1.00 37.59  ? 74   ASP A OD1   1 
ATOM   613  O  OD2   . ASP A 1 77  ? 53.521 19.830  23.279  1.00 35.63  ? 74   ASP A OD2   1 
ATOM   614  N  N     . LEU A 1 78  ? 51.682 16.483  19.611  1.00 14.91  ? 75   LEU A N     1 
ATOM   615  C  CA    . LEU A 1 78  ? 51.553 15.873  18.278  1.00 12.22  ? 75   LEU A CA    1 
ATOM   616  C  C     . LEU A 1 78  ? 51.148 16.926  17.261  1.00 13.19  ? 75   LEU A C     1 
ATOM   617  O  O     . LEU A 1 78  ? 50.197 17.678  17.496  1.00 14.70  ? 75   LEU A O     1 
ATOM   618  C  CB    . LEU A 1 78  ? 50.517 14.748  18.291  1.00 12.58  ? 75   LEU A CB    1 
ATOM   619  C  CG    . LEU A 1 78  ? 50.202 14.029  16.979  1.00 12.14  ? 75   LEU A CG    1 
ATOM   620  C  CD1   . LEU A 1 78  ? 51.390 13.175  16.544  1.00 13.84  ? 75   LEU A CD1   1 
ATOM   621  C  CD2   . LEU A 1 78  ? 48.962 13.171  17.164  1.00 15.33  ? 75   LEU A CD2   1 
ATOM   622  N  N     . LEU A 1 79  ? 51.867 16.986  16.141  1.00 10.43  ? 76   LEU A N     1 
ATOM   623  C  CA    . LEU A 1 79  ? 51.510 17.920  15.086  1.00 9.66   ? 76   LEU A CA    1 
ATOM   624  C  C     . LEU A 1 79  ? 50.626 17.195  14.086  1.00 15.37  ? 76   LEU A C     1 
ATOM   625  O  O     . LEU A 1 79  ? 50.751 15.995  13.888  1.00 14.06  ? 76   LEU A O     1 
ATOM   626  C  CB    . LEU A 1 79  ? 52.763 18.509  14.419  1.00 8.48   ? 76   LEU A CB    1 
ATOM   627  C  CG    . LEU A 1 79  ? 53.723 19.241  15.366  1.00 10.69  ? 76   LEU A CG    1 
ATOM   628  C  CD1   . LEU A 1 79  ? 54.905 19.842  14.606  1.00 11.12  ? 76   LEU A CD1   1 
ATOM   629  C  CD2   . LEU A 1 79  ? 52.984 20.330  16.133  1.00 11.51  ? 76   LEU A CD2   1 
ATOM   630  N  N     . LEU A 1 80  ? 49.705 17.924  13.479  1.00 14.39  ? 77   LEU A N     1 
ATOM   631  C  CA    . LEU A 1 80  ? 48.743 17.303  12.581  1.00 14.87  ? 77   LEU A CA    1 
ATOM   632  C  C     . LEU A 1 80  ? 48.685 18.045  11.269  1.00 15.57  ? 77   LEU A C     1 
ATOM   633  O  O     . LEU A 1 80  ? 48.668 19.273  11.238  1.00 22.23  ? 77   LEU A O     1 
ATOM   634  C  CB    . LEU A 1 80  ? 47.354 17.270  13.202  1.00 18.02  ? 77   LEU A CB    1 
ATOM   635  C  CG    . LEU A 1 80  ? 47.185 16.494  14.496  1.00 17.11  ? 77   LEU A CG    1 
ATOM   636  C  CD1   . LEU A 1 80  ? 45.780 16.708  14.997  1.00 15.76  ? 77   LEU A CD1   1 
ATOM   637  C  CD2   . LEU A 1 80  ? 47.473 15.013  14.254  1.00 16.83  ? 77   LEU A CD2   1 
ATOM   638  N  N     . ALA A 1 81  ? 48.668 17.293  10.185  1.00 10.84  ? 78   ALA A N     1 
ATOM   639  C  CA    . ALA A 1 81  ? 48.357 17.859  8.874   1.00 13.44  ? 78   ALA A CA    1 
ATOM   640  C  C     . ALA A 1 81  ? 47.053 17.237  8.383   1.00 13.55  ? 78   ALA A C     1 
ATOM   641  O  O     . ALA A 1 81  ? 46.847 16.040  8.508   1.00 14.44  ? 78   ALA A O     1 
ATOM   642  C  CB    . ALA A 1 81  ? 49.474 17.609  7.898   1.00 15.98  ? 78   ALA A CB    1 
ATOM   643  N  N     . GLN A 1 82  ? 46.167 18.064  7.835   1.00 15.03  ? 79   GLN A N     1 
ATOM   644  C  CA    . GLN A 1 82  ? 44.862 17.590  7.375   1.00 13.21  ? 79   GLN A CA    1 
ATOM   645  C  C     . GLN A 1 82  ? 44.836 17.235  5.901   1.00 12.67  ? 79   GLN A C     1 
ATOM   646  O  O     . GLN A 1 82  ? 45.373 17.966  5.080   1.00 13.60  ? 79   GLN A O     1 
ATOM   647  C  CB    . GLN A 1 82  ? 43.796 18.656  7.618   1.00 15.48  ? 79   GLN A CB    1 
ATOM   648  C  CG    . GLN A 1 82  ? 43.575 19.020  9.070   1.00 20.49  ? 79   GLN A CG    1 
ATOM   649  C  CD    . GLN A 1 82  ? 42.382 19.936  9.237   1.00 26.47  ? 79   GLN A CD    1 
ATOM   650  O  OE1   . GLN A 1 82  ? 42.517 21.061  9.703   1.00 28.06  ? 79   GLN A OE1   1 
ATOM   651  N  NE2   . GLN A 1 82  ? 41.204 19.462  8.833   1.00 25.42  ? 79   GLN A NE2   1 
ATOM   652  N  N     . VAL A 1 83  ? 44.182 16.124  5.577   1.00 13.70  ? 80   VAL A N     1 
ATOM   653  C  CA    . VAL A 1 83  ? 43.850 15.804  4.195   1.00 12.84  ? 80   VAL A CA    1 
ATOM   654  C  C     . VAL A 1 83  ? 42.983 16.904  3.603   1.00 12.46  ? 80   VAL A C     1 
ATOM   655  O  O     . VAL A 1 83  ? 42.072 17.406  4.247   1.00 13.60  ? 80   VAL A O     1 
ATOM   656  C  CB    . VAL A 1 83  ? 43.108 14.453  4.095   1.00 12.00  ? 80   VAL A CB    1 
ATOM   657  C  CG1   . VAL A 1 83  ? 42.643 14.176  2.677   1.00 13.71  ? 80   VAL A CG1   1 
ATOM   658  C  CG2   . VAL A 1 83  ? 44.014 13.307  4.602   1.00 12.98  ? 80   VAL A CG2   1 
ATOM   659  N  N     . ARG A 1 84  ? 43.293 17.274  2.369   1.00 11.62  ? 81   ARG A N     1 
ATOM   660  C  CA    . ARG A 1 84  ? 42.509 18.256  1.634   1.00 12.60  ? 81   ARG A CA    1 
ATOM   661  C  C     . ARG A 1 84  ? 41.051 17.839  1.575   1.00 13.98  ? 81   ARG A C     1 
ATOM   662  O  O     . ARG A 1 84  ? 40.755 16.659  1.422   1.00 11.63  ? 81   ARG A O     1 
ATOM   663  C  CB    . ARG A 1 84  ? 43.064 18.397  0.217   1.00 16.00  ? 81   ARG A CB    1 
ATOM   664  C  CG    . ARG A 1 84  ? 42.169 19.171  -0.747  1.00 19.12  ? 81   ARG A CG    1 
ATOM   665  C  CD    . ARG A 1 84  ? 42.805 19.196  -2.126  1.00 24.57  ? 81   ARG A CD    1 
ATOM   666  N  NE    . ARG A 1 84  ? 41.892 19.640  -3.175  1.00 39.11  ? 81   ARG A NE    1 
ATOM   667  C  CZ    . ARG A 1 84  ? 42.131 19.498  -4.478  1.00 43.01  ? 81   ARG A CZ    1 
ATOM   668  N  NH1   . ARG A 1 84  ? 43.255 18.922  -4.888  1.00 38.15  ? 81   ARG A NH1   1 
ATOM   669  N  NH2   . ARG A 1 84  ? 41.246 19.923  -5.373  1.00 37.14  ? 81   ARG A NH2   1 
ATOM   670  N  N     . GLU A 1 85  ? 40.146 18.804  1.682   1.00 11.99  ? 82   GLU A N     1 
ATOM   671  C  CA    . GLU A 1 85  ? 38.754 18.534  1.388   1.00 13.93  ? 82   GLU A CA    1 
ATOM   672  C  C     . GLU A 1 85  ? 38.329 19.342  0.172   1.00 13.44  ? 82   GLU A C     1 
ATOM   673  O  O     . GLU A 1 85  ? 38.608 20.534  0.083   1.00 16.36  ? 82   GLU A O     1 
ATOM   674  C  CB    . GLU A 1 85  ? 37.872 18.852  2.596   1.00 19.90  ? 82   GLU A CB    1 
ATOM   675  C  CG    . GLU A 1 85  ? 38.047 17.833  3.720   1.00 23.09  ? 82   GLU A CG    1 
ATOM   676  C  CD    . GLU A 1 85  ? 37.334 18.223  5.002   1.00 26.63  ? 82   GLU A CD    1 
ATOM   677  O  OE1   . GLU A 1 85  ? 36.155 18.661  4.947   1.00 24.20  ? 82   GLU A OE1   1 
ATOM   678  O  OE2   . GLU A 1 85  ? 37.974 18.092  6.067   1.00 27.31  ? 82   GLU A OE2   1 
ATOM   679  N  N     . SER A 1 86  ? 37.688 18.666  -0.781  1.00 12.95  ? 83   SER A N     1 
ATOM   680  C  CA    . SER A 1 86  ? 37.116 19.304  -1.957  1.00 16.32  ? 83   SER A CA    1 
ATOM   681  C  C     . SER A 1 86  ? 35.755 18.695  -2.213  1.00 17.28  ? 83   SER A C     1 
ATOM   682  O  O     . SER A 1 86  ? 35.589 17.481  -2.088  1.00 14.10  ? 83   SER A O     1 
ATOM   683  C  CB    . SER A 1 86  ? 38.006 19.117  -3.191  1.00 14.46  ? 83   SER A CB    1 
ATOM   684  O  OG    . SER A 1 86  ? 39.308 19.607  -2.941  1.00 34.42  ? 83   SER A OG    1 
ATOM   685  N  N     . ARG A 1 87  ? 34.792 19.535  -2.589  1.00 18.25  ? 84   ARG A N     1 
ATOM   686  C  CA    . ARG A 1 87  ? 33.428 19.083  -2.863  1.00 16.82  ? 84   ARG A CA    1 
ATOM   687  C  C     . ARG A 1 87  ? 32.834 18.283  -1.709  1.00 15.10  ? 84   ARG A C     1 
ATOM   688  O  O     . ARG A 1 87  ? 32.064 17.344  -1.929  1.00 18.53  ? 84   ARG A O     1 
ATOM   689  C  CB    . ARG A 1 87  ? 33.381 18.263  -4.157  1.00 19.93  ? 84   ARG A CB    1 
ATOM   690  C  CG    . ARG A 1 87  ? 33.908 19.005  -5.371  1.00 23.27  ? 84   ARG A CG    1 
ATOM   691  C  CD    . ARG A 1 87  ? 33.712 18.186  -6.634  1.00 23.64  ? 84   ARG A CD    1 
ATOM   692  N  NE    . ARG A 1 87  ? 34.938 18.145  -7.420  1.00 31.92  ? 84   ARG A NE    1 
ATOM   693  C  CZ    . ARG A 1 87  ? 35.204 18.970  -8.426  1.00 37.89  ? 84   ARG A CZ    1 
ATOM   694  N  NH1   . ARG A 1 87  ? 34.326 19.907  -8.772  1.00 34.00  ? 84   ARG A NH1   1 
ATOM   695  N  NH2   . ARG A 1 87  ? 36.355 18.860  -9.080  1.00 37.48  ? 84   ARG A NH2   1 
ATOM   696  N  N     . GLY A 1 88  ? 33.196 18.659  -0.488  1.00 13.88  ? 85   GLY A N     1 
ATOM   697  C  CA    . GLY A 1 88  ? 32.584 18.114  0.714   1.00 16.73  ? 85   GLY A CA    1 
ATOM   698  C  C     . GLY A 1 88  ? 33.228 16.836  1.234   1.00 15.10  ? 85   GLY A C     1 
ATOM   699  O  O     . GLY A 1 88  ? 32.756 16.237  2.213   1.00 15.45  ? 85   GLY A O     1 
ATOM   700  N  N     . LYS A 1 89  ? 34.309 16.410  0.579   1.00 13.17  ? 86   LYS A N     1 
ATOM   701  C  CA    . LYS A 1 89  ? 34.927 15.130  0.911   1.00 13.12  ? 86   LYS A CA    1 
ATOM   702  C  C     . LYS A 1 89  ? 36.456 15.185  0.957   1.00 10.43  ? 86   LYS A C     1 
ATOM   703  O  O     . LYS A 1 89  ? 37.079 16.071  0.363   1.00 13.13  ? 86   LYS A O     1 
ATOM   704  C  CB    . LYS A 1 89  ? 34.491 14.059  -0.097  1.00 14.14  ? 86   LYS A CB    1 
ATOM   705  C  CG    . LYS A 1 89  ? 34.894 14.345  -1.540  1.00 13.83  ? 86   LYS A CG    1 
ATOM   706  C  CD    . LYS A 1 89  ? 34.447 13.230  -2.494  1.00 15.91  ? 86   LYS A CD    1 
ATOM   707  C  CE    . LYS A 1 89  ? 35.025 11.872  -2.090  1.00 14.52  ? 86   LYS A CE    1 
ATOM   708  N  NZ    . LYS A 1 89  ? 36.501 11.805  -2.262  1.00 13.88  ? 86   LYS A NZ    1 
ATOM   709  N  N     . ALA A 1 90  ? 37.048 14.226  1.658   1.00 13.95  ? 87   ALA A N     1 
ATOM   710  C  CA    . ALA A 1 90  ? 38.491 14.065  1.606   1.00 14.50  ? 87   ALA A CA    1 
ATOM   711  C  C     . ALA A 1 90  ? 38.897 13.792  0.174   1.00 14.78  ? 87   ALA A C     1 
ATOM   712  O  O     . ALA A 1 90  ? 38.220 13.060  -0.555  1.00 14.60  ? 87   ALA A O     1 
ATOM   713  C  CB    . ALA A 1 90  ? 38.954 12.938  2.529   1.00 16.08  ? 87   ALA A CB    1 
ATOM   714  N  N     . ASN A 1 91  ? 40.004 14.406  -0.221  1.00 12.50  ? 88   ASN A N     1 
ATOM   715  C  CA    . ASN A 1 91  ? 40.534 14.275  -1.565  1.00 13.45  ? 88   ASN A CA    1 
ATOM   716  C  C     . ASN A 1 91  ? 42.000 13.911  -1.472  1.00 12.64  ? 88   ASN A C     1 
ATOM   717  O  O     . ASN A 1 91  ? 42.786 14.641  -0.862  1.00 12.63  ? 88   ASN A O     1 
ATOM   718  C  CB    . ASN A 1 91  ? 40.347 15.581  -2.328  1.00 13.91  ? 88   ASN A CB    1 
ATOM   719  C  CG    . ASN A 1 91  ? 40.743 15.471  -3.781  1.00 16.99  ? 88   ASN A CG    1 
ATOM   720  O  OD1   . ASN A 1 91  ? 41.897 15.236  -4.098  1.00 13.95  ? 88   ASN A OD1   1 
ATOM   721  N  ND2   . ASN A 1 91  ? 39.777 15.672  -4.681  1.00 20.22  ? 88   ASN A ND2   1 
ATOM   722  N  N     . LEU A 1 92  ? 42.374 12.781  -2.058  1.00 10.45  ? 89   LEU A N     1 
ATOM   723  C  CA    . LEU A 1 92  ? 43.716 12.231  -1.832  1.00 12.43  ? 89   LEU A CA    1 
ATOM   724  C  C     . LEU A 1 92  ? 44.681 12.535  -2.975  1.00 11.83  ? 89   LEU A C     1 
ATOM   725  O  O     . LEU A 1 92  ? 45.707 11.894  -3.082  1.00 12.09  ? 89   LEU A O     1 
ATOM   726  C  CB    . LEU A 1 92  ? 43.630 10.717  -1.614  1.00 10.75  ? 89   LEU A CB    1 
ATOM   727  C  CG    . LEU A 1 92  ? 42.655 10.251  -0.523  1.00 13.68  ? 89   LEU A CG    1 
ATOM   728  C  CD1   . LEU A 1 92  ? 42.563 8.743   -0.495  1.00 15.92  ? 89   LEU A CD1   1 
ATOM   729  C  CD2   . LEU A 1 92  ? 43.095 10.782  0.837   1.00 13.98  ? 89   LEU A CD2   1 
ATOM   730  N  N     . THR A 1 93  ? 44.362 13.537  -3.796  1.00 10.51  ? 90   THR A N     1 
ATOM   731  C  CA    . THR A 1 93  ? 45.139 13.822  -5.005  1.00 12.61  ? 90   THR A CA    1 
ATOM   732  C  C     . THR A 1 93  ? 46.626 14.084  -4.724  1.00 10.97  ? 90   THR A C     1 
ATOM   733  O  O     . THR A 1 93  ? 47.503 13.594  -5.458  1.00 12.65  ? 90   THR A O     1 
ATOM   734  C  CB    . THR A 1 93  ? 44.522 15.017  -5.777  1.00 13.97  ? 90   THR A CB    1 
ATOM   735  O  OG1   . THR A 1 93  ? 43.189 14.668  -6.199  1.00 16.23  ? 90   THR A OG1   1 
ATOM   736  C  CG2   . THR A 1 93  ? 45.352 15.389  -7.006  1.00 16.04  ? 90   THR A CG2   1 
ATOM   737  N  N     . LYS A 1 94  ? 46.922 14.828  -3.665  1.00 10.68  ? 91   LYS A N     1 
ATOM   738  C  CA    . LYS A 1 94  ? 48.312 15.146  -3.346  1.00 10.79  ? 91   LYS A CA    1 
ATOM   739  C  C     . LYS A 1 94  ? 49.133 13.864  -3.169  1.00 12.39  ? 91   LYS A C     1 
ATOM   740  O  O     . LYS A 1 94  ? 50.294 13.786  -3.588  1.00 13.31  ? 91   LYS A O     1 
ATOM   741  C  CB    . LYS A 1 94  ? 48.397 16.013  -2.081  1.00 12.43  ? 91   LYS A CB    1 
ATOM   742  C  CG    . LYS A 1 94  ? 49.805 16.552  -1.804  1.00 13.90  ? 91   LYS A CG    1 
ATOM   743  C  CD    . LYS A 1 94  ? 49.931 17.069  -0.372  1.00 13.32  ? 91   LYS A CD    1 
ATOM   744  C  CE    . LYS A 1 94  ? 48.995 18.243  -0.116  1.00 16.87  ? 91   LYS A CE    1 
ATOM   745  N  NZ    . LYS A 1 94  ? 49.172 18.765  1.258   1.00 13.39  ? 91   LYS A NZ    1 
ATOM   746  N  N     . TYR A 1 95  ? 48.517 12.843  -2.583  1.00 11.68  ? 92   TYR A N     1 
ATOM   747  C  CA    . TYR A 1 95  ? 49.245 11.634  -2.244  1.00 9.90   ? 92   TYR A CA    1 
ATOM   748  C  C     . TYR A 1 95  ? 49.333 10.736  -3.455  1.00 11.43  ? 92   TYR A C     1 
ATOM   749  O  O     . TYR A 1 95  ? 50.347 10.066  -3.661  1.00 11.65  ? 92   TYR A O     1 
ATOM   750  C  CB    . TYR A 1 95  ? 48.581 10.909  -1.058  1.00 9.67   ? 92   TYR A CB    1 
ATOM   751  C  CG    . TYR A 1 95  ? 48.288 11.885  0.055   1.00 8.26   ? 92   TYR A CG    1 
ATOM   752  C  CD1   . TYR A 1 95  ? 46.997 12.272  0.319   1.00 10.24  ? 92   TYR A CD1   1 
ATOM   753  C  CD2   . TYR A 1 95  ? 49.323 12.502  0.761   1.00 8.63   ? 92   TYR A CD2   1 
ATOM   754  C  CE1   . TYR A 1 95  ? 46.724 13.198  1.302   1.00 11.71  ? 92   TYR A CE1   1 
ATOM   755  C  CE2   . TYR A 1 95  ? 49.070 13.425  1.736   1.00 11.97  ? 92   TYR A CE2   1 
ATOM   756  C  CZ    . TYR A 1 95  ? 47.758 13.777  1.996   1.00 11.61  ? 92   TYR A CZ    1 
ATOM   757  O  OH    . TYR A 1 95  ? 47.470 14.703  2.964   1.00 11.96  ? 92   TYR A OH    1 
ATOM   758  N  N     . ARG A 1 96  ? 48.296 10.748  -4.289  1.00 12.00  ? 93   ARG A N     1 
ATOM   759  C  CA    . ARG A 1 96  ? 48.370 10.001  -5.548  1.00 12.64  ? 93   ARG A CA    1 
ATOM   760  C  C     . ARG A 1 96  ? 49.457 10.571  -6.461  1.00 12.86  ? 93   ARG A C     1 
ATOM   761  O  O     . ARG A 1 96  ? 50.166 9.818   -7.144  1.00 12.22  ? 93   ARG A O     1 
ATOM   762  C  CB    . ARG A 1 96  ? 47.031 10.001  -6.296  1.00 9.17   ? 93   ARG A CB    1 
ATOM   763  C  CG    . ARG A 1 96  ? 45.943 9.169   -5.618  1.00 10.41  ? 93   ARG A CG    1 
ATOM   764  C  CD    . ARG A 1 96  ? 44.717 8.967   -6.500  1.00 13.74  ? 93   ARG A CD    1 
ATOM   765  N  NE    . ARG A 1 96  ? 43.703 8.233   -5.747  1.00 15.85  ? 93   ARG A NE    1 
ATOM   766  C  CZ    . ARG A 1 96  ? 42.683 8.812   -5.121  1.00 14.26  ? 93   ARG A CZ    1 
ATOM   767  N  NH1   . ARG A 1 96  ? 41.828 8.074   -4.419  1.00 12.15  ? 93   ARG A NH1   1 
ATOM   768  N  NH2   . ARG A 1 96  ? 42.519 10.127  -5.200  1.00 13.69  ? 93   ARG A NH2   1 
ATOM   769  N  N     . GLU A 1 97  ? 49.582 11.895  -6.486  1.00 12.83  ? 94   GLU A N     1 
ATOM   770  C  CA    . GLU A 1 97  ? 50.606 12.545  -7.315  1.00 12.63  ? 94   GLU A CA    1 
ATOM   771  C  C     . GLU A 1 97  ? 52.024 12.297  -6.775  1.00 12.44  ? 94   GLU A C     1 
ATOM   772  O  O     . GLU A 1 97  ? 52.945 12.024  -7.545  1.00 11.89  ? 94   GLU A O     1 
ATOM   773  C  CB    . GLU A 1 97  ? 50.300 14.048  -7.452  1.00 15.45  ? 94   GLU A CB    1 
ATOM   774  C  CG    . GLU A 1 97  ? 49.073 14.270  -8.343  1.00 16.82  ? 94   GLU A CG    1 
ATOM   775  C  CD    . GLU A 1 97  ? 48.671 15.724  -8.517  1.00 26.21  ? 94   GLU A CD    1 
ATOM   776  O  OE1   . GLU A 1 97  ? 49.207 16.598  -7.806  1.00 28.69  ? 94   GLU A OE1   1 
ATOM   777  O  OE2   . GLU A 1 97  ? 47.801 15.985  -9.380  1.00 22.04  ? 94   GLU A OE2   1 
ATOM   778  N  N     . ALA A 1 98  ? 52.189 12.346  -5.455  1.00 11.23  ? 95   ALA A N     1 
ATOM   779  C  CA    . ALA A 1 98  ? 53.462 11.977  -4.847  1.00 10.54  ? 95   ALA A CA    1 
ATOM   780  C  C     . ALA A 1 98  ? 53.827 10.524  -5.147  1.00 10.96  ? 95   ALA A C     1 
ATOM   781  O  O     . ALA A 1 98  ? 54.985 10.205  -5.402  1.00 10.99  ? 95   ALA A O     1 
ATOM   782  C  CB    . ALA A 1 98  ? 53.421 12.210  -3.348  1.00 10.87  ? 95   ALA A CB    1 
ATOM   783  N  N     . SER A 1 99  ? 52.826 9.652   -5.150  1.00 9.70   ? 96   SER A N     1 
ATOM   784  C  CA    . SER A 1 99  ? 53.045 8.256   -5.497  1.00 10.20  ? 96   SER A CA    1 
ATOM   785  C  C     . SER A 1 99  ? 53.595 8.107   -6.922  1.00 10.98  ? 96   SER A C     1 
ATOM   786  O  O     . SER A 1 99  ? 54.529 7.336   -7.165  1.00 11.74  ? 96   SER A O     1 
ATOM   787  C  CB    . SER A 1 99  ? 51.734 7.479   -5.352  1.00 13.08  ? 96   SER A CB    1 
ATOM   788  O  OG    . SER A 1 99  ? 51.895 6.136   -5.755  1.00 14.93  ? 96   SER A OG    1 
ATOM   789  N  N     . VAL A 1 100 ? 53.014 8.839   -7.866  1.00 11.08  ? 97   VAL A N     1 
ATOM   790  C  CA    . VAL A 1 100 ? 53.484 8.777   -9.247  1.00 9.58   ? 97   VAL A CA    1 
ATOM   791  C  C     . VAL A 1 100 ? 54.955 9.206   -9.333  1.00 11.49  ? 97   VAL A C     1 
ATOM   792  O  O     . VAL A 1 100 ? 55.741 8.583   -10.050 1.00 13.40  ? 97   VAL A O     1 
ATOM   793  C  CB    . VAL A 1 100 ? 52.612 9.653   -10.164 1.00 10.33  ? 97   VAL A CB    1 
ATOM   794  C  CG1   . VAL A 1 100 ? 53.256 9.838   -11.547 1.00 14.65  ? 97   VAL A CG1   1 
ATOM   795  C  CG2   . VAL A 1 100 ? 51.217 9.056   -10.270 1.00 16.55  ? 97   VAL A CG2   1 
ATOM   796  N  N     . GLU A 1 101 ? 55.354 10.213  -8.554  1.00 9.88   ? 98   GLU A N     1 
ATOM   797  C  CA    . GLU A 1 101 ? 56.773 10.610  -8.538  1.00 12.33  ? 98   GLU A CA    1 
ATOM   798  C  C     . GLU A 1 101 ? 57.696 9.436   -8.229  1.00 11.52  ? 98   GLU A C     1 
ATOM   799  O  O     . GLU A 1 101 ? 58.754 9.266   -8.848  1.00 13.17  ? 98   GLU A O     1 
ATOM   800  C  CB    . GLU A 1 101 ? 57.039 11.685  -7.488  1.00 11.91  ? 98   GLU A CB    1 
ATOM   801  C  CG    . GLU A 1 101 ? 56.447 13.048  -7.714  1.00 14.30  ? 98   GLU A CG    1 
ATOM   802  C  CD    . GLU A 1 101 ? 56.840 14.003  -6.590  1.00 13.12  ? 98   GLU A CD    1 
ATOM   803  O  OE1   . GLU A 1 101 ? 58.038 14.355  -6.472  1.00 17.22  ? 98   GLU A OE1   1 
ATOM   804  O  OE2   . GLU A 1 101 ? 55.944 14.405  -5.828  1.00 15.21  ? 98   GLU A OE2   1 
ATOM   805  N  N     . VAL A 1 102 ? 57.302 8.644   -7.237  1.00 10.47  ? 99   VAL A N     1 
ATOM   806  C  CA    . VAL A 1 102 ? 58.124 7.532   -6.800  1.00 10.46  ? 99   VAL A CA    1 
ATOM   807  C  C     . VAL A 1 102 ? 58.075 6.375   -7.791  1.00 10.95  ? 99   VAL A C     1 
ATOM   808  O  O     . VAL A 1 102 ? 59.115 5.770   -8.099  1.00 13.06  ? 99   VAL A O     1 
ATOM   809  C  CB    . VAL A 1 102 ? 57.688 7.023   -5.404  1.00 12.14  ? 99   VAL A CB    1 
ATOM   810  C  CG1   . VAL A 1 102 ? 58.465 5.779   -5.032  1.00 16.16  ? 99   VAL A CG1   1 
ATOM   811  C  CG2   . VAL A 1 102 ? 57.880 8.129   -4.360  1.00 14.43  ? 99   VAL A CG2   1 
ATOM   812  N  N     . MET A 1 103 ? 56.878 6.063   -8.293  1.00 9.44   ? 100  MET A N     1 
ATOM   813  C  CA    . MET A 1 103 ? 56.727 4.947   -9.220  1.00 9.66   ? 100  MET A CA    1 
ATOM   814  C  C     . MET A 1 103 ? 57.511 5.207   -10.495 1.00 13.61  ? 100  MET A C     1 
ATOM   815  O  O     . MET A 1 103 ? 58.099 4.287   -11.044 1.00 13.25  ? 100  MET A O     1 
ATOM   816  C  CB    . MET A 1 103 ? 55.250 4.691   -9.556  1.00 16.44  ? 100  MET A CB    1 
ATOM   817  C  CG    A MET A 1 103 ? 54.328 4.545   -8.341  0.44 15.83  ? 100  MET A CG    1 
ATOM   818  C  CG    B MET A 1 103 ? 54.384 4.339   -8.348  0.56 15.96  ? 100  MET A CG    1 
ATOM   819  S  SD    A MET A 1 103 ? 54.232 2.884   -7.653  0.44 12.25  ? 100  MET A SD    1 
ATOM   820  S  SD    B MET A 1 103 ? 55.020 2.899   -7.472  0.56 13.61  ? 100  MET A SD    1 
ATOM   821  C  CE    A MET A 1 103 ? 53.630 3.212   -5.988  0.44 12.72  ? 100  MET A CE    1 
ATOM   822  C  CE    B MET A 1 103 ? 54.073 2.938   -5.938  0.56 13.12  ? 100  MET A CE    1 
ATOM   823  N  N     . GLU A 1 104 ? 57.548 6.460   -10.950 1.00 12.90  ? 101  GLU A N     1 
ATOM   824  C  CA    . GLU A 1 104 ? 58.264 6.758   -12.189 1.00 17.41  ? 101  GLU A CA    1 
ATOM   825  C  C     . GLU A 1 104 ? 59.783 6.567   -12.020 1.00 13.16  ? 101  GLU A C     1 
ATOM   826  O  O     . GLU A 1 104 ? 60.459 6.075   -12.936 1.00 16.70  ? 101  GLU A O     1 
ATOM   827  C  CB    . GLU A 1 104 ? 57.911 8.176   -12.682 1.00 19.30  ? 101  GLU A CB    1 
ATOM   828  C  CG    . GLU A 1 104 ? 56.462 8.235   -13.187 1.00 20.31  ? 101  GLU A CG    1 
ATOM   829  C  CD    . GLU A 1 104 ? 56.063 9.547   -13.867 1.00 33.27  ? 101  GLU A CD    1 
ATOM   830  O  OE1   . GLU A 1 104 ? 56.737 10.582  -13.666 1.00 30.44  ? 101  GLU A OE1   1 
ATOM   831  O  OE2   . GLU A 1 104 ? 55.050 9.530   -14.602 1.00 33.23  ? 101  GLU A OE2   1 
ATOM   832  N  N     . ILE A 1 105 ? 60.312 6.907   -10.846 1.00 12.56  ? 102  ILE A N     1 
ATOM   833  C  CA    . ILE A 1 105 ? 61.730 6.669   -10.558 1.00 12.09  ? 102  ILE A CA    1 
ATOM   834  C  C     . ILE A 1 105 ? 62.032 5.180   -10.518 1.00 14.32  ? 102  ILE A C     1 
ATOM   835  O  O     . ILE A 1 105 ? 62.984 4.700   -11.147 1.00 14.06  ? 102  ILE A O     1 
ATOM   836  C  CB    . ILE A 1 105 ? 62.126 7.326   -9.234  1.00 10.74  ? 102  ILE A CB    1 
ATOM   837  C  CG1   . ILE A 1 105 ? 62.009 8.843   -9.363  1.00 10.97  ? 102  ILE A CG1   1 
ATOM   838  C  CG2   . ILE A 1 105 ? 63.544 6.945   -8.828  1.00 15.41  ? 102  ILE A CG2   1 
ATOM   839  C  CD1   . ILE A 1 105 ? 62.000 9.550   -8.028  1.00 13.74  ? 102  ILE A CD1   1 
ATOM   840  N  N     . MET A 1 106 ? 61.192 4.433   -9.820  1.00 13.21  ? 103  MET A N     1 
ATOM   841  C  CA    . MET A 1 106 ? 61.404 2.994   -9.741  1.00 13.10  ? 103  MET A CA    1 
ATOM   842  C  C     . MET A 1 106 ? 61.376 2.347   -11.126 1.00 15.81  ? 103  MET A C     1 
ATOM   843  O  O     . MET A 1 106 ? 62.137 1.422   -11.394 1.00 16.18  ? 103  MET A O     1 
ATOM   844  C  CB    . MET A 1 106 ? 60.356 2.354   -8.829  1.00 12.44  ? 103  MET A CB    1 
ATOM   845  C  CG    A MET A 1 106 ? 60.658 2.531   -7.353  0.45 12.88  ? 103  MET A CG    1 
ATOM   846  C  CG    B MET A 1 106 ? 60.513 2.703   -7.360  0.55 13.03  ? 103  MET A CG    1 
ATOM   847  S  SD    A MET A 1 106 ? 59.466 1.621   -6.351  0.45 14.73  ? 103  MET A SD    1 
ATOM   848  S  SD    B MET A 1 106 ? 59.282 1.850   -6.343  0.55 15.97  ? 103  MET A SD    1 
ATOM   849  C  CE    A MET A 1 106 ? 57.988 2.587   -6.648  0.45 18.84  ? 103  MET A CE    1 
ATOM   850  C  CE    B MET A 1 106 ? 59.691 0.138   -6.661  0.55 14.56  ? 103  MET A CE    1 
ATOM   851  N  N     . SER A 1 107 ? 60.519 2.855   -12.008 1.00 12.45  ? 104  SER A N     1 
ATOM   852  C  CA    . SER A 1 107 ? 60.369 2.275   -13.336 1.00 12.76  ? 104  SER A CA    1 
ATOM   853  C  C     . SER A 1 107 ? 61.613 2.439   -14.211 1.00 18.39  ? 104  SER A C     1 
ATOM   854  O  O     . SER A 1 107 ? 61.714 1.786   -15.249 1.00 16.55  ? 104  SER A O     1 
ATOM   855  C  CB    . SER A 1 107 ? 59.156 2.887   -14.044 1.00 17.02  ? 104  SER A CB    1 
ATOM   856  O  OG    . SER A 1 107 ? 57.974 2.631   -13.310 1.00 24.77  ? 104  SER A OG    1 
ATOM   857  N  N     . ARG A 1 108 ? 62.551 3.296   -13.802 1.00 16.37  ? 105  ARG A N     1 
ATOM   858  C  CA    . ARG A 1 108 ? 63.806 3.454   -14.556 1.00 17.62  ? 105  ARG A CA    1 
ATOM   859  C  C     . ARG A 1 108 ? 64.720 2.247   -14.353 1.00 19.22  ? 105  ARG A C     1 
ATOM   860  O  O     . ARG A 1 108 ? 65.614 1.991   -15.160 1.00 20.92  ? 105  ARG A O     1 
ATOM   861  C  CB    . ARG A 1 108 ? 64.571 4.723   -14.148 1.00 18.79  ? 105  ARG A CB    1 
ATOM   862  C  CG    . ARG A 1 108 ? 63.818 6.045   -14.228 1.00 16.94  ? 105  ARG A CG    1 
ATOM   863  C  CD    . ARG A 1 108 ? 64.787 7.218   -14.444 1.00 19.15  ? 105  ARG A CD    1 
ATOM   864  N  NE    . ARG A 1 108 ? 65.799 7.341   -13.394 1.00 24.89  ? 105  ARG A NE    1 
ATOM   865  C  CZ    . ARG A 1 108 ? 65.734 8.203   -12.380 1.00 19.36  ? 105  ARG A CZ    1 
ATOM   866  N  NH1   . ARG A 1 108 ? 66.702 8.242   -11.475 1.00 23.94  ? 105  ARG A NH1   1 
ATOM   867  N  NH2   . ARG A 1 108 ? 64.705 9.030   -12.282 1.00 20.67  ? 105  ARG A NH2   1 
ATOM   868  N  N     . PHE A 1 109 ? 64.509 1.509   -13.267 1.00 19.57  ? 106  PHE A N     1 
ATOM   869  C  CA    . PHE A 1 109 ? 65.360 0.362   -12.960 1.00 20.05  ? 106  PHE A CA    1 
ATOM   870  C  C     . PHE A 1 109 ? 64.784 -0.941  -13.495 1.00 22.72  ? 106  PHE A C     1 
ATOM   871  O  O     . PHE A 1 109 ? 65.528 -1.821  -13.944 1.00 26.57  ? 106  PHE A O     1 
ATOM   872  C  CB    . PHE A 1 109 ? 65.583 0.259   -11.446 1.00 16.55  ? 106  PHE A CB    1 
ATOM   873  C  CG    . PHE A 1 109 ? 66.344 1.421   -10.872 1.00 19.79  ? 106  PHE A CG    1 
ATOM   874  C  CD1   . PHE A 1 109 ? 65.707 2.627   -10.612 1.00 17.18  ? 106  PHE A CD1   1 
ATOM   875  C  CD2   . PHE A 1 109 ? 67.704 1.316   -10.608 1.00 16.37  ? 106  PHE A CD2   1 
ATOM   876  C  CE1   . PHE A 1 109 ? 66.398 3.708   -10.095 1.00 19.53  ? 106  PHE A CE1   1 
ATOM   877  C  CE2   . PHE A 1 109 ? 68.402 2.389   -10.082 1.00 20.64  ? 106  PHE A CE2   1 
ATOM   878  C  CZ    . PHE A 1 109 ? 67.758 3.589   -9.827  1.00 21.87  ? 106  PHE A CZ    1 
ATOM   879  N  N     . ALA A 1 110 ? 63.461 -1.059  -13.449 1.00 19.00  ? 107  ALA A N     1 
ATOM   880  C  CA    . ALA A 1 110 ? 62.769 -2.262  -13.894 1.00 20.34  ? 107  ALA A CA    1 
ATOM   881  C  C     . ALA A 1 110 ? 61.268 -2.030  -14.028 1.00 21.37  ? 107  ALA A C     1 
ATOM   882  O  O     . ALA A 1 110 ? 60.732 -1.032  -13.544 1.00 20.00  ? 107  ALA A O     1 
ATOM   883  C  CB    . ALA A 1 110 ? 63.033 -3.409  -12.943 1.00 22.78  ? 107  ALA A CB    1 
ATOM   884  N  N     . VAL A 1 111 ? 60.599 -2.955  -14.702 1.00 20.12  ? 108  VAL A N     1 
ATOM   885  C  CA    . VAL A 1 111 ? 59.149 -2.955  -14.778 1.00 16.88  ? 108  VAL A CA    1 
ATOM   886  C  C     . VAL A 1 111 ? 58.610 -3.181  -13.353 1.00 22.30  ? 108  VAL A C     1 
ATOM   887  O  O     . VAL A 1 111 ? 59.112 -4.036  -12.625 1.00 21.48  ? 108  VAL A O     1 
ATOM   888  C  CB    . VAL A 1 111 ? 58.636 -4.041  -15.758 1.00 34.27  ? 108  VAL A CB    1 
ATOM   889  C  CG1   . VAL A 1 111 ? 57.642 -4.985  -15.087 1.00 34.31  ? 108  VAL A CG1   1 
ATOM   890  C  CG2   . VAL A 1 111 ? 58.025 -3.394  -16.996 1.00 41.62  ? 108  VAL A CG2   1 
ATOM   891  N  N     . ILE A 1 112 ? 57.623 -2.391  -12.943 1.00 20.58  ? 109  ILE A N     1 
ATOM   892  C  CA    . ILE A 1 112 ? 57.123 -2.526  -11.573 1.00 21.57  ? 109  ILE A CA    1 
ATOM   893  C  C     . ILE A 1 112 ? 55.664 -2.941  -11.497 1.00 16.85  ? 109  ILE A C     1 
ATOM   894  O  O     . ILE A 1 112 ? 54.884 -2.745  -12.438 1.00 19.20  ? 109  ILE A O     1 
ATOM   895  C  CB    . ILE A 1 112 ? 57.296 -1.211  -10.764 1.00 18.91  ? 109  ILE A CB    1 
ATOM   896  C  CG1   . ILE A 1 112 ? 56.295 -0.147  -11.220 1.00 22.25  ? 109  ILE A CG1   1 
ATOM   897  C  CG2   . ILE A 1 112 ? 58.748 -0.733  -10.824 1.00 22.23  ? 109  ILE A CG2   1 
ATOM   898  C  CD1   . ILE A 1 112 ? 56.313 1.126   -10.362 1.00 20.37  ? 109  ILE A CD1   1 
ATOM   899  N  N     . GLU A 1 113 ? 55.303 -3.525  -10.361 1.00 10.24  ? 110  GLU A N     1 
ATOM   900  C  CA    . GLU A 1 113 ? 53.899 -3.744  -10.040 1.00 10.64  ? 110  GLU A CA    1 
ATOM   901  C  C     . GLU A 1 113 ? 53.480 -2.793  -8.923  1.00 14.10  ? 110  GLU A C     1 
ATOM   902  O  O     . GLU A 1 113 ? 53.940 -2.920  -7.801  1.00 11.89  ? 110  GLU A O     1 
ATOM   903  C  CB    . GLU A 1 113 ? 53.640 -5.202  -9.617  1.00 10.88  ? 110  GLU A CB    1 
ATOM   904  C  CG    . GLU A 1 113 ? 52.192 -5.422  -9.186  1.00 14.90  ? 110  GLU A CG    1 
ATOM   905  C  CD    . GLU A 1 113 ? 51.881 -6.860  -8.769  1.00 17.05  ? 110  GLU A CD    1 
ATOM   906  O  OE1   . GLU A 1 113 ? 50.783 -7.085  -8.209  1.00 21.63  ? 110  GLU A OE1   1 
ATOM   907  O  OE2   . GLU A 1 113 ? 52.705 -7.771  -9.011  1.00 16.31  ? 110  GLU A OE2   1 
ATOM   908  N  N     . ARG A 1 114 ? 52.625 -1.827  -9.236  1.00 12.66  ? 111  ARG A N     1 
ATOM   909  C  CA    . ARG A 1 114 ? 52.069 -0.959  -8.192  1.00 13.02  ? 111  ARG A CA    1 
ATOM   910  C  C     . ARG A 1 114 ? 51.166 -1.790  -7.293  1.00 13.14  ? 111  ARG A C     1 
ATOM   911  O  O     . ARG A 1 114 ? 50.174 -2.354  -7.757  1.00 18.59  ? 111  ARG A O     1 
ATOM   912  C  CB    . ARG A 1 114 ? 51.286 0.206   -8.804  1.00 16.06  ? 111  ARG A CB    1 
ATOM   913  C  CG    . ARG A 1 114 ? 50.659 1.172   -7.773  1.00 14.34  ? 111  ARG A CG    1 
ATOM   914  C  CD    . ARG A 1 114 ? 49.538 1.986   -8.430  1.00 13.56  ? 111  ARG A CD    1 
ATOM   915  N  NE    . ARG A 1 114 ? 49.199 3.213   -7.704  1.00 15.57  ? 111  ARG A NE    1 
ATOM   916  C  CZ    . ARG A 1 114 ? 48.245 3.323   -6.782  1.00 19.46  ? 111  ARG A CZ    1 
ATOM   917  N  NH1   . ARG A 1 114 ? 47.515 2.268   -6.425  1.00 22.77  ? 111  ARG A NH1   1 
ATOM   918  N  NH2   . ARG A 1 114 ? 48.027 4.503   -6.213  1.00 19.23  ? 111  ARG A NH2   1 
ATOM   919  N  N     . ALA A 1 115 ? 51.520 -1.896  -6.016  1.00 10.34  ? 112  ALA A N     1 
ATOM   920  C  CA    . ALA A 1 115 ? 50.789 -2.761  -5.110  1.00 9.47   ? 112  ALA A CA    1 
ATOM   921  C  C     . ALA A 1 115 ? 49.942 -1.969  -4.121  1.00 11.37  ? 112  ALA A C     1 
ATOM   922  O  O     . ALA A 1 115 ? 49.062 -2.532  -3.475  1.00 12.53  ? 112  ALA A O     1 
ATOM   923  C  CB    . ALA A 1 115 ? 51.748 -3.651  -4.364  1.00 10.53  ? 112  ALA A CB    1 
ATOM   924  N  N     . SER A 1 116 ? 50.246 -0.682  -3.984  1.00 12.02  ? 113  SER A N     1 
ATOM   925  C  CA    . SER A 1 116 ? 49.442 0.255   -3.185  1.00 12.33  ? 113  SER A CA    1 
ATOM   926  C  C     . SER A 1 116 ? 49.840 1.671   -3.551  1.00 11.94  ? 113  SER A C     1 
ATOM   927  O  O     . SER A 1 116 ? 50.712 1.870   -4.390  1.00 10.98  ? 113  SER A O     1 
ATOM   928  C  CB    . SER A 1 116 ? 49.646 0.058   -1.675  1.00 12.53  ? 113  SER A CB    1 
ATOM   929  O  OG    . SER A 1 116 ? 50.845 0.701   -1.255  1.00 12.61  ? 113  SER A OG    1 
ATOM   930  N  N     . ILE A 1 117 ? 49.249 2.662   -2.894  1.00 12.03  ? 114  ILE A N     1 
ATOM   931  C  CA    . ILE A 1 117 ? 49.640 4.041   -3.152  1.00 8.65   ? 114  ILE A CA    1 
ATOM   932  C  C     . ILE A 1 117 ? 51.123 4.296   -2.789  1.00 13.50  ? 114  ILE A C     1 
ATOM   933  O  O     . ILE A 1 117 ? 51.741 5.217   -3.324  1.00 12.30  ? 114  ILE A O     1 
ATOM   934  C  CB    . ILE A 1 117 ? 48.713 5.015   -2.384  1.00 10.30  ? 114  ILE A CB    1 
ATOM   935  C  CG1   . ILE A 1 117 ? 48.759 6.417   -2.990  1.00 11.38  ? 114  ILE A CG1   1 
ATOM   936  C  CG2   . ILE A 1 117 ? 49.074 5.063   -0.906  1.00 10.33  ? 114  ILE A CG2   1 
ATOM   937  C  CD1   . ILE A 1 117 ? 47.624 7.309   -2.498  1.00 10.29  ? 114  ILE A CD1   1 
ATOM   938  N  N     . ASP A 1 118 ? 51.715 3.475   -1.914  1.00 10.00  ? 115  ASP A N     1 
ATOM   939  C  CA    . ASP A 1 118 ? 53.081 3.781   -1.480  1.00 10.45  ? 115  ASP A CA    1 
ATOM   940  C  C     . ASP A 1 118 ? 54.070 2.623   -1.636  1.00 9.59   ? 115  ASP A C     1 
ATOM   941  O  O     . ASP A 1 118 ? 55.133 2.641   -1.011  1.00 10.73  ? 115  ASP A O     1 
ATOM   942  C  CB    . ASP A 1 118 ? 53.085 4.253   -0.023  1.00 11.00  ? 115  ASP A CB    1 
ATOM   943  C  CG    . ASP A 1 118 ? 53.259 3.115   0.987   1.00 10.11  ? 115  ASP A CG    1 
ATOM   944  O  OD1   . ASP A 1 118 ? 52.647 2.028   0.848   1.00 10.20  ? 115  ASP A OD1   1 
ATOM   945  O  OD2   . ASP A 1 118 ? 54.035 3.339   1.944   1.00 10.25  ? 115  ASP A OD2   1 
ATOM   946  N  N     . GLU A 1 119 ? 53.741 1.620   -2.450  1.00 8.90   ? 116  GLU A N     1 
ATOM   947  C  CA    . GLU A 1 119 ? 54.681 0.519   -2.610  1.00 9.73   ? 116  GLU A CA    1 
ATOM   948  C  C     . GLU A 1 119 ? 54.553 -0.195  -3.937  1.00 11.63  ? 116  GLU A C     1 
ATOM   949  O  O     . GLU A 1 119 ? 53.484 -0.195  -4.572  1.00 13.37  ? 116  GLU A O     1 
ATOM   950  C  CB    . GLU A 1 119 ? 54.528 -0.509  -1.484  1.00 9.80   ? 116  GLU A CB    1 
ATOM   951  C  CG    . GLU A 1 119 ? 53.311 -1.416  -1.589  1.00 8.95   ? 116  GLU A CG    1 
ATOM   952  C  CD    . GLU A 1 119 ? 52.831 -1.855  -0.223  1.00 14.26  ? 116  GLU A CD    1 
ATOM   953  O  OE1   . GLU A 1 119 ? 53.153 -2.986  0.200   1.00 15.96  ? 116  GLU A OE1   1 
ATOM   954  O  OE2   . GLU A 1 119 ? 52.170 -1.037  0.443   1.00 13.28  ? 116  GLU A OE2   1 
ATOM   955  N  N     . ALA A 1 120 ? 55.671 -0.776  -4.359  1.00 9.78   ? 117  ALA A N     1 
ATOM   956  C  CA    . ALA A 1 120 ? 55.708 -1.505  -5.618  1.00 10.58  ? 117  ALA A CA    1 
ATOM   957  C  C     . ALA A 1 120 ? 56.669 -2.664  -5.548  1.00 12.58  ? 117  ALA A C     1 
ATOM   958  O  O     . ALA A 1 120 ? 57.702 -2.573  -4.888  1.00 12.14  ? 117  ALA A O     1 
ATOM   959  C  CB    . ALA A 1 120 ? 56.103 -0.574  -6.776  1.00 12.96  ? 117  ALA A CB    1 
ATOM   960  N  N     . TYR A 1 121 ? 56.334 -3.749  -6.244  1.00 12.51  ? 118  TYR A N     1 
ATOM   961  C  CA    . TYR A 1 121 ? 57.280 -4.836  -6.434  1.00 10.68  ? 118  TYR A CA    1 
ATOM   962  C  C     . TYR A 1 121 ? 58.084 -4.630  -7.692  1.00 12.85  ? 118  TYR A C     1 
ATOM   963  O  O     . TYR A 1 121 ? 57.619 -4.009  -8.654  1.00 17.04  ? 118  TYR A O     1 
ATOM   964  C  CB    . TYR A 1 121 ? 56.563 -6.192  -6.494  1.00 11.06  ? 118  TYR A CB    1 
ATOM   965  C  CG    . TYR A 1 121 ? 55.851 -6.544  -5.224  1.00 10.74  ? 118  TYR A CG    1 
ATOM   966  C  CD1   . TYR A 1 121 ? 54.526 -6.176  -5.023  1.00 11.78  ? 118  TYR A CD1   1 
ATOM   967  C  CD2   . TYR A 1 121 ? 56.495 -7.253  -4.230  1.00 11.10  ? 118  TYR A CD2   1 
ATOM   968  C  CE1   . TYR A 1 121 ? 53.861 -6.498  -3.849  1.00 11.82  ? 118  TYR A CE1   1 
ATOM   969  C  CE2   . TYR A 1 121 ? 55.837 -7.591  -3.053  1.00 9.80   ? 118  TYR A CE2   1 
ATOM   970  C  CZ    . TYR A 1 121 ? 54.524 -7.196  -2.867  1.00 12.83  ? 118  TYR A CZ    1 
ATOM   971  O  OH    . TYR A 1 121 ? 53.866 -7.527  -1.712  1.00 13.72  ? 118  TYR A OH    1 
ATOM   972  N  N     . VAL A 1 122 ? 59.294 -5.186  -7.673  1.00 12.96  ? 119  VAL A N     1 
ATOM   973  C  CA    . VAL A 1 122 ? 60.240 -5.118  -8.768  1.00 14.14  ? 119  VAL A CA    1 
ATOM   974  C  C     . VAL A 1 122 ? 60.800 -6.510  -8.994  1.00 16.47  ? 119  VAL A C     1 
ATOM   975  O  O     . VAL A 1 122 ? 61.239 -7.135  -8.041  1.00 14.35  ? 119  VAL A O     1 
ATOM   976  C  CB    . VAL A 1 122 ? 61.419 -4.171  -8.433  1.00 19.91  ? 119  VAL A CB    1 
ATOM   977  C  CG1   . VAL A 1 122 ? 61.941 -3.525  -9.678  1.00 29.17  ? 119  VAL A CG1   1 
ATOM   978  C  CG2   . VAL A 1 122 ? 61.005 -3.119  -7.406  1.00 28.66  ? 119  VAL A CG2   1 
ATOM   979  N  N     . ASP A 1 123 ? 60.779 -7.012  -10.227 1.00 15.84  ? 120  ASP A N     1 
ATOM   980  C  CA    . ASP A 1 123 ? 61.544 -8.211  -10.560 1.00 13.73  ? 120  ASP A CA    1 
ATOM   981  C  C     . ASP A 1 123 ? 62.910 -7.791  -11.091 1.00 13.83  ? 120  ASP A C     1 
ATOM   982  O  O     . ASP A 1 123 ? 63.040 -7.310  -12.217 1.00 17.56  ? 120  ASP A O     1 
ATOM   983  C  CB    . ASP A 1 123 ? 60.801 -9.091  -11.573 1.00 19.63  ? 120  ASP A CB    1 
ATOM   984  C  CG    . ASP A 1 123 ? 61.467 -10.444 -11.775 1.00 21.91  ? 120  ASP A CG    1 
ATOM   985  O  OD1   . ASP A 1 123 ? 62.689 -10.467 -11.974 1.00 21.28  ? 120  ASP A OD1   1 
ATOM   986  O  OD2   . ASP A 1 123 ? 60.775 -11.490 -11.720 1.00 22.12  ? 120  ASP A OD2   1 
ATOM   987  N  N     . LEU A 1 124 ? 63.926 -7.986  -10.261 1.00 14.62  ? 121  LEU A N     1 
ATOM   988  C  CA    . LEU A 1 124 ? 65.287 -7.570  -10.569 1.00 14.02  ? 121  LEU A CA    1 
ATOM   989  C  C     . LEU A 1 124 ? 66.142 -8.671  -11.189 1.00 14.04  ? 121  LEU A C     1 
ATOM   990  O  O     . LEU A 1 124 ? 67.349 -8.481  -11.341 1.00 13.69  ? 121  LEU A O     1 
ATOM   991  C  CB    . LEU A 1 124 ? 65.974 -7.061  -9.297  1.00 14.83  ? 121  LEU A CB    1 
ATOM   992  C  CG    . LEU A 1 124 ? 65.345 -5.803  -8.712  1.00 15.65  ? 121  LEU A CG    1 
ATOM   993  C  CD1   . LEU A 1 124 ? 65.929 -5.486  -7.348  1.00 19.17  ? 121  LEU A CD1   1 
ATOM   994  C  CD2   . LEU A 1 124 ? 65.522 -4.635  -9.674  1.00 16.77  ? 121  LEU A CD2   1 
ATOM   995  N  N     . THR A 1 125 ? 65.535 -9.816  -11.511 1.00 13.29  ? 122  THR A N     1 
ATOM   996  C  CA    . THR A 1 125 ? 66.299 -10.960 -12.005 1.00 13.16  ? 122  THR A CA    1 
ATOM   997  C  C     . THR A 1 125 ? 67.190 -10.577 -13.193 1.00 16.94  ? 122  THR A C     1 
ATOM   998  O  O     . THR A 1 125 ? 68.381 -10.882 -13.186 1.00 16.86  ? 122  THR A O     1 
ATOM   999  C  CB    . THR A 1 125 ? 65.379 -12.123 -12.421 1.00 18.20  ? 122  THR A CB    1 
ATOM   1000 O  OG1   . THR A 1 125 ? 64.483 -12.431 -11.347 1.00 16.79  ? 122  THR A OG1   1 
ATOM   1001 C  CG2   . THR A 1 125 ? 66.189 -13.360 -12.755 1.00 18.83  ? 122  THR A CG2   1 
ATOM   1002 N  N     . SER A 1 126 ? 66.611 -9.908  -14.189 1.00 16.14  ? 123  SER A N     1 
ATOM   1003 C  CA    . SER A 1 126 ? 67.363 -9.537  -15.395 1.00 19.34  ? 123  SER A CA    1 
ATOM   1004 C  C     A SER A 1 126 ? 68.446 -8.510  -15.086 0.43 19.48  ? 123  SER A C     1 
ATOM   1005 C  C     B SER A 1 126 ? 68.446 -8.510  -15.086 0.57 18.87  ? 123  SER A C     1 
ATOM   1006 O  O     . SER A 1 126 ? 69.588 -8.653  -15.528 1.00 22.20  ? 123  SER A O     1 
ATOM   1007 C  CB    . SER A 1 126 ? 66.428 -8.995  -16.482 1.00 19.89  ? 123  SER A CB    1 
ATOM   1008 O  OG    A SER A 1 126 ? 65.577 -10.010 -16.980 0.43 21.58  ? 123  SER A OG    1 
ATOM   1009 O  OG    B SER A 1 126 ? 65.767 -7.818  -16.063 0.57 23.99  ? 123  SER A OG    1 
ATOM   1010 N  N     . ALA A 1 127 ? 68.087 -7.477  -14.329 1.00 18.56  ? 124  ALA A N     1 
ATOM   1011 C  CA    . ALA A 1 127 ? 69.039 -6.440  -13.939 1.00 20.40  ? 124  ALA A CA    1 
ATOM   1012 C  C     . ALA A 1 127 ? 70.197 -7.016  -13.122 1.00 18.48  ? 124  ALA A C     1 
ATOM   1013 O  O     . ALA A 1 127 ? 71.338 -6.560  -13.227 1.00 21.58  ? 124  ALA A O     1 
ATOM   1014 C  CB    . ALA A 1 127 ? 68.336 -5.331  -13.149 1.00 19.92  ? 124  ALA A CB    1 
ATOM   1015 N  N     . VAL A 1 128 ? 69.906 -8.016  -12.295 1.00 18.76  ? 125  VAL A N     1 
ATOM   1016 C  CA    . VAL A 1 128 ? 70.956 -8.657  -11.527 1.00 18.74  ? 125  VAL A CA    1 
ATOM   1017 C  C     . VAL A 1 128 ? 71.949 -9.384  -12.436 1.00 18.37  ? 125  VAL A C     1 
ATOM   1018 O  O     . VAL A 1 128 ? 73.162 -9.283  -12.239 1.00 20.92  ? 125  VAL A O     1 
ATOM   1019 C  CB    . VAL A 1 128 ? 70.364 -9.638  -10.502 1.00 15.72  ? 125  VAL A CB    1 
ATOM   1020 C  CG1   . VAL A 1 128 ? 71.398 -10.651 -10.059 1.00 16.29  ? 125  VAL A CG1   1 
ATOM   1021 C  CG2   . VAL A 1 128 ? 69.822 -8.866  -9.308  1.00 15.61  ? 125  VAL A CG2   1 
ATOM   1022 N  N     . GLN A 1 129 ? 71.434 -10.106 -13.431 1.00 19.02  ? 126  GLN A N     1 
ATOM   1023 C  CA    . GLN A 1 129 ? 72.303 -10.809 -14.368 1.00 28.33  ? 126  GLN A CA    1 
ATOM   1024 C  C     . GLN A 1 129 ? 73.259 -9.852  -15.064 1.00 29.43  ? 126  GLN A C     1 
ATOM   1025 O  O     . GLN A 1 129 ? 74.443 -10.144 -15.193 1.00 29.17  ? 126  GLN A O     1 
ATOM   1026 C  CB    . GLN A 1 129 ? 71.483 -11.576 -15.404 1.00 25.72  ? 126  GLN A CB    1 
ATOM   1027 C  CG    . GLN A 1 129 ? 70.800 -12.815 -14.851 1.00 32.19  ? 126  GLN A CG    1 
ATOM   1028 C  CD    . GLN A 1 129 ? 71.761 -13.716 -14.101 1.00 35.86  ? 126  GLN A CD    1 
ATOM   1029 O  OE1   . GLN A 1 129 ? 71.530 -14.065 -12.943 1.00 36.07  ? 126  GLN A OE1   1 
ATOM   1030 N  NE2   . GLN A 1 129 ? 72.856 -14.090 -14.756 1.00 45.80  ? 126  GLN A NE2   1 
ATOM   1031 N  N     . GLU A 1 130 ? 72.757 -8.699  -15.495 1.00 30.55  ? 127  GLU A N     1 
ATOM   1032 C  CA    . GLU A 1 130 ? 73.621 -7.764  -16.216 1.00 34.64  ? 127  GLU A CA    1 
ATOM   1033 C  C     . GLU A 1 130 ? 74.637 -7.095  -15.293 1.00 33.59  ? 127  GLU A C     1 
ATOM   1034 O  O     . GLU A 1 130 ? 75.782 -6.863  -15.686 1.00 32.33  ? 127  GLU A O     1 
ATOM   1035 C  CB    . GLU A 1 130 ? 72.792 -6.713  -16.950 1.00 39.14  ? 127  GLU A CB    1 
ATOM   1036 C  CG    . GLU A 1 130 ? 71.487 -7.253  -17.487 1.00 46.47  ? 127  GLU A CG    1 
ATOM   1037 C  CD    . GLU A 1 130 ? 70.875 -6.372  -18.555 1.00 65.87  ? 127  GLU A CD    1 
ATOM   1038 O  OE1   . GLU A 1 130 ? 71.171 -5.157  -18.575 1.00 67.85  ? 127  GLU A OE1   1 
ATOM   1039 O  OE2   . GLU A 1 130 ? 70.105 -6.908  -19.384 1.00 70.12  ? 127  GLU A OE2   1 
ATOM   1040 N  N     . ARG A 1 131 ? 74.237 -6.805  -14.060 1.00 27.92  ? 128  ARG A N     1 
ATOM   1041 C  CA    . ARG A 1 131 ? 75.175 -6.218  -13.116 1.00 28.50  ? 128  ARG A CA    1 
ATOM   1042 C  C     . ARG A 1 131 ? 76.262 -7.234  -12.783 1.00 31.94  ? 128  ARG A C     1 
ATOM   1043 O  O     . ARG A 1 131 ? 77.424 -6.873  -12.585 1.00 36.14  ? 128  ARG A O     1 
ATOM   1044 C  CB    . ARG A 1 131 ? 74.462 -5.755  -11.846 1.00 21.98  ? 128  ARG A CB    1 
ATOM   1045 C  CG    A ARG A 1 131 ? 75.349 -5.034  -10.838 0.47 27.40  ? 128  ARG A CG    1 
ATOM   1046 C  CG    B ARG A 1 131 ? 75.404 -5.121  -10.835 0.53 27.55  ? 128  ARG A CG    1 
ATOM   1047 C  CD    A ARG A 1 131 ? 75.944 -3.757  -11.412 0.47 25.98  ? 128  ARG A CD    1 
ATOM   1048 C  CD    B ARG A 1 131 ? 75.979 -3.828  -11.382 0.53 26.02  ? 128  ARG A CD    1 
ATOM   1049 N  NE    A ARG A 1 131 ? 76.568 -2.935  -10.378 0.47 25.94  ? 128  ARG A NE    1 
ATOM   1050 N  NE    B ARG A 1 131 ? 74.896 -2.915  -11.716 0.53 24.36  ? 128  ARG A NE    1 
ATOM   1051 C  CZ    A ARG A 1 131 ? 75.912 -2.026  -9.660  0.47 20.64  ? 128  ARG A CZ    1 
ATOM   1052 C  CZ    B ARG A 1 131 ? 74.333 -2.089  -10.842 0.53 26.67  ? 128  ARG A CZ    1 
ATOM   1053 N  NH1   A ARG A 1 131 ? 76.546 -1.313  -8.737  0.47 22.40  ? 128  ARG A NH1   1 
ATOM   1054 N  NH1   B ARG A 1 131 ? 73.337 -1.298  -11.218 0.53 30.24  ? 128  ARG A NH1   1 
ATOM   1055 N  NH2   A ARG A 1 131 ? 74.618 -1.831  -9.870  0.47 25.25  ? 128  ARG A NH2   1 
ATOM   1056 N  NH2   B ARG A 1 131 ? 74.779 -2.047  -9.596  0.53 25.17  ? 128  ARG A NH2   1 
ATOM   1057 N  N     . LEU A 1 132 ? 75.880 -8.508  -12.747 1.00 28.20  ? 129  LEU A N     1 
ATOM   1058 C  CA    . LEU A 1 132 ? 76.826 -9.586  -12.474 1.00 28.37  ? 129  LEU A CA    1 
ATOM   1059 C  C     . LEU A 1 132 ? 77.858 -9.713  -13.590 1.00 42.05  ? 129  LEU A C     1 
ATOM   1060 O  O     . LEU A 1 132 ? 79.026 -10.007 -13.337 1.00 38.33  ? 129  LEU A O     1 
ATOM   1061 C  CB    . LEU A 1 132 ? 76.090 -10.917 -12.290 1.00 29.16  ? 129  LEU A CB    1 
ATOM   1062 C  CG    . LEU A 1 132 ? 75.637 -11.224 -10.860 1.00 25.91  ? 129  LEU A CG    1 
ATOM   1063 C  CD1   . LEU A 1 132 ? 74.697 -12.413 -10.834 1.00 19.99  ? 129  LEU A CD1   1 
ATOM   1064 C  CD2   . LEU A 1 132 ? 76.836 -11.463 -9.952  1.00 24.03  ? 129  LEU A CD2   1 
ATOM   1065 N  N     . GLN A 1 133 ? 77.424 -9.489  -14.825 1.00 40.49  ? 130  GLN A N     1 
ATOM   1066 C  CA    . GLN A 1 133 ? 78.301 -9.692  -15.969 1.00 48.83  ? 130  GLN A CA    1 
ATOM   1067 C  C     . GLN A 1 133 ? 79.349 -8.584  -16.068 1.00 54.74  ? 130  GLN A C     1 
ATOM   1068 O  O     . GLN A 1 133 ? 80.471 -8.825  -16.513 1.00 63.92  ? 130  GLN A O     1 
ATOM   1069 C  CB    . GLN A 1 133 ? 77.481 -9.789  -17.260 1.00 55.28  ? 130  GLN A CB    1 
ATOM   1070 C  CG    . GLN A 1 133 ? 78.307 -9.817  -18.541 1.00 69.31  ? 130  GLN A CG    1 
ATOM   1071 C  CD    . GLN A 1 133 ? 78.136 -8.561  -19.374 1.00 74.40  ? 130  GLN A CD    1 
ATOM   1072 O  OE1   . GLN A 1 133 ? 77.029 -8.035  -19.497 1.00 77.72  ? 130  GLN A OE1   1 
ATOM   1073 N  NE2   . GLN A 1 133 ? 79.231 -8.073  -19.949 1.00 75.18  ? 130  GLN A NE2   1 
ATOM   1074 N  N     . LYS A 1 134 ? 79.003 -7.377  -15.632 1.00 53.73  ? 131  LYS A N     1 
ATOM   1075 C  CA    . LYS A 1 134 ? 79.960 -6.277  -15.706 1.00 62.79  ? 131  LYS A CA    1 
ATOM   1076 C  C     . LYS A 1 134 ? 80.790 -6.178  -14.427 1.00 64.20  ? 131  LYS A C     1 
ATOM   1077 O  O     . LYS A 1 134 ? 81.775 -5.440  -14.373 1.00 69.50  ? 131  LYS A O     1 
ATOM   1078 C  CB    . LYS A 1 134 ? 79.248 -4.951  -15.999 1.00 60.41  ? 131  LYS A CB    1 
ATOM   1079 C  CG    . LYS A 1 134 ? 78.796 -4.154  -14.788 1.00 54.04  ? 131  LYS A CG    1 
ATOM   1080 C  CD    . LYS A 1 134 ? 78.104 -2.870  -15.242 1.00 57.05  ? 131  LYS A CD    1 
ATOM   1081 C  CE    . LYS A 1 134 ? 77.645 -2.017  -14.067 1.00 52.05  ? 131  LYS A CE    1 
ATOM   1082 N  NZ    . LYS A 1 134 ? 76.601 -1.025  -14.462 1.00 47.82  ? 131  LYS A NZ    1 
ATOM   1083 N  N     . LEU A 1 135 ? 80.398 -6.932  -13.405 1.00 58.02  ? 132  LEU A N     1 
ATOM   1084 C  CA    . LEU A 1 135 ? 81.178 -7.001  -12.175 1.00 65.23  ? 132  LEU A CA    1 
ATOM   1085 C  C     . LEU A 1 135 ? 82.441 -7.830  -12.384 1.00 69.82  ? 132  LEU A C     1 
ATOM   1086 O  O     . LEU A 1 135 ? 83.478 -7.565  -11.771 1.00 72.09  ? 132  LEU A O     1 
ATOM   1087 C  CB    . LEU A 1 135 ? 80.344 -7.586  -11.033 1.00 60.08  ? 132  LEU A CB    1 
ATOM   1088 C  CG    . LEU A 1 135 ? 80.023 -6.631  -9.879  1.00 60.20  ? 132  LEU A CG    1 
ATOM   1089 C  CD1   . LEU A 1 135 ? 79.301 -5.393  -10.376 1.00 54.10  ? 132  LEU A CD1   1 
ATOM   1090 C  CD2   . LEU A 1 135 ? 79.207 -7.337  -8.810  1.00 56.90  ? 132  LEU A CD2   1 
ATOM   1091 N  N     . GLN A 1 136 ? 82.337 -8.834  -13.252 1.00 67.85  ? 133  GLN A N     1 
ATOM   1092 C  CA    . GLN A 1 136 ? 83.461 -9.697  -13.610 1.00 75.55  ? 133  GLN A CA    1 
ATOM   1093 C  C     . GLN A 1 136 ? 84.068 -10.415 -12.407 1.00 74.08  ? 133  GLN A C     1 
ATOM   1094 O  O     . GLN A 1 136 ? 85.280 -10.373 -12.196 1.00 79.18  ? 133  GLN A O     1 
ATOM   1095 C  CB    . GLN A 1 136 ? 84.548 -8.888  -14.326 1.00 79.81  ? 133  GLN A CB    1 
ATOM   1096 C  CG    . GLN A 1 136 ? 84.175 -8.442  -15.731 1.00 79.42  ? 133  GLN A CG    1 
ATOM   1097 C  CD    . GLN A 1 136 ? 85.254 -8.759  -16.746 1.00 85.62  ? 133  GLN A CD    1 
ATOM   1098 O  OE1   . GLN A 1 136 ? 86.390 -8.298  -16.626 1.00 90.34  ? 133  GLN A OE1   1 
ATOM   1099 N  NE2   . GLN A 1 136 ? 84.905 -9.550  -17.754 1.00 86.88  ? 133  GLN A NE2   1 
ATOM   1100 N  N     . GLY A 1 137 ? 83.222 -11.071 -11.619 1.00 67.17  ? 134  GLY A N     1 
ATOM   1101 C  CA    . GLY A 1 137 ? 83.686 -11.884 -10.507 1.00 62.73  ? 134  GLY A CA    1 
ATOM   1102 C  C     . GLY A 1 137 ? 84.301 -11.105 -9.360  1.00 65.72  ? 134  GLY A C     1 
ATOM   1103 O  O     . GLY A 1 137 ? 84.848 -11.688 -8.425  1.00 64.70  ? 134  GLY A O     1 
ATOM   1104 N  N     . GLN A 1 138 ? 84.218 -9.781  -9.434  1.00 64.56  ? 135  GLN A N     1 
ATOM   1105 C  CA    . GLN A 1 138 ? 84.711 -8.921  -8.366  1.00 64.86  ? 135  GLN A CA    1 
ATOM   1106 C  C     . GLN A 1 138 ? 83.764 -8.985  -7.172  1.00 59.33  ? 135  GLN A C     1 
ATOM   1107 O  O     . GLN A 1 138 ? 82.550 -8.842  -7.330  1.00 57.60  ? 135  GLN A O     1 
ATOM   1108 C  CB    . GLN A 1 138 ? 84.854 -7.481  -8.862  1.00 68.04  ? 135  GLN A CB    1 
ATOM   1109 C  CG    . GLN A 1 138 ? 86.284 -6.946  -8.878  1.00 77.96  ? 135  GLN A CG    1 
ATOM   1110 C  CD    . GLN A 1 138 ? 86.793 -6.594  -7.496  1.00 81.58  ? 135  GLN A CD    1 
ATOM   1111 O  OE1   . GLN A 1 138 ? 86.028 -6.145  -6.640  1.00 79.29  ? 135  GLN A OE1   1 
ATOM   1112 N  NE2   . GLN A 1 138 ? 88.090 -6.788  -7.271  1.00 84.04  ? 135  GLN A NE2   1 
ATOM   1113 N  N     . PRO A 1 139 ? 84.320 -9.208  -5.972  1.00 55.56  ? 136  PRO A N     1 
ATOM   1114 C  CA    . PRO A 1 139 ? 83.523 -9.323  -4.747  1.00 45.30  ? 136  PRO A CA    1 
ATOM   1115 C  C     . PRO A 1 139 ? 82.684 -8.077  -4.457  1.00 45.88  ? 136  PRO A C     1 
ATOM   1116 O  O     . PRO A 1 139 ? 82.973 -6.992  -4.959  1.00 37.98  ? 136  PRO A O     1 
ATOM   1117 C  CB    . PRO A 1 139 ? 84.587 -9.533  -3.658  1.00 49.28  ? 136  PRO A CB    1 
ATOM   1118 C  CG    . PRO A 1 139 ? 85.847 -8.978  -4.232  1.00 51.87  ? 136  PRO A CG    1 
ATOM   1119 C  CD    . PRO A 1 139 ? 85.764 -9.299  -5.697  1.00 58.07  ? 136  PRO A CD    1 
ATOM   1120 N  N     . ILE A 1 140 ? 81.636 -8.240  -3.662  1.00 37.60  ? 137  ILE A N     1 
ATOM   1121 C  CA    . ILE A 1 140 ? 80.798 -7.110  -3.304  1.00 30.09  ? 137  ILE A CA    1 
ATOM   1122 C  C     . ILE A 1 140 ? 81.230 -6.528  -1.965  1.00 28.14  ? 137  ILE A C     1 
ATOM   1123 O  O     . ILE A 1 140 ? 81.259 -7.220  -0.953  1.00 31.03  ? 137  ILE A O     1 
ATOM   1124 C  CB    . ILE A 1 140 ? 79.321 -7.512  -3.256  1.00 31.97  ? 137  ILE A CB    1 
ATOM   1125 C  CG1   . ILE A 1 140 ? 78.869 -7.928  -4.658  1.00 37.12  ? 137  ILE A CG1   1 
ATOM   1126 C  CG2   . ILE A 1 140 ? 78.474 -6.367  -2.722  1.00 25.40  ? 137  ILE A CG2   1 
ATOM   1127 C  CD1   . ILE A 1 140 ? 77.449 -8.376  -4.739  1.00 36.81  ? 137  ILE A CD1   1 
ATOM   1128 N  N     . SER A 1 141 ? 81.578 -5.249  -1.982  1.00 24.02  ? 138  SER A N     1 
ATOM   1129 C  CA    . SER A 1 141 ? 82.050 -4.542  -0.795  1.00 21.97  ? 138  SER A CA    1 
ATOM   1130 C  C     . SER A 1 141 ? 80.876 -4.146  0.090   1.00 24.59  ? 138  SER A C     1 
ATOM   1131 O  O     . SER A 1 141 ? 79.790 -3.865  -0.417  1.00 23.80  ? 138  SER A O     1 
ATOM   1132 C  CB    . SER A 1 141 ? 82.865 -3.309  -1.219  1.00 22.32  ? 138  SER A CB    1 
ATOM   1133 O  OG    . SER A 1 141 ? 82.982 -2.353  -0.178  1.00 32.99  ? 138  SER A OG    1 
ATOM   1134 N  N     . ALA A 1 142 ? 81.095 -4.121  1.404   1.00 24.10  ? 139  ALA A N     1 
ATOM   1135 C  CA    . ALA A 1 142 ? 80.082 -3.664  2.349   1.00 25.50  ? 139  ALA A CA    1 
ATOM   1136 C  C     . ALA A 1 142 ? 79.660 -2.213  2.086   1.00 23.48  ? 139  ALA A C     1 
ATOM   1137 O  O     . ALA A 1 142 ? 78.555 -1.807  2.444   1.00 20.47  ? 139  ALA A O     1 
ATOM   1138 C  CB    . ALA A 1 142 ? 80.591 -3.812  3.779   1.00 24.81  ? 139  ALA A CB    1 
ATOM   1139 N  N     . ASP A 1 143 ? 80.543 -1.443  1.451   1.00 25.26  ? 140  ASP A N     1 
ATOM   1140 C  CA    . ASP A 1 143 ? 80.278 -0.043  1.143   1.00 25.94  ? 140  ASP A CA    1 
ATOM   1141 C  C     . ASP A 1 143 ? 79.165 0.120   0.120   1.00 23.22  ? 140  ASP A C     1 
ATOM   1142 O  O     . ASP A 1 143 ? 78.575 1.194   0.004   1.00 27.08  ? 140  ASP A O     1 
ATOM   1143 C  CB    . ASP A 1 143 ? 81.548 0.643   0.635   1.00 27.92  ? 140  ASP A CB    1 
ATOM   1144 C  CG    . ASP A 1 143 ? 82.585 0.823   1.721   1.00 38.90  ? 140  ASP A CG    1 
ATOM   1145 O  OD1   . ASP A 1 143 ? 82.220 0.715   2.912   1.00 34.94  ? 140  ASP A OD1   1 
ATOM   1146 O  OD2   . ASP A 1 143 ? 83.763 1.080   1.386   1.00 43.85  ? 140  ASP A OD2   1 
ATOM   1147 N  N     . LEU A 1 144 ? 78.878 -0.940  -0.627  1.00 19.17  ? 141  LEU A N     1 
ATOM   1148 C  CA    . LEU A 1 144 ? 77.793 -0.884  -1.594  1.00 20.86  ? 141  LEU A CA    1 
ATOM   1149 C  C     . LEU A 1 144 ? 76.449 -1.185  -0.938  1.00 18.37  ? 141  LEU A C     1 
ATOM   1150 O  O     . LEU A 1 144 ? 75.405 -1.003  -1.557  1.00 20.88  ? 141  LEU A O     1 
ATOM   1151 C  CB    . LEU A 1 144 ? 78.046 -1.858  -2.735  1.00 21.03  ? 141  LEU A CB    1 
ATOM   1152 C  CG    . LEU A 1 144 ? 79.253 -1.540  -3.614  1.00 25.87  ? 141  LEU A CG    1 
ATOM   1153 C  CD1   . LEU A 1 144 ? 79.313 -2.526  -4.771  1.00 24.80  ? 141  LEU A CD1   1 
ATOM   1154 C  CD2   . LEU A 1 144 ? 79.189 -0.103  -4.117  1.00 23.29  ? 141  LEU A CD2   1 
ATOM   1155 N  N     . LEU A 1 145 ? 76.479 -1.632  0.317   1.00 16.99  ? 142  LEU A N     1 
ATOM   1156 C  CA    . LEU A 1 145 ? 75.257 -1.982  1.037   1.00 14.37  ? 142  LEU A CA    1 
ATOM   1157 C  C     . LEU A 1 145 ? 75.119 -1.227  2.364   1.00 16.06  ? 142  LEU A C     1 
ATOM   1158 O  O     . LEU A 1 145 ? 74.972 -1.844  3.423   1.00 14.90  ? 142  LEU A O     1 
ATOM   1159 C  CB    . LEU A 1 145 ? 75.229 -3.495  1.284   1.00 14.64  ? 142  LEU A CB    1 
ATOM   1160 C  CG    . LEU A 1 145 ? 75.167 -4.331  0.005   1.00 16.99  ? 142  LEU A CG    1 
ATOM   1161 C  CD1   . LEU A 1 145 ? 75.587 -5.784  0.260   1.00 14.95  ? 142  LEU A CD1   1 
ATOM   1162 C  CD2   . LEU A 1 145 ? 73.777 -4.284  -0.565  1.00 18.82  ? 142  LEU A CD2   1 
ATOM   1163 N  N     . PRO A 1 146 ? 75.144 0.119   2.307   1.00 17.28  ? 143  PRO A N     1 
ATOM   1164 C  CA    . PRO A 1 146 ? 75.239 0.907   3.540   1.00 18.84  ? 143  PRO A CA    1 
ATOM   1165 C  C     . PRO A 1 146 ? 73.991 0.890   4.411   1.00 16.16  ? 143  PRO A C     1 
ATOM   1166 O  O     . PRO A 1 146 ? 74.096 1.283   5.564   1.00 16.50  ? 143  PRO A O     1 
ATOM   1167 C  CB    . PRO A 1 146 ? 75.501 2.328   3.027   1.00 16.00  ? 143  PRO A CB    1 
ATOM   1168 C  CG    . PRO A 1 146 ? 74.873 2.357   1.677   1.00 20.23  ? 143  PRO A CG    1 
ATOM   1169 C  CD    . PRO A 1 146 ? 75.097 0.975   1.110   1.00 16.02  ? 143  PRO A CD    1 
ATOM   1170 N  N     . SER A 1 147 ? 72.847 0.434   3.903   1.00 19.18  ? 144  SER A N     1 
ATOM   1171 C  CA    . SER A 1 147 ? 71.633 0.437   4.726   1.00 16.37  ? 144  SER A CA    1 
ATOM   1172 C  C     . SER A 1 147 ? 70.958 -0.941  4.746   1.00 15.25  ? 144  SER A C     1 
ATOM   1173 O  O     . SER A 1 147 ? 69.776 -1.056  5.067   1.00 13.47  ? 144  SER A O     1 
ATOM   1174 C  CB    . SER A 1 147 ? 70.646 1.501   4.221   1.00 20.03  ? 144  SER A CB    1 
ATOM   1175 O  OG    . SER A 1 147 ? 70.163 1.197   2.919   1.00 17.41  ? 144  SER A OG    1 
ATOM   1176 N  N     . THR A 1 148 ? 71.727 -1.975  4.421   1.00 14.95  ? 145  THR A N     1 
ATOM   1177 C  CA    . THR A 1 148 ? 71.196 -3.331  4.285   1.00 14.20  ? 145  THR A CA    1 
ATOM   1178 C  C     . THR A 1 148 ? 71.401 -4.194  5.522   1.00 17.77  ? 145  THR A C     1 
ATOM   1179 O  O     . THR A 1 148 ? 72.492 -4.241  6.082   1.00 16.84  ? 145  THR A O     1 
ATOM   1180 C  CB    . THR A 1 148 ? 71.840 -4.044  3.081   1.00 12.90  ? 145  THR A CB    1 
ATOM   1181 O  OG1   . THR A 1 148 ? 71.482 -3.354  1.883   1.00 12.62  ? 145  THR A OG1   1 
ATOM   1182 C  CG2   . THR A 1 148 ? 71.362 -5.496  2.982   1.00 15.16  ? 145  THR A CG2   1 
ATOM   1183 N  N     . TYR A 1 149 ? 70.329 -4.864  5.927   1.00 11.54  ? 146  TYR A N     1 
ATOM   1184 C  CA    . TYR A 1 149 ? 70.341 -5.896  6.967   1.00 14.28  ? 146  TYR A CA    1 
ATOM   1185 C  C     . TYR A 1 149 ? 70.257 -7.252  6.328   1.00 14.62  ? 146  TYR A C     1 
ATOM   1186 O  O     . TYR A 1 149 ? 69.501 -7.438  5.378   1.00 13.40  ? 146  TYR A O     1 
ATOM   1187 C  CB    . TYR A 1 149 ? 69.153 -5.745  7.920   1.00 16.31  ? 146  TYR A CB    1 
ATOM   1188 C  CG    . TYR A 1 149 ? 69.361 -4.712  8.978   1.00 15.03  ? 146  TYR A CG    1 
ATOM   1189 C  CD1   . TYR A 1 149 ? 69.820 -5.077  10.231  1.00 15.49  ? 146  TYR A CD1   1 
ATOM   1190 C  CD2   . TYR A 1 149 ? 69.101 -3.367  8.730   1.00 18.18  ? 146  TYR A CD2   1 
ATOM   1191 C  CE1   . TYR A 1 149 ? 70.029 -4.133  11.211  1.00 17.48  ? 146  TYR A CE1   1 
ATOM   1192 C  CE2   . TYR A 1 149 ? 69.301 -2.420  9.705   1.00 18.60  ? 146  TYR A CE2   1 
ATOM   1193 C  CZ    . TYR A 1 149 ? 69.767 -2.812  10.946  1.00 18.34  ? 146  TYR A CZ    1 
ATOM   1194 O  OH    . TYR A 1 149 ? 69.971 -1.870  11.929  1.00 28.77  ? 146  TYR A OH    1 
ATOM   1195 N  N     . ILE A 1 150 ? 70.999 -8.213  6.864   1.00 12.15  ? 147  ILE A N     1 
ATOM   1196 C  CA    . ILE A 1 150 ? 70.863 -9.587  6.418   1.00 12.62  ? 147  ILE A CA    1 
ATOM   1197 C  C     . ILE A 1 150 ? 70.103 -10.360 7.483   1.00 12.20  ? 147  ILE A C     1 
ATOM   1198 O  O     . ILE A 1 150 ? 70.620 -10.594 8.580   1.00 13.60  ? 147  ILE A O     1 
ATOM   1199 C  CB    . ILE A 1 150 ? 72.223 -10.251 6.169   1.00 14.20  ? 147  ILE A CB    1 
ATOM   1200 C  CG1   . ILE A 1 150 ? 73.112 -9.391  5.254   1.00 11.82  ? 147  ILE A CG1   1 
ATOM   1201 C  CG2   . ILE A 1 150 ? 72.029 -11.664 5.605   1.00 16.93  ? 147  ILE A CG2   1 
ATOM   1202 C  CD1   . ILE A 1 150 ? 72.534 -9.140  3.851   1.00 13.27  ? 147  ILE A CD1   1 
ATOM   1203 N  N     . GLU A 1 151 ? 68.864 -10.736 7.189   1.00 9.37   ? 148  GLU A N     1 
ATOM   1204 C  CA    . GLU A 1 151 ? 68.039 -11.373 8.209   1.00 11.08  ? 148  GLU A CA    1 
ATOM   1205 C  C     . GLU A 1 151 ? 68.663 -12.675 8.686   1.00 13.24  ? 148  GLU A C     1 
ATOM   1206 O  O     . GLU A 1 151 ? 69.050 -13.522 7.876   1.00 14.47  ? 148  GLU A O     1 
ATOM   1207 C  CB    . GLU A 1 151 ? 66.622 -11.633 7.687   1.00 15.26  ? 148  GLU A CB    1 
ATOM   1208 C  CG    . GLU A 1 151 ? 65.755 -12.456 8.663   1.00 13.00  ? 148  GLU A CG    1 
ATOM   1209 C  CD    . GLU A 1 151 ? 65.509 -11.766 9.991   1.00 16.25  ? 148  GLU A CD    1 
ATOM   1210 O  OE1   . GLU A 1 151 ? 65.241 -12.474 10.982  1.00 19.56  ? 148  GLU A OE1   1 
ATOM   1211 O  OE2   . GLU A 1 151 ? 65.561 -10.520 10.040  1.00 19.20  ? 148  GLU A OE2   1 
ATOM   1212 N  N     . GLY A 1 152 ? 68.767 -12.819 10.008  1.00 14.14  ? 149  GLY A N     1 
ATOM   1213 C  CA    . GLY A 1 152 ? 69.312 -14.030 10.606  1.00 15.97  ? 149  GLY A CA    1 
ATOM   1214 C  C     . GLY A 1 152 ? 70.759 -13.917 11.041  1.00 17.65  ? 149  GLY A C     1 
ATOM   1215 O  O     . GLY A 1 152 ? 71.286 -14.821 11.694  1.00 18.89  ? 149  GLY A O     1 
ATOM   1216 N  N     . LEU A 1 153 ? 71.401 -12.812 10.677  1.00 13.50  ? 150  LEU A N     1 
ATOM   1217 C  CA    . LEU A 1 153 ? 72.800 -12.586 11.002  1.00 16.74  ? 150  LEU A CA    1 
ATOM   1218 C  C     . LEU A 1 153 ? 72.953 -11.268 11.759  1.00 19.52  ? 150  LEU A C     1 
ATOM   1219 O  O     . LEU A 1 153 ? 72.137 -10.365 11.606  1.00 16.99  ? 150  LEU A O     1 
ATOM   1220 C  CB    . LEU A 1 153 ? 73.649 -12.590 9.727   1.00 13.71  ? 150  LEU A CB    1 
ATOM   1221 C  CG    . LEU A 1 153 ? 73.662 -13.879 8.905   1.00 18.10  ? 150  LEU A CG    1 
ATOM   1222 C  CD1   . LEU A 1 153 ? 74.530 -13.721 7.663   1.00 17.66  ? 150  LEU A CD1   1 
ATOM   1223 C  CD2   . LEU A 1 153 ? 74.137 -15.065 9.780   1.00 17.44  ? 150  LEU A CD2   1 
ATOM   1224 N  N     . PRO A 1 154 ? 74.001 -11.151 12.602  1.00 16.34  ? 151  PRO A N     1 
ATOM   1225 C  CA    . PRO A 1 154 ? 75.047 -12.143 12.870  1.00 19.16  ? 151  PRO A CA    1 
ATOM   1226 C  C     . PRO A 1 154 ? 74.563 -13.311 13.719  1.00 17.88  ? 151  PRO A C     1 
ATOM   1227 O  O     . PRO A 1 154 ? 73.541 -13.231 14.406  1.00 19.11  ? 151  PRO A O     1 
ATOM   1228 C  CB    . PRO A 1 154 ? 76.106 -11.329 13.618  1.00 16.60  ? 151  PRO A CB    1 
ATOM   1229 C  CG    . PRO A 1 154 ? 75.313 -10.289 14.342  1.00 23.78  ? 151  PRO A CG    1 
ATOM   1230 C  CD    . PRO A 1 154 ? 74.193 -9.923  13.396  1.00 20.53  ? 151  PRO A CD    1 
ATOM   1231 N  N     . GLN A 1 155 ? 75.304 -14.410 13.667  1.00 19.51  ? 152  GLN A N     1 
ATOM   1232 C  CA    . GLN A 1 155 ? 74.964 -15.579 14.464  1.00 25.75  ? 152  GLN A CA    1 
ATOM   1233 C  C     . GLN A 1 155 ? 76.236 -16.350 14.786  1.00 31.13  ? 152  GLN A C     1 
ATOM   1234 O  O     . GLN A 1 155 ? 77.208 -16.271 14.038  1.00 30.62  ? 152  GLN A O     1 
ATOM   1235 C  CB    . GLN A 1 155 ? 73.967 -16.477 13.722  1.00 29.83  ? 152  GLN A CB    1 
ATOM   1236 C  CG    . GLN A 1 155 ? 74.324 -17.953 13.763  1.00 37.97  ? 152  GLN A CG    1 
ATOM   1237 C  CD    . GLN A 1 155 ? 73.761 -18.727 12.607  1.00 44.56  ? 152  GLN A CD    1 
ATOM   1238 O  OE1   . GLN A 1 155 ? 72.546 -18.783 12.417  1.00 50.49  ? 152  GLN A OE1   1 
ATOM   1239 N  NE2   . GLN A 1 155 ? 74.645 -19.327 11.814  1.00 43.03  ? 152  GLN A NE2   1 
ATOM   1240 N  N     . GLY A 1 156 ? 76.241 -17.068 15.907  1.00 40.44  ? 153  GLY A N     1 
ATOM   1241 C  CA    . GLY A 1 156 ? 77.324 -17.991 16.203  1.00 44.22  ? 153  GLY A CA    1 
ATOM   1242 C  C     . GLY A 1 156 ? 78.368 -17.429 17.144  1.00 48.80  ? 153  GLY A C     1 
ATOM   1243 O  O     . GLY A 1 156 ? 78.160 -16.380 17.751  1.00 49.04  ? 153  GLY A O     1 
ATOM   1244 N  N     . PRO A 1 157 ? 79.502 -18.137 17.273  1.00 55.91  ? 154  PRO A N     1 
ATOM   1245 C  CA    . PRO A 1 157 ? 80.601 -17.765 18.174  1.00 52.63  ? 154  PRO A CA    1 
ATOM   1246 C  C     . PRO A 1 157 ? 81.382 -16.534 17.705  1.00 43.77  ? 154  PRO A C     1 
ATOM   1247 O  O     . PRO A 1 157 ? 81.877 -16.507 16.578  1.00 49.36  ? 154  PRO A O     1 
ATOM   1248 C  CB    . PRO A 1 157 ? 81.493 -19.014 18.170  1.00 44.69  ? 154  PRO A CB    1 
ATOM   1249 C  CG    . PRO A 1 157 ? 81.190 -19.695 16.878  1.00 39.26  ? 154  PRO A CG    1 
ATOM   1250 C  CD    . PRO A 1 157 ? 79.743 -19.429 16.604  1.00 49.22  ? 154  PRO A CD    1 
ATOM   1251 N  N     . THR A 1 163 ? 79.830 -5.721  20.765  1.00 68.74  ? 160  THR A N     1 
ATOM   1252 C  CA    . THR A 1 163 ? 79.002 -4.652  20.215  1.00 69.53  ? 160  THR A CA    1 
ATOM   1253 C  C     . THR A 1 163 ? 77.571 -4.744  20.736  1.00 67.44  ? 160  THR A C     1 
ATOM   1254 O  O     . THR A 1 163 ? 76.928 -5.792  20.655  1.00 68.04  ? 160  THR A O     1 
ATOM   1255 C  CB    . THR A 1 163 ? 78.994 -4.676  18.668  1.00 66.75  ? 160  THR A CB    1 
ATOM   1256 O  OG1   . THR A 1 163 ? 80.151 -3.988  18.175  1.00 67.44  ? 160  THR A OG1   1 
ATOM   1257 C  CG2   . THR A 1 163 ? 77.754 -3.989  18.119  1.00 55.45  ? 160  THR A CG2   1 
ATOM   1258 N  N     . VAL A 1 164 ? 77.084 -3.633  21.277  1.00 65.83  ? 161  VAL A N     1 
ATOM   1259 C  CA    . VAL A 1 164 ? 75.735 -3.566  21.818  1.00 58.86  ? 161  VAL A CA    1 
ATOM   1260 C  C     . VAL A 1 164 ? 74.922 -2.486  21.099  1.00 54.62  ? 161  VAL A C     1 
ATOM   1261 O  O     . VAL A 1 164 ? 73.813 -2.148  21.518  1.00 50.58  ? 161  VAL A O     1 
ATOM   1262 C  CB    . VAL A 1 164 ? 75.760 -3.285  23.335  1.00 55.77  ? 161  VAL A CB    1 
ATOM   1263 C  CG1   . VAL A 1 164 ? 76.424 -4.439  24.080  1.00 44.87  ? 161  VAL A CG1   1 
ATOM   1264 C  CG2   . VAL A 1 164 ? 76.483 -1.976  23.623  1.00 49.53  ? 161  VAL A CG2   1 
ATOM   1265 N  N     . GLN A 1 165 ? 75.486 -1.958  20.013  1.00 39.08  ? 162  GLN A N     1 
ATOM   1266 C  CA    . GLN A 1 165 ? 74.851 -0.903  19.222  1.00 49.09  ? 162  GLN A CA    1 
ATOM   1267 C  C     . GLN A 1 165 ? 74.143 -1.492  18.004  1.00 42.08  ? 162  GLN A C     1 
ATOM   1268 O  O     . GLN A 1 165 ? 74.512 -2.560  17.518  1.00 37.43  ? 162  GLN A O     1 
ATOM   1269 C  CB    . GLN A 1 165 ? 75.889 0.135   18.783  1.00 49.16  ? 162  GLN A CB    1 
ATOM   1270 C  CG    . GLN A 1 165 ? 77.028 -0.449  17.957  1.00 51.28  ? 162  GLN A CG    1 
ATOM   1271 C  CD    . GLN A 1 165 ? 78.030 0.594   17.491  1.00 54.83  ? 162  GLN A CD    1 
ATOM   1272 O  OE1   . GLN A 1 165 ? 77.657 1.694   17.080  1.00 62.09  ? 162  GLN A OE1   1 
ATOM   1273 N  NE2   . GLN A 1 165 ? 79.311 0.243   17.533  1.00 48.76  ? 162  GLN A NE2   1 
ATOM   1274 N  N     . LYS A 1 166 ? 73.125 -0.796  17.511  1.00 36.06  ? 163  LYS A N     1 
ATOM   1275 C  CA    . LYS A 1 166 ? 72.294 -1.343  16.446  1.00 35.82  ? 163  LYS A CA    1 
ATOM   1276 C  C     . LYS A 1 166 ? 72.994 -1.319  15.083  1.00 28.37  ? 163  LYS A C     1 
ATOM   1277 O  O     . LYS A 1 166 ? 72.935 -2.295  14.337  1.00 25.78  ? 163  LYS A O     1 
ATOM   1278 C  CB    . LYS A 1 166 ? 70.960 -0.593  16.391  1.00 38.06  ? 163  LYS A CB    1 
ATOM   1279 C  CG    . LYS A 1 166 ? 70.274 -0.609  15.051  1.00 39.46  ? 163  LYS A CG    1 
ATOM   1280 C  CD    . LYS A 1 166 ? 69.519 0.686   14.839  1.00 51.39  ? 163  LYS A CD    1 
ATOM   1281 C  CE    . LYS A 1 166 ? 69.829 1.278   13.479  1.00 55.79  ? 163  LYS A CE    1 
ATOM   1282 N  NZ    . LYS A 1 166 ? 69.058 2.528   13.234  1.00 63.71  ? 163  LYS A NZ    1 
ATOM   1283 N  N     . GLU A 1 167 ? 73.663 -0.218  14.755  1.00 25.59  ? 164  GLU A N     1 
ATOM   1284 C  CA    . GLU A 1 167 ? 74.414 -0.150  13.499  1.00 32.99  ? 164  GLU A CA    1 
ATOM   1285 C  C     . GLU A 1 167 ? 75.579 -1.142  13.525  1.00 26.36  ? 164  GLU A C     1 
ATOM   1286 O  O     . GLU A 1 167 ? 75.985 -1.670  12.489  1.00 24.28  ? 164  GLU A O     1 
ATOM   1287 C  CB    . GLU A 1 167 ? 74.913 1.280   13.237  1.00 27.64  ? 164  GLU A CB    1 
ATOM   1288 C  CG    . GLU A 1 167 ? 75.960 1.434   12.111  1.00 27.11  ? 164  GLU A CG    1 
ATOM   1289 C  CD    . GLU A 1 167 ? 75.413 1.151   10.712  1.00 26.02  ? 164  GLU A CD    1 
ATOM   1290 O  OE1   . GLU A 1 167 ? 76.231 1.022   9.773   1.00 29.85  ? 164  GLU A OE1   1 
ATOM   1291 O  OE2   . GLU A 1 167 ? 74.176 1.062   10.543  1.00 33.67  ? 164  GLU A OE2   1 
ATOM   1292 N  N     . GLY A 1 168 ? 76.104 -1.400  14.718  1.00 32.29  ? 165  GLY A N     1 
ATOM   1293 C  CA    . GLY A 1 168 ? 77.193 -2.343  14.879  1.00 34.69  ? 165  GLY A CA    1 
ATOM   1294 C  C     . GLY A 1 168 ? 76.764 -3.755  14.549  1.00 25.48  ? 165  GLY A C     1 
ATOM   1295 O  O     . GLY A 1 168 ? 77.491 -4.499  13.887  1.00 27.36  ? 165  GLY A O     1 
ATOM   1296 N  N     . MET A 1 169 ? 75.580 -4.128  15.025  1.00 30.23  ? 166  MET A N     1 
ATOM   1297 C  CA    . MET A 1 169 ? 74.985 -5.420  14.705  1.00 24.43  ? 166  MET A CA    1 
ATOM   1298 C  C     . MET A 1 169 ? 74.731 -5.561  13.202  1.00 22.04  ? 166  MET A C     1 
ATOM   1299 O  O     . MET A 1 169 ? 74.997 -6.611  12.618  1.00 23.25  ? 166  MET A O     1 
ATOM   1300 C  CB    . MET A 1 169 ? 73.670 -5.615  15.470  1.00 29.62  ? 166  MET A CB    1 
ATOM   1301 C  CG    . MET A 1 169 ? 73.826 -5.742  16.977  1.00 41.33  ? 166  MET A CG    1 
ATOM   1302 S  SD    . MET A 1 169 ? 74.310 -7.407  17.480  1.00 71.68  ? 166  MET A SD    1 
ATOM   1303 C  CE    . MET A 1 169 ? 72.932 -8.372  16.845  1.00 35.89  ? 166  MET A CE    1 
ATOM   1304 N  N     . ARG A 1 170 ? 74.219 -4.506  12.578  1.00 21.27  ? 167  ARG A N     1 
ATOM   1305 C  CA    . ARG A 1 170 ? 73.931 -4.565  11.152  1.00 18.88  ? 167  ARG A CA    1 
ATOM   1306 C  C     . ARG A 1 170 ? 75.187 -4.902  10.373  1.00 21.02  ? 167  ARG A C     1 
ATOM   1307 O  O     . ARG A 1 170 ? 75.186 -5.814  9.548   1.00 21.04  ? 167  ARG A O     1 
ATOM   1308 C  CB    . ARG A 1 170 ? 73.357 -3.241  10.633  1.00 18.65  ? 167  ARG A CB    1 
ATOM   1309 C  CG    . ARG A 1 170 ? 72.971 -3.308  9.152   1.00 16.44  ? 167  ARG A CG    1 
ATOM   1310 C  CD    . ARG A 1 170 ? 72.821 -1.918  8.520   1.00 14.40  ? 167  ARG A CD    1 
ATOM   1311 N  NE    . ARG A 1 170 ? 74.090 -1.211  8.328   1.00 19.99  ? 167  ARG A NE    1 
ATOM   1312 C  CZ    . ARG A 1 170 ? 74.876 -1.348  7.262   1.00 16.91  ? 167  ARG A CZ    1 
ATOM   1313 N  NH1   . ARG A 1 170 ? 74.552 -2.189  6.287   1.00 15.69  ? 167  ARG A NH1   1 
ATOM   1314 N  NH2   . ARG A 1 170 ? 75.998 -0.652  7.169   1.00 24.01  ? 167  ARG A NH2   1 
ATOM   1315 N  N     . LYS A 1 171 ? 76.260 -4.157  10.635  1.00 21.59  ? 168  LYS A N     1 
ATOM   1316 C  CA    . LYS A 1 171 ? 77.519 -4.378  9.934   1.00 22.62  ? 168  LYS A CA    1 
ATOM   1317 C  C     . LYS A 1 171 ? 78.115 -5.756  10.217  1.00 23.24  ? 168  LYS A C     1 
ATOM   1318 O  O     . LYS A 1 171 ? 78.685 -6.387  9.328   1.00 20.44  ? 168  LYS A O     1 
ATOM   1319 C  CB    . LYS A 1 171 ? 78.534 -3.298  10.306  1.00 28.29  ? 168  LYS A CB    1 
ATOM   1320 C  CG    . LYS A 1 171 ? 78.350 -1.992  9.556   1.00 32.83  ? 168  LYS A CG    1 
ATOM   1321 C  CD    . LYS A 1 171 ? 79.533 -1.729  8.636   1.00 47.40  ? 168  LYS A CD    1 
ATOM   1322 C  CE    . LYS A 1 171 ? 79.838 -0.245  8.543   1.00 47.92  ? 168  LYS A CE    1 
ATOM   1323 N  NZ    . LYS A 1 171 ? 81.304 -0.001  8.608   1.00 62.54  ? 168  LYS A NZ    1 
ATOM   1324 N  N     . GLN A 1 172 ? 77.990 -6.223  11.454  1.00 25.95  ? 169  GLN A N     1 
ATOM   1325 C  CA    . GLN A 1 172 ? 78.513 -7.539  11.807  1.00 24.90  ? 169  GLN A CA    1 
ATOM   1326 C  C     . GLN A 1 172 ? 77.817 -8.617  10.985  1.00 18.12  ? 169  GLN A C     1 
ATOM   1327 O  O     . GLN A 1 172 ? 78.455 -9.512  10.419  1.00 19.01  ? 169  GLN A O     1 
ATOM   1328 C  CB    . GLN A 1 172 ? 78.330 -7.814  13.297  1.00 25.81  ? 169  GLN A CB    1 
ATOM   1329 C  CG    . GLN A 1 172 ? 79.600 -8.173  14.034  1.00 48.16  ? 169  GLN A CG    1 
ATOM   1330 C  CD    . GLN A 1 172 ? 79.355 -8.377  15.514  1.00 60.57  ? 169  GLN A CD    1 
ATOM   1331 O  OE1   . GLN A 1 172 ? 78.246 -8.152  16.005  1.00 58.70  ? 169  GLN A OE1   1 
ATOM   1332 N  NE2   . GLN A 1 172 ? 80.386 -8.806  16.235  1.00 72.32  ? 169  GLN A NE2   1 
ATOM   1333 N  N     . GLY A 1 173 ? 76.495 -8.524  10.906  1.00 20.43  ? 170  GLY A N     1 
ATOM   1334 C  CA    . GLY A 1 173 ? 75.745 -9.467  10.101  1.00 14.34  ? 170  GLY A CA    1 
ATOM   1335 C  C     . GLY A 1 173 ? 76.118 -9.398  8.634   1.00 17.24  ? 170  GLY A C     1 
ATOM   1336 O  O     . GLY A 1 173 ? 76.260 -10.433 7.963   1.00 17.48  ? 170  GLY A O     1 
ATOM   1337 N  N     . LEU A 1 174 ? 76.292 -8.177  8.134   1.00 15.91  ? 171  LEU A N     1 
ATOM   1338 C  CA    . LEU A 1 174 ? 76.621 -7.978  6.734   1.00 13.59  ? 171  LEU A CA    1 
ATOM   1339 C  C     . LEU A 1 174 ? 77.988 -8.564  6.430   1.00 17.72  ? 171  LEU A C     1 
ATOM   1340 O  O     . LEU A 1 174 ? 78.177 -9.201  5.399   1.00 17.94  ? 171  LEU A O     1 
ATOM   1341 C  CB    . LEU A 1 174 ? 76.592 -6.489  6.369   1.00 16.69  ? 171  LEU A CB    1 
ATOM   1342 C  CG    . LEU A 1 174 ? 76.904 -6.151  4.915   1.00 15.79  ? 171  LEU A CG    1 
ATOM   1343 C  CD1   . LEU A 1 174 ? 75.949 -6.843  3.960   1.00 16.12  ? 171  LEU A CD1   1 
ATOM   1344 C  CD2   . LEU A 1 174 ? 76.862 -4.649  4.724   1.00 19.12  ? 171  LEU A CD2   1 
ATOM   1345 N  N     . PHE A 1 175 ? 78.940 -8.345  7.335   1.00 17.68  ? 172  PHE A N     1 
ATOM   1346 C  CA    . PHE A 1 175 ? 80.274 -8.911  7.159   1.00 19.44  ? 172  PHE A CA    1 
ATOM   1347 C  C     . PHE A 1 175 ? 80.232 -10.440 7.108   1.00 17.74  ? 172  PHE A C     1 
ATOM   1348 O  O     . PHE A 1 175 ? 80.849 -11.045 6.235   1.00 22.03  ? 172  PHE A O     1 
ATOM   1349 C  CB    . PHE A 1 175 ? 81.199 -8.444  8.276   1.00 16.33  ? 172  PHE A CB    1 
ATOM   1350 C  CG    . PHE A 1 175 ? 81.726 -7.056  8.075   1.00 38.36  ? 172  PHE A CG    1 
ATOM   1351 C  CD1   . PHE A 1 175 ? 81.999 -6.584  6.799   1.00 41.75  ? 172  PHE A CD1   1 
ATOM   1352 C  CD2   . PHE A 1 175 ? 81.937 -6.216  9.157   1.00 40.59  ? 172  PHE A CD2   1 
ATOM   1353 C  CE1   . PHE A 1 175 ? 82.481 -5.302  6.606   1.00 45.65  ? 172  PHE A CE1   1 
ATOM   1354 C  CE2   . PHE A 1 175 ? 82.420 -4.932  8.972   1.00 51.91  ? 172  PHE A CE2   1 
ATOM   1355 C  CZ    . PHE A 1 175 ? 82.690 -4.474  7.694   1.00 52.94  ? 172  PHE A CZ    1 
ATOM   1356 N  N     . GLN A 1 176 ? 79.489 -11.064 8.021   1.00 21.47  ? 173  GLN A N     1 
ATOM   1357 C  CA    . GLN A 1 176 ? 79.382 -12.526 8.024   1.00 18.73  ? 173  GLN A CA    1 
ATOM   1358 C  C     . GLN A 1 176 ? 78.798 -13.017 6.708   1.00 22.06  ? 173  GLN A C     1 
ATOM   1359 O  O     . GLN A 1 176 ? 79.241 -14.026 6.152   1.00 23.75  ? 173  GLN A O     1 
ATOM   1360 C  CB    . GLN A 1 176 ? 78.522 -13.029 9.198   1.00 19.16  ? 173  GLN A CB    1 
ATOM   1361 C  CG    . GLN A 1 176 ? 79.183 -12.883 10.572  1.00 22.18  ? 173  GLN A CG    1 
ATOM   1362 C  CD    . GLN A 1 176 ? 78.378 -13.504 11.700  1.00 24.83  ? 173  GLN A CD    1 
ATOM   1363 O  OE1   . GLN A 1 176 ? 77.281 -14.013 11.494  1.00 22.95  ? 173  GLN A OE1   1 
ATOM   1364 N  NE2   . GLN A 1 176 ? 78.940 -13.483 12.907  1.00 30.71  ? 173  GLN A NE2   1 
ATOM   1365 N  N     . TRP A 1 177 ? 77.802 -12.287 6.215   1.00 18.38  ? 174  TRP A N     1 
ATOM   1366 C  CA    . TRP A 1 177 ? 77.142 -12.632 4.959   1.00 15.08  ? 174  TRP A CA    1 
ATOM   1367 C  C     . TRP A 1 177 ? 78.117 -12.534 3.790   1.00 17.63  ? 174  TRP A C     1 
ATOM   1368 O  O     . TRP A 1 177 ? 78.254 -13.463 3.003   1.00 19.00  ? 174  TRP A O     1 
ATOM   1369 C  CB    . TRP A 1 177 ? 75.929 -11.721 4.721   1.00 13.38  ? 174  TRP A CB    1 
ATOM   1370 C  CG    . TRP A 1 177 ? 75.257 -11.911 3.372   1.00 13.98  ? 174  TRP A CG    1 
ATOM   1371 C  CD1   . TRP A 1 177 ? 75.350 -11.082 2.284   1.00 13.96  ? 174  TRP A CD1   1 
ATOM   1372 C  CD2   . TRP A 1 177 ? 74.385 -12.983 2.980   1.00 15.17  ? 174  TRP A CD2   1 
ATOM   1373 N  NE1   . TRP A 1 177 ? 74.605 -11.576 1.243   1.00 15.37  ? 174  TRP A NE1   1 
ATOM   1374 C  CE2   . TRP A 1 177 ? 73.994 -12.739 1.647   1.00 13.93  ? 174  TRP A CE2   1 
ATOM   1375 C  CE3   . TRP A 1 177 ? 73.898 -14.124 3.627   1.00 15.29  ? 174  TRP A CE3   1 
ATOM   1376 C  CZ2   . TRP A 1 177 ? 73.139 -13.590 0.947   1.00 13.40  ? 174  TRP A CZ2   1 
ATOM   1377 C  CZ3   . TRP A 1 177 ? 73.043 -14.974 2.927   1.00 15.23  ? 174  TRP A CZ3   1 
ATOM   1378 C  CH2   . TRP A 1 177 ? 72.683 -14.703 1.598   1.00 15.59  ? 174  TRP A CH2   1 
ATOM   1379 N  N     . LEU A 1 178 ? 78.807 -11.408 3.687   1.00 16.83  ? 175  LEU A N     1 
ATOM   1380 C  CA    . LEU A 1 178 ? 79.688 -11.190 2.544   1.00 19.16  ? 175  LEU A CA    1 
ATOM   1381 C  C     . LEU A 1 178 ? 80.892 -12.120 2.589   1.00 20.39  ? 175  LEU A C     1 
ATOM   1382 O  O     . LEU A 1 178 ? 81.388 -12.549 1.547   1.00 27.16  ? 175  LEU A O     1 
ATOM   1383 C  CB    . LEU A 1 178 ? 80.152 -9.740  2.484   1.00 18.61  ? 175  LEU A CB    1 
ATOM   1384 C  CG    . LEU A 1 178 ? 79.055 -8.707  2.184   1.00 21.69  ? 175  LEU A CG    1 
ATOM   1385 C  CD1   . LEU A 1 178 ? 79.640 -7.310  2.228   1.00 19.25  ? 175  LEU A CD1   1 
ATOM   1386 C  CD2   . LEU A 1 178 ? 78.402 -8.986  0.823   1.00 15.08  ? 175  LEU A CD2   1 
ATOM   1387 N  N     . ASP A 1 179 ? 81.344 -12.434 3.800   1.00 27.46  ? 176  ASP A N     1 
ATOM   1388 C  CA    . ASP A 1 179 ? 82.486 -13.330 3.984   1.00 30.60  ? 176  ASP A CA    1 
ATOM   1389 C  C     . ASP A 1 179 ? 82.180 -14.716 3.459   1.00 34.00  ? 176  ASP A C     1 
ATOM   1390 O  O     . ASP A 1 179 ? 83.057 -15.388 2.925   1.00 34.68  ? 176  ASP A O     1 
ATOM   1391 C  CB    . ASP A 1 179 ? 82.892 -13.410 5.459   1.00 27.76  ? 176  ASP A CB    1 
ATOM   1392 C  CG    . ASP A 1 179 ? 83.590 -12.154 5.942   1.00 41.21  ? 176  ASP A CG    1 
ATOM   1393 O  OD1   . ASP A 1 179 ? 84.038 -11.356 5.090   1.00 49.34  ? 176  ASP A OD1   1 
ATOM   1394 O  OD2   . ASP A 1 179 ? 83.687 -11.961 7.174   1.00 52.51  ? 176  ASP A OD2   1 
ATOM   1395 N  N     . SER A 1 180 ? 80.929 -15.134 3.597   1.00 24.05  ? 177  SER A N     1 
ATOM   1396 C  CA    . SER A 1 180 ? 80.523 -16.468 3.169   1.00 30.56  ? 177  SER A CA    1 
ATOM   1397 C  C     . SER A 1 180 ? 80.204 -16.554 1.679   1.00 32.36  ? 177  SER A C     1 
ATOM   1398 O  O     . SER A 1 180 ? 80.132 -17.647 1.117   1.00 40.49  ? 177  SER A O     1 
ATOM   1399 C  CB    . SER A 1 180 ? 79.313 -16.926 3.977   1.00 30.51  ? 177  SER A CB    1 
ATOM   1400 O  OG    . SER A 1 180 ? 79.622 -16.951 5.358   1.00 36.24  ? 177  SER A OG    1 
ATOM   1401 N  N     . LEU A 1 181 ? 79.966 -15.415 1.035   1.00 28.40  ? 178  LEU A N     1 
ATOM   1402 C  CA    . LEU A 1 181 ? 79.493 -15.425 -0.351  1.00 25.78  ? 178  LEU A CA    1 
ATOM   1403 C  C     . LEU A 1 181 ? 80.432 -16.164 -1.299  1.00 39.55  ? 178  LEU A C     1 
ATOM   1404 O  O     . LEU A 1 181 ? 81.634 -16.251 -1.054  1.00 40.87  ? 178  LEU A O     1 
ATOM   1405 C  CB    . LEU A 1 181 ? 79.283 -13.995 -0.857  1.00 31.75  ? 178  LEU A CB    1 
ATOM   1406 C  CG    . LEU A 1 181 ? 77.946 -13.341 -0.502  1.00 31.60  ? 178  LEU A CG    1 
ATOM   1407 C  CD1   . LEU A 1 181 ? 77.802 -11.991 -1.200  1.00 25.28  ? 178  LEU A CD1   1 
ATOM   1408 C  CD2   . LEU A 1 181 ? 76.787 -14.258 -0.860  1.00 23.55  ? 178  LEU A CD2   1 
ATOM   1409 N  N     . GLN A 1 182 ? 79.873 -16.720 -2.368  1.00 38.39  ? 179  GLN A N     1 
ATOM   1410 C  CA    . GLN A 1 182 ? 80.696 -17.235 -3.452  1.00 47.75  ? 179  GLN A CA    1 
ATOM   1411 C  C     . GLN A 1 182 ? 80.449 -16.423 -4.716  1.00 47.29  ? 179  GLN A C     1 
ATOM   1412 O  O     . GLN A 1 182 ? 79.548 -16.725 -5.499  1.00 48.12  ? 179  GLN A O     1 
ATOM   1413 C  CB    . GLN A 1 182 ? 80.423 -18.713 -3.708  1.00 46.33  ? 179  GLN A CB    1 
ATOM   1414 C  CG    . GLN A 1 182 ? 81.434 -19.340 -4.649  1.00 52.10  ? 179  GLN A CG    1 
ATOM   1415 C  CD    . GLN A 1 182 ? 82.864 -18.963 -4.294  1.00 59.93  ? 179  GLN A CD    1 
ATOM   1416 O  OE1   . GLN A 1 182 ? 83.456 -18.072 -4.907  1.00 58.55  ? 179  GLN A OE1   1 
ATOM   1417 N  NE2   . GLN A 1 182 ? 83.424 -19.637 -3.294  1.00 57.77  ? 179  GLN A NE2   1 
ATOM   1418 N  N     . ILE A 1 183 ? 81.267 -15.392 -4.910  1.00 46.30  ? 180  ILE A N     1 
ATOM   1419 C  CA    . ILE A 1 183 ? 81.093 -14.461 -6.018  1.00 50.25  ? 180  ILE A CA    1 
ATOM   1420 C  C     . ILE A 1 183 ? 81.574 -15.045 -7.345  1.00 52.38  ? 180  ILE A C     1 
ATOM   1421 O  O     . ILE A 1 183 ? 81.482 -14.403 -8.391  1.00 55.19  ? 180  ILE A O     1 
ATOM   1422 C  CB    . ILE A 1 183 ? 81.827 -13.136 -5.738  1.00 48.88  ? 180  ILE A CB    1 
ATOM   1423 C  CG1   . ILE A 1 183 ? 83.171 -13.395 -5.050  1.00 49.24  ? 180  ILE A CG1   1 
ATOM   1424 C  CG2   . ILE A 1 183 ? 80.981 -12.250 -4.846  1.00 44.88  ? 180  ILE A CG2   1 
ATOM   1425 C  CD1   . ILE A 1 183 ? 84.307 -13.729 -5.989  1.00 53.65  ? 180  ILE A CD1   1 
ATOM   1426 N  N     . ASP A 1 184 ? 82.080 -16.270 -7.288  1.00 53.69  ? 181  ASP A N     1 
ATOM   1427 C  CA    . ASP A 1 184 ? 82.598 -16.956 -8.464  1.00 56.31  ? 181  ASP A CA    1 
ATOM   1428 C  C     . ASP A 1 184 ? 81.469 -17.559 -9.298  1.00 56.20  ? 181  ASP A C     1 
ATOM   1429 O  O     . ASP A 1 184 ? 81.625 -17.791 -10.497 1.00 60.37  ? 181  ASP A O     1 
ATOM   1430 C  CB    . ASP A 1 184 ? 83.586 -18.044 -8.033  1.00 59.62  ? 181  ASP A CB    1 
ATOM   1431 C  CG    . ASP A 1 184 ? 84.274 -18.710 -9.202  1.00 68.81  ? 181  ASP A CG    1 
ATOM   1432 O  OD1   . ASP A 1 184 ? 84.509 -18.031 -10.224 1.00 68.73  ? 181  ASP A OD1   1 
ATOM   1433 O  OD2   . ASP A 1 184 ? 84.589 -19.914 -9.095  1.00 72.88  ? 181  ASP A OD2   1 
ATOM   1434 N  N     . ASN A 1 185 ? 80.328 -17.800 -8.658  1.00 54.46  ? 182  ASN A N     1 
ATOM   1435 C  CA    . ASN A 1 185 ? 79.205 -18.472 -9.306  1.00 48.49  ? 182  ASN A CA    1 
ATOM   1436 C  C     . ASN A 1 185 ? 78.062 -17.514 -9.644  1.00 46.64  ? 182  ASN A C     1 
ATOM   1437 O  O     . ASN A 1 185 ? 77.275 -17.142 -8.777  1.00 43.32  ? 182  ASN A O     1 
ATOM   1438 C  CB    . ASN A 1 185 ? 78.701 -19.610 -8.411  1.00 41.48  ? 182  ASN A CB    1 
ATOM   1439 C  CG    . ASN A 1 185 ? 77.576 -20.411 -9.045  1.00 44.59  ? 182  ASN A CG    1 
ATOM   1440 O  OD1   . ASN A 1 185 ? 77.223 -20.208 -10.207 1.00 48.88  ? 182  ASN A OD1   1 
ATOM   1441 N  ND2   . ASN A 1 185 ? 77.019 -21.345 -8.280  1.00 45.75  ? 182  ASN A ND2   1 
ATOM   1442 N  N     . LEU A 1 186 ? 77.963 -17.145 -10.918 1.00 43.03  ? 183  LEU A N     1 
ATOM   1443 C  CA    . LEU A 1 186 ? 76.948 -16.200 -11.386 1.00 40.31  ? 183  LEU A CA    1 
ATOM   1444 C  C     . LEU A 1 186 ? 75.521 -16.753 -11.287 1.00 39.53  ? 183  LEU A C     1 
ATOM   1445 O  O     . LEU A 1 186 ? 74.545 -16.021 -11.481 1.00 39.18  ? 183  LEU A O     1 
ATOM   1446 C  CB    . LEU A 1 186 ? 77.245 -15.781 -12.833 1.00 37.39  ? 183  LEU A CB    1 
ATOM   1447 C  CG    . LEU A 1 186 ? 78.261 -14.653 -13.055 1.00 44.01  ? 183  LEU A CG    1 
ATOM   1448 C  CD1   . LEU A 1 186 ? 79.666 -15.063 -12.633 1.00 49.65  ? 183  LEU A CD1   1 
ATOM   1449 C  CD2   . LEU A 1 186 ? 78.257 -14.197 -14.505 1.00 44.07  ? 183  LEU A CD2   1 
ATOM   1450 N  N     . THR A 1 187 ? 75.401 -18.042 -10.985 1.00 39.23  ? 184  THR A N     1 
ATOM   1451 C  CA    . THR A 1 187 ? 74.093 -18.680 -10.865 1.00 39.56  ? 184  THR A CA    1 
ATOM   1452 C  C     . THR A 1 187 ? 73.690 -18.915 -9.405  1.00 36.65  ? 184  THR A C     1 
ATOM   1453 O  O     . THR A 1 187 ? 72.621 -19.461 -9.136  1.00 40.42  ? 184  THR A O     1 
ATOM   1454 C  CB    . THR A 1 187 ? 74.052 -20.032 -11.621 1.00 44.04  ? 184  THR A CB    1 
ATOM   1455 O  OG1   . THR A 1 187 ? 74.964 -20.958 -11.017 1.00 46.83  ? 184  THR A OG1   1 
ATOM   1456 C  CG2   . THR A 1 187 ? 74.429 -19.843 -13.088 1.00 40.94  ? 184  THR A CG2   1 
ATOM   1457 N  N     . SER A 1 188 ? 74.544 -18.504 -8.470  1.00 30.30  ? 185  SER A N     1 
ATOM   1458 C  CA    . SER A 1 188 ? 74.277 -18.684 -7.039  1.00 23.98  ? 185  SER A CA    1 
ATOM   1459 C  C     . SER A 1 188 ? 73.185 -17.741 -6.532  1.00 17.82  ? 185  SER A C     1 
ATOM   1460 O  O     . SER A 1 188 ? 73.333 -16.528 -6.623  1.00 16.66  ? 185  SER A O     1 
ATOM   1461 C  CB    . SER A 1 188 ? 75.557 -18.463 -6.232  1.00 29.27  ? 185  SER A CB    1 
ATOM   1462 O  OG    . SER A 1 188 ? 75.272 -18.335 -4.851  1.00 29.14  ? 185  SER A OG    1 
ATOM   1463 N  N     . PRO A 1 189 ? 72.092 -18.299 -5.979  1.00 17.00  ? 186  PRO A N     1 
ATOM   1464 C  CA    . PRO A 1 189 ? 70.965 -17.470 -5.527  1.00 12.92  ? 186  PRO A CA    1 
ATOM   1465 C  C     . PRO A 1 189 ? 71.344 -16.424 -4.483  1.00 14.90  ? 186  PRO A C     1 
ATOM   1466 O  O     . PRO A 1 189 ? 70.842 -15.302 -4.538  1.00 14.76  ? 186  PRO A O     1 
ATOM   1467 C  CB    . PRO A 1 189 ? 70.011 -18.498 -4.915  1.00 16.64  ? 186  PRO A CB    1 
ATOM   1468 C  CG    . PRO A 1 189 ? 70.269 -19.737 -5.700  1.00 22.22  ? 186  PRO A CG    1 
ATOM   1469 C  CD    . PRO A 1 189 ? 71.749 -19.735 -5.925  1.00 17.94  ? 186  PRO A CD    1 
ATOM   1470 N  N     . ASP A 1 190 ? 72.192 -16.791 -3.524  1.00 13.80  ? 187  ASP A N     1 
ATOM   1471 C  CA    . ASP A 1 190 ? 72.588 -15.838 -2.486  1.00 12.99  ? 187  ASP A CA    1 
ATOM   1472 C  C     . ASP A 1 190 ? 73.312 -14.648 -3.095  1.00 13.73  ? 187  ASP A C     1 
ATOM   1473 O  O     . ASP A 1 190 ? 73.077 -13.497 -2.698  1.00 13.00  ? 187  ASP A O     1 
ATOM   1474 C  CB    . ASP A 1 190 ? 73.488 -16.502 -1.429  1.00 14.36  ? 187  ASP A CB    1 
ATOM   1475 C  CG    . ASP A 1 190 ? 72.726 -17.441 -0.505  1.00 16.67  ? 187  ASP A CG    1 
ATOM   1476 O  OD1   . ASP A 1 190 ? 71.485 -17.372 -0.447  1.00 13.65  ? 187  ASP A OD1   1 
ATOM   1477 O  OD2   . ASP A 1 190 ? 73.374 -18.258 0.173   1.00 19.21  ? 187  ASP A OD2   1 
ATOM   1478 N  N     . LEU A 1 191 ? 74.188 -14.928 -4.060  1.00 12.75  ? 188  LEU A N     1 
ATOM   1479 C  CA    . LEU A 1 191 ? 74.921 -13.876 -4.755  1.00 15.33  ? 188  LEU A CA    1 
ATOM   1480 C  C     . LEU A 1 191 ? 73.937 -13.000 -5.508  1.00 12.88  ? 188  LEU A C     1 
ATOM   1481 O  O     . LEU A 1 191 ? 74.045 -11.779 -5.492  1.00 14.11  ? 188  LEU A O     1 
ATOM   1482 C  CB    . LEU A 1 191 ? 75.961 -14.452 -5.724  1.00 17.77  ? 188  LEU A CB    1 
ATOM   1483 C  CG    . LEU A 1 191 ? 76.721 -13.413 -6.569  1.00 18.52  ? 188  LEU A CG    1 
ATOM   1484 C  CD1   . LEU A 1 191 ? 77.430 -12.401 -5.707  1.00 18.64  ? 188  LEU A CD1   1 
ATOM   1485 C  CD2   . LEU A 1 191 ? 77.725 -14.082 -7.509  1.00 19.22  ? 188  LEU A CD2   1 
ATOM   1486 N  N     . GLN A 1 192 ? 72.984 -13.632 -6.180  1.00 11.32  ? 189  GLN A N     1 
ATOM   1487 C  CA    . GLN A 1 192 ? 71.982 -12.885 -6.943  1.00 15.08  ? 189  GLN A CA    1 
ATOM   1488 C  C     . GLN A 1 192 ? 71.157 -11.950 -6.055  1.00 15.73  ? 189  GLN A C     1 
ATOM   1489 O  O     . GLN A 1 192 ? 70.889 -10.806 -6.431  1.00 14.53  ? 189  GLN A O     1 
ATOM   1490 C  CB    . GLN A 1 192 ? 71.066 -13.849 -7.694  1.00 14.59  ? 189  GLN A CB    1 
ATOM   1491 C  CG    . GLN A 1 192 ? 71.812 -14.592 -8.793  1.00 17.94  ? 189  GLN A CG    1 
ATOM   1492 C  CD    . GLN A 1 192 ? 71.014 -15.714 -9.417  1.00 28.64  ? 189  GLN A CD    1 
ATOM   1493 O  OE1   . GLN A 1 192 ? 69.910 -16.030 -8.978  1.00 30.23  ? 189  GLN A OE1   1 
ATOM   1494 N  NE2   . GLN A 1 192 ? 71.576 -16.329 -10.454 1.00 35.06  ? 189  GLN A NE2   1 
ATOM   1495 N  N     . LEU A 1 193 ? 70.763 -12.426 -4.876  1.00 14.63  ? 190  LEU A N     1 
ATOM   1496 C  CA    . LEU A 1 193 ? 70.069 -11.554 -3.931  1.00 9.32   ? 190  LEU A CA    1 
ATOM   1497 C  C     . LEU A 1 193 ? 70.947 -10.379 -3.489  1.00 11.77  ? 190  LEU A C     1 
ATOM   1498 O  O     . LEU A 1 193 ? 70.463 -9.269  -3.266  1.00 14.84  ? 190  LEU A O     1 
ATOM   1499 C  CB    . LEU A 1 193 ? 69.617 -12.338 -2.691  1.00 10.81  ? 190  LEU A CB    1 
ATOM   1500 C  CG    . LEU A 1 193 ? 68.540 -13.411 -2.844  1.00 11.94  ? 190  LEU A CG    1 
ATOM   1501 C  CD1   . LEU A 1 193 ? 68.171 -14.005 -1.491  1.00 13.53  ? 190  LEU A CD1   1 
ATOM   1502 C  CD2   . LEU A 1 193 ? 67.300 -12.820 -3.512  1.00 13.62  ? 190  LEU A CD2   1 
ATOM   1503 N  N     . THR A 1 194 ? 72.227 -10.654 -3.278  1.00 14.84  ? 191  THR A N     1 
ATOM   1504 C  CA    . THR A 1 194 ? 73.136 -9.628  -2.800  1.00 12.49  ? 191  THR A CA    1 
ATOM   1505 C  C     . THR A 1 194 ? 73.265 -8.506  -3.819  1.00 14.23  ? 191  THR A C     1 
ATOM   1506 O  O     . THR A 1 194 ? 73.212 -7.329  -3.465  1.00 15.42  ? 191  THR A O     1 
ATOM   1507 C  CB    . THR A 1 194 ? 74.522 -10.203 -2.504  1.00 14.52  ? 191  THR A CB    1 
ATOM   1508 O  OG1   . THR A 1 194 ? 74.388 -11.285 -1.579  1.00 14.18  ? 191  THR A OG1   1 
ATOM   1509 C  CG2   . THR A 1 194 ? 75.420 -9.121  -1.882  1.00 13.47  ? 191  THR A CG2   1 
ATOM   1510 N  N     . VAL A 1 195 ? 73.413 -8.890  -5.083  1.00 14.25  ? 192  VAL A N     1 
ATOM   1511 C  CA    . VAL A 1 195 ? 73.486 -7.918  -6.173  1.00 15.16  ? 192  VAL A CA    1 
ATOM   1512 C  C     . VAL A 1 195 ? 72.140 -7.199  -6.288  1.00 15.85  ? 192  VAL A C     1 
ATOM   1513 O  O     . VAL A 1 195 ? 72.086 -5.995  -6.517  1.00 15.64  ? 192  VAL A O     1 
ATOM   1514 C  CB    . VAL A 1 195 ? 73.864 -8.591  -7.500  1.00 13.54  ? 192  VAL A CB    1 
ATOM   1515 C  CG1   . VAL A 1 195 ? 73.834 -7.578  -8.655  1.00 14.77  ? 192  VAL A CG1   1 
ATOM   1516 C  CG2   . VAL A 1 195 ? 75.257 -9.205  -7.390  1.00 18.12  ? 192  VAL A CG2   1 
ATOM   1517 N  N     . GLY A 1 196 ? 71.051 -7.940  -6.108  1.00 11.40  ? 193  GLY A N     1 
ATOM   1518 C  CA    . GLY A 1 196 ? 69.736 -7.322  -6.044  1.00 11.08  ? 193  GLY A CA    1 
ATOM   1519 C  C     . GLY A 1 196 ? 69.706 -6.219  -4.997  1.00 15.65  ? 193  GLY A C     1 
ATOM   1520 O  O     . GLY A 1 196 ? 69.192 -5.123  -5.244  1.00 14.42  ? 193  GLY A O     1 
ATOM   1521 N  N     . ALA A 1 197 ? 70.271 -6.500  -3.826  1.00 12.77  ? 194  ALA A N     1 
ATOM   1522 C  CA    . ALA A 1 197 ? 70.305 -5.527  -2.737  1.00 9.29   ? 194  ALA A CA    1 
ATOM   1523 C  C     . ALA A 1 197 ? 71.136 -4.287  -3.088  1.00 12.18  ? 194  ALA A C     1 
ATOM   1524 O  O     . ALA A 1 197 ? 70.763 -3.160  -2.737  1.00 13.07  ? 194  ALA A O     1 
ATOM   1525 C  CB    . ALA A 1 197 ? 70.827 -6.188  -1.458  1.00 15.56  ? 194  ALA A CB    1 
ATOM   1526 N  N     . VAL A 1 198 ? 72.239 -4.486  -3.807  1.00 13.66  ? 195  VAL A N     1 
ATOM   1527 C  CA    . VAL A 1 198 ? 73.046 -3.359  -4.289  1.00 11.17  ? 195  VAL A CA    1 
ATOM   1528 C  C     . VAL A 1 198 ? 72.216 -2.435  -5.191  1.00 15.05  ? 195  VAL A C     1 
ATOM   1529 O  O     . VAL A 1 198 ? 72.217 -1.210  -5.026  1.00 17.88  ? 195  VAL A O     1 
ATOM   1530 C  CB    . VAL A 1 198 ? 74.304 -3.856  -5.043  1.00 15.27  ? 195  VAL A CB    1 
ATOM   1531 C  CG1   . VAL A 1 198 ? 75.057 -2.683  -5.679  1.00 18.27  ? 195  VAL A CG1   1 
ATOM   1532 C  CG2   . VAL A 1 198 ? 75.212 -4.605  -4.086  1.00 17.21  ? 195  VAL A CG2   1 
ATOM   1533 N  N     . ILE A 1 199 ? 71.486 -3.029  -6.126  1.00 12.67  ? 196  ILE A N     1 
ATOM   1534 C  CA    . ILE A 1 199 ? 70.580 -2.267  -6.991  1.00 16.72  ? 196  ILE A CA    1 
ATOM   1535 C  C     . ILE A 1 199 ? 69.492 -1.536  -6.191  1.00 17.16  ? 196  ILE A C     1 
ATOM   1536 O  O     . ILE A 1 199 ? 69.172 -0.385  -6.471  1.00 12.82  ? 196  ILE A O     1 
ATOM   1537 C  CB    . ILE A 1 199 ? 69.952 -3.195  -8.049  1.00 14.21  ? 196  ILE A CB    1 
ATOM   1538 C  CG1   . ILE A 1 199 ? 71.052 -3.675  -9.002  1.00 15.09  ? 196  ILE A CG1   1 
ATOM   1539 C  CG2   . ILE A 1 199 ? 68.869 -2.470  -8.858  1.00 13.86  ? 196  ILE A CG2   1 
ATOM   1540 C  CD1   . ILE A 1 199 ? 70.639 -4.772  -9.930  1.00 15.70  ? 196  ILE A CD1   1 
ATOM   1541 N  N     . VAL A 1 200 ? 68.936 -2.177  -5.172  1.00 13.28  ? 197  VAL A N     1 
ATOM   1542 C  CA    . VAL A 1 200 ? 67.872 -1.526  -4.414  1.00 12.02  ? 197  VAL A CA    1 
ATOM   1543 C  C     . VAL A 1 200 ? 68.426 -0.349  -3.581  1.00 13.81  ? 197  VAL A C     1 
ATOM   1544 O  O     . VAL A 1 200 ? 67.727 0.651   -3.393  1.00 12.64  ? 197  VAL A O     1 
ATOM   1545 C  CB    . VAL A 1 200 ? 67.131 -2.565  -3.527  1.00 8.34   ? 197  VAL A CB    1 
ATOM   1546 C  CG1   . VAL A 1 200 ? 66.127 -1.875  -2.598  1.00 13.25  ? 197  VAL A CG1   1 
ATOM   1547 C  CG2   . VAL A 1 200 ? 66.424 -3.569  -4.421  1.00 11.36  ? 197  VAL A CG2   1 
ATOM   1548 N  N     . GLU A 1 201 ? 69.675 -0.446  -3.109  1.00 11.59  ? 198  GLU A N     1 
ATOM   1549 C  CA    . GLU A 1 201 ? 70.313 0.705   -2.453  1.00 13.28  ? 198  GLU A CA    1 
ATOM   1550 C  C     . GLU A 1 201 ? 70.308 1.883   -3.424  1.00 14.89  ? 198  GLU A C     1 
ATOM   1551 O  O     . GLU A 1 201 ? 69.998 3.017   -3.054  1.00 15.41  ? 198  GLU A O     1 
ATOM   1552 C  CB    . GLU A 1 201 ? 71.765 0.412   -2.022  1.00 14.47  ? 198  GLU A CB    1 
ATOM   1553 C  CG    . GLU A 1 201 ? 71.942 -0.628  -0.896  1.00 15.25  ? 198  GLU A CG    1 
ATOM   1554 C  CD    . GLU A 1 201 ? 71.871 -0.044  0.517   1.00 13.13  ? 198  GLU A CD    1 
ATOM   1555 O  OE1   . GLU A 1 201 ? 71.516 1.149   0.681   1.00 15.90  ? 198  GLU A OE1   1 
ATOM   1556 O  OE2   . GLU A 1 201 ? 72.149 -0.778  1.488   1.00 16.60  ? 198  GLU A OE2   1 
ATOM   1557 N  N     . GLU A 1 202 ? 70.667 1.591   -4.669  1.00 13.96  ? 199  GLU A N     1 
ATOM   1558 C  CA    . GLU A 1 202 ? 70.741 2.619   -5.714  1.00 14.03  ? 199  GLU A CA    1 
ATOM   1559 C  C     . GLU A 1 202 ? 69.361 3.197   -5.992  1.00 15.42  ? 199  GLU A C     1 
ATOM   1560 O  O     . GLU A 1 202 ? 69.191 4.418   -6.099  1.00 16.13  ? 199  GLU A O     1 
ATOM   1561 C  CB    . GLU A 1 202 ? 71.349 2.033   -6.992  1.00 16.93  ? 199  GLU A CB    1 
ATOM   1562 C  CG    . GLU A 1 202 ? 72.812 1.647   -6.793  1.00 18.07  ? 199  GLU A CG    1 
ATOM   1563 C  CD    . GLU A 1 202 ? 73.375 0.803   -7.928  1.00 23.45  ? 199  GLU A CD    1 
ATOM   1564 O  OE1   . GLU A 1 202 ? 74.584 0.485   -7.888  1.00 30.51  ? 199  GLU A OE1   1 
ATOM   1565 O  OE2   . GLU A 1 202 ? 72.613 0.460   -8.855  1.00 25.61  ? 199  GLU A OE2   1 
ATOM   1566 N  N     . MET A 1 203 ? 68.374 2.307   -6.091  1.00 12.64  ? 200  MET A N     1 
ATOM   1567 C  CA    . MET A 1 203 ? 66.987 2.728   -6.290  1.00 12.16  ? 200  MET A CA    1 
ATOM   1568 C  C     . MET A 1 203 ? 66.494 3.620   -5.171  1.00 13.62  ? 200  MET A C     1 
ATOM   1569 O  O     . MET A 1 203 ? 65.878 4.666   -5.414  1.00 14.42  ? 200  MET A O     1 
ATOM   1570 C  CB    . MET A 1 203 ? 66.067 1.512   -6.401  1.00 13.83  ? 200  MET A CB    1 
ATOM   1571 C  CG    A MET A 1 203 ? 64.638 1.861   -6.716  0.32 11.36  ? 200  MET A CG    1 
ATOM   1572 C  CG    B MET A 1 203 ? 66.330 0.606   -7.574  0.68 13.15  ? 200  MET A CG    1 
ATOM   1573 S  SD    A MET A 1 203 ? 63.572 0.410   -6.740  0.32 14.48  ? 200  MET A SD    1 
ATOM   1574 S  SD    B MET A 1 203 ? 65.094 -0.707  -7.588  0.68 17.48  ? 200  MET A SD    1 
ATOM   1575 C  CE    A MET A 1 203 ? 63.953 -0.296  -8.336  0.32 15.74  ? 200  MET A CE    1 
ATOM   1576 C  CE    B MET A 1 203 ? 63.610 0.280   -7.685  0.68 10.81  ? 200  MET A CE    1 
ATOM   1577 N  N     . ARG A 1 204 ? 66.743 3.203   -3.930  1.00 11.83  ? 201  ARG A N     1 
ATOM   1578 C  CA    . ARG A 1 204 ? 66.278 3.963   -2.775  1.00 10.26  ? 201  ARG A CA    1 
ATOM   1579 C  C     . ARG A 1 204 ? 66.999 5.312   -2.647  1.00 14.13  ? 201  ARG A C     1 
ATOM   1580 O  O     . ARG A 1 204 ? 66.400 6.303   -2.238  1.00 12.22  ? 201  ARG A O     1 
ATOM   1581 C  CB    . ARG A 1 204 ? 66.428 3.137   -1.498  1.00 14.32  ? 201  ARG A CB    1 
ATOM   1582 C  CG    . ARG A 1 204 ? 65.428 1.964   -1.438  1.00 15.24  ? 201  ARG A CG    1 
ATOM   1583 C  CD    . ARG A 1 204 ? 65.563 1.118   -0.167  1.00 13.28  ? 201  ARG A CD    1 
ATOM   1584 N  NE    . ARG A 1 204 ? 65.639 1.958   1.016   1.00 14.88  ? 201  ARG A NE    1 
ATOM   1585 C  CZ    . ARG A 1 204 ? 66.737 2.124   1.749   1.00 14.29  ? 201  ARG A CZ    1 
ATOM   1586 N  NH1   . ARG A 1 204 ? 66.716 2.940   2.789   1.00 12.91  ? 201  ARG A NH1   1 
ATOM   1587 N  NH2   . ARG A 1 204 ? 67.858 1.479   1.448   1.00 14.48  ? 201  ARG A NH2   1 
ATOM   1588 N  N     . ALA A 1 205 ? 68.270 5.345   -3.038  1.00 13.99  ? 202  ALA A N     1 
ATOM   1589 C  CA    . ALA A 1 205 ? 69.036 6.587   -3.016  1.00 13.85  ? 202  ALA A CA    1 
ATOM   1590 C  C     . ALA A 1 205 ? 68.457 7.548   -4.062  1.00 13.12  ? 202  ALA A C     1 
ATOM   1591 O  O     . ALA A 1 205 ? 68.317 8.744   -3.802  1.00 14.82  ? 202  ALA A O     1 
ATOM   1592 C  CB    . ALA A 1 205 ? 70.535 6.303   -3.265  1.00 12.54  ? 202  ALA A CB    1 
ATOM   1593 N  N     . ALA A 1 206 ? 68.087 7.014   -5.229  1.00 11.03  ? 203  ALA A N     1 
ATOM   1594 C  CA    . ALA A 1 206 ? 67.480 7.832   -6.275  1.00 13.14  ? 203  ALA A CA    1 
ATOM   1595 C  C     . ALA A 1 206 ? 66.150 8.399   -5.817  1.00 13.94  ? 203  ALA A C     1 
ATOM   1596 O  O     . ALA A 1 206 ? 65.850 9.570   -6.056  1.00 15.53  ? 203  ALA A O     1 
ATOM   1597 C  CB    . ALA A 1 206 ? 67.302 7.027   -7.561  1.00 17.29  ? 203  ALA A CB    1 
ATOM   1598 N  N     . ILE A 1 207 ? 65.350 7.574   -5.142  1.00 11.08  ? 204  ILE A N     1 
ATOM   1599 C  CA    . ILE A 1 207 ? 64.060 8.051   -4.672  1.00 10.10  ? 204  ILE A CA    1 
ATOM   1600 C  C     . ILE A 1 207 ? 64.265 9.183   -3.681  1.00 12.85  ? 204  ILE A C     1 
ATOM   1601 O  O     . ILE A 1 207 ? 63.608 10.219  -3.760  1.00 11.65  ? 204  ILE A O     1 
ATOM   1602 C  CB    . ILE A 1 207 ? 63.245 6.919   -4.030  1.00 10.82  ? 204  ILE A CB    1 
ATOM   1603 C  CG1   . ILE A 1 207 ? 62.875 5.885   -5.093  1.00 13.20  ? 204  ILE A CG1   1 
ATOM   1604 C  CG2   . ILE A 1 207 ? 61.997 7.461   -3.347  1.00 11.38  ? 204  ILE A CG2   1 
ATOM   1605 C  CD1   . ILE A 1 207 ? 62.223 4.627   -4.517  1.00 15.88  ? 204  ILE A CD1   1 
ATOM   1606 N  N     . GLU A 1 208 ? 65.184 9.003   -2.745  1.00 14.05  ? 205  GLU A N     1 
ATOM   1607 C  CA    . GLU A 1 208 ? 65.362 10.046  -1.745  1.00 11.96  ? 205  GLU A CA    1 
ATOM   1608 C  C     . GLU A 1 208 ? 65.942 11.315  -2.378  1.00 11.93  ? 205  GLU A C     1 
ATOM   1609 O  O     . GLU A 1 208 ? 65.490 12.427  -2.090  1.00 13.62  ? 205  GLU A O     1 
ATOM   1610 C  CB    . GLU A 1 208 ? 66.251 9.565   -0.609  1.00 13.98  ? 205  GLU A CB    1 
ATOM   1611 C  CG    . GLU A 1 208 ? 66.331 10.596  0.511   1.00 15.37  ? 205  GLU A CG    1 
ATOM   1612 C  CD    . GLU A 1 208 ? 67.096 10.107  1.720   1.00 14.66  ? 205  GLU A CD    1 
ATOM   1613 O  OE1   . GLU A 1 208 ? 67.125 10.862  2.719   1.00 19.49  ? 205  GLU A OE1   1 
ATOM   1614 O  OE2   . GLU A 1 208 ? 67.687 9.004   1.661   1.00 19.46  ? 205  GLU A OE2   1 
ATOM   1615 N  N     . ARG A 1 209 ? 66.926 11.146  -3.258  1.00 14.86  ? 206  ARG A N     1 
ATOM   1616 C  CA    . ARG A 1 209 ? 67.547 12.301  -3.914  1.00 13.91  ? 206  ARG A CA    1 
ATOM   1617 C  C     . ARG A 1 209 ? 66.507 13.115  -4.662  1.00 12.79  ? 206  ARG A C     1 
ATOM   1618 O  O     . ARG A 1 209 ? 66.493 14.340  -4.565  1.00 15.61  ? 206  ARG A O     1 
ATOM   1619 C  CB    . ARG A 1 209 ? 68.664 11.878  -4.885  1.00 17.40  ? 206  ARG A CB    1 
ATOM   1620 C  CG    . ARG A 1 209 ? 69.458 13.085  -5.438  1.00 22.08  ? 206  ARG A CG    1 
ATOM   1621 C  CD    . ARG A 1 209 ? 70.509 12.709  -6.498  1.00 23.30  ? 206  ARG A CD    1 
ATOM   1622 N  NE    . ARG A 1 209 ? 69.924 12.475  -7.821  1.00 25.54  ? 206  ARG A NE    1 
ATOM   1623 C  CZ    . ARG A 1 209 ? 69.533 13.437  -8.656  1.00 23.44  ? 206  ARG A CZ    1 
ATOM   1624 N  NH1   . ARG A 1 209 ? 69.010 13.121  -9.835  1.00 22.09  ? 206  ARG A NH1   1 
ATOM   1625 N  NH2   . ARG A 1 209 ? 69.663 14.715  -8.319  1.00 20.96  ? 206  ARG A NH2   1 
ATOM   1626 N  N     . GLU A 1 210 ? 65.631 12.433  -5.398  1.00 11.68  ? 207  GLU A N     1 
ATOM   1627 C  CA    . GLU A 1 210 ? 64.796 13.103  -6.397  1.00 9.10   ? 207  GLU A CA    1 
ATOM   1628 C  C     . GLU A 1 210 ? 63.423 13.502  -5.856  1.00 10.27  ? 207  GLU A C     1 
ATOM   1629 O  O     . GLU A 1 210 ? 62.706 14.282  -6.495  1.00 11.74  ? 207  GLU A O     1 
ATOM   1630 C  CB    . GLU A 1 210 ? 64.643 12.211  -7.636  1.00 13.15  ? 207  GLU A CB    1 
ATOM   1631 C  CG    . GLU A 1 210 ? 65.975 11.891  -8.260  1.00 11.17  ? 207  GLU A CG    1 
ATOM   1632 C  CD    . GLU A 1 210 ? 65.873 11.095  -9.525  1.00 19.22  ? 207  GLU A CD    1 
ATOM   1633 O  OE1   . GLU A 1 210 ? 64.825 11.160  -10.201 1.00 18.31  ? 207  GLU A OE1   1 
ATOM   1634 O  OE2   . GLU A 1 210 ? 66.866 10.416  -9.854  1.00 24.57  ? 207  GLU A OE2   1 
ATOM   1635 N  N     . THR A 1 211 ? 63.052 12.993  -4.678  1.00 11.52  ? 208  THR A N     1 
ATOM   1636 C  CA    . THR A 1 211 ? 61.757 13.371  -4.118  1.00 11.32  ? 208  THR A CA    1 
ATOM   1637 C  C     . THR A 1 211 ? 61.828 13.929  -2.714  1.00 13.26  ? 208  THR A C     1 
ATOM   1638 O  O     . THR A 1 211 ? 60.906 14.605  -2.289  1.00 14.04  ? 208  THR A O     1 
ATOM   1639 C  CB    . THR A 1 211 ? 60.772 12.177  -4.073  1.00 10.61  ? 208  THR A CB    1 
ATOM   1640 O  OG1   . THR A 1 211 ? 61.196 11.243  -3.074  1.00 10.83  ? 208  THR A OG1   1 
ATOM   1641 C  CG2   . THR A 1 211 ? 60.678 11.485  -5.420  1.00 10.33  ? 208  THR A CG2   1 
ATOM   1642 N  N     . GLY A 1 212 ? 62.891 13.599  -1.979  1.00 11.72  ? 209  GLY A N     1 
ATOM   1643 C  CA    . GLY A 1 212 ? 62.969 13.925  -0.565  1.00 15.35  ? 209  GLY A CA    1 
ATOM   1644 C  C     . GLY A 1 212 ? 62.347 12.876  0.344   1.00 16.07  ? 209  GLY A C     1 
ATOM   1645 O  O     . GLY A 1 212 ? 62.395 13.009  1.567   1.00 19.28  ? 209  GLY A O     1 
ATOM   1646 N  N     . PHE A 1 213 ? 61.761 11.834  -0.244  1.00 13.26  ? 210  PHE A N     1 
ATOM   1647 C  CA    . PHE A 1 213 ? 61.084 10.801  0.536   1.00 13.90  ? 210  PHE A CA    1 
ATOM   1648 C  C     . PHE A 1 213 ? 62.018 9.634   0.832   1.00 14.23  ? 210  PHE A C     1 
ATOM   1649 O  O     . PHE A 1 213 ? 62.754 9.179   -0.045  1.00 13.56  ? 210  PHE A O     1 
ATOM   1650 C  CB    . PHE A 1 213 ? 59.854 10.268  -0.205  1.00 11.60  ? 210  PHE A CB    1 
ATOM   1651 C  CG    . PHE A 1 213 ? 58.854 11.321  -0.610  1.00 10.42  ? 210  PHE A CG    1 
ATOM   1652 C  CD1   . PHE A 1 213 ? 58.185 11.193  -1.816  1.00 12.15  ? 210  PHE A CD1   1 
ATOM   1653 C  CD2   . PHE A 1 213 ? 58.555 12.406  0.213   1.00 12.57  ? 210  PHE A CD2   1 
ATOM   1654 C  CE1   . PHE A 1 213 ? 57.245 12.127  -2.204  1.00 9.23   ? 210  PHE A CE1   1 
ATOM   1655 C  CE2   . PHE A 1 213 ? 57.620 13.347  -0.180  1.00 10.71  ? 210  PHE A CE2   1 
ATOM   1656 C  CZ    . PHE A 1 213 ? 56.959 13.201  -1.385  1.00 9.67   ? 210  PHE A CZ    1 
ATOM   1657 N  N     . GLN A 1 214 ? 61.973 9.154   2.072   1.00 11.53  ? 211  GLN A N     1 
ATOM   1658 C  CA    . GLN A 1 214 ? 62.696 7.959   2.479   1.00 12.75  ? 211  GLN A CA    1 
ATOM   1659 C  C     . GLN A 1 214 ? 61.799 6.732   2.401   1.00 9.68   ? 211  GLN A C     1 
ATOM   1660 O  O     . GLN A 1 214 ? 60.573 6.835   2.554   1.00 12.21  ? 211  GLN A O     1 
ATOM   1661 C  CB    . GLN A 1 214 ? 63.240 8.125   3.903   1.00 12.61  ? 211  GLN A CB    1 
ATOM   1662 C  CG    . GLN A 1 214 ? 64.453 9.053   3.921   1.00 14.80  ? 211  GLN A CG    1 
ATOM   1663 C  CD    . GLN A 1 214 ? 65.077 9.215   5.286   1.00 20.04  ? 211  GLN A CD    1 
ATOM   1664 O  OE1   . GLN A 1 214 ? 64.533 8.760   6.291   1.00 14.83  ? 211  GLN A OE1   1 
ATOM   1665 N  NE2   . GLN A 1 214 ? 66.244 9.857   5.324   1.00 19.87  ? 211  GLN A NE2   1 
ATOM   1666 N  N     . CYS A 1 215 ? 62.417 5.575   2.179   1.00 9.91   ? 212  CYS A N     1 
ATOM   1667 C  CA    . CYS A 1 215 ? 61.653 4.336   2.090   1.00 8.76   ? 212  CYS A CA    1 
ATOM   1668 C  C     . CYS A 1 215 ? 62.441 3.149   2.611   1.00 10.05  ? 212  CYS A C     1 
ATOM   1669 O  O     . CYS A 1 215 ? 63.638 3.238   2.868   1.00 12.98  ? 212  CYS A O     1 
ATOM   1670 C  CB    . CYS A 1 215 ? 61.223 4.085   0.641   1.00 9.19   ? 212  CYS A CB    1 
ATOM   1671 S  SG    . CYS A 1 215 ? 62.656 3.881   -0.478  1.00 18.05  ? 212  CYS A SG    1 
ATOM   1672 N  N     . SER A 1 216 ? 61.746 2.032   2.776   1.00 10.23  ? 213  SER A N     1 
ATOM   1673 C  CA    . SER A 1 216 ? 62.374 0.788   3.162   1.00 11.38  ? 213  SER A CA    1 
ATOM   1674 C  C     . SER A 1 216 ? 62.160 -0.211  2.043   1.00 9.90   ? 213  SER A C     1 
ATOM   1675 O  O     . SER A 1 216 ? 61.375 0.049   1.122   1.00 12.46  ? 213  SER A O     1 
ATOM   1676 C  CB    . SER A 1 216 ? 61.797 0.297   4.474   1.00 13.18  ? 213  SER A CB    1 
ATOM   1677 O  OG    . SER A 1 216 ? 62.109 1.235   5.491   1.00 13.83  ? 213  SER A OG    1 
ATOM   1678 N  N     . ALA A 1 217 ? 62.865 -1.338  2.099   1.00 9.73   ? 214  ALA A N     1 
ATOM   1679 C  CA    . ALA A 1 217 ? 62.728 -2.344  1.061   1.00 9.54   ? 214  ALA A CA    1 
ATOM   1680 C  C     . ALA A 1 217 ? 63.072 -3.713  1.563   1.00 11.30  ? 214  ALA A C     1 
ATOM   1681 O  O     . ALA A 1 217 ? 63.869 -3.855  2.488   1.00 10.83  ? 214  ALA A O     1 
ATOM   1682 C  CB    . ALA A 1 217 ? 63.607 -2.015  -0.136  1.00 9.76   ? 214  ALA A CB    1 
ATOM   1683 N  N     . GLY A 1 218 ? 62.500 -4.696  0.924   1.00 10.14  ? 215  GLY A N     1 
ATOM   1684 C  CA    . GLY A 1 218 ? 62.896 -6.064  1.101   1.00 10.39  ? 215  GLY A CA    1 
ATOM   1685 C  C     . GLY A 1 218 ? 63.338 -6.712  -0.192  1.00 11.43  ? 215  GLY A C     1 
ATOM   1686 O  O     . GLY A 1 218 ? 62.842 -6.399  -1.199  1.00 10.48  ? 215  GLY A O     1 
ATOM   1687 N  N     . ILE A 1 219 ? 64.335 -7.580  -0.071  1.00 8.79   ? 216  ILE A N     1 
ATOM   1688 C  CA    . ILE A 1 219 ? 64.879 -8.273  -1.204  1.00 10.41  ? 216  ILE A CA    1 
ATOM   1689 C  C     . ILE A 1 219 ? 64.835 -9.769  -0.895  1.00 12.76  ? 216  ILE A C     1 
ATOM   1690 O  O     . ILE A 1 219 ? 65.400 -10.197 0.042   1.00 10.94  ? 216  ILE A O     1 
ATOM   1691 C  CB    . ILE A 1 219 ? 66.346 -7.866  -1.514  1.00 10.69  ? 216  ILE A CB    1 
ATOM   1692 C  CG1   . ILE A 1 219 ? 66.498 -6.356  -1.713  1.00 13.19  ? 216  ILE A CG1   1 
ATOM   1693 C  CG2   . ILE A 1 219 ? 66.853 -8.557  -2.773  1.00 11.54  ? 216  ILE A CG2   1 
ATOM   1694 C  CD1   . ILE A 1 219 ? 66.884 -5.557  -0.497  1.00 13.37  ? 216  ILE A CD1   1 
ATOM   1695 N  N     . SER A 1 220 ? 64.155 -10.532 -1.734  1.00 11.89  ? 217  SER A N     1 
ATOM   1696 C  CA    . SER A 1 220 ? 64.122 -11.961 -1.581  1.00 9.22   ? 217  SER A CA    1 
ATOM   1697 C  C     . SER A 1 220 ? 63.857 -12.630 -2.918  1.00 11.59  ? 217  SER A C     1 
ATOM   1698 O  O     . SER A 1 220 ? 64.097 -12.045 -3.903  1.00 12.23  ? 217  SER A O     1 
ATOM   1699 C  CB    . SER A 1 220 ? 63.057 -12.376 -0.603  1.00 13.60  ? 217  SER A CB    1 
ATOM   1700 O  OG    . SER A 1 220 ? 63.310 -13.654 -0.166  1.00 12.38  ? 217  SER A OG    1 
ATOM   1701 N  N     . HIS A 1 221 ? 63.395 -13.862 -2.917  1.00 13.67  ? 218  HIS A N     1 
ATOM   1702 C  CA    . HIS A 1 221 ? 63.137 -14.577 -4.127  1.00 13.32  ? 218  HIS A CA    1 
ATOM   1703 C  C     . HIS A 1 221 ? 61.676 -14.563 -4.612  1.00 13.97  ? 218  HIS A C     1 
ATOM   1704 O  O     . HIS A 1 221 ? 61.372 -15.133 -5.582  1.00 12.44  ? 218  HIS A O     1 
ATOM   1705 C  CB    . HIS A 1 221 ? 63.555 -16.036 -3.947  1.00 13.15  ? 218  HIS A CB    1 
ATOM   1706 C  CG    . HIS A 1 221 ? 65.025 -16.236 -3.830  1.00 15.31  ? 218  HIS A CG    1 
ATOM   1707 N  ND1   . HIS A 1 221 ? 65.898 -15.900 -4.825  1.00 13.66  ? 218  HIS A ND1   1 
ATOM   1708 C  CD2   . HIS A 1 221 ? 65.772 -16.757 -2.837  1.00 12.96  ? 218  HIS A CD2   1 
ATOM   1709 C  CE1   . HIS A 1 221 ? 67.120 -16.204 -4.450  1.00 13.95  ? 218  HIS A CE1   1 
ATOM   1710 N  NE2   . HIS A 1 221 ? 67.070 -16.718 -3.245  1.00 16.10  ? 218  HIS A NE2   1 
ATOM   1711 N  N     . ASN A 1 222 ? 60.822 -13.907 -3.875  1.00 8.97   ? 219  ASN A N     1 
ATOM   1712 C  CA    . ASN A 1 222 ? 59.426 -13.830 -4.256  1.00 10.18  ? 219  ASN A CA    1 
ATOM   1713 C  C     . ASN A 1 222 ? 58.763 -12.651 -3.542  1.00 11.12  ? 219  ASN A C     1 
ATOM   1714 O  O     . ASN A 1 222 ? 59.372 -12.019 -2.680  1.00 12.19  ? 219  ASN A O     1 
ATOM   1715 C  CB    . ASN A 1 222 ? 58.692 -15.147 -3.965  1.00 8.91   ? 219  ASN A CB    1 
ATOM   1716 C  CG    . ASN A 1 222 ? 58.835 -15.587 -2.534  1.00 13.08  ? 219  ASN A CG    1 
ATOM   1717 O  OD1   . ASN A 1 222 ? 58.359 -14.907 -1.625  1.00 12.04  ? 219  ASN A OD1   1 
ATOM   1718 N  ND2   . ASN A 1 222 ? 59.472 -16.738 -2.317  1.00 14.05  ? 219  ASN A ND2   1 
ATOM   1719 N  N     . LYS A 1 223 ? 57.521 -12.358 -3.910  1.00 10.30  ? 220  LYS A N     1 
ATOM   1720 C  CA    . LYS A 1 223 ? 56.832 -11.183 -3.390  1.00 11.98  ? 220  LYS A CA    1 
ATOM   1721 C  C     . LYS A 1 223 ? 56.507 -11.274 -1.901  1.00 11.16  ? 220  LYS A C     1 
ATOM   1722 O  O     . LYS A 1 223 ? 56.666 -10.292 -1.160  1.00 10.83  ? 220  LYS A O     1 
ATOM   1723 C  CB    . LYS A 1 223 ? 55.548 -10.945 -4.190  1.00 13.13  ? 220  LYS A CB    1 
ATOM   1724 C  CG    . LYS A 1 223 ? 55.835 -10.492 -5.620  1.00 14.32  ? 220  LYS A CG    1 
ATOM   1725 C  CD    . LYS A 1 223 ? 54.617 -10.686 -6.544  1.00 24.79  ? 220  LYS A CD    1 
ATOM   1726 C  CE    . LYS A 1 223 ? 53.516 -9.701  -6.257  1.00 26.29  ? 220  LYS A CE    1 
ATOM   1727 N  NZ    . LYS A 1 223 ? 52.368 -9.827  -7.240  1.00 16.37  ? 220  LYS A NZ    1 
ATOM   1728 N  N     . VAL A 1 224 ? 56.033 -12.435 -1.450  1.00 9.88   ? 221  VAL A N     1 
ATOM   1729 C  CA    . VAL A 1 224 ? 55.642 -12.548 -0.043  1.00 10.56  ? 221  VAL A CA    1 
ATOM   1730 C  C     . VAL A 1 224 ? 56.859 -12.357 0.866   1.00 9.08   ? 221  VAL A C     1 
ATOM   1731 O  O     . VAL A 1 224 ? 56.775 -11.656 1.885   1.00 12.32  ? 221  VAL A O     1 
ATOM   1732 C  CB    . VAL A 1 224 ? 54.980 -13.901 0.266   1.00 12.79  ? 221  VAL A CB    1 
ATOM   1733 C  CG1   . VAL A 1 224 ? 54.952 -14.161 1.760   1.00 19.82  ? 221  VAL A CG1   1 
ATOM   1734 C  CG2   . VAL A 1 224 ? 53.571 -13.935 -0.301  1.00 14.17  ? 221  VAL A CG2   1 
ATOM   1735 N  N     . LEU A 1 225 ? 57.992 -12.963 0.501   1.00 8.92   ? 222  LEU A N     1 
ATOM   1736 C  CA    . LEU A 1 225 ? 59.187 -12.812 1.345   1.00 11.37  ? 222  LEU A CA    1 
ATOM   1737 C  C     . LEU A 1 225 ? 59.759 -11.400 1.228   1.00 11.70  ? 222  LEU A C     1 
ATOM   1738 O  O     . LEU A 1 225 ? 60.256 -10.843 2.207   1.00 10.68  ? 222  LEU A O     1 
ATOM   1739 C  CB    . LEU A 1 225 ? 60.266 -13.841 1.006   1.00 10.49  ? 222  LEU A CB    1 
ATOM   1740 C  CG    . LEU A 1 225 ? 59.962 -15.296 1.385   1.00 10.77  ? 222  LEU A CG    1 
ATOM   1741 C  CD1   . LEU A 1 225 ? 61.121 -16.218 0.987   1.00 10.10  ? 222  LEU A CD1   1 
ATOM   1742 C  CD2   . LEU A 1 225 ? 59.651 -15.419 2.866   1.00 10.47  ? 222  LEU A CD2   1 
ATOM   1743 N  N     . ALA A 1 226 ? 59.690 -10.811 0.040   1.00 10.67  ? 223  ALA A N     1 
ATOM   1744 C  CA    . ALA A 1 226 ? 60.120 -9.424  -0.098  1.00 10.33  ? 223  ALA A CA    1 
ATOM   1745 C  C     . ALA A 1 226 ? 59.303 -8.452  0.764   1.00 8.89   ? 223  ALA A C     1 
ATOM   1746 O  O     . ALA A 1 226 ? 59.867 -7.545  1.377   1.00 9.79   ? 223  ALA A O     1 
ATOM   1747 C  CB    . ALA A 1 226 ? 60.067 -9.012  -1.549  1.00 11.03  ? 223  ALA A CB    1 
ATOM   1748 N  N     . LYS A 1 227 ? 57.988 -8.655  0.823   1.00 9.84   ? 224  LYS A N     1 
ATOM   1749 C  CA    . LYS A 1 227 ? 57.106 -7.817  1.633   1.00 9.45   ? 224  LYS A CA    1 
ATOM   1750 C  C     . LYS A 1 227 ? 57.425 -7.970  3.114   1.00 10.12  ? 224  LYS A C     1 
ATOM   1751 O  O     . LYS A 1 227 ? 57.549 -6.988  3.858   1.00 12.31  ? 224  LYS A O     1 
ATOM   1752 C  CB    . LYS A 1 227 ? 55.635 -8.170  1.372   1.00 11.19  ? 224  LYS A CB    1 
ATOM   1753 C  CG    . LYS A 1 227 ? 54.669 -7.406  2.243   1.00 13.33  ? 224  LYS A CG    1 
ATOM   1754 C  CD    . LYS A 1 227 ? 54.796 -5.901  2.065   1.00 15.24  ? 224  LYS A CD    1 
ATOM   1755 C  CE    . LYS A 1 227 ? 53.731 -5.198  2.879   1.00 20.94  ? 224  LYS A CE    1 
ATOM   1756 N  NZ    . LYS A 1 227 ? 53.770 -3.706  2.753   1.00 14.64  ? 224  LYS A NZ    1 
ATOM   1757 N  N     . LEU A 1 228 ? 57.570 -9.219  3.531   1.00 11.05  ? 225  LEU A N     1 
ATOM   1758 C  CA    . LEU A 1 228 ? 57.855 -9.530  4.915   1.00 11.85  ? 225  LEU A CA    1 
ATOM   1759 C  C     . LEU A 1 228 ? 59.195 -8.926  5.317   1.00 11.28  ? 225  LEU A C     1 
ATOM   1760 O  O     . LEU A 1 228 ? 59.302 -8.233  6.346   1.00 11.06  ? 225  LEU A O     1 
ATOM   1761 C  CB    . LEU A 1 228 ? 57.844 -11.047 5.112   1.00 12.75  ? 225  LEU A CB    1 
ATOM   1762 C  CG    . LEU A 1 228 ? 58.093 -11.499 6.545   1.00 15.13  ? 225  LEU A CG    1 
ATOM   1763 C  CD1   . LEU A 1 228 ? 56.907 -11.114 7.440   1.00 21.36  ? 225  LEU A CD1   1 
ATOM   1764 C  CD2   . LEU A 1 228 ? 58.354 -12.996 6.591   1.00 15.37  ? 225  LEU A CD2   1 
ATOM   1765 N  N     . ALA A 1 229 ? 60.204 -9.146  4.472   1.00 11.72  ? 226  ALA A N     1 
ATOM   1766 C  CA    . ALA A 1 229 ? 61.535 -8.570  4.672   1.00 9.84   ? 226  ALA A CA    1 
ATOM   1767 C  C     . ALA A 1 229 ? 61.511 -7.055  4.853   1.00 10.84  ? 226  ALA A C     1 
ATOM   1768 O  O     . ALA A 1 229 ? 62.203 -6.521  5.722   1.00 13.10  ? 226  ALA A O     1 
ATOM   1769 C  CB    . ALA A 1 229 ? 62.461 -8.935  3.489   1.00 10.82  ? 226  ALA A CB    1 
ATOM   1770 N  N     . CYS A 1 230 ? 60.730 -6.370  4.017   1.00 10.55  ? 227  CYS A N     1 
ATOM   1771 C  CA    . CYS A 1 230 ? 60.687 -4.915  4.017   1.00 10.86  ? 227  CYS A CA    1 
ATOM   1772 C  C     . CYS A 1 230 ? 60.367 -4.359  5.411   1.00 11.17  ? 227  CYS A C     1 
ATOM   1773 O  O     . CYS A 1 230 ? 61.005 -3.407  5.874   1.00 13.68  ? 227  CYS A O     1 
ATOM   1774 C  CB    . CYS A 1 230 ? 59.650 -4.429  3.002   1.00 9.29   ? 227  CYS A CB    1 
ATOM   1775 S  SG    . CYS A 1 230 ? 59.571 -2.625  2.899   1.00 12.03  ? 227  CYS A SG    1 
ATOM   1776 N  N     . GLY A 1 231 ? 59.406 -4.988  6.087   1.00 11.36  ? 228  GLY A N     1 
ATOM   1777 C  CA    . GLY A 1 231 ? 58.982 -4.530  7.392   1.00 12.71  ? 228  GLY A CA    1 
ATOM   1778 C  C     . GLY A 1 231 ? 59.947 -4.803  8.540   1.00 13.23  ? 228  GLY A C     1 
ATOM   1779 O  O     . GLY A 1 231 ? 59.794 -4.230  9.625   1.00 17.85  ? 228  GLY A O     1 
ATOM   1780 N  N     . LEU A 1 232 ? 60.938 -5.656  8.321   1.00 13.41  ? 229  LEU A N     1 
ATOM   1781 C  CA    . LEU A 1 232 ? 61.744 -6.151  9.439   1.00 14.43  ? 229  LEU A CA    1 
ATOM   1782 C  C     . LEU A 1 232 ? 62.642 -5.055  10.004  1.00 14.44  ? 229  LEU A C     1 
ATOM   1783 O  O     . LEU A 1 232 ? 62.988 -5.097  11.189  1.00 15.83  ? 229  LEU A O     1 
ATOM   1784 C  CB    . LEU A 1 232 ? 62.592 -7.357  9.016   1.00 13.02  ? 229  LEU A CB    1 
ATOM   1785 C  CG    . LEU A 1 232 ? 61.793 -8.636  8.719   1.00 16.32  ? 229  LEU A CG    1 
ATOM   1786 C  CD1   . LEU A 1 232 ? 62.695 -9.774  8.195   1.00 14.08  ? 229  LEU A CD1   1 
ATOM   1787 C  CD2   . LEU A 1 232 ? 61.001 -9.070  9.948   1.00 19.40  ? 229  LEU A CD2   1 
ATOM   1788 N  N     . ASN A 1 233 ? 63.024 -4.074  9.183   1.00 12.59  ? 230  ASN A N     1 
ATOM   1789 C  CA    . ASN A 1 233 ? 63.919 -3.027  9.685   1.00 12.43  ? 230  ASN A CA    1 
ATOM   1790 C  C     . ASN A 1 233 ? 63.563 -1.602  9.272   1.00 14.16  ? 230  ASN A C     1 
ATOM   1791 O  O     . ASN A 1 233 ? 64.450 -0.750  9.143   1.00 19.53  ? 230  ASN A O     1 
ATOM   1792 C  CB    . ASN A 1 233 ? 65.351 -3.343  9.269   1.00 13.67  ? 230  ASN A CB    1 
ATOM   1793 C  CG    . ASN A 1 233 ? 65.896 -4.557  9.983   1.00 17.65  ? 230  ASN A CG    1 
ATOM   1794 O  OD1   . ASN A 1 233 ? 66.254 -4.487  11.164  1.00 17.44  ? 230  ASN A OD1   1 
ATOM   1795 N  ND2   . ASN A 1 233 ? 65.960 -5.684  9.280   1.00 14.03  ? 230  ASN A ND2   1 
ATOM   1796 N  N     . LYS A 1 234 ? 62.268 -1.347  9.108   1.00 20.94  ? 231  LYS A N     1 
ATOM   1797 C  CA    . LYS A 1 234 ? 61.740 0.008   8.920   1.00 19.04  ? 231  LYS A CA    1 
ATOM   1798 C  C     . LYS A 1 234 ? 62.031 0.892   10.128  1.00 17.96  ? 231  LYS A C     1 
ATOM   1799 O  O     . LYS A 1 234 ? 62.004 0.418   11.274  1.00 21.43  ? 231  LYS A O     1 
ATOM   1800 C  CB    . LYS A 1 234 ? 60.225 -0.035  8.677   1.00 20.80  ? 231  LYS A CB    1 
ATOM   1801 C  CG    . LYS A 1 234 ? 59.835 -0.250  7.232   1.00 21.41  ? 231  LYS A CG    1 
ATOM   1802 C  CD    . LYS A 1 234 ? 58.339 -0.032  7.002   1.00 22.17  ? 231  LYS A CD    1 
ATOM   1803 C  CE    . LYS A 1 234 ? 58.017 0.126   5.507   1.00 19.37  ? 231  LYS A CE    1 
ATOM   1804 N  NZ    . LYS A 1 234 ? 58.036 1.567   5.117   1.00 14.82  ? 231  LYS A NZ    1 
ATOM   1805 N  N     . PRO A 1 235 ? 62.267 2.191   9.904   1.00 16.08  ? 232  PRO A N     1 
ATOM   1806 C  CA    . PRO A 1 235 ? 62.289 2.903   8.622   1.00 12.39  ? 232  PRO A CA    1 
ATOM   1807 C  C     . PRO A 1 235 ? 63.679 3.084   8.030   1.00 11.29  ? 232  PRO A C     1 
ATOM   1808 O  O     . PRO A 1 235 ? 64.697 2.853   8.711   1.00 13.83  ? 232  PRO A O     1 
ATOM   1809 C  CB    . PRO A 1 235 ? 61.710 4.264   8.994   1.00 15.08  ? 232  PRO A CB    1 
ATOM   1810 C  CG    . PRO A 1 235 ? 62.255 4.495   10.367  1.00 18.74  ? 232  PRO A CG    1 
ATOM   1811 C  CD    . PRO A 1 235 ? 62.312 3.135   11.035  1.00 20.59  ? 232  PRO A CD    1 
ATOM   1812 N  N     . ASN A 1 236 ? 63.701 3.509   6.766   1.00 13.50  ? 233  ASN A N     1 
ATOM   1813 C  CA    . ASN A 1 236 ? 64.914 3.938   6.078   1.00 12.92  ? 233  ASN A CA    1 
ATOM   1814 C  C     . ASN A 1 236 ? 66.000 2.868   6.024   1.00 10.02  ? 233  ASN A C     1 
ATOM   1815 O  O     . ASN A 1 236 ? 67.177 3.183   6.055   1.00 14.75  ? 233  ASN A O     1 
ATOM   1816 C  CB    . ASN A 1 236 ? 65.465 5.209   6.739   1.00 12.50  ? 233  ASN A CB    1 
ATOM   1817 C  CG    . ASN A 1 236 ? 66.440 5.966   5.840   1.00 11.93  ? 233  ASN A CG    1 
ATOM   1818 O  OD1   . ASN A 1 236 ? 66.341 5.919   4.616   1.00 18.91  ? 233  ASN A OD1   1 
ATOM   1819 N  ND2   . ASN A 1 236 ? 67.403 6.645   6.456   1.00 15.46  ? 233  ASN A ND2   1 
ATOM   1820 N  N     . ARG A 1 237 ? 65.597 1.603   5.935   1.00 11.41  ? 234  ARG A N     1 
ATOM   1821 C  CA    . ARG A 1 237 ? 66.569 0.522   5.816   1.00 13.58  ? 234  ARG A CA    1 
ATOM   1822 C  C     . ARG A 1 237 ? 66.019 -0.535  4.889   1.00 13.49  ? 234  ARG A C     1 
ATOM   1823 O  O     . ARG A 1 237 ? 64.820 -0.554  4.630   1.00 12.77  ? 234  ARG A O     1 
ATOM   1824 C  CB    . ARG A 1 237 ? 66.875 -0.126  7.176   1.00 13.84  ? 234  ARG A CB    1 
ATOM   1825 C  CG    . ARG A 1 237 ? 67.511 0.776   8.217   1.00 15.05  ? 234  ARG A CG    1 
ATOM   1826 C  CD    . ARG A 1 237 ? 68.966 1.058   7.885   1.00 22.81  ? 234  ARG A CD    1 
ATOM   1827 N  NE    . ARG A 1 237 ? 69.633 1.840   8.926   1.00 23.35  ? 234  ARG A NE    1 
ATOM   1828 C  CZ    . ARG A 1 237 ? 69.743 3.166   8.908   1.00 26.92  ? 234  ARG A CZ    1 
ATOM   1829 N  NH1   . ARG A 1 237 ? 69.235 3.871   7.903   1.00 24.20  ? 234  ARG A NH1   1 
ATOM   1830 N  NH2   . ARG A 1 237 ? 70.367 3.790   9.896   1.00 27.18  ? 234  ARG A NH2   1 
ATOM   1831 N  N     . GLN A 1 238 ? 66.882 -1.432  4.418   1.00 12.32  ? 235  GLN A N     1 
ATOM   1832 C  CA    . GLN A 1 238 ? 66.410 -2.543  3.594   1.00 8.99   ? 235  GLN A CA    1 
ATOM   1833 C  C     . GLN A 1 238 ? 66.928 -3.863  4.123   1.00 12.71  ? 235  GLN A C     1 
ATOM   1834 O  O     . GLN A 1 238 ? 67.982 -3.920  4.757   1.00 13.20  ? 235  GLN A O     1 
ATOM   1835 C  CB    . GLN A 1 238 ? 66.825 -2.364  2.134   1.00 11.85  ? 235  GLN A CB    1 
ATOM   1836 C  CG    . GLN A 1 238 ? 68.311 -2.118  1.928   1.00 10.55  ? 235  GLN A CG    1 
ATOM   1837 C  CD    . GLN A 1 238 ? 68.671 -1.904  0.462   1.00 14.85  ? 235  GLN A CD    1 
ATOM   1838 O  OE1   . GLN A 1 238 ? 68.316 -0.880  -0.141  1.00 14.22  ? 235  GLN A OE1   1 
ATOM   1839 N  NE2   . GLN A 1 238 ? 69.382 -2.862  -0.117  1.00 11.43  ? 235  GLN A NE2   1 
ATOM   1840 N  N     . THR A 1 239 ? 66.189 -4.936  3.853   1.00 10.53  ? 236  THR A N     1 
ATOM   1841 C  CA    . THR A 1 239 ? 66.498 -6.223  4.461   1.00 9.65   ? 236  THR A CA    1 
ATOM   1842 C  C     . THR A 1 239 ? 66.515 -7.310  3.404   1.00 12.85  ? 236  THR A C     1 
ATOM   1843 O  O     . THR A 1 239 ? 65.579 -7.405  2.608   1.00 12.66  ? 236  THR A O     1 
ATOM   1844 C  CB    . THR A 1 239 ? 65.458 -6.591  5.538   1.00 11.40  ? 236  THR A CB    1 
ATOM   1845 O  OG1   . THR A 1 239 ? 65.355 -5.516  6.464   1.00 13.12  ? 236  THR A OG1   1 
ATOM   1846 C  CG2   . THR A 1 239 ? 65.860 -7.869  6.284   1.00 14.34  ? 236  THR A CG2   1 
ATOM   1847 N  N     . LEU A 1 240 ? 67.569 -8.122  3.421   1.00 9.70   ? 237  LEU A N     1 
ATOM   1848 C  CA    . LEU A 1 240 ? 67.697 -9.272  2.530   1.00 8.14   ? 237  LEU A CA    1 
ATOM   1849 C  C     . LEU A 1 240 ? 67.267 -10.529 3.291   1.00 11.85  ? 237  LEU A C     1 
ATOM   1850 O  O     . LEU A 1 240 ? 67.847 -10.878 4.338   1.00 12.02  ? 237  LEU A O     1 
ATOM   1851 C  CB    . LEU A 1 240 ? 69.143 -9.402  2.010   1.00 10.27  ? 237  LEU A CB    1 
ATOM   1852 C  CG    . LEU A 1 240 ? 69.500 -10.430 0.929   1.00 11.07  ? 237  LEU A CG    1 
ATOM   1853 C  CD1   . LEU A 1 240 ? 70.804 -10.032 0.257   1.00 11.41  ? 237  LEU A CD1   1 
ATOM   1854 C  CD2   . LEU A 1 240 ? 69.629 -11.838 1.504   1.00 11.41  ? 237  LEU A CD2   1 
ATOM   1855 N  N     . VAL A 1 241 ? 66.245 -11.204 2.771   1.00 8.16   ? 238  VAL A N     1 
ATOM   1856 C  CA    . VAL A 1 241 ? 65.807 -12.487 3.322   1.00 11.53  ? 238  VAL A CA    1 
ATOM   1857 C  C     . VAL A 1 241 ? 66.190 -13.579 2.333   1.00 9.07   ? 238  VAL A C     1 
ATOM   1858 O  O     . VAL A 1 241 ? 65.599 -13.699 1.253   1.00 12.03  ? 238  VAL A O     1 
ATOM   1859 C  CB    . VAL A 1 241 ? 64.297 -12.493 3.607   1.00 10.84  ? 238  VAL A CB    1 
ATOM   1860 C  CG1   . VAL A 1 241 ? 63.743 -13.927 3.753   1.00 10.28  ? 238  VAL A CG1   1 
ATOM   1861 C  CG2   . VAL A 1 241 ? 63.999 -11.702 4.876   1.00 11.09  ? 238  VAL A CG2   1 
ATOM   1862 N  N     . SER A 1 242 ? 67.216 -14.343 2.688   1.00 11.43  ? 239  SER A N     1 
ATOM   1863 C  CA    . SER A 1 242 ? 67.689 -15.432 1.843   1.00 11.74  ? 239  SER A CA    1 
ATOM   1864 C  C     . SER A 1 242 ? 66.809 -16.666 1.967   1.00 12.06  ? 239  SER A C     1 
ATOM   1865 O  O     . SER A 1 242 ? 66.020 -16.798 2.915   1.00 12.03  ? 239  SER A O     1 
ATOM   1866 C  CB    . SER A 1 242 ? 69.128 -15.798 2.209   1.00 13.09  ? 239  SER A CB    1 
ATOM   1867 O  OG    . SER A 1 242 ? 69.173 -16.333 3.525   1.00 14.48  ? 239  SER A OG    1 
ATOM   1868 N  N     . HIS A 1 243 ? 66.952 -17.589 1.019   1.00 11.40  ? 240  HIS A N     1 
ATOM   1869 C  CA    . HIS A 1 243 ? 66.218 -18.837 1.101   1.00 11.55  ? 240  HIS A CA    1 
ATOM   1870 C  C     . HIS A 1 243 ? 66.581 -19.585 2.378   1.00 13.16  ? 240  HIS A C     1 
ATOM   1871 O  O     . HIS A 1 243 ? 65.714 -20.154 3.044   1.00 10.52  ? 240  HIS A O     1 
ATOM   1872 C  CB    . HIS A 1 243 ? 66.507 -19.715 -0.109  1.00 14.16  ? 240  HIS A CB    1 
ATOM   1873 C  CG    . HIS A 1 243 ? 65.733 -20.996 -0.116  1.00 14.54  ? 240  HIS A CG    1 
ATOM   1874 N  ND1   . HIS A 1 243 ? 64.387 -21.045 -0.402  1.00 15.79  ? 240  HIS A ND1   1 
ATOM   1875 C  CD2   . HIS A 1 243 ? 66.115 -22.272 0.137   1.00 18.98  ? 240  HIS A CD2   1 
ATOM   1876 C  CE1   . HIS A 1 243 ? 63.973 -22.300 -0.337  1.00 19.60  ? 240  HIS A CE1   1 
ATOM   1877 N  NE2   . HIS A 1 243 ? 65.004 -23.063 -0.015  1.00 15.58  ? 240  HIS A NE2   1 
ATOM   1878 N  N     . GLY A 1 244 ? 67.864 -19.561 2.718   1.00 13.14  ? 241  GLY A N     1 
ATOM   1879 C  CA    . GLY A 1 244 ? 68.352 -20.301 3.867   1.00 13.04  ? 241  GLY A CA    1 
ATOM   1880 C  C     . GLY A 1 244 ? 67.885 -19.723 5.189   1.00 11.07  ? 241  GLY A C     1 
ATOM   1881 O  O     . GLY A 1 244 ? 67.832 -20.433 6.188   1.00 14.00  ? 241  GLY A O     1 
ATOM   1882 N  N     . SER A 1 245 ? 67.525 -18.443 5.193   1.00 13.01  ? 242  SER A N     1 
ATOM   1883 C  CA    . SER A 1 245 ? 67.057 -17.807 6.420   1.00 11.58  ? 242  SER A CA    1 
ATOM   1884 C  C     . SER A 1 245 ? 65.618 -18.184 6.791   1.00 10.20  ? 242  SER A C     1 
ATOM   1885 O  O     . SER A 1 245 ? 65.168 -17.899 7.907   1.00 11.45  ? 242  SER A O     1 
ATOM   1886 C  CB    . SER A 1 245 ? 67.164 -16.276 6.303   1.00 12.87  ? 242  SER A CB    1 
ATOM   1887 O  OG    . SER A 1 245 ? 66.083 -15.743 5.549   1.00 11.11  ? 242  SER A OG    1 
ATOM   1888 N  N     . VAL A 1 246 ? 64.893 -18.808 5.863   1.00 9.64   ? 243  VAL A N     1 
ATOM   1889 C  CA    . VAL A 1 246 ? 63.465 -19.040 6.072   1.00 10.64  ? 243  VAL A CA    1 
ATOM   1890 C  C     . VAL A 1 246 ? 63.116 -19.988 7.244   1.00 11.69  ? 243  VAL A C     1 
ATOM   1891 O  O     . VAL A 1 246 ? 62.246 -19.647 8.053   1.00 11.63  ? 243  VAL A O     1 
ATOM   1892 C  CB    . VAL A 1 246 ? 62.811 -19.530 4.755   1.00 11.64  ? 243  VAL A CB    1 
ATOM   1893 C  CG1   . VAL A 1 246 ? 61.344 -19.898 4.973   1.00 12.67  ? 243  VAL A CG1   1 
ATOM   1894 C  CG2   . VAL A 1 246 ? 62.942 -18.439 3.707   1.00 13.66  ? 243  VAL A CG2   1 
ATOM   1895 N  N     . PRO A 1 247 ? 63.792 -21.153 7.382   1.00 10.18  ? 244  PRO A N     1 
ATOM   1896 C  CA    . PRO A 1 247 ? 63.400 -22.012 8.519   1.00 11.26  ? 244  PRO A CA    1 
ATOM   1897 C  C     . PRO A 1 247 ? 63.444 -21.331 9.900   1.00 11.80  ? 244  PRO A C     1 
ATOM   1898 O  O     . PRO A 1 247 ? 62.478 -21.451 10.656  1.00 12.63  ? 244  PRO A O     1 
ATOM   1899 C  CB    . PRO A 1 247 ? 64.426 -23.159 8.452   1.00 10.66  ? 244  PRO A CB    1 
ATOM   1900 C  CG    . PRO A 1 247 ? 64.663 -23.296 6.938   1.00 13.06  ? 244  PRO A CG    1 
ATOM   1901 C  CD    . PRO A 1 247 ? 64.762 -21.843 6.497   1.00 10.95  ? 244  PRO A CD    1 
ATOM   1902 N  N     . GLN A 1 248 ? 64.528 -20.637 10.227  1.00 11.37  ? 245  GLN A N     1 
ATOM   1903 C  CA    . GLN A 1 248 ? 64.576 -19.917 11.499  1.00 11.78  ? 245  GLN A CA    1 
ATOM   1904 C  C     . GLN A 1 248 ? 63.560 -18.771 11.546  1.00 13.48  ? 245  GLN A C     1 
ATOM   1905 O  O     . GLN A 1 248 ? 62.825 -18.623 12.525  1.00 13.24  ? 245  GLN A O     1 
ATOM   1906 C  CB    . GLN A 1 248 ? 65.992 -19.401 11.765  1.00 15.15  ? 245  GLN A CB    1 
ATOM   1907 C  CG    . GLN A 1 248 ? 66.981 -20.526 11.979  1.00 20.31  ? 245  GLN A CG    1 
ATOM   1908 C  CD    . GLN A 1 248 ? 68.079 -20.178 12.969  1.00 31.42  ? 245  GLN A CD    1 
ATOM   1909 O  OE1   . GLN A 1 248 ? 69.259 -20.097 12.608  1.00 29.70  ? 245  GLN A OE1   1 
ATOM   1910 N  NE2   . GLN A 1 248 ? 67.700 -20.001 14.232  1.00 36.93  ? 245  GLN A NE2   1 
ATOM   1911 N  N     . LEU A 1 249 ? 63.492 -17.979 10.482  1.00 10.79  ? 246  LEU A N     1 
ATOM   1912 C  CA    . LEU A 1 249 ? 62.527 -16.875 10.448  1.00 11.16  ? 246  LEU A CA    1 
ATOM   1913 C  C     . LEU A 1 249 ? 61.101 -17.366 10.662  1.00 9.51   ? 246  LEU A C     1 
ATOM   1914 O  O     . LEU A 1 249 ? 60.337 -16.805 11.459  1.00 12.81  ? 246  LEU A O     1 
ATOM   1915 C  CB    . LEU A 1 249 ? 62.630 -16.138 9.111   1.00 11.93  ? 246  LEU A CB    1 
ATOM   1916 C  CG    . LEU A 1 249 ? 61.726 -14.915 8.972   1.00 12.45  ? 246  LEU A CG    1 
ATOM   1917 C  CD1   . LEU A 1 249 ? 62.038 -13.865 10.038  1.00 14.22  ? 246  LEU A CD1   1 
ATOM   1918 C  CD2   . LEU A 1 249 ? 61.893 -14.337 7.582   1.00 16.05  ? 246  LEU A CD2   1 
ATOM   1919 N  N     . PHE A 1 250 ? 60.745 -18.436 9.967   1.00 10.80  ? 247  PHE A N     1 
ATOM   1920 C  CA    . PHE A 1 250 ? 59.366 -18.902 10.027  1.00 12.21  ? 247  PHE A CA    1 
ATOM   1921 C  C     . PHE A 1 250 ? 59.055 -19.682 11.298  1.00 11.06  ? 247  PHE A C     1 
ATOM   1922 O  O     . PHE A 1 250 ? 57.888 -19.864 11.620  1.00 11.86  ? 247  PHE A O     1 
ATOM   1923 C  CB    . PHE A 1 250 ? 59.030 -19.753 8.795   1.00 11.29  ? 247  PHE A CB    1 
ATOM   1924 C  CG    . PHE A 1 250 ? 58.593 -18.948 7.599   1.00 9.19   ? 247  PHE A CG    1 
ATOM   1925 C  CD1   . PHE A 1 250 ? 58.134 -19.590 6.464   1.00 11.76  ? 247  PHE A CD1   1 
ATOM   1926 C  CD2   . PHE A 1 250 ? 58.622 -17.559 7.620   1.00 12.26  ? 247  PHE A CD2   1 
ATOM   1927 C  CE1   . PHE A 1 250 ? 57.717 -18.880 5.359   1.00 12.31  ? 247  PHE A CE1   1 
ATOM   1928 C  CE2   . PHE A 1 250 ? 58.216 -16.833 6.507   1.00 12.81  ? 247  PHE A CE2   1 
ATOM   1929 C  CZ    . PHE A 1 250 ? 57.754 -17.503 5.377   1.00 11.60  ? 247  PHE A CZ    1 
ATOM   1930 N  N     . SER A 1 251 ? 60.079 -20.133 12.030  1.00 9.17   ? 248  SER A N     1 
ATOM   1931 C  CA    . SER A 1 251 ? 59.816 -21.002 13.186  1.00 11.73  ? 248  SER A CA    1 
ATOM   1932 C  C     . SER A 1 251 ? 59.098 -20.267 14.329  1.00 10.96  ? 248  SER A C     1 
ATOM   1933 O  O     . SER A 1 251 ? 58.444 -20.896 15.145  1.00 10.04  ? 248  SER A O     1 
ATOM   1934 C  CB    . SER A 1 251 ? 61.120 -21.631 13.703  1.00 12.35  ? 248  SER A CB    1 
ATOM   1935 O  OG    . SER A 1 251 ? 61.937 -20.667 14.330  1.00 12.91  ? 248  SER A OG    1 
ATOM   1936 N  N     . GLN A 1 252 ? 59.198 -18.941 14.370  1.00 13.12  ? 249  GLN A N     1 
ATOM   1937 C  CA    . GLN A 1 252 ? 58.473 -18.163 15.365  1.00 13.86  ? 249  GLN A CA    1 
ATOM   1938 C  C     . GLN A 1 252 ? 57.618 -17.050 14.748  1.00 13.90  ? 249  GLN A C     1 
ATOM   1939 O  O     . GLN A 1 252 ? 57.287 -16.060 15.419  1.00 16.34  ? 249  GLN A O     1 
ATOM   1940 C  CB    . GLN A 1 252 ? 59.436 -17.538 16.354  1.00 18.17  ? 249  GLN A CB    1 
ATOM   1941 C  CG    . GLN A 1 252 ? 60.300 -18.507 17.098  1.00 20.69  ? 249  GLN A CG    1 
ATOM   1942 C  CD    . GLN A 1 252 ? 61.104 -17.786 18.152  1.00 21.41  ? 249  GLN A CD    1 
ATOM   1943 O  OE1   . GLN A 1 252 ? 60.634 -17.590 19.276  1.00 22.55  ? 249  GLN A OE1   1 
ATOM   1944 N  NE2   . GLN A 1 252 ? 62.296 -17.332 17.781  1.00 22.80  ? 249  GLN A NE2   1 
ATOM   1945 N  N     . MET A 1 253 ? 57.276 -17.205 13.478  1.00 10.94  ? 250  MET A N     1 
ATOM   1946 C  CA    . MET A 1 253 ? 56.544 -16.168 12.755  1.00 14.50  ? 250  MET A CA    1 
ATOM   1947 C  C     . MET A 1 253 ? 55.061 -16.454 12.797  1.00 11.20  ? 250  MET A C     1 
ATOM   1948 O  O     . MET A 1 253 ? 54.615 -17.431 12.212  1.00 12.34  ? 250  MET A O     1 
ATOM   1949 C  CB    . MET A 1 253 ? 57.025 -16.086 11.303  1.00 15.70  ? 250  MET A CB    1 
ATOM   1950 C  CG    . MET A 1 253 ? 56.324 -15.029 10.454  1.00 18.87  ? 250  MET A CG    1 
ATOM   1951 S  SD    . MET A 1 253 ? 56.711 -13.348 10.961  1.00 20.00  ? 250  MET A SD    1 
ATOM   1952 C  CE    . MET A 1 253 ? 58.506 -13.315 10.829  1.00 13.72  ? 250  MET A CE    1 
ATOM   1953 N  N     . PRO A 1 254 ? 54.280 -15.601 13.486  1.00 12.46  ? 251  PRO A N     1 
ATOM   1954 C  CA    . PRO A 1 254 ? 52.838 -15.873 13.505  1.00 13.28  ? 251  PRO A CA    1 
ATOM   1955 C  C     . PRO A 1 254 ? 52.280 -15.932 12.102  1.00 12.76  ? 251  PRO A C     1 
ATOM   1956 O  O     . PRO A 1 254 ? 52.684 -15.143 11.256  1.00 14.04  ? 251  PRO A O     1 
ATOM   1957 C  CB    . PRO A 1 254 ? 52.254 -14.678 14.272  1.00 16.03  ? 251  PRO A CB    1 
ATOM   1958 C  CG    . PRO A 1 254 ? 53.404 -14.208 15.142  1.00 16.28  ? 251  PRO A CG    1 
ATOM   1959 C  CD    . PRO A 1 254 ? 54.629 -14.401 14.262  1.00 15.08  ? 251  PRO A CD    1 
ATOM   1960 N  N     . ILE A 1 255 ? 51.369 -16.860 11.865  1.00 12.10  ? 252  ILE A N     1 
ATOM   1961 C  CA    . ILE A 1 255 ? 50.826 -17.062 10.536  1.00 12.94  ? 252  ILE A CA    1 
ATOM   1962 C  C     . ILE A 1 255 ? 50.214 -15.763 9.983   1.00 12.27  ? 252  ILE A C     1 
ATOM   1963 O  O     . ILE A 1 255 ? 50.330 -15.477 8.790   1.00 11.07  ? 252  ILE A O     1 
ATOM   1964 C  CB    . ILE A 1 255 ? 49.796 -18.222 10.550  1.00 13.93  ? 252  ILE A CB    1 
ATOM   1965 C  CG1   . ILE A 1 255 ? 50.558 -19.564 10.626  1.00 13.63  ? 252  ILE A CG1   1 
ATOM   1966 C  CG2   . ILE A 1 255 ? 48.873 -18.174 9.334   1.00 16.34  ? 252  ILE A CG2   1 
ATOM   1967 C  CD1   . ILE A 1 255 ? 49.825 -20.688 11.307  1.00 15.67  ? 252  ILE A CD1   1 
ATOM   1968 N  N     . ARG A 1 256 ? 49.605 -14.957 10.848  1.00 13.71  ? 253  ARG A N     1 
ATOM   1969 C  CA    . ARG A 1 256 ? 48.882 -13.771 10.381  1.00 12.64  ? 253  ARG A CA    1 
ATOM   1970 C  C     . ARG A 1 256 ? 49.794 -12.700 9.767   1.00 13.17  ? 253  ARG A C     1 
ATOM   1971 O  O     . ARG A 1 256 ? 49.319 -11.770 9.099   1.00 14.37  ? 253  ARG A O     1 
ATOM   1972 C  CB    . ARG A 1 256 ? 48.083 -13.160 11.534  1.00 13.90  ? 253  ARG A CB    1 
ATOM   1973 C  CG    . ARG A 1 256 ? 48.989 -12.559 12.611  1.00 15.25  ? 253  ARG A CG    1 
ATOM   1974 C  CD    . ARG A 1 256 ? 48.204 -11.966 13.769  1.00 22.41  ? 253  ARG A CD    1 
ATOM   1975 N  NE    . ARG A 1 256 ? 49.110 -11.445 14.794  1.00 22.43  ? 253  ARG A NE    1 
ATOM   1976 C  CZ    . ARG A 1 256 ? 49.565 -12.156 15.820  1.00 26.94  ? 253  ARG A CZ    1 
ATOM   1977 N  NH1   . ARG A 1 256 ? 49.192 -13.422 15.977  1.00 23.87  ? 253  ARG A NH1   1 
ATOM   1978 N  NH2   . ARG A 1 256 ? 50.392 -11.596 16.697  1.00 25.84  ? 253  ARG A NH2   1 
ATOM   1979 N  N     . LYS A 1 257 ? 51.103 -12.827 9.970   1.00 13.04  ? 254  LYS A N     1 
ATOM   1980 C  CA    . LYS A 1 257 ? 52.025 -11.810 9.480   1.00 12.67  ? 254  LYS A CA    1 
ATOM   1981 C  C     . LYS A 1 257 ? 52.275 -11.911 7.988   1.00 12.24  ? 254  LYS A C     1 
ATOM   1982 O  O     . LYS A 1 257 ? 52.839 -11.000 7.392   1.00 15.42  ? 254  LYS A O     1 
ATOM   1983 C  CB    . LYS A 1 257 ? 53.371 -11.887 10.206  1.00 13.76  ? 254  LYS A CB    1 
ATOM   1984 C  CG    . LYS A 1 257 ? 53.298 -11.646 11.706  1.00 21.22  ? 254  LYS A CG    1 
ATOM   1985 C  CD    . LYS A 1 257 ? 52.600 -10.342 12.058  1.00 20.53  ? 254  LYS A CD    1 
ATOM   1986 C  CE    . LYS A 1 257 ? 52.615 -10.118 13.569  1.00 32.41  ? 254  LYS A CE    1 
ATOM   1987 N  NZ    . LYS A 1 257 ? 51.987 -8.821  13.947  1.00 34.37  ? 254  LYS A NZ    1 
ATOM   1988 N  N     . ILE A 1 258 ? 51.894 -13.030 7.375   1.00 13.98  ? 255  ILE A N     1 
ATOM   1989 C  CA    . ILE A 1 258 ? 52.200 -13.275 5.981   1.00 13.79  ? 255  ILE A CA    1 
ATOM   1990 C  C     . ILE A 1 258 ? 51.081 -12.709 5.124   1.00 12.72  ? 255  ILE A C     1 
ATOM   1991 O  O     . ILE A 1 258 ? 49.967 -12.865 5.437   1.00 14.78  ? 255  ILE A O     1 
ATOM   1992 C  CB    . ILE A 1 258 ? 52.406 -14.797 5.702   1.00 12.21  ? 255  ILE A CB    1 
ATOM   1993 C  CG1   . ILE A 1 258 ? 53.844 -15.187 5.953   1.00 20.19  ? 255  ILE A CG1   1 
ATOM   1994 C  CG2   . ILE A 1 258 ? 52.209 -15.169 4.247   1.00 14.45  ? 255  ILE A CG2   1 
ATOM   1995 C  CD1   . ILE A 1 258 ? 54.302 -14.940 7.336   1.00 25.53  ? 255  ILE A CD1   1 
ATOM   1996 N  N     . ARG A 1 259 ? 51.446 -12.001 4.063   1.00 14.07  ? 256  ARG A N     1 
ATOM   1997 C  CA    . ARG A 1 259 ? 50.444 -11.324 3.289   1.00 14.79  ? 256  ARG A CA    1 
ATOM   1998 C  C     . ARG A 1 259 ? 49.440 -12.332 2.728   1.00 17.06  ? 256  ARG A C     1 
ATOM   1999 O  O     . ARG A 1 259 ? 49.802 -13.216 2.079   1.00 18.83  ? 256  ARG A O     1 
ATOM   2000 C  CB    . ARG A 1 259 ? 51.116 -10.546 2.147   1.00 15.15  ? 256  ARG A CB    1 
ATOM   2001 C  CG    . ARG A 1 259 ? 50.176 -9.645  1.382   1.00 15.42  ? 256  ARG A CG    1 
ATOM   2002 C  CD    . ARG A 1 259 ? 50.852 -8.968  0.204   1.00 19.31  ? 256  ARG A CD    1 
ATOM   2003 N  NE    . ARG A 1 259 ? 49.937 -8.087  -0.496  1.00 21.05  ? 256  ARG A NE    1 
ATOM   2004 C  CZ    . ARG A 1 259 ? 49.012 -8.534  -1.325  1.00 26.45  ? 256  ARG A CZ    1 
ATOM   2005 N  NH1   . ARG A 1 259 ? 48.175 -7.717  -1.926  1.00 25.33  ? 256  ARG A NH1   1 
ATOM   2006 N  NH2   . ARG A 1 259 ? 48.908 -9.814  -1.512  1.00 29.99  ? 256  ARG A NH2   1 
ATOM   2007 N  N     . SER A 1 260 ? 48.178 -12.025 2.958   1.00 13.89  ? 257  SER A N     1 
ATOM   2008 C  CA    . SER A 1 260 ? 46.990 -12.786 2.634   1.00 15.31  ? 257  SER A CA    1 
ATOM   2009 C  C     . SER A 1 260 ? 46.460 -13.670 3.737   1.00 16.91  ? 257  SER A C     1 
ATOM   2010 O  O     . SER A 1 260 ? 45.399 -14.178 3.608   1.00 15.74  ? 257  SER A O     1 
ATOM   2011 C  CB    . SER A 1 260 ? 47.132 -13.626 1.356   1.00 14.28  ? 257  SER A CB    1 
ATOM   2012 O  OG    . SER A 1 260 ? 47.672 -14.876 1.572   1.00 16.17  ? 257  SER A OG    1 
ATOM   2013 N  N     . LEU A 1 261 ? 47.224 -13.848 4.793   1.00 14.22  ? 258  LEU A N     1 
ATOM   2014 C  CA    . LEU A 1 261 ? 46.796 -14.675 5.921   1.00 12.63  ? 258  LEU A CA    1 
ATOM   2015 C  C     . LEU A 1 261 ? 46.398 -13.901 7.164   1.00 14.59  ? 258  LEU A C     1 
ATOM   2016 O  O     . LEU A 1 261 ? 46.241 -14.451 8.206   1.00 12.36  ? 258  LEU A O     1 
ATOM   2017 C  CB    . LEU A 1 261 ? 47.866 -15.699 6.286   1.00 14.13  ? 258  LEU A CB    1 
ATOM   2018 C  CG    . LEU A 1 261 ? 48.351 -16.595 5.162   1.00 13.38  ? 258  LEU A CG    1 
ATOM   2019 C  CD1   . LEU A 1 261 ? 49.409 -17.537 5.691   1.00 11.71  ? 258  LEU A CD1   1 
ATOM   2020 C  CD2   . LEU A 1 261 ? 47.216 -17.409 4.590   1.00 17.10  ? 258  LEU A CD2   1 
ATOM   2021 N  N     . GLY A 1 262 ? 46.260 -12.585 6.997   1.00 15.06  ? 259  GLY A N     1 
ATOM   2022 C  CA    . GLY A 1 262 ? 45.921 -11.756 8.140   1.00 16.78  ? 259  GLY A CA    1 
ATOM   2023 C  C     . GLY A 1 262 ? 44.443 -11.745 8.495   1.00 14.88  ? 259  GLY A C     1 
ATOM   2024 O  O     . GLY A 1 262 ? 44.046 -11.107 9.463   1.00 18.96  ? 259  GLY A O     1 
ATOM   2025 N  N     . GLY A 1 263 ? 43.634 -12.449 7.710   1.00 16.71  ? 260  GLY A N     1 
ATOM   2026 C  CA    . GLY A 1 263 ? 42.194 -12.453 7.880   1.00 16.43  ? 260  GLY A CA    1 
ATOM   2027 C  C     . GLY A 1 263 ? 41.615 -13.796 8.280   1.00 16.90  ? 260  GLY A C     1 
ATOM   2028 O  O     . GLY A 1 263 ? 42.211 -14.547 9.062   1.00 15.91  ? 260  GLY A O     1 
ATOM   2029 N  N     . LYS A 1 264 ? 40.439 -14.100 7.741   1.00 15.80  ? 261  LYS A N     1 
ATOM   2030 C  CA    . LYS A 1 264 ? 39.712 -15.308 8.105   1.00 16.55  ? 261  LYS A CA    1 
ATOM   2031 C  C     . LYS A 1 264 ? 40.456 -16.597 7.755   1.00 16.02  ? 261  LYS A C     1 
ATOM   2032 O  O     . LYS A 1 264 ? 40.426 -17.556 8.532   1.00 19.46  ? 261  LYS A O     1 
ATOM   2033 C  CB    . LYS A 1 264 ? 38.335 -15.312 7.424   1.00 15.12  ? 261  LYS A CB    1 
ATOM   2034 C  CG    . LYS A 1 264 ? 37.345 -14.356 8.045   1.00 26.50  ? 261  LYS A CG    1 
ATOM   2035 C  CD    . LYS A 1 264 ? 36.042 -14.350 7.247   1.00 27.76  ? 261  LYS A CD    1 
ATOM   2036 C  CE    . LYS A 1 264 ? 35.047 -13.332 7.789   1.00 39.51  ? 261  LYS A CE    1 
ATOM   2037 N  NZ    . LYS A 1 264 ? 33.781 -13.344 6.999   1.00 36.56  ? 261  LYS A NZ    1 
ATOM   2038 N  N     . LEU A 1 265 ? 41.095 -16.631 6.586   1.00 13.63  ? 262  LEU A N     1 
ATOM   2039 C  CA    . LEU A 1 265 ? 41.811 -17.831 6.169   1.00 11.99  ? 262  LEU A CA    1 
ATOM   2040 C  C     . LEU A 1 265 ? 42.931 -18.129 7.159   1.00 15.39  ? 262  LEU A C     1 
ATOM   2041 O  O     . LEU A 1 265 ? 43.095 -19.269 7.587   1.00 14.93  ? 262  LEU A O     1 
ATOM   2042 C  CB    . LEU A 1 265 ? 42.383 -17.692 4.757   1.00 14.64  ? 262  LEU A CB    1 
ATOM   2043 C  CG    . LEU A 1 265 ? 43.256 -18.845 4.231   1.00 17.71  ? 262  LEU A CG    1 
ATOM   2044 C  CD1   . LEU A 1 265 ? 42.480 -20.189 4.167   1.00 16.08  ? 262  LEU A CD1   1 
ATOM   2045 C  CD2   . LEU A 1 265 ? 43.898 -18.520 2.884   1.00 15.26  ? 262  LEU A CD2   1 
ATOM   2046 N  N     . GLY A 1 266 ? 43.702 -17.104 7.510   1.00 13.96  ? 263  GLY A N     1 
ATOM   2047 C  CA    . GLY A 1 266 ? 44.788 -17.283 8.457   1.00 12.47  ? 263  GLY A CA    1 
ATOM   2048 C  C     . GLY A 1 266 ? 44.283 -17.797 9.790   1.00 14.87  ? 263  GLY A C     1 
ATOM   2049 O  O     . GLY A 1 266 ? 44.868 -18.699 10.405  1.00 14.03  ? 263  GLY A O     1 
ATOM   2050 N  N     . ALA A 1 267 ? 43.174 -17.229 10.251  1.00 13.63  ? 264  ALA A N     1 
ATOM   2051 C  CA    . ALA A 1 267 ? 42.589 -17.690 11.502  1.00 16.86  ? 264  ALA A CA    1 
ATOM   2052 C  C     . ALA A 1 267 ? 42.111 -19.136 11.387  1.00 15.72  ? 264  ALA A C     1 
ATOM   2053 O  O     . ALA A 1 267 ? 42.131 -19.874 12.369  1.00 16.87  ? 264  ALA A O     1 
ATOM   2054 C  CB    . ALA A 1 267 ? 41.432 -16.775 11.924  1.00 17.98  ? 264  ALA A CB    1 
ATOM   2055 N  N     . SER A 1 268 ? 41.669 -19.545 10.197  1.00 14.40  ? 265  SER A N     1 
ATOM   2056 C  CA    . SER A 1 268 ? 41.191 -20.914 10.032  1.00 16.04  ? 265  SER A CA    1 
ATOM   2057 C  C     . SER A 1 268 ? 42.373 -21.894 10.015  1.00 14.37  ? 265  SER A C     1 
ATOM   2058 O  O     . SER A 1 268 ? 42.250 -23.031 10.482  1.00 17.51  ? 265  SER A O     1 
ATOM   2059 C  CB    . SER A 1 268 ? 40.338 -21.069 8.767   1.00 19.77  ? 265  SER A CB    1 
ATOM   2060 O  OG    . SER A 1 268 ? 41.103 -20.933 7.590   1.00 27.66  ? 265  SER A OG    1 
ATOM   2061 N  N     . VAL A 1 269 ? 43.507 -21.454 9.478   1.00 15.61  ? 266  VAL A N     1 
ATOM   2062 C  CA    . VAL A 1 269 ? 44.712 -22.288 9.488   1.00 14.27  ? 266  VAL A CA    1 
ATOM   2063 C  C     . VAL A 1 269 ? 45.083 -22.598 10.936  1.00 17.93  ? 266  VAL A C     1 
ATOM   2064 O  O     . VAL A 1 269 ? 45.330 -23.749 11.305  1.00 16.31  ? 266  VAL A O     1 
ATOM   2065 C  CB    . VAL A 1 269 ? 45.901 -21.622 8.778   1.00 11.85  ? 266  VAL A CB    1 
ATOM   2066 C  CG1   . VAL A 1 269 ? 47.160 -22.474 8.956   1.00 14.50  ? 266  VAL A CG1   1 
ATOM   2067 C  CG2   . VAL A 1 269 ? 45.600 -21.411 7.281   1.00 14.06  ? 266  VAL A CG2   1 
ATOM   2068 N  N     . ILE A 1 270 ? 45.090 -21.561 11.762  1.00 14.46  ? 267  ILE A N     1 
ATOM   2069 C  CA    . ILE A 1 270 ? 45.412 -21.705 13.174  1.00 16.78  ? 267  ILE A CA    1 
ATOM   2070 C  C     . ILE A 1 270 ? 44.429 -22.615 13.899  1.00 16.57  ? 267  ILE A C     1 
ATOM   2071 O  O     . ILE A 1 270 ? 44.828 -23.515 14.653  1.00 17.42  ? 267  ILE A O     1 
ATOM   2072 C  CB    . ILE A 1 270 ? 45.436 -20.324 13.851  1.00 14.72  ? 267  ILE A CB    1 
ATOM   2073 C  CG1   . ILE A 1 270 ? 46.624 -19.513 13.317  1.00 14.71  ? 267  ILE A CG1   1 
ATOM   2074 C  CG2   . ILE A 1 270 ? 45.449 -20.464 15.369  1.00 21.70  ? 267  ILE A CG2   1 
ATOM   2075 C  CD1   . ILE A 1 270 ? 46.534 -18.013 13.576  1.00 16.15  ? 267  ILE A CD1   1 
ATOM   2076 N  N     . GLU A 1 271 ? 43.138 -22.401 13.672  1.00 15.76  ? 268  GLU A N     1 
ATOM   2077 C  CA    . GLU A 1 271 ? 42.145 -23.177 14.414  1.00 19.86  ? 268  GLU A CA    1 
ATOM   2078 C  C     . GLU A 1 271 ? 42.073 -24.632 13.982  1.00 19.13  ? 268  GLU A C     1 
ATOM   2079 O  O     . GLU A 1 271 ? 42.011 -25.541 14.823  1.00 18.67  ? 268  GLU A O     1 
ATOM   2080 C  CB    . GLU A 1 271 ? 40.760 -22.552 14.288  1.00 25.83  ? 268  GLU A CB    1 
ATOM   2081 C  CG    . GLU A 1 271 ? 39.728 -23.297 15.124  1.00 40.35  ? 268  GLU A CG    1 
ATOM   2082 C  CD    . GLU A 1 271 ? 38.359 -22.672 15.069  1.00 50.38  ? 268  GLU A CD    1 
ATOM   2083 O  OE1   . GLU A 1 271 ? 38.190 -21.662 14.349  1.00 61.44  ? 268  GLU A OE1   1 
ATOM   2084 O  OE2   . GLU A 1 271 ? 37.452 -23.195 15.746  1.00 54.20  ? 268  GLU A OE2   1 
ATOM   2085 N  N     . ILE A 1 272 ? 42.057 -24.855 12.672  1.00 15.32  ? 269  ILE A N     1 
ATOM   2086 C  CA    . ILE A 1 272 ? 41.859 -26.186 12.137  1.00 15.36  ? 269  ILE A CA    1 
ATOM   2087 C  C     . ILE A 1 272 ? 43.067 -27.072 12.413  1.00 16.93  ? 269  ILE A C     1 
ATOM   2088 O  O     . ILE A 1 272 ? 42.928 -28.235 12.782  1.00 19.87  ? 269  ILE A O     1 
ATOM   2089 C  CB    . ILE A 1 272 ? 41.579 -26.139 10.619  1.00 14.46  ? 269  ILE A CB    1 
ATOM   2090 C  CG1   . ILE A 1 272 ? 40.203 -25.509 10.361  1.00 18.14  ? 269  ILE A CG1   1 
ATOM   2091 C  CG2   . ILE A 1 272 ? 41.673 -27.538 10.015  1.00 17.51  ? 269  ILE A CG2   1 
ATOM   2092 C  CD1   . ILE A 1 272 ? 39.851 -25.326 8.896   1.00 20.85  ? 269  ILE A CD1   1 
ATOM   2093 N  N     . LEU A 1 273 ? 44.257 -26.513 12.244  1.00 16.10  ? 270  LEU A N     1 
ATOM   2094 C  CA    . LEU A 1 273 ? 45.469 -27.314 12.359  1.00 13.79  ? 270  LEU A CA    1 
ATOM   2095 C  C     . LEU A 1 273 ? 46.051 -27.265 13.764  1.00 14.57  ? 270  LEU A C     1 
ATOM   2096 O  O     . LEU A 1 273 ? 46.933 -28.053 14.094  1.00 19.15  ? 270  LEU A O     1 
ATOM   2097 C  CB    . LEU A 1 273 ? 46.512 -26.842 11.352  1.00 18.10  ? 270  LEU A CB    1 
ATOM   2098 C  CG    . LEU A 1 273 ? 46.099 -26.931 9.881   1.00 14.79  ? 270  LEU A CG    1 
ATOM   2099 C  CD1   . LEU A 1 273 ? 47.218 -26.397 9.011   1.00 15.23  ? 270  LEU A CD1   1 
ATOM   2100 C  CD2   . LEU A 1 273 ? 45.745 -28.376 9.509   1.00 19.89  ? 270  LEU A CD2   1 
ATOM   2101 N  N     . GLY A 1 274 ? 45.591 -26.317 14.576  1.00 15.47  ? 271  GLY A N     1 
ATOM   2102 C  CA    . GLY A 1 274 ? 46.100 -26.183 15.930  1.00 16.07  ? 271  GLY A CA    1 
ATOM   2103 C  C     . GLY A 1 274 ? 47.552 -25.767 16.007  1.00 15.88  ? 271  GLY A C     1 
ATOM   2104 O  O     . GLY A 1 274 ? 48.311 -26.285 16.826  1.00 21.34  ? 271  GLY A O     1 
ATOM   2105 N  N     . ILE A 1 275 ? 47.940 -24.823 15.156  1.00 15.48  ? 272  ILE A N     1 
ATOM   2106 C  CA    . ILE A 1 275 ? 49.309 -24.327 15.116  1.00 13.55  ? 272  ILE A CA    1 
ATOM   2107 C  C     . ILE A 1 275 ? 49.337 -22.807 15.288  1.00 13.32  ? 272  ILE A C     1 
ATOM   2108 O  O     . ILE A 1 275 ? 48.286 -22.155 15.277  1.00 18.20  ? 272  ILE A O     1 
ATOM   2109 C  CB    . ILE A 1 275 ? 49.994 -24.713 13.791  1.00 11.56  ? 272  ILE A CB    1 
ATOM   2110 C  CG1   . ILE A 1 275 ? 49.232 -24.112 12.607  1.00 13.64  ? 272  ILE A CG1   1 
ATOM   2111 C  CG2   . ILE A 1 275 ? 50.065 -26.243 13.646  1.00 13.20  ? 272  ILE A CG2   1 
ATOM   2112 C  CD1   . ILE A 1 275 ? 49.942 -24.347 11.253  1.00 13.93  ? 272  ILE A CD1   1 
ATOM   2113 N  N     . GLU A 1 276 ? 50.532 -22.248 15.447  1.00 14.75  ? 273  GLU A N     1 
ATOM   2114 C  CA    . GLU A 1 276 ? 50.697 -20.801 15.616  1.00 13.99  ? 273  GLU A CA    1 
ATOM   2115 C  C     . GLU A 1 276 ? 51.630 -20.169 14.582  1.00 14.58  ? 273  GLU A C     1 
ATOM   2116 O  O     . GLU A 1 276 ? 51.445 -19.020 14.202  1.00 14.36  ? 273  GLU A O     1 
ATOM   2117 C  CB    . GLU A 1 276 ? 51.249 -20.461 16.994  1.00 16.10  ? 273  GLU A CB    1 
ATOM   2118 C  CG    . GLU A 1 276 ? 50.389 -20.853 18.180  1.00 25.78  ? 273  GLU A CG    1 
ATOM   2119 C  CD    . GLU A 1 276 ? 51.092 -20.582 19.506  1.00 33.28  ? 273  GLU A CD    1 
ATOM   2120 O  OE1   . GLU A 1 276 ? 51.149 -21.496 20.355  1.00 48.76  ? 273  GLU A OE1   1 
ATOM   2121 O  OE2   . GLU A 1 276 ? 51.591 -19.453 19.701  1.00 37.65  ? 273  GLU A OE2   1 
ATOM   2122 N  N     . TYR A 1 277 ? 52.654 -20.904 14.151  1.00 14.89  ? 274  TYR A N     1 
ATOM   2123 C  CA    . TYR A 1 277 ? 53.721 -20.288 13.359  1.00 13.16  ? 274  TYR A CA    1 
ATOM   2124 C  C     . TYR A 1 277 ? 53.809 -20.845 11.945  1.00 13.64  ? 274  TYR A C     1 
ATOM   2125 O  O     . TYR A 1 277 ? 53.439 -21.994 11.680  1.00 14.72  ? 274  TYR A O     1 
ATOM   2126 C  CB    . TYR A 1 277 ? 55.075 -20.463 14.063  1.00 14.69  ? 274  TYR A CB    1 
ATOM   2127 C  CG    . TYR A 1 277 ? 55.065 -19.972 15.491  1.00 15.40  ? 274  TYR A CG    1 
ATOM   2128 C  CD1   . TYR A 1 277 ? 55.323 -20.837 16.538  1.00 14.27  ? 274  TYR A CD1   1 
ATOM   2129 C  CD2   . TYR A 1 277 ? 54.770 -18.646 15.787  1.00 15.42  ? 274  TYR A CD2   1 
ATOM   2130 C  CE1   . TYR A 1 277 ? 55.303 -20.405 17.844  1.00 16.16  ? 274  TYR A CE1   1 
ATOM   2131 C  CE2   . TYR A 1 277 ? 54.738 -18.192 17.104  1.00 15.86  ? 274  TYR A CE2   1 
ATOM   2132 C  CZ    . TYR A 1 277 ? 55.010 -19.086 18.127  1.00 17.71  ? 274  TYR A CZ    1 
ATOM   2133 O  OH    . TYR A 1 277 ? 54.987 -18.677 19.442  1.00 21.43  ? 274  TYR A OH    1 
ATOM   2134 N  N     . MET A 1 278 ? 54.320 -20.020 11.039  1.00 10.93  ? 275  MET A N     1 
ATOM   2135 C  CA    . MET A 1 278 ? 54.392 -20.402 9.641   1.00 12.26  ? 275  MET A CA    1 
ATOM   2136 C  C     . MET A 1 278 ? 55.160 -21.701 9.476   1.00 12.02  ? 275  MET A C     1 
ATOM   2137 O  O     . MET A 1 278 ? 54.792 -22.549 8.666   1.00 12.28  ? 275  MET A O     1 
ATOM   2138 C  CB    . MET A 1 278 ? 55.047 -19.288 8.821   1.00 17.72  ? 275  MET A CB    1 
ATOM   2139 C  CG    . MET A 1 278 ? 54.626 -19.247 7.363   1.00 21.37  ? 275  MET A CG    1 
ATOM   2140 S  SD    . MET A 1 278 ? 52.852 -18.964 7.083   1.00 19.41  ? 275  MET A SD    1 
ATOM   2141 C  CE    . MET A 1 278 ? 52.792 -19.328 5.329   1.00 27.59  ? 275  MET A CE    1 
ATOM   2142 N  N     . GLY A 1 279 ? 56.222 -21.867 10.258  1.00 11.81  ? 276  GLY A N     1 
ATOM   2143 C  CA    . GLY A 1 279 ? 57.065 -23.045 10.112  1.00 12.40  ? 276  GLY A CA    1 
ATOM   2144 C  C     . GLY A 1 279 ? 56.348 -24.355 10.388  1.00 14.60  ? 276  GLY A C     1 
ATOM   2145 O  O     . GLY A 1 279 ? 56.673 -25.383 9.795   1.00 15.24  ? 276  GLY A O     1 
ATOM   2146 N  N     . GLU A 1 280 ? 55.367 -24.327 11.287  1.00 10.97  ? 277  GLU A N     1 
ATOM   2147 C  CA    . GLU A 1 280 ? 54.638 -25.527 11.644  1.00 12.22  ? 277  GLU A CA    1 
ATOM   2148 C  C     . GLU A 1 280 ? 53.839 -26.121 10.476  1.00 10.98  ? 277  GLU A C     1 
ATOM   2149 O  O     . GLU A 1 280 ? 53.466 -27.280 10.521  1.00 12.58  ? 277  GLU A O     1 
ATOM   2150 C  CB    . GLU A 1 280 ? 53.699 -25.236 12.820  1.00 11.32  ? 277  GLU A CB    1 
ATOM   2151 C  CG    . GLU A 1 280 ? 54.417 -24.851 14.098  1.00 12.94  ? 277  GLU A CG    1 
ATOM   2152 C  CD    . GLU A 1 280 ? 53.434 -24.594 15.221  1.00 15.89  ? 277  GLU A CD    1 
ATOM   2153 O  OE1   . GLU A 1 280 ? 53.080 -23.420 15.424  1.00 15.35  ? 277  GLU A OE1   1 
ATOM   2154 O  OE2   . GLU A 1 280 ? 53.014 -25.560 15.886  1.00 19.16  ? 277  GLU A OE2   1 
ATOM   2155 N  N     . LEU A 1 281 ? 53.597 -25.329 9.434   1.00 12.48  ? 278  LEU A N     1 
ATOM   2156 C  CA    . LEU A 1 281 ? 52.865 -25.824 8.271   1.00 11.93  ? 278  LEU A CA    1 
ATOM   2157 C  C     . LEU A 1 281 ? 53.623 -26.905 7.499   1.00 10.52  ? 278  LEU A C     1 
ATOM   2158 O  O     . LEU A 1 281 ? 53.009 -27.653 6.728   1.00 11.13  ? 278  LEU A O     1 
ATOM   2159 C  CB    . LEU A 1 281 ? 52.524 -24.667 7.326   1.00 11.29  ? 278  LEU A CB    1 
ATOM   2160 C  CG    . LEU A 1 281 ? 51.336 -23.791 7.738   1.00 12.12  ? 278  LEU A CG    1 
ATOM   2161 C  CD1   . LEU A 1 281 ? 51.348 -22.471 6.962   1.00 15.26  ? 278  LEU A CD1   1 
ATOM   2162 C  CD2   . LEU A 1 281 ? 50.028 -24.540 7.518   1.00 15.56  ? 278  LEU A CD2   1 
ATOM   2163 N  N     . THR A 1 282 ? 54.941 -26.980 7.676   1.00 13.23  ? 279  THR A N     1 
ATOM   2164 C  CA    . THR A 1 282 ? 55.730 -27.920 6.872   1.00 14.33  ? 279  THR A CA    1 
ATOM   2165 C  C     . THR A 1 282 ? 55.343 -29.364 7.193   1.00 12.62  ? 279  THR A C     1 
ATOM   2166 O  O     . THR A 1 282 ? 55.586 -30.264 6.405   1.00 15.29  ? 279  THR A O     1 
ATOM   2167 C  CB    . THR A 1 282 ? 57.267 -27.752 7.079   1.00 13.77  ? 279  THR A CB    1 
ATOM   2168 O  OG1   . THR A 1 282 ? 57.610 -28.025 8.450   1.00 15.31  ? 279  THR A OG1   1 
ATOM   2169 C  CG2   . THR A 1 282 ? 57.746 -26.343 6.682   1.00 12.86  ? 279  THR A CG2   1 
ATOM   2170 N  N     . GLN A 1 283 ? 54.741 -29.590 8.356   1.00 12.58  ? 280  GLN A N     1 
ATOM   2171 C  CA    . GLN A 1 283 ? 54.430 -30.960 8.765   1.00 15.32  ? 280  GLN A CA    1 
ATOM   2172 C  C     . GLN A 1 283 ? 53.160 -31.541 8.149   1.00 18.32  ? 280  GLN A C     1 
ATOM   2173 O  O     . GLN A 1 283 ? 52.758 -32.643 8.487   1.00 23.37  ? 280  GLN A O     1 
ATOM   2174 C  CB    . GLN A 1 283 ? 54.330 -31.013 10.288  1.00 15.74  ? 280  GLN A CB    1 
ATOM   2175 C  CG    A GLN A 1 283 ? 55.679 -30.805 10.917  0.60 12.42  ? 280  GLN A CG    1 
ATOM   2176 C  CG    B GLN A 1 283 ? 53.043 -30.438 10.820  0.40 15.75  ? 280  GLN A CG    1 
ATOM   2177 C  CD    A GLN A 1 283 ? 56.734 -31.663 10.247  0.60 14.40  ? 280  GLN A CD    1 
ATOM   2178 C  CD    B GLN A 1 283 ? 53.101 -30.166 12.304  0.40 22.77  ? 280  GLN A CD    1 
ATOM   2179 O  OE1   A GLN A 1 283 ? 56.696 -32.891 10.333  0.60 16.15  ? 280  GLN A OE1   1 
ATOM   2180 O  OE1   B GLN A 1 283 ? 53.454 -31.042 13.095  0.40 22.68  ? 280  GLN A OE1   1 
ATOM   2181 N  NE2   A GLN A 1 283 ? 57.674 -31.020 9.553   0.60 18.58  ? 280  GLN A NE2   1 
ATOM   2182 N  NE2   B GLN A 1 283 ? 52.770 -28.938 12.690  0.40 9.08   ? 280  GLN A NE2   1 
ATOM   2183 N  N     . PHE A 1 284 ? 52.521 -30.798 7.261   1.00 14.61  ? 281  PHE A N     1 
ATOM   2184 C  CA    . PHE A 1 284 ? 51.313 -31.286 6.607   1.00 12.46  ? 281  PHE A CA    1 
ATOM   2185 C  C     . PHE A 1 284 ? 51.595 -31.576 5.141   1.00 16.08  ? 281  PHE A C     1 
ATOM   2186 O  O     . PHE A 1 284 ? 52.402 -30.893 4.516   1.00 17.99  ? 281  PHE A O     1 
ATOM   2187 C  CB    . PHE A 1 284 ? 50.187 -30.272 6.773   1.00 13.83  ? 281  PHE A CB    1 
ATOM   2188 C  CG    . PHE A 1 284 ? 49.864 -30.006 8.210   1.00 15.97  ? 281  PHE A CG    1 
ATOM   2189 C  CD1   . PHE A 1 284 ? 49.053 -30.882 8.912   1.00 19.16  ? 281  PHE A CD1   1 
ATOM   2190 C  CD2   . PHE A 1 284 ? 50.421 -28.932 8.877   1.00 14.54  ? 281  PHE A CD2   1 
ATOM   2191 C  CE1   . PHE A 1 284 ? 48.772 -30.672 10.258  1.00 20.22  ? 281  PHE A CE1   1 
ATOM   2192 C  CE2   . PHE A 1 284 ? 50.143 -28.717 10.220  1.00 14.59  ? 281  PHE A CE2   1 
ATOM   2193 C  CZ    . PHE A 1 284 ? 49.311 -29.596 10.907  1.00 17.91  ? 281  PHE A CZ    1 
ATOM   2194 N  N     . THR A 1 285 ? 50.978 -32.622 4.604   1.00 16.14  ? 282  THR A N     1 
ATOM   2195 C  CA    . THR A 1 285 ? 51.141 -32.901 3.186   1.00 14.53  ? 282  THR A CA    1 
ATOM   2196 C  C     . THR A 1 285 ? 50.405 -31.853 2.389   1.00 12.04  ? 282  THR A C     1 
ATOM   2197 O  O     . THR A 1 285 ? 49.504 -31.196 2.906   1.00 13.49  ? 282  THR A O     1 
ATOM   2198 C  CB    . THR A 1 285 ? 50.605 -34.272 2.775   1.00 11.81  ? 282  THR A CB    1 
ATOM   2199 O  OG1   . THR A 1 285 ? 49.194 -34.315 3.002   1.00 18.01  ? 282  THR A OG1   1 
ATOM   2200 C  CG2   . THR A 1 285 ? 51.287 -35.376 3.566   1.00 20.96  ? 282  THR A CG2   1 
ATOM   2201 N  N     . GLU A 1 286 ? 50.779 -31.724 1.124   1.00 14.19  ? 283  GLU A N     1 
ATOM   2202 C  CA    . GLU A 1 286 ? 50.101 -30.798 0.229   1.00 15.59  ? 283  GLU A CA    1 
ATOM   2203 C  C     . GLU A 1 286 ? 48.619 -31.158 0.159   1.00 14.74  ? 283  GLU A C     1 
ATOM   2204 O  O     . GLU A 1 286 ? 47.755 -30.275 0.189   1.00 15.16  ? 283  GLU A O     1 
ATOM   2205 C  CB    . GLU A 1 286 ? 50.739 -30.810 -1.165  1.00 15.72  ? 283  GLU A CB    1 
ATOM   2206 C  CG    . GLU A 1 286 ? 50.135 -29.771 -2.090  1.00 13.51  ? 283  GLU A CG    1 
ATOM   2207 C  CD    . GLU A 1 286 ? 50.918 -29.592 -3.376  1.00 19.12  ? 283  GLU A CD    1 
ATOM   2208 O  OE1   . GLU A 1 286 ? 51.870 -30.361 -3.607  1.00 23.07  ? 283  GLU A OE1   1 
ATOM   2209 O  OE2   . GLU A 1 286 ? 50.574 -28.675 -4.156  1.00 22.60  ? 283  GLU A OE2   1 
ATOM   2210 N  N     A SER A 1 287 ? 48.329 -32.454 0.094   0.73 13.87  ? 284  SER A N     1 
ATOM   2211 N  N     B SER A 1 287 ? 48.328 -32.452 0.090   0.27 14.13  ? 284  SER A N     1 
ATOM   2212 C  CA    . SER A 1 287 ? 46.947 -32.913 0.028   1.00 15.31  ? 284  SER A CA    1 
ATOM   2213 C  C     . SER A 1 287 ? 46.190 -32.571 1.306   1.00 17.70  ? 284  SER A C     1 
ATOM   2214 O  O     . SER A 1 287 ? 45.009 -32.223 1.247   1.00 14.16  ? 284  SER A O     1 
ATOM   2215 C  CB    . SER A 1 287 ? 46.894 -34.421 -0.236  1.00 21.92  ? 284  SER A CB    1 
ATOM   2216 O  OG    A SER A 1 287 ? 47.505 -34.731 -1.474  0.73 22.05  ? 284  SER A OG    1 
ATOM   2217 O  OG    B SER A 1 287 ? 47.556 -35.148 0.782   0.27 18.27  ? 284  SER A OG    1 
ATOM   2218 N  N     . GLN A 1 288 ? 46.863 -32.639 2.456   1.00 15.46  ? 285  GLN A N     1 
ATOM   2219 C  CA    . GLN A 1 288 ? 46.204 -32.277 3.710   1.00 13.04  ? 285  GLN A CA    1 
ATOM   2220 C  C     . GLN A 1 288 ? 45.793 -30.807 3.693   1.00 12.27  ? 285  GLN A C     1 
ATOM   2221 O  O     . GLN A 1 288 ? 44.658 -30.457 4.041   1.00 13.69  ? 285  GLN A O     1 
ATOM   2222 C  CB    . GLN A 1 288 ? 47.110 -32.552 4.924   1.00 10.11  ? 285  GLN A CB    1 
ATOM   2223 C  CG    . GLN A 1 288 ? 47.138 -33.992 5.353   1.00 16.02  ? 285  GLN A CG    1 
ATOM   2224 C  CD    . GLN A 1 288 ? 48.111 -34.225 6.490   1.00 17.69  ? 285  GLN A CD    1 
ATOM   2225 O  OE1   . GLN A 1 288 ? 49.275 -33.837 6.418   1.00 18.88  ? 285  GLN A OE1   1 
ATOM   2226 N  NE2   . GLN A 1 288 ? 47.630 -34.854 7.559   1.00 27.81  ? 285  GLN A NE2   1 
ATOM   2227 N  N     . LEU A 1 289 ? 46.718 -29.938 3.289   1.00 14.34  ? 286  LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 289 ? 46.413 -28.514 3.255   1.00 13.75  ? 286  LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 289 ? 45.316 -28.198 2.230   1.00 13.11  ? 286  LEU A C     1 
ATOM   2230 O  O     . LEU A 1 289 ? 44.443 -27.358 2.478   1.00 13.84  ? 286  LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 289 ? 47.684 -27.710 2.965   1.00 12.78  ? 286  LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 289 ? 48.773 -27.847 4.036   1.00 11.66  ? 286  LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 289 ? 50.015 -27.045 3.630   1.00 11.61  ? 286  LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 289 ? 48.243 -27.452 5.413   1.00 13.55  ? 286  LEU A CD2   1 
ATOM   2235 N  N     . GLN A 1 290 ? 45.360 -28.873 1.085   1.00 13.12  ? 287  GLN A N     1 
ATOM   2236 C  CA    . GLN A 1 290 ? 44.324 -28.686 0.073   1.00 12.86  ? 287  GLN A CA    1 
ATOM   2237 C  C     . GLN A 1 290 ? 42.959 -29.128 0.584   1.00 14.63  ? 287  GLN A C     1 
ATOM   2238 O  O     . GLN A 1 290 ? 41.927 -28.521 0.258   1.00 16.28  ? 287  GLN A O     1 
ATOM   2239 C  CB    . GLN A 1 290 ? 44.679 -29.457 -1.199  1.00 16.67  ? 287  GLN A CB    1 
ATOM   2240 C  CG    . GLN A 1 290 ? 45.820 -28.857 -2.003  1.00 16.69  ? 287  GLN A CG    1 
ATOM   2241 C  CD    . GLN A 1 290 ? 46.213 -29.741 -3.167  1.00 18.55  ? 287  GLN A CD    1 
ATOM   2242 O  OE1   . GLN A 1 290 ? 46.200 -30.968 -3.059  1.00 18.33  ? 287  GLN A OE1   1 
ATOM   2243 N  NE2   . GLN A 1 290 ? 46.570 -29.122 -4.288  1.00 22.05  ? 287  GLN A NE2   1 
ATOM   2244 N  N     . SER A 1 291 ? 42.940 -30.180 1.395   1.00 13.38  ? 288  SER A N     1 
ATOM   2245 C  CA    . SER A 1 291 ? 41.664 -30.683 1.908   1.00 14.96  ? 288  SER A CA    1 
ATOM   2246 C  C     . SER A 1 291 ? 40.955 -29.669 2.804   1.00 18.83  ? 288  SER A C     1 
ATOM   2247 O  O     . SER A 1 291 ? 39.722 -29.576 2.808   1.00 24.17  ? 288  SER A O     1 
ATOM   2248 C  CB    . SER A 1 291 ? 41.869 -31.988 2.671   1.00 16.35  ? 288  SER A CB    1 
ATOM   2249 O  OG    A SER A 1 291 ? 42.466 -31.763 3.932   0.68 16.18  ? 288  SER A OG    1 
ATOM   2250 O  OG    B SER A 1 291 ? 40.631 -32.642 2.879   0.32 17.36  ? 288  SER A OG    1 
ATOM   2251 N  N     . HIS A 1 292 ? 41.732 -28.913 3.568   1.00 18.12  ? 289  HIS A N     1 
ATOM   2252 C  CA    . HIS A 1 292 ? 41.164 -27.923 4.475   1.00 18.75  ? 289  HIS A CA    1 
ATOM   2253 C  C     . HIS A 1 292 ? 40.934 -26.570 3.818   1.00 19.92  ? 289  HIS A C     1 
ATOM   2254 O  O     . HIS A 1 292 ? 39.956 -25.897 4.122   1.00 24.43  ? 289  HIS A O     1 
ATOM   2255 C  CB    . HIS A 1 292 ? 42.069 -27.712 5.687   1.00 19.28  ? 289  HIS A CB    1 
ATOM   2256 C  CG    . HIS A 1 292 ? 42.253 -28.927 6.541   1.00 19.71  ? 289  HIS A CG    1 
ATOM   2257 N  ND1   . HIS A 1 292 ? 41.219 -29.518 7.233   1.00 28.53  ? 289  HIS A ND1   1 
ATOM   2258 C  CD2   . HIS A 1 292 ? 43.365 -29.640 6.838   1.00 21.39  ? 289  HIS A CD2   1 
ATOM   2259 C  CE1   . HIS A 1 292 ? 41.685 -30.552 7.913   1.00 22.04  ? 289  HIS A CE1   1 
ATOM   2260 N  NE2   . HIS A 1 292 ? 42.981 -30.649 7.688   1.00 24.33  ? 289  HIS A NE2   1 
ATOM   2261 N  N     . PHE A 1 293 ? 41.838 -26.154 2.933   1.00 15.15  ? 290  PHE A N     1 
ATOM   2262 C  CA    . PHE A 1 293 ? 41.842 -24.756 2.514   1.00 18.07  ? 290  PHE A CA    1 
ATOM   2263 C  C     . PHE A 1 293 ? 41.592 -24.577 1.020   1.00 18.75  ? 290  PHE A C     1 
ATOM   2264 O  O     . PHE A 1 293 ? 41.620 -23.452 0.504   1.00 19.59  ? 290  PHE A O     1 
ATOM   2265 C  CB    . PHE A 1 293 ? 43.167 -24.107 2.956   1.00 15.66  ? 290  PHE A CB    1 
ATOM   2266 C  CG    . PHE A 1 293 ? 43.472 -24.339 4.417   1.00 15.43  ? 290  PHE A CG    1 
ATOM   2267 C  CD1   . PHE A 1 293 ? 42.635 -23.811 5.395   1.00 16.23  ? 290  PHE A CD1   1 
ATOM   2268 C  CD2   . PHE A 1 293 ? 44.562 -25.108 4.815   1.00 16.66  ? 290  PHE A CD2   1 
ATOM   2269 C  CE1   . PHE A 1 293 ? 42.882 -24.039 6.742   1.00 17.09  ? 290  PHE A CE1   1 
ATOM   2270 C  CE2   . PHE A 1 293 ? 44.823 -25.336 6.168   1.00 18.47  ? 290  PHE A CE2   1 
ATOM   2271 C  CZ    . PHE A 1 293 ? 43.977 -24.805 7.127   1.00 16.64  ? 290  PHE A CZ    1 
ATOM   2272 N  N     . GLY A 1 294 ? 41.302 -25.685 0.336   1.00 17.65  ? 291  GLY A N     1 
ATOM   2273 C  CA    . GLY A 1 294 ? 41.038 -25.644 -1.090  1.00 16.95  ? 291  GLY A CA    1 
ATOM   2274 C  C     . GLY A 1 294 ? 42.300 -25.930 -1.876  1.00 17.93  ? 291  GLY A C     1 
ATOM   2275 O  O     . GLY A 1 294 ? 43.406 -25.803 -1.349  1.00 17.09  ? 291  GLY A O     1 
ATOM   2276 N  N     . GLU A 1 295 ? 42.128 -26.301 -3.140  1.00 15.55  ? 292  GLU A N     1 
ATOM   2277 C  CA    . GLU A 1 295 ? 43.229 -26.679 -4.020  1.00 15.86  ? 292  GLU A CA    1 
ATOM   2278 C  C     . GLU A 1 295 ? 44.288 -25.588 -4.131  1.00 15.12  ? 292  GLU A C     1 
ATOM   2279 O  O     . GLU A 1 295 ? 45.482 -25.837 -3.963  1.00 15.95  ? 292  GLU A O     1 
ATOM   2280 C  CB    . GLU A 1 295 ? 42.687 -27.012 -5.414  1.00 16.53  ? 292  GLU A CB    1 
ATOM   2281 C  CG    . GLU A 1 295 ? 43.709 -27.562 -6.386  1.00 23.19  ? 292  GLU A CG    1 
ATOM   2282 C  CD    . GLU A 1 295 ? 43.086 -27.919 -7.727  1.00 43.74  ? 292  GLU A CD    1 
ATOM   2283 O  OE1   . GLU A 1 295 ? 43.833 -28.052 -8.719  1.00 53.14  ? 292  GLU A OE1   1 
ATOM   2284 O  OE2   . GLU A 1 295 ? 41.845 -28.066 -7.787  1.00 35.06  ? 292  GLU A OE2   1 
ATOM   2285 N  N     . LYS A 1 296 ? 43.835 -24.378 -4.438  1.00 17.26  ? 293  LYS A N     1 
ATOM   2286 C  CA    . LYS A 1 296 ? 44.727 -23.249 -4.667  1.00 15.21  ? 293  LYS A CA    1 
ATOM   2287 C  C     . LYS A 1 296 ? 45.453 -22.845 -3.386  1.00 13.60  ? 293  LYS A C     1 
ATOM   2288 O  O     . LYS A 1 296 ? 46.691 -22.749 -3.355  1.00 14.35  ? 293  LYS A O     1 
ATOM   2289 C  CB    . LYS A 1 296 ? 43.926 -22.062 -5.230  1.00 18.31  ? 293  LYS A CB    1 
ATOM   2290 C  CG    . LYS A 1 296 ? 44.744 -20.996 -5.922  1.00 23.88  ? 293  LYS A CG    1 
ATOM   2291 C  CD    . LYS A 1 296 ? 43.853 -20.071 -6.758  1.00 31.13  ? 293  LYS A CD    1 
ATOM   2292 C  CE    . LYS A 1 296 ? 44.529 -18.735 -7.033  1.00 35.48  ? 293  LYS A CE    1 
ATOM   2293 N  NZ    . LYS A 1 296 ? 44.664 -17.923 -5.796  1.00 40.66  ? 293  LYS A NZ    1 
ATOM   2294 N  N     . ASN A 1 297 ? 44.686 -22.622 -2.328  1.00 15.23  ? 294  ASN A N     1 
ATOM   2295 C  CA    . ASN A 1 297 ? 45.281 -22.195 -1.067  1.00 13.27  ? 294  ASN A CA    1 
ATOM   2296 C  C     . ASN A 1 297 ? 46.206 -23.257 -0.507  1.00 13.94  ? 294  ASN A C     1 
ATOM   2297 O  O     . ASN A 1 297 ? 47.249 -22.935 0.064   1.00 13.90  ? 294  ASN A O     1 
ATOM   2298 C  CB    . ASN A 1 297 ? 44.212 -21.894 -0.024  1.00 16.68  ? 294  ASN A CB    1 
ATOM   2299 C  CG    . ASN A 1 297 ? 43.518 -20.573 -0.251  1.00 20.44  ? 294  ASN A CG    1 
ATOM   2300 O  OD1   . ASN A 1 297 ? 44.082 -19.644 -0.828  1.00 22.13  ? 294  ASN A OD1   1 
ATOM   2301 N  ND2   . ASN A 1 297 ? 42.281 -20.478 0.220   1.00 22.18  ? 294  ASN A ND2   1 
ATOM   2302 N  N     . GLY A 1 298 ? 45.800 -24.521 -0.633  1.00 14.47  ? 295  GLY A N     1 
ATOM   2303 C  CA    . GLY A 1 298 ? 46.597 -25.620 -0.100  1.00 14.34  ? 295  GLY A CA    1 
ATOM   2304 C  C     . GLY A 1 298 ? 47.974 -25.723 -0.737  1.00 11.85  ? 295  GLY A C     1 
ATOM   2305 O  O     . GLY A 1 298 ? 48.979 -25.870 -0.042  1.00 13.64  ? 295  GLY A O     1 
ATOM   2306 N  N     . SER A 1 299 ? 48.031 -25.674 -2.065  1.00 11.02  ? 296  SER A N     1 
ATOM   2307 C  CA    . SER A 1 299 ? 49.307 -25.672 -2.774  1.00 11.91  ? 296  SER A CA    1 
ATOM   2308 C  C     . SER A 1 299 ? 50.121 -24.423 -2.433  1.00 12.40  ? 296  SER A C     1 
ATOM   2309 O  O     . SER A 1 299 ? 51.340 -24.493 -2.249  1.00 13.59  ? 296  SER A O     1 
ATOM   2310 C  CB    . SER A 1 299 ? 49.075 -25.749 -4.289  1.00 15.67  ? 296  SER A CB    1 
ATOM   2311 O  OG    . SER A 1 299 ? 48.598 -27.029 -4.660  1.00 16.09  ? 296  SER A OG    1 
ATOM   2312 N  N     . TRP A 1 300 ? 49.442 -23.283 -2.341  1.00 13.64  ? 297  TRP A N     1 
ATOM   2313 C  CA    . TRP A 1 300 ? 50.124 -22.039 -2.005  1.00 12.66  ? 297  TRP A CA    1 
ATOM   2314 C  C     . TRP A 1 300 ? 50.746 -22.144 -0.611  1.00 14.13  ? 297  TRP A C     1 
ATOM   2315 O  O     . TRP A 1 300 ? 51.926 -21.845 -0.449  1.00 12.60  ? 297  TRP A O     1 
ATOM   2316 C  CB    . TRP A 1 300 ? 49.174 -20.855 -2.092  1.00 11.13  ? 297  TRP A CB    1 
ATOM   2317 C  CG    . TRP A 1 300 ? 49.853 -19.530 -1.872  1.00 14.61  ? 297  TRP A CG    1 
ATOM   2318 C  CD1   . TRP A 1 300 ? 50.501 -18.773 -2.813  1.00 17.78  ? 297  TRP A CD1   1 
ATOM   2319 C  CD2   . TRP A 1 300 ? 49.951 -18.801 -0.637  1.00 15.08  ? 297  TRP A CD2   1 
ATOM   2320 N  NE1   . TRP A 1 300 ? 50.984 -17.616 -2.237  1.00 23.20  ? 297  TRP A NE1   1 
ATOM   2321 C  CE2   . TRP A 1 300 ? 50.662 -17.614 -0.902  1.00 17.88  ? 297  TRP A CE2   1 
ATOM   2322 C  CE3   . TRP A 1 300 ? 49.504 -19.035 0.667   1.00 17.25  ? 297  TRP A CE3   1 
ATOM   2323 C  CZ2   . TRP A 1 300 ? 50.928 -16.662 0.090   1.00 14.38  ? 297  TRP A CZ2   1 
ATOM   2324 C  CZ3   . TRP A 1 300 ? 49.772 -18.095 1.642   1.00 19.72  ? 297  TRP A CZ3   1 
ATOM   2325 C  CH2   . TRP A 1 300 ? 50.482 -16.932 1.354   1.00 16.42  ? 297  TRP A CH2   1 
ATOM   2326 N  N     . LEU A 1 301 ? 49.977 -22.604 0.375   1.00 10.38  ? 298  LEU A N     1 
ATOM   2327 C  CA    . LEU A 1 301 ? 50.537 -22.783 1.726   1.00 13.17  ? 298  LEU A CA    1 
ATOM   2328 C  C     . LEU A 1 301 ? 51.684 -23.802 1.786   1.00 12.63  ? 298  LEU A C     1 
ATOM   2329 O  O     . LEU A 1 301 ? 52.682 -23.583 2.477   1.00 10.76  ? 298  LEU A O     1 
ATOM   2330 C  CB    . LEU A 1 301 ? 49.441 -23.204 2.710   1.00 9.93   ? 298  LEU A CB    1 
ATOM   2331 C  CG    . LEU A 1 301 ? 48.398 -22.130 3.040   1.00 12.37  ? 298  LEU A CG    1 
ATOM   2332 C  CD1   . LEU A 1 301 ? 47.187 -22.770 3.696   1.00 14.19  ? 298  LEU A CD1   1 
ATOM   2333 C  CD2   . LEU A 1 301 ? 48.982 -21.045 3.937   1.00 15.08  ? 298  LEU A CD2   1 
ATOM   2334 N  N     . TYR A 1 302 ? 51.534 -24.920 1.086   1.00 12.62  ? 299  TYR A N     1 
ATOM   2335 C  CA    . TYR A 1 302 ? 52.573 -25.954 1.071   1.00 12.02  ? 299  TYR A CA    1 
ATOM   2336 C  C     . TYR A 1 302 ? 53.923 -25.386 0.604   1.00 13.69  ? 299  TYR A C     1 
ATOM   2337 O  O     . TYR A 1 302 ? 54.970 -25.636 1.212   1.00 12.48  ? 299  TYR A O     1 
ATOM   2338 C  CB    . TYR A 1 302 ? 52.154 -27.126 0.169   1.00 12.10  ? 299  TYR A CB    1 
ATOM   2339 C  CG    . TYR A 1 302 ? 53.158 -28.251 0.177   1.00 14.14  ? 299  TYR A CG    1 
ATOM   2340 C  CD1   . TYR A 1 302 ? 53.121 -29.223 1.167   1.00 16.22  ? 299  TYR A CD1   1 
ATOM   2341 C  CD2   . TYR A 1 302 ? 54.170 -28.316 -0.777  1.00 15.25  ? 299  TYR A CD2   1 
ATOM   2342 C  CE1   . TYR A 1 302 ? 54.044 -30.261 1.196   1.00 15.90  ? 299  TYR A CE1   1 
ATOM   2343 C  CE2   . TYR A 1 302 ? 55.107 -29.343 -0.748  1.00 20.15  ? 299  TYR A CE2   1 
ATOM   2344 C  CZ    . TYR A 1 302 ? 55.035 -30.307 0.244   1.00 21.59  ? 299  TYR A CZ    1 
ATOM   2345 O  OH    . TYR A 1 302 ? 55.950 -31.329 0.288   1.00 26.36  ? 299  TYR A OH    1 
ATOM   2346 N  N     . ALA A 1 303 ? 53.894 -24.608 -0.471  1.00 12.46  ? 300  ALA A N     1 
ATOM   2347 C  CA    . ALA A 1 303 ? 55.113 -24.001 -0.977  1.00 11.17  ? 300  ALA A CA    1 
ATOM   2348 C  C     . ALA A 1 303 ? 55.533 -22.819 -0.115  1.00 11.06  ? 300  ALA A C     1 
ATOM   2349 O  O     . ALA A 1 303 ? 56.725 -22.658 0.146   1.00 12.63  ? 300  ALA A O     1 
ATOM   2350 C  CB    . ALA A 1 303 ? 54.936 -23.547 -2.459  1.00 13.14  ? 300  ALA A CB    1 
ATOM   2351 N  N     . MET A 1 304 ? 54.580 -21.989 0.317   1.00 10.21  ? 301  MET A N     1 
ATOM   2352 C  CA    . MET A 1 304 ? 54.938 -20.762 1.034   1.00 9.34   ? 301  MET A CA    1 
ATOM   2353 C  C     . MET A 1 304 ? 55.676 -21.043 2.343   1.00 8.23   ? 301  MET A C     1 
ATOM   2354 O  O     . MET A 1 304 ? 56.621 -20.324 2.694   1.00 10.13  ? 301  MET A O     1 
ATOM   2355 C  CB    . MET A 1 304 ? 53.699 -19.913 1.332   1.00 15.00  ? 301  MET A CB    1 
ATOM   2356 C  CG    . MET A 1 304 ? 54.004 -18.479 1.753   1.00 17.23  ? 301  MET A CG    1 
ATOM   2357 S  SD    . MET A 1 304 ? 54.803 -17.536 0.432   1.00 17.56  ? 301  MET A SD    1 
ATOM   2358 C  CE    . MET A 1 304 ? 56.490 -17.457 1.057   1.00 15.26  ? 301  MET A CE    1 
ATOM   2359 N  N     . CYS A 1 305 ? 55.256 -22.067 3.075   1.00 12.04  ? 302  CYS A N     1 
ATOM   2360 C  CA    . CYS A 1 305 ? 55.906 -22.326 4.365   1.00 12.59  ? 302  CYS A CA    1 
ATOM   2361 C  C     . CYS A 1 305 ? 57.353 -22.841 4.209   1.00 11.72  ? 302  CYS A C     1 
ATOM   2362 O  O     . CYS A 1 305 ? 58.107 -22.882 5.190   1.00 13.68  ? 302  CYS A O     1 
ATOM   2363 C  CB    . CYS A 1 305 ? 55.081 -23.303 5.205   1.00 11.32  ? 302  CYS A CB    1 
ATOM   2364 S  SG    . CYS A 1 305 ? 55.066 -25.003 4.615   1.00 11.09  ? 302  CYS A SG    1 
ATOM   2365 N  N     . ARG A 1 306 ? 57.724 -23.204 2.985   1.00 10.57  ? 303  ARG A N     1 
ATOM   2366 C  CA    . ARG A 1 306 ? 59.092 -23.577 2.617   1.00 11.92  ? 303  ARG A CA    1 
ATOM   2367 C  C     . ARG A 1 306 ? 59.848 -22.400 1.949   1.00 11.88  ? 303  ARG A C     1 
ATOM   2368 O  O     . ARG A 1 306 ? 61.006 -22.542 1.537   1.00 16.85  ? 303  ARG A O     1 
ATOM   2369 C  CB    . ARG A 1 306 ? 59.060 -24.810 1.692   1.00 12.97  ? 303  ARG A CB    1 
ATOM   2370 C  CG    . ARG A 1 306 ? 58.563 -26.079 2.400   1.00 13.15  ? 303  ARG A CG    1 
ATOM   2371 C  CD    . ARG A 1 306 ? 58.201 -27.217 1.440   1.00 13.57  ? 303  ARG A CD    1 
ATOM   2372 N  NE    . ARG A 1 306 ? 57.970 -28.433 2.209   1.00 14.41  ? 303  ARG A NE    1 
ATOM   2373 C  CZ    . ARG A 1 306 ? 56.867 -28.674 2.914   1.00 14.35  ? 303  ARG A CZ    1 
ATOM   2374 N  NH1   . ARG A 1 306 ? 56.754 -29.808 3.601   1.00 13.79  ? 303  ARG A NH1   1 
ATOM   2375 N  NH2   . ARG A 1 306 ? 55.864 -27.795 2.917   1.00 11.63  ? 303  ARG A NH2   1 
ATOM   2376 N  N     . GLY A 1 307 ? 59.195 -21.244 1.848   1.00 9.85   ? 304  GLY A N     1 
ATOM   2377 C  CA    . GLY A 1 307 ? 59.842 -20.047 1.330   1.00 11.26  ? 304  GLY A CA    1 
ATOM   2378 C  C     . GLY A 1 307 ? 59.648 -19.867 -0.161  1.00 10.76  ? 304  GLY A C     1 
ATOM   2379 O  O     . GLY A 1 307 ? 60.319 -19.045 -0.790  1.00 12.52  ? 304  GLY A O     1 
ATOM   2380 N  N     . ILE A 1 308 ? 58.731 -20.639 -0.721  1.00 10.49  ? 305  ILE A N     1 
ATOM   2381 C  CA    . ILE A 1 308 ? 58.546 -20.700 -2.170  1.00 11.66  ? 305  ILE A CA    1 
ATOM   2382 C  C     . ILE A 1 308 ? 57.186 -20.150 -2.561  1.00 12.70  ? 305  ILE A C     1 
ATOM   2383 O  O     . ILE A 1 308 ? 56.166 -20.529 -2.002  1.00 12.56  ? 305  ILE A O     1 
ATOM   2384 C  CB    . ILE A 1 308 ? 58.695 -22.150 -2.679  1.00 14.54  ? 305  ILE A CB    1 
ATOM   2385 C  CG1   . ILE A 1 308 ? 60.104 -22.666 -2.347  1.00 16.97  ? 305  ILE A CG1   1 
ATOM   2386 C  CG2   . ILE A 1 308 ? 58.388 -22.236 -4.164  1.00 13.70  ? 305  ILE A CG2   1 
ATOM   2387 C  CD1   . ILE A 1 308 ? 60.296 -24.151 -2.599  1.00 25.15  ? 305  ILE A CD1   1 
ATOM   2388 N  N     . GLU A 1 309 ? 57.188 -19.244 -3.528  1.00 11.61  ? 306  GLU A N     1 
ATOM   2389 C  CA    . GLU A 1 309 ? 55.957 -18.669 -4.037  1.00 15.55  ? 306  GLU A CA    1 
ATOM   2390 C  C     . GLU A 1 309 ? 56.200 -18.272 -5.476  1.00 15.91  ? 306  GLU A C     1 
ATOM   2391 O  O     . GLU A 1 309 ? 57.292 -17.817 -5.819  1.00 16.73  ? 306  GLU A O     1 
ATOM   2392 C  CB    . GLU A 1 309 ? 55.520 -17.451 -3.218  1.00 21.20  ? 306  GLU A CB    1 
ATOM   2393 C  CG    . GLU A 1 309 ? 54.124 -17.027 -3.575  1.00 26.84  ? 306  GLU A CG    1 
ATOM   2394 C  CD    . GLU A 1 309 ? 53.854 -15.561 -3.371  1.00 22.79  ? 306  GLU A CD    1 
ATOM   2395 O  OE1   . GLU A 1 309 ? 54.794 -14.730 -3.454  1.00 17.66  ? 306  GLU A OE1   1 
ATOM   2396 O  OE2   . GLU A 1 309 ? 52.675 -15.239 -3.128  1.00 29.28  ? 306  GLU A OE2   1 
ATOM   2397 N  N     . HIS A 1 310 ? 55.195 -18.423 -6.329  1.00 19.04  ? 307  HIS A N     1 
ATOM   2398 C  CA    . HIS A 1 310 ? 55.461 -18.225 -7.742  1.00 20.34  ? 307  HIS A CA    1 
ATOM   2399 C  C     . HIS A 1 310 ? 54.782 -17.008 -8.353  1.00 17.44  ? 307  HIS A C     1 
ATOM   2400 O  O     . HIS A 1 310 ? 55.079 -16.672 -9.487  1.00 20.28  ? 307  HIS A O     1 
ATOM   2401 C  CB    . HIS A 1 310 ? 55.080 -19.495 -8.502  1.00 26.19  ? 307  HIS A CB    1 
ATOM   2402 C  CG    . HIS A 1 310 ? 55.995 -20.645 -8.217  1.00 30.27  ? 307  HIS A CG    1 
ATOM   2403 N  ND1   . HIS A 1 310 ? 57.369 -20.509 -8.165  1.00 34.03  ? 307  HIS A ND1   1 
ATOM   2404 C  CD2   . HIS A 1 310 ? 55.740 -21.941 -7.916  1.00 33.21  ? 307  HIS A CD2   1 
ATOM   2405 C  CE1   . HIS A 1 310 ? 57.917 -21.673 -7.875  1.00 32.61  ? 307  HIS A CE1   1 
ATOM   2406 N  NE2   . HIS A 1 310 ? 56.948 -22.560 -7.716  1.00 34.27  ? 307  HIS A NE2   1 
ATOM   2407 N  N     . ASP A 1 311 ? 53.921 -16.338 -7.590  1.00 14.30  ? 308  ASP A N     1 
ATOM   2408 C  CA    . ASP A 1 311 ? 53.163 -15.174 -8.079  1.00 16.75  ? 308  ASP A CA    1 
ATOM   2409 C  C     . ASP A 1 311 ? 54.061 -14.149 -8.777  1.00 17.28  ? 308  ASP A C     1 
ATOM   2410 O  O     . ASP A 1 311 ? 54.989 -13.623 -8.172  1.00 15.63  ? 308  ASP A O     1 
ATOM   2411 C  CB    . ASP A 1 311 ? 52.427 -14.514 -6.912  1.00 18.63  ? 308  ASP A CB    1 
ATOM   2412 C  CG    . ASP A 1 311 ? 51.528 -13.377 -7.356  1.00 22.97  ? 308  ASP A CG    1 
ATOM   2413 O  OD1   . ASP A 1 311 ? 51.516 -12.334 -6.683  1.00 26.85  ? 308  ASP A OD1   1 
ATOM   2414 O  OD2   . ASP A 1 311 ? 50.822 -13.534 -8.373  1.00 29.03  ? 308  ASP A OD2   1 
ATOM   2415 N  N     . PRO A 1 312 ? 53.810 -13.877 -10.073 1.00 15.23  ? 309  PRO A N     1 
ATOM   2416 C  CA    . PRO A 1 312 ? 54.740 -12.969 -10.736 1.00 14.17  ? 309  PRO A CA    1 
ATOM   2417 C  C     . PRO A 1 312 ? 54.532 -11.503 -10.396 1.00 12.91  ? 309  PRO A C     1 
ATOM   2418 O  O     . PRO A 1 312 ? 53.455 -11.095 -9.973  1.00 14.07  ? 309  PRO A O     1 
ATOM   2419 C  CB    . PRO A 1 312 ? 54.450 -13.195 -12.229 1.00 19.15  ? 309  PRO A CB    1 
ATOM   2420 C  CG    . PRO A 1 312 ? 53.057 -13.658 -12.267 1.00 15.94  ? 309  PRO A CG    1 
ATOM   2421 C  CD    . PRO A 1 312 ? 52.882 -14.508 -11.024 1.00 18.27  ? 309  PRO A CD    1 
ATOM   2422 N  N     . VAL A 1 313 ? 55.548 -10.720 -10.657 1.00 14.56  ? 310  VAL A N     1 
ATOM   2423 C  CA    . VAL A 1 313 ? 55.469 -9.312  -10.510 1.00 11.17  ? 310  VAL A CA    1 
ATOM   2424 C  C     . VAL A 1 313 ? 54.800 -8.846  -11.789 1.00 15.81  ? 310  VAL A C     1 
ATOM   2425 O  O     . VAL A 1 313 ? 55.356 -8.966  -12.793 1.00 15.96  ? 310  VAL A O     1 
ATOM   2426 C  CB    . VAL A 1 313 ? 56.873 -8.715  -10.443 1.00 12.38  ? 310  VAL A CB    1 
ATOM   2427 C  CG1   . VAL A 1 313 ? 56.780 -7.210  -10.366 1.00 15.06  ? 310  VAL A CG1   1 
ATOM   2428 C  CG2   . VAL A 1 313 ? 57.588 -9.216  -9.202  1.00 15.18  ? 310  VAL A CG2   1 
ATOM   2429 N  N     . LYS A 1 314 ? 53.587 -8.366  -11.688 1.00 15.68  ? 311  LYS A N     1 
ATOM   2430 C  CA    . LYS A 1 314 ? 52.907 -7.836  -12.833 1.00 16.14  ? 311  LYS A CA    1 
ATOM   2431 C  C     . LYS A 1 314 ? 53.425 -6.501  -13.324 1.00 15.78  ? 311  LYS A C     1 
ATOM   2432 O  O     . LYS A 1 314 ? 53.663 -5.581  -12.635 1.00 15.21  ? 311  LYS A O     1 
ATOM   2433 C  CB    . LYS A 1 314 ? 51.424 -7.691  -12.571 1.00 15.11  ? 311  LYS A CB    1 
ATOM   2434 C  CG    . LYS A 1 314 ? 50.780 -8.979  -12.141 1.00 26.33  ? 311  LYS A CG    1 
ATOM   2435 C  CD    . LYS A 1 314 ? 49.289 -8.857  -11.959 1.00 31.87  ? 311  LYS A CD    1 
ATOM   2436 C  CE    . LYS A 1 314 ? 48.667 -10.139 -11.415 1.00 39.26  ? 311  LYS A CE    1 
ATOM   2437 N  NZ    . LYS A 1 314 ? 47.186 -10.152 -11.332 1.00 41.43  ? 311  LYS A NZ    1 
ATOM   2438 N  N     . PRO A 1 315 ? 53.475 -6.487  -14.716 1.00 13.31  ? 312  PRO A N     1 
ATOM   2439 C  CA    . PRO A 1 315 ? 53.858 -5.214  -15.290 1.00 13.78  ? 312  PRO A CA    1 
ATOM   2440 C  C     . PRO A 1 315 ? 52.671 -4.285  -15.334 1.00 18.99  ? 312  PRO A C     1 
ATOM   2441 O  O     . PRO A 1 315 ? 52.008 -4.201  -16.294 1.00 17.17  ? 312  PRO A O     1 
ATOM   2442 C  CB    . PRO A 1 315 ? 54.303 -5.579  -16.701 1.00 17.48  ? 312  PRO A CB    1 
ATOM   2443 C  CG    . PRO A 1 315 ? 53.439 -6.679  -17.090 1.00 15.50  ? 312  PRO A CG    1 
ATOM   2444 C  CD    . PRO A 1 315 ? 53.373 -7.513  -15.886 1.00 14.01  ? 312  PRO A CD    1 
ATOM   2445 N  N     . ARG A 1 316 ? 52.421 -3.643  -14.206 1.00 13.97  ? 313  ARG A N     1 
ATOM   2446 C  CA    . ARG A 1 316 ? 51.328 -2.678  -14.092 1.00 14.88  ? 313  ARG A CA    1 
ATOM   2447 C  C     . ARG A 1 316 ? 51.692 -1.554  -13.144 1.00 15.09  ? 313  ARG A C     1 
ATOM   2448 O  O     . ARG A 1 316 ? 51.720 -1.762  -12.002 1.00 17.03  ? 313  ARG A O     1 
ATOM   2449 C  CB    . ARG A 1 316 ? 50.091 -3.367  -13.561 1.00 16.33  ? 313  ARG A CB    1 
ATOM   2450 C  CG    A ARG A 1 316 ? 48.822 -2.524  -13.492 0.53 21.00  ? 313  ARG A CG    1 
ATOM   2451 C  CG    B ARG A 1 316 ? 48.846 -2.480  -13.568 0.47 20.98  ? 313  ARG A CG    1 
ATOM   2452 C  CD    A ARG A 1 316 ? 47.664 -3.275  -12.847 0.53 20.31  ? 313  ARG A CD    1 
ATOM   2453 C  CD    B ARG A 1 316 ? 47.640 -3.099  -12.891 0.47 20.33  ? 313  ARG A CD    1 
ATOM   2454 N  NE    A ARG A 1 316 ? 48.022 -3.796  -11.530 0.53 19.67  ? 313  ARG A NE    1 
ATOM   2455 N  NE    B ARG A 1 316 ? 47.936 -3.574  -11.542 0.47 19.37  ? 313  ARG A NE    1 
ATOM   2456 C  CZ    A ARG A 1 316 ? 48.025 -5.086  -11.204 0.53 23.67  ? 313  ARG A CZ    1 
ATOM   2457 C  CZ    B ARG A 1 316 ? 48.034 -2.795  -10.466 0.47 20.89  ? 313  ARG A CZ    1 
ATOM   2458 N  NH1   A ARG A 1 316 ? 48.372 -5.465  -9.980  0.53 23.74  ? 313  ARG A NH1   1 
ATOM   2459 N  NH1   B ARG A 1 316 ? 48.300 -3.337  -9.286  0.47 21.96  ? 313  ARG A NH1   1 
ATOM   2460 N  NH2   A ARG A 1 316 ? 47.675 -6.000  -12.101 0.53 25.36  ? 313  ARG A NH2   1 
ATOM   2461 N  NH2   B ARG A 1 316 ? 47.871 -1.478  -10.564 0.47 16.75  ? 313  ARG A NH2   1 
ATOM   2462 N  N     . GLN A 1 317 ? 51.931 -0.371  -13.678 1.00 16.82  ? 314  GLN A N     1 
ATOM   2463 C  CA    . GLN A 1 317 ? 52.382 0.789   -12.916 1.00 18.14  ? 314  GLN A CA    1 
ATOM   2464 C  C     . GLN A 1 317 ? 51.209 1.681   -12.520 1.00 16.15  ? 314  GLN A C     1 
ATOM   2465 O  O     . GLN A 1 317 ? 51.267 2.443   -11.545 1.00 22.02  ? 314  GLN A O     1 
ATOM   2466 C  CB    . GLN A 1 317 ? 53.391 1.576   -13.749 1.00 26.64  ? 314  GLN A CB    1 
ATOM   2467 C  CG    . GLN A 1 317 ? 53.980 2.762   -13.055 1.00 31.97  ? 314  GLN A CG    1 
ATOM   2468 C  CD    . GLN A 1 317 ? 54.973 3.486   -13.925 1.00 28.16  ? 314  GLN A CD    1 
ATOM   2469 O  OE1   . GLN A 1 317 ? 55.356 2.997   -14.991 1.00 34.71  ? 314  GLN A OE1   1 
ATOM   2470 N  NE2   . GLN A 1 317 ? 55.389 4.663   -13.487 1.00 28.77  ? 314  GLN A NE2   1 
ATOM   2471 N  N     . LEU A 1 318 ? 50.146 1.589   -13.301 1.00 15.98  ? 315  LEU A N     1 
ATOM   2472 C  CA    . LEU A 1 318 ? 48.978 2.424   -13.097 1.00 15.61  ? 315  LEU A CA    1 
ATOM   2473 C  C     . LEU A 1 318 ? 47.859 1.649   -12.426 1.00 15.27  ? 315  LEU A C     1 
ATOM   2474 O  O     . LEU A 1 318 ? 47.666 0.478   -12.713 1.00 15.83  ? 315  LEU A O     1 
ATOM   2475 C  CB    . LEU A 1 318 ? 48.475 2.966   -14.437 1.00 16.22  ? 315  LEU A CB    1 
ATOM   2476 C  CG    . LEU A 1 318 ? 49.469 3.683   -15.350 1.00 17.95  ? 315  LEU A CG    1 
ATOM   2477 C  CD1   . LEU A 1 318 ? 48.818 4.008   -16.707 1.00 15.47  ? 315  LEU A CD1   1 
ATOM   2478 C  CD2   . LEU A 1 318 ? 49.987 4.944   -14.672 1.00 21.67  ? 315  LEU A CD2   1 
ATOM   2479 N  N     . PRO A 1 319 ? 47.089 2.311   -11.557 1.00 13.86  ? 316  PRO A N     1 
ATOM   2480 C  CA    . PRO A 1 319 ? 45.888 1.624   -11.056 1.00 12.90  ? 316  PRO A CA    1 
ATOM   2481 C  C     . PRO A 1 319 ? 44.925 1.283   -12.203 1.00 14.33  ? 316  PRO A C     1 
ATOM   2482 O  O     . PRO A 1 319 ? 44.895 1.993   -13.204 1.00 18.79  ? 316  PRO A O     1 
ATOM   2483 C  CB    . PRO A 1 319 ? 45.273 2.627   -10.075 1.00 18.74  ? 316  PRO A CB    1 
ATOM   2484 C  CG    . PRO A 1 319 ? 45.992 3.901   -10.267 1.00 18.01  ? 316  PRO A CG    1 
ATOM   2485 C  CD    . PRO A 1 319 ? 47.282 3.652   -10.978 1.00 15.70  ? 316  PRO A CD    1 
ATOM   2486 N  N     . LYS A 1 320 ? 44.176 0.193   -12.072 1.00 16.88  ? 317  LYS A N     1 
ATOM   2487 C  CA    . LYS A 1 320 ? 43.264 -0.215  -13.139 1.00 18.20  ? 317  LYS A CA    1 
ATOM   2488 C  C     . LYS A 1 320 ? 41.820 0.167   -12.828 1.00 15.61  ? 317  LYS A C     1 
ATOM   2489 O  O     . LYS A 1 320 ? 40.904 -0.217  -13.543 1.00 20.25  ? 317  LYS A O     1 
ATOM   2490 C  CB    . LYS A 1 320 ? 43.370 -1.723  -13.402 1.00 23.99  ? 317  LYS A CB    1 
ATOM   2491 C  CG    . LYS A 1 320 ? 43.312 -2.580  -12.158 1.00 25.67  ? 317  LYS A CG    1 
ATOM   2492 C  CD    . LYS A 1 320 ? 43.089 -4.048  -12.504 1.00 36.47  ? 317  LYS A CD    1 
ATOM   2493 C  CE    . LYS A 1 320 ? 44.252 -4.613  -13.286 1.00 38.11  ? 317  LYS A CE    1 
ATOM   2494 N  NZ    . LYS A 1 320 ? 44.162 -6.095  -13.399 1.00 38.89  ? 317  LYS A NZ    1 
ATOM   2495 N  N     . THR A 1 321 ? 41.626 0.927   -11.758 1.00 15.27  ? 318  THR A N     1 
ATOM   2496 C  CA    . THR A 1 321 ? 40.322 1.496   -11.440 1.00 15.32  ? 318  THR A CA    1 
ATOM   2497 C  C     . THR A 1 321 ? 40.546 2.876   -10.849 1.00 17.11  ? 318  THR A C     1 
ATOM   2498 O  O     . THR A 1 321 ? 41.588 3.140   -10.252 1.00 19.16  ? 318  THR A O     1 
ATOM   2499 C  CB    . THR A 1 321 ? 39.499 0.630   -10.446 1.00 19.17  ? 318  THR A CB    1 
ATOM   2500 O  OG1   . THR A 1 321 ? 40.178 0.539   -9.182  1.00 18.10  ? 318  THR A OG1   1 
ATOM   2501 C  CG2   . THR A 1 321 ? 39.216 -0.770  -11.000 1.00 16.38  ? 318  THR A CG2   1 
ATOM   2502 N  N     . ILE A 1 322 ? 39.582 3.759   -11.058 1.00 13.44  ? 319  ILE A N     1 
ATOM   2503 C  CA    . ILE A 1 322 ? 39.597 5.092   -10.448 1.00 15.38  ? 319  ILE A CA    1 
ATOM   2504 C  C     . ILE A 1 322 ? 38.251 5.308   -9.756  1.00 16.87  ? 319  ILE A C     1 
ATOM   2505 O  O     . ILE A 1 322 ? 37.211 5.338   -10.412 1.00 16.90  ? 319  ILE A O     1 
ATOM   2506 C  CB    . ILE A 1 322 ? 39.851 6.194   -11.503 1.00 17.51  ? 319  ILE A CB    1 
ATOM   2507 C  CG1   . ILE A 1 322 ? 41.234 6.025   -12.134 1.00 17.72  ? 319  ILE A CG1   1 
ATOM   2508 C  CG2   . ILE A 1 322 ? 39.712 7.591   -10.893 1.00 16.42  ? 319  ILE A CG2   1 
ATOM   2509 C  CD1   . ILE A 1 322 ? 41.544 7.085   -13.174 1.00 16.58  ? 319  ILE A CD1   1 
ATOM   2510 N  N     . GLY A 1 323 ? 38.271 5.414   -8.432  1.00 13.67  ? 320  GLY A N     1 
ATOM   2511 C  CA    . GLY A 1 323 ? 37.037 5.492   -7.659  1.00 13.43  ? 320  GLY A CA    1 
ATOM   2512 C  C     . GLY A 1 323 ? 36.992 6.609   -6.638  1.00 14.48  ? 320  GLY A C     1 
ATOM   2513 O  O     . GLY A 1 323 ? 38.023 7.149   -6.239  1.00 15.22  ? 320  GLY A O     1 
ATOM   2514 N  N     . CYS A 1 324 ? 35.769 6.925   -6.221  1.00 16.93  ? 321  CYS A N     1 
ATOM   2515 C  CA    . CYS A 1 324 ? 35.443 8.026   -5.321  1.00 15.80  ? 321  CYS A CA    1 
ATOM   2516 C  C     . CYS A 1 324 ? 34.429 7.483   -4.325  1.00 17.84  ? 321  CYS A C     1 
ATOM   2517 O  O     . CYS A 1 324 ? 33.416 6.944   -4.744  1.00 16.81  ? 321  CYS A O     1 
ATOM   2518 C  CB    . CYS A 1 324 ? 34.859 9.225   -6.098  1.00 16.03  ? 321  CYS A CB    1 
ATOM   2519 S  SG    A CYS A 1 324 ? 35.235 10.829  -5.435  0.36 22.04  ? 321  CYS A SG    1 
ATOM   2520 S  SG    B CYS A 1 324 ? 36.000 10.010  -7.221  0.64 24.57  ? 321  CYS A SG    1 
ATOM   2521 N  N     . SER A 1 325 ? 34.667 7.618   -3.027  1.00 15.91  ? 322  SER A N     1 
ATOM   2522 C  CA    A SER A 1 325 ? 33.702 7.093   -2.070  0.57 15.71  ? 322  SER A CA    1 
ATOM   2523 C  CA    B SER A 1 325 ? 33.802 7.017   -2.016  0.43 15.79  ? 322  SER A CA    1 
ATOM   2524 C  C     . SER A 1 325 ? 33.594 7.951   -0.824  1.00 17.47  ? 322  SER A C     1 
ATOM   2525 O  O     . SER A 1 325 ? 34.525 8.665   -0.436  1.00 17.02  ? 322  SER A O     1 
ATOM   2526 C  CB    A SER A 1 325 ? 34.042 5.652   -1.676  0.57 16.56  ? 322  SER A CB    1 
ATOM   2527 C  CB    B SER A 1 325 ? 34.405 5.687   -1.547  0.43 16.21  ? 322  SER A CB    1 
ATOM   2528 O  OG    A SER A 1 325 ? 35.234 5.584   -0.927  0.57 16.57  ? 322  SER A OG    1 
ATOM   2529 O  OG    B SER A 1 325 ? 33.793 5.215   -0.362  0.43 16.71  ? 322  SER A OG    1 
ATOM   2530 N  N     . LYS A 1 326 ? 32.407 7.922   -0.230  1.00 18.19  ? 323  LYS A N     1 
ATOM   2531 C  CA    . LYS A 1 326 ? 32.193 8.656   1.010   1.00 16.51  ? 323  LYS A CA    1 
ATOM   2532 C  C     . LYS A 1 326 ? 31.178 7.969   1.901   1.00 16.01  ? 323  LYS A C     1 
ATOM   2533 O  O     . LYS A 1 326 ? 30.098 7.580   1.438   1.00 14.43  ? 323  LYS A O     1 
ATOM   2534 C  CB    . LYS A 1 326 ? 31.736 10.084  0.722   1.00 14.34  ? 323  LYS A CB    1 
ATOM   2535 C  CG    . LYS A 1 326 ? 31.565 10.905  2.015   1.00 18.01  ? 323  LYS A CG    1 
ATOM   2536 C  CD    . LYS A 1 326 ? 31.579 12.395  1.737   1.00 24.41  ? 323  LYS A CD    1 
ATOM   2537 C  CE    . LYS A 1 326 ? 31.348 13.174  3.016   1.00 27.00  ? 323  LYS A CE    1 
ATOM   2538 N  NZ    . LYS A 1 326 ? 31.929 12.448  4.165   1.00 28.20  ? 323  LYS A NZ    1 
ATOM   2539 N  N     . ASN A 1 327 ? 31.548 7.813   3.172   1.00 14.37  ? 324  ASN A N     1 
ATOM   2540 C  CA    . ASN A 1 327 ? 30.649 7.352   4.227   1.00 18.84  ? 324  ASN A CA    1 
ATOM   2541 C  C     . ASN A 1 327 ? 29.776 8.469   4.780   1.00 20.39  ? 324  ASN A C     1 
ATOM   2542 O  O     . ASN A 1 327 ? 30.177 9.635   4.825   1.00 18.94  ? 324  ASN A O     1 
ATOM   2543 C  CB    . ASN A 1 327 ? 31.425 6.750   5.403   1.00 22.47  ? 324  ASN A CB    1 
ATOM   2544 C  CG    . ASN A 1 327 ? 32.059 5.425   5.081   1.00 24.04  ? 324  ASN A CG    1 
ATOM   2545 O  OD1   . ASN A 1 327 ? 31.762 4.795   4.059   1.00 27.29  ? 324  ASN A OD1   1 
ATOM   2546 N  ND2   . ASN A 1 327 ? 32.928 4.968   5.983   1.00 26.18  ? 324  ASN A ND2   1 
ATOM   2547 N  N     . PHE A 1 328 ? 28.590 8.111   5.247   1.00 21.46  ? 325  PHE A N     1 
ATOM   2548 C  CA    . PHE A 1 328 ? 27.651 9.032   5.843   1.00 26.41  ? 325  PHE A CA    1 
ATOM   2549 C  C     . PHE A 1 328 ? 27.189 8.395   7.138   1.00 30.47  ? 325  PHE A C     1 
ATOM   2550 O  O     . PHE A 1 328 ? 26.215 7.721   7.212   1.00 31.98  ? 325  PHE A O     1 
ATOM   2551 C  CB    . PHE A 1 328 ? 26.525 9.323   4.873   1.00 27.04  ? 325  PHE A CB    1 
ATOM   2552 C  CG    . PHE A 1 328 ? 27.000 9.886   3.604   1.00 25.89  ? 325  PHE A CG    1 
ATOM   2553 C  CD1   . PHE A 1 328 ? 27.152 9.107   2.520   1.00 23.01  ? 325  PHE A CD1   1 
ATOM   2554 C  CD2   . PHE A 1 328 ? 27.349 11.184  3.520   1.00 20.74  ? 325  PHE A CD2   1 
ATOM   2555 C  CE1   . PHE A 1 328 ? 27.636 9.628   1.378   1.00 16.28  ? 325  PHE A CE1   1 
ATOM   2556 C  CE2   . PHE A 1 328 ? 27.789 11.718  2.364   1.00 23.20  ? 325  PHE A CE2   1 
ATOM   2557 C  CZ    . PHE A 1 328 ? 27.957 10.917  1.284   1.00 23.57  ? 325  PHE A CZ    1 
ATOM   2558 N  N     . PRO A 1 329 ? 28.024 8.512   8.153   1.00 26.90  ? 326  PRO A N     1 
ATOM   2559 C  CA    . PRO A 1 329 ? 27.836 7.808   9.413   1.00 34.98  ? 326  PRO A CA    1 
ATOM   2560 C  C     . PRO A 1 329 ? 26.745 8.339   10.291  1.00 38.01  ? 326  PRO A C     1 
ATOM   2561 O  O     . PRO A 1 329 ? 26.456 9.483   10.250  1.00 36.34  ? 326  PRO A O     1 
ATOM   2562 C  CB    . PRO A 1 329 ? 29.150 8.017   10.118  1.00 39.58  ? 326  PRO A CB    1 
ATOM   2563 C  CG    . PRO A 1 329 ? 29.599 9.305   9.595   1.00 38.16  ? 326  PRO A CG    1 
ATOM   2564 C  CD    . PRO A 1 329 ? 29.255 9.286   8.165   1.00 31.62  ? 326  PRO A CD    1 
ATOM   2565 N  N     . GLY A 1 330 ? 26.175 7.454   11.085  1.00 47.83  ? 327  GLY A N     1 
ATOM   2566 C  CA    . GLY A 1 330 ? 25.330 7.845   12.186  1.00 48.28  ? 327  GLY A CA    1 
ATOM   2567 C  C     . GLY A 1 330 ? 24.186 8.683   11.729  1.00 45.23  ? 327  GLY A C     1 
ATOM   2568 O  O     . GLY A 1 330 ? 23.344 8.261   10.957  1.00 46.21  ? 327  GLY A O     1 
ATOM   2569 N  N     . LYS A 1 331 ? 24.156 9.874   12.282  1.00 44.36  ? 328  LYS A N     1 
ATOM   2570 C  CA    . LYS A 1 331 ? 23.147 10.867  11.992  1.00 44.44  ? 328  LYS A CA    1 
ATOM   2571 C  C     . LYS A 1 331 ? 23.117 11.415  10.584  1.00 44.78  ? 328  LYS A C     1 
ATOM   2572 O  O     . LYS A 1 331 ? 22.113 11.878  10.158  1.00 44.28  ? 328  LYS A O     1 
ATOM   2573 C  CB    . LYS A 1 331 ? 23.194 12.003  13.008  1.00 53.51  ? 328  LYS A CB    1 
ATOM   2574 C  CG    . LYS A 1 331 ? 22.449 11.663  14.273  1.00 56.04  ? 328  LYS A CG    1 
ATOM   2575 C  CD    . LYS A 1 331 ? 21.267 12.590  14.518  1.00 57.71  ? 328  LYS A CD    1 
ATOM   2576 C  CE    . LYS A 1 331 ? 20.145 11.901  15.281  1.00 55.95  ? 328  LYS A CE    1 
ATOM   2577 N  NZ    . LYS A 1 331 ? 19.615 12.780  16.347  1.00 58.79  ? 328  LYS A NZ    1 
ATOM   2578 N  N     . THR A 1 332 ? 24.243 11.400  9.904   1.00 41.35  ? 329  THR A N     1 
ATOM   2579 C  CA    . THR A 1 332 ? 24.439 12.100  8.636   1.00 40.64  ? 329  THR A CA    1 
ATOM   2580 C  C     . THR A 1 332 ? 23.985 11.267  7.438   1.00 35.55  ? 329  THR A C     1 
ATOM   2581 O  O     . THR A 1 332 ? 24.101 11.711  6.298   1.00 33.64  ? 329  THR A O     1 
ATOM   2582 C  CB    . THR A 1 332 ? 25.914 12.499  8.430   1.00 34.66  ? 329  THR A CB    1 
ATOM   2583 O  OG1   . THR A 1 332 ? 26.714 11.324  8.251   1.00 34.29  ? 329  THR A OG1   1 
ATOM   2584 C  CG2   . THR A 1 332 ? 26.426 13.283  9.631   1.00 37.77  ? 329  THR A CG2   1 
ATOM   2585 N  N     . ALA A 1 333 ? 23.472 10.069  7.710   1.00 31.51  ? 330  ALA A N     1 
ATOM   2586 C  CA    . ALA A 1 333 ? 22.981 9.170   6.666   1.00 31.01  ? 330  ALA A CA    1 
ATOM   2587 C  C     . ALA A 1 333 ? 21.945 9.851   5.778   1.00 40.40  ? 330  ALA A C     1 
ATOM   2588 O  O     . ALA A 1 333 ? 21.007 10.480  6.268   1.00 43.70  ? 330  ALA A O     1 
ATOM   2589 C  CB    . ALA A 1 333 ? 22.403 7.916   7.288   1.00 33.38  ? 330  ALA A CB    1 
ATOM   2590 N  N     . LEU A 1 334 ? 22.124 9.724   4.468   1.00 34.11  ? 331  LEU A N     1 
ATOM   2591 C  CA    . LEU A 1 334 ? 21.292 10.437  3.507   1.00 35.62  ? 331  LEU A CA    1 
ATOM   2592 C  C     . LEU A 1 334 ? 19.863 9.894   3.510   1.00 32.67  ? 331  LEU A C     1 
ATOM   2593 O  O     . LEU A 1 334 ? 19.637 8.710   3.267   1.00 35.43  ? 331  LEU A O     1 
ATOM   2594 C  CB    . LEU A 1 334 ? 21.901 10.343  2.109   1.00 29.08  ? 331  LEU A CB    1 
ATOM   2595 C  CG    . LEU A 1 334 ? 23.410 10.592  2.040   1.00 27.73  ? 331  LEU A CG    1 
ATOM   2596 C  CD1   . LEU A 1 334 ? 23.893 10.480  0.599   1.00 22.37  ? 331  LEU A CD1   1 
ATOM   2597 C  CD2   . LEU A 1 334 ? 23.765 11.946  2.648   1.00 26.35  ? 331  LEU A CD2   1 
ATOM   2598 N  N     . ALA A 1 335 ? 18.902 10.767  3.789   1.00 38.71  ? 332  ALA A N     1 
ATOM   2599 C  CA    . ALA A 1 335 ? 17.525 10.329  3.986   1.00 36.88  ? 332  ALA A CA    1 
ATOM   2600 C  C     . ALA A 1 335 ? 16.559 10.961  2.987   1.00 40.60  ? 332  ALA A C     1 
ATOM   2601 O  O     . ALA A 1 335 ? 15.370 10.640  2.984   1.00 43.12  ? 332  ALA A O     1 
ATOM   2602 C  CB    . ALA A 1 335 ? 17.082 10.628  5.411   1.00 38.77  ? 332  ALA A CB    1 
ATOM   2603 N  N     . THR A 1 336 ? 17.065 11.856  2.144   1.00 31.59  ? 333  THR A N     1 
ATOM   2604 C  CA    . THR A 1 336 ? 16.237 12.465  1.108   1.00 37.88  ? 333  THR A CA    1 
ATOM   2605 C  C     . THR A 1 336 ? 16.821 12.258  -0.283  1.00 42.45  ? 333  THR A C     1 
ATOM   2606 O  O     . THR A 1 336 ? 18.003 11.961  -0.431  1.00 39.60  ? 333  THR A O     1 
ATOM   2607 C  CB    . THR A 1 336 ? 16.045 13.978  1.332   1.00 41.06  ? 333  THR A CB    1 
ATOM   2608 O  OG1   . THR A 1 336 ? 17.277 14.670  1.082   1.00 36.85  ? 333  THR A OG1   1 
ATOM   2609 C  CG2   . THR A 1 336 ? 15.565 14.263  2.746   1.00 38.83  ? 333  THR A CG2   1 
ATOM   2610 N  N     . ARG A 1 337 ? 15.980 12.436  -1.299  1.00 43.61  ? 334  ARG A N     1 
ATOM   2611 C  CA    . ARG A 1 337 ? 16.386 12.264  -2.689  1.00 40.68  ? 334  ARG A CA    1 
ATOM   2612 C  C     . ARG A 1 337 ? 17.426 13.294  -3.108  1.00 38.52  ? 334  ARG A C     1 
ATOM   2613 O  O     . ARG A 1 337 ? 18.470 12.937  -3.654  1.00 37.98  ? 334  ARG A O     1 
ATOM   2614 C  CB    . ARG A 1 337 ? 15.173 12.356  -3.619  1.00 48.31  ? 334  ARG A CB    1 
ATOM   2615 C  CG    . ARG A 1 337 ? 15.532 12.373  -5.099  1.00 50.03  ? 334  ARG A CG    1 
ATOM   2616 C  CD    . ARG A 1 337 ? 14.296 12.493  -5.976  1.00 53.66  ? 334  ARG A CD    1 
ATOM   2617 N  NE    . ARG A 1 337 ? 13.817 13.871  -6.062  1.00 56.13  ? 334  ARG A NE    1 
ATOM   2618 C  CZ    . ARG A 1 337 ? 12.664 14.227  -6.620  1.00 63.49  ? 334  ARG A CZ    1 
ATOM   2619 N  NH1   . ARG A 1 337 ? 11.868 13.305  -7.143  1.00 62.09  ? 334  ARG A NH1   1 
ATOM   2620 N  NH2   . ARG A 1 337 ? 12.304 15.504  -6.656  1.00 60.52  ? 334  ARG A NH2   1 
ATOM   2621 N  N     . GLU A 1 338 ? 17.138 14.569  -2.858  1.00 40.03  ? 335  GLU A N     1 
ATOM   2622 C  CA    . GLU A 1 338 ? 18.049 15.648  -3.240  1.00 38.56  ? 335  GLU A CA    1 
ATOM   2623 C  C     . GLU A 1 338 ? 19.403 15.542  -2.540  1.00 31.20  ? 335  GLU A C     1 
ATOM   2624 O  O     . GLU A 1 338 ? 20.413 16.002  -3.064  1.00 31.87  ? 335  GLU A O     1 
ATOM   2625 C  CB    . GLU A 1 338 ? 17.431 17.014  -2.944  1.00 39.02  ? 335  GLU A CB    1 
ATOM   2626 C  CG    . GLU A 1 338 ? 15.932 17.079  -3.141  1.00 55.26  ? 335  GLU A CG    1 
ATOM   2627 C  CD    . GLU A 1 338 ? 15.350 18.420  -2.737  1.00 63.54  ? 335  GLU A CD    1 
ATOM   2628 O  OE1   . GLU A 1 338 ? 16.058 19.201  -2.064  1.00 64.35  ? 335  GLU A OE1   1 
ATOM   2629 O  OE2   . GLU A 1 338 ? 14.180 18.688  -3.086  1.00 67.80  ? 335  GLU A OE2   1 
ATOM   2630 N  N     . GLN A 1 339 ? 19.419 14.944  -1.355  1.00 34.55  ? 336  GLN A N     1 
ATOM   2631 C  CA    . GLN A 1 339 ? 20.668 14.741  -0.640  1.00 30.99  ? 336  GLN A CA    1 
ATOM   2632 C  C     . GLN A 1 339 ? 21.496 13.680  -1.344  1.00 35.10  ? 336  GLN A C     1 
ATOM   2633 O  O     . GLN A 1 339 ? 22.697 13.858  -1.572  1.00 29.27  ? 336  GLN A O     1 
ATOM   2634 C  CB    . GLN A 1 339 ? 20.396 14.332  0.799   1.00 31.60  ? 336  GLN A CB    1 
ATOM   2635 C  CG    . GLN A 1 339 ? 21.164 15.121  1.821   1.00 34.49  ? 336  GLN A CG    1 
ATOM   2636 C  CD    . GLN A 1 339 ? 20.978 14.558  3.200   1.00 32.26  ? 336  GLN A CD    1 
ATOM   2637 O  OE1   . GLN A 1 339 ? 19.985 13.879  3.474   1.00 37.83  ? 336  GLN A OE1   1 
ATOM   2638 N  NE2   . GLN A 1 339 ? 21.924 14.826  4.078   1.00 33.62  ? 336  GLN A NE2   1 
ATOM   2639 N  N     . VAL A 1 340 ? 20.842 12.576  -1.688  1.00 28.76  ? 337  VAL A N     1 
ATOM   2640 C  CA    . VAL A 1 340 ? 21.495 11.485  -2.390  1.00 29.55  ? 337  VAL A CA    1 
ATOM   2641 C  C     . VAL A 1 340 ? 22.040 12.002  -3.711  1.00 27.48  ? 337  VAL A C     1 
ATOM   2642 O  O     . VAL A 1 340 ? 23.189 11.743  -4.065  1.00 29.08  ? 337  VAL A O     1 
ATOM   2643 C  CB    . VAL A 1 340 ? 20.527 10.306  -2.635  1.00 28.40  ? 337  VAL A CB    1 
ATOM   2644 C  CG1   . VAL A 1 340 ? 21.155 9.251   -3.551  1.00 21.40  ? 337  VAL A CG1   1 
ATOM   2645 C  CG2   . VAL A 1 340 ? 20.122 9.687   -1.319  1.00 24.24  ? 337  VAL A CG2   1 
ATOM   2646 N  N     . GLN A 1 341 ? 21.212 12.759  -4.421  1.00 28.08  ? 338  GLN A N     1 
ATOM   2647 C  CA    . GLN A 1 341 ? 21.587 13.288  -5.724  1.00 25.54  ? 338  GLN A CA    1 
ATOM   2648 C  C     . GLN A 1 341 ? 22.693 14.331  -5.627  1.00 28.60  ? 338  GLN A C     1 
ATOM   2649 O  O     . GLN A 1 341 ? 23.540 14.424  -6.517  1.00 28.84  ? 338  GLN A O     1 
ATOM   2650 C  CB    . GLN A 1 341 ? 20.364 13.871  -6.430  1.00 31.47  ? 338  GLN A CB    1 
ATOM   2651 C  CG    . GLN A 1 341 ? 19.391 12.805  -6.904  1.00 30.88  ? 338  GLN A CG    1 
ATOM   2652 C  CD    . GLN A 1 341 ? 18.096 13.380  -7.448  1.00 38.55  ? 338  GLN A CD    1 
ATOM   2653 O  OE1   . GLN A 1 341 ? 17.755 14.534  -7.195  1.00 38.75  ? 338  GLN A OE1   1 
ATOM   2654 N  NE2   . GLN A 1 341 ? 17.368 12.570  -8.210  1.00 36.25  ? 338  GLN A NE2   1 
ATOM   2655 N  N     . TRP A 1 342 ? 22.696 15.114  -4.552  1.00 24.10  ? 339  TRP A N     1 
ATOM   2656 C  CA    . TRP A 1 342 ? 23.753 16.102  -4.383  1.00 27.12  ? 339  TRP A CA    1 
ATOM   2657 C  C     . TRP A 1 342 ? 25.119 15.431  -4.200  1.00 18.50  ? 339  TRP A C     1 
ATOM   2658 O  O     . TRP A 1 342 ? 26.109 15.834  -4.809  1.00 20.47  ? 339  TRP A O     1 
ATOM   2659 C  CB    . TRP A 1 342 ? 23.456 17.017  -3.198  1.00 24.61  ? 339  TRP A CB    1 
ATOM   2660 C  CG    . TRP A 1 342 ? 24.416 18.150  -3.108  1.00 26.20  ? 339  TRP A CG    1 
ATOM   2661 C  CD1   . TRP A 1 342 ? 24.373 19.318  -3.814  1.00 27.04  ? 339  TRP A CD1   1 
ATOM   2662 C  CD2   . TRP A 1 342 ? 25.569 18.231  -2.266  1.00 22.41  ? 339  TRP A CD2   1 
ATOM   2663 N  NE1   . TRP A 1 342 ? 25.427 20.122  -3.463  1.00 29.91  ? 339  TRP A NE1   1 
ATOM   2664 C  CE2   . TRP A 1 342 ? 26.178 19.479  -2.512  1.00 21.56  ? 339  TRP A CE2   1 
ATOM   2665 C  CE3   . TRP A 1 342 ? 26.143 17.374  -1.321  1.00 23.56  ? 339  TRP A CE3   1 
ATOM   2666 C  CZ2   . TRP A 1 342 ? 27.332 19.889  -1.855  1.00 26.06  ? 339  TRP A CZ2   1 
ATOM   2667 C  CZ3   . TRP A 1 342 ? 27.290 17.783  -0.668  1.00 25.92  ? 339  TRP A CZ3   1 
ATOM   2668 C  CH2   . TRP A 1 342 ? 27.874 19.029  -0.938  1.00 25.48  ? 339  TRP A CH2   1 
ATOM   2669 N  N     . TRP A 1 343 ? 25.167 14.403  -3.362  1.00 22.59  ? 340  TRP A N     1 
ATOM   2670 C  CA    . TRP A 1 343 ? 26.428 13.729  -3.084  1.00 16.98  ? 340  TRP A CA    1 
ATOM   2671 C  C     . TRP A 1 343 ? 26.896 12.896  -4.265  1.00 20.49  ? 340  TRP A C     1 
ATOM   2672 O  O     . TRP A 1 343 ? 28.097 12.739  -4.468  1.00 19.43  ? 340  TRP A O     1 
ATOM   2673 C  CB    . TRP A 1 343 ? 26.308 12.866  -1.828  1.00 22.63  ? 340  TRP A CB    1 
ATOM   2674 C  CG    . TRP A 1 343 ? 26.448 13.674  -0.572  1.00 21.77  ? 340  TRP A CG    1 
ATOM   2675 C  CD1   . TRP A 1 343 ? 25.469 13.989  0.327   1.00 25.39  ? 340  TRP A CD1   1 
ATOM   2676 C  CD2   . TRP A 1 343 ? 27.643 14.288  -0.097  1.00 17.53  ? 340  TRP A CD2   1 
ATOM   2677 N  NE1   . TRP A 1 343 ? 25.990 14.760  1.346   1.00 23.73  ? 340  TRP A NE1   1 
ATOM   2678 C  CE2   . TRP A 1 343 ? 27.324 14.957  1.105   1.00 24.03  ? 340  TRP A CE2   1 
ATOM   2679 C  CE3   . TRP A 1 343 ? 28.959 14.338  -0.570  1.00 18.84  ? 340  TRP A CE3   1 
ATOM   2680 C  CZ2   . TRP A 1 343 ? 28.275 15.661  1.845   1.00 23.05  ? 340  TRP A CZ2   1 
ATOM   2681 C  CZ3   . TRP A 1 343 ? 29.898 15.040  0.165   1.00 20.96  ? 340  TRP A CZ3   1 
ATOM   2682 C  CH2   . TRP A 1 343 ? 29.551 15.691  1.360   1.00 26.35  ? 340  TRP A CH2   1 
ATOM   2683 N  N     . LEU A 1 344 ? 25.954 12.367  -5.047  1.00 20.96  ? 341  LEU A N     1 
ATOM   2684 C  CA    . LEU A 1 344 ? 26.326 11.605  -6.235  1.00 18.06  ? 341  LEU A CA    1 
ATOM   2685 C  C     . LEU A 1 344 ? 27.038 12.535  -7.191  1.00 17.87  ? 341  LEU A C     1 
ATOM   2686 O  O     . LEU A 1 344 ? 28.016 12.145  -7.832  1.00 16.99  ? 341  LEU A O     1 
ATOM   2687 C  CB    . LEU A 1 344 ? 25.108 10.974  -6.919  1.00 18.78  ? 341  LEU A CB    1 
ATOM   2688 C  CG    . LEU A 1 344 ? 24.535 9.702   -6.277  1.00 22.03  ? 341  LEU A CG    1 
ATOM   2689 C  CD1   . LEU A 1 344 ? 23.274 9.251   -7.015  1.00 27.01  ? 341  LEU A CD1   1 
ATOM   2690 C  CD2   . LEU A 1 344 ? 25.569 8.584   -6.243  1.00 17.96  ? 341  LEU A CD2   1 
ATOM   2691 N  N     . LEU A 1 345 ? 26.561 13.775  -7.253  1.00 16.16  ? 342  LEU A N     1 
ATOM   2692 C  CA    . LEU A 1 345 ? 27.155 14.783  -8.116  1.00 13.61  ? 342  LEU A CA    1 
ATOM   2693 C  C     . LEU A 1 345 ? 28.547 15.193  -7.625  1.00 17.96  ? 342  LEU A C     1 
ATOM   2694 O  O     . LEU A 1 345 ? 29.464 15.347  -8.424  1.00 17.52  ? 342  LEU A O     1 
ATOM   2695 C  CB    . LEU A 1 345 ? 26.243 16.014  -8.216  1.00 20.45  ? 342  LEU A CB    1 
ATOM   2696 C  CG    . LEU A 1 345 ? 26.754 17.155  -9.097  1.00 24.90  ? 342  LEU A CG    1 
ATOM   2697 C  CD1   . LEU A 1 345 ? 27.020 16.663  -10.529 1.00 24.56  ? 342  LEU A CD1   1 
ATOM   2698 C  CD2   . LEU A 1 345 ? 25.762 18.308  -9.103  1.00 30.87  ? 342  LEU A CD2   1 
ATOM   2699 N  N     . GLN A 1 346 ? 28.709 15.365  -6.314  1.00 17.58  ? 343  GLN A N     1 
ATOM   2700 C  CA    . GLN A 1 346 ? 30.027 15.701  -5.771  1.00 15.78  ? 343  GLN A CA    1 
ATOM   2701 C  C     . GLN A 1 346 ? 31.037 14.608  -6.110  1.00 14.76  ? 343  GLN A C     1 
ATOM   2702 O  O     . GLN A 1 346 ? 32.133 14.889  -6.606  1.00 16.30  ? 343  GLN A O     1 
ATOM   2703 C  CB    . GLN A 1 346 ? 29.975 15.898  -4.249  1.00 18.80  ? 343  GLN A CB    1 
ATOM   2704 C  CG    . GLN A 1 346 ? 29.003 16.988  -3.786  1.00 14.93  ? 343  GLN A CG    1 
ATOM   2705 C  CD    . GLN A 1 346 ? 28.997 18.213  -4.688  1.00 20.52  ? 343  GLN A CD    1 
ATOM   2706 O  OE1   . GLN A 1 346 ? 29.959 18.985  -4.737  1.00 21.79  ? 343  GLN A OE1   1 
ATOM   2707 N  NE2   . GLN A 1 346 ? 27.909 18.384  -5.425  1.00 21.33  ? 343  GLN A NE2   1 
ATOM   2708 N  N     . LEU A 1 347 ? 30.660 13.361  -5.840  1.00 15.71  ? 344  LEU A N     1 
ATOM   2709 C  CA    . LEU A 1 347 ? 31.511 12.228  -6.173  1.00 15.90  ? 344  LEU A CA    1 
ATOM   2710 C  C     . LEU A 1 347 ? 31.812 12.211  -7.674  1.00 15.74  ? 344  LEU A C     1 
ATOM   2711 O  O     . LEU A 1 347 ? 32.955 11.991  -8.079  1.00 16.80  ? 344  LEU A O     1 
ATOM   2712 C  CB    . LEU A 1 347 ? 30.859 10.902  -5.753  1.00 14.21  ? 344  LEU A CB    1 
ATOM   2713 C  CG    . LEU A 1 347 ? 30.834 10.565  -4.264  1.00 22.81  ? 344  LEU A CG    1 
ATOM   2714 C  CD1   . LEU A 1 347 ? 30.280 9.173   -4.047  1.00 26.43  ? 344  LEU A CD1   1 
ATOM   2715 C  CD2   . LEU A 1 347 ? 32.216 10.624  -3.736  1.00 23.65  ? 344  LEU A CD2   1 
ATOM   2716 N  N     . ALA A 1 348 ? 30.786 12.458  -8.491  1.00 14.78  ? 345  ALA A N     1 
ATOM   2717 C  CA    . ALA A 1 348 ? 30.925 12.383  -9.938  1.00 13.93  ? 345  ALA A CA    1 
ATOM   2718 C  C     . ALA A 1 348 ? 31.854 13.466  -10.479 1.00 13.37  ? 345  ALA A C     1 
ATOM   2719 O  O     . ALA A 1 348 ? 32.591 13.244  -11.440 1.00 14.96  ? 345  ALA A O     1 
ATOM   2720 C  CB    . ALA A 1 348 ? 29.559 12.489  -10.604 1.00 14.06  ? 345  ALA A CB    1 
ATOM   2721 N  N     . GLN A 1 349 ? 31.820 14.633  -9.841  1.00 13.21  ? 346  GLN A N     1 
ATOM   2722 C  CA    . GLN A 1 349 ? 32.663 15.736  -10.272 1.00 14.65  ? 346  GLN A CA    1 
ATOM   2723 C  C     . GLN A 1 349 ? 34.123 15.470  -9.931  1.00 12.96  ? 346  GLN A C     1 
ATOM   2724 O  O     . GLN A 1 349 ? 35.006 15.783  -10.732 1.00 16.25  ? 346  GLN A O     1 
ATOM   2725 C  CB    . GLN A 1 349 ? 32.182 17.053  -9.665  1.00 19.52  ? 346  GLN A CB    1 
ATOM   2726 C  CG    . GLN A 1 349 ? 30.926 17.565  -10.357 1.00 23.36  ? 346  GLN A CG    1 
ATOM   2727 C  CD    . GLN A 1 349 ? 30.316 18.776  -9.690  1.00 28.80  ? 346  GLN A CD    1 
ATOM   2728 O  OE1   . GLN A 1 349 ? 30.764 19.215  -8.632  1.00 34.30  ? 346  GLN A OE1   1 
ATOM   2729 N  NE2   . GLN A 1 349 ? 29.289 19.332  -10.319 1.00 36.74  ? 346  GLN A NE2   1 
ATOM   2730 N  N     . GLU A 1 350 ? 34.385 14.870  -8.771  1.00 14.06  ? 347  GLU A N     1 
ATOM   2731 C  CA    . GLU A 1 350 ? 35.752 14.470  -8.470  1.00 13.25  ? 347  GLU A CA    1 
ATOM   2732 C  C     . GLU A 1 350 ? 36.205 13.395  -9.459  1.00 13.39  ? 347  GLU A C     1 
ATOM   2733 O  O     . GLU A 1 350 ? 37.333 13.434  -9.957  1.00 15.84  ? 347  GLU A O     1 
ATOM   2734 C  CB    . GLU A 1 350 ? 35.906 13.947  -7.045  1.00 14.01  ? 347  GLU A CB    1 
ATOM   2735 C  CG    . GLU A 1 350 ? 37.352 13.513  -6.813  1.00 15.09  ? 347  GLU A CG    1 
ATOM   2736 C  CD    . GLU A 1 350 ? 37.619 12.951  -5.435  1.00 22.56  ? 347  GLU A CD    1 
ATOM   2737 O  OE1   . GLU A 1 350 ? 36.968 13.355  -4.442  1.00 18.73  ? 347  GLU A OE1   1 
ATOM   2738 O  OE2   . GLU A 1 350 ? 38.485 12.068  -5.357  1.00 15.79  ? 347  GLU A OE2   1 
ATOM   2739 N  N     . LEU A 1 351 ? 35.320 12.443  -9.746  1.00 13.81  ? 348  LEU A N     1 
ATOM   2740 C  CA    . LEU A 1 351 ? 35.645 11.356  -10.653 1.00 12.56  ? 348  LEU A CA    1 
ATOM   2741 C  C     . LEU A 1 351 ? 35.972 11.901  -12.038 1.00 17.29  ? 348  LEU A C     1 
ATOM   2742 O  O     . LEU A 1 351 ? 36.949 11.487  -12.657 1.00 17.33  ? 348  LEU A O     1 
ATOM   2743 C  CB    . LEU A 1 351 ? 34.491 10.349  -10.732 1.00 16.35  ? 348  LEU A CB    1 
ATOM   2744 C  CG    . LEU A 1 351 ? 34.822 9.008   -11.397 1.00 20.26  ? 348  LEU A CG    1 
ATOM   2745 C  CD1   . LEU A 1 351 ? 36.010 8.338   -10.711 1.00 24.97  ? 348  LEU A CD1   1 
ATOM   2746 C  CD2   . LEU A 1 351 ? 33.598 8.093   -11.382 1.00 21.16  ? 348  LEU A CD2   1 
ATOM   2747 N  N     . GLU A 1 352 ? 35.164 12.841  -12.516 1.00 15.14  ? 349  GLU A N     1 
ATOM   2748 C  CA    . GLU A 1 352 ? 35.387 13.414  -13.840 1.00 15.50  ? 349  GLU A CA    1 
ATOM   2749 C  C     . GLU A 1 352 ? 36.749 14.094  -13.915 1.00 16.56  ? 349  GLU A C     1 
ATOM   2750 O  O     . GLU A 1 352 ? 37.475 13.953  -14.907 1.00 16.14  ? 349  GLU A O     1 
ATOM   2751 C  CB    . GLU A 1 352 ? 34.288 14.417  -14.201 1.00 17.31  ? 349  GLU A CB    1 
ATOM   2752 C  CG    . GLU A 1 352 ? 34.485 14.993  -15.603 1.00 20.80  ? 349  GLU A CG    1 
ATOM   2753 C  CD    . GLU A 1 352 ? 33.587 16.175  -15.915 1.00 38.87  ? 349  GLU A CD    1 
ATOM   2754 O  OE1   . GLU A 1 352 ? 34.049 17.092  -16.626 1.00 42.56  ? 349  GLU A OE1   1 
ATOM   2755 O  OE2   . GLU A 1 352 ? 32.417 16.182  -15.478 1.00 39.48  ? 349  GLU A OE2   1 
ATOM   2756 N  N     . GLU A 1 353 ? 37.089 14.834  -12.867 1.00 18.18  ? 350  GLU A N     1 
ATOM   2757 C  CA    . GLU A 1 353 ? 38.358 15.542  -12.828 1.00 14.73  ? 350  GLU A CA    1 
ATOM   2758 C  C     . GLU A 1 353 ? 39.521 14.558  -12.943 1.00 18.14  ? 350  GLU A C     1 
ATOM   2759 O  O     . GLU A 1 353 ? 40.446 14.747  -13.741 1.00 16.42  ? 350  GLU A O     1 
ATOM   2760 C  CB    . GLU A 1 353 ? 38.476 16.355  -11.538 1.00 19.85  ? 350  GLU A CB    1 
ATOM   2761 C  CG    . GLU A 1 353 ? 39.798 17.068  -11.374 1.00 27.36  ? 350  GLU A CG    1 
ATOM   2762 C  CD    . GLU A 1 353 ? 39.789 18.037  -10.207 1.00 35.29  ? 350  GLU A CD    1 
ATOM   2763 O  OE1   . GLU A 1 353 ? 38.708 18.252  -9.619  1.00 38.78  ? 350  GLU A OE1   1 
ATOM   2764 O  OE2   . GLU A 1 353 ? 40.869 18.565  -9.867  1.00 52.54  ? 350  GLU A OE2   1 
ATOM   2765 N  N     . ARG A 1 354 ? 39.459 13.501  -12.139 1.00 14.91  ? 351  ARG A N     1 
ATOM   2766 C  CA    . ARG A 1 354 ? 40.510 12.492  -12.141 1.00 13.51  ? 351  ARG A CA    1 
ATOM   2767 C  C     . ARG A 1 354 ? 40.535 11.669  -13.434 1.00 16.24  ? 351  ARG A C     1 
ATOM   2768 O  O     . ARG A 1 354 ? 41.613 11.332  -13.932 1.00 15.44  ? 351  ARG A O     1 
ATOM   2769 C  CB    . ARG A 1 354 ? 40.347 11.573  -10.918 1.00 15.05  ? 351  ARG A CB    1 
ATOM   2770 C  CG    A ARG A 1 354 ? 40.844 12.222  -9.621  0.97 14.84  ? 351  ARG A CG    1 
ATOM   2771 C  CG    B ARG A 1 354 ? 40.592 12.236  -9.576  0.03 14.88  ? 351  ARG A CG    1 
ATOM   2772 C  CD    A ARG A 1 354 ? 40.345 11.508  -8.379  0.97 15.65  ? 351  ARG A CD    1 
ATOM   2773 C  CD    B ARG A 1 354 ? 40.396 11.235  -8.447  0.03 15.16  ? 351  ARG A CD    1 
ATOM   2774 N  NE    A ARG A 1 354 ? 40.788 10.121  -8.329  0.97 14.92  ? 351  ARG A NE    1 
ATOM   2775 N  NE    B ARG A 1 354 ? 41.234 10.051  -8.620  0.03 14.80  ? 351  ARG A NE    1 
ATOM   2776 C  CZ    A ARG A 1 354 ? 40.297 9.217   -7.488  0.97 15.39  ? 351  ARG A CZ    1 
ATOM   2777 C  CZ    B ARG A 1 354 ? 41.056 8.905   -7.971  0.03 14.66  ? 351  ARG A CZ    1 
ATOM   2778 N  NH1   A ARG A 1 354 ? 39.345 9.549   -6.610  0.97 12.47  ? 351  ARG A NH1   1 
ATOM   2779 N  NH1   B ARG A 1 354 ? 40.062 8.779   -7.102  0.03 14.64  ? 351  ARG A NH1   1 
ATOM   2780 N  NH2   A ARG A 1 354 ? 40.755 7.975   -7.531  0.97 14.16  ? 351  ARG A NH2   1 
ATOM   2781 N  NH2   B ARG A 1 354 ? 41.869 7.882   -8.194  0.03 14.50  ? 351  ARG A NH2   1 
ATOM   2782 N  N     . LEU A 1 355 ? 39.363 11.363  -13.990 1.00 16.43  ? 352  LEU A N     1 
ATOM   2783 C  CA    . LEU A 1 355 ? 39.294 10.603  -15.233 1.00 20.19  ? 352  LEU A CA    1 
ATOM   2784 C  C     . LEU A 1 355 ? 39.860 11.406  -16.398 1.00 17.04  ? 352  LEU A C     1 
ATOM   2785 O  O     . LEU A 1 355 ? 40.545 10.864  -17.274 1.00 17.98  ? 352  LEU A O     1 
ATOM   2786 C  CB    . LEU A 1 355 ? 37.856 10.200  -15.542 1.00 16.03  ? 352  LEU A CB    1 
ATOM   2787 C  CG    . LEU A 1 355 ? 37.287 9.019   -14.766 1.00 16.48  ? 352  LEU A CG    1 
ATOM   2788 C  CD1   . LEU A 1 355 ? 35.804 8.874   -15.079 1.00 17.36  ? 352  LEU A CD1   1 
ATOM   2789 C  CD2   . LEU A 1 355 ? 38.044 7.751   -15.136 1.00 15.04  ? 352  LEU A CD2   1 
ATOM   2790 N  N     . THR A 1 356 ? 39.557 12.700  -16.425 1.00 15.18  ? 353  THR A N     1 
ATOM   2791 C  CA    . THR A 1 356 ? 40.025 13.523  -17.537 1.00 17.94  ? 353  THR A CA    1 
ATOM   2792 C  C     . THR A 1 356 ? 41.548 13.656  -17.502 1.00 19.72  ? 353  THR A C     1 
ATOM   2793 O  O     . THR A 1 356 ? 42.214 13.534  -18.528 1.00 22.09  ? 353  THR A O     1 
ATOM   2794 C  CB    . THR A 1 356 ? 39.342 14.904  -17.530 1.00 20.21  ? 353  THR A CB    1 
ATOM   2795 O  OG1   . THR A 1 356 ? 37.937 14.716  -17.730 1.00 21.07  ? 353  THR A OG1   1 
ATOM   2796 C  CG2   . THR A 1 356 ? 39.876 15.764  -18.653 1.00 21.42  ? 353  THR A CG2   1 
ATOM   2797 N  N     . LYS A 1 357 ? 42.098 13.862  -16.311 1.00 16.20  ? 354  LYS A N     1 
ATOM   2798 C  CA    . LYS A 1 357 ? 43.543 13.883  -16.133 1.00 15.83  ? 354  LYS A CA    1 
ATOM   2799 C  C     . LYS A 1 357 ? 44.179 12.547  -16.531 1.00 15.69  ? 354  LYS A C     1 
ATOM   2800 O  O     . LYS A 1 357 ? 45.241 12.501  -17.176 1.00 18.98  ? 354  LYS A O     1 
ATOM   2801 C  CB    . LYS A 1 357 ? 43.876 14.210  -14.679 1.00 16.63  ? 354  LYS A CB    1 
ATOM   2802 C  CG    . LYS A 1 357 ? 45.357 14.262  -14.365 1.00 22.86  ? 354  LYS A CG    1 
ATOM   2803 C  CD    . LYS A 1 357 ? 46.041 15.375  -15.133 1.00 32.73  ? 354  LYS A CD    1 
ATOM   2804 C  CE    . LYS A 1 357 ? 47.221 15.933  -14.351 1.00 38.49  ? 354  LYS A CE    1 
ATOM   2805 N  NZ    . LYS A 1 357 ? 48.212 14.874  -14.006 1.00 28.98  ? 354  LYS A NZ    1 
ATOM   2806 N  N     . ASP A 1 358 ? 43.524 11.458  -16.150 1.00 16.11  ? 355  ASP A N     1 
ATOM   2807 C  CA    . ASP A 1 358 ? 44.031 10.119  -16.460 1.00 16.86  ? 355  ASP A CA    1 
ATOM   2808 C  C     . ASP A 1 358 ? 44.093 9.881   -17.969 1.00 16.37  ? 355  ASP A C     1 
ATOM   2809 O  O     . ASP A 1 358 ? 45.043 9.281   -18.461 1.00 17.79  ? 355  ASP A O     1 
ATOM   2810 C  CB    . ASP A 1 358 ? 43.161 9.046   -15.797 1.00 16.97  ? 355  ASP A CB    1 
ATOM   2811 C  CG    . ASP A 1 358 ? 43.681 7.647   -16.041 1.00 20.04  ? 355  ASP A CG    1 
ATOM   2812 O  OD1   . ASP A 1 358 ? 44.658 7.253   -15.370 1.00 16.82  ? 355  ASP A OD1   1 
ATOM   2813 O  OD2   . ASP A 1 358 ? 43.130 6.945   -16.917 1.00 18.32  ? 355  ASP A OD2   1 
ATOM   2814 N  N     . ARG A 1 359 ? 43.079 10.351  -18.698 1.00 15.02  ? 356  ARG A N     1 
ATOM   2815 C  CA    . ARG A 1 359 ? 43.008 10.150  -20.136 1.00 24.05  ? 356  ARG A CA    1 
ATOM   2816 C  C     . ARG A 1 359 ? 44.149 10.883  -20.835 1.00 18.84  ? 356  ARG A C     1 
ATOM   2817 O  O     . ARG A 1 359 ? 44.803 10.338  -21.726 1.00 21.18  ? 356  ARG A O     1 
ATOM   2818 C  CB    . ARG A 1 359 ? 41.656 10.628  -20.681 1.00 21.33  ? 356  ARG A CB    1 
ATOM   2819 C  CG    . ARG A 1 359 ? 41.409 10.273  -22.148 1.00 21.38  ? 356  ARG A CG    1 
ATOM   2820 C  CD    . ARG A 1 359 ? 40.015 10.691  -22.597 1.00 25.28  ? 356  ARG A CD    1 
ATOM   2821 N  NE    . ARG A 1 359 ? 39.785 12.120  -22.399 1.00 27.79  ? 356  ARG A NE    1 
ATOM   2822 C  CZ    . ARG A 1 359 ? 38.590 12.676  -22.213 1.00 31.91  ? 356  ARG A CZ    1 
ATOM   2823 N  NH1   . ARG A 1 359 ? 37.493 11.927  -22.197 1.00 35.87  ? 356  ARG A NH1   1 
ATOM   2824 N  NH2   . ARG A 1 359 ? 38.494 13.988  -22.042 1.00 33.51  ? 356  ARG A NH2   1 
ATOM   2825 N  N     . ASN A 1 360 ? 44.398 12.117  -20.413 1.00 16.40  ? 357  ASN A N     1 
ATOM   2826 C  CA    . ASN A 1 360 ? 45.498 12.901  -20.974 1.00 18.34  ? 357  ASN A CA    1 
ATOM   2827 C  C     . ASN A 1 360 ? 46.880 12.323  -20.658 1.00 18.22  ? 357  ASN A C     1 
ATOM   2828 O  O     . ASN A 1 360 ? 47.771 12.324  -21.501 1.00 21.64  ? 357  ASN A O     1 
ATOM   2829 C  CB    . ASN A 1 360 ? 45.428 14.334  -20.466 1.00 20.67  ? 357  ASN A CB    1 
ATOM   2830 C  CG    . ASN A 1 360 ? 44.341 15.134  -21.144 1.00 26.49  ? 357  ASN A CG    1 
ATOM   2831 O  OD1   . ASN A 1 360 ? 44.102 14.979  -22.341 1.00 29.65  ? 357  ASN A OD1   1 
ATOM   2832 N  ND2   . ASN A 1 360 ? 43.675 15.995  -20.386 1.00 26.79  ? 357  ASN A ND2   1 
ATOM   2833 N  N     . ASP A 1 361 ? 47.052 11.825  -19.437 1.00 20.66  ? 358  ASP A N     1 
ATOM   2834 C  CA    . ASP A 1 361 ? 48.357 11.326  -19.007 1.00 20.67  ? 358  ASP A CA    1 
ATOM   2835 C  C     . ASP A 1 361 ? 48.649 9.937   -19.555 1.00 18.43  ? 358  ASP A C     1 
ATOM   2836 O  O     . ASP A 1 361 ? 49.784 9.630   -19.915 1.00 21.11  ? 358  ASP A O     1 
ATOM   2837 C  CB    . ASP A 1 361 ? 48.454 11.278  -17.474 1.00 18.99  ? 358  ASP A CB    1 
ATOM   2838 C  CG    . ASP A 1 361 ? 48.572 12.663  -16.843 1.00 30.66  ? 358  ASP A CG    1 
ATOM   2839 O  OD1   . ASP A 1 361 ? 48.678 13.671  -17.586 1.00 22.89  ? 358  ASP A OD1   1 
ATOM   2840 O  OD2   . ASP A 1 361 ? 48.571 12.732  -15.591 1.00 24.61  ? 358  ASP A OD2   1 
ATOM   2841 N  N     . ASN A 1 362 ? 47.619 9.101   -19.605 1.00 18.21  ? 359  ASN A N     1 
ATOM   2842 C  CA    . ASN A 1 362 ? 47.830 7.666   -19.736 1.00 17.79  ? 359  ASN A CA    1 
ATOM   2843 C  C     . ASN A 1 362 ? 47.209 7.039   -20.970 1.00 19.62  ? 359  ASN A C     1 
ATOM   2844 O  O     . ASN A 1 362 ? 47.271 5.827   -21.121 1.00 18.32  ? 359  ASN A O     1 
ATOM   2845 C  CB    . ASN A 1 362 ? 47.307 6.967   -18.469 1.00 16.91  ? 359  ASN A CB    1 
ATOM   2846 C  CG    . ASN A 1 362 ? 48.089 7.371   -17.228 1.00 17.04  ? 359  ASN A CG    1 
ATOM   2847 O  OD1   . ASN A 1 362 ? 49.311 7.511   -17.282 1.00 16.33  ? 359  ASN A OD1   1 
ATOM   2848 N  ND2   . ASN A 1 362 ? 47.390 7.565   -16.106 1.00 15.94  ? 359  ASN A ND2   1 
ATOM   2849 N  N     . ASP A 1 363 ? 46.625 7.855   -21.847 1.00 18.72  ? 360  ASP A N     1 
ATOM   2850 C  CA    . ASP A 1 363 ? 46.151 7.374   -23.150 1.00 19.26  ? 360  ASP A CA    1 
ATOM   2851 C  C     . ASP A 1 363 ? 45.182 6.217   -23.005 1.00 20.13  ? 360  ASP A C     1 
ATOM   2852 O  O     . ASP A 1 363 ? 45.350 5.157   -23.623 1.00 23.23  ? 360  ASP A O     1 
ATOM   2853 C  CB    . ASP A 1 363 ? 47.327 6.940   -24.028 1.00 27.39  ? 360  ASP A CB    1 
ATOM   2854 C  CG    . ASP A 1 363 ? 48.291 8.070   -24.301 1.00 32.49  ? 360  ASP A CG    1 
ATOM   2855 O  OD1   . ASP A 1 363 ? 47.822 9.183   -24.620 1.00 30.20  ? 360  ASP A OD1   1 
ATOM   2856 O  OD2   . ASP A 1 363 ? 49.515 7.847   -24.186 1.00 35.95  ? 360  ASP A OD2   1 
ATOM   2857 N  N     . ARG A 1 364 ? 44.178 6.404   -22.160 1.00 19.45  ? 361  ARG A N     1 
ATOM   2858 C  CA    . ARG A 1 364 ? 43.192 5.356   -21.966 1.00 21.26  ? 361  ARG A CA    1 
ATOM   2859 C  C     . ARG A 1 364 ? 41.879 5.957   -21.540 1.00 21.38  ? 361  ARG A C     1 
ATOM   2860 O  O     . ARG A 1 364 ? 41.835 7.096   -21.059 1.00 19.38  ? 361  ARG A O     1 
ATOM   2861 C  CB    . ARG A 1 364 ? 43.668 4.340   -20.923 1.00 19.33  ? 361  ARG A CB    1 
ATOM   2862 C  CG    . ARG A 1 364 ? 43.930 4.944   -19.545 1.00 15.87  ? 361  ARG A CG    1 
ATOM   2863 C  CD    . ARG A 1 364 ? 44.398 3.880   -18.555 1.00 13.98  ? 361  ARG A CD    1 
ATOM   2864 N  NE    . ARG A 1 364 ? 44.438 4.429   -17.213 1.00 17.06  ? 361  ARG A NE    1 
ATOM   2865 C  CZ    . ARG A 1 364 ? 44.686 3.710   -16.125 1.00 21.32  ? 361  ARG A CZ    1 
ATOM   2866 N  NH1   . ARG A 1 364 ? 44.688 4.292   -14.937 1.00 16.37  ? 361  ARG A NH1   1 
ATOM   2867 N  NH2   . ARG A 1 364 ? 44.927 2.414   -16.228 1.00 16.33  ? 361  ARG A NH2   1 
ATOM   2868 N  N     . VAL A 1 365 ? 40.818 5.177   -21.699 1.00 17.53  ? 362  VAL A N     1 
ATOM   2869 C  CA    . VAL A 1 365 ? 39.473 5.595   -21.318 1.00 20.33  ? 362  VAL A CA    1 
ATOM   2870 C  C     . VAL A 1 365 ? 38.728 4.497   -20.575 1.00 23.06  ? 362  VAL A C     1 
ATOM   2871 O  O     . VAL A 1 365 ? 38.712 3.344   -21.002 1.00 22.66  ? 362  VAL A O     1 
ATOM   2872 C  CB    . VAL A 1 365 ? 38.634 5.996   -22.553 1.00 26.20  ? 362  VAL A CB    1 
ATOM   2873 C  CG1   . VAL A 1 365 ? 39.024 7.375   -23.030 1.00 35.28  ? 362  VAL A CG1   1 
ATOM   2874 C  CG2   . VAL A 1 365 ? 38.811 4.975   -23.667 1.00 30.06  ? 362  VAL A CG2   1 
ATOM   2875 N  N     . ALA A 1 366 ? 38.105 4.861   -19.462 1.00 18.65  ? 363  ALA A N     1 
ATOM   2876 C  CA    . ALA A 1 366 ? 37.251 3.932   -18.728 1.00 21.34  ? 363  ALA A CA    1 
ATOM   2877 C  C     . ALA A 1 366 ? 35.935 3.717   -19.468 1.00 22.35  ? 363  ALA A C     1 
ATOM   2878 O  O     . ALA A 1 366 ? 35.389 4.649   -20.070 1.00 26.33  ? 363  ALA A O     1 
ATOM   2879 C  CB    . ALA A 1 366 ? 36.995 4.451   -17.321 1.00 15.09  ? 363  ALA A CB    1 
ATOM   2880 N  N     . THR A 1 367 ? 35.415 2.494   -19.425 1.00 20.06  ? 364  THR A N     1 
ATOM   2881 C  CA    . THR A 1 367 ? 34.199 2.182   -20.166 1.00 18.03  ? 364  THR A CA    1 
ATOM   2882 C  C     . THR A 1 367 ? 33.037 1.727   -19.286 1.00 24.09  ? 364  THR A C     1 
ATOM   2883 O  O     . THR A 1 367 ? 31.909 1.577   -19.762 1.00 22.87  ? 364  THR A O     1 
ATOM   2884 C  CB    . THR A 1 367 ? 34.463 1.093   -21.230 1.00 22.97  ? 364  THR A CB    1 
ATOM   2885 O  OG1   . THR A 1 367 ? 34.700 -0.173  -20.592 1.00 25.04  ? 364  THR A OG1   1 
ATOM   2886 C  CG2   . THR A 1 367 ? 35.674 1.474   -22.077 1.00 23.72  ? 364  THR A CG2   1 
ATOM   2887 N  N     . GLN A 1 368 ? 33.299 1.499   -18.004 1.00 21.45  ? 365  GLN A N     1 
ATOM   2888 C  CA    . GLN A 1 368 ? 32.241 1.017   -17.128 1.00 23.30  ? 365  GLN A CA    1 
ATOM   2889 C  C     . GLN A 1 368 ? 32.217 1.811   -15.834 1.00 21.88  ? 365  GLN A C     1 
ATOM   2890 O  O     . GLN A 1 368 ? 33.256 2.117   -15.262 1.00 21.72  ? 365  GLN A O     1 
ATOM   2891 C  CB    . GLN A 1 368 ? 32.416 -0.471  -16.829 1.00 27.38  ? 365  GLN A CB    1 
ATOM   2892 C  CG    . GLN A 1 368 ? 31.271 -1.073  -16.031 1.00 27.78  ? 365  GLN A CG    1 
ATOM   2893 C  CD    . GLN A 1 368 ? 31.367 -2.585  -15.910 1.00 25.06  ? 365  GLN A CD    1 
ATOM   2894 O  OE1   . GLN A 1 368 ? 32.266 -3.105  -15.258 1.00 38.96  ? 365  GLN A OE1   1 
ATOM   2895 N  NE2   . GLN A 1 368 ? 30.439 -3.296  -16.539 1.00 42.09  ? 365  GLN A NE2   1 
ATOM   2896 N  N     . LEU A 1 369 ? 31.019 2.167   -15.399 1.00 19.43  ? 366  LEU A N     1 
ATOM   2897 C  CA    . LEU A 1 369 ? 30.845 2.867   -14.133 1.00 18.49  ? 366  LEU A CA    1 
ATOM   2898 C  C     . LEU A 1 369 ? 30.210 1.918   -13.144 1.00 20.98  ? 366  LEU A C     1 
ATOM   2899 O  O     . LEU A 1 369 ? 29.177 1.311   -13.417 1.00 21.19  ? 366  LEU A O     1 
ATOM   2900 C  CB    . LEU A 1 369 ? 29.977 4.116   -14.299 1.00 19.03  ? 366  LEU A CB    1 
ATOM   2901 C  CG    . LEU A 1 369 ? 29.735 4.902   -13.011 1.00 25.64  ? 366  LEU A CG    1 
ATOM   2902 C  CD1   . LEU A 1 369 ? 31.018 5.605   -12.571 1.00 23.05  ? 366  LEU A CD1   1 
ATOM   2903 C  CD2   . LEU A 1 369 ? 28.598 5.894   -13.205 1.00 27.15  ? 366  LEU A CD2   1 
ATOM   2904 N  N     . VAL A 1 370 ? 30.850 1.768   -11.996 1.00 19.72  ? 367  VAL A N     1 
ATOM   2905 C  CA    . VAL A 1 370 ? 30.312 0.917   -10.958 1.00 20.51  ? 367  VAL A CA    1 
ATOM   2906 C  C     . VAL A 1 370 ? 29.772 1.777   -9.820  1.00 23.33  ? 367  VAL A C     1 
ATOM   2907 O  O     . VAL A 1 370 ? 30.467 2.665   -9.330  1.00 24.68  ? 367  VAL A O     1 
ATOM   2908 C  CB    . VAL A 1 370 ? 31.377 -0.048  -10.430 1.00 27.37  ? 367  VAL A CB    1 
ATOM   2909 C  CG1   . VAL A 1 370 ? 30.783 -0.891  -9.365  1.00 32.62  ? 367  VAL A CG1   1 
ATOM   2910 C  CG2   . VAL A 1 370 ? 31.920 -0.918  -11.564 1.00 24.74  ? 367  VAL A CG2   1 
ATOM   2911 N  N     . VAL A 1 371 ? 28.527 1.532   -9.420  1.00 22.00  ? 368  VAL A N     1 
ATOM   2912 C  CA    . VAL A 1 371 ? 27.919 2.296   -8.332  1.00 23.91  ? 368  VAL A CA    1 
ATOM   2913 C  C     . VAL A 1 371 ? 27.636 1.391   -7.148  1.00 26.72  ? 368  VAL A C     1 
ATOM   2914 O  O     . VAL A 1 371 ? 27.030 0.336   -7.296  1.00 25.36  ? 368  VAL A O     1 
ATOM   2915 C  CB    . VAL A 1 371 ? 26.621 2.976   -8.780  1.00 21.84  ? 368  VAL A CB    1 
ATOM   2916 C  CG1   . VAL A 1 371 ? 26.105 3.914   -7.685  1.00 24.53  ? 368  VAL A CG1   1 
ATOM   2917 C  CG2   . VAL A 1 371 ? 26.860 3.732   -10.076 1.00 21.78  ? 368  VAL A CG2   1 
ATOM   2918 N  N     . SER A 1 372 ? 28.090 1.802   -5.970  1.00 25.41  ? 369  SER A N     1 
ATOM   2919 C  CA    . SER A 1 372 ? 27.943 0.982   -4.780  1.00 26.46  ? 369  SER A CA    1 
ATOM   2920 C  C     . SER A 1 372 ? 27.356 1.810   -3.651  1.00 27.35  ? 369  SER A C     1 
ATOM   2921 O  O     . SER A 1 372 ? 27.665 2.989   -3.510  1.00 23.74  ? 369  SER A O     1 
ATOM   2922 C  CB    . SER A 1 372 ? 29.291 0.387   -4.364  1.00 31.12  ? 369  SER A CB    1 
ATOM   2923 O  OG    . SER A 1 372 ? 29.152 -0.434  -3.222  1.00 37.32  ? 369  SER A OG    1 
ATOM   2924 N  N     . ILE A 1 373 ? 26.478 1.201   -2.867  1.00 23.12  ? 370  ILE A N     1 
ATOM   2925 C  CA    . ILE A 1 373 ? 25.927 1.882   -1.707  1.00 23.09  ? 370  ILE A CA    1 
ATOM   2926 C  C     . ILE A 1 373 ? 25.959 0.973   -0.482  1.00 31.99  ? 370  ILE A C     1 
ATOM   2927 O  O     . ILE A 1 373 ? 26.110 -0.250  -0.591  1.00 26.36  ? 370  ILE A O     1 
ATOM   2928 C  CB    . ILE A 1 373 ? 24.463 2.356   -1.937  1.00 30.41  ? 370  ILE A CB    1 
ATOM   2929 C  CG1   . ILE A 1 373 ? 23.535 1.156   -2.140  1.00 35.81  ? 370  ILE A CG1   1 
ATOM   2930 C  CG2   . ILE A 1 373 ? 24.360 3.364   -3.104  1.00 19.41  ? 370  ILE A CG2   1 
ATOM   2931 C  CD1   . ILE A 1 373 ? 22.110 1.546   -2.443  1.00 35.74  ? 370  ILE A CD1   1 
ATOM   2932 N  N     . ARG A 1 374 ? 25.834 1.586   0.689   1.00 30.04  ? 371  ARG A N     1 
ATOM   2933 C  CA    . ARG A 1 374 ? 25.578 0.834   1.902   1.00 33.17  ? 371  ARG A CA    1 
ATOM   2934 C  C     . ARG A 1 374 ? 24.312 1.381   2.517   1.00 37.95  ? 371  ARG A C     1 
ATOM   2935 O  O     . ARG A 1 374 ? 24.023 2.579   2.435   1.00 31.01  ? 371  ARG A O     1 
ATOM   2936 C  CB    . ARG A 1 374 ? 26.734 0.913   2.895   1.00 37.19  ? 371  ARG A CB    1 
ATOM   2937 C  CG    . ARG A 1 374 ? 26.631 -0.110  4.027   1.00 43.99  ? 371  ARG A CG    1 
ATOM   2938 C  CD    . ARG A 1 374 ? 27.655 0.151   5.116   1.00 48.37  ? 371  ARG A CD    1 
ATOM   2939 N  NE    . ARG A 1 374 ? 28.928 0.601   4.560   1.00 60.17  ? 371  ARG A NE    1 
ATOM   2940 C  CZ    . ARG A 1 374 ? 29.977 0.968   5.289   1.00 56.59  ? 371  ARG A CZ    1 
ATOM   2941 N  NH1   . ARG A 1 374 ? 29.910 0.936   6.614   1.00 63.18  ? 371  ARG A NH1   1 
ATOM   2942 N  NH2   . ARG A 1 374 ? 31.093 1.366   4.691   1.00 57.51  ? 371  ARG A NH2   1 
ATOM   2943 N  N     . VAL A 1 375 ? 23.543 0.491   3.119   1.00 36.87  ? 372  VAL A N     1 
ATOM   2944 C  CA    . VAL A 1 375 ? 22.282 0.880   3.704   1.00 38.88  ? 372  VAL A CA    1 
ATOM   2945 C  C     . VAL A 1 375 ? 22.395 0.773   5.221   1.00 40.53  ? 372  VAL A C     1 
ATOM   2946 O  O     . VAL A 1 375 ? 23.078 -0.105  5.726   1.00 44.13  ? 372  VAL A O     1 
ATOM   2947 C  CB    . VAL A 1 375 ? 21.151 0.011   3.152   1.00 45.87  ? 372  VAL A CB    1 
ATOM   2948 C  CG1   . VAL A 1 375 ? 19.879 0.320   3.856   1.00 49.60  ? 372  VAL A CG1   1 
ATOM   2949 C  CG2   . VAL A 1 375 ? 20.994 0.254   1.652   1.00 41.35  ? 372  VAL A CG2   1 
ATOM   2950 N  N     . GLN A 1 376 ? 21.775 1.696   5.946   1.00 44.38  ? 373  GLN A N     1 
ATOM   2951 C  CA    . GLN A 1 376 ? 21.841 1.686   7.405   1.00 51.16  ? 373  GLN A CA    1 
ATOM   2952 C  C     . GLN A 1 376 ? 21.341 0.374   8.017   1.00 54.81  ? 373  GLN A C     1 
ATOM   2953 O  O     . GLN A 1 376 ? 20.240 -0.089  7.709   1.00 58.65  ? 373  GLN A O     1 
ATOM   2954 C  CB    . GLN A 1 376 ? 21.040 2.861   7.959   1.00 45.60  ? 373  GLN A CB    1 
ATOM   2955 C  CG    . GLN A 1 376 ? 20.907 2.871   9.463   1.00 54.75  ? 373  GLN A CG    1 
ATOM   2956 C  CD    . GLN A 1 376 ? 20.079 4.036   9.958   1.00 56.37  ? 373  GLN A CD    1 
ATOM   2957 O  OE1   . GLN A 1 376 ? 20.359 5.193   9.639   1.00 49.15  ? 373  GLN A OE1   1 
ATOM   2958 N  NE2   . GLN A 1 376 ? 19.040 3.737   10.731  1.00 62.57  ? 373  GLN A NE2   1 
ATOM   2959 N  N     . GLY A 1 377 ? 22.111 -0.218  8.879   1.00 59.36  ? 374  GLY A N     1 
ATOM   2960 C  CA    . GLY A 1 377 ? 21.705 -1.483  9.449   1.00 63.85  ? 374  GLY A CA    1 
ATOM   2961 C  C     . GLY A 1 377 ? 22.334 -2.695  8.808   1.00 67.34  ? 374  GLY A C     1 
ATOM   2962 O  O     . GLY A 1 377 ? 21.997 -3.803  9.216   1.00 69.73  ? 374  GLY A O     1 
ATOM   2963 N  N     . ASP A 1 378 ? 23.266 -2.474  7.874   1.00 59.36  ? 375  ASP A N     1 
ATOM   2964 C  CA    . ASP A 1 378 ? 24.066 -3.500  7.252   1.00 62.68  ? 375  ASP A CA    1 
ATOM   2965 C  C     . ASP A 1 378 ? 25.506 -3.362  7.746   1.00 67.71  ? 375  ASP A C     1 
ATOM   2966 O  O     . ASP A 1 378 ? 26.078 -2.309  7.698   1.00 68.29  ? 375  ASP A O     1 
ATOM   2967 C  CB    . ASP A 1 378 ? 24.009 -3.243  5.740   1.00 62.44  ? 375  ASP A CB    1 
ATOM   2968 C  CG    . ASP A 1 378 ? 24.419 -4.414  4.930   1.00 64.48  ? 375  ASP A CG    1 
ATOM   2969 O  OD1   . ASP A 1 378 ? 25.361 -5.093  5.316   1.00 65.23  ? 375  ASP A OD1   1 
ATOM   2970 O  OD2   . ASP A 1 378 ? 23.777 -4.667  3.915   1.00 56.86  ? 375  ASP A OD2   1 
ATOM   2971 N  N     . LYS A 1 379 ? 26.054 -4.319  8.456   1.00 73.60  ? 376  LYS A N     1 
ATOM   2972 C  CA    . LYS A 1 379 ? 26.661 -5.563  8.133   1.00 77.32  ? 376  LYS A CA    1 
ATOM   2973 C  C     . LYS A 1 379 ? 27.992 -5.518  7.385   1.00 74.90  ? 376  LYS A C     1 
ATOM   2974 O  O     . LYS A 1 379 ? 28.998 -5.964  7.881   1.00 75.30  ? 376  LYS A O     1 
ATOM   2975 C  CB    . LYS A 1 379 ? 25.671 -6.552  7.560   1.00 81.25  ? 376  LYS A CB    1 
ATOM   2976 C  CG    . LYS A 1 379 ? 24.458 -6.812  8.442   1.00 84.27  ? 376  LYS A CG    1 
ATOM   2977 C  CD    . LYS A 1 379 ? 23.638 -7.895  7.803   1.00 88.16  ? 376  LYS A CD    1 
ATOM   2978 C  CE    . LYS A 1 379 ? 22.267 -8.007  8.426   1.00 91.12  ? 376  LYS A CE    1 
ATOM   2979 N  NZ    . LYS A 1 379 ? 21.292 -6.923  8.091   1.00 89.98  ? 376  LYS A NZ    1 
ATOM   2980 N  N     . ARG A 1 380 ? 27.998 -4.932  6.212   1.00 73.29  ? 377  ARG A N     1 
ATOM   2981 C  CA    . ARG A 1 380 ? 29.085 -5.122  5.268   1.00 70.88  ? 377  ARG A CA    1 
ATOM   2982 C  C     . ARG A 1 380 ? 29.565 -3.793  4.735   1.00 67.15  ? 377  ARG A C     1 
ATOM   2983 O  O     . ARG A 1 380 ? 28.811 -2.862  4.759   1.00 67.37  ? 377  ARG A O     1 
ATOM   2984 C  CB    . ARG A 1 380 ? 28.571 -5.955  4.092   1.00 66.68  ? 377  ARG A CB    1 
ATOM   2985 C  CG    . ARG A 1 380 ? 27.585 -7.026  4.514   1.00 66.71  ? 377  ARG A CG    1 
ATOM   2986 C  CD    . ARG A 1 380 ? 26.914 -7.702  3.358   1.00 58.97  ? 377  ARG A CD    1 
ATOM   2987 N  NE    . ARG A 1 380 ? 25.639 -7.094  3.103   1.00 53.28  ? 377  ARG A NE    1 
ATOM   2988 C  CZ    . ARG A 1 380 ? 24.848 -7.410  2.098   1.00 52.57  ? 377  ARG A CZ    1 
ATOM   2989 N  NH1   . ARG A 1 380 ? 25.186 -8.330  1.248   1.00 47.22  ? 377  ARG A NH1   1 
ATOM   2990 N  NH2   . ARG A 1 380 ? 23.709 -6.789  1.955   1.00 52.81  ? 377  ARG A NH2   1 
ATOM   2991 N  N     . LEU A 1 381 ? 30.800 -3.700  4.257   1.00 64.75  ? 378  LEU A N     1 
ATOM   2992 C  CA    . LEU A 1 381 ? 31.252 -2.467  3.664   1.00 64.83  ? 378  LEU A CA    1 
ATOM   2993 C  C     . LEU A 1 381 ? 30.302 -2.049  2.537   1.00 60.76  ? 378  LEU A C     1 
ATOM   2994 O  O     . LEU A 1 381 ? 29.951 -0.876  2.420   1.00 59.18  ? 378  LEU A O     1 
ATOM   2995 C  CB    . LEU A 1 381 ? 32.680 -2.643  3.164   1.00 68.06  ? 378  LEU A CB    1 
ATOM   2996 C  CG    . LEU A 1 381 ? 33.187 -1.867  1.955   1.00 65.66  ? 378  LEU A CG    1 
ATOM   2997 C  CD1   . LEU A 1 381 ? 33.369 -0.396  2.303   1.00 61.78  ? 378  LEU A CD1   1 
ATOM   2998 C  CD2   . LEU A 1 381 ? 34.505 -2.474  1.508   1.00 62.90  ? 378  LEU A CD2   1 
ATOM   2999 N  N     . SER A 1 382 ? 29.866 -3.013  1.728   1.00 57.49  ? 379  SER A N     1 
ATOM   3000 C  CA    . SER A 1 382 ? 28.926 -2.731  0.646   1.00 49.30  ? 379  SER A CA    1 
ATOM   3001 C  C     . SER A 1 382 ? 27.645 -3.547  0.766   1.00 51.19  ? 379  SER A C     1 
ATOM   3002 O  O     . SER A 1 382 ? 27.679 -4.736  1.085   1.00 50.03  ? 379  SER A O     1 
ATOM   3003 C  CB    . SER A 1 382 ? 29.567 -2.998  -0.718  1.00 44.73  ? 379  SER A CB    1 
ATOM   3004 O  OG    . SER A 1 382 ? 28.592 -2.936  -1.748  1.00 43.46  ? 379  SER A OG    1 
ATOM   3005 N  N     . SER A 1 383 ? 26.519 -2.895  0.491   1.00 44.13  ? 380  SER A N     1 
ATOM   3006 C  CA    . SER A 1 383 ? 25.213 -3.535  0.547   1.00 42.87  ? 380  SER A CA    1 
ATOM   3007 C  C     . SER A 1 383 ? 24.758 -3.936  -0.847  1.00 47.66  ? 380  SER A C     1 
ATOM   3008 O  O     . SER A 1 383 ? 24.078 -4.947  -1.029  1.00 43.57  ? 380  SER A O     1 
ATOM   3009 C  CB    . SER A 1 383 ? 24.182 -2.592  1.166   1.00 48.40  ? 380  SER A CB    1 
ATOM   3010 O  OG    . SER A 1 383 ? 24.575 -2.175  2.460   1.00 48.53  ? 380  SER A OG    1 
ATOM   3011 N  N     . LEU A 1 384 ? 25.133 -3.119  -1.828  1.00 45.41  ? 381  LEU A N     1 
ATOM   3012 C  CA    . LEU A 1 384 ? 24.668 -3.289  -3.200  1.00 38.47  ? 381  LEU A CA    1 
ATOM   3013 C  C     . LEU A 1 384 ? 25.608 -2.660  -4.227  1.00 37.57  ? 381  LEU A C     1 
ATOM   3014 O  O     . LEU A 1 384 ? 26.071 -1.530  -4.067  1.00 29.30  ? 381  LEU A O     1 
ATOM   3015 C  CB    . LEU A 1 384 ? 23.270 -2.699  -3.356  1.00 36.52  ? 381  LEU A CB    1 
ATOM   3016 C  CG    . LEU A 1 384 ? 22.639 -2.794  -4.745  1.00 42.05  ? 381  LEU A CG    1 
ATOM   3017 C  CD1   . LEU A 1 384 ? 21.204 -3.278  -4.642  1.00 46.91  ? 381  LEU A CD1   1 
ATOM   3018 C  CD2   . LEU A 1 384 ? 22.694 -1.443  -5.438  1.00 42.27  ? 381  LEU A CD2   1 
ATOM   3019 N  N     . ARG A 1 385 ? 25.852 -3.404  -5.299  1.00 32.81  ? 382  ARG A N     1 
ATOM   3020 C  CA    . ARG A 1 385 ? 26.806 -3.037  -6.328  1.00 27.34  ? 382  ARG A CA    1 
ATOM   3021 C  C     . ARG A 1 385 ? 26.185 -3.225  -7.712  1.00 30.14  ? 382  ARG A C     1 
ATOM   3022 O  O     . ARG A 1 385 ? 25.748 -4.326  -8.056  1.00 34.77  ? 382  ARG A O     1 
ATOM   3023 C  CB    . ARG A 1 385 ? 28.068 -3.887  -6.176  1.00 36.75  ? 382  ARG A CB    1 
ATOM   3024 C  CG    . ARG A 1 385 ? 29.011 -3.834  -7.345  1.00 41.47  ? 382  ARG A CG    1 
ATOM   3025 C  CD    . ARG A 1 385 ? 30.272 -3.091  -6.986  1.00 54.70  ? 382  ARG A CD    1 
ATOM   3026 N  NE    . ARG A 1 385 ? 30.863 -3.480  -5.712  1.00 61.65  ? 382  ARG A NE    1 
ATOM   3027 C  CZ    . ARG A 1 385 ? 31.970 -2.929  -5.224  1.00 69.37  ? 382  ARG A CZ    1 
ATOM   3028 N  NH1   . ARG A 1 385 ? 32.458 -3.330  -4.058  1.00 70.07  ? 382  ARG A NH1   1 
ATOM   3029 N  NH2   . ARG A 1 385 ? 32.592 -1.971  -5.903  1.00 67.26  ? 382  ARG A NH2   1 
ATOM   3030 N  N     . ARG A 1 386 ? 26.118 -2.150  -8.493  1.00 25.19  ? 383  ARG A N     1 
ATOM   3031 C  CA    . ARG A 1 386 ? 25.524 -2.204  -9.833  1.00 29.32  ? 383  ARG A CA    1 
ATOM   3032 C  C     . ARG A 1 386 ? 26.416 -1.482  -10.832 1.00 24.15  ? 383  ARG A C     1 
ATOM   3033 O  O     . ARG A 1 386 ? 27.060 -0.501  -10.490 1.00 24.65  ? 383  ARG A O     1 
ATOM   3034 C  CB    . ARG A 1 386 ? 24.135 -1.575  -9.834  1.00 29.04  ? 383  ARG A CB    1 
ATOM   3035 C  CG    . ARG A 1 386 ? 23.120 -2.267  -8.939  1.00 38.45  ? 383  ARG A CG    1 
ATOM   3036 C  CD    . ARG A 1 386 ? 22.576 -3.522  -9.590  1.00 33.14  ? 383  ARG A CD    1 
ATOM   3037 N  NE    . ARG A 1 386 ? 21.400 -4.043  -8.897  1.00 29.94  ? 383  ARG A NE    1 
ATOM   3038 C  CZ    . ARG A 1 386 ? 21.444 -4.972  -7.948  1.00 36.90  ? 383  ARG A CZ    1 
ATOM   3039 N  NH1   . ARG A 1 386 ? 22.612 -5.487  -7.572  1.00 35.18  ? 383  ARG A NH1   1 
ATOM   3040 N  NH2   . ARG A 1 386 ? 20.320 -5.391  -7.380  1.00 44.31  ? 383  ARG A NH2   1 
ATOM   3041 N  N     A CYS A 1 387 ? 26.456 -1.970  -12.066 0.88 26.55  ? 384  CYS A N     1 
ATOM   3042 N  N     B CYS A 1 387 ? 26.451 -1.968  -12.069 0.12 26.65  ? 384  CYS A N     1 
ATOM   3043 C  CA    . CYS A 1 387 ? 27.275 -1.343  -13.098 1.00 27.55  ? 384  CYS A CA    1 
ATOM   3044 C  C     . CYS A 1 387 ? 26.420 -0.772  -14.222 1.00 31.50  ? 384  CYS A C     1 
ATOM   3045 O  O     . CYS A 1 387 ? 25.306 -1.230  -14.460 1.00 31.00  ? 384  CYS A O     1 
ATOM   3046 C  CB    . CYS A 1 387 ? 28.279 -2.349  -13.672 1.00 32.58  ? 384  CYS A CB    1 
ATOM   3047 S  SG    A CYS A 1 387 ? 27.536 -3.672  -14.664 0.88 35.56  ? 384  CYS A SG    1 
ATOM   3048 S  SG    B CYS A 1 387 ? 29.325 -3.169  -12.457 0.12 31.30  ? 384  CYS A SG    1 
ATOM   3049 N  N     . CYS A 1 388 ? 26.949 0.231   -14.912 1.00 29.07  ? 385  CYS A N     1 
ATOM   3050 C  CA    . CYS A 1 388 ? 26.326 0.729   -16.135 1.00 30.05  ? 385  CYS A CA    1 
ATOM   3051 C  C     . CYS A 1 388 ? 27.410 1.279   -17.046 1.00 30.71  ? 385  CYS A C     1 
ATOM   3052 O  O     . CYS A 1 388 ? 28.566 1.371   -16.643 1.00 27.38  ? 385  CYS A O     1 
ATOM   3053 C  CB    . CYS A 1 388 ? 25.279 1.799   -15.825 1.00 26.26  ? 385  CYS A CB    1 
ATOM   3054 S  SG    . CYS A 1 388 ? 25.973 3.298   -15.108 1.00 29.90  ? 385  CYS A SG    1 
ATOM   3055 N  N     . ALA A 1 389 ? 27.047 1.637   -18.273 1.00 30.24  ? 386  ALA A N     1 
ATOM   3056 C  CA    . ALA A 1 389 ? 28.037 2.114   -19.235 1.00 24.67  ? 386  ALA A CA    1 
ATOM   3057 C  C     . ALA A 1 389 ? 28.620 3.471   -18.850 1.00 25.40  ? 386  ALA A C     1 
ATOM   3058 O  O     . ALA A 1 389 ? 27.904 4.370   -18.406 1.00 29.46  ? 386  ALA A O     1 
ATOM   3059 C  CB    . ALA A 1 389 ? 27.423 2.193   -20.637 1.00 23.85  ? 386  ALA A CB    1 
ATOM   3060 N  N     . LEU A 1 390 ? 29.927 3.614   -19.017 1.00 19.81  ? 387  LEU A N     1 
ATOM   3061 C  CA    . LEU A 1 390 ? 30.562 4.919   -18.900 1.00 22.76  ? 387  LEU A CA    1 
ATOM   3062 C  C     . LEU A 1 390 ? 30.990 5.327   -20.306 1.00 25.11  ? 387  LEU A C     1 
ATOM   3063 O  O     . LEU A 1 390 ? 32.015 4.870   -20.808 1.00 28.13  ? 387  LEU A O     1 
ATOM   3064 C  CB    . LEU A 1 390 ? 31.755 4.879   -17.943 1.00 23.84  ? 387  LEU A CB    1 
ATOM   3065 C  CG    . LEU A 1 390 ? 32.109 6.152   -17.168 1.00 22.05  ? 387  LEU A CG    1 
ATOM   3066 C  CD1   . LEU A 1 390 ? 33.262 5.857   -16.213 1.00 21.91  ? 387  LEU A CD1   1 
ATOM   3067 C  CD2   . LEU A 1 390 ? 32.459 7.325   -18.081 1.00 19.78  ? 387  LEU A CD2   1 
ATOM   3068 N  N     . THR A 1 391 ? 30.193 6.176   -20.944 1.00 26.69  ? 388  THR A N     1 
ATOM   3069 C  CA    . THR A 1 391 ? 30.414 6.514   -22.347 1.00 30.96  ? 388  THR A CA    1 
ATOM   3070 C  C     . THR A 1 391 ? 30.928 7.931   -22.549 1.00 28.20  ? 388  THR A C     1 
ATOM   3071 O  O     . THR A 1 391 ? 31.435 8.265   -23.616 1.00 30.74  ? 388  THR A O     1 
ATOM   3072 C  CB    . THR A 1 391 ? 29.122 6.357   -23.169 1.00 32.71  ? 388  THR A CB    1 
ATOM   3073 O  OG1   . THR A 1 391 ? 28.176 7.359   -22.772 1.00 37.81  ? 388  THR A OG1   1 
ATOM   3074 C  CG2   . THR A 1 391 ? 28.521 4.970   -22.972 1.00 29.25  ? 388  THR A CG2   1 
ATOM   3075 N  N     . ARG A 1 392 ? 30.785 8.761   -21.522 1.00 31.29  ? 389  ARG A N     1 
ATOM   3076 C  CA    . ARG A 1 392 ? 31.214 10.151  -21.580 1.00 29.74  ? 389  ARG A CA    1 
ATOM   3077 C  C     . ARG A 1 392 ? 31.774 10.609  -20.237 1.00 27.54  ? 389  ARG A C     1 
ATOM   3078 O  O     . ARG A 1 392 ? 31.186 10.336  -19.192 1.00 24.89  ? 389  ARG A O     1 
ATOM   3079 C  CB    . ARG A 1 392 ? 30.052 11.056  -21.989 1.00 33.92  ? 389  ARG A CB    1 
ATOM   3080 C  CG    . ARG A 1 392 ? 30.375 12.002  -23.130 1.00 46.60  ? 389  ARG A CG    1 
ATOM   3081 C  CD    . ARG A 1 392 ? 29.129 12.727  -23.605 1.00 46.57  ? 389  ARG A CD    1 
ATOM   3082 N  NE    . ARG A 1 392 ? 28.792 12.409  -24.991 1.00 59.74  ? 389  ARG A NE    1 
ATOM   3083 C  CZ    . ARG A 1 392 ? 27.549 12.249  -25.436 1.00 56.81  ? 389  ARG A CZ    1 
ATOM   3084 N  NH1   . ARG A 1 392 ? 27.327 11.964  -26.714 1.00 49.77  ? 389  ARG A NH1   1 
ATOM   3085 N  NH2   . ARG A 1 392 ? 26.526 12.365  -24.599 1.00 57.50  ? 389  ARG A NH2   1 
ATOM   3086 N  N     . TYR A 1 393 ? 32.910 11.301  -20.269 1.00 28.84  ? 390  TYR A N     1 
ATOM   3087 C  CA    . TYR A 1 393 ? 33.482 11.892  -19.062 1.00 19.21  ? 390  TYR A CA    1 
ATOM   3088 C  C     . TYR A 1 393 ? 32.716 13.166  -18.718 1.00 26.59  ? 390  TYR A C     1 
ATOM   3089 O  O     . TYR A 1 393 ? 33.177 14.282  -18.980 1.00 27.00  ? 390  TYR A O     1 
ATOM   3090 C  CB    . TYR A 1 393 ? 34.970 12.188  -19.250 1.00 23.62  ? 390  TYR A CB    1 
ATOM   3091 C  CG    . TYR A 1 393 ? 35.862 10.963  -19.168 1.00 23.69  ? 390  TYR A CG    1 
ATOM   3092 C  CD1   . TYR A 1 393 ? 37.243 11.086  -19.153 1.00 18.51  ? 390  TYR A CD1   1 
ATOM   3093 C  CD2   . TYR A 1 393 ? 35.317 9.691   -19.094 1.00 24.23  ? 390  TYR A CD2   1 
ATOM   3094 C  CE1   . TYR A 1 393 ? 38.058 9.963   -19.071 1.00 17.65  ? 390  TYR A CE1   1 
ATOM   3095 C  CE2   . TYR A 1 393 ? 36.118 8.570   -19.014 1.00 21.41  ? 390  TYR A CE2   1 
ATOM   3096 C  CZ    . TYR A 1 393 ? 37.485 8.708   -19.004 1.00 21.60  ? 390  TYR A CZ    1 
ATOM   3097 O  OH    . TYR A 1 393 ? 38.271 7.578   -18.922 1.00 23.88  ? 390  TYR A OH    1 
ATOM   3098 N  N     . ASP A 1 394 ? 31.535 12.982  -18.139 1.00 20.85  ? 391  ASP A N     1 
ATOM   3099 C  CA    . ASP A 1 394 ? 30.650 14.083  -17.806 1.00 25.26  ? 391  ASP A CA    1 
ATOM   3100 C  C     . ASP A 1 394 ? 30.016 13.812  -16.446 1.00 18.48  ? 391  ASP A C     1 
ATOM   3101 O  O     . ASP A 1 394 ? 29.254 12.855  -16.291 1.00 23.85  ? 391  ASP A O     1 
ATOM   3102 C  CB    . ASP A 1 394 ? 29.591 14.247  -18.903 1.00 24.04  ? 391  ASP A CB    1 
ATOM   3103 C  CG    . ASP A 1 394 ? 28.720 15.458  -18.693 1.00 30.05  ? 391  ASP A CG    1 
ATOM   3104 O  OD1   . ASP A 1 394 ? 27.971 15.477  -17.701 1.00 25.80  ? 391  ASP A OD1   1 
ATOM   3105 O  OD2   . ASP A 1 394 ? 28.786 16.392  -19.520 1.00 49.68  ? 391  ASP A OD2   1 
ATOM   3106 N  N     . ALA A 1 395 ? 30.368 14.629  -15.455 1.00 20.68  ? 392  ALA A N     1 
ATOM   3107 C  CA    . ALA A 1 395 ? 29.896 14.437  -14.084 1.00 19.18  ? 392  ALA A CA    1 
ATOM   3108 C  C     . ALA A 1 395 ? 28.370 14.400  -13.967 1.00 21.31  ? 392  ALA A C     1 
ATOM   3109 O  O     . ALA A 1 395 ? 27.815 13.572  -13.248 1.00 18.94  ? 392  ALA A O     1 
ATOM   3110 C  CB    . ALA A 1 395 ? 30.457 15.523  -13.192 1.00 13.98  ? 392  ALA A CB    1 
ATOM   3111 N  N     . HIS A 1 396 ? 27.682 15.299  -14.659 1.00 26.18  ? 393  HIS A N     1 
ATOM   3112 C  CA    . HIS A 1 396 ? 26.228 15.315  -14.541 1.00 25.77  ? 393  HIS A CA    1 
ATOM   3113 C  C     . HIS A 1 396 ? 25.616 14.034  -15.107 1.00 17.89  ? 393  HIS A C     1 
ATOM   3114 O  O     . HIS A 1 396 ? 24.699 13.474  -14.510 1.00 21.97  ? 393  HIS A O     1 
ATOM   3115 C  CB    . HIS A 1 396 ? 25.643 16.560  -15.210 1.00 23.22  ? 393  HIS A CB    1 
ATOM   3116 C  CG    . HIS A 1 396 ? 25.723 17.786  -14.350 1.00 29.71  ? 393  HIS A CG    1 
ATOM   3117 N  ND1   . HIS A 1 396 ? 26.667 18.773  -14.540 1.00 39.92  ? 393  HIS A ND1   1 
ATOM   3118 C  CD2   . HIS A 1 396 ? 24.995 18.166  -13.274 1.00 28.94  ? 393  HIS A CD2   1 
ATOM   3119 C  CE1   . HIS A 1 396 ? 26.504 19.718  -13.631 1.00 33.13  ? 393  HIS A CE1   1 
ATOM   3120 N  NE2   . HIS A 1 396 ? 25.498 19.372  -12.848 1.00 38.45  ? 393  HIS A NE2   1 
ATOM   3121 N  N     . LYS A 1 397 ? 26.137 13.551  -16.231 1.00 22.22  ? 394  LYS A N     1 
ATOM   3122 C  CA    . LYS A 1 397 ? 25.666 12.275  -16.774 1.00 20.48  ? 394  LYS A CA    1 
ATOM   3123 C  C     . LYS A 1 397 ? 25.996 11.076  -15.882 1.00 21.38  ? 394  LYS A C     1 
ATOM   3124 O  O     . LYS A 1 397 ? 25.159 10.187  -15.688 1.00 23.04  ? 394  LYS A O     1 
ATOM   3125 C  CB    . LYS A 1 397 ? 26.236 12.035  -18.172 1.00 22.82  ? 394  LYS A CB    1 
ATOM   3126 C  CG    . LYS A 1 397 ? 25.936 10.632  -18.708 1.00 34.94  ? 394  LYS A CG    1 
ATOM   3127 C  CD    . LYS A 1 397 ? 26.226 10.487  -20.194 1.00 40.32  ? 394  LYS A CD    1 
ATOM   3128 C  CE    . LYS A 1 397 ? 25.979 9.055   -20.661 1.00 31.22  ? 394  LYS A CE    1 
ATOM   3129 N  NZ    . LYS A 1 397 ? 24.655 8.528   -20.210 1.00 41.67  ? 394  LYS A NZ    1 
ATOM   3130 N  N     . MET A 1 398 ? 27.203 11.040  -15.330 1.00 19.40  ? 395  MET A N     1 
ATOM   3131 C  CA    . MET A 1 398 ? 27.575 9.902   -14.497 1.00 19.38  ? 395  MET A CA    1 
ATOM   3132 C  C     . MET A 1 398 ? 26.726 9.853   -13.223 1.00 23.46  ? 395  MET A C     1 
ATOM   3133 O  O     . MET A 1 398 ? 26.312 8.777   -12.795 1.00 20.01  ? 395  MET A O     1 
ATOM   3134 C  CB    . MET A 1 398 ? 29.069 9.938   -14.164 1.00 17.55  ? 395  MET A CB    1 
ATOM   3135 C  CG    . MET A 1 398 ? 29.958 9.569   -15.342 1.00 16.27  ? 395  MET A CG    1 
ATOM   3136 S  SD    . MET A 1 398 ? 31.673 9.337   -14.850 1.00 24.22  ? 395  MET A SD    1 
ATOM   3137 C  CE    . MET A 1 398 ? 32.144 11.000  -14.387 1.00 23.91  ? 395  MET A CE    1 
ATOM   3138 N  N     . SER A 1 399 ? 26.434 11.013  -12.643 1.00 24.76  ? 396  SER A N     1 
ATOM   3139 C  CA    . SER A 1 399 ? 25.662 11.046  -11.405 1.00 21.03  ? 396  SER A CA    1 
ATOM   3140 C  C     . SER A 1 399 ? 24.192 10.744  -11.685 1.00 18.62  ? 396  SER A C     1 
ATOM   3141 O  O     . SER A 1 399 ? 23.521 10.096  -10.879 1.00 20.23  ? 396  SER A O     1 
ATOM   3142 C  CB    . SER A 1 399 ? 25.809 12.396  -10.692 1.00 22.68  ? 396  SER A CB    1 
ATOM   3143 O  OG    . SER A 1 399 ? 25.328 13.462  -11.488 1.00 22.60  ? 396  SER A OG    1 
ATOM   3144 N  N     . HIS A 1 400 ? 23.696 11.191  -12.834 1.00 23.91  ? 397  HIS A N     1 
ATOM   3145 C  CA    . HIS A 1 400 ? 22.325 10.863  -13.201 1.00 29.78  ? 397  HIS A CA    1 
ATOM   3146 C  C     . HIS A 1 400 ? 22.210 9.357   -13.443 1.00 28.73  ? 397  HIS A C     1 
ATOM   3147 O  O     . HIS A 1 400 ? 21.271 8.720   -12.978 1.00 26.79  ? 397  HIS A O     1 
ATOM   3148 C  CB    . HIS A 1 400 ? 21.878 11.649  -14.434 1.00 32.65  ? 397  HIS A CB    1 
ATOM   3149 C  CG    . HIS A 1 400 ? 20.466 11.370  -14.843 1.00 46.58  ? 397  HIS A CG    1 
ATOM   3150 N  ND1   . HIS A 1 400 ? 20.143 10.479  -15.845 1.00 46.45  ? 397  HIS A ND1   1 
ATOM   3151 C  CD2   . HIS A 1 400 ? 19.289 11.856  -14.379 1.00 47.95  ? 397  HIS A CD2   1 
ATOM   3152 C  CE1   . HIS A 1 400 ? 18.831 10.432  -15.985 1.00 48.86  ? 397  HIS A CE1   1 
ATOM   3153 N  NE2   . HIS A 1 400 ? 18.289 11.259  -15.107 1.00 48.45  ? 397  HIS A NE2   1 
ATOM   3154 N  N     . ASP A 1 401 ? 23.188 8.789   -14.145 1.00 28.22  ? 398  ASP A N     1 
ATOM   3155 C  CA    . ASP A 1 401 ? 23.221 7.348   -14.375 1.00 25.75  ? 398  ASP A CA    1 
ATOM   3156 C  C     . ASP A 1 401 ? 23.328 6.556   -13.076 1.00 28.03  ? 398  ASP A C     1 
ATOM   3157 O  O     . ASP A 1 401 ? 22.646 5.547   -12.912 1.00 28.16  ? 398  ASP A O     1 
ATOM   3158 C  CB    . ASP A 1 401 ? 24.377 6.976   -15.296 1.00 26.90  ? 398  ASP A CB    1 
ATOM   3159 C  CG    . ASP A 1 401 ? 24.151 7.430   -16.728 1.00 31.80  ? 398  ASP A CG    1 
ATOM   3160 O  OD1   . ASP A 1 401 ? 23.000 7.784   -17.072 1.00 31.60  ? 398  ASP A OD1   1 
ATOM   3161 O  OD2   . ASP A 1 401 ? 25.120 7.414   -17.514 1.00 27.44  ? 398  ASP A OD2   1 
ATOM   3162 N  N     . ALA A 1 402 ? 24.173 7.015   -12.153 1.00 25.95  ? 399  ALA A N     1 
ATOM   3163 C  CA    . ALA A 1 402 ? 24.331 6.336   -10.871 1.00 25.33  ? 399  ALA A CA    1 
ATOM   3164 C  C     . ALA A 1 402 ? 23.006 6.294   -10.113 1.00 20.06  ? 399  ALA A C     1 
ATOM   3165 O  O     . ALA A 1 402 ? 22.657 5.276   -9.501  1.00 23.69  ? 399  ALA A O     1 
ATOM   3166 C  CB    . ALA A 1 402 ? 25.407 7.027   -10.019 1.00 20.19  ? 399  ALA A CB    1 
ATOM   3167 N  N     . PHE A 1 403 ? 22.269 7.399   -10.159 1.00 23.93  ? 400  PHE A N     1 
ATOM   3168 C  CA    . PHE A 1 403 ? 20.988 7.470   -9.476  1.00 26.63  ? 400  PHE A CA    1 
ATOM   3169 C  C     . PHE A 1 403 ? 20.003 6.467   -10.072 1.00 32.30  ? 400  PHE A C     1 
ATOM   3170 O  O     . PHE A 1 403 ? 19.269 5.806   -9.347  1.00 34.53  ? 400  PHE A O     1 
ATOM   3171 C  CB    . PHE A 1 403 ? 20.409 8.878   -9.550  1.00 28.21  ? 400  PHE A CB    1 
ATOM   3172 C  CG    . PHE A 1 403 ? 19.126 9.039   -8.791  1.00 39.84  ? 400  PHE A CG    1 
ATOM   3173 C  CD1   . PHE A 1 403 ? 17.927 9.231   -9.460  1.00 34.91  ? 400  PHE A CD1   1 
ATOM   3174 C  CD2   . PHE A 1 403 ? 19.116 8.987   -7.405  1.00 33.07  ? 400  PHE A CD2   1 
ATOM   3175 C  CE1   . PHE A 1 403 ? 16.741 9.375   -8.761  1.00 43.44  ? 400  PHE A CE1   1 
ATOM   3176 C  CE2   . PHE A 1 403 ? 17.934 9.133   -6.701  1.00 40.46  ? 400  PHE A CE2   1 
ATOM   3177 C  CZ    . PHE A 1 403 ? 16.745 9.328   -7.381  1.00 38.33  ? 400  PHE A CZ    1 
ATOM   3178 N  N     . THR A 1 404 ? 20.008 6.353   -11.395 1.00 32.76  ? 401  THR A N     1 
ATOM   3179 C  CA    . THR A 1 404 ? 19.103 5.445   -12.095 1.00 35.54  ? 401  THR A CA    1 
ATOM   3180 C  C     . THR A 1 404 ? 19.311 3.988   -11.688 1.00 37.12  ? 401  THR A C     1 
ATOM   3181 O  O     . THR A 1 404 ? 18.347 3.237   -11.539 1.00 37.71  ? 401  THR A O     1 
ATOM   3182 C  CB    . THR A 1 404 ? 19.268 5.558   -13.625 1.00 27.38  ? 401  THR A CB    1 
ATOM   3183 O  OG1   . THR A 1 404 ? 19.055 6.914   -14.033 1.00 31.01  ? 401  THR A OG1   1 
ATOM   3184 C  CG2   . THR A 1 404 ? 18.277 4.653   -14.346 1.00 36.57  ? 401  THR A CG2   1 
ATOM   3185 N  N     . VAL A 1 405 ? 20.555 3.612   -11.543 1.00 31.12  ? 402  VAL A N     1 
ATOM   3186 C  CA    . VAL A 1 405 ? 20.852 2.280   -11.141 1.00 32.51  ? 402  VAL A CA    1 
ATOM   3187 C  C     . VAL A 1 405 ? 20.525 1.966   -9.706  1.00 39.47  ? 402  VAL A C     1 
ATOM   3188 O  O     . VAL A 1 405 ? 20.327 0.818   -9.404  1.00 39.69  ? 402  VAL A O     1 
ATOM   3189 C  CB    . VAL A 1 405 ? 22.206 1.761   -11.637 1.00 37.60  ? 402  VAL A CB    1 
ATOM   3190 C  CG1   . VAL A 1 405 ? 22.602 2.449   -12.911 1.00 36.22  ? 402  VAL A CG1   1 
ATOM   3191 C  CG2   . VAL A 1 405 ? 23.264 1.942   -10.610 1.00 36.40  ? 402  VAL A CG2   1 
ATOM   3192 N  N     . ILE A 1 406 ? 20.500 2.978   -8.845  1.00 36.19  ? 403  ILE A N     1 
ATOM   3193 C  CA    . ILE A 1 406 ? 20.105 2.812   -7.455  1.00 41.55  ? 403  ILE A CA    1 
ATOM   3194 C  C     . ILE A 1 406 ? 18.722 3.214   -7.007  1.00 41.92  ? 403  ILE A C     1 
ATOM   3195 O  O     . ILE A 1 406 ? 18.348 2.939   -5.890  1.00 42.85  ? 403  ILE A O     1 
ATOM   3196 C  CB    . ILE A 1 406 ? 21.119 3.431   -6.453  1.00 39.66  ? 403  ILE A CB    1 
ATOM   3197 C  CG1   . ILE A 1 406 ? 21.011 4.949   -6.389  1.00 34.17  ? 403  ILE A CG1   1 
ATOM   3198 C  CG2   . ILE A 1 406 ? 22.499 2.944   -6.753  1.00 27.99  ? 403  ILE A CG2   1 
ATOM   3199 C  CD1   . ILE A 1 406 ? 21.787 5.529   -5.219  1.00 35.10  ? 403  ILE A CD1   1 
ATOM   3200 N  N     . LYS A 1 407 ? 17.946 3.802   -7.869  1.00 43.03  ? 404  LYS A N     1 
ATOM   3201 C  CA    . LYS A 1 407 ? 16.728 4.451   -7.434  1.00 54.19  ? 404  LYS A CA    1 
ATOM   3202 C  C     . LYS A 1 407 ? 15.740 3.479   -6.809  1.00 56.63  ? 404  LYS A C     1 
ATOM   3203 O  O     . LYS A 1 407 ? 14.907 3.875   -6.037  1.00 58.46  ? 404  LYS A O     1 
ATOM   3204 C  CB    . LYS A 1 407 ? 16.078 5.159   -8.574  1.00 50.57  ? 404  LYS A CB    1 
ATOM   3205 C  CG    . LYS A 1 407 ? 16.061 4.309   -9.793  1.00 53.40  ? 404  LYS A CG    1 
ATOM   3206 C  CD    . LYS A 1 407 ? 16.231 5.187   -11.002 1.00 57.43  ? 404  LYS A CD    1 
ATOM   3207 C  CE    . LYS A 1 407 ? 14.923 5.416   -11.724 1.00 63.73  ? 404  LYS A CE    1 
ATOM   3208 N  NZ    . LYS A 1 407 ? 14.613 6.866   -11.751 1.00 69.91  ? 404  LYS A NZ    1 
ATOM   3209 N  N     . ASN A 1 408 ? 15.830 2.228   -7.188  1.00 58.93  ? 405  ASN A N     1 
ATOM   3210 C  CA    . ASN A 1 408 ? 14.928 1.173   -6.747  1.00 63.85  ? 405  ASN A CA    1 
ATOM   3211 C  C     . ASN A 1 408 ? 15.258 0.624   -5.375  1.00 61.52  ? 405  ASN A C     1 
ATOM   3212 O  O     . ASN A 1 408 ? 14.633 -0.281  -4.887  1.00 58.38  ? 405  ASN A O     1 
ATOM   3213 C  CB    . ASN A 1 408 ? 14.975 0.038   -7.759  1.00 70.69  ? 405  ASN A CB    1 
ATOM   3214 C  CG    . ASN A 1 408 ? 16.383 -0.385  -8.084  1.00 73.78  ? 405  ASN A CG    1 
ATOM   3215 O  OD1   . ASN A 1 408 ? 17.248 0.442   -8.305  1.00 73.32  ? 405  ASN A OD1   1 
ATOM   3216 N  ND2   . ASN A 1 408 ? 16.632 -1.678  -8.042  1.00 76.28  ? 405  ASN A ND2   1 
ATOM   3217 N  N     . CYS A 1 409 ? 16.324 1.120   -4.788  1.00 58.46  ? 406  CYS A N     1 
ATOM   3218 C  CA    . CYS A 1 409 ? 16.749 0.669   -3.469  1.00 54.45  ? 406  CYS A CA    1 
ATOM   3219 C  C     . CYS A 1 409 ? 15.947 1.394   -2.397  1.00 48.72  ? 406  CYS A C     1 
ATOM   3220 O  O     . CYS A 1 409 ? 15.885 0.957   -1.248  1.00 51.27  ? 406  CYS A O     1 
ATOM   3221 C  CB    . CYS A 1 409 ? 18.248 0.895   -3.270  1.00 55.13  ? 406  CYS A CB    1 
ATOM   3222 S  SG    . CYS A 1 409 ? 19.284 -0.038  -4.412  1.00 62.99  ? 406  CYS A SG    1 
ATOM   3223 N  N     . ASN A 1 410 ? 15.322 2.499   -2.790  1.00 45.66  ? 407  ASN A N     1 
ATOM   3224 C  CA    . ASN A 1 410 ? 14.521 3.304   -1.878  1.00 52.64  ? 407  ASN A CA    1 
ATOM   3225 C  C     . ASN A 1 410 ? 13.200 2.615   -1.497  1.00 54.77  ? 407  ASN A C     1 
ATOM   3226 O  O     . ASN A 1 410 ? 12.316 2.453   -2.338  1.00 54.92  ? 407  ASN A O     1 
ATOM   3227 C  CB    . ASN A 1 410 ? 14.251 4.671   -2.510  1.00 43.58  ? 407  ASN A CB    1 
ATOM   3228 C  CG    . ASN A 1 410 ? 13.663 5.653   -1.534  1.00 43.22  ? 407  ASN A CG    1 
ATOM   3229 O  OD1   . ASN A 1 410 ? 13.502 5.349   -0.352  1.00 48.82  ? 407  ASN A OD1   1 
ATOM   3230 N  ND2   . ASN A 1 410 ? 13.349 6.852   -2.017  1.00 46.64  ? 407  ASN A ND2   1 
ATOM   3231 N  N     . THR A 1 411 ? 13.062 2.216   -0.232  1.00 56.27  ? 408  THR A N     1 
ATOM   3232 C  CA    . THR A 1 411 ? 11.887 1.449   0.184   1.00 58.05  ? 408  THR A CA    1 
ATOM   3233 C  C     . THR A 1 411 ? 10.702 2.349   0.499   1.00 59.45  ? 408  THR A C     1 
ATOM   3234 O  O     . THR A 1 411 ? 9.589  1.862   0.667   1.00 65.94  ? 408  THR A O     1 
ATOM   3235 C  CB    . THR A 1 411 ? 12.150 0.581   1.437   1.00 59.46  ? 408  THR A CB    1 
ATOM   3236 O  OG1   . THR A 1 411 ? 12.936 1.313   2.382   1.00 62.53  ? 408  THR A OG1   1 
ATOM   3237 C  CG2   . THR A 1 411 ? 12.916 -0.676  1.056   1.00 58.41  ? 408  THR A CG2   1 
ATOM   3238 N  N     . SER A 1 412 ? 10.940 3.654   0.591   1.00 58.40  ? 409  SER A N     1 
ATOM   3239 C  CA    . SER A 1 412 ? 9.910  4.578   1.059   1.00 60.92  ? 409  SER A CA    1 
ATOM   3240 C  C     . SER A 1 412 ? 8.754  4.715   0.077   1.00 66.20  ? 409  SER A C     1 
ATOM   3241 O  O     . SER A 1 412 ? 8.941  4.643   -1.138  1.00 64.46  ? 409  SER A O     1 
ATOM   3242 C  CB    . SER A 1 412 ? 10.514 5.954   1.337   1.00 57.13  ? 409  SER A CB    1 
ATOM   3243 O  OG    . SER A 1 412 ? 10.325 6.826   0.239   1.00 61.04  ? 409  SER A OG    1 
ATOM   3244 N  N     . GLY A 1 413 ? 7.559  4.914   0.623   1.00 69.60  ? 410  GLY A N     1 
ATOM   3245 C  CA    . GLY A 1 413 ? 6.359  5.085   -0.175  1.00 74.16  ? 410  GLY A CA    1 
ATOM   3246 C  C     . GLY A 1 413 ? 6.458  6.260   -1.126  1.00 72.49  ? 410  GLY A C     1 
ATOM   3247 O  O     . GLY A 1 413 ? 6.448  6.079   -2.343  1.00 70.53  ? 410  GLY A O     1 
ATOM   3248 N  N     . ILE A 1 414 ? 6.555  7.468   -0.578  1.00 78.37  ? 411  ILE A N     1 
ATOM   3249 C  CA    . ILE A 1 414 ? 6.745  8.649   -1.411  1.00 83.73  ? 411  ILE A CA    1 
ATOM   3250 C  C     . ILE A 1 414 ? 8.236  8.837   -1.683  1.00 82.84  ? 411  ILE A C     1 
ATOM   3251 O  O     . ILE A 1 414 ? 9.083  8.451   -0.874  1.00 77.58  ? 411  ILE A O     1 
ATOM   3252 C  CB    . ILE A 1 414 ? 6.138  9.921   -0.771  1.00 84.22  ? 411  ILE A CB    1 
ATOM   3253 C  CG1   . ILE A 1 414 ? 7.070  10.513  0.289   1.00 74.80  ? 411  ILE A CG1   1 
ATOM   3254 C  CG2   . ILE A 1 414 ? 4.750  9.623   -0.203  1.00 82.29  ? 411  ILE A CG2   1 
ATOM   3255 C  CD1   . ILE A 1 414 ? 6.828  11.986  0.547   1.00 75.31  ? 411  ILE A CD1   1 
ATOM   3256 N  N     . GLN A 1 415 ? 8.547  9.428   -2.830  1.00 85.06  ? 412  GLN A N     1 
ATOM   3257 C  CA    . GLN A 1 415 ? 9.893  9.350   -3.385  1.00 84.63  ? 412  GLN A CA    1 
ATOM   3258 C  C     . GLN A 1 415 ? 10.794 10.528  -3.022  1.00 76.93  ? 412  GLN A C     1 
ATOM   3259 O  O     . GLN A 1 415 ? 11.976 10.538  -3.368  1.00 76.24  ? 412  GLN A O     1 
ATOM   3260 C  CB    . GLN A 1 415 ? 9.799  9.209   -4.903  1.00 93.22  ? 412  GLN A CB    1 
ATOM   3261 C  CG    . GLN A 1 415 ? 9.180  7.887   -5.334  1.00 97.67  ? 412  GLN A CG    1 
ATOM   3262 C  CD    . GLN A 1 415 ? 8.523  7.962   -6.695  1.00 101.04 ? 412  GLN A CD    1 
ATOM   3263 O  OE1   . GLN A 1 415 ? 9.078  8.529   -7.635  1.00 100.35 ? 412  GLN A OE1   1 
ATOM   3264 N  NE2   . GLN A 1 415 ? 7.330  7.387   -6.807  1.00 100.89 ? 412  GLN A NE2   1 
ATOM   3265 N  N     . THR A 1 416 ? 10.243 11.514  -2.324  1.00 71.78  ? 413  THR A N     1 
ATOM   3266 C  CA    . THR A 1 416 ? 11.049 12.624  -1.828  1.00 68.66  ? 413  THR A CA    1 
ATOM   3267 C  C     . THR A 1 416 ? 12.009 12.118  -0.756  1.00 63.47  ? 413  THR A C     1 
ATOM   3268 O  O     . THR A 1 416 ? 13.149 12.572  -0.656  1.00 58.85  ? 413  THR A O     1 
ATOM   3269 C  CB    . THR A 1 416 ? 10.170 13.755  -1.258  1.00 67.63  ? 413  THR A CB    1 
ATOM   3270 O  OG1   . THR A 1 416 ? 9.322  14.266  -2.292  1.00 70.11  ? 413  THR A OG1   1 
ATOM   3271 C  CG2   . THR A 1 416 ? 11.029 14.890  -0.719  1.00 69.48  ? 413  THR A CG2   1 
ATOM   3272 N  N     . GLU A 1 417 ? 11.541 11.157  0.033   1.00 61.70  ? 414  GLU A N     1 
ATOM   3273 C  CA    . GLU A 1 417 ? 12.348 10.572  1.092   1.00 55.81  ? 414  GLU A CA    1 
ATOM   3274 C  C     . GLU A 1 417 ? 13.133 9.368   0.597   1.00 54.17  ? 414  GLU A C     1 
ATOM   3275 O  O     . GLU A 1 417 ? 12.733 8.697   -0.356  1.00 54.99  ? 414  GLU A O     1 
ATOM   3276 C  CB    . GLU A 1 417 ? 11.465 10.161  2.270   1.00 59.37  ? 414  GLU A CB    1 
ATOM   3277 C  CG    . GLU A 1 417 ? 10.547 11.260  2.752   1.00 63.55  ? 414  GLU A CG    1 
ATOM   3278 C  CD    . GLU A 1 417 ? 11.287 12.555  3.007   1.00 66.08  ? 414  GLU A CD    1 
ATOM   3279 O  OE1   . GLU A 1 417 ? 12.089 12.603  3.965   1.00 63.44  ? 414  GLU A OE1   1 
ATOM   3280 O  OE2   . GLU A 1 417 ? 11.066 13.523  2.250   1.00 63.78  ? 414  GLU A OE2   1 
ATOM   3281 N  N     . TRP A 1 418 ? 14.252 9.093   1.255   1.00 39.49  ? 415  TRP A N     1 
ATOM   3282 C  CA    . TRP A 1 418 ? 15.027 7.907   0.942   1.00 35.28  ? 415  TRP A CA    1 
ATOM   3283 C  C     . TRP A 1 418 ? 15.114 6.982   2.143   1.00 41.17  ? 415  TRP A C     1 
ATOM   3284 O  O     . TRP A 1 418 ? 15.653 7.350   3.185   1.00 41.15  ? 415  TRP A O     1 
ATOM   3285 C  CB    . TRP A 1 418 ? 16.436 8.272   0.479   1.00 39.16  ? 415  TRP A CB    1 
ATOM   3286 C  CG    . TRP A 1 418 ? 17.111 7.117   -0.166  1.00 38.11  ? 415  TRP A CG    1 
ATOM   3287 C  CD1   . TRP A 1 418 ? 17.626 6.016   0.453   1.00 31.06  ? 415  TRP A CD1   1 
ATOM   3288 C  CD2   . TRP A 1 418 ? 17.329 6.931   -1.564  1.00 34.12  ? 415  TRP A CD2   1 
ATOM   3289 N  NE1   . TRP A 1 418 ? 18.153 5.154   -0.477  1.00 36.49  ? 415  TRP A NE1   1 
ATOM   3290 C  CE2   . TRP A 1 418 ? 17.984 5.695   -1.725  1.00 30.88  ? 415  TRP A CE2   1 
ATOM   3291 C  CE3   . TRP A 1 418 ? 17.035 7.693   -2.699  1.00 33.31  ? 415  TRP A CE3   1 
ATOM   3292 C  CZ2   . TRP A 1 418 ? 18.358 5.204   -2.974  1.00 37.69  ? 415  TRP A CZ2   1 
ATOM   3293 C  CZ3   . TRP A 1 418 ? 17.406 7.202   -3.939  1.00 39.85  ? 415  TRP A CZ3   1 
ATOM   3294 C  CH2   . TRP A 1 418 ? 18.061 5.972   -4.066  1.00 34.59  ? 415  TRP A CH2   1 
ATOM   3295 N  N     . SER A 1 419 ? 14.595 5.770   1.988   1.00 45.53  ? 416  SER A N     1 
ATOM   3296 C  CA    . SER A 1 419 ? 14.631 4.801   3.070   1.00 45.17  ? 416  SER A CA    1 
ATOM   3297 C  C     . SER A 1 419 ? 15.037 3.426   2.558   1.00 50.42  ? 416  SER A C     1 
ATOM   3298 O  O     . SER A 1 419 ? 14.728 3.069   1.425   1.00 53.63  ? 416  SER A O     1 
ATOM   3299 C  CB    . SER A 1 419 ? 13.272 4.728   3.763   1.00 57.16  ? 416  SER A CB    1 
ATOM   3300 O  OG    . SER A 1 419 ? 12.356 3.966   2.998   1.00 61.95  ? 416  SER A OG    1 
ATOM   3301 N  N     . PRO A 1 420 ? 15.776 2.666   3.379   1.00 54.28  ? 417  PRO A N     1 
ATOM   3302 C  CA    . PRO A 1 420 ? 16.370 3.196   4.611   1.00 53.55  ? 417  PRO A CA    1 
ATOM   3303 C  C     . PRO A 1 420 ? 17.629 3.988   4.273   1.00 44.95  ? 417  PRO A C     1 
ATOM   3304 O  O     . PRO A 1 420 ? 18.250 3.703   3.245   1.00 40.96  ? 417  PRO A O     1 
ATOM   3305 C  CB    . PRO A 1 420 ? 16.672 1.941   5.438   1.00 55.46  ? 417  PRO A CB    1 
ATOM   3306 C  CG    . PRO A 1 420 ? 16.671 0.817   4.482   1.00 55.53  ? 417  PRO A CG    1 
ATOM   3307 C  CD    . PRO A 1 420 ? 16.008 1.222   3.210   1.00 52.89  ? 417  PRO A CD    1 
ATOM   3308 N  N     . PRO A 1 421 ? 17.975 4.985   5.106   1.00 45.01  ? 418  PRO A N     1 
ATOM   3309 C  CA    . PRO A 1 421 ? 19.051 5.956   4.860   1.00 37.80  ? 418  PRO A CA    1 
ATOM   3310 C  C     . PRO A 1 421 ? 20.346 5.328   4.353   1.00 33.32  ? 418  PRO A C     1 
ATOM   3311 O  O     . PRO A 1 421 ? 20.689 4.212   4.740   1.00 34.02  ? 418  PRO A O     1 
ATOM   3312 C  CB    . PRO A 1 421 ? 19.265 6.587   6.236   1.00 40.37  ? 418  PRO A CB    1 
ATOM   3313 C  CG    . PRO A 1 421 ? 17.937 6.496   6.887   1.00 44.96  ? 418  PRO A CG    1 
ATOM   3314 C  CD    . PRO A 1 421 ? 17.336 5.203   6.418   1.00 43.56  ? 418  PRO A CD    1 
ATOM   3315 N  N     . LEU A 1 422 ? 21.048 6.052   3.487   1.00 34.34  ? 419  LEU A N     1 
ATOM   3316 C  CA    . LEU A 1 422 ? 22.292 5.567   2.900   1.00 27.71  ? 419  LEU A CA    1 
ATOM   3317 C  C     . LEU A 1 422 ? 23.488 5.952   3.756   1.00 23.81  ? 419  LEU A C     1 
ATOM   3318 O  O     . LEU A 1 422 ? 23.646 7.113   4.124   1.00 33.50  ? 419  LEU A O     1 
ATOM   3319 C  CB    . LEU A 1 422 ? 22.458 6.117   1.481   1.00 28.97  ? 419  LEU A CB    1 
ATOM   3320 C  CG    . LEU A 1 422 ? 21.376 5.651   0.503   1.00 28.59  ? 419  LEU A CG    1 
ATOM   3321 C  CD1   . LEU A 1 422 ? 21.645 6.168   -0.908  1.00 31.55  ? 419  LEU A CD1   1 
ATOM   3322 C  CD2   . LEU A 1 422 ? 21.274 4.132   0.516   1.00 34.23  ? 419  LEU A CD2   1 
ATOM   3323 N  N     . THR A 1 423 ? 24.335 4.976   4.063   1.00 27.90  ? 420  THR A N     1 
ATOM   3324 C  CA    . THR A 1 423 ? 25.495 5.233   4.912   1.00 27.74  ? 420  THR A CA    1 
ATOM   3325 C  C     . THR A 1 423 ? 26.794 5.255   4.103   1.00 25.24  ? 420  THR A C     1 
ATOM   3326 O  O     . THR A 1 423 ? 27.877 5.431   4.665   1.00 22.10  ? 420  THR A O     1 
ATOM   3327 C  CB    . THR A 1 423 ? 25.609 4.180   6.035   1.00 34.46  ? 420  THR A CB    1 
ATOM   3328 O  OG1   . THR A 1 423 ? 25.551 2.865   5.467   1.00 35.41  ? 420  THR A OG1   1 
ATOM   3329 C  CG2   . THR A 1 423 ? 24.467 4.345   7.038   1.00 37.19  ? 420  THR A CG2   1 
ATOM   3330 N  N     . MET A 1 424 ? 26.685 5.064   2.791   1.00 22.65  ? 421  MET A N     1 
ATOM   3331 C  CA    . MET A 1 424 ? 27.860 5.085   1.922   1.00 20.12  ? 421  MET A CA    1 
ATOM   3332 C  C     . MET A 1 424 ? 27.468 5.218   0.453   1.00 26.12  ? 421  MET A C     1 
ATOM   3333 O  O     . MET A 1 424 ? 26.518 4.576   -0.004  1.00 23.54  ? 421  MET A O     1 
ATOM   3334 C  CB    . MET A 1 424 ? 28.703 3.821   2.123   1.00 21.60  ? 421  MET A CB    1 
ATOM   3335 C  CG    . MET A 1 424 ? 30.005 3.791   1.331   1.00 23.79  ? 421  MET A CG    1 
ATOM   3336 S  SD    . MET A 1 424 ? 29.769 3.094   -0.323  1.00 26.77  ? 421  MET A SD    1 
ATOM   3337 C  CE    . MET A 1 424 ? 29.331 1.402   0.084   1.00 30.45  ? 421  MET A CE    1 
ATOM   3338 N  N     . LEU A 1 425 ? 28.207 6.056   -0.274  1.00 18.28  ? 422  LEU A N     1 
ATOM   3339 C  CA    . LEU A 1 425 ? 28.129 6.117   -1.734  1.00 19.34  ? 422  LEU A CA    1 
ATOM   3340 C  C     . LEU A 1 425 ? 29.516 5.879   -2.347  1.00 18.34  ? 422  LEU A C     1 
ATOM   3341 O  O     . LEU A 1 425 ? 30.529 6.299   -1.791  1.00 19.01  ? 422  LEU A O     1 
ATOM   3342 C  CB    . LEU A 1 425 ? 27.586 7.462   -2.201  1.00 18.98  ? 422  LEU A CB    1 
ATOM   3343 C  CG    . LEU A 1 425 ? 26.171 7.864   -1.795  1.00 21.11  ? 422  LEU A CG    1 
ATOM   3344 C  CD1   . LEU A 1 425 ? 25.889 9.264   -2.316  1.00 21.53  ? 422  LEU A CD1   1 
ATOM   3345 C  CD2   . LEU A 1 425 ? 25.140 6.861   -2.326  1.00 22.51  ? 422  LEU A CD2   1 
ATOM   3346 N  N     . PHE A 1 426 ? 29.561 5.216   -3.496  1.00 16.30  ? 423  PHE A N     1 
ATOM   3347 C  CA    . PHE A 1 426 ? 30.826 4.839   -4.108  1.00 19.36  ? 423  PHE A CA    1 
ATOM   3348 C  C     . PHE A 1 426 ? 30.670 4.870   -5.610  1.00 21.55  ? 423  PHE A C     1 
ATOM   3349 O  O     . PHE A 1 426 ? 29.774 4.216   -6.152  1.00 23.57  ? 423  PHE A O     1 
ATOM   3350 C  CB    . PHE A 1 426 ? 31.246 3.438   -3.644  1.00 18.85  ? 423  PHE A CB    1 
ATOM   3351 C  CG    . PHE A 1 426 ? 32.582 2.971   -4.175  1.00 27.56  ? 423  PHE A CG    1 
ATOM   3352 C  CD1   . PHE A 1 426 ? 32.834 1.617   -4.327  1.00 44.65  ? 423  PHE A CD1   1 
ATOM   3353 C  CD2   . PHE A 1 426 ? 33.594 3.866   -4.482  1.00 22.53  ? 423  PHE A CD2   1 
ATOM   3354 C  CE1   . PHE A 1 426 ? 34.055 1.172   -4.801  1.00 43.01  ? 423  PHE A CE1   1 
ATOM   3355 C  CE2   . PHE A 1 426 ? 34.820 3.427   -4.953  1.00 26.26  ? 423  PHE A CE2   1 
ATOM   3356 C  CZ    . PHE A 1 426 ? 35.049 2.082   -5.113  1.00 38.41  ? 423  PHE A CZ    1 
ATOM   3357 N  N     . LEU A 1 427 ? 31.520 5.633   -6.289  1.00 14.78  ? 424  LEU A N     1 
ATOM   3358 C  CA    . LEU A 1 427 ? 31.545 5.587   -7.745  1.00 17.67  ? 424  LEU A CA    1 
ATOM   3359 C  C     . LEU A 1 427 ? 32.905 5.115   -8.217  1.00 15.01  ? 424  LEU A C     1 
ATOM   3360 O  O     . LEU A 1 427 ? 33.925 5.619   -7.772  1.00 18.87  ? 424  LEU A O     1 
ATOM   3361 C  CB    . LEU A 1 427 ? 31.234 6.950   -8.344  1.00 14.15  ? 424  LEU A CB    1 
ATOM   3362 C  CG    . LEU A 1 427 ? 29.845 7.534   -8.117  1.00 20.76  ? 424  LEU A CG    1 
ATOM   3363 C  CD1   . LEU A 1 427 ? 29.716 8.848   -8.880  1.00 17.51  ? 424  LEU A CD1   1 
ATOM   3364 C  CD2   . LEU A 1 427 ? 28.733 6.534   -8.506  1.00 16.72  ? 424  LEU A CD2   1 
ATOM   3365 N  N     . CYS A 1 428 ? 32.929 4.174   -9.155  1.00 15.50  ? 425  CYS A N     1 
ATOM   3366 C  CA    . CYS A 1 428 ? 34.202 3.640   -9.618  1.00 15.89  ? 425  CYS A CA    1 
ATOM   3367 C  C     . CYS A 1 428 ? 34.196 3.463   -11.125 1.00 17.22  ? 425  CYS A C     1 
ATOM   3368 O  O     . CYS A 1 428 ? 33.303 2.821   -11.666 1.00 21.60  ? 425  CYS A O     1 
ATOM   3369 C  CB    . CYS A 1 428 ? 34.504 2.298   -8.948  1.00 18.23  ? 425  CYS A CB    1 
ATOM   3370 S  SG    . CYS A 1 428 ? 36.197 1.697   -9.216  1.00 22.94  ? 425  CYS A SG    1 
ATOM   3371 N  N     . ALA A 1 429 ? 35.210 3.977   -11.765 1.00 15.92  ? 426  ALA A N     1 
ATOM   3372 C  CA    . ALA A 1 429 ? 35.353 3.801   -13.158 1.00 15.58  ? 426  ALA A CA    1 
ATOM   3373 C  C     . ALA A 1 429 ? 36.311 2.625   -13.399 1.00 19.42  ? 426  ALA A C     1 
ATOM   3374 O  O     . ALA A 1 429 ? 37.341 2.554   -12.800 1.00 18.79  ? 426  ALA A O     1 
ATOM   3375 C  CB    . ALA A 1 429 ? 35.888 5.058   -13.770 1.00 16.21  ? 426  ALA A CB    1 
ATOM   3376 N  N     . THR A 1 430 ? 35.904 1.751   -14.311 1.00 17.84  ? 427  THR A N     1 
ATOM   3377 C  CA    . THR A 1 430 ? 36.595 0.502   -14.555 1.00 20.02  ? 427  THR A CA    1 
ATOM   3378 C  C     . THR A 1 430 ? 36.653 0.176   -16.051 1.00 19.43  ? 427  THR A C     1 
ATOM   3379 O  O     . THR A 1 430 ? 36.123 0.852   -16.826 1.00 19.82  ? 427  THR A O     1 
ATOM   3380 C  CB    . THR A 1 430 ? 35.914 -0.622  -13.788 1.00 21.77  ? 427  THR A CB    1 
ATOM   3381 O  OG1   . THR A 1 430 ? 34.645 -0.867  -14.357 1.00 21.98  ? 427  THR A OG1   1 
ATOM   3382 C  CG2   . THR A 1 430 ? 35.666 -0.243  -12.357 1.00 22.12  ? 427  THR A CG2   1 
ATOM   3383 N  N     . LYS A 1 431 ? 37.341 -0.893  -16.384 1.00 21.90  ? 428  LYS A N     1 
ATOM   3384 C  CA    . LYS A 1 431 ? 37.374 -1.393  -17.745 1.00 22.44  ? 428  LYS A CA    1 
ATOM   3385 C  C     . LYS A 1 431 ? 37.966 -0.449  -18.773 1.00 23.91  ? 428  LYS A C     1 
ATOM   3386 O  O     . LYS A 1 431 ? 37.296 -0.009  -19.657 1.00 21.77  ? 428  LYS A O     1 
ATOM   3387 C  CB    . LYS A 1 431 ? 35.987 -1.838  -18.164 1.00 19.29  ? 428  LYS A CB    1 
ATOM   3388 C  CG    . LYS A 1 431 ? 35.629 -3.084  -17.446 1.00 26.44  ? 428  LYS A CG    1 
ATOM   3389 C  CD    . LYS A 1 431 ? 34.406 -3.865  -17.885 1.00 33.14  ? 428  LYS A CD    1 
ATOM   3390 C  CE    . LYS A 1 431 ? 34.301 -5.060  -16.943 1.00 35.70  ? 428  LYS A CE    1 
ATOM   3391 N  NZ    . LYS A 1 431 ? 33.131 -5.920  -17.173 1.00 42.04  ? 428  LYS A NZ    1 
ATOM   3392 N  N     . PHE A 1 432 ? 39.212 -0.083  -18.555 1.00 19.74  ? 429  PHE A N     1 
ATOM   3393 C  CA    . PHE A 1 432 ? 39.932 0.818   -19.412 1.00 16.73  ? 429  PHE A CA    1 
ATOM   3394 C  C     . PHE A 1 432 ? 40.280 0.201   -20.745 1.00 26.75  ? 429  PHE A C     1 
ATOM   3395 O  O     . PHE A 1 432 ? 40.651 -0.899  -20.796 1.00 25.21  ? 429  PHE A O     1 
ATOM   3396 C  CB    . PHE A 1 432 ? 41.214 1.283   -18.720 1.00 18.59  ? 429  PHE A CB    1 
ATOM   3397 C  CG    . PHE A 1 432 ? 40.989 2.291   -17.633 1.00 21.62  ? 429  PHE A CG    1 
ATOM   3398 C  CD1   . PHE A 1 432 ? 40.838 3.584   -17.931 1.00 19.75  ? 429  PHE A CD1   1 
ATOM   3399 C  CD2   . PHE A 1 432 ? 40.969 1.946   -16.308 1.00 29.24  ? 429  PHE A CD2   1 
ATOM   3400 C  CE1   . PHE A 1 432 ? 40.637 4.527   -16.972 1.00 20.84  ? 429  PHE A CE1   1 
ATOM   3401 C  CE2   . PHE A 1 432 ? 40.766 2.908   -15.333 1.00 27.77  ? 429  PHE A CE2   1 
ATOM   3402 C  CZ    . PHE A 1 432 ? 40.617 4.208   -15.676 1.00 18.78  ? 429  PHE A CZ    1 
ATOM   3403 N  N     . SER A 1 433 ? 40.181 0.990   -21.793 1.00 21.92  ? 430  SER A N     1 
ATOM   3404 C  CA    . SER A 1 433 ? 40.666 0.623   -23.118 1.00 18.83  ? 430  SER A CA    1 
ATOM   3405 C  C     . SER A 1 433 ? 41.616 1.701   -23.610 1.00 22.24  ? 430  SER A C     1 
ATOM   3406 O  O     . SER A 1 433 ? 41.495 2.861   -23.221 1.00 21.15  ? 430  SER A O     1 
ATOM   3407 C  CB    . SER A 1 433 ? 39.512 0.448   -24.106 1.00 28.74  ? 430  SER A CB    1 
ATOM   3408 O  OG    . SER A 1 433 ? 38.565 -0.490  -23.630 1.00 38.25  ? 430  SER A OG    1 
ATOM   3409 N  N     . ALA A 1 434 ? 42.561 1.322   -24.464 1.00 23.27  ? 431  ALA A N     1 
ATOM   3410 C  CA    . ALA A 1 434 ? 43.508 2.287   -25.007 1.00 30.95  ? 431  ALA A CA    1 
ATOM   3411 C  C     . ALA A 1 434 ? 42.766 3.320   -25.851 1.00 32.66  ? 431  ALA A C     1 
ATOM   3412 O  O     . ALA A 1 434 ? 41.817 2.984   -26.558 1.00 37.02  ? 431  ALA A O     1 
ATOM   3413 C  CB    . ALA A 1 434 ? 44.583 1.583   -25.833 1.00 26.39  ? 431  ALA A CB    1 
ATOM   3414 N  N     . SER A 1 435 ? 43.184 4.577   -25.762 1.00 32.25  ? 432  SER A N     1 
ATOM   3415 C  CA    . SER A 1 435 ? 42.537 5.635   -26.532 1.00 29.46  ? 432  SER A CA    1 
ATOM   3416 C  C     . SER A 1 435 ? 43.553 6.646   -27.042 1.00 36.46  ? 432  SER A C     1 
ATOM   3417 O  O     . SER A 1 435 ? 43.187 7.732   -27.483 1.00 50.56  ? 432  SER A O     1 
ATOM   3418 C  CB    . SER A 1 435 ? 41.478 6.346   -25.693 1.00 38.37  ? 432  SER A CB    1 
ATOM   3419 O  OG    . SER A 1 435 ? 42.076 7.268   -24.799 1.00 44.87  ? 432  SER A OG    1 
ATOM   3420 O  OXT   . SER A 1 435 ? 44.756 6.409   -27.025 1.00 41.63  ? 432  SER A OXT   1 
ATOM   3421 O  "O3'" . DC  B 2 1   ? 27.376 4.612   11.703  1.00 70.96  ? 1    DC  T "O3'" 1 
ATOM   3422 P  P     . DA  B 2 2   ? 27.906 4.294   13.188  1.00 96.85  ? 2    DA  T P     1 
ATOM   3423 O  OP1   . DA  B 2 2   ? 28.018 2.824   13.333  1.00 98.01  ? 2    DA  T OP1   1 
ATOM   3424 O  OP2   . DA  B 2 2   ? 27.076 5.070   14.136  1.00 96.57  ? 2    DA  T OP2   1 
ATOM   3425 O  "O5'" . DA  B 2 2   ? 29.377 4.923   13.219  1.00 79.89  ? 2    DA  T "O5'" 1 
ATOM   3426 C  "C5'" . DA  B 2 2   ? 30.437 4.316   12.485  1.00 73.47  ? 2    DA  T "C5'" 1 
ATOM   3427 C  "C4'" . DA  B 2 2   ? 31.759 5.005   12.779  1.00 67.86  ? 2    DA  T "C4'" 1 
ATOM   3428 O  "O4'" . DA  B 2 2   ? 31.647 6.418   12.471  1.00 61.24  ? 2    DA  T "O4'" 1 
ATOM   3429 C  "C3'" . DA  B 2 2   ? 32.215 4.936   14.234  1.00 70.71  ? 2    DA  T "C3'" 1 
ATOM   3430 O  "O3'" . DA  B 2 2   ? 33.632 4.905   14.295  1.00 73.08  ? 2    DA  T "O3'" 1 
ATOM   3431 C  "C2'" . DA  B 2 2   ? 31.663 6.229   14.820  1.00 62.51  ? 2    DA  T "C2'" 1 
ATOM   3432 C  "C1'" . DA  B 2 2   ? 31.827 7.186   13.646  1.00 57.12  ? 2    DA  T "C1'" 1 
ATOM   3433 N  N9    . DA  B 2 2   ? 30.853 8.273   13.643  1.00 49.09  ? 2    DA  T N9    1 
ATOM   3434 C  C8    . DA  B 2 2   ? 29.632 8.291   14.258  1.00 52.35  ? 2    DA  T C8    1 
ATOM   3435 N  N7    . DA  B 2 2   ? 28.970 9.412   14.084  1.00 46.62  ? 2    DA  T N7    1 
ATOM   3436 C  C5    . DA  B 2 2   ? 29.818 10.179  13.302  1.00 43.58  ? 2    DA  T C5    1 
ATOM   3437 C  C6    . DA  B 2 2   ? 29.702 11.477  12.768  1.00 43.70  ? 2    DA  T C6    1 
ATOM   3438 N  N6    . DA  B 2 2   ? 28.635 12.257  12.954  1.00 46.84  ? 2    DA  T N6    1 
ATOM   3439 N  N1    . DA  B 2 2   ? 30.730 11.941  12.031  1.00 39.68  ? 2    DA  T N1    1 
ATOM   3440 C  C2    . DA  B 2 2   ? 31.796 11.156  11.842  1.00 39.38  ? 2    DA  T C2    1 
ATOM   3441 N  N3    . DA  B 2 2   ? 32.018 9.925   12.293  1.00 39.85  ? 2    DA  T N3    1 
ATOM   3442 C  C4    . DA  B 2 2   ? 30.982 9.491   13.022  1.00 41.92  ? 2    DA  T C4    1 
ATOM   3443 P  P     . DT  B 2 3   ? 34.379 3.711   15.065  1.00 77.70  ? 3    DT  T P     1 
ATOM   3444 O  OP1   . DT  B 2 3   ? 33.372 2.653   15.309  1.00 83.76  ? 3    DT  T OP1   1 
ATOM   3445 O  OP2   . DT  B 2 3   ? 35.122 4.308   16.197  1.00 78.48  ? 3    DT  T OP2   1 
ATOM   3446 O  "O5'" . DT  B 2 3   ? 35.453 3.172   14.004  1.00 79.02  ? 3    DT  T "O5'" 1 
ATOM   3447 C  "C5'" . DT  B 2 3   ? 36.785 3.693   13.995  1.00 73.12  ? 3    DT  T "C5'" 1 
ATOM   3448 C  "C4'" . DT  B 2 3   ? 36.951 4.743   12.911  1.00 69.77  ? 3    DT  T "C4'" 1 
ATOM   3449 O  "O4'" . DT  B 2 3   ? 38.349 4.823   12.528  1.00 70.22  ? 3    DT  T "O4'" 1 
ATOM   3450 C  "C3'" . DT  B 2 3   ? 36.167 4.461   11.626  1.00 68.35  ? 3    DT  T "C3'" 1 
ATOM   3451 O  "O3'" . DT  B 2 3   ? 35.438 5.596   11.221  1.00 54.41  ? 3    DT  T "O3'" 1 
ATOM   3452 C  "C2'" . DT  B 2 3   ? 37.240 4.116   10.605  1.00 69.62  ? 3    DT  T "C2'" 1 
ATOM   3453 C  "C1'" . DT  B 2 3   ? 38.447 4.869   11.123  1.00 71.46  ? 3    DT  T "C1'" 1 
ATOM   3454 N  N1    . DT  B 2 3   ? 39.713 4.221   10.710  1.00 72.47  ? 3    DT  T N1    1 
ATOM   3455 C  C2    . DT  B 2 3   ? 40.716 4.977   10.146  1.00 69.96  ? 3    DT  T C2    1 
ATOM   3456 O  O2    . DT  B 2 3   ? 40.640 6.185   9.988   1.00 65.82  ? 3    DT  T O2    1 
ATOM   3457 N  N3    . DT  B 2 3   ? 41.831 4.263   9.786   1.00 70.95  ? 3    DT  T N3    1 
ATOM   3458 C  C4    . DT  B 2 3   ? 42.027 2.897   9.919   1.00 74.20  ? 3    DT  T C4    1 
ATOM   3459 O  O4    . DT  B 2 3   ? 43.061 2.344   9.565   1.00 78.34  ? 3    DT  T O4    1 
ATOM   3460 C  C5    . DT  B 2 3   ? 40.926 2.167   10.503  1.00 72.13  ? 3    DT  T C5    1 
ATOM   3461 C  C7    . DT  B 2 3   ? 41.022 0.681   10.701  1.00 71.22  ? 3    DT  T C7    1 
ATOM   3462 C  C6    . DT  B 2 3   ? 39.837 2.856   10.861  1.00 72.24  ? 3    DT  T C6    1 
ATOM   3463 P  P     . DT  B 2 4   ? 34.512 5.504   9.915   1.00 50.74  ? 4    DT  T P     1 
ATOM   3464 O  OP1   . DT  B 2 4   ? 33.330 6.366   10.145  1.00 53.71  ? 4    DT  T OP1   1 
ATOM   3465 O  OP2   . DT  B 2 4   ? 34.357 4.075   9.566   1.00 47.26  ? 4    DT  T OP2   1 
ATOM   3466 O  "O5'" . DT  B 2 4   ? 35.392 6.149   8.746   1.00 22.30  ? 4    DT  T "O5'" 1 
ATOM   3467 C  "C5'" . DT  B 2 4   ? 35.707 7.521   8.773   1.00 16.02  ? 4    DT  T "C5'" 1 
ATOM   3468 C  "C4'" . DT  B 2 4   ? 36.373 7.935   7.467   1.00 13.87  ? 4    DT  T "C4'" 1 
ATOM   3469 O  "O4'" . DT  B 2 4   ? 37.640 7.253   7.316   1.00 15.30  ? 4    DT  T "O4'" 1 
ATOM   3470 C  "C3'" . DT  B 2 4   ? 35.594 7.641   6.191   1.00 18.48  ? 4    DT  T "C3'" 1 
ATOM   3471 O  "O3'" . DT  B 2 4   ? 35.892 8.685   5.274   1.00 14.29  ? 4    DT  T "O3'" 1 
ATOM   3472 C  "C2'" . DT  B 2 4   ? 36.179 6.298   5.744   1.00 22.64  ? 4    DT  T "C2'" 1 
ATOM   3473 C  "C1'" . DT  B 2 4   ? 37.640 6.496   6.118   1.00 18.00  ? 4    DT  T "C1'" 1 
ATOM   3474 N  N1    . DT  B 2 4   ? 38.413 5.252   6.377   1.00 16.77  ? 4    DT  T N1    1 
ATOM   3475 C  C2    . DT  B 2 4   ? 39.718 5.213   5.967   1.00 15.04  ? 4    DT  T C2    1 
ATOM   3476 O  O2    . DT  B 2 4   ? 40.258 6.135   5.372   1.00 15.84  ? 4    DT  T O2    1 
ATOM   3477 N  N3    . DT  B 2 4   ? 40.381 4.065   6.272   1.00 18.78  ? 4    DT  T N3    1 
ATOM   3478 C  C4    . DT  B 2 4   ? 39.897 2.965   6.931   1.00 21.98  ? 4    DT  T C4    1 
ATOM   3479 O  O4    . DT  B 2 4   ? 40.595 1.978   7.149   1.00 19.79  ? 4    DT  T O4    1 
ATOM   3480 C  C5    . DT  B 2 4   ? 38.518 3.060   7.358   1.00 24.22  ? 4    DT  T C5    1 
ATOM   3481 C  C7    . DT  B 2 4   ? 37.881 1.908   8.081   1.00 25.43  ? 4    DT  T C7    1 
ATOM   3482 C  C6    . DT  B 2 4   ? 37.842 4.195   7.070   1.00 19.32  ? 4    DT  T C6    1 
ATOM   3483 P  P     . DA  B 2 5   ? 35.252 8.738   3.805   1.00 16.34  ? 5    DA  T P     1 
ATOM   3484 O  OP1   . DA  B 2 5   ? 34.948 10.161  3.530   1.00 20.00  ? 5    DA  T OP1   1 
ATOM   3485 O  OP2   . DA  B 2 5   ? 34.198 7.702   3.718   1.00 15.46  ? 5    DA  T OP2   1 
ATOM   3486 O  "O5'" . DA  B 2 5   ? 36.473 8.265   2.870   1.00 14.04  ? 5    DA  T "O5'" 1 
ATOM   3487 C  "C5'" . DA  B 2 5   ? 37.652 9.083   2.739   1.00 13.49  ? 5    DA  T "C5'" 1 
ATOM   3488 C  "C4'" . DA  B 2 5   ? 38.612 8.481   1.735   1.00 13.70  ? 5    DA  T "C4'" 1 
ATOM   3489 O  "O4'" . DA  B 2 5   ? 39.205 7.270   2.294   1.00 18.27  ? 5    DA  T "O4'" 1 
ATOM   3490 C  "C3'" . DA  B 2 5   ? 37.973 8.062   0.405   1.00 12.20  ? 5    DA  T "C3'" 1 
ATOM   3491 O  "O3'" . DA  B 2 5   ? 38.873 8.344   -0.675  1.00 13.44  ? 5    DA  T "O3'" 1 
ATOM   3492 C  "C2'" . DA  B 2 5   ? 37.779 6.558   0.585   1.00 15.13  ? 5    DA  T "C2'" 1 
ATOM   3493 C  "C1'" . DA  B 2 5   ? 39.029 6.207   1.370   1.00 18.08  ? 5    DA  T "C1'" 1 
ATOM   3494 N  N9    . DA  B 2 5   ? 38.937 4.960   2.107   1.00 13.54  ? 5    DA  T N9    1 
ATOM   3495 C  C8    . DA  B 2 5   ? 37.844 4.448   2.759   1.00 15.66  ? 5    DA  T C8    1 
ATOM   3496 N  N7    . DA  B 2 5   ? 38.083 3.307   3.367   1.00 18.26  ? 5    DA  T N7    1 
ATOM   3497 C  C5    . DA  B 2 5   ? 39.426 3.067   3.098   1.00 18.34  ? 5    DA  T C5    1 
ATOM   3498 C  C6    . DA  B 2 5   ? 40.287 2.017   3.452   1.00 23.22  ? 5    DA  T C6    1 
ATOM   3499 N  N6    . DA  B 2 5   ? 39.902 0.973   4.197   1.00 25.49  ? 5    DA  T N6    1 
ATOM   3500 N  N1    . DA  B 2 5   ? 41.568 2.083   3.020   1.00 19.28  ? 5    DA  T N1    1 
ATOM   3501 C  C2    . DA  B 2 5   ? 41.947 3.140   2.281   1.00 17.96  ? 5    DA  T C2    1 
ATOM   3502 N  N3    . DA  B 2 5   ? 41.223 4.187   1.885   1.00 13.79  ? 5    DA  T N3    1 
ATOM   3503 C  C4    . DA  B 2 5   ? 39.959 4.079   2.327   1.00 15.23  ? 5    DA  T C4    1 
ATOM   3504 P  P     . DT  B 2 6   ? 38.371 8.343   -2.210  1.00 14.24  ? 6    DT  T P     1 
ATOM   3505 O  OP1   . DT  B 2 6   ? 39.562 8.673   -3.022  1.00 16.67  ? 6    DT  T OP1   1 
ATOM   3506 O  OP2   . DT  B 2 6   ? 37.119 9.129   -2.302  1.00 13.70  ? 6    DT  T OP2   1 
ATOM   3507 O  "O5'" . DT  B 2 6   ? 37.913 6.835   -2.474  1.00 15.56  ? 6    DT  T "O5'" 1 
ATOM   3508 C  "C5'" . DT  B 2 6   ? 38.594 6.018   -3.386  1.00 16.49  ? 6    DT  T "C5'" 1 
ATOM   3509 C  "C4'" . DT  B 2 6   ? 39.828 5.363   -2.784  1.00 17.89  ? 6    DT  T "C4'" 1 
ATOM   3510 O  "O4'" . DT  B 2 6   ? 39.489 4.626   -1.590  1.00 16.14  ? 6    DT  T "O4'" 1 
ATOM   3511 C  "C3'" . DT  B 2 6   ? 40.455 4.341   -3.723  1.00 19.50  ? 6    DT  T "C3'" 1 
ATOM   3512 O  "O3'" . DT  B 2 6   ? 41.560 4.918   -4.383  1.00 14.54  ? 6    DT  T "O3'" 1 
ATOM   3513 C  "C2'" . DT  B 2 6   ? 40.863 3.158   -2.834  1.00 20.62  ? 6    DT  T "C2'" 1 
ATOM   3514 C  "C1'" . DT  B 2 6   ? 40.396 3.564   -1.440  1.00 15.70  ? 6    DT  T "C1'" 1 
ATOM   3515 N  N1    . DT  B 2 6   ? 39.720 2.473   -0.680  1.00 15.29  ? 6    DT  T N1    1 
ATOM   3516 C  C2    . DT  B 2 6   ? 40.440 1.362   -0.297  1.00 13.65  ? 6    DT  T C2    1 
ATOM   3517 O  O2    . DT  B 2 6   ? 41.615 1.188   -0.578  1.00 19.30  ? 6    DT  T O2    1 
ATOM   3518 N  N3    . DT  B 2 6   ? 39.727 0.448   0.432   1.00 18.61  ? 6    DT  T N3    1 
ATOM   3519 C  C4    . DT  B 2 6   ? 38.397 0.516   0.797   1.00 20.78  ? 6    DT  T C4    1 
ATOM   3520 O  O4    . DT  B 2 6   ? 37.851 -0.366  1.459   1.00 26.22  ? 6    DT  T O4    1 
ATOM   3521 C  C5    . DT  B 2 6   ? 37.705 1.700   0.373   1.00 20.83  ? 6    DT  T C5    1 
ATOM   3522 C  C7    . DT  B 2 6   ? 36.256 1.889   0.726   1.00 26.32  ? 6    DT  T C7    1 
ATOM   3523 C  C6    . DT  B 2 6   ? 38.390 2.613   -0.333  1.00 16.32  ? 6    DT  T C6    1 
ATOM   3524 P  P     . DG  B 2 7   ? 41.800 4.593   -5.931  1.00 15.92  ? 7    DG  T P     1 
ATOM   3525 O  OP1   . DG  B 2 7   ? 43.003 5.340   -6.361  1.00 15.71  ? 7    DG  T OP1   1 
ATOM   3526 O  OP2   . DG  B 2 7   ? 40.543 4.727   -6.675  1.00 14.91  ? 7    DG  T OP2   1 
ATOM   3527 O  "O5'" . DG  B 2 7   ? 42.095 3.017   -5.947  1.00 18.51  ? 7    DG  T "O5'" 1 
ATOM   3528 C  "C5'" . DG  B 2 7   ? 43.377 2.542   -5.703  1.00 22.78  ? 7    DG  T "C5'" 1 
ATOM   3529 C  "C4'" . DG  B 2 7   ? 43.378 1.028   -5.613  1.00 15.12  ? 7    DG  T "C4'" 1 
ATOM   3530 O  "O4'" . DG  B 2 7   ? 42.622 0.603   -4.472  1.00 17.63  ? 7    DG  T "O4'" 1 
ATOM   3531 C  "C3'" . DG  B 2 7   ? 42.776 0.286   -6.813  1.00 19.21  ? 7    DG  T "C3'" 1 
ATOM   3532 O  "O3'" . DG  B 2 7   ? 43.789 -0.420  -7.470  1.00 20.47  ? 7    DG  T "O3'" 1 
ATOM   3533 C  "C2'" . DG  B 2 7   ? 41.739 -0.664  -6.188  1.00 22.79  ? 7    DG  T "C2'" 1 
ATOM   3534 C  "C1'" . DG  B 2 7   ? 42.180 -0.696  -4.737  1.00 22.11  ? 7    DG  T "C1'" 1 
ATOM   3535 N  N9    . DG  B 2 7   ? 41.120 -1.046  -3.799  1.00 19.21  ? 7    DG  T N9    1 
ATOM   3536 C  C8    . DG  B 2 7   ? 39.914 -0.409  -3.617  1.00 17.97  ? 7    DG  T C8    1 
ATOM   3537 N  N7    . DG  B 2 7   ? 39.169 -0.963  -2.699  1.00 20.18  ? 7    DG  T N7    1 
ATOM   3538 C  C5    . DG  B 2 7   ? 39.928 -2.041  -2.247  1.00 16.16  ? 7    DG  T C5    1 
ATOM   3539 C  C6    . DG  B 2 7   ? 39.637 -3.004  -1.262  1.00 20.87  ? 7    DG  T C6    1 
ATOM   3540 O  O6    . DG  B 2 7   ? 38.616 -3.100  -0.560  1.00 22.92  ? 7    DG  T O6    1 
ATOM   3541 N  N1    . DG  B 2 7   ? 40.682 -3.925  -1.117  1.00 18.02  ? 7    DG  T N1    1 
ATOM   3542 C  C2    . DG  B 2 7   ? 41.857 -3.899  -1.842  1.00 17.51  ? 7    DG  T C2    1 
ATOM   3543 N  N2    . DG  B 2 7   ? 42.758 -4.861  -1.564  1.00 21.56  ? 7    DG  T N2    1 
ATOM   3544 N  N3    . DG  B 2 7   ? 42.136 -2.992  -2.769  1.00 16.76  ? 7    DG  T N3    1 
ATOM   3545 C  C4    . DG  B 2 7   ? 41.130 -2.103  -2.915  1.00 14.49  ? 7    DG  T C4    1 
ATOM   3546 P  P     . DA  B 2 8   ? 43.474 -1.310  -8.772  1.00 20.12  ? 8    DA  T P     1 
ATOM   3547 O  OP1   . DA  B 2 8   ? 44.589 -0.995  -9.683  1.00 19.19  ? 8    DA  T OP1   1 
ATOM   3548 O  OP2   . DA  B 2 8   ? 42.052 -1.185  -9.199  1.00 21.93  ? 8    DA  T OP2   1 
ATOM   3549 O  "O5'" . DA  B 2 8   ? 43.729 -2.800  -8.259  1.00 21.12  ? 8    DA  T "O5'" 1 
ATOM   3550 C  "C5'" . DA  B 2 8   ? 45.001 -3.137  -7.717  1.00 17.24  ? 8    DA  T "C5'" 1 
ATOM   3551 C  "C4'" . DA  B 2 8   ? 44.967 -4.555  -7.218  1.00 20.63  ? 8    DA  T "C4'" 1 
ATOM   3552 O  "O4'" . DA  B 2 8   ? 44.012 -4.625  -6.129  1.00 19.54  ? 8    DA  T "O4'" 1 
ATOM   3553 C  "C3'" . DA  B 2 8   ? 44.497 -5.552  -8.276  1.00 25.57  ? 8    DA  T "C3'" 1 
ATOM   3554 O  "O3'" . DA  B 2 8   ? 45.372 -6.658  -8.331  1.00 25.45  ? 8    DA  T "O3'" 1 
ATOM   3555 C  "C2'" . DA  B 2 8   ? 43.091 -5.953  -7.825  1.00 26.52  ? 8    DA  T "C2'" 1 
ATOM   3556 C  "C1'" . DA  B 2 8   ? 43.144 -5.715  -6.323  1.00 24.12  ? 8    DA  T "C1'" 1 
ATOM   3557 N  N9    . DA  B 2 8   ? 41.843 -5.375  -5.755  1.00 18.20  ? 8    DA  T N9    1 
ATOM   3558 C  C8    . DA  B 2 8   ? 41.018 -4.349  -6.136  1.00 17.97  ? 8    DA  T C8    1 
ATOM   3559 N  N7    . DA  B 2 8   ? 39.905 -4.280  -5.444  1.00 16.45  ? 8    DA  T N7    1 
ATOM   3560 C  C5    . DA  B 2 8   ? 40.004 -5.339  -4.549  1.00 15.57  ? 8    DA  T C5    1 
ATOM   3561 C  C6    . DA  B 2 8   ? 39.138 -5.818  -3.543  1.00 18.33  ? 8    DA  T C6    1 
ATOM   3562 N  N6    . DA  B 2 8   ? 37.954 -5.263  -3.266  1.00 16.11  ? 8    DA  T N6    1 
ATOM   3563 N  N1    . DA  B 2 8   ? 39.533 -6.908  -2.837  1.00 18.64  ? 8    DA  T N1    1 
ATOM   3564 C  C2    . DA  B 2 8   ? 40.720 -7.463  -3.117  1.00 14.26  ? 8    DA  T C2    1 
ATOM   3565 N  N3    . DA  B 2 8   ? 41.623 -7.101  -4.037  1.00 17.12  ? 8    DA  T N3    1 
ATOM   3566 C  C4    . DA  B 2 8   ? 41.191 -6.027  -4.734  1.00 15.12  ? 8    DA  T C4    1 
ATOM   3567 P  P     . DC  B 2 9   ? 45.211 -7.753  -9.493  1.00 26.05  ? 9    DC  T P     1 
ATOM   3568 O  OP1   . DC  B 2 9   ? 46.586 -8.180  -9.834  1.00 28.54  ? 9    DC  T OP1   1 
ATOM   3569 O  OP2   . DC  B 2 9   ? 44.291 -7.241  -10.535 1.00 32.50  ? 9    DC  T OP2   1 
ATOM   3570 O  "O5'" . DC  B 2 9   ? 44.480 -8.947  -8.761  1.00 20.46  ? 9    DC  T "O5'" 1 
ATOM   3571 C  "C5'" . DC  B 2 9   ? 45.079 -9.494  -7.614  1.00 17.67  ? 9    DC  T "C5'" 1 
ATOM   3572 C  "C4'" . DC  B 2 9   ? 44.128 -10.435 -6.951  1.00 25.32  ? 9    DC  T "C4'" 1 
ATOM   3573 O  "O4'" . DC  B 2 9   ? 43.011 -9.690  -6.415  1.00 26.67  ? 9    DC  T "O4'" 1 
ATOM   3574 C  "C3'" . DC  B 2 9   ? 43.526 -11.481 -7.892  1.00 27.82  ? 9    DC  T "C3'" 1 
ATOM   3575 O  "O3'" . DC  B 2 9   ? 43.555 -12.716 -7.250  1.00 35.28  ? 9    DC  T "O3'" 1 
ATOM   3576 C  "C2'" . DC  B 2 9   ? 42.093 -10.989 -8.092  1.00 24.47  ? 9    DC  T "C2'" 1 
ATOM   3577 C  "C1'" . DC  B 2 9   ? 41.826 -10.382 -6.730  1.00 24.34  ? 9    DC  T "C1'" 1 
ATOM   3578 N  N1    . DC  B 2 9   ? 40.677 -9.434  -6.685  1.00 26.50  ? 9    DC  T N1    1 
ATOM   3579 C  C2    . DC  B 2 9   ? 39.738 -9.565  -5.669  1.00 24.00  ? 9    DC  T C2    1 
ATOM   3580 O  O2    . DC  B 2 9   ? 39.881 -10.470 -4.838  1.00 22.33  ? 9    DC  T O2    1 
ATOM   3581 N  N3    . DC  B 2 9   ? 38.689 -8.707  -5.622  1.00 21.32  ? 9    DC  T N3    1 
ATOM   3582 C  C4    . DC  B 2 9   ? 38.564 -7.755  -6.537  1.00 26.78  ? 9    DC  T C4    1 
ATOM   3583 N  N4    . DC  B 2 9   ? 37.511 -6.933  -6.439  1.00 23.21  ? 9    DC  T N4    1 
ATOM   3584 C  C5    . DC  B 2 9   ? 39.516 -7.599  -7.590  1.00 23.99  ? 9    DC  T C5    1 
ATOM   3585 C  C6    . DC  B 2 9   ? 40.550 -8.454  -7.623  1.00 22.39  ? 9    DC  T C6    1 
ATOM   3586 P  P     . DG  B 2 10  ? 43.375 -14.072 -8.082  1.00 31.84  ? 10   DG  T P     1 
ATOM   3587 O  OP1   . DG  B 2 10  ? 44.662 -14.789 -7.976  1.00 31.95  ? 10   DG  T OP1   1 
ATOM   3588 O  OP2   . DG  B 2 10  ? 42.737 -13.778 -9.385  1.00 32.34  ? 10   DG  T OP2   1 
ATOM   3589 O  "O5'" . DG  B 2 10  ? 42.317 -14.873 -7.229  1.00 28.76  ? 10   DG  T "O5'" 1 
ATOM   3590 C  "C5'" . DG  B 2 10  ? 42.359 -14.835 -5.835  1.00 27.69  ? 10   DG  T "C5'" 1 
ATOM   3591 C  "C4'" . DG  B 2 10  ? 41.062 -15.378 -5.295  1.00 29.29  ? 10   DG  T "C4'" 1 
ATOM   3592 O  "O4'" . DG  B 2 10  ? 40.095 -14.300 -5.213  1.00 33.40  ? 10   DG  T "O4'" 1 
ATOM   3593 C  "C3'" . DG  B 2 10  ? 40.429 -16.459 -6.177  1.00 30.34  ? 10   DG  T "C3'" 1 
ATOM   3594 O  "O3'" . DG  B 2 10  ? 39.923 -17.510 -5.366  1.00 28.72  ? 10   DG  T "O3'" 1 
ATOM   3595 C  "C2'" . DG  B 2 10  ? 39.315 -15.716 -6.912  1.00 32.03  ? 10   DG  T "C2'" 1 
ATOM   3596 C  "C1'" . DG  B 2 10  ? 38.916 -14.657 -5.896  1.00 28.44  ? 10   DG  T "C1'" 1 
ATOM   3597 N  N9    . DG  B 2 10  ? 38.365 -13.455 -6.511  1.00 24.39  ? 10   DG  T N9    1 
ATOM   3598 C  C8    . DG  B 2 10  ? 38.950 -12.687 -7.494  1.00 23.31  ? 10   DG  T C8    1 
ATOM   3599 N  N7    . DG  B 2 10  ? 38.225 -11.667 -7.860  1.00 21.62  ? 10   DG  T N7    1 
ATOM   3600 C  C5    . DG  B 2 10  ? 37.085 -11.763 -7.069  1.00 17.95  ? 10   DG  T C5    1 
ATOM   3601 C  C6    . DG  B 2 10  ? 35.946 -10.930 -7.022  1.00 23.79  ? 10   DG  T C6    1 
ATOM   3602 O  O6    . DG  B 2 10  ? 35.715 -9.916  -7.696  1.00 29.81  ? 10   DG  T O6    1 
ATOM   3603 N  N1    . DG  B 2 10  ? 35.015 -11.378 -6.085  1.00 26.17  ? 10   DG  T N1    1 
ATOM   3604 C  C2    . DG  B 2 10  ? 35.169 -12.496 -5.293  1.00 26.39  ? 10   DG  T C2    1 
ATOM   3605 N  N2    . DG  B 2 10  ? 34.161 -12.767 -4.453  1.00 24.62  ? 10   DG  T N2    1 
ATOM   3606 N  N3    . DG  B 2 10  ? 36.244 -13.289 -5.319  1.00 23.32  ? 10   DG  T N3    1 
ATOM   3607 C  C4    . DG  B 2 10  ? 37.160 -12.856 -6.227  1.00 19.48  ? 10   DG  T C4    1 
ATOM   3608 P  P     . DC  B 2 11  ? 39.291 -18.834 -6.028  1.00 30.77  ? 11   DC  T P     1 
ATOM   3609 O  OP1   . DC  B 2 11  ? 39.876 -19.982 -5.307  1.00 36.92  ? 11   DC  T OP1   1 
ATOM   3610 O  OP2   . DC  B 2 11  ? 39.372 -18.788 -7.506  1.00 29.28  ? 11   DC  T OP2   1 
ATOM   3611 O  "O5'" . DC  B 2 11  ? 37.742 -18.688 -5.699  1.00 31.00  ? 11   DC  T "O5'" 1 
ATOM   3612 C  "C5'" . DC  B 2 11  ? 37.319 -18.241 -4.434  1.00 25.59  ? 11   DC  T "C5'" 1 
ATOM   3613 C  "C4'" . DC  B 2 11  ? 35.801 -18.199 -4.387  1.00 26.59  ? 11   DC  T "C4'" 1 
ATOM   3614 O  "O4'" . DC  B 2 11  ? 35.325 -16.948 -4.939  1.00 24.47  ? 11   DC  T "O4'" 1 
ATOM   3615 C  "C3'" . DC  B 2 11  ? 35.095 -19.310 -5.172  1.00 18.68  ? 11   DC  T "C3'" 1 
ATOM   3616 O  "O3'" . DC  B 2 11  ? 34.016 -19.809 -4.390  1.00 18.35  ? 11   DC  T "O3'" 1 
ATOM   3617 C  "C2'" . DC  B 2 11  ? 34.615 -18.602 -6.450  1.00 20.89  ? 11   DC  T "C2'" 1 
ATOM   3618 C  "C1'" . DC  B 2 11  ? 34.362 -17.187 -5.949  1.00 22.92  ? 11   DC  T "C1'" 1 
ATOM   3619 N  N1    . DC  B 2 11  ? 34.529 -16.098 -6.975  1.00 19.11  ? 11   DC  T N1    1 
ATOM   3620 C  C2    . DC  B 2 11  ? 33.492 -15.180 -7.187  1.00 19.78  ? 11   DC  T C2    1 
ATOM   3621 O  O2    . DC  B 2 11  ? 32.432 -15.308 -6.573  1.00 19.67  ? 11   DC  T O2    1 
ATOM   3622 N  N3    . DC  B 2 11  ? 33.669 -14.178 -8.079  1.00 23.51  ? 11   DC  T N3    1 
ATOM   3623 C  C4    . DC  B 2 11  ? 34.819 -14.066 -8.734  1.00 16.82  ? 11   DC  T C4    1 
ATOM   3624 N  N4    . DC  B 2 11  ? 34.937 -13.048 -9.607  1.00 18.94  ? 11   DC  T N4    1 
ATOM   3625 C  C5    . DC  B 2 11  ? 35.899 -14.984 -8.531  1.00 13.88  ? 11   DC  T C5    1 
ATOM   3626 C  C6    . DC  B 2 11  ? 35.717 -15.969 -7.636  1.00 20.10  ? 11   DC  T C6    1 
ATOM   3627 P  P     . DT  B 2 12  ? 33.272 -21.172 -4.793  1.00 17.83  ? 12   DT  T P     1 
ATOM   3628 O  OP1   . DT  B 2 12  ? 32.724 -21.769 -3.547  1.00 18.68  ? 12   DT  T OP1   1 
ATOM   3629 O  OP2   . DT  B 2 12  ? 34.115 -22.019 -5.665  1.00 19.37  ? 12   DT  T OP2   1 
ATOM   3630 O  "O5'" . DT  B 2 12  ? 32.043 -20.668 -5.652  1.00 17.16  ? 12   DT  T "O5'" 1 
ATOM   3631 C  "C5'" . DT  B 2 12  ? 30.930 -20.083 -5.006  1.00 18.41  ? 12   DT  T "C5'" 1 
ATOM   3632 C  "C4'" . DT  B 2 12  ? 29.923 -19.606 -6.020  1.00 21.59  ? 12   DT  T "C4'" 1 
ATOM   3633 O  "O4'" . DT  B 2 12  ? 30.482 -18.489 -6.764  1.00 23.01  ? 12   DT  T "O4'" 1 
ATOM   3634 C  "C3'" . DT  B 2 12  ? 29.522 -20.649 -7.076  1.00 22.47  ? 12   DT  T "C3'" 1 
ATOM   3635 O  "O3'" . DT  B 2 12  ? 28.121 -20.581 -7.315  1.00 26.40  ? 12   DT  T "O3'" 1 
ATOM   3636 C  "C2'" . DT  B 2 12  ? 30.305 -20.199 -8.306  1.00 17.89  ? 12   DT  T "C2'" 1 
ATOM   3637 C  "C1'" . DT  B 2 12  ? 30.190 -18.700 -8.120  1.00 17.51  ? 12   DT  T "C1'" 1 
ATOM   3638 N  N1    . DT  B 2 12  ? 31.104 -17.897 -8.935  1.00 19.37  ? 12   DT  T N1    1 
ATOM   3639 C  C2    . DT  B 2 12  ? 30.671 -16.671 -9.376  1.00 20.27  ? 12   DT  T C2    1 
ATOM   3640 O  O2    . DT  B 2 12  ? 29.567 -16.230 -9.127  1.00 27.31  ? 12   DT  T O2    1 
ATOM   3641 N  N3    . DT  B 2 12  ? 31.573 -15.984 -10.129 1.00 20.25  ? 12   DT  T N3    1 
ATOM   3642 C  C4    . DT  B 2 12  ? 32.844 -16.388 -10.486 1.00 17.86  ? 12   DT  T C4    1 
ATOM   3643 O  O4    . DT  B 2 12  ? 33.585 -15.685 -11.184 1.00 18.97  ? 12   DT  T O4    1 
ATOM   3644 C  C5    . DT  B 2 12  ? 33.246 -17.683 -9.983  1.00 18.56  ? 12   DT  T C5    1 
ATOM   3645 C  C7    . DT  B 2 12  ? 34.608 -18.227 -10.299 1.00 22.26  ? 12   DT  T C7    1 
ATOM   3646 C  C6    . DT  B 2 12  ? 32.364 -18.372 -9.236  1.00 18.92  ? 12   DT  T C6    1 
ATOM   3647 O  "O5'" . DA  C 3 1   ? 28.970 -7.793  -15.472 1.00 39.32  ? 1    DA  P "O5'" 1 
ATOM   3648 C  "C5'" . DA  C 3 1   ? 27.617 -8.000  -15.841 1.00 34.61  ? 1    DA  P "C5'" 1 
ATOM   3649 C  "C4'" . DA  C 3 1   ? 26.793 -8.482  -14.658 1.00 33.11  ? 1    DA  P "C4'" 1 
ATOM   3650 O  "O4'" . DA  C 3 1   ? 27.236 -9.800  -14.263 1.00 32.48  ? 1    DA  P "O4'" 1 
ATOM   3651 C  "C3'" . DA  C 3 1   ? 26.861 -7.605  -13.407 1.00 29.22  ? 1    DA  P "C3'" 1 
ATOM   3652 O  "O3'" A DA  C 3 1   ? 25.584 -7.536  -12.788 0.56 31.40  ? 1    DA  P "O3'" 1 
ATOM   3653 O  "O3'" B DA  C 3 1   ? 25.583 -7.535  -12.788 0.44 31.42  ? 1    DA  P "O3'" 1 
ATOM   3654 C  "C2'" . DA  C 3 1   ? 27.875 -8.314  -12.517 1.00 32.75  ? 1    DA  P "C2'" 1 
ATOM   3655 C  "C1'" . DA  C 3 1   ? 27.773 -9.776  -12.956 1.00 30.05  ? 1    DA  P "C1'" 1 
ATOM   3656 N  N9    . DA  C 3 1   ? 29.071 -10.435 -12.989 1.00 26.75  ? 1    DA  P N9    1 
ATOM   3657 C  C8    . DA  C 3 1   ? 30.156 -10.076 -13.739 1.00 25.56  ? 1    DA  P C8    1 
ATOM   3658 N  N7    . DA  C 3 1   ? 31.203 -10.846 -13.554 1.00 23.84  ? 1    DA  P N7    1 
ATOM   3659 C  C5    . DA  C 3 1   ? 30.776 -11.767 -12.610 1.00 22.55  ? 1    DA  P C5    1 
ATOM   3660 C  C6    . DA  C 3 1   ? 31.414 -12.855 -11.993 1.00 21.05  ? 1    DA  P C6    1 
ATOM   3661 N  N6    . DA  C 3 1   ? 32.676 -13.209 -12.247 1.00 20.97  ? 1    DA  P N6    1 
ATOM   3662 N  N1    . DA  C 3 1   ? 30.697 -13.579 -11.109 1.00 21.65  ? 1    DA  P N1    1 
ATOM   3663 C  C2    . DA  C 3 1   ? 29.431 -13.230 -10.859 1.00 18.83  ? 1    DA  P C2    1 
ATOM   3664 N  N3    . DA  C 3 1   ? 28.727 -12.229 -11.375 1.00 26.89  ? 1    DA  P N3    1 
ATOM   3665 C  C4    . DA  C 3 1   ? 29.465 -11.531 -12.254 1.00 25.27  ? 1    DA  P C4    1 
ATOM   3666 P  P     A DG  C 3 2   ? 25.245 -6.336  -11.772 0.67 35.87  ? 2    DG  P P     1 
ATOM   3667 P  P     B DG  C 3 2   ? 25.241 -6.328  -11.782 0.33 35.85  ? 2    DG  P P     1 
ATOM   3668 O  OP1   A DG  C 3 2   ? 23.788 -6.110  -11.841 0.67 34.46  ? 2    DG  P OP1   1 
ATOM   3669 O  OP1   B DG  C 3 2   ? 23.785 -6.088  -11.857 0.33 34.43  ? 2    DG  P OP1   1 
ATOM   3670 O  OP2   A DG  C 3 2   ? 26.208 -5.233  -12.001 0.67 33.61  ? 2    DG  P OP2   1 
ATOM   3671 O  OP2   B DG  C 3 2   ? 26.200 -5.229  -12.035 0.33 33.58  ? 2    DG  P OP2   1 
ATOM   3672 O  "O5'" A DG  C 3 2   ? 25.596 -6.939  -10.338 0.67 32.02  ? 2    DG  P "O5'" 1 
ATOM   3673 O  "O5'" B DG  C 3 2   ? 25.586 -6.923  -10.340 0.33 32.04  ? 2    DG  P "O5'" 1 
ATOM   3674 C  "C5'" A DG  C 3 2   ? 24.750 -7.912  -9.765  0.67 31.28  ? 2    DG  P "C5'" 1 
ATOM   3675 C  "C5'" B DG  C 3 2   ? 24.748 -7.912  -9.768  0.33 31.29  ? 2    DG  P "C5'" 1 
ATOM   3676 C  "C4'" . DG  C 3 2   ? 25.446 -8.603  -8.616  1.00 23.97  ? 2    DG  P "C4'" 1 
ATOM   3677 O  "O4'" . DG  C 3 2   ? 26.671 -9.207  -9.088  1.00 24.09  ? 2    DG  P "O4'" 1 
ATOM   3678 C  "C3'" . DG  C 3 2   ? 25.835 -7.683  -7.452  1.00 28.06  ? 2    DG  P "C3'" 1 
ATOM   3679 O  "O3'" . DG  C 3 2   ? 25.226 -8.180  -6.275  1.00 31.62  ? 2    DG  P "O3'" 1 
ATOM   3680 C  "C2'" . DG  C 3 2   ? 27.371 -7.776  -7.401  1.00 23.38  ? 2    DG  P "C2'" 1 
ATOM   3681 C  "C1'" . DG  C 3 2   ? 27.624 -9.117  -8.071  1.00 23.14  ? 2    DG  P "C1'" 1 
ATOM   3682 N  N9    . DG  C 3 2   ? 28.958 -9.270  -8.651  1.00 19.70  ? 2    DG  P N9    1 
ATOM   3683 C  C8    . DG  C 3 2   ? 29.627 -8.393  -9.479  1.00 24.57  ? 2    DG  P C8    1 
ATOM   3684 N  N7    . DG  C 3 2   ? 30.813 -8.817  -9.835  1.00 23.22  ? 2    DG  P N7    1 
ATOM   3685 C  C5    . DG  C 3 2   ? 30.935 -10.053 -9.196  1.00 23.53  ? 2    DG  P C5    1 
ATOM   3686 C  C6    . DG  C 3 2   ? 32.000 -10.980 -9.196  1.00 21.66  ? 2    DG  P C6    1 
ATOM   3687 O  O6    . DG  C 3 2   ? 33.088 -10.898 -9.784  1.00 22.97  ? 2    DG  P O6    1 
ATOM   3688 N  N1    . DG  C 3 2   ? 31.707 -12.107 -8.417  1.00 26.13  ? 2    DG  P N1    1 
ATOM   3689 C  C2    . DG  C 3 2   ? 30.527 -12.303 -7.729  1.00 27.44  ? 2    DG  P C2    1 
ATOM   3690 N  N2    . DG  C 3 2   ? 30.415 -13.454 -7.038  1.00 25.09  ? 2    DG  P N2    1 
ATOM   3691 N  N3    . DG  C 3 2   ? 29.522 -11.439 -7.729  1.00 19.38  ? 2    DG  P N3    1 
ATOM   3692 C  C4    . DG  C 3 2   ? 29.797 -10.341 -8.474  1.00 22.26  ? 2    DG  P C4    1 
ATOM   3693 P  P     . DC  C 3 3   ? 25.380 -7.453  -4.852  1.00 32.07  ? 3    DC  P P     1 
ATOM   3694 O  OP1   . DC  C 3 3   ? 24.020 -7.473  -4.275  1.00 35.37  ? 3    DC  P OP1   1 
ATOM   3695 O  OP2   . DC  C 3 3   ? 26.153 -6.200  -4.934  1.00 31.96  ? 3    DC  P OP2   1 
ATOM   3696 O  "O5'" . DC  C 3 3   ? 26.321 -8.453  -4.030  1.00 34.79  ? 3    DC  P "O5'" 1 
ATOM   3697 C  "C5'" . DC  C 3 3   ? 26.111 -9.853  -4.106  1.00 36.79  ? 3    DC  P "C5'" 1 
ATOM   3698 C  "C4'" . DC  C 3 3   ? 27.290 -10.596 -3.511  1.00 35.36  ? 3    DC  P "C4'" 1 
ATOM   3699 O  "O4'" . DC  C 3 3   ? 28.377 -10.600 -4.461  1.00 32.17  ? 3    DC  P "O4'" 1 
ATOM   3700 C  "C3'" . DC  C 3 3   ? 27.848 -9.987  -2.218  1.00 35.74  ? 3    DC  P "C3'" 1 
ATOM   3701 O  "O3'" . DC  C 3 3   ? 27.781 -10.935 -1.162  1.00 39.21  ? 3    DC  P "O3'" 1 
ATOM   3702 C  "C2'" . DC  C 3 3   ? 29.299 -9.612  -2.561  1.00 34.25  ? 3    DC  P "C2'" 1 
ATOM   3703 C  "C1'" . DC  C 3 3   ? 29.595 -10.484 -3.771  1.00 35.96  ? 3    DC  P "C1'" 1 
ATOM   3704 N  N1    . DC  C 3 3   ? 30.604 -9.883  -4.701  1.00 33.51  ? 3    DC  P N1    1 
ATOM   3705 C  C2    . DC  C 3 3   ? 31.772 -10.591 -5.015  1.00 23.75  ? 3    DC  P C2    1 
ATOM   3706 O  O2    . DC  C 3 3   ? 31.955 -11.708 -4.520  1.00 33.40  ? 3    DC  P O2    1 
ATOM   3707 N  N3    . DC  C 3 3   ? 32.675 -10.027 -5.852  1.00 29.62  ? 3    DC  P N3    1 
ATOM   3708 C  C4    . DC  C 3 3   ? 32.447 -8.821  -6.363  1.00 27.35  ? 3    DC  P C4    1 
ATOM   3709 N  N4    . DC  C 3 3   ? 33.366 -8.312  -7.188  1.00 33.33  ? 3    DC  P N4    1 
ATOM   3710 C  C5    . DC  C 3 3   ? 31.264 -8.085  -6.057  1.00 34.39  ? 3    DC  P C5    1 
ATOM   3711 C  C6    . DC  C 3 3   ? 30.381 -8.648  -5.228  1.00 26.96  ? 3    DC  P C6    1 
ATOM   3712 P  P     . DG  C 3 4   ? 28.228 -10.517 0.325   1.00 37.36  ? 4    DG  P P     1 
ATOM   3713 O  OP1   . DG  C 3 4   ? 27.360 -11.256 1.269   1.00 43.80  ? 4    DG  P OP1   1 
ATOM   3714 O  OP2   . DG  C 3 4   ? 28.344 -9.046  0.375   1.00 37.32  ? 4    DG  P OP2   1 
ATOM   3715 O  "O5'" . DG  C 3 4   ? 29.725 -11.073 0.445   1.00 39.00  ? 4    DG  P "O5'" 1 
ATOM   3716 C  "C5'" . DG  C 3 4   ? 30.016 -12.417 0.077   1.00 34.84  ? 4    DG  P "C5'" 1 
ATOM   3717 C  "C4'" . DG  C 3 4   ? 31.505 -12.697 0.204   1.00 41.25  ? 4    DG  P "C4'" 1 
ATOM   3718 O  "O4'" . DG  C 3 4   ? 32.218 -12.089 -0.901  1.00 38.94  ? 4    DG  P "O4'" 1 
ATOM   3719 C  "C3'" . DG  C 3 4   ? 32.156 -12.172 1.484   1.00 37.16  ? 4    DG  P "C3'" 1 
ATOM   3720 O  "O3'" . DG  C 3 4   ? 32.885 -13.219 2.097   1.00 38.70  ? 4    DG  P "O3'" 1 
ATOM   3721 C  "C2'" . DG  C 3 4   ? 33.070 -11.037 1.000   1.00 31.33  ? 4    DG  P "C2'" 1 
ATOM   3722 C  "C1'" . DG  C 3 4   ? 33.380 -11.448 -0.430  1.00 27.49  ? 4    DG  P "C1'" 1 
ATOM   3723 N  N9    . DG  C 3 4   ? 33.645 -10.316 -1.314  1.00 28.06  ? 4    DG  P N9    1 
ATOM   3724 C  C8    . DG  C 3 4   ? 32.809 -9.247  -1.553  1.00 29.42  ? 4    DG  P C8    1 
ATOM   3725 N  N7    . DG  C 3 4   ? 33.288 -8.391  -2.411  1.00 24.03  ? 4    DG  P N7    1 
ATOM   3726 C  C5    . DG  C 3 4   ? 34.520 -8.924  -2.770  1.00 27.28  ? 4    DG  P C5    1 
ATOM   3727 C  C6    . DG  C 3 4   ? 35.487 -8.430  -3.663  1.00 23.25  ? 4    DG  P C6    1 
ATOM   3728 O  O6    . DG  C 3 4   ? 35.446 -7.390  -4.331  1.00 25.41  ? 4    DG  P O6    1 
ATOM   3729 N  N1    . DG  C 3 4   ? 36.596 -9.277  -3.752  1.00 22.53  ? 4    DG  P N1    1 
ATOM   3730 C  C2    . DG  C 3 4   ? 36.744 -10.453 -3.052  1.00 22.92  ? 4    DG  P C2    1 
ATOM   3731 N  N2    . DG  C 3 4   ? 37.880 -11.130 -3.271  1.00 21.97  ? 4    DG  P N2    1 
ATOM   3732 N  N3    . DG  C 3 4   ? 35.836 -10.935 -2.207  1.00 18.26  ? 4    DG  P N3    1 
ATOM   3733 C  C4    . DG  C 3 4   ? 34.753 -10.115 -2.113  1.00 21.27  ? 4    DG  P C4    1 
ATOM   3734 P  P     . DT  C 3 5   ? 33.596 -13.013 3.521   1.00 37.41  ? 5    DT  P P     1 
ATOM   3735 O  OP1   . DT  C 3 5   ? 33.479 -14.304 4.231   1.00 35.91  ? 5    DT  P OP1   1 
ATOM   3736 O  OP2   . DT  C 3 5   ? 33.152 -11.757 4.154   1.00 30.12  ? 5    DT  P OP2   1 
ATOM   3737 O  "O5'" . DT  C 3 5   ? 35.125 -12.775 3.126   1.00 34.76  ? 5    DT  P "O5'" 1 
ATOM   3738 C  "C5'" . DT  C 3 5   ? 35.736 -13.633 2.201   1.00 22.59  ? 5    DT  P "C5'" 1 
ATOM   3739 C  "C4'" . DT  C 3 5   ? 37.154 -13.179 1.905   1.00 18.00  ? 5    DT  P "C4'" 1 
ATOM   3740 O  "O4'" . DT  C 3 5   ? 37.147 -12.126 0.915   1.00 21.03  ? 5    DT  P "O4'" 1 
ATOM   3741 C  "C3'" . DT  C 3 5   ? 37.938 -12.648 3.099   1.00 22.62  ? 5    DT  P "C3'" 1 
ATOM   3742 O  "O3'" . DT  C 3 5   ? 39.166 -13.351 3.163   1.00 19.94  ? 5    DT  P "O3'" 1 
ATOM   3743 C  "C2'" . DT  C 3 5   ? 38.141 -11.153 2.778   1.00 16.81  ? 5    DT  P "C2'" 1 
ATOM   3744 C  "C1'" . DT  C 3 5   ? 38.111 -11.159 1.263   1.00 17.22  ? 5    DT  P "C1'" 1 
ATOM   3745 N  N1    . DT  C 3 5   ? 37.687 -9.880  0.647   1.00 18.04  ? 5    DT  P N1    1 
ATOM   3746 C  C2    . DT  C 3 5   ? 38.481 -9.306  -0.318  1.00 17.35  ? 5    DT  P C2    1 
ATOM   3747 O  O2    . DT  C 3 5   ? 39.543 -9.774  -0.674  1.00 20.58  ? 5    DT  P O2    1 
ATOM   3748 N  N3    . DT  C 3 5   ? 37.984 -8.152  -0.860  1.00 19.30  ? 5    DT  P N3    1 
ATOM   3749 C  C4    . DT  C 3 5   ? 36.799 -7.529  -0.549  1.00 19.54  ? 5    DT  P C4    1 
ATOM   3750 O  O4    . DT  C 3 5   ? 36.445 -6.485  -1.096  1.00 19.74  ? 5    DT  P O4    1 
ATOM   3751 C  C5    . DT  C 3 5   ? 36.005 -8.180  0.464   1.00 20.42  ? 5    DT  P C5    1 
ATOM   3752 C  C7    . DT  C 3 5   ? 34.696 -7.588  0.888   1.00 27.84  ? 5    DT  P C7    1 
ATOM   3753 C  C6    . DT  C 3 5   ? 36.475 -9.324  1.003   1.00 20.24  ? 5    DT  P C6    1 
ATOM   3754 P  P     . DC  C 3 6   ? 40.116 -13.231 4.450   1.00 18.05  ? 6    DC  P P     1 
ATOM   3755 O  OP1   . DC  C 3 6   ? 40.849 -14.526 4.512   1.00 15.99  ? 6    DC  P OP1   1 
ATOM   3756 O  OP2   . DC  C 3 6   ? 39.345 -12.736 5.623   1.00 17.69  ? 6    DC  P OP2   1 
ATOM   3757 O  "O5'" . DC  C 3 6   ? 41.143 -12.084 4.035   1.00 16.19  ? 6    DC  P "O5'" 1 
ATOM   3758 C  "C5'" . DC  C 3 6   ? 42.008 -12.305 2.950   1.00 14.25  ? 6    DC  P "C5'" 1 
ATOM   3759 C  "C4'" . DC  C 3 6   ? 42.745 -11.033 2.625   1.00 16.97  ? 6    DC  P "C4'" 1 
ATOM   3760 O  "O4'" . DC  C 3 6   ? 41.845 -10.116 1.977   1.00 17.52  ? 6    DC  P "O4'" 1 
ATOM   3761 C  "C3'" . DC  C 3 6   ? 43.305 -10.299 3.842   1.00 13.94  ? 6    DC  P "C3'" 1 
ATOM   3762 O  "O3'" . DC  C 3 6   ? 44.735 -10.477 3.845   1.00 14.29  ? 6    DC  P "O3'" 1 
ATOM   3763 C  "C2'" . DC  C 3 6   ? 42.872 -8.828  3.632   1.00 13.49  ? 6    DC  P "C2'" 1 
ATOM   3764 C  "C1'" . DC  C 3 6   ? 42.315 -8.823  2.202   1.00 14.68  ? 6    DC  P "C1'" 1 
ATOM   3765 N  N1    . DC  C 3 6   ? 41.188 -7.860  1.981   1.00 13.54  ? 6    DC  P N1    1 
ATOM   3766 C  C2    . DC  C 3 6   ? 41.270 -6.940  0.924   1.00 16.34  ? 6    DC  P C2    1 
ATOM   3767 O  O2    . DC  C 3 6   ? 42.271 -6.947  0.196   1.00 16.32  ? 6    DC  P O2    1 
ATOM   3768 N  N3    . DC  C 3 6   ? 40.247 -6.079  0.723   1.00 19.78  ? 6    DC  P N3    1 
ATOM   3769 C  C4    . DC  C 3 6   ? 39.182 -6.100  1.525   1.00 22.94  ? 6    DC  P C4    1 
ATOM   3770 N  N4    . DC  C 3 6   ? 38.203 -5.215  1.283   1.00 23.09  ? 6    DC  P N4    1 
ATOM   3771 C  C5    . DC  C 3 6   ? 39.069 -7.027  2.606   1.00 15.58  ? 6    DC  P C5    1 
ATOM   3772 C  C6    . DC  C 3 6   ? 40.086 -7.886  2.796   1.00 16.19  ? 6    DC  P C6    1 
ATOM   3773 P  P     . DA  C 3 7   ? 45.704 -9.669  4.828   1.00 15.85  ? 7    DA  P P     1 
ATOM   3774 O  OP1   . DA  C 3 7   ? 46.950 -10.490 4.950   1.00 16.10  ? 7    DA  P OP1   1 
ATOM   3775 O  OP2   . DA  C 3 7   ? 44.977 -9.284  6.056   1.00 16.56  ? 7    DA  P OP2   1 
ATOM   3776 O  "O5'" . DA  C 3 7   ? 45.990 -8.316  4.038   1.00 17.28  ? 7    DA  P "O5'" 1 
ATOM   3777 C  "C5'" . DA  C 3 7   ? 46.498 -8.372  2.714   1.00 17.07  ? 7    DA  P "C5'" 1 
ATOM   3778 C  "C4'" . DA  C 3 7   ? 46.496 -6.987  2.102   1.00 15.75  ? 7    DA  P "C4'" 1 
ATOM   3779 O  "O4'" . DA  C 3 7   ? 45.134 -6.604  1.828   1.00 18.58  ? 7    DA  P "O4'" 1 
ATOM   3780 C  "C3'" . DA  C 3 7   ? 47.002 -5.896  3.038   1.00 22.27  ? 7    DA  P "C3'" 1 
ATOM   3781 O  "O3'" . DA  C 3 7   ? 48.409 -5.693  2.913   1.00 45.63  ? 7    DA  P "O3'" 1 
ATOM   3782 C  "C2'" . DA  C 3 7   ? 46.234 -4.651  2.602   1.00 23.22  ? 7    DA  P "C2'" 1 
ATOM   3783 C  "C1'" . DA  C 3 7   ? 45.069 -5.195  1.794   1.00 19.06  ? 7    DA  P "C1'" 1 
ATOM   3784 N  N9    . DA  C 3 7   ? 43.781 -4.750  2.291   1.00 15.75  ? 7    DA  P N9    1 
ATOM   3785 C  C8    . DA  C 3 7   ? 43.010 -5.319  3.272   1.00 18.79  ? 7    DA  P C8    1 
ATOM   3786 N  N7    . DA  C 3 7   ? 41.876 -4.681  3.488   1.00 20.40  ? 7    DA  P N7    1 
ATOM   3787 C  C5    . DA  C 3 7   ? 41.915 -3.624  2.587   1.00 17.84  ? 7    DA  P C5    1 
ATOM   3788 C  C6    . DA  C 3 7   ? 41.021 -2.569  2.319   1.00 18.14  ? 7    DA  P C6    1 
ATOM   3789 N  N6    . DA  C 3 7   ? 39.854 -2.413  2.959   1.00 24.99  ? 7    DA  P N6    1 
ATOM   3790 N  N1    . DA  C 3 7   ? 41.379 -1.673  1.372   1.00 16.04  ? 7    DA  P N1    1 
ATOM   3791 C  C2    . DA  C 3 7   ? 42.551 -1.832  0.742   1.00 20.92  ? 7    DA  P C2    1 
ATOM   3792 N  N3    . DA  C 3 7   ? 43.473 -2.784  0.912   1.00 14.98  ? 7    DA  P N3    1 
ATOM   3793 C  C4    . DA  C 3 7   ? 43.087 -3.650  1.854   1.00 15.45  ? 7    DA  P C4    1 
ATOM   3794 P  P     A DT  C 3 8   ? 49.168 -4.773  3.992   0.85 51.33  ? 8    DT  P P     1 
ATOM   3795 P  P     B DT  C 3 8   ? 49.174 -4.727  3.951   0.15 46.68  ? 8    DT  P P     1 
ATOM   3796 O  OP1   A DT  C 3 8   ? 50.590 -5.178  4.058   0.85 50.71  ? 8    DT  P OP1   1 
ATOM   3797 O  OP1   B DT  C 3 8   ? 50.629 -4.936  3.795   0.15 49.22  ? 8    DT  P OP1   1 
ATOM   3798 O  OP2   A DT  C 3 8   ? 48.329 -4.731  5.217   0.85 46.87  ? 8    DT  P OP2   1 
ATOM   3799 O  OP2   B DT  C 3 8   ? 48.540 -4.900  5.277   0.15 47.49  ? 8    DT  P OP2   1 
ATOM   3800 O  "O5'" A DT  C 3 8   ? 49.067 -3.305  3.388   0.85 31.04  ? 8    DT  P "O5'" 1 
ATOM   3801 O  "O5'" B DT  C 3 8   ? 48.809 -3.244  3.466   0.15 29.53  ? 8    DT  P "O5'" 1 
ATOM   3802 C  "C5'" A DT  C 3 8   ? 49.263 -3.058  2.000   0.85 22.79  ? 8    DT  P "C5'" 1 
ATOM   3803 C  "C5'" B DT  C 3 8   ? 49.239 -2.765  2.193   0.15 23.27  ? 8    DT  P "C5'" 1 
ATOM   3804 C  "C4'" A DT  C 3 8   ? 48.906 -1.615  1.742   0.85 16.00  ? 8    DT  P "C4'" 1 
ATOM   3805 C  "C4'" B DT  C 3 8   ? 48.763 -1.339  1.991   0.15 16.82  ? 8    DT  P "C4'" 1 
ATOM   3806 O  "O4'" A DT  C 3 8   ? 47.467 -1.481  1.867   0.85 14.87  ? 8    DT  P "O4'" 1 
ATOM   3807 O  "O4'" B DT  C 3 8   ? 47.322 -1.334  1.920   0.15 15.44  ? 8    DT  P "O4'" 1 
ATOM   3808 C  "C3'" A DT  C 3 8   ? 49.513 -0.670  2.793   0.85 15.60  ? 8    DT  P "C3'" 1 
ATOM   3809 C  "C3'" B DT  C 3 8   ? 49.122 -0.396  3.141   0.15 15.64  ? 8    DT  P "C3'" 1 
ATOM   3810 O  "O3'" A DT  C 3 8   ? 50.228 0.394   2.181   0.85 11.16  ? 8    DT  P "O3'" 1 
ATOM   3811 O  "O3'" B DT  C 3 8   ? 50.187 0.485   2.774   0.15 12.71  ? 8    DT  P "O3'" 1 
ATOM   3812 C  "C2'" A DT  C 3 8   ? 48.302 -0.169  3.606   0.85 14.35  ? 8    DT  P "C2'" 1 
ATOM   3813 C  "C2'" B DT  C 3 8   ? 47.834 0.383   3.444   0.15 15.30  ? 8    DT  P "C2'" 1 
ATOM   3814 C  "C1'" A DT  C 3 8   ? 47.164 -0.318  2.615   0.85 15.23  ? 8    DT  P "C1'" 1 
ATOM   3815 C  "C1'" B DT  C 3 8   ? 46.841 -0.099  2.393   0.15 15.08  ? 8    DT  P "C1'" 1 
ATOM   3816 N  N1    A DT  C 3 8   ? 45.820 -0.489  3.270   0.85 12.81  ? 8    DT  P N1    1 
ATOM   3817 N  N1    B DT  C 3 8   ? 45.482 -0.300  2.960   0.15 15.27  ? 8    DT  P N1    1 
ATOM   3818 C  C2    A DT  C 3 8   ? 44.799 0.398   2.979   0.85 15.58  ? 8    DT  P C2    1 
ATOM   3819 C  C2    B DT  C 3 8   ? 44.445 0.501   2.539   0.15 16.21  ? 8    DT  P C2    1 
ATOM   3820 O  O2    A DT  C 3 8   ? 44.917 1.316   2.192   0.85 18.88  ? 8    DT  P O2    1 
ATOM   3821 O  O2    B DT  C 3 8   ? 44.568 1.362   1.686   0.15 18.02  ? 8    DT  P O2    1 
ATOM   3822 N  N3    A DT  C 3 8   ? 43.626 0.160   3.640   0.85 16.29  ? 8    DT  P N3    1 
ATOM   3823 N  N3    B DT  C 3 8   ? 43.244 0.244   3.145   0.15 18.25  ? 8    DT  P N3    1 
ATOM   3824 C  C4    A DT  C 3 8   ? 43.371 -0.843  4.552   0.85 16.19  ? 8    DT  P C4    1 
ATOM   3825 C  C4    B DT  C 3 8   ? 42.985 -0.703  4.119   0.15 17.19  ? 8    DT  P C4    1 
ATOM   3826 O  O4    A DT  C 3 8   ? 42.276 -0.973  5.107   0.85 19.99  ? 8    DT  P O4    1 
ATOM   3827 O  O4    B DT  C 3 8   ? 41.869 -0.857  4.606   0.15 20.51  ? 8    DT  P O4    1 
ATOM   3828 C  C5    A DT  C 3 8   ? 44.478 -1.722  4.819   0.85 15.58  ? 8    DT  P C5    1 
ATOM   3829 C  C5    B DT  C 3 8   ? 44.120 -1.497  4.523   0.15 16.32  ? 8    DT  P C5    1 
ATOM   3830 C  C7    A DT  C 3 8   ? 44.320 -2.853  5.794   0.85 22.29  ? 8    DT  P C7    1 
ATOM   3831 C  C7    B DT  C 3 8   ? 43.964 -2.557  5.573   0.15 20.47  ? 8    DT  P C7    1 
ATOM   3832 C  C6    A DT  C 3 8   ? 45.633 -1.506  4.173   0.85 16.48  ? 8    DT  P C6    1 
ATOM   3833 C  C6    B DT  C 3 8   ? 45.299 -1.255  3.936   0.15 15.78  ? 8    DT  P C6    1 
ATOM   3834 P  P     B DA  C 3 9   ? 50.885 1.394   3.903   0.15 12.90  ? 9    DA  P P     1 
ATOM   3835 O  OP1   B DA  C 3 9   ? 52.319 1.552   3.567   0.15 11.16  ? 9    DA  P OP1   1 
ATOM   3836 O  OP2   B DA  C 3 9   ? 50.503 0.816   5.212   0.15 14.11  ? 9    DA  P OP2   1 
ATOM   3837 O  "O5'" B DA  C 3 9   ? 50.136 2.806   3.793   0.15 11.81  ? 9    DA  P "O5'" 1 
ATOM   3838 C  "C5'" B DA  C 3 9   ? 50.761 3.906   3.130   0.15 12.08  ? 9    DA  P "C5'" 1 
ATOM   3839 C  "C4'" B DA  C 3 9   ? 49.877 5.142   3.178   0.15 9.55   ? 9    DA  P "C4'" 1 
ATOM   3840 O  "O4'" B DA  C 3 9   ? 48.530 4.785   2.773   0.15 11.61  ? 9    DA  P "O4'" 1 
ATOM   3841 C  "C3'" B DA  C 3 9   ? 49.722 5.774   4.555   0.15 10.66  ? 9    DA  P "C3'" 1 
ATOM   3842 O  "O3'" B DA  C 3 9   ? 50.770 6.715   4.786   0.15 11.07  ? 9    DA  P "O3'" 1 
ATOM   3843 C  "C2'" B DA  C 3 9   ? 48.366 6.463   4.437   0.15 11.78  ? 9    DA  P "C2'" 1 
ATOM   3844 C  "C1'" B DA  C 3 9   ? 47.584 5.475   3.571   0.15 12.76  ? 9    DA  P "C1'" 1 
ATOM   3845 N  N9    B DA  C 3 9   ? 46.820 4.493   4.340   0.15 11.76  ? 9    DA  P N9    1 
ATOM   3846 C  C8    B DA  C 3 9   ? 47.296 3.355   4.929   0.15 13.28  ? 9    DA  P C8    1 
ATOM   3847 N  N7    B DA  C 3 9   ? 46.378 2.658   5.555   0.15 14.26  ? 9    DA  P N7    1 
ATOM   3848 C  C5    B DA  C 3 9   ? 45.217 3.388   5.361   0.15 13.61  ? 9    DA  P C5    1 
ATOM   3849 C  C6    B DA  C 3 9   ? 43.887 3.183   5.776   0.15 14.05  ? 9    DA  P C6    1 
ATOM   3850 N  N6    B DA  C 3 9   ? 43.496 2.131   6.502   0.15 16.03  ? 9    DA  P N6    1 
ATOM   3851 N  N1    B DA  C 3 9   ? 42.970 4.106   5.414   0.15 14.14  ? 9    DA  P N1    1 
ATOM   3852 C  C2    B DA  C 3 9   ? 43.365 5.157   4.687   0.15 11.54  ? 9    DA  P C2    1 
ATOM   3853 N  N3    B DA  C 3 9   ? 44.584 5.456   4.238   0.15 12.57  ? 9    DA  P N3    1 
ATOM   3854 C  C4    B DA  C 3 9   ? 45.472 4.522   4.614   0.15 11.93  ? 9    DA  P C4    1 
HETATM 3855 MN MN    . MN  D 4 .   ? 52.584 0.249   2.124   1.00 10.08  ? 501  MN  A MN    1 
HETATM 3856 MN MN    B MN  E 4 .   ? 54.634 2.621   3.851   1.00 10.31  ? 502  MN  A MN    1 
HETATM 3857 C  C1    . GOL F 5 .   ? 60.291 -24.934 12.135  1.00 20.87  ? 503  GOL A C1    1 
HETATM 3858 O  O1    . GOL F 5 .   ? 58.946 -24.641 12.400  1.00 16.76  ? 503  GOL A O1    1 
HETATM 3859 C  C2    . GOL F 5 .   ? 60.793 -24.374 10.798  1.00 24.25  ? 503  GOL A C2    1 
HETATM 3860 O  O2    . GOL F 5 .   ? 60.337 -23.063 10.581  1.00 18.98  ? 503  GOL A O2    1 
HETATM 3861 C  C3    . GOL F 5 .   ? 60.429 -25.286 9.628   1.00 28.11  ? 503  GOL A C3    1 
HETATM 3862 O  O3    . GOL F 5 .   ? 61.283 -25.029 8.527   1.00 20.24  ? 503  GOL A O3    1 
HETATM 3863 C  C1    . GOL G 5 .   ? 53.731 16.533  -7.059  1.00 32.61  ? 504  GOL A C1    1 
HETATM 3864 O  O1    . GOL G 5 .   ? 53.584 15.202  -6.618  1.00 18.50  ? 504  GOL A O1    1 
HETATM 3865 C  C2    . GOL G 5 .   ? 54.318 16.505  -8.464  1.00 34.72  ? 504  GOL A C2    1 
HETATM 3866 O  O2    . GOL G 5 .   ? 53.304 16.135  -9.372  1.00 29.88  ? 504  GOL A O2    1 
HETATM 3867 C  C3    . GOL G 5 .   ? 54.869 17.881  -8.823  1.00 36.58  ? 504  GOL A C3    1 
HETATM 3868 O  O3    . GOL G 5 .   ? 55.368 17.842  -10.142 1.00 43.11  ? 504  GOL A O3    1 
HETATM 3869 C  C1    . GOL H 5 .   ? 53.733 28.264  4.679   1.00 36.40  ? 505  GOL A C1    1 
HETATM 3870 O  O1    . GOL H 5 .   ? 52.489 27.804  4.187   1.00 26.28  ? 505  GOL A O1    1 
HETATM 3871 C  C2    . GOL H 5 .   ? 54.263 27.311  5.746   1.00 48.11  ? 505  GOL A C2    1 
HETATM 3872 O  O2    . GOL H 5 .   ? 53.487 26.130  5.773   1.00 47.72  ? 505  GOL A O2    1 
HETATM 3873 C  C3    . GOL H 5 .   ? 55.727 26.974  5.473   1.00 37.83  ? 505  GOL A C3    1 
HETATM 3874 O  O3    . GOL H 5 .   ? 56.257 26.176  6.519   1.00 27.14  ? 505  GOL A O3    1 
HETATM 3875 P  PG    A DTP I 6 .   ? 55.139 2.605   7.196   0.85 11.90  ? 506  DTP A PG    1 
HETATM 3876 O  O1G   A DTP I 6 .   ? 54.991 1.931   5.849   0.85 11.20  ? 506  DTP A O1G   1 
HETATM 3877 O  O2G   A DTP I 6 .   ? 56.490 3.274   7.354   0.85 11.69  ? 506  DTP A O2G   1 
HETATM 3878 O  O3G   A DTP I 6 .   ? 54.816 1.670   8.351   0.85 11.75  ? 506  DTP A O3G   1 
HETATM 3879 P  PB    A DTP I 6 .   ? 52.935 4.078   6.099   0.85 10.84  ? 506  DTP A PB    1 
HETATM 3880 O  O1B   A DTP I 6 .   ? 53.628 4.297   4.761   0.85 9.74   ? 506  DTP A O1B   1 
HETATM 3881 O  O2B   A DTP I 6 .   ? 52.145 5.300   6.507   0.85 11.13  ? 506  DTP A O2B   1 
HETATM 3882 O  O3B   A DTP I 6 .   ? 54.018 3.765   7.260   0.85 9.98   ? 506  DTP A O3B   1 
HETATM 3883 P  PA    A DTP I 6 .   ? 51.464 2.018   4.824   0.85 10.41  ? 506  DTP A PA    1 
HETATM 3884 O  O1A   A DTP I 6 .   ? 52.588 1.538   3.923   0.85 10.87  ? 506  DTP A O1A   1 
HETATM 3885 O  O2A   A DTP I 6 .   ? 50.687 0.858   5.421   0.85 14.25  ? 506  DTP A O2A   1 
HETATM 3886 O  O3A   A DTP I 6 .   ? 51.976 2.820   6.077   0.85 11.60  ? 506  DTP A O3A   1 
HETATM 3887 O  "O5'" A DTP I 6 .   ? 50.443 2.920   4.036   0.85 11.00  ? 506  DTP A "O5'" 1 
HETATM 3888 C  "C5'" A DTP I 6 .   ? 50.872 3.925   3.156   0.85 13.04  ? 506  DTP A "C5'" 1 
HETATM 3889 C  "C4'" A DTP I 6 .   ? 49.910 5.110   3.145   0.85 9.60   ? 506  DTP A "C4'" 1 
HETATM 3890 O  "O4'" A DTP I 6 .   ? 48.629 4.668   2.735   0.85 11.85  ? 506  DTP A "O4'" 1 
HETATM 3891 C  "C3'" A DTP I 6 .   ? 49.764 5.729   4.455   0.85 10.52  ? 506  DTP A "C3'" 1 
HETATM 3892 O  "O3'" A DTP I 6 .   ? 50.736 6.766   4.659   0.85 11.74  ? 506  DTP A "O3'" 1 
HETATM 3893 C  "C2'" A DTP I 6 .   ? 48.400 6.258   4.471   0.85 12.03  ? 506  DTP A "C2'" 1 
HETATM 3894 C  "C1'" A DTP I 6 .   ? 47.661 5.330   3.570   0.85 13.18  ? 506  DTP A "C1'" 1 
HETATM 3895 N  N9    A DTP I 6 .   ? 46.917 4.360   4.284   0.85 11.44  ? 506  DTP A N9    1 
HETATM 3896 C  C8    A DTP I 6 .   ? 47.376 3.186   4.770   0.85 13.00  ? 506  DTP A C8    1 
HETATM 3897 N  N7    A DTP I 6 .   ? 46.395 2.535   5.379   0.85 14.24  ? 506  DTP A N7    1 
HETATM 3898 C  C5    A DTP I 6 .   ? 45.262 3.244   5.283   0.85 13.45  ? 506  DTP A C5    1 
HETATM 3899 C  C6    A DTP I 6 .   ? 43.946 3.079   5.714   0.85 13.85  ? 506  DTP A C6    1 
HETATM 3900 N  N6    A DTP I 6 .   ? 43.565 1.906   6.432   0.85 15.58  ? 506  DTP A N6    1 
HETATM 3901 N  N1    A DTP I 6 .   ? 43.040 4.016   5.454   0.85 14.27  ? 506  DTP A N1    1 
HETATM 3902 C  C2    A DTP I 6 .   ? 43.350 5.138   4.776   0.85 11.41  ? 506  DTP A C2    1 
HETATM 3903 N  N3    A DTP I 6 .   ? 44.628 5.338   4.342   0.85 12.68  ? 506  DTP A N3    1 
HETATM 3904 C  C4    A DTP I 6 .   ? 45.576 4.422   4.587   0.85 11.58  ? 506  DTP A C4    1 
HETATM 3905 P  P1    B DPO J 7 .   ? 52.945 4.152   6.345   0.15 11.20  ? 507  DPO A P1    1 
HETATM 3906 O  O1    B DPO J 7 .   ? 53.702 4.409   5.063   0.15 10.42  ? 507  DPO A O1    1 
HETATM 3907 O  O2    B DPO J 7 .   ? 51.938 3.051   6.151   0.15 11.90  ? 507  DPO A O2    1 
HETATM 3908 O  O3    B DPO J 7 .   ? 52.220 5.406   6.769   0.15 11.17  ? 507  DPO A O3    1 
HETATM 3909 O  O4    B DPO J 7 .   ? 53.932 3.717   7.473   0.15 10.58  ? 507  DPO A O4    1 
HETATM 3910 P  P2    B DPO J 7 .   ? 54.962 2.563   7.242   0.15 12.03  ? 507  DPO A P2    1 
HETATM 3911 O  O5    B DPO J 7 .   ? 54.732 1.936   5.887   0.15 11.23  ? 507  DPO A O5    1 
HETATM 3912 O  O6    B DPO J 7 .   ? 54.782 1.527   8.325   0.15 12.11  ? 507  DPO A O6    1 
HETATM 3913 O  O7    B DPO J 7 .   ? 56.356 3.136   7.311   0.15 11.77  ? 507  DPO A O7    1 
HETATM 3914 MN MN    B MN  K 4 .   ? 51.049 0.937   7.152   0.15 17.30  ? 101  MN  P MN    1 
HETATM 3915 O  O     . HOH L 8 .   ? 57.232 12.037  -11.982 1.00 31.75  ? 601  HOH A O     1 
HETATM 3916 O  O     . HOH L 8 .   ? 76.146 0.622   -6.221  1.00 31.95  ? 602  HOH A O     1 
HETATM 3917 O  O     . HOH L 8 .   ? 28.258 9.947   -27.289 1.00 40.85  ? 603  HOH A O     1 
HETATM 3918 O  O     . HOH L 8 .   ? 36.480 -24.237 17.557  1.00 14.31  ? 604  HOH A O     1 
HETATM 3919 O  O     . HOH L 8 .   ? 65.273 -25.354 -0.315  1.00 18.84  ? 605  HOH A O     1 
HETATM 3920 O  O     . HOH L 8 .   ? 13.772 11.516  5.156   1.00 51.95  ? 606  HOH A O     1 
HETATM 3921 O  O     . HOH L 8 .   ? 50.347 28.273  4.983   1.00 39.26  ? 607  HOH A O     1 
HETATM 3922 O  O     . HOH L 8 .   ? 37.230 15.066  -20.343 1.00 40.34  ? 608  HOH A O     1 
HETATM 3923 O  O     . HOH L 8 .   ? 53.026 24.294  4.331   1.00 31.76  ? 609  HOH A O     1 
HETATM 3924 O  O     . HOH L 8 .   ? 50.744 -11.841 -10.045 1.00 28.82  ? 610  HOH A O     1 
HETATM 3925 O  O     . HOH L 8 .   ? 32.745 10.624  5.465   1.00 23.34  ? 611  HOH A O     1 
HETATM 3926 O  O     . HOH L 8 .   ? 36.980 17.345  -6.477  1.00 31.53  ? 612  HOH A O     1 
HETATM 3927 O  O     . HOH L 8 .   ? 46.904 -0.567  -8.573  1.00 24.83  ? 613  HOH A O     1 
HETATM 3928 O  O     . HOH L 8 .   ? 63.967 -24.356 -7.575  1.00 49.19  ? 614  HOH A O     1 
HETATM 3929 O  O     . HOH L 8 .   ? 43.241 9.654   -9.883  1.00 19.43  ? 615  HOH A O     1 
HETATM 3930 O  O     . HOH L 8 .   ? 39.342 22.967  16.929  1.00 27.20  ? 616  HOH A O     1 
HETATM 3931 O  O     . HOH L 8 .   ? 64.934 -34.695 -6.146  1.00 45.49  ? 617  HOH A O     1 
HETATM 3932 O  O     . HOH L 8 .   ? 47.878 -36.654 2.663   1.00 23.83  ? 618  HOH A O     1 
HETATM 3933 O  O     . HOH L 8 .   ? 65.483 -32.165 -12.283 1.00 50.28  ? 619  HOH A O     1 
HETATM 3934 O  O     . HOH L 8 .   ? 47.723 -33.235 -3.406  1.00 27.85  ? 620  HOH A O     1 
HETATM 3935 O  O     . HOH L 8 .   ? 67.849 -15.865 -7.655  1.00 25.11  ? 621  HOH A O     1 
HETATM 3936 O  O     . HOH L 8 .   ? 56.940 -34.714 8.701   1.00 29.21  ? 622  HOH A O     1 
HETATM 3937 O  O     . HOH L 8 .   ? 31.639 -1.437  -2.709  1.00 34.04  ? 623  HOH A O     1 
HETATM 3938 O  O     . HOH L 8 .   ? 65.346 -6.814  -13.843 1.00 19.72  ? 624  HOH A O     1 
HETATM 3939 O  O     . HOH L 8 .   ? 60.834 20.641  12.148  1.00 30.61  ? 625  HOH A O     1 
HETATM 3940 O  O     . HOH L 8 .   ? 45.112 17.901  -3.606  1.00 29.77  ? 626  HOH A O     1 
HETATM 3941 O  O     A HOH L 8 .   ? 48.168 0.257   9.692   0.62 28.28  ? 627  HOH A O     1 
HETATM 3942 O  O     . HOH L 8 .   ? 67.236 1.579   11.838  1.00 56.79  ? 628  HOH A O     1 
HETATM 3943 O  O     . HOH L 8 .   ? 64.828 -9.361  12.128  1.00 35.70  ? 629  HOH A O     1 
HETATM 3944 O  O     . HOH L 8 .   ? 34.558 -0.940  -7.074  1.00 70.69  ? 630  HOH A O     1 
HETATM 3945 O  O     . HOH L 8 .   ? 34.072 5.910   -21.814 1.00 30.44  ? 631  HOH A O     1 
HETATM 3946 O  O     . HOH L 8 .   ? 55.697 -0.671  9.165   1.00 28.74  ? 632  HOH A O     1 
HETATM 3947 O  O     . HOH L 8 .   ? 51.576 17.974  -9.583  1.00 30.98  ? 633  HOH A O     1 
HETATM 3948 O  O     . HOH L 8 .   ? 50.741 -35.256 7.925   1.00 37.12  ? 634  HOH A O     1 
HETATM 3949 O  O     . HOH L 8 .   ? 50.508 17.529  -5.837  1.00 27.22  ? 635  HOH A O     1 
HETATM 3950 O  O     . HOH L 8 .   ? 34.713 17.610  -12.492 1.00 27.10  ? 636  HOH A O     1 
HETATM 3951 O  O     . HOH L 8 .   ? 60.589 -15.462 13.617  1.00 32.92  ? 637  HOH A O     1 
HETATM 3952 O  O     . HOH L 8 .   ? 41.153 16.972  -14.802 1.00 20.05  ? 638  HOH A O     1 
HETATM 3953 O  O     . HOH L 8 .   ? 66.181 -2.384  12.633  1.00 28.39  ? 639  HOH A O     1 
HETATM 3954 O  O     . HOH L 8 .   ? 65.277 5.832   2.282   1.00 24.08  ? 640  HOH A O     1 
HETATM 3955 O  O     . HOH L 8 .   ? 23.913 16.210  3.224   1.00 27.57  ? 641  HOH A O     1 
HETATM 3956 O  O     . HOH L 8 .   ? 75.255 0.690   -3.488  1.00 29.26  ? 642  HOH A O     1 
HETATM 3957 O  O     . HOH L 8 .   ? 51.720 5.619   9.285   1.00 12.97  ? 643  HOH A O     1 
HETATM 3958 O  O     . HOH L 8 .   ? 33.325 7.480   17.192  1.00 41.79  ? 644  HOH A O     1 
HETATM 3959 O  O     . HOH L 8 .   ? 34.657 5.465   2.050   1.00 18.67  ? 645  HOH A O     1 
HETATM 3960 O  O     . HOH L 8 .   ? 57.002 -16.445 -11.189 1.00 26.67  ? 646  HOH A O     1 
HETATM 3961 O  O     . HOH L 8 .   ? 65.712 13.023  2.856   1.00 36.59  ? 647  HOH A O     1 
HETATM 3962 O  O     . HOH L 8 .   ? 80.219 -15.930 7.672   1.00 34.98  ? 648  HOH A O     1 
HETATM 3963 O  O     . HOH L 8 .   ? 57.560 -23.398 14.215  1.00 12.75  ? 649  HOH A O     1 
HETATM 3964 O  O     . HOH L 8 .   ? 73.195 -20.705 1.035   1.00 27.31  ? 650  HOH A O     1 
HETATM 3965 O  O     . HOH L 8 .   ? 48.150 19.634  4.644   1.00 29.06  ? 651  HOH A O     1 
HETATM 3966 O  O     . HOH L 8 .   ? 53.461 -28.399 4.268   1.00 13.57  ? 652  HOH A O     1 
HETATM 3967 O  O     . HOH L 8 .   ? 52.536 -19.644 22.128  1.00 30.83  ? 653  HOH A O     1 
HETATM 3968 O  O     . HOH L 8 .   ? 42.764 -1.242  -24.923 1.00 22.04  ? 654  HOH A O     1 
HETATM 3969 O  O     . HOH L 8 .   ? 51.969 15.684  -4.617  1.00 15.62  ? 655  HOH A O     1 
HETATM 3970 O  O     B HOH L 8 .   ? 49.111 4.432   7.536   0.15 16.38  ? 656  HOH A O     1 
HETATM 3971 O  O     . HOH L 8 .   ? 38.391 -19.954 12.374  1.00 33.40  ? 657  HOH A O     1 
HETATM 3972 O  O     . HOH L 8 .   ? 61.153 -18.093 -13.182 1.00 44.22  ? 658  HOH A O     1 
HETATM 3973 O  O     . HOH L 8 .   ? 61.529 -31.547 -10.372 1.00 48.37  ? 659  HOH A O     1 
HETATM 3974 O  O     . HOH L 8 .   ? 71.237 0.691   10.653  1.00 50.82  ? 660  HOH A O     1 
HETATM 3975 O  O     . HOH L 8 .   ? 27.619 6.787   -17.026 1.00 25.84  ? 661  HOH A O     1 
HETATM 3976 O  O     . HOH L 8 .   ? 60.229 -28.174 8.571   1.00 31.92  ? 662  HOH A O     1 
HETATM 3977 O  O     . HOH L 8 .   ? 70.276 -17.149 12.407  1.00 26.68  ? 663  HOH A O     1 
HETATM 3978 O  O     . HOH L 8 .   ? 52.618 -26.179 -3.823  1.00 21.32  ? 664  HOH A O     1 
HETATM 3979 O  O     . HOH L 8 .   ? 48.567 13.418  28.307  1.00 29.28  ? 665  HOH A O     1 
HETATM 3980 O  O     . HOH L 8 .   ? 33.499 2.959   3.301   1.00 36.93  ? 666  HOH A O     1 
HETATM 3981 O  O     . HOH L 8 .   ? 52.431 1.200   9.478   1.00 18.69  ? 667  HOH A O     1 
HETATM 3982 O  O     . HOH L 8 .   ? 34.326 19.690  -16.223 1.00 33.26  ? 668  HOH A O     1 
HETATM 3983 O  O     . HOH L 8 .   ? 70.831 3.507   -0.299  1.00 17.33  ? 669  HOH A O     1 
HETATM 3984 O  O     . HOH L 8 .   ? 52.995 19.231  -1.399  1.00 24.38  ? 670  HOH A O     1 
HETATM 3985 O  O     . HOH L 8 .   ? 56.070 -14.022 -5.791  1.00 13.73  ? 671  HOH A O     1 
HETATM 3986 O  O     . HOH L 8 .   ? 37.100 13.354  21.604  1.00 33.67  ? 672  HOH A O     1 
HETATM 3987 O  O     . HOH L 8 .   ? 39.655 6.958   13.572  1.00 31.33  ? 673  HOH A O     1 
HETATM 3988 O  O     . HOH L 8 .   ? 59.468 14.011  -8.675  1.00 19.37  ? 674  HOH A O     1 
HETATM 3989 O  O     . HOH L 8 .   ? 67.305 6.577   0.668   1.00 24.79  ? 675  HOH A O     1 
HETATM 3990 O  O     . HOH L 8 .   ? 36.883 15.982  -4.101  1.00 18.25  ? 676  HOH A O     1 
HETATM 3991 O  O     . HOH L 8 .   ? 46.855 -22.762 17.424  1.00 28.43  ? 677  HOH A O     1 
HETATM 3992 O  O     . HOH L 8 .   ? 44.515 10.617  -24.347 1.00 33.15  ? 678  HOH A O     1 
HETATM 3993 O  O     . HOH L 8 .   ? 50.998 8.682   -15.601 1.00 25.90  ? 679  HOH A O     1 
HETATM 3994 O  O     . HOH L 8 .   ? 50.207 14.079  -19.719 1.00 39.30  ? 680  HOH A O     1 
HETATM 3995 O  O     . HOH L 8 .   ? 57.549 -7.398  8.161   1.00 20.70  ? 681  HOH A O     1 
HETATM 3996 O  O     . HOH L 8 .   ? 77.768 -1.030  5.214   1.00 24.16  ? 682  HOH A O     1 
HETATM 3997 O  O     . HOH L 8 .   ? 69.458 -13.107 -11.558 1.00 26.51  ? 683  HOH A O     1 
HETATM 3998 O  O     . HOH L 8 .   ? 62.885 -26.514 6.988   1.00 22.32  ? 684  HOH A O     1 
HETATM 3999 O  O     . HOH L 8 .   ? 53.151 -28.179 15.372  1.00 17.15  ? 685  HOH A O     1 
HETATM 4000 O  O     . HOH L 8 .   ? 80.809 -4.640  23.006  1.00 46.54  ? 686  HOH A O     1 
HETATM 4001 O  O     . HOH L 8 .   ? 30.631 1.809   -22.101 1.00 32.39  ? 687  HOH A O     1 
HETATM 4002 O  O     . HOH L 8 .   ? 81.002 -10.922 -8.007  1.00 46.56  ? 688  HOH A O     1 
HETATM 4003 O  O     . HOH L 8 .   ? 62.697 12.682  -10.783 1.00 25.56  ? 689  HOH A O     1 
HETATM 4004 O  O     . HOH L 8 .   ? 62.427 -17.085 -7.088  1.00 21.88  ? 690  HOH A O     1 
HETATM 4005 O  O     . HOH L 8 .   ? 49.373 -9.365  -8.293  1.00 23.17  ? 691  HOH A O     1 
HETATM 4006 O  O     . HOH L 8 .   ? 68.193 -1.541  -14.103 1.00 30.80  ? 692  HOH A O     1 
HETATM 4007 O  O     . HOH L 8 .   ? 37.403 7.745   21.649  1.00 34.24  ? 693  HOH A O     1 
HETATM 4008 O  O     . HOH L 8 .   ? 17.564 -3.088  -5.948  1.00 52.24  ? 694  HOH A O     1 
HETATM 4009 O  O     . HOH L 8 .   ? 59.533 12.891  11.430  1.00 23.00  ? 695  HOH A O     1 
HETATM 4010 O  O     . HOH L 8 .   ? 49.499 -15.836 -8.829  1.00 31.66  ? 696  HOH A O     1 
HETATM 4011 O  O     . HOH L 8 .   ? 60.099 6.431   -15.582 1.00 29.62  ? 697  HOH A O     1 
HETATM 4012 O  O     . HOH L 8 .   ? 39.152 -2.131  -14.276 1.00 27.06  ? 698  HOH A O     1 
HETATM 4013 O  O     . HOH L 8 .   ? 51.080 6.208   -18.846 1.00 28.93  ? 699  HOH A O     1 
HETATM 4014 O  O     . HOH L 8 .   ? 35.504 10.850  0.816   1.00 20.27  ? 700  HOH A O     1 
HETATM 4015 O  O     . HOH L 8 .   ? 59.026 4.784   16.796  1.00 19.37  ? 701  HOH A O     1 
HETATM 4016 O  O     . HOH L 8 .   ? 66.203 3.874   10.709  1.00 30.06  ? 702  HOH A O     1 
HETATM 4017 O  O     . HOH L 8 .   ? 56.778 -15.577 18.029  1.00 32.07  ? 703  HOH A O     1 
HETATM 4018 O  O     . HOH L 8 .   ? 50.014 -14.810 -3.328  1.00 38.24  ? 704  HOH A O     1 
HETATM 4019 O  O     . HOH L 8 .   ? 44.292 -32.882 -3.120  1.00 33.09  ? 705  HOH A O     1 
HETATM 4020 O  O     . HOH L 8 .   ? 50.018 -34.854 -0.482  1.00 21.44  ? 706  HOH A O     1 
HETATM 4021 O  O     . HOH L 8 .   ? 72.016 -7.661  11.614  1.00 20.40  ? 707  HOH A O     1 
HETATM 4022 O  O     . HOH L 8 .   ? 55.394 -35.142 11.086  1.00 29.61  ? 708  HOH A O     1 
HETATM 4023 O  O     . HOH L 8 .   ? 60.491 -23.507 6.315   1.00 19.46  ? 709  HOH A O     1 
HETATM 4024 O  O     . HOH L 8 .   ? 40.339 8.734   27.022  1.00 20.41  ? 710  HOH A O     1 
HETATM 4025 O  O     . HOH L 8 .   ? 67.098 -8.295  9.832   1.00 23.52  ? 711  HOH A O     1 
HETATM 4026 O  O     . HOH L 8 .   ? 50.308 -1.705  6.226   1.00 23.84  ? 712  HOH A O     1 
HETATM 4027 O  O     . HOH L 8 .   ? 62.102 14.721  -9.104  1.00 14.49  ? 713  HOH A O     1 
HETATM 4028 O  O     . HOH L 8 .   ? 69.228 9.860   -8.638  1.00 24.18  ? 714  HOH A O     1 
HETATM 4029 O  O     . HOH L 8 .   ? 45.787 1.943   18.720  1.00 39.61  ? 715  HOH A O     1 
HETATM 4030 O  O     . HOH L 8 .   ? 41.444 -30.321 -6.324  1.00 21.27  ? 716  HOH A O     1 
HETATM 4031 O  O     . HOH L 8 .   ? 52.369 -5.423  -0.864  1.00 16.27  ? 717  HOH A O     1 
HETATM 4032 O  O     . HOH L 8 .   ? 65.514 -15.079 11.711  1.00 18.76  ? 718  HOH A O     1 
HETATM 4033 O  O     . HOH L 8 .   ? 40.956 7.705   -18.511 1.00 16.77  ? 719  HOH A O     1 
HETATM 4034 O  O     . HOH L 8 .   ? 52.063 20.097  5.072   1.00 19.45  ? 720  HOH A O     1 
HETATM 4035 O  O     . HOH L 8 .   ? 67.314 -6.385  12.802  1.00 24.02  ? 721  HOH A O     1 
HETATM 4036 O  O     . HOH L 8 .   ? 81.311 -19.086 5.419   1.00 35.02  ? 722  HOH A O     1 
HETATM 4037 O  O     . HOH L 8 .   ? 83.239 -7.853  0.807   1.00 37.24  ? 723  HOH A O     1 
HETATM 4038 O  O     . HOH L 8 .   ? 29.180 3.952   6.546   1.00 37.92  ? 724  HOH A O     1 
HETATM 4039 O  O     . HOH L 8 .   ? 49.679 -3.088  -17.174 1.00 21.53  ? 725  HOH A O     1 
HETATM 4040 O  O     . HOH L 8 .   ? 66.721 -16.567 9.712   1.00 15.24  ? 726  HOH A O     1 
HETATM 4041 O  O     . HOH L 8 .   ? 41.000 6.548   19.096  1.00 20.59  ? 727  HOH A O     1 
HETATM 4042 O  O     . HOH L 8 .   ? 62.917 -19.016 -1.652  1.00 18.20  ? 728  HOH A O     1 
HETATM 4043 O  O     . HOH L 8 .   ? 23.020 14.413  -9.206  1.00 27.55  ? 729  HOH A O     1 
HETATM 4044 O  O     . HOH L 8 .   ? 40.581 16.768  6.458   1.00 24.94  ? 730  HOH A O     1 
HETATM 4045 O  O     . HOH L 8 .   ? 63.684 -9.566  -14.365 1.00 19.42  ? 731  HOH A O     1 
HETATM 4046 O  O     . HOH L 8 .   ? 14.333 14.920  -1.435  1.00 50.00  ? 732  HOH A O     1 
HETATM 4047 O  O     . HOH L 8 .   ? 40.133 -28.582 -9.867  1.00 29.65  ? 733  HOH A O     1 
HETATM 4048 O  O     . HOH L 8 .   ? 51.128 5.109   -10.915 1.00 17.85  ? 734  HOH A O     1 
HETATM 4049 O  O     . HOH L 8 .   ? 63.783 -3.302  6.069   1.00 12.51  ? 735  HOH A O     1 
HETATM 4050 O  O     . HOH L 8 .   ? 53.305 -32.651 -3.114  1.00 40.01  ? 736  HOH A O     1 
HETATM 4051 O  O     . HOH L 8 .   ? 52.444 3.613   18.040  1.00 29.40  ? 737  HOH A O     1 
HETATM 4052 O  O     . HOH L 8 .   ? 34.281 14.745  11.412  1.00 24.96  ? 738  HOH A O     1 
HETATM 4053 O  O     . HOH L 8 .   ? 48.656 2.597   21.203  1.00 24.91  ? 739  HOH A O     1 
HETATM 4054 O  O     . HOH L 8 .   ? 47.554 -27.093 -7.207  1.00 28.96  ? 740  HOH A O     1 
HETATM 4055 O  O     . HOH L 8 .   ? 55.080 -1.406  -14.837 1.00 26.29  ? 741  HOH A O     1 
HETATM 4056 O  O     . HOH L 8 .   ? 36.821 18.470  16.761  1.00 36.82  ? 742  HOH A O     1 
HETATM 4057 O  O     . HOH L 8 .   ? 42.637 13.098  -23.725 1.00 32.03  ? 743  HOH A O     1 
HETATM 4058 O  O     . HOH L 8 .   ? 56.308 1.193   13.278  1.00 28.30  ? 744  HOH A O     1 
HETATM 4059 O  O     . HOH L 8 .   ? 50.853 5.811   -22.893 1.00 40.57  ? 745  HOH A O     1 
HETATM 4060 O  O     . HOH L 8 .   ? 27.034 20.718  -6.606  1.00 31.95  ? 746  HOH A O     1 
HETATM 4061 O  O     . HOH L 8 .   ? 52.259 8.591   25.965  1.00 37.42  ? 747  HOH A O     1 
HETATM 4062 O  O     . HOH L 8 .   ? 63.121 -17.072 15.161  1.00 32.54  ? 748  HOH A O     1 
HETATM 4063 O  O     . HOH L 8 .   ? 49.841 -17.205 15.524  1.00 18.78  ? 749  HOH A O     1 
HETATM 4064 O  O     . HOH L 8 .   ? 43.773 11.007  -12.245 1.00 20.05  ? 750  HOH A O     1 
HETATM 4065 O  O     . HOH L 8 .   ? 45.734 17.745  -9.901  1.00 36.94  ? 751  HOH A O     1 
HETATM 4066 O  O     . HOH L 8 .   ? 67.067 -20.703 8.833   1.00 11.95  ? 752  HOH A O     1 
HETATM 4067 O  O     . HOH L 8 .   ? 42.783 -25.334 17.472  1.00 32.42  ? 753  HOH A O     1 
HETATM 4068 O  O     . HOH L 8 .   ? 53.279 6.040   -12.339 1.00 21.55  ? 754  HOH A O     1 
HETATM 4069 O  O     . HOH L 8 .   ? 55.114 -20.672 21.359  1.00 26.49  ? 755  HOH A O     1 
HETATM 4070 O  O     . HOH L 8 .   ? 71.719 -3.900  -13.908 1.00 26.38  ? 756  HOH A O     1 
HETATM 4071 O  O     . HOH L 8 .   ? 68.423 16.252  -4.004  1.00 14.88  ? 757  HOH A O     1 
HETATM 4072 O  O     . HOH L 8 .   ? 47.198 -16.399 -0.700  1.00 24.22  ? 758  HOH A O     1 
HETATM 4073 O  O     . HOH L 8 .   ? 62.210 7.469   7.131   1.00 14.43  ? 759  HOH A O     1 
HETATM 4074 O  O     . HOH L 8 .   ? 41.870 8.042   3.165   1.00 15.88  ? 760  HOH A O     1 
HETATM 4075 O  O     . HOH L 8 .   ? 70.376 -18.968 1.539   1.00 15.53  ? 761  HOH A O     1 
HETATM 4076 O  O     . HOH L 8 .   ? 68.793 -17.611 -1.256  1.00 12.11  ? 762  HOH A O     1 
HETATM 4077 O  O     . HOH L 8 .   ? 58.686 4.602   23.085  1.00 22.51  ? 763  HOH A O     1 
HETATM 4078 O  O     A HOH L 8 .   ? 54.310 -0.763  5.728   0.80 14.43  ? 764  HOH A O     1 
HETATM 4079 O  O     B HOH L 8 .   ? 52.973 -0.425  6.502   0.20 13.19  ? 764  HOH A O     1 
HETATM 4080 O  O     . HOH L 8 .   ? 44.595 -14.240 10.462  1.00 16.08  ? 765  HOH A O     1 
HETATM 4081 O  O     . HOH L 8 .   ? 55.825 18.607  18.197  1.00 19.68  ? 766  HOH A O     1 
HETATM 4082 O  O     . HOH L 8 .   ? 68.849 8.038   3.998   1.00 35.21  ? 767  HOH A O     1 
HETATM 4083 O  O     . HOH L 8 .   ? 64.395 6.442   -0.313  1.00 24.05  ? 768  HOH A O     1 
HETATM 4084 O  O     . HOH L 8 .   ? 53.763 -9.362  5.337   1.00 19.56  ? 769  HOH A O     1 
HETATM 4085 O  O     . HOH L 8 .   ? 37.773 10.667  21.461  1.00 37.96  ? 770  HOH A O     1 
HETATM 4086 O  O     . HOH L 8 .   ? 55.148 17.406  -0.689  1.00 13.94  ? 771  HOH A O     1 
HETATM 4087 O  O     . HOH L 8 .   ? 62.255 9.280   -13.589 1.00 34.87  ? 772  HOH A O     1 
HETATM 4088 O  O     . HOH L 8 .   ? 46.448 16.280  25.566  1.00 25.96  ? 773  HOH A O     1 
HETATM 4089 O  O     . HOH L 8 .   ? 62.689 -23.707 3.433   1.00 27.25  ? 774  HOH A O     1 
HETATM 4090 O  O     . HOH L 8 .   ? 53.840 15.479  23.336  1.00 34.41  ? 775  HOH A O     1 
HETATM 4091 O  O     . HOH L 8 .   ? 47.134 -18.820 -4.850  1.00 35.00  ? 776  HOH A O     1 
HETATM 4092 O  O     . HOH L 8 .   ? 62.087 11.992  5.499   1.00 26.36  ? 777  HOH A O     1 
HETATM 4093 O  O     . HOH L 8 .   ? 48.280 -22.136 -5.570  1.00 22.81  ? 778  HOH A O     1 
HETATM 4094 O  O     . HOH L 8 .   ? 38.284 -17.970 10.279  1.00 20.23  ? 779  HOH A O     1 
HETATM 4095 O  O     . HOH L 8 .   ? 71.122 6.068   -7.266  1.00 19.08  ? 780  HOH A O     1 
HETATM 4096 O  O     . HOH L 8 .   ? 50.831 5.480   -8.256  1.00 15.89  ? 781  HOH A O     1 
HETATM 4097 O  O     . HOH L 8 .   ? 76.336 2.609   6.596   1.00 29.36  ? 782  HOH A O     1 
HETATM 4098 O  O     . HOH L 8 .   ? 43.001 -33.075 -0.509  1.00 17.19  ? 783  HOH A O     1 
HETATM 4099 O  O     . HOH L 8 .   ? 49.402 -8.936  12.875  1.00 31.81  ? 784  HOH A O     1 
HETATM 4100 O  O     . HOH L 8 .   ? 59.654 11.479  -10.310 1.00 18.52  ? 785  HOH A O     1 
HETATM 4101 O  O     . HOH L 8 .   ? 60.418 13.957  6.390   1.00 24.66  ? 786  HOH A O     1 
HETATM 4102 O  O     . HOH L 8 .   ? 69.723 -8.846  10.579  1.00 31.22  ? 787  HOH A O     1 
HETATM 4103 O  O     . HOH L 8 .   ? 64.857 19.639  6.490   1.00 30.59  ? 788  HOH A O     1 
HETATM 4104 O  O     . HOH L 8 .   ? 62.982 -7.316  12.902  1.00 29.71  ? 789  HOH A O     1 
HETATM 4105 O  O     . HOH L 8 .   ? 45.310 15.718  -1.436  1.00 16.19  ? 790  HOH A O     1 
HETATM 4106 O  O     . HOH L 8 .   ? 40.695 -29.926 12.955  1.00 32.95  ? 791  HOH A O     1 
HETATM 4107 O  O     . HOH L 8 .   ? 65.190 -22.907 3.257   1.00 16.08  ? 792  HOH A O     1 
HETATM 4108 O  O     . HOH L 8 .   ? 45.753 7.159   -12.783 1.00 30.88  ? 793  HOH A O     1 
HETATM 4109 O  O     . HOH L 8 .   ? 65.464 8.662   8.942   1.00 29.35  ? 794  HOH A O     1 
HETATM 4110 O  O     . HOH L 8 .   ? 41.945 -18.788 14.958  1.00 24.27  ? 795  HOH A O     1 
HETATM 4111 O  O     . HOH L 8 .   ? 49.817 2.931   12.754  1.00 22.75  ? 796  HOH A O     1 
HETATM 4112 O  O     . HOH L 8 .   ? 59.015 11.098  8.630   1.00 17.69  ? 797  HOH A O     1 
HETATM 4113 O  O     . HOH L 8 .   ? 42.296 15.464  23.608  1.00 23.51  ? 798  HOH A O     1 
HETATM 4114 O  O     . HOH L 8 .   ? 52.548 -1.274  3.687   1.00 11.71  ? 799  HOH A O     1 
HETATM 4115 O  O     . HOH L 8 .   ? 58.061 -12.192 -11.392 1.00 15.85  ? 800  HOH A O     1 
HETATM 4116 O  O     . HOH L 8 .   ? 70.387 16.110  -5.974  1.00 15.24  ? 801  HOH A O     1 
HETATM 4117 O  O     . HOH L 8 .   ? 43.473 -14.429 5.703   1.00 15.30  ? 802  HOH A O     1 
HETATM 4118 O  O     . HOH L 8 .   ? 53.391 -20.260 -2.456  1.00 17.06  ? 803  HOH A O     1 
HETATM 4119 O  O     . HOH L 8 .   ? 46.477 -0.259  -15.168 1.00 18.83  ? 804  HOH A O     1 
HETATM 4120 O  O     . HOH L 8 .   ? 43.312 12.013  -7.179  1.00 16.77  ? 805  HOH A O     1 
HETATM 4121 O  O     . HOH L 8 .   ? 57.890 -18.004 19.848  1.00 22.69  ? 806  HOH A O     1 
HETATM 4122 O  O     . HOH L 8 .   ? 42.710 -2.684  -20.010 1.00 28.49  ? 807  HOH A O     1 
HETATM 4123 O  O     . HOH L 8 .   ? 61.687 -13.491 -13.512 1.00 29.23  ? 808  HOH A O     1 
HETATM 4124 O  O     . HOH L 8 .   ? 53.232 13.361  -10.036 1.00 19.37  ? 809  HOH A O     1 
HETATM 4125 O  O     . HOH L 8 .   ? 72.904 -7.408  8.960   1.00 14.42  ? 810  HOH A O     1 
HETATM 4126 O  O     . HOH L 8 .   ? 53.170 7.394   -14.674 1.00 25.93  ? 811  HOH A O     1 
HETATM 4127 O  O     . HOH L 8 .   ? 68.833 -13.550 5.038   1.00 11.49  ? 812  HOH A O     1 
HETATM 4128 O  O     . HOH L 8 .   ? 68.943 4.372   3.834   1.00 21.92  ? 813  HOH A O     1 
HETATM 4129 O  O     . HOH L 8 .   ? 83.434 -5.366  2.450   1.00 31.93  ? 814  HOH A O     1 
HETATM 4130 O  O     . HOH L 8 .   ? 46.177 0.149   6.923   1.00 26.63  ? 815  HOH A O     1 
HETATM 4131 O  O     . HOH L 8 .   ? 72.805 2.090   7.978   1.00 28.59  ? 816  HOH A O     1 
HETATM 4132 O  O     . HOH L 8 .   ? 48.609 -34.387 10.199  1.00 29.63  ? 817  HOH A O     1 
HETATM 4133 O  O     . HOH L 8 .   ? 68.824 -10.806 12.034  1.00 23.96  ? 818  HOH A O     1 
HETATM 4134 O  O     . HOH L 8 .   ? 26.005 11.283  13.943  1.00 50.65  ? 819  HOH A O     1 
HETATM 4135 O  O     . HOH L 8 .   ? 45.812 -9.283  10.774  1.00 36.48  ? 820  HOH A O     1 
HETATM 4136 O  O     . HOH L 8 .   ? 41.108 21.423  2.306   1.00 25.10  ? 821  HOH A O     1 
HETATM 4137 O  O     . HOH L 8 .   ? 40.588 22.061  -2.204  1.00 44.83  ? 822  HOH A O     1 
HETATM 4138 O  O     . HOH L 8 .   ? 59.500 10.421  19.985  1.00 19.96  ? 823  HOH A O     1 
HETATM 4139 O  O     . HOH L 8 .   ? 46.362 19.237  1.600   1.00 25.50  ? 824  HOH A O     1 
HETATM 4140 O  O     . HOH L 8 .   ? 60.045 -18.449 -4.550  1.00 14.68  ? 825  HOH A O     1 
HETATM 4141 O  O     . HOH L 8 .   ? 65.097 -22.292 -7.956  1.00 29.97  ? 826  HOH A O     1 
HETATM 4142 O  O     . HOH L 8 .   ? 21.256 13.326  6.559   1.00 49.67  ? 827  HOH A O     1 
HETATM 4143 O  O     . HOH L 8 .   ? 41.230 20.084  4.857   1.00 20.29  ? 828  HOH A O     1 
HETATM 4144 O  O     . HOH L 8 .   ? 56.092 -2.715  4.134   1.00 20.29  ? 829  HOH A O     1 
HETATM 4145 O  O     . HOH L 8 .   ? 57.767 -27.403 11.529  1.00 22.52  ? 830  HOH A O     1 
HETATM 4146 O  O     . HOH L 8 .   ? 52.493 -12.446 -3.975  1.00 31.88  ? 831  HOH A O     1 
HETATM 4147 O  O     . HOH L 8 .   ? 43.718 -14.995 1.413   1.00 18.50  ? 832  HOH A O     1 
HETATM 4148 O  O     . HOH L 8 .   ? 50.134 -12.632 -0.727  1.00 20.74  ? 833  HOH A O     1 
HETATM 4149 O  O     . HOH L 8 .   ? 65.182 3.286   -17.702 1.00 38.57  ? 834  HOH A O     1 
HETATM 4150 O  O     . HOH L 8 .   ? 21.752 11.924  -9.511  1.00 27.99  ? 835  HOH A O     1 
HETATM 4151 O  O     . HOH L 8 .   ? 50.464 -6.595  -5.378  1.00 27.20  ? 836  HOH A O     1 
HETATM 4152 O  O     . HOH L 8 .   ? 69.738 -18.852 -9.601  1.00 38.65  ? 837  HOH A O     1 
HETATM 4153 O  O     . HOH L 8 .   ? 78.894 3.394   1.865   1.00 28.66  ? 838  HOH A O     1 
HETATM 4154 O  O     . HOH L 8 .   ? 44.434 -16.811 -0.318  1.00 27.55  ? 839  HOH A O     1 
HETATM 4155 O  O     . HOH L 8 .   ? 67.756 -14.416 -10.059 1.00 23.90  ? 840  HOH A O     1 
HETATM 4156 O  O     . HOH L 8 .   ? 48.567 -9.422  10.628  1.00 23.90  ? 841  HOH A O     1 
HETATM 4157 O  O     . HOH L 8 .   ? 63.099 -11.609 12.750  1.00 39.30  ? 842  HOH A O     1 
HETATM 4158 O  O     . HOH L 8 .   ? 41.033 -23.807 -4.982  1.00 21.11  ? 843  HOH A O     1 
HETATM 4159 O  O     . HOH L 8 .   ? 65.268 -4.351  -15.360 1.00 28.81  ? 844  HOH A O     1 
HETATM 4160 O  O     . HOH L 8 .   ? 42.730 20.026  -11.566 1.00 37.39  ? 845  HOH A O     1 
HETATM 4161 O  O     . HOH L 8 .   ? 50.754 -8.797  -5.045  1.00 24.69  ? 846  HOH A O     1 
HETATM 4162 O  O     . HOH L 8 .   ? 55.046 -32.772 5.014   1.00 30.28  ? 847  HOH A O     1 
HETATM 4163 O  O     . HOH L 8 .   ? 40.346 -18.345 0.730   1.00 30.54  ? 848  HOH A O     1 
HETATM 4164 O  O     . HOH L 8 .   ? 47.051 2.278   -0.997  1.00 17.80  ? 849  HOH A O     1 
HETATM 4165 O  O     . HOH L 8 .   ? 61.282 14.553  8.877   1.00 28.79  ? 850  HOH A O     1 
HETATM 4166 O  O     . HOH L 8 .   ? 59.711 14.431  3.476   1.00 25.94  ? 851  HOH A O     1 
HETATM 4167 O  O     . HOH L 8 .   ? 48.876 7.209   -7.517  1.00 20.21  ? 852  HOH A O     1 
HETATM 4168 O  O     . HOH L 8 .   ? 41.772 -22.326 -2.549  1.00 18.28  ? 853  HOH A O     1 
HETATM 4169 O  O     . HOH L 8 .   ? 82.381 -3.911  -4.472  1.00 32.82  ? 854  HOH A O     1 
HETATM 4170 O  O     . HOH L 8 .   ? 45.954 16.557  1.256   1.00 14.26  ? 855  HOH A O     1 
HETATM 4171 O  O     . HOH L 8 .   ? 52.830 -33.414 -0.155  1.00 23.18  ? 856  HOH A O     1 
HETATM 4172 O  O     . HOH L 8 .   ? 54.319 -11.263 3.474   1.00 13.77  ? 857  HOH A O     1 
HETATM 4173 O  O     . HOH L 8 .   ? 34.988 20.687  0.691   1.00 27.14  ? 858  HOH A O     1 
HETATM 4174 O  O     . HOH L 8 .   ? 53.402 -8.474  8.834   1.00 27.49  ? 859  HOH A O     1 
HETATM 4175 O  O     . HOH L 8 .   ? 46.461 0.637   13.941  1.00 39.55  ? 860  HOH A O     1 
HETATM 4176 O  O     . HOH L 8 .   ? 43.653 -29.106 15.525  1.00 31.90  ? 861  HOH A O     1 
HETATM 4177 O  O     . HOH L 8 .   ? 48.798 -15.515 13.650  1.00 18.72  ? 862  HOH A O     1 
HETATM 4178 O  O     . HOH L 8 .   ? 40.459 -29.285 -2.209  1.00 25.45  ? 863  HOH A O     1 
HETATM 4179 O  O     . HOH L 8 .   ? 35.187 22.422  -3.173  1.00 32.29  ? 864  HOH A O     1 
HETATM 4180 O  O     . HOH L 8 .   ? 36.407 12.792  11.967  1.00 22.00  ? 865  HOH A O     1 
HETATM 4181 O  O     . HOH L 8 .   ? 32.833 2.399   -0.428  1.00 31.68  ? 866  HOH A O     1 
HETATM 4182 O  O     . HOH L 8 .   ? 57.289 23.347  14.301  1.00 28.63  ? 867  HOH A O     1 
HETATM 4183 O  O     . HOH L 8 .   ? 50.911 21.617  7.263   1.00 27.84  ? 868  HOH A O     1 
HETATM 4184 O  O     . HOH L 8 .   ? 57.201 5.590   -15.662 1.00 28.71  ? 869  HOH A O     1 
HETATM 4185 O  O     . HOH L 8 .   ? 44.968 17.144  -17.958 1.00 31.79  ? 870  HOH A O     1 
HETATM 4186 O  O     . HOH L 8 .   ? 37.754 -25.199 6.020   1.00 38.79  ? 871  HOH A O     1 
HETATM 4187 O  O     . HOH L 8 .   ? 61.199 16.423  4.590   1.00 30.98  ? 872  HOH A O     1 
HETATM 4188 O  O     . HOH L 8 .   ? 38.069 10.391  9.566   1.00 26.44  ? 873  HOH A O     1 
HETATM 4189 O  O     . HOH L 8 .   ? 48.859 -14.735 18.656  1.00 36.76  ? 874  HOH A O     1 
HETATM 4190 O  O     . HOH L 8 .   ? 59.270 9.533   10.795  1.00 12.54  ? 875  HOH A O     1 
HETATM 4191 O  O     . HOH L 8 .   ? 45.076 0.658   -18.670 1.00 23.25  ? 876  HOH A O     1 
HETATM 4192 O  O     . HOH L 8 .   ? 55.450 -33.144 2.644   1.00 30.02  ? 877  HOH A O     1 
HETATM 4193 O  O     . HOH L 8 .   ? 56.413 21.359  18.278  1.00 22.11  ? 878  HOH A O     1 
HETATM 4194 O  O     . HOH L 8 .   ? 40.959 -2.918  -23.039 1.00 22.80  ? 879  HOH A O     1 
HETATM 4195 O  O     . HOH L 8 .   ? 57.095 -0.062  10.560  1.00 31.36  ? 880  HOH A O     1 
HETATM 4196 O  O     . HOH L 8 .   ? 39.309 18.462  17.951  1.00 31.92  ? 881  HOH A O     1 
HETATM 4197 O  O     . HOH L 8 .   ? 57.103 0.025   -14.731 1.00 22.58  ? 882  HOH A O     1 
HETATM 4198 O  O     . HOH L 8 .   ? 38.837 -3.268  -20.130 1.00 29.58  ? 883  HOH A O     1 
HETATM 4199 O  O     . HOH L 8 .   ? 33.677 14.877  18.964  1.00 38.58  ? 884  HOH A O     1 
HETATM 4200 O  O     . HOH L 8 .   ? 61.705 -2.500  12.193  1.00 36.98  ? 885  HOH A O     1 
HETATM 4201 O  O     . HOH L 8 .   ? 59.819 -18.161 -7.633  1.00 17.82  ? 886  HOH A O     1 
HETATM 4202 O  O     . HOH L 8 .   ? 40.817 -1.535  -16.362 1.00 27.28  ? 887  HOH A O     1 
HETATM 4203 O  O     . HOH L 8 .   ? 70.946 -19.157 15.034  1.00 50.59  ? 888  HOH A O     1 
HETATM 4204 O  O     . HOH L 8 .   ? 30.720 21.567  -3.219  1.00 29.38  ? 889  HOH A O     1 
HETATM 4205 O  O     . HOH L 8 .   ? 47.481 -30.681 -6.810  1.00 47.79  ? 890  HOH A O     1 
HETATM 4206 O  O     . HOH L 8 .   ? 51.775 -17.885 -5.970  1.00 30.58  ? 891  HOH A O     1 
HETATM 4207 O  O     . HOH L 8 .   ? 28.837 8.309   -18.973 1.00 25.68  ? 892  HOH A O     1 
HETATM 4208 O  O     . HOH L 8 .   ? 64.703 19.232  1.890   1.00 27.18  ? 893  HOH A O     1 
HETATM 4209 O  O     . HOH L 8 .   ? 48.975 8.433   -13.571 1.00 21.78  ? 894  HOH A O     1 
HETATM 4210 O  O     . HOH L 8 .   ? 61.739 15.962  2.396   1.00 28.53  ? 895  HOH A O     1 
HETATM 4211 O  O     . HOH L 8 .   ? 46.571 -8.563  -4.490  1.00 21.12  ? 896  HOH A O     1 
HETATM 4212 O  O     . HOH L 8 .   ? 51.331 -33.424 11.181  1.00 33.90  ? 897  HOH A O     1 
HETATM 4213 O  O     . HOH L 8 .   ? 58.043 18.774  -8.752  1.00 32.79  ? 898  HOH A O     1 
HETATM 4214 O  O     . HOH L 8 .   ? 41.900 -8.800  9.707   1.00 33.28  ? 899  HOH A O     1 
HETATM 4215 O  O     . HOH L 8 .   ? 47.196 21.713  9.869   1.00 32.52  ? 900  HOH A O     1 
HETATM 4216 O  O     . HOH L 8 .   ? 46.481 -18.588 -2.596  1.00 32.99  ? 901  HOH A O     1 
HETATM 4217 O  O     . HOH L 8 .   ? 49.555 21.095  8.783   1.00 44.27  ? 902  HOH A O     1 
HETATM 4218 O  O     . HOH L 8 .   ? 46.972 15.767  -23.504 1.00 28.38  ? 903  HOH A O     1 
HETATM 4219 O  O     . HOH L 8 .   ? 54.578 -34.029 12.837  1.00 43.37  ? 904  HOH A O     1 
HETATM 4220 O  O     . HOH L 8 .   ? 53.350 17.320  -3.026  1.00 16.48  ? 905  HOH A O     1 
HETATM 4221 O  O     . HOH L 8 .   ? 50.994 3.403   10.311  1.00 19.92  ? 906  HOH A O     1 
HETATM 4222 O  O     . HOH L 8 .   ? 52.780 -20.156 -5.045  1.00 25.70  ? 907  HOH A O     1 
HETATM 4223 O  O     . HOH L 8 .   ? 39.419 -18.674 14.646  1.00 38.25  ? 908  HOH A O     1 
HETATM 4224 O  O     . HOH L 8 .   ? 38.181 13.153  24.249  1.00 37.70  ? 909  HOH A O     1 
HETATM 4225 O  O     . HOH L 8 .   ? 38.381 -27.926 7.060   1.00 33.86  ? 910  HOH A O     1 
HETATM 4226 O  O     . HOH L 8 .   ? 50.923 4.488   24.736  1.00 28.60  ? 911  HOH A O     1 
HETATM 4227 O  O     . HOH L 8 .   ? 80.739 -3.963  13.901  1.00 42.33  ? 912  HOH A O     1 
HETATM 4228 O  O     . HOH L 8 .   ? 61.445 4.514   -17.075 1.00 38.21  ? 913  HOH A O     1 
HETATM 4229 O  O     . HOH L 8 .   ? 61.448 7.868   16.283  1.00 30.40  ? 914  HOH A O     1 
HETATM 4230 O  O     . HOH L 8 .   ? 31.004 19.420  11.162  1.00 37.69  ? 915  HOH A O     1 
HETATM 4231 O  O     . HOH L 8 .   ? 74.637 -22.669 -6.332  1.00 41.45  ? 916  HOH A O     1 
HETATM 4232 O  O     . HOH L 8 .   ? 43.038 -30.898 -10.299 1.00 35.02  ? 917  HOH A O     1 
HETATM 4233 O  O     . HOH L 8 .   ? 46.211 -14.537 14.925  1.00 36.41  ? 918  HOH A O     1 
HETATM 4234 O  O     . HOH L 8 .   ? 61.569 24.234  9.933   1.00 27.19  ? 919  HOH A O     1 
HETATM 4235 O  O     . HOH L 8 .   ? 18.714 14.521  6.528   1.00 61.64  ? 920  HOH A O     1 
HETATM 4236 O  O     . HOH L 8 .   ? 59.054 30.203  12.333  1.00 59.13  ? 921  HOH A O     1 
HETATM 4237 O  O     . HOH L 8 .   ? 68.320 -20.833 -8.993  1.00 44.82  ? 922  HOH A O     1 
HETATM 4238 O  O     . HOH L 8 .   ? 61.290 1.905   14.261  1.00 38.37  ? 923  HOH A O     1 
HETATM 4239 O  O     . HOH L 8 .   ? 25.501 14.596  5.106   1.00 31.72  ? 924  HOH A O     1 
HETATM 4240 O  O     . HOH L 8 .   ? 49.569 26.371  3.117   1.00 32.02  ? 925  HOH A O     1 
HETATM 4241 O  O     . HOH L 8 .   ? 59.312 -13.303 15.128  1.00 33.46  ? 926  HOH A O     1 
HETATM 4242 O  O     . HOH L 8 .   ? 36.703 -28.710 4.207   1.00 31.10  ? 927  HOH A O     1 
HETATM 4243 O  O     . HOH L 8 .   ? 32.045 3.036   -23.730 1.00 39.16  ? 928  HOH A O     1 
HETATM 4244 O  O     . HOH L 8 .   ? 38.869 -18.941 5.314   1.00 41.10  ? 929  HOH A O     1 
HETATM 4245 O  O     . HOH L 8 .   ? 60.904 9.973   7.279   1.00 30.65  ? 930  HOH A O     1 
HETATM 4246 O  O     . HOH L 8 .   ? 47.722 10.625  -9.480  1.00 22.83  ? 931  HOH A O     1 
HETATM 4247 O  O     . HOH L 8 .   ? 35.233 -1.933  -23.592 1.00 49.82  ? 932  HOH A O     1 
HETATM 4248 O  O     . HOH L 8 .   ? 53.367 5.369   -16.690 1.00 40.90  ? 933  HOH A O     1 
HETATM 4249 O  O     . HOH L 8 .   ? 40.624 7.295   -29.874 1.00 39.91  ? 934  HOH A O     1 
HETATM 4250 O  O     . HOH L 8 .   ? 57.137 -19.071 22.227  1.00 26.67  ? 935  HOH A O     1 
HETATM 4251 O  O     . HOH L 8 .   ? 59.496 -29.085 -8.473  1.00 47.91  ? 936  HOH A O     1 
HETATM 4252 O  O     . HOH L 8 .   ? 45.730 9.945   -13.262 1.00 38.13  ? 937  HOH A O     1 
HETATM 4253 O  O     . HOH L 8 .   ? 61.738 28.351  10.381  1.00 25.31  ? 938  HOH A O     1 
HETATM 4254 O  O     . HOH L 8 .   ? 33.438 22.247  -0.556  1.00 55.15  ? 939  HOH A O     1 
HETATM 4255 O  O     . HOH L 8 .   ? 40.036 -18.234 -1.475  1.00 33.62  ? 940  HOH A O     1 
HETATM 4256 O  O     . HOH L 8 .   ? 70.755 8.906   -6.767  1.00 29.54  ? 941  HOH A O     1 
HETATM 4257 O  O     . HOH L 8 .   ? 44.734 7.245   -10.307 1.00 16.29  ? 942  HOH A O     1 
HETATM 4258 O  O     . HOH L 8 .   ? 65.500 13.411  -12.954 1.00 24.61  ? 943  HOH A O     1 
HETATM 4259 O  O     . HOH L 8 .   ? 48.663 12.287  -11.514 1.00 27.30  ? 944  HOH A O     1 
HETATM 4260 O  O     . HOH L 8 .   ? 64.070 -15.396 13.675  1.00 34.26  ? 945  HOH A O     1 
HETATM 4261 O  O     . HOH L 8 .   ? 43.969 0.631   -20.993 1.00 26.88  ? 946  HOH A O     1 
HETATM 4262 O  O     . HOH L 8 .   ? 42.788 10.995  -25.851 1.00 41.91  ? 947  HOH A O     1 
HETATM 4263 O  O     . HOH L 8 .   ? 52.456 -18.335 -11.466 1.00 36.33  ? 948  HOH A O     1 
HETATM 4264 O  O     . HOH L 8 .   ? 67.900 -4.689  -16.940 1.00 38.91  ? 949  HOH A O     1 
HETATM 4265 O  O     . HOH L 8 .   ? 52.796 0.109   12.153  1.00 26.20  ? 950  HOH A O     1 
HETATM 4266 O  O     . HOH L 8 .   ? 39.391 4.497   17.883  1.00 48.08  ? 951  HOH A O     1 
HETATM 4267 O  O     . HOH L 8 .   ? 47.944 -24.011 19.750  1.00 34.46  ? 952  HOH A O     1 
HETATM 4268 O  O     . HOH L 8 .   ? 49.268 -0.176  -16.461 1.00 30.79  ? 953  HOH A O     1 
HETATM 4269 O  O     . HOH L 8 .   ? 54.734 -17.278 -13.162 1.00 29.31  ? 954  HOH A O     1 
HETATM 4270 O  O     . HOH L 8 .   ? 50.997 -17.964 -9.282  1.00 42.44  ? 955  HOH A O     1 
HETATM 4271 O  O     . HOH L 8 .   ? 22.677 14.799  -17.384 1.00 52.09  ? 956  HOH A O     1 
HETATM 4272 O  O     . HOH L 8 .   ? 22.245 17.988  -6.986  1.00 38.01  ? 957  HOH A O     1 
HETATM 4273 O  O     . HOH L 8 .   ? 45.514 -10.781 -0.110  1.00 17.43  ? 958  HOH A O     1 
HETATM 4274 O  O     . HOH L 8 .   ? 59.287 -28.080 -2.094  1.00 34.70  ? 959  HOH A O     1 
HETATM 4275 O  O     . HOH L 8 .   ? 38.067 -22.603 10.662  1.00 27.93  ? 960  HOH A O     1 
HETATM 4276 O  O     . HOH L 8 .   ? 55.644 13.403  -11.334 1.00 29.32  ? 961  HOH A O     1 
HETATM 4277 O  O     . HOH L 8 .   ? 29.682 15.545  10.894  1.00 36.92  ? 962  HOH A O     1 
HETATM 4278 O  O     . HOH L 8 .   ? 58.119 15.210  -10.642 1.00 26.66  ? 963  HOH A O     1 
HETATM 4279 O  O     . HOH L 8 .   ? 54.970 -7.411  6.685   1.00 25.60  ? 964  HOH A O     1 
HETATM 4280 O  O     . HOH L 8 .   ? 69.291 5.259   1.072   1.00 27.59  ? 965  HOH A O     1 
HETATM 4281 O  O     . HOH L 8 .   ? 61.603 12.097  9.582   1.00 34.54  ? 966  HOH A O     1 
HETATM 4282 O  O     . HOH L 8 .   ? 42.909 3.265   18.419  1.00 44.37  ? 967  HOH A O     1 
HETATM 4283 O  O     . HOH L 8 .   ? 47.148 -20.232 18.520  1.00 30.03  ? 968  HOH A O     1 
HETATM 4284 O  O     . HOH L 8 .   ? 73.220 4.533   -1.298  1.00 27.21  ? 969  HOH A O     1 
HETATM 4285 O  O     . HOH L 8 .   ? 62.341 -29.010 -11.720 1.00 42.71  ? 970  HOH A O     1 
HETATM 4286 O  O     . HOH L 8 .   ? 42.511 -20.957 17.378  1.00 41.68  ? 971  HOH A O     1 
HETATM 4287 O  O     . HOH L 8 .   ? 51.197 13.405  -11.529 1.00 28.04  ? 972  HOH A O     1 
HETATM 4288 O  O     . HOH L 8 .   ? 45.288 -1.717  -24.462 1.00 32.62  ? 973  HOH A O     1 
HETATM 4289 O  O     . HOH L 8 .   ? 34.604 14.142  21.581  1.00 34.82  ? 974  HOH A O     1 
HETATM 4290 O  O     . HOH L 8 .   ? 67.590 -26.189 -0.630  1.00 36.17  ? 975  HOH A O     1 
HETATM 4291 O  O     . HOH L 8 .   ? 57.509 -14.254 -13.058 1.00 29.79  ? 976  HOH A O     1 
HETATM 4292 O  O     . HOH L 8 .   ? 49.705 0.715   19.961  1.00 29.81  ? 977  HOH A O     1 
HETATM 4293 O  O     . HOH L 8 .   ? 42.980 -15.928 -2.559  1.00 37.03  ? 978  HOH A O     1 
HETATM 4294 O  O     . HOH L 8 .   ? 69.611 1.599   -14.043 1.00 50.78  ? 979  HOH A O     1 
HETATM 4295 O  O     . HOH L 8 .   ? 42.504 4.958   20.817  1.00 38.12  ? 980  HOH A O     1 
HETATM 4296 O  O     . HOH L 8 .   ? 47.382 7.856   -9.582  1.00 17.65  ? 981  HOH A O     1 
HETATM 4297 O  O     . HOH L 8 .   ? 70.915 -6.710  14.017  1.00 32.68  ? 982  HOH A O     1 
HETATM 4298 O  O     . HOH L 8 .   ? 78.541 2.017   4.566   1.00 34.24  ? 983  HOH A O     1 
HETATM 4299 O  O     . HOH L 8 .   ? 39.742 14.808  25.544  1.00 57.85  ? 984  HOH A O     1 
HETATM 4300 O  O     . HOH L 8 .   ? 61.089 11.515  -12.195 1.00 39.49  ? 985  HOH A O     1 
HETATM 4301 O  O     . HOH L 8 .   ? 61.479 9.025   18.826  1.00 37.86  ? 986  HOH A O     1 
HETATM 4302 O  O     . HOH L 8 .   ? 54.010 -35.075 1.327   1.00 30.95  ? 987  HOH A O     1 
HETATM 4303 O  O     . HOH L 8 .   ? 45.274 11.742  -9.172  1.00 22.22  ? 988  HOH A O     1 
HETATM 4304 O  O     . HOH L 8 .   ? 55.640 -3.441  8.264   1.00 34.56  ? 989  HOH A O     1 
HETATM 4305 O  O     . HOH L 8 .   ? 55.335 -26.935 -4.084  1.00 36.03  ? 990  HOH A O     1 
HETATM 4306 O  O     . HOH L 8 .   ? 47.959 -17.886 17.482  1.00 31.73  ? 991  HOH A O     1 
HETATM 4307 O  O     . HOH L 8 .   ? 60.632 4.757   19.026  1.00 35.91  ? 992  HOH A O     1 
HETATM 4308 O  O     . HOH L 8 .   ? 59.216 9.510   22.712  1.00 32.34  ? 993  HOH A O     1 
HETATM 4309 O  O     . HOH L 8 .   ? 57.725 17.682  19.903  1.00 26.49  ? 994  HOH A O     1 
HETATM 4310 O  O     . HOH L 8 .   ? 57.352 -26.562 -3.254  1.00 55.68  ? 995  HOH A O     1 
HETATM 4311 O  O     . HOH L 8 .   ? 48.633 6.636   -11.741 1.00 18.05  ? 996  HOH A O     1 
HETATM 4312 O  O     . HOH L 8 .   ? 37.398 -28.871 9.705   1.00 55.53  ? 997  HOH A O     1 
HETATM 4313 O  O     . HOH L 8 .   ? 44.276 13.111  -10.619 1.00 33.28  ? 998  HOH A O     1 
HETATM 4314 O  O     . HOH L 8 .   ? 37.904 -15.435 11.870  1.00 37.36  ? 999  HOH A O     1 
HETATM 4315 O  O     . HOH L 8 .   ? 43.393 15.728  26.210  1.00 28.96  ? 1000 HOH A O     1 
HETATM 4316 O  O     . HOH L 8 .   ? 61.434 8.011   9.774   1.00 22.49  ? 1001 HOH A O     1 
HETATM 4317 O  O     . HOH L 8 .   ? 62.802 4.750   14.041  1.00 41.68  ? 1002 HOH A O     1 
HETATM 4318 O  O     . HOH L 8 .   ? 47.427 16.823  28.132  1.00 29.66  ? 1003 HOH A O     1 
HETATM 4319 O  O     . HOH L 8 .   ? 64.972 5.340   13.170  1.00 45.40  ? 1004 HOH A O     1 
HETATM 4320 O  O     . HOH L 8 .   ? 41.586 -29.303 18.114  1.00 43.73  ? 1005 HOH A O     1 
HETATM 4321 O  O     . HOH M 8 .   ? 34.992 5.587   17.991  1.00 57.59  ? 101  HOH T O     1 
HETATM 4322 O  O     . HOH M 8 .   ? 41.930 -7.457  -10.515 1.00 34.20  ? 102  HOH T O     1 
HETATM 4323 O  O     . HOH M 8 .   ? 38.167 -10.321 -9.818  1.00 50.64  ? 103  HOH T O     1 
HETATM 4324 O  O     . HOH M 8 .   ? 41.365 -19.821 -3.393  1.00 27.40  ? 104  HOH T O     1 
HETATM 4325 O  O     . HOH M 8 .   ? 38.938 2.796   -7.077  1.00 29.15  ? 105  HOH T O     1 
HETATM 4326 O  O     . HOH M 8 .   ? 40.162 -22.064 -6.751  1.00 26.21  ? 106  HOH T O     1 
HETATM 4327 O  O     . HOH M 8 .   ? 28.893 0.414   13.315  1.00 62.61  ? 107  HOH T O     1 
HETATM 4328 O  O     . HOH M 8 .   ? 42.962 5.415   -9.026  1.00 16.69  ? 108  HOH T O     1 
HETATM 4329 O  O     . HOH M 8 .   ? 35.908 2.464   4.661   1.00 29.59  ? 109  HOH T O     1 
HETATM 4330 O  O     . HOH M 8 .   ? 45.042 -4.999  -2.948  1.00 35.21  ? 110  HOH T O     1 
HETATM 4331 O  O     . HOH M 8 .   ? 39.827 8.506   8.894   1.00 24.91  ? 111  HOH T O     1 
HETATM 4332 O  O     . HOH M 8 .   ? 40.335 11.208  -3.543  1.00 13.53  ? 112  HOH T O     1 
HETATM 4333 O  O     . HOH M 8 .   ? 28.859 4.458   9.434   1.00 61.26  ? 113  HOH T O     1 
HETATM 4334 O  O     . HOH M 8 .   ? 36.586 -23.116 -5.226  1.00 20.99  ? 114  HOH T O     1 
HETATM 4335 O  O     . HOH M 8 .   ? 31.105 -16.181 -4.285  1.00 28.14  ? 115  HOH T O     1 
HETATM 4336 O  O     . HOH M 8 .   ? 36.093 -2.076  -1.194  1.00 31.43  ? 116  HOH T O     1 
HETATM 4337 O  O     . HOH M 8 .   ? 43.869 -8.669  -3.430  1.00 26.07  ? 117  HOH T O     1 
HETATM 4338 O  O     . HOH M 8 .   ? 44.870 -2.869  -3.490  1.00 35.53  ? 118  HOH T O     1 
HETATM 4339 O  O     . HOH M 8 .   ? 45.347 4.992   -4.777  1.00 23.43  ? 119  HOH T O     1 
HETATM 4340 O  O     . HOH M 8 .   ? 44.073 1.249   -2.028  1.00 25.54  ? 120  HOH T O     1 
HETATM 4341 O  O     . HOH M 8 .   ? 38.188 -2.227  -6.457  1.00 30.49  ? 121  HOH T O     1 
HETATM 4342 O  O     . HOH M 8 .   ? 36.413 -3.154  -4.444  1.00 35.28  ? 122  HOH T O     1 
HETATM 4343 O  O     . HOH M 8 .   ? 43.455 5.321   0.465   1.00 19.22  ? 123  HOH T O     1 
HETATM 4344 O  O     . HOH M 8 .   ? 40.542 -1.004  7.588   1.00 42.13  ? 124  HOH T O     1 
HETATM 4345 O  O     . HOH M 8 .   ? 27.210 -20.635 -4.442  1.00 44.08  ? 125  HOH T O     1 
HETATM 4346 O  O     . HOH M 8 .   ? 40.460 -3.710  -9.623  1.00 31.86  ? 126  HOH T O     1 
HETATM 4347 O  O     . HOH M 8 .   ? 25.549 -18.932 -6.971  1.00 35.63  ? 127  HOH T O     1 
HETATM 4348 O  O     . HOH M 8 .   ? 37.071 -0.169  4.791   1.00 25.23  ? 128  HOH T O     1 
HETATM 4349 O  O     . HOH M 8 .   ? 37.899 -21.602 -3.523  1.00 28.99  ? 129  HOH T O     1 
HETATM 4350 O  O     . HOH M 8 .   ? 37.517 -12.789 -11.371 1.00 36.22  ? 130  HOH T O     1 
HETATM 4351 O  O     . HOH M 8 .   ? 42.589 -11.722 -3.396  1.00 36.07  ? 131  HOH T O     1 
HETATM 4352 O  O     . HOH M 8 .   ? 33.170 10.068  8.038   1.00 38.81  ? 132  HOH T O     1 
HETATM 4353 O  O     . HOH M 8 .   ? 35.763 10.816  10.370  1.00 28.18  ? 133  HOH T O     1 
HETATM 4354 O  O     . HOH M 8 .   ? 40.534 -10.086 -11.160 1.00 45.37  ? 134  HOH T O     1 
HETATM 4355 O  O     . HOH N 8 .   ? 45.551 -7.756  7.744   1.00 42.94  ? 201  HOH P O     1 
HETATM 4356 O  O     . HOH N 8 .   ? 38.416 -10.718 6.594   1.00 35.54  ? 202  HOH P O     1 
HETATM 4357 O  O     . HOH N 8 .   ? 32.068 -7.504  -11.509 1.00 40.38  ? 203  HOH P O     1 
HETATM 4358 O  O     . HOH N 8 .   ? 48.797 2.243   1.242   1.00 14.64  ? 204  HOH P O     1 
HETATM 4359 O  O     . HOH N 8 .   ? 34.508 -9.431  -11.341 1.00 45.93  ? 205  HOH P O     1 
HETATM 4360 O  O     . HOH N 8 .   ? 41.206 -11.793 -0.808  1.00 21.99  ? 206  HOH P O     1 
HETATM 4361 O  O     . HOH N 8 .   ? 36.374 -4.692  3.142   1.00 35.68  ? 207  HOH P O     1 
HETATM 4362 O  O     . HOH N 8 .   ? 44.202 7.140   2.163   1.00 17.31  ? 208  HOH P O     1 
HETATM 4363 O  O     . HOH N 8 .   ? 48.846 -9.994  6.807   1.00 22.08  ? 209  HOH P O     1 
HETATM 4364 O  O     . HOH N 8 .   ? 45.739 3.735   1.063   1.00 16.42  ? 210  HOH P O     1 
HETATM 4365 O  O     . HOH N 8 .   ? 42.537 -8.952  7.225   1.00 20.79  ? 211  HOH P O     1 
HETATM 4366 O  O     . HOH N 8 .   ? 30.553 -6.331  -13.753 1.00 44.06  ? 212  HOH P O     1 
HETATM 4367 O  O     . HOH N 8 .   ? 44.520 -8.220  -0.868  1.00 21.71  ? 213  HOH P O     1 
HETATM 4368 O  O     . HOH N 8 .   ? 44.519 -6.472  5.965   1.00 35.98  ? 214  HOH P O     1 
HETATM 4369 O  O     B HOH N 8 .   ? 49.285 1.676   7.728   0.15 18.61  ? 215  HOH P O     1 
HETATM 4370 O  O     . HOH N 8 .   ? 40.160 -5.651  5.652   1.00 30.13  ? 216  HOH P O     1 
HETATM 4371 O  O     . HOH N 8 .   ? 41.263 -15.644 1.815   1.00 21.76  ? 217  HOH P O     1 
HETATM 4372 O  O     . HOH N 8 .   ? 45.789 -2.686  -0.918  1.00 23.48  ? 218  HOH P O     1 
HETATM 4373 O  O     . HOH N 8 .   ? 46.190 -5.090  7.267   1.00 52.61  ? 219  HOH P O     1 
HETATM 4374 O  O     . HOH N 8 .   ? 51.090 -8.113  4.537   1.00 27.22  ? 220  HOH P O     1 
HETATM 4375 O  O     . HOH N 8 .   ? 38.232 -4.243  5.011   1.00 30.68  ? 221  HOH P O     1 
HETATM 4376 O  O     . HOH N 8 .   ? 47.688 -1.935  7.020   1.00 29.78  ? 222  HOH P O     1 
HETATM 4377 O  O     . HOH N 8 .   ? 40.157 -14.001 -0.019  1.00 30.44  ? 223  HOH P O     1 
HETATM 4378 O  O     . HOH N 8 .   ? 40.092 -8.894  5.954   1.00 23.69  ? 224  HOH P O     1 
HETATM 4379 O  O     . HOH N 8 .   ? 43.662 -12.783 -0.212  1.00 21.51  ? 225  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1   501  501  MN  MN  A . 
E 4 MN  1   502  503  MN  MN  A . 
F 5 GOL 1   503  506  GOL GOL A . 
G 5 GOL 1   504  507  GOL GOL A . 
H 5 GOL 1   505  508  GOL GOL A . 
I 6 DTP 1   506  504  DTP DTP A . 
J 7 DPO 1   507  505  DPO DPO A . 
K 4 MN  1   101  506  MN  MN  P . 
L 8 HOH 1   601  797  HOH HOH A . 
L 8 HOH 2   602  759  HOH HOH A . 
L 8 HOH 3   603  994  HOH HOH A . 
L 8 HOH 4   604  773  HOH HOH A . 
L 8 HOH 5   605  840  HOH HOH A . 
L 8 HOH 6   606  995  HOH HOH A . 
L 8 HOH 7   607  865  HOH HOH A . 
L 8 HOH 8   608  875  HOH HOH A . 
L 8 HOH 9   609  803  HOH HOH A . 
L 8 HOH 10  610  735  HOH HOH A . 
L 8 HOH 11  611  646  HOH HOH A . 
L 8 HOH 12  612  999  HOH HOH A . 
L 8 HOH 13  613  105  HOH HOH A . 
L 8 HOH 14  614  975  HOH HOH A . 
L 8 HOH 15  615  977  HOH HOH A . 
L 8 HOH 16  616  970  HOH HOH A . 
L 8 HOH 17  617  827  HOH HOH A . 
L 8 HOH 18  618  658  HOH HOH A . 
L 8 HOH 19  619  932  HOH HOH A . 
L 8 HOH 20  620  842  HOH HOH A . 
L 8 HOH 21  621  644  HOH HOH A . 
L 8 HOH 22  622  724  HOH HOH A . 
L 8 HOH 23  623  882  HOH HOH A . 
L 8 HOH 24  624  657  HOH HOH A . 
L 8 HOH 25  625  834  HOH HOH A . 
L 8 HOH 26  626  746  HOH HOH A . 
L 8 HOH 27  627  601  HOH HOH A . 
L 8 HOH 28  628  843  HOH HOH A . 
L 8 HOH 29  629  825  HOH HOH A . 
L 8 HOH 30  630  991  HOH HOH A . 
L 8 HOH 31  631  819  HOH HOH A . 
L 8 HOH 32  632  939  HOH HOH A . 
L 8 HOH 33  633  972  HOH HOH A . 
L 8 HOH 34  634  801  HOH HOH A . 
L 8 HOH 35  635  783  HOH HOH A . 
L 8 HOH 36  636  850  HOH HOH A . 
L 8 HOH 37  637  778  HOH HOH A . 
L 8 HOH 38  638  670  HOH HOH A . 
L 8 HOH 39  639  998  HOH HOH A . 
L 8 HOH 40  640  692  HOH HOH A . 
L 8 HOH 41  641  209  HOH HOH A . 
L 8 HOH 42  642  707  HOH HOH A . 
L 8 HOH 43  643  611  HOH HOH A . 
L 8 HOH 44  644  848  HOH HOH A . 
L 8 HOH 45  645  640  HOH HOH A . 
L 8 HOH 46  646  722  HOH HOH A . 
L 8 HOH 47  647  793  HOH HOH A . 
L 8 HOH 48  648  831  HOH HOH A . 
L 8 HOH 49  649  609  HOH HOH A . 
L 8 HOH 50  650  852  HOH HOH A . 
L 8 HOH 51  651  775  HOH HOH A . 
L 8 HOH 52  652  618  HOH HOH A . 
L 8 HOH 53  653  763  HOH HOH A . 
L 8 HOH 54  654  677  HOH HOH A . 
L 8 HOH 55  655  647  HOH HOH A . 
L 8 HOH 56  656  603  HOH HOH A . 
L 8 HOH 57  657  753  HOH HOH A . 
L 8 HOH 58  658  884  HOH HOH A . 
L 8 HOH 59  659  758  HOH HOH A . 
L 8 HOH 60  660  725  HOH HOH A . 
L 8 HOH 61  661  890  HOH HOH A . 
L 8 HOH 62  662  824  HOH HOH A . 
L 8 HOH 63  663  808  HOH HOH A . 
L 8 HOH 64  664  721  HOH HOH A . 
L 8 HOH 65  665  730  HOH HOH A . 
L 8 HOH 66  666  917  HOH HOH A . 
L 8 HOH 67  667  653  HOH HOH A . 
L 8 HOH 68  668  755  HOH HOH A . 
L 8 HOH 69  669  638  HOH HOH A . 
L 8 HOH 70  670  769  HOH HOH A . 
L 8 HOH 71  671  605  HOH HOH A . 
L 8 HOH 72  672  855  HOH HOH A . 
L 8 HOH 73  673  791  HOH HOH A . 
L 8 HOH 74  674  678  HOH HOH A . 
L 8 HOH 75  675  888  HOH HOH A . 
L 8 HOH 76  676  686  HOH HOH A . 
L 8 HOH 77  677  896  HOH HOH A . 
L 8 HOH 78  678  745  HOH HOH A . 
L 8 HOH 79  679  750  HOH HOH A . 
L 8 HOH 80  680  980  HOH HOH A . 
L 8 HOH 81  681  689  HOH HOH A . 
L 8 HOH 82  682  660  HOH HOH A . 
L 8 HOH 83  683  742  HOH HOH A . 
L 8 HOH 84  684  688  HOH HOH A . 
L 8 HOH 85  685  667  HOH HOH A . 
L 8 HOH 86  686  997  HOH HOH A . 
L 8 HOH 87  687  899  HOH HOH A . 
L 8 HOH 88  688  921  HOH HOH A . 
L 8 HOH 89  689  671  HOH HOH A . 
L 8 HOH 90  690  727  HOH HOH A . 
L 8 HOH 91  691  704  HOH HOH A . 
L 8 HOH 92  692  863  HOH HOH A . 
L 8 HOH 93  693  1002 HOH HOH A . 
L 8 HOH 94  694  996  HOH HOH A . 
L 8 HOH 95  695  705  HOH HOH A . 
L 8 HOH 96  696  956  HOH HOH A . 
L 8 HOH 97  697  768  HOH HOH A . 
L 8 HOH 98  698  913  HOH HOH A . 
L 8 HOH 99  699  737  HOH HOH A . 
L 8 HOH 100 700  107  HOH HOH A . 
L 8 HOH 101 701  694  HOH HOH A . 
L 8 HOH 102 702  782  HOH HOH A . 
L 8 HOH 103 703  712  HOH HOH A . 
L 8 HOH 104 704  925  HOH HOH A . 
L 8 HOH 105 705  838  HOH HOH A . 
L 8 HOH 106 706  681  HOH HOH A . 
L 8 HOH 107 707  752  HOH HOH A . 
L 8 HOH 108 708  829  HOH HOH A . 
L 8 HOH 109 709  627  HOH HOH A . 
L 8 HOH 110 710  668  HOH HOH A . 
L 8 HOH 111 711  687  HOH HOH A . 
L 8 HOH 112 712  841  HOH HOH A . 
L 8 HOH 113 713  626  HOH HOH A . 
L 8 HOH 114 714  776  HOH HOH A . 
L 8 HOH 115 715  835  HOH HOH A . 
L 8 HOH 116 716  714  HOH HOH A . 
L 8 HOH 117 717  853  HOH HOH A . 
L 8 HOH 118 718  655  HOH HOH A . 
L 8 HOH 119 719  669  HOH HOH A . 
L 8 HOH 120 720  645  HOH HOH A . 
L 8 HOH 121 721  717  HOH HOH A . 
L 8 HOH 122 722  919  HOH HOH A . 
L 8 HOH 123 723  938  HOH HOH A . 
L 8 HOH 124 724  976  HOH HOH A . 
L 8 HOH 125 725  695  HOH HOH A . 
L 8 HOH 126 726  619  HOH HOH A . 
L 8 HOH 127 727  635  HOH HOH A . 
L 8 HOH 128 728  651  HOH HOH A . 
L 8 HOH 129 729  680  HOH HOH A . 
L 8 HOH 130 730  661  HOH HOH A . 
L 8 HOH 131 731  659  HOH HOH A . 
L 8 HOH 132 732  936  HOH HOH A . 
L 8 HOH 133 733  885  HOH HOH A . 
L 8 HOH 134 734  674  HOH HOH A . 
L 8 HOH 135 735  606  HOH HOH A . 
L 8 HOH 136 736  790  HOH HOH A . 
L 8 HOH 137 737  788  HOH HOH A . 
L 8 HOH 138 738  810  HOH HOH A . 
L 8 HOH 139 739  685  HOH HOH A . 
L 8 HOH 140 740  679  HOH HOH A . 
L 8 HOH 141 741  822  HOH HOH A . 
L 8 HOH 142 742  900  HOH HOH A . 
L 8 HOH 143 743  846  HOH HOH A . 
L 8 HOH 144 744  815  HOH HOH A . 
L 8 HOH 145 745  870  HOH HOH A . 
L 8 HOH 146 746  935  HOH HOH A . 
L 8 HOH 147 747  786  HOH HOH A . 
L 8 HOH 148 748  805  HOH HOH A . 
L 8 HOH 149 749  656  HOH HOH A . 
L 8 HOH 150 750  662  HOH HOH A . 
L 8 HOH 151 751  862  HOH HOH A . 
L 8 HOH 152 752  607  HOH HOH A . 
L 8 HOH 153 753  990  HOH HOH A . 
L 8 HOH 154 754  743  HOH HOH A . 
L 8 HOH 155 755  771  HOH HOH A . 
L 8 HOH 156 756  728  HOH HOH A . 
L 8 HOH 157 757  616  HOH HOH A . 
L 8 HOH 158 758  973  HOH HOH A . 
L 8 HOH 159 759  634  HOH HOH A . 
L 8 HOH 160 760  676  HOH HOH A . 
L 8 HOH 161 761  650  HOH HOH A . 
L 8 HOH 162 762  608  HOH HOH A . 
L 8 HOH 163 763  766  HOH HOH A . 
L 8 HOH 164 764  889  HOH HOH A . 
L 8 HOH 165 765  628  HOH HOH A . 
L 8 HOH 166 766  736  HOH HOH A . 
L 8 HOH 167 767  926  HOH HOH A . 
L 8 HOH 168 768  672  HOH HOH A . 
L 8 HOH 169 769  623  HOH HOH A . 
L 8 HOH 170 770  784  HOH HOH A . 
L 8 HOH 171 771  625  HOH HOH A . 
L 8 HOH 172 772  760  HOH HOH A . 
L 8 HOH 173 773  715  HOH HOH A . 
L 8 HOH 174 774  814  HOH HOH A . 
L 8 HOH 175 775  744  HOH HOH A . 
L 8 HOH 176 776  943  HOH HOH A . 
L 8 HOH 177 777  740  HOH HOH A . 
L 8 HOH 178 778  649  HOH HOH A . 
L 8 HOH 179 779  780  HOH HOH A . 
L 8 HOH 180 780  643  HOH HOH A . 
L 8 HOH 181 781  648  HOH HOH A . 
L 8 HOH 182 782  729  HOH HOH A . 
L 8 HOH 183 783  639  HOH HOH A . 
L 8 HOH 184 784  733  HOH HOH A . 
L 8 HOH 185 785  632  HOH HOH A . 
L 8 HOH 186 786  904  HOH HOH A . 
L 8 HOH 187 787  809  HOH HOH A . 
L 8 HOH 188 788  923  HOH HOH A . 
L 8 HOH 189 789  877  HOH HOH A . 
L 8 HOH 190 790  630  HOH HOH A . 
L 8 HOH 191 791  868  HOH HOH A . 
L 8 HOH 192 792  631  HOH HOH A . 
L 8 HOH 193 793  858  HOH HOH A . 
L 8 HOH 194 794  796  HOH HOH A . 
L 8 HOH 195 795  757  HOH HOH A . 
L 8 HOH 196 796  702  HOH HOH A . 
L 8 HOH 197 797  665  HOH HOH A . 
L 8 HOH 198 798  663  HOH HOH A . 
L 8 HOH 199 799  604  HOH HOH A . 
L 8 HOH 200 800  617  HOH HOH A . 
L 8 HOH 201 801  629  HOH HOH A . 
L 8 HOH 202 802  610  HOH HOH A . 
L 8 HOH 203 803  621  HOH HOH A . 
L 8 HOH 204 804  682  HOH HOH A . 
L 8 HOH 205 805  633  HOH HOH A . 
L 8 HOH 206 806  701  HOH HOH A . 
L 8 HOH 207 807  754  HOH HOH A . 
L 8 HOH 208 808  781  HOH HOH A . 
L 8 HOH 209 809  642  HOH HOH A . 
L 8 HOH 210 810  612  HOH HOH A . 
L 8 HOH 211 811  820  HOH HOH A . 
L 8 HOH 212 812  613  HOH HOH A . 
L 8 HOH 213 813  699  HOH HOH A . 
L 8 HOH 214 814  720  HOH HOH A . 
L 8 HOH 215 815  867  HOH HOH A . 
L 8 HOH 216 816  719  HOH HOH A . 
L 8 HOH 217 817  826  HOH HOH A . 
L 8 HOH 218 818  968  HOH HOH A . 
L 8 HOH 219 819  979  HOH HOH A . 
L 8 HOH 220 820  777  HOH HOH A . 
L 8 HOH 221 821  789  HOH HOH A . 
L 8 HOH 222 822  944  HOH HOH A . 
L 8 HOH 223 823  683  HOH HOH A . 
L 8 HOH 224 824  708  HOH HOH A . 
L 8 HOH 225 825  620  HOH HOH A . 
L 8 HOH 226 826  800  HOH HOH A . 
L 8 HOH 227 827  813  HOH HOH A . 
L 8 HOH 228 828  762  HOH HOH A . 
L 8 HOH 229 829  886  HOH HOH A . 
L 8 HOH 230 830  703  HOH HOH A . 
L 8 HOH 231 831  741  HOH HOH A . 
L 8 HOH 232 832  636  HOH HOH A . 
L 8 HOH 233 833  891  HOH HOH A . 
L 8 HOH 234 834  881  HOH HOH A . 
L 8 HOH 235 835  894  HOH HOH A . 
L 8 HOH 236 836  872  HOH HOH A . 
L 8 HOH 237 837  950  HOH HOH A . 
L 8 HOH 238 838  772  HOH HOH A . 
L 8 HOH 239 839  799  HOH HOH A . 
L 8 HOH 240 840  723  HOH HOH A . 
L 8 HOH 241 841  684  HOH HOH A . 
L 8 HOH 242 842  906  HOH HOH A . 
L 8 HOH 243 843  713  HOH HOH A . 
L 8 HOH 244 844  804  HOH HOH A . 
L 8 HOH 245 845  902  HOH HOH A . 
L 8 HOH 246 846  739  HOH HOH A . 
L 8 HOH 247 847  779  HOH HOH A . 
L 8 HOH 248 848  929  HOH HOH A . 
L 8 HOH 249 849  709  HOH HOH A . 
L 8 HOH 250 850  718  HOH HOH A . 
L 8 HOH 251 851  859  HOH HOH A . 
L 8 HOH 252 852  675  HOH HOH A . 
L 8 HOH 253 853  652  HOH HOH A . 
L 8 HOH 254 854  984  HOH HOH A . 
L 8 HOH 255 855  624  HOH HOH A . 
L 8 HOH 256 856  654  HOH HOH A . 
L 8 HOH 257 857  614  HOH HOH A . 
L 8 HOH 258 858  833  HOH HOH A . 
L 8 HOH 259 859  873  HOH HOH A . 
L 8 HOH 260 860  933  HOH HOH A . 
L 8 HOH 261 861  816  HOH HOH A . 
L 8 HOH 262 862  637  HOH HOH A . 
L 8 HOH 263 863  966  HOH HOH A . 
L 8 HOH 264 864  967  HOH HOH A . 
L 8 HOH 265 865  710  HOH HOH A . 
L 8 HOH 266 866  794  HOH HOH A . 
L 8 HOH 267 867  856  HOH HOH A . 
L 8 HOH 268 868  732  HOH HOH A . 
L 8 HOH 269 869  1001 HOH HOH A . 
L 8 HOH 270 870  761  HOH HOH A . 
L 8 HOH 271 871  830  HOH HOH A . 
L 8 HOH 272 872  942  HOH HOH A . 
L 8 HOH 273 873  774  HOH HOH A . 
L 8 HOH 274 874  817  HOH HOH A . 
L 8 HOH 275 875  615  HOH HOH A . 
L 8 HOH 276 876  749  HOH HOH A . 
L 8 HOH 277 877  958  HOH HOH A . 
L 8 HOH 278 878  887  HOH HOH A . 
L 8 HOH 279 879  847  HOH HOH A . 
L 8 HOH 280 880  844  HOH HOH A . 
L 8 HOH 281 881  849  HOH HOH A . 
L 8 HOH 282 882  901  HOH HOH A . 
L 8 HOH 283 883  787  HOH HOH A . 
L 8 HOH 284 884  934  HOH HOH A . 
L 8 HOH 285 885  951  HOH HOH A . 
L 8 HOH 286 886  964  HOH HOH A . 
L 8 HOH 287 887  818  HOH HOH A . 
L 8 HOH 288 888  806  HOH HOH A . 
L 8 HOH 289 889  1000 HOH HOH A . 
L 8 HOH 290 890  963  HOH HOH A . 
L 8 HOH 291 891  915  HOH HOH A . 
L 8 HOH 292 892  734  HOH HOH A . 
L 8 HOH 293 893  747  HOH HOH A . 
L 8 HOH 294 894  711  HOH HOH A . 
L 8 HOH 295 895  756  HOH HOH A . 
L 8 HOH 296 896  124  HOH HOH A . 
L 8 HOH 297 897  946  HOH HOH A . 
L 8 HOH 298 898  807  HOH HOH A . 
L 8 HOH 299 899  767  HOH HOH A . 
L 8 HOH 300 900  811  HOH HOH A . 
L 8 HOH 301 901  914  HOH HOH A . 
L 8 HOH 302 902  928  HOH HOH A . 
L 8 HOH 303 903  836  HOH HOH A . 
L 8 HOH 304 904  960  HOH HOH A . 
L 8 HOH 305 905  641  HOH HOH A . 
L 8 HOH 306 906  706  HOH HOH A . 
L 8 HOH 307 907  716  HOH HOH A . 
L 8 HOH 308 908  927  HOH HOH A . 
L 8 HOH 309 909  802  HOH HOH A . 
L 8 HOH 310 910  907  HOH HOH A . 
L 8 HOH 311 911  910  HOH HOH A . 
L 8 HOH 312 912  949  HOH HOH A . 
L 8 HOH 313 913  988  HOH HOH A . 
L 8 HOH 314 914  770  HOH HOH A . 
L 8 HOH 315 915  133  HOH HOH A . 
L 8 HOH 316 916  931  HOH HOH A . 
L 8 HOH 317 917  941  HOH HOH A . 
L 8 HOH 318 918  731  HOH HOH A . 
L 8 HOH 319 919  892  HOH HOH A . 
L 8 HOH 320 920  854  HOH HOH A . 
L 8 HOH 321 921  945  HOH HOH A . 
L 8 HOH 322 922  965  HOH HOH A . 
L 8 HOH 323 923  861  HOH HOH A . 
L 8 HOH 324 924  216  HOH HOH A . 
L 8 HOH 325 925  878  HOH HOH A . 
L 8 HOH 326 926  969  HOH HOH A . 
L 8 HOH 327 927  912  HOH HOH A . 
L 8 HOH 328 928  992  HOH HOH A . 
L 8 HOH 329 929  971  HOH HOH A . 
L 8 HOH 330 930  857  HOH HOH A . 
L 8 HOH 331 931  690  HOH HOH A . 
L 8 HOH 332 932  957  HOH HOH A . 
L 8 HOH 333 933  978  HOH HOH A . 
L 8 HOH 334 934  930  HOH HOH A . 
L 8 HOH 335 935  785  HOH HOH A . 
L 8 HOH 336 936  920  HOH HOH A . 
L 8 HOH 337 937  947  HOH HOH A . 
L 8 HOH 338 938  812  HOH HOH A . 
L 8 HOH 339 939  993  HOH HOH A . 
L 8 HOH 340 940  798  HOH HOH A . 
L 8 HOH 341 941  903  HOH HOH A . 
L 8 HOH 342 942  666  HOH HOH A . 
L 8 HOH 343 943  860  HOH HOH A . 
L 8 HOH 344 944  792  HOH HOH A . 
L 8 HOH 345 945  909  HOH HOH A . 
L 8 HOH 346 946  866  HOH HOH A . 
L 8 HOH 347 947  908  HOH HOH A . 
L 8 HOH 348 948  764  HOH HOH A . 
L 8 HOH 349 949  981  HOH HOH A . 
L 8 HOH 350 950  974  HOH HOH A . 
L 8 HOH 351 951  874  HOH HOH A . 
L 8 HOH 352 952  916  HOH HOH A . 
L 8 HOH 353 953  897  HOH HOH A . 
L 8 HOH 354 954  924  HOH HOH A . 
L 8 HOH 355 955  983  HOH HOH A . 
L 8 HOH 356 956  937  HOH HOH A . 
L 8 HOH 357 957  952  HOH HOH A . 
L 8 HOH 358 958  208  HOH HOH A . 
L 8 HOH 359 959  982  HOH HOH A . 
L 8 HOH 360 960  876  HOH HOH A . 
L 8 HOH 361 961  751  HOH HOH A . 
L 8 HOH 362 962  129  HOH HOH A . 
L 8 HOH 363 963  693  HOH HOH A . 
L 8 HOH 364 964  765  HOH HOH A . 
L 8 HOH 365 965  726  HOH HOH A . 
L 8 HOH 366 966  922  HOH HOH A . 
L 8 HOH 367 967  1003 HOH HOH A . 
L 8 HOH 368 968  795  HOH HOH A . 
L 8 HOH 369 969  893  HOH HOH A . 
L 8 HOH 370 970  821  HOH HOH A . 
L 8 HOH 371 971  989  HOH HOH A . 
L 8 HOH 372 972  837  HOH HOH A . 
L 8 HOH 373 973  898  HOH HOH A . 
L 8 HOH 374 974  851  HOH HOH A . 
L 8 HOH 375 975  869  HOH HOH A . 
L 8 HOH 376 976  664  HOH HOH A . 
L 8 HOH 377 977  895  HOH HOH A . 
L 8 HOH 378 978  828  HOH HOH A . 
L 8 HOH 379 979  962  HOH HOH A . 
L 8 HOH 380 980  953  HOH HOH A . 
L 8 HOH 381 981  697  HOH HOH A . 
L 8 HOH 382 982  748  HOH HOH A . 
L 8 HOH 383 983  961  HOH HOH A . 
L 8 HOH 384 984  883  HOH HOH A . 
L 8 HOH 385 985  823  HOH HOH A . 
L 8 HOH 386 986  839  HOH HOH A . 
L 8 HOH 387 987  880  HOH HOH A . 
L 8 HOH 388 988  905  HOH HOH A . 
L 8 HOH 389 989  948  HOH HOH A . 
L 8 HOH 390 990  911  HOH HOH A . 
L 8 HOH 391 991  738  HOH HOH A . 
L 8 HOH 392 992  987  HOH HOH A . 
L 8 HOH 393 993  864  HOH HOH A . 
L 8 HOH 394 994  879  HOH HOH A . 
L 8 HOH 395 995  954  HOH HOH A . 
L 8 HOH 396 996  691  HOH HOH A . 
L 8 HOH 397 997  959  HOH HOH A . 
L 8 HOH 398 998  955  HOH HOH A . 
L 8 HOH 399 999  940  HOH HOH A . 
L 8 HOH 400 1000 696  HOH HOH A . 
L 8 HOH 401 1001 700  HOH HOH A . 
L 8 HOH 402 1002 986  HOH HOH A . 
L 8 HOH 403 1003 845  HOH HOH A . 
L 8 HOH 404 1004 985  HOH HOH A . 
L 8 HOH 405 1005 918  HOH HOH A . 
M 8 HOH 1   101  106  HOH HOH T . 
M 8 HOH 2   102  103  HOH HOH T . 
M 8 HOH 3   103  125  HOH HOH T . 
M 8 HOH 4   104  109  HOH HOH T . 
M 8 HOH 5   105  113  HOH HOH T . 
M 8 HOH 6   106  114  HOH HOH T . 
M 8 HOH 7   107  120  HOH HOH T . 
M 8 HOH 8   108  110  HOH HOH T . 
M 8 HOH 9   109  108  HOH HOH T . 
M 8 HOH 10  110  117  HOH HOH T . 
M 8 HOH 11  111  115  HOH HOH T . 
M 8 HOH 12  112  622  HOH HOH T . 
M 8 HOH 13  113  136  HOH HOH T . 
M 8 HOH 14  114  102  HOH HOH T . 
M 8 HOH 15  115  111  HOH HOH T . 
M 8 HOH 16  116  123  HOH HOH T . 
M 8 HOH 17  117  104  HOH HOH T . 
M 8 HOH 18  118  135  HOH HOH T . 
M 8 HOH 19  119  132  HOH HOH T . 
M 8 HOH 20  120  119  HOH HOH T . 
M 8 HOH 21  121  116  HOH HOH T . 
M 8 HOH 22  122  112  HOH HOH T . 
M 8 HOH 23  123  127  HOH HOH T . 
M 8 HOH 24  124  130  HOH HOH T . 
M 8 HOH 25  125  128  HOH HOH T . 
M 8 HOH 26  126  101  HOH HOH T . 
M 8 HOH 27  127  122  HOH HOH T . 
M 8 HOH 28  128  126  HOH HOH T . 
M 8 HOH 29  129  118  HOH HOH T . 
M 8 HOH 30  130  121  HOH HOH T . 
M 8 HOH 31  131  134  HOH HOH T . 
M 8 HOH 32  132  832  HOH HOH T . 
M 8 HOH 33  133  871  HOH HOH T . 
M 8 HOH 34  134  131  HOH HOH T . 
N 8 HOH 1   201  214  HOH HOH P . 
N 8 HOH 2   202  215  HOH HOH P . 
N 8 HOH 3   203  217  HOH HOH P . 
N 8 HOH 4   204  1    HOH HOH P . 
N 8 HOH 5   205  221  HOH HOH P . 
N 8 HOH 6   206  202  HOH HOH P . 
N 8 HOH 7   207  222  HOH HOH P . 
N 8 HOH 8   208  673  HOH HOH P . 
N 8 HOH 9   209  201  HOH HOH P . 
N 8 HOH 10  210  211  HOH HOH P . 
N 8 HOH 11  211  203  HOH HOH P . 
N 8 HOH 12  212  219  HOH HOH P . 
N 8 HOH 13  213  204  HOH HOH P . 
N 8 HOH 14  214  223  HOH HOH P . 
N 8 HOH 15  215  602  HOH HOH P . 
N 8 HOH 16  216  220  HOH HOH P . 
N 8 HOH 17  217  205  HOH HOH P . 
N 8 HOH 18  218  210  HOH HOH P . 
N 8 HOH 19  219  218  HOH HOH P . 
N 8 HOH 20  220  698  HOH HOH P . 
N 8 HOH 21  221  224  HOH HOH P . 
N 8 HOH 22  222  212  HOH HOH P . 
N 8 HOH 23  223  213  HOH HOH P . 
N 8 HOH 24  224  207  HOH HOH P . 
N 8 HOH 25  225  206  HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6530  ? 
1 MORE         -52   ? 
1 'SSA (A^2)'  21910 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 83.5  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 99.1  ? 
3  O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 86.4  ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 100.5 ? 
5  O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 164.0 ? 
6  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 77.7  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O1    B J DPO .   ? A DPO 507 ? 1_555 163.1 ? 
8  O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O1    B J DPO .   ? A DPO 507 ? 1_555 88.9  ? 
9  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O1    B J DPO .   ? A DPO 507 ? 1_555 95.4  ? 
10 OP1   B C DA  9   ? P DA  9   ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O1    B J DPO .   ? A DPO 507 ? 1_555 90.9  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 90.5  ? 
12 O     ? A MET 17  ? A MET 14  ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 104.8 ? 
13 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 166.1 ? 
14 OP1   B C DA  9   ? P DA  9   ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 90.8  ? 
15 O1    B J DPO .   ? A DPO 507 ? 1_555 MN B E MN . ? A MN 502 ? 1_555 O5    B J DPO .   ? A DPO 507 ? 1_555 76.8  ? 
16 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 94.0  ? 
17 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 88.9  ? 
18 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 92.0  ? 
19 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 170.5 ? 
20 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 89.6  ? 
21 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 82.2  ? 
22 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 169.5 ? 
23 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 95.9  ? 
24 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 94.3  ? 
25 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 13.9  ? 
26 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 110.2 ? 
27 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 83.9  ? 
28 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 160.6 ? 
29 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 78.9  ? 
30 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 67.4  ? 
31 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 799 ? 1_555 87.5  ? 
32 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 799 ? 1_555 169.9 ? 
33 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 799 ? 1_555 98.0  ? 
34 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 799 ? 1_555 90.5  ? 
35 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 799 ? 1_555 82.2  ? 
36 OP1   B C DA  9   ? P DA  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? L HOH .   ? A HOH 799 ? 1_555 86.2  ? 
37 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 101.8 ? 
38 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 90.0  ? 
39 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 168.9 ? 
40 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 86.9  ? 
41 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 74.6  ? 
42 OP1   B C DA  9   ? P DA  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 10.2  ? 
43 O     ? L HOH .   ? A HOH 799 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A I DTP .   ? A DTP 506 ? 1_555 79.9  ? 
44 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O2    B J DPO .   ? A DPO 507 ? 1_555 76.3  ? 
45 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B L HOH .   ? A HOH 764 ? 1_555 85.6  ? 
46 O2    B J DPO .   ? A DPO 507 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B L HOH .   ? A HOH 764 ? 1_555 94.9  ? 
47 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B N HOH .   ? P HOH 215 ? 1_555 93.5  ? 
48 O2    B J DPO .   ? A DPO 507 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B N HOH .   ? P HOH 215 ? 1_555 96.7  ? 
49 O     B L HOH .   ? A HOH 764 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     B N HOH .   ? P HOH 215 ? 1_555 167.9 ? 
50 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     ? L HOH .   ? A HOH 667 ? 1_555 164.9 ? 
51 O2    B J DPO .   ? A DPO 507 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     ? L HOH .   ? A HOH 667 ? 1_555 94.6  ? 
52 O     B L HOH .   ? A HOH 764 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     ? L HOH .   ? A HOH 667 ? 1_555 83.2  ? 
53 O     B N HOH .   ? P HOH 215 ? 1_555 MN B K MN . ? P MN 101 ? 1_555 O     ? L HOH .   ? A HOH 667 ? 1_555 99.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2017-09-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Database references'        
3 2 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' pdbx_audit_support    
3 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_CSD'                  
2 2 'Structure model' '_pdbx_audit_support.funding_organization'  
3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .        1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 632 ? ? O A HOH 880 ? ? 2.07 
2 1 O A HOH 868 ? ? O A HOH 902 ? ? 2.10 
3 1 O A HOH 601 ? ? O A HOH 961 ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_1             312 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_2             312 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.559 
_pdbx_validate_rmsd_bond.bond_target_value         1.474 
_pdbx_validate_rmsd_bond.bond_deviation            0.085 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.014 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 38.51   53.97   
2 1 TYR A 39  ? ? 73.44   179.65  
3 1 LYS A 40  ? ? -150.27 -34.00  
4 1 SER A 62  ? ? 82.91   -13.20  
5 1 SER A 217 ? ? -154.26 -159.62 
6 1 SER A 257 ? ? 94.66   -11.05  
7 1 LYS A 376 ? ? 67.97   -60.14  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    375 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    376 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            80.85 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KG5 'double helix'        
5KG5 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 4  1_555 C DA 9 1_555 0.056  -0.212 0.070  -6.324 -6.655  3.559  1 T_DT4:DA9_P  T 4  ? P 9 ? 20 1 
1 B DA 5  1_555 C DT 8 1_555 -0.044 -0.041 0.043  -2.235 -8.008  4.065  2 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.049  -0.091 0.418  -2.872 -14.724 4.023  3 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.145 -0.175 -0.404 -6.413 -1.790  -0.775 4 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.123  -0.147 0.024  3.174  -3.513  -0.505 5 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.142  -0.111 -0.188 10.908 -7.623  2.801  6 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.235 -0.278 -0.181 -3.526 -8.898  4.134  7 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 -0.050 -0.122 0.230  -7.977 -4.192  -0.914 8 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.047 -0.217 0.001  11.542 -0.388  -0.147 9 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 4  1_555 C DA 9 1_555 B DA 5  1_555 C DT 8 1_555 0.643  0.012  3.266 -0.378 6.917 38.366 -0.818 -1.010 3.214 10.422 0.570   
38.963 1 TT_DT4DA5:DT8DA9_PP   T 4  ? P 9 ? T 5  ? P 8 ? 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.775  -1.001 3.428 -4.168 2.899 25.356 -3.053 -2.906 3.130 6.522  9.376   
25.851 2 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.504 -1.010 3.359 7.717  6.650 30.296 -3.017 2.286  2.868 12.295 -14.268 
31.925 3 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.536 -0.453 3.178 -3.146 2.498 33.296 -1.185 0.425  3.172 4.341  5.466   
33.531 4 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.265  -0.615 3.152 2.125  1.048 30.959 -1.344 -0.101 3.141 1.960  -3.973  
31.047 5 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.269 -0.454 3.774 -3.185 5.615 35.428 -1.651 -0.085 3.671 9.134  5.181   
35.993 6 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.576 -0.641 3.457 -4.382 1.913 35.813 -1.321 0.272  3.464 3.093  7.087   
36.120 7 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 -0.006 0.006  2.986 -0.622 2.324 28.013 -0.485 -0.120 2.976 4.789  1.282   
28.114 8 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Intramural DK036146-08' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION'                MN  
5 GLYCEROL                            GOL 
6 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
7 DIPHOSPHATE                         DPO 
8 water                               HOH 
#