data_5KHR
# 
_entry.id   5KHR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KHR         
WWPDB D_1000222243 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB . EMD-4025 'associated EM volume' 
EMDB . EMD-4021 'other EM volume'      
PDB  . 5KHU     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KHR 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'VanderLinden, R.' 1 
'Yamaguchi, M.'    2 
'Dube, P.'         3 
'Haselbach, D.'    4 
'Stark, H.'        5 
'Schulman, B.A.'   6 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            63 
_citation.language                  ? 
_citation.page_first                593 
_citation.page_last                 607 
_citation.title                     
'Cryo-EM of Mitotic Checkpoint Complex-Bound APC/C Reveals Reciprocal and Conformational Regulation of Ubiquitin Ligation.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2016.07.003 
_citation.pdbx_database_id_PubMed   27522463 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yamaguchi, M.'    1  
primary 'VanderLinden, R.' 2  
primary 'Weissmann, F.'    3  
primary 'Qiao, R.'         4  
primary 'Dube, P.'         5  
primary 'Brown, N.G.'      6  
primary 'Haselbach, D.'    7  
primary 'Zhang, W.'        8  
primary 'Sidhu, S.S.'      9  
primary 'Peters, J.M.'     10 
primary 'Stark, H.'        11 
primary 'Schulman, B.A.'   12 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer man 'Anaphase-promoting complex subunit 1'     216725.469 1 ?                 ? ? ? 
2  polymer man 'Anaphase-promoting complex subunit 11'    9854.647   1 ?                 ? ? ? 
3  polymer man 'Cell division cycle protein 23 homolog'   68921.031  2 ?                 ? ? ? 
4  polymer man 'Anaphase-promoting complex subunit 16'    11677.995  1 ?                 ? ? ? 
5  polymer man 'Cell division cycle protein 27 homolog'   91973.125  2 ?                 ? ? ? 
6  polymer man 'Anaphase-promoting complex subunit CDC26' 9793.999   2 ?                 ? ? ? 
7  polymer man 'Anaphase-promoting complex subunit 4'     93207.328  1 ?                 ? ? 
'Contains the remnant of a C-terminal linker and HRV14 3C protease site.'         
8  polymer man 'Cell division cycle protein 16 homolog'   71747.516  2 ?                 ? ? ? 
9  polymer man 'Anaphase-promoting complex subunit 10'    21282.143  1 ?                 ? ? ? 
10 polymer man 'Anaphase-promoting complex subunit 13'    8528.309   1 ?                 ? ? ? 
11 polymer man 'Anaphase-promoting complex subunit 2'     94023.055  1 ?                 ? ? ? 
12 polymer man 'Anaphase-promoting complex subunit 5'     85249.812  1 ?                 ? ? ? 
13 polymer man 'Ubiquitin-conjugating enzyme E2 C'        20748.438  1 2.3.2.23,2.3.2.24 ? ? 
'Contains the remnant of a C-terminal linker and HRV14 3C protease site.'         
14 polymer man 'Cell division cycle protein 20 homolog'   54796.508  1 ?                 ? ? ? 
15 polymer syn 'HSL1 peptide'                             3783.135   1 ?                 ? ? 
'Contains azidohomoalanine in place of K788 and is cross-linked to UBE2C and UB.' 
16 polymer man 'Anaphase-promoting complex subunit 7'     63204.020  2 ?                 ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'APC1,Cyclosome subunit 1,Mitotic checkpoint regulator,Testis-specific gene 24 protein' 
2  'APC11,Cyclosome subunit 11,Hepatocellular carcinoma-associated RING finger protein' 
3  'Anaphase-promoting complex subunit 8,APC8,Cyclosome subunit 8' 
4  'APC16,Cyclosome subunit 16' 
5  'Anaphase-promoting complex subunit 3,APC3,CDC27 homolog,CDC27Hs,H-NUC' 
6  'Anaphase-promoting complex subunit 12,APC12,Cell division cycle protein 26 homolog' 
7  'APC4,Cyclosome subunit 4' 
8  'Anaphase-promoting complex subunit 6,APC6,CDC16 homolog,CDC16Hs,Cyclosome subunit 6' 
9  'APC10,Cyclosome subunit 10' 
10 'APC13,Cyclosome subunit 13' 
11 'APC2,Cyclosome subunit 2' 
12 'APC5,Cyclosome subunit 5' 
13 
;(E3-independent) E2 ubiquitin-conjugating enzyme C,E2 ubiquitin-conjugating enzyme C,UbcH10,Ubiquitin carrier protein C,Ubiquitin-protein ligase C
;
14 p55CDC 
16 'APC7,Cyclosome subunit 7' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGV
SEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCIN
MHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSPVTSPFQ
NYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVHSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPET
EPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKPLSKLLGSLDEVVLLSPVPEL
RDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVK
WYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLG
PYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALY
ILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRL
LQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDL
NSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRP
PGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINV
DVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVL
LSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNR
YHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVN
MGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFM
NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
;
;MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGV
SEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCIN
MHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSPVTSPFQ
NYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVHSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPET
EPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKPLSKLLGSLDEVVLLSPVPEL
RDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVK
WYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLG
PYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALY
ILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRL
LQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDL
NSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRP
PGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINV
DVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVL
LSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNR
YHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVN
MGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFM
NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
;
A   ? 
2  'polypeptide(L)' no no 
;MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEW
KFKE
;
;MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEW
KFKE
;
B   ? 
3  'polypeptide(L)' no no 
;MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEED
AQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSK
KHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLA
HNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYR
AWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
;
;MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEED
AQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSK
KHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLA
HNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYR
AWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
;
C,P ? 
4  'polypeptide(L)' no no 
;MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARME
KLAGLVEELEADEWRFKPIEQLLGFTPSSG
;
;MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARME
KLAGLVEELEADEWRFKPIEQLLGFTPSSG
;
E   ? 
5  'polypeptide(L)' no no 
;MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCV
DLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGE
KPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKS
VARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKF
PPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYG
LGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGT
DESQESSMTDADDTQLHAAESDEF
;
;MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCV
DLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGE
KPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKS
VARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKF
PPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYG
LGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGT
DESQESSMTDADDTQLHAAESDEF
;
F,H ? 
6  'polypeptide(L)' no no 
;MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF
GSLEF
;
;MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF
GSLEF
;
G,W ? 
7  'polypeptide(L)' no no 
;MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLL
AFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEEN
SDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTL
LMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKA
NELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLD
AQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVE
KLDPELDSGGSLEVLFQG
;
;MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLL
AFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEEN
SDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTL
LMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKA
NELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLD
AQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVE
KLDPELDSGGSLEVLFQG
;
I   ? 
8  'polypeptide(L)' no no 
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
J,K ? 
9  'polypeptide(L)' no no 
;MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIY
ADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYT
PVEESSIGKFPRCTTIDFMMYRSIR
;
;MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIY
ADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYT
PVEESSIGKFPRCTTIDFMMYRSIR
;
L   ? 
10 'polypeptide(L)' no no MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN 
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN M   ? 
11 'polypeptide(L)' no no 
;MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQ
NDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGV
LFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNT
LRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLY
ISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFEPEREIRNVELLKLRFGEAPMHFCEVM
LKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHT
LGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQ
KKVRDQQLVYEAGVYRLPKNCS
;
;MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQ
NDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGV
LFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNT
LRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLY
ISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFEPEREIRNVELLKLRFGEAPMHFCEVM
LKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHT
LGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQ
KKVRDQQLVYEAGVYRLPKNCS
;
N   ? 
12 'polypeptide(L)' no no 
;MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYK
LIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQ
YFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQAELLKNDETKALEPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQA
ELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD
ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQA
LSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
;
;MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYK
LIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQ
YFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQAELLKNDETKALEPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQA
ELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD
ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQA
LSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
;
O   ? 
13 'polypeptide(L)' no no 
;MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYK
LSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPT
AFKKYLQETYSKQVTSQEPGGSGSLEVLFQ
;
;MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYK
LSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPT
AFKKYLQETYSKQVTSQEPGGSGSLEVLFQ
;
Q   ? 
14 'polypeptide(L)' no no 
;MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYI
PHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGS
SRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPD
GRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS
QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
;
;MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYI
PHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGS
SRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPD
GRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS
QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
;
R   ? 
15 'polypeptide(L)' no no 'NKENEGPEYPTKIE(UNK)YLEEQKPKRAALSDITNS' NKENEGPEYPTKIEXYLEEQKPKRAALSDITNS S   ? 
16 'polypeptide(L)' no no 
;MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTS
KVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKE
VLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLL
GSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKR
YSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVY
KTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQ
WFGMQ
;
;MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTS
KVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKE
VLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLL
GSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKR
YSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVY
KTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQ
WFGMQ
;
X,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    SER n 
1  3    ASN n 
1  4    PHE n 
1  5    TYR n 
1  6    GLU n 
1  7    GLU n 
1  8    ARG n 
1  9    THR n 
1  10   THR n 
1  11   MET n 
1  12   ILE n 
1  13   ALA n 
1  14   ALA n 
1  15   ARG n 
1  16   ASP n 
1  17   LEU n 
1  18   GLN n 
1  19   GLU n 
1  20   PHE n 
1  21   VAL n 
1  22   PRO n 
1  23   PHE n 
1  24   GLY n 
1  25   ARG n 
1  26   ASP n 
1  27   HIS n 
1  28   CYS n 
1  29   LYS n 
1  30   HIS n 
1  31   HIS n 
1  32   PRO n 
1  33   ASN n 
1  34   ALA n 
1  35   LEU n 
1  36   ASN n 
1  37   LEU n 
1  38   GLN n 
1  39   LEU n 
1  40   ARG n 
1  41   GLN n 
1  42   LEU n 
1  43   GLN n 
1  44   PRO n 
1  45   ALA n 
1  46   SER n 
1  47   GLU n 
1  48   LEU n 
1  49   TRP n 
1  50   SER n 
1  51   SER n 
1  52   ASP n 
1  53   GLY n 
1  54   ALA n 
1  55   ALA n 
1  56   GLY n 
1  57   LEU n 
1  58   VAL n 
1  59   GLY n 
1  60   SER n 
1  61   LEU n 
1  62   GLN n 
1  63   GLU n 
1  64   VAL n 
1  65   THR n 
1  66   ILE n 
1  67   HIS n 
1  68   GLU n 
1  69   LYS n 
1  70   GLN n 
1  71   LYS n 
1  72   GLU n 
1  73   SER n 
1  74   TRP n 
1  75   GLN n 
1  76   LEU n 
1  77   ARG n 
1  78   LYS n 
1  79   GLY n 
1  80   VAL n 
1  81   SER n 
1  82   GLU n 
1  83   ILE n 
1  84   GLY n 
1  85   GLU n 
1  86   ASP n 
1  87   VAL n 
1  88   ASP n 
1  89   TYR n 
1  90   ASP n 
1  91   GLU n 
1  92   GLU n 
1  93   LEU n 
1  94   TYR n 
1  95   VAL n 
1  96   ALA n 
1  97   GLY n 
1  98   ASN n 
1  99   MET n 
1  100  VAL n 
1  101  ILE n 
1  102  TRP n 
1  103  SER n 
1  104  LYS n 
1  105  GLY n 
1  106  SER n 
1  107  LYS n 
1  108  SER n 
1  109  GLN n 
1  110  ALA n 
1  111  LEU n 
1  112  ALA n 
1  113  VAL n 
1  114  TYR n 
1  115  LYS n 
1  116  ALA n 
1  117  PHE n 
1  118  THR n 
1  119  VAL n 
1  120  ASP n 
1  121  SER n 
1  122  PRO n 
1  123  VAL n 
1  124  GLN n 
1  125  GLN n 
1  126  ALA n 
1  127  LEU n 
1  128  TRP n 
1  129  CYS n 
1  130  ASP n 
1  131  PHE n 
1  132  ILE n 
1  133  ILE n 
1  134  SER n 
1  135  GLN n 
1  136  ASP n 
1  137  LYS n 
1  138  SER n 
1  139  GLU n 
1  140  LYS n 
1  141  ALA n 
1  142  TYR n 
1  143  SER n 
1  144  SER n 
1  145  ASN n 
1  146  GLU n 
1  147  VAL n 
1  148  GLU n 
1  149  LYS n 
1  150  CYS n 
1  151  ILE n 
1  152  CYS n 
1  153  ILE n 
1  154  LEU n 
1  155  GLN n 
1  156  SER n 
1  157  SER n 
1  158  CYS n 
1  159  ILE n 
1  160  ASN n 
1  161  MET n 
1  162  HIS n 
1  163  SER n 
1  164  ILE n 
1  165  GLU n 
1  166  GLY n 
1  167  LYS n 
1  168  ASP n 
1  169  TYR n 
1  170  ILE n 
1  171  ALA n 
1  172  SER n 
1  173  LEU n 
1  174  PRO n 
1  175  PHE n 
1  176  GLN n 
1  177  VAL n 
1  178  ALA n 
1  179  ASN n 
1  180  VAL n 
1  181  TRP n 
1  182  PRO n 
1  183  THR n 
1  184  LYS n 
1  185  TYR n 
1  186  GLY n 
1  187  LEU n 
1  188  LEU n 
1  189  PHE n 
1  190  GLU n 
1  191  ARG n 
1  192  SER n 
1  193  ALA n 
1  194  SER n 
1  195  SER n 
1  196  HIS n 
1  197  GLU n 
1  198  VAL n 
1  199  PRO n 
1  200  PRO n 
1  201  GLY n 
1  202  SER n 
1  203  PRO n 
1  204  ARG n 
1  205  GLU n 
1  206  PRO n 
1  207  LEU n 
1  208  PRO n 
1  209  THR n 
1  210  MET n 
1  211  PHE n 
1  212  SER n 
1  213  MET n 
1  214  LEU n 
1  215  HIS n 
1  216  PRO n 
1  217  LEU n 
1  218  ASP n 
1  219  GLU n 
1  220  ILE n 
1  221  THR n 
1  222  PRO n 
1  223  LEU n 
1  224  VAL n 
1  225  CYS n 
1  226  LYS n 
1  227  SER n 
1  228  GLY n 
1  229  SER n 
1  230  LEU n 
1  231  PHE n 
1  232  GLY n 
1  233  SER n 
1  234  SER n 
1  235  ARG n 
1  236  VAL n 
1  237  GLN n 
1  238  TYR n 
1  239  VAL n 
1  240  VAL n 
1  241  ASP n 
1  242  HIS n 
1  243  ALA n 
1  244  MET n 
1  245  LYS n 
1  246  ILE n 
1  247  VAL n 
1  248  PHE n 
1  249  LEU n 
1  250  ASN n 
1  251  THR n 
1  252  ASP n 
1  253  PRO n 
1  254  SER n 
1  255  ILE n 
1  256  VAL n 
1  257  MET n 
1  258  THR n 
1  259  TYR n 
1  260  ASP n 
1  261  ALA n 
1  262  VAL n 
1  263  GLN n 
1  264  ASN n 
1  265  VAL n 
1  266  HIS n 
1  267  SER n 
1  268  VAL n 
1  269  TRP n 
1  270  THR n 
1  271  LEU n 
1  272  ARG n 
1  273  ARG n 
1  274  VAL n 
1  275  LYS n 
1  276  SER n 
1  277  GLU n 
1  278  GLU n 
1  279  GLU n 
1  280  ASN n 
1  281  VAL n 
1  282  VAL n 
1  283  LEU n 
1  284  LYS n 
1  285  PHE n 
1  286  SER n 
1  287  GLU n 
1  288  GLN n 
1  289  GLY n 
1  290  GLY n 
1  291  THR n 
1  292  PRO n 
1  293  GLN n 
1  294  ASN n 
1  295  VAL n 
1  296  ALA n 
1  297  THR n 
1  298  SER n 
1  299  SER n 
1  300  SER n 
1  301  LEU n 
1  302  THR n 
1  303  ALA n 
1  304  HIS n 
1  305  LEU n 
1  306  ARG n 
1  307  SER n 
1  308  LEU n 
1  309  SER n 
1  310  LYS n 
1  311  GLY n 
1  312  ASP n 
1  313  SER n 
1  314  PRO n 
1  315  VAL n 
1  316  THR n 
1  317  SER n 
1  318  PRO n 
1  319  PHE n 
1  320  GLN n 
1  321  ASN n 
1  322  TYR n 
1  323  SER n 
1  324  SER n 
1  325  ILE n 
1  326  HIS n 
1  327  SER n 
1  328  GLN n 
1  329  SER n 
1  330  ARG n 
1  331  SER n 
1  332  THR n 
1  333  SER n 
1  334  SER n 
1  335  PRO n 
1  336  SER n 
1  337  LEU n 
1  338  HIS n 
1  339  SER n 
1  340  ARG n 
1  341  SER n 
1  342  PRO n 
1  343  SER n 
1  344  ILE n 
1  345  SER n 
1  346  ASN n 
1  347  MET n 
1  348  ALA n 
1  349  ALA n 
1  350  LEU n 
1  351  SER n 
1  352  ARG n 
1  353  ALA n 
1  354  HIS n 
1  355  SER n 
1  356  PRO n 
1  357  ALA n 
1  358  LEU n 
1  359  GLY n 
1  360  VAL n 
1  361  HIS n 
1  362  SER n 
1  363  PHE n 
1  364  SER n 
1  365  GLY n 
1  366  VAL n 
1  367  GLN n 
1  368  ARG n 
1  369  PHE n 
1  370  ASN n 
1  371  ILE n 
1  372  SER n 
1  373  SER n 
1  374  HIS n 
1  375  ASN n 
1  376  GLN n 
1  377  SER n 
1  378  PRO n 
1  379  LYS n 
1  380  ARG n 
1  381  HIS n 
1  382  SER n 
1  383  ILE n 
1  384  SER n 
1  385  HIS n 
1  386  SER n 
1  387  PRO n 
1  388  ASN n 
1  389  SER n 
1  390  ASN n 
1  391  SER n 
1  392  ASN n 
1  393  GLY n 
1  394  SER n 
1  395  PHE n 
1  396  LEU n 
1  397  ALA n 
1  398  PRO n 
1  399  GLU n 
1  400  THR n 
1  401  GLU n 
1  402  PRO n 
1  403  ILE n 
1  404  VAL n 
1  405  PRO n 
1  406  GLU n 
1  407  LEU n 
1  408  CYS n 
1  409  ILE n 
1  410  ASP n 
1  411  HIS n 
1  412  LEU n 
1  413  TRP n 
1  414  THR n 
1  415  GLU n 
1  416  THR n 
1  417  ILE n 
1  418  THR n 
1  419  ASN n 
1  420  ILE n 
1  421  ARG n 
1  422  GLU n 
1  423  LYS n 
1  424  ASN n 
1  425  SER n 
1  426  GLN n 
1  427  ALA n 
1  428  SER n 
1  429  LYS n 
1  430  VAL n 
1  431  PHE n 
1  432  ILE n 
1  433  THR n 
1  434  SER n 
1  435  ASP n 
1  436  LEU n 
1  437  CYS n 
1  438  GLY n 
1  439  GLN n 
1  440  LYS n 
1  441  PHE n 
1  442  LEU n 
1  443  CYS n 
1  444  PHE n 
1  445  LEU n 
1  446  VAL n 
1  447  GLU n 
1  448  SER n 
1  449  GLN n 
1  450  LEU n 
1  451  GLN n 
1  452  LEU n 
1  453  ARG n 
1  454  CYS n 
1  455  VAL n 
1  456  LYS n 
1  457  PHE n 
1  458  GLN n 
1  459  GLU n 
1  460  SER n 
1  461  ASN n 
1  462  ASP n 
1  463  LYS n 
1  464  THR n 
1  465  GLN n 
1  466  LEU n 
1  467  ILE n 
1  468  PHE n 
1  469  GLY n 
1  470  SER n 
1  471  VAL n 
1  472  THR n 
1  473  ASN n 
1  474  ILE n 
1  475  PRO n 
1  476  ALA n 
1  477  LYS n 
1  478  ASP n 
1  479  ALA n 
1  480  ALA n 
1  481  PRO n 
1  482  VAL n 
1  483  GLU n 
1  484  LYS n 
1  485  ILE n 
1  486  ASP n 
1  487  THR n 
1  488  MET n 
1  489  LEU n 
1  490  VAL n 
1  491  LEU n 
1  492  GLU n 
1  493  GLY n 
1  494  SER n 
1  495  GLY n 
1  496  ASN n 
1  497  LEU n 
1  498  VAL n 
1  499  LEU n 
1  500  TYR n 
1  501  THR n 
1  502  GLY n 
1  503  VAL n 
1  504  VAL n 
1  505  ARG n 
1  506  VAL n 
1  507  GLY n 
1  508  LYS n 
1  509  VAL n 
1  510  PHE n 
1  511  ILE n 
1  512  PRO n 
1  513  GLY n 
1  514  LEU n 
1  515  PRO n 
1  516  ALA n 
1  517  PRO n 
1  518  SER n 
1  519  LEU n 
1  520  THR n 
1  521  MET n 
1  522  SER n 
1  523  ASN n 
1  524  THR n 
1  525  MET n 
1  526  PRO n 
1  527  ARG n 
1  528  PRO n 
1  529  SER n 
1  530  THR n 
1  531  PRO n 
1  532  LEU n 
1  533  ASP n 
1  534  GLY n 
1  535  VAL n 
1  536  SER n 
1  537  THR n 
1  538  PRO n 
1  539  LYS n 
1  540  PRO n 
1  541  LEU n 
1  542  SER n 
1  543  LYS n 
1  544  LEU n 
1  545  LEU n 
1  546  GLY n 
1  547  SER n 
1  548  LEU n 
1  549  ASP n 
1  550  GLU n 
1  551  VAL n 
1  552  VAL n 
1  553  LEU n 
1  554  LEU n 
1  555  SER n 
1  556  PRO n 
1  557  VAL n 
1  558  PRO n 
1  559  GLU n 
1  560  LEU n 
1  561  ARG n 
1  562  ASP n 
1  563  SER n 
1  564  SER n 
1  565  LYS n 
1  566  LEU n 
1  567  HIS n 
1  568  ASP n 
1  569  SER n 
1  570  LEU n 
1  571  TYR n 
1  572  ASN n 
1  573  GLU n 
1  574  ASP n 
1  575  CYS n 
1  576  THR n 
1  577  PHE n 
1  578  GLN n 
1  579  GLN n 
1  580  LEU n 
1  581  GLY n 
1  582  THR n 
1  583  TYR n 
1  584  ILE n 
1  585  HIS n 
1  586  SER n 
1  587  ILE n 
1  588  ARG n 
1  589  ASP n 
1  590  PRO n 
1  591  VAL n 
1  592  HIS n 
1  593  ASN n 
1  594  ARG n 
1  595  VAL n 
1  596  THR n 
1  597  LEU n 
1  598  GLU n 
1  599  LEU n 
1  600  SER n 
1  601  ASN n 
1  602  GLY n 
1  603  SER n 
1  604  MET n 
1  605  VAL n 
1  606  ARG n 
1  607  ILE n 
1  608  THR n 
1  609  ILE n 
1  610  PRO n 
1  611  GLU n 
1  612  ILE n 
1  613  ALA n 
1  614  THR n 
1  615  SER n 
1  616  GLU n 
1  617  LEU n 
1  618  VAL n 
1  619  GLN n 
1  620  THR n 
1  621  CYS n 
1  622  LEU n 
1  623  GLN n 
1  624  ALA n 
1  625  ILE n 
1  626  LYS n 
1  627  PHE n 
1  628  ILE n 
1  629  LEU n 
1  630  PRO n 
1  631  LYS n 
1  632  GLU n 
1  633  ILE n 
1  634  ALA n 
1  635  VAL n 
1  636  GLN n 
1  637  MET n 
1  638  LEU n 
1  639  VAL n 
1  640  LYS n 
1  641  TRP n 
1  642  TYR n 
1  643  ASN n 
1  644  VAL n 
1  645  HIS n 
1  646  SER n 
1  647  ALA n 
1  648  PRO n 
1  649  GLY n 
1  650  GLY n 
1  651  PRO n 
1  652  SER n 
1  653  TYR n 
1  654  HIS n 
1  655  SER n 
1  656  GLU n 
1  657  TRP n 
1  658  ASN n 
1  659  LEU n 
1  660  PHE n 
1  661  VAL n 
1  662  THR n 
1  663  CYS n 
1  664  LEU n 
1  665  MET n 
1  666  ASN n 
1  667  MET n 
1  668  MET n 
1  669  GLY n 
1  670  TYR n 
1  671  ASN n 
1  672  THR n 
1  673  ASP n 
1  674  ARG n 
1  675  LEU n 
1  676  ALA n 
1  677  TRP n 
1  678  THR n 
1  679  ARG n 
1  680  ASN n 
1  681  PHE n 
1  682  ASP n 
1  683  PHE n 
1  684  GLU n 
1  685  GLY n 
1  686  SER n 
1  687  LEU n 
1  688  SER n 
1  689  PRO n 
1  690  VAL n 
1  691  ILE n 
1  692  ALA n 
1  693  PRO n 
1  694  LYS n 
1  695  LYS n 
1  696  ALA n 
1  697  ARG n 
1  698  PRO n 
1  699  SER n 
1  700  GLU n 
1  701  THR n 
1  702  GLY n 
1  703  SER n 
1  704  ASP n 
1  705  ASP n 
1  706  ASP n 
1  707  TRP n 
1  708  GLU n 
1  709  TYR n 
1  710  LEU n 
1  711  LEU n 
1  712  ASN n 
1  713  SER n 
1  714  ASP n 
1  715  TYR n 
1  716  HIS n 
1  717  GLN n 
1  718  ASN n 
1  719  VAL n 
1  720  GLU n 
1  721  SER n 
1  722  HIS n 
1  723  LEU n 
1  724  LEU n 
1  725  ASN n 
1  726  ARG n 
1  727  SER n 
1  728  LEU n 
1  729  CYS n 
1  730  LEU n 
1  731  SER n 
1  732  PRO n 
1  733  SER n 
1  734  GLU n 
1  735  ALA n 
1  736  SER n 
1  737  GLN n 
1  738  MET n 
1  739  LYS n 
1  740  ASP n 
1  741  GLU n 
1  742  ASP n 
1  743  PHE n 
1  744  SER n 
1  745  GLN n 
1  746  ASN n 
1  747  LEU n 
1  748  SER n 
1  749  LEU n 
1  750  ASP n 
1  751  SER n 
1  752  SER n 
1  753  THR n 
1  754  LEU n 
1  755  LEU n 
1  756  PHE n 
1  757  THR n 
1  758  HIS n 
1  759  ILE n 
1  760  PRO n 
1  761  ALA n 
1  762  ILE n 
1  763  PHE n 
1  764  PHE n 
1  765  VAL n 
1  766  LEU n 
1  767  HIS n 
1  768  LEU n 
1  769  VAL n 
1  770  TYR n 
1  771  GLU n 
1  772  GLU n 
1  773  LEU n 
1  774  LYS n 
1  775  LEU n 
1  776  ASN n 
1  777  THR n 
1  778  LEU n 
1  779  MET n 
1  780  GLY n 
1  781  GLU n 
1  782  GLY n 
1  783  ILE n 
1  784  CYS n 
1  785  SER n 
1  786  LEU n 
1  787  VAL n 
1  788  GLU n 
1  789  LEU n 
1  790  LEU n 
1  791  VAL n 
1  792  GLN n 
1  793  LEU n 
1  794  ALA n 
1  795  ARG n 
1  796  ASP n 
1  797  LEU n 
1  798  LYS n 
1  799  LEU n 
1  800  GLY n 
1  801  PRO n 
1  802  TYR n 
1  803  VAL n 
1  804  ASP n 
1  805  HIS n 
1  806  TYR n 
1  807  TYR n 
1  808  ARG n 
1  809  ASP n 
1  810  TYR n 
1  811  PRO n 
1  812  THR n 
1  813  LEU n 
1  814  VAL n 
1  815  ARG n 
1  816  THR n 
1  817  THR n 
1  818  GLY n 
1  819  GLN n 
1  820  VAL n 
1  821  CYS n 
1  822  THR n 
1  823  ILE n 
1  824  ASP n 
1  825  PRO n 
1  826  GLY n 
1  827  GLN n 
1  828  THR n 
1  829  GLY n 
1  830  PHE n 
1  831  MET n 
1  832  HIS n 
1  833  HIS n 
1  834  PRO n 
1  835  SER n 
1  836  PHE n 
1  837  PHE n 
1  838  THR n 
1  839  SER n 
1  840  GLU n 
1  841  PRO n 
1  842  PRO n 
1  843  SER n 
1  844  ILE n 
1  845  TYR n 
1  846  GLN n 
1  847  TRP n 
1  848  VAL n 
1  849  SER n 
1  850  SER n 
1  851  CYS n 
1  852  LEU n 
1  853  LYS n 
1  854  GLY n 
1  855  GLU n 
1  856  GLY n 
1  857  MET n 
1  858  PRO n 
1  859  PRO n 
1  860  TYR n 
1  861  PRO n 
1  862  TYR n 
1  863  LEU n 
1  864  PRO n 
1  865  GLY n 
1  866  ILE n 
1  867  CYS n 
1  868  GLU n 
1  869  ARG n 
1  870  SER n 
1  871  ARG n 
1  872  LEU n 
1  873  VAL n 
1  874  VAL n 
1  875  LEU n 
1  876  SER n 
1  877  ILE n 
1  878  ALA n 
1  879  LEU n 
1  880  TYR n 
1  881  ILE n 
1  882  LEU n 
1  883  GLY n 
1  884  ASP n 
1  885  GLU n 
1  886  SER n 
1  887  LEU n 
1  888  VAL n 
1  889  SER n 
1  890  ASP n 
1  891  GLU n 
1  892  SER n 
1  893  SER n 
1  894  GLN n 
1  895  TYR n 
1  896  LEU n 
1  897  THR n 
1  898  ARG n 
1  899  ILE n 
1  900  THR n 
1  901  ILE n 
1  902  ALA n 
1  903  PRO n 
1  904  GLN n 
1  905  LYS n 
1  906  LEU n 
1  907  GLN n 
1  908  VAL n 
1  909  GLU n 
1  910  GLN n 
1  911  GLU n 
1  912  GLU n 
1  913  ASN n 
1  914  ARG n 
1  915  PHE n 
1  916  SER n 
1  917  PHE n 
1  918  ARG n 
1  919  HIS n 
1  920  SER n 
1  921  THR n 
1  922  SER n 
1  923  VAL n 
1  924  SER n 
1  925  SER n 
1  926  LEU n 
1  927  ALA n 
1  928  GLU n 
1  929  ARG n 
1  930  LEU n 
1  931  VAL n 
1  932  VAL n 
1  933  TRP n 
1  934  MET n 
1  935  THR n 
1  936  ASN n 
1  937  VAL n 
1  938  GLY n 
1  939  PHE n 
1  940  THR n 
1  941  LEU n 
1  942  ARG n 
1  943  ASP n 
1  944  LEU n 
1  945  GLU n 
1  946  THR n 
1  947  LEU n 
1  948  PRO n 
1  949  PHE n 
1  950  GLY n 
1  951  ILE n 
1  952  ALA n 
1  953  LEU n 
1  954  PRO n 
1  955  ILE n 
1  956  ARG n 
1  957  ASP n 
1  958  ALA n 
1  959  ILE n 
1  960  TYR n 
1  961  HIS n 
1  962  CYS n 
1  963  ARG n 
1  964  GLU n 
1  965  GLN n 
1  966  PRO n 
1  967  ALA n 
1  968  SER n 
1  969  ASP n 
1  970  TRP n 
1  971  PRO n 
1  972  GLU n 
1  973  ALA n 
1  974  VAL n 
1  975  CYS n 
1  976  LEU n 
1  977  LEU n 
1  978  ILE n 
1  979  GLY n 
1  980  ARG n 
1  981  GLN n 
1  982  ASP n 
1  983  LEU n 
1  984  SER n 
1  985  LYS n 
1  986  GLN n 
1  987  ALA n 
1  988  CYS n 
1  989  GLU n 
1  990  GLY n 
1  991  ASN n 
1  992  LEU n 
1  993  PRO n 
1  994  LYS n 
1  995  GLY n 
1  996  LYS n 
1  997  SER n 
1  998  VAL n 
1  999  LEU n 
1  1000 SER n 
1  1001 SER n 
1  1002 ASP n 
1  1003 VAL n 
1  1004 PRO n 
1  1005 SER n 
1  1006 GLY n 
1  1007 THR n 
1  1008 GLU n 
1  1009 THR n 
1  1010 GLU n 
1  1011 GLU n 
1  1012 GLU n 
1  1013 ASP n 
1  1014 ASP n 
1  1015 GLY n 
1  1016 MET n 
1  1017 ASN n 
1  1018 ASP n 
1  1019 MET n 
1  1020 ASN n 
1  1021 HIS n 
1  1022 GLU n 
1  1023 VAL n 
1  1024 MET n 
1  1025 SER n 
1  1026 LEU n 
1  1027 ILE n 
1  1028 TRP n 
1  1029 SER n 
1  1030 GLU n 
1  1031 ASP n 
1  1032 LEU n 
1  1033 ARG n 
1  1034 VAL n 
1  1035 GLN n 
1  1036 ASP n 
1  1037 VAL n 
1  1038 ARG n 
1  1039 ARG n 
1  1040 LEU n 
1  1041 LEU n 
1  1042 GLN n 
1  1043 SER n 
1  1044 ALA n 
1  1045 HIS n 
1  1046 PRO n 
1  1047 VAL n 
1  1048 ARG n 
1  1049 VAL n 
1  1050 ASN n 
1  1051 VAL n 
1  1052 VAL n 
1  1053 GLN n 
1  1054 TYR n 
1  1055 PRO n 
1  1056 GLU n 
1  1057 LEU n 
1  1058 SER n 
1  1059 ASP n 
1  1060 HIS n 
1  1061 GLU n 
1  1062 PHE n 
1  1063 ILE n 
1  1064 GLU n 
1  1065 GLU n 
1  1066 LYS n 
1  1067 GLU n 
1  1068 ASN n 
1  1069 ARG n 
1  1070 LEU n 
1  1071 LEU n 
1  1072 GLN n 
1  1073 LEU n 
1  1074 CYS n 
1  1075 GLN n 
1  1076 ARG n 
1  1077 THR n 
1  1078 MET n 
1  1079 ALA n 
1  1080 LEU n 
1  1081 PRO n 
1  1082 VAL n 
1  1083 GLY n 
1  1084 ARG n 
1  1085 GLY n 
1  1086 MET n 
1  1087 PHE n 
1  1088 THR n 
1  1089 LEU n 
1  1090 PHE n 
1  1091 SER n 
1  1092 TYR n 
1  1093 HIS n 
1  1094 PRO n 
1  1095 VAL n 
1  1096 PRO n 
1  1097 THR n 
1  1098 GLU n 
1  1099 PRO n 
1  1100 LEU n 
1  1101 PRO n 
1  1102 ILE n 
1  1103 PRO n 
1  1104 LYS n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 LEU n 
1  1108 THR n 
1  1109 GLY n 
1  1110 ARG n 
1  1111 ALA n 
1  1112 PRO n 
1  1113 PRO n 
1  1114 ARG n 
1  1115 ASN n 
1  1116 THR n 
1  1117 THR n 
1  1118 VAL n 
1  1119 ASP n 
1  1120 LEU n 
1  1121 ASN n 
1  1122 SER n 
1  1123 GLY n 
1  1124 ASN n 
1  1125 ILE n 
1  1126 ASP n 
1  1127 VAL n 
1  1128 PRO n 
1  1129 PRO n 
1  1130 ASN n 
1  1131 MET n 
1  1132 THR n 
1  1133 SER n 
1  1134 TRP n 
1  1135 ALA n 
1  1136 SER n 
1  1137 PHE n 
1  1138 HIS n 
1  1139 ASN n 
1  1140 GLY n 
1  1141 VAL n 
1  1142 ALA n 
1  1143 ALA n 
1  1144 GLY n 
1  1145 LEU n 
1  1146 LYS n 
1  1147 ILE n 
1  1148 ALA n 
1  1149 PRO n 
1  1150 ALA n 
1  1151 SER n 
1  1152 GLN n 
1  1153 ILE n 
1  1154 ASP n 
1  1155 SER n 
1  1156 ALA n 
1  1157 TRP n 
1  1158 ILE n 
1  1159 VAL n 
1  1160 TYR n 
1  1161 ASN n 
1  1162 LYS n 
1  1163 PRO n 
1  1164 LYS n 
1  1165 HIS n 
1  1166 ALA n 
1  1167 GLU n 
1  1168 LEU n 
1  1169 ALA n 
1  1170 ASN n 
1  1171 GLU n 
1  1172 TYR n 
1  1173 ALA n 
1  1174 GLY n 
1  1175 PHE n 
1  1176 LEU n 
1  1177 MET n 
1  1178 ALA n 
1  1179 LEU n 
1  1180 GLY n 
1  1181 LEU n 
1  1182 ASN n 
1  1183 GLY n 
1  1184 HIS n 
1  1185 LEU n 
1  1186 THR n 
1  1187 LYS n 
1  1188 LEU n 
1  1189 ALA n 
1  1190 THR n 
1  1191 LEU n 
1  1192 ASN n 
1  1193 ILE n 
1  1194 HIS n 
1  1195 ASP n 
1  1196 TYR n 
1  1197 LEU n 
1  1198 THR n 
1  1199 LYS n 
1  1200 GLY n 
1  1201 HIS n 
1  1202 GLU n 
1  1203 MET n 
1  1204 THR n 
1  1205 SER n 
1  1206 ILE n 
1  1207 GLY n 
1  1208 LEU n 
1  1209 LEU n 
1  1210 LEU n 
1  1211 GLY n 
1  1212 VAL n 
1  1213 SER n 
1  1214 ALA n 
1  1215 ALA n 
1  1216 LYS n 
1  1217 LEU n 
1  1218 GLY n 
1  1219 THR n 
1  1220 MET n 
1  1221 ASP n 
1  1222 MET n 
1  1223 SER n 
1  1224 ILE n 
1  1225 THR n 
1  1226 ARG n 
1  1227 LEU n 
1  1228 LEU n 
1  1229 SER n 
1  1230 ILE n 
1  1231 HIS n 
1  1232 ILE n 
1  1233 PRO n 
1  1234 ALA n 
1  1235 LEU n 
1  1236 LEU n 
1  1237 PRO n 
1  1238 PRO n 
1  1239 THR n 
1  1240 SER n 
1  1241 THR n 
1  1242 GLU n 
1  1243 LEU n 
1  1244 ASP n 
1  1245 VAL n 
1  1246 PRO n 
1  1247 HIS n 
1  1248 ASN n 
1  1249 VAL n 
1  1250 GLN n 
1  1251 VAL n 
1  1252 ALA n 
1  1253 ALA n 
1  1254 VAL n 
1  1255 VAL n 
1  1256 GLY n 
1  1257 ILE n 
1  1258 GLY n 
1  1259 LEU n 
1  1260 VAL n 
1  1261 TYR n 
1  1262 GLN n 
1  1263 GLY n 
1  1264 THR n 
1  1265 ALA n 
1  1266 HIS n 
1  1267 ARG n 
1  1268 HIS n 
1  1269 THR n 
1  1270 ALA n 
1  1271 GLU n 
1  1272 VAL n 
1  1273 LEU n 
1  1274 LEU n 
1  1275 ALA n 
1  1276 GLU n 
1  1277 ILE n 
1  1278 GLY n 
1  1279 ARG n 
1  1280 PRO n 
1  1281 PRO n 
1  1282 GLY n 
1  1283 PRO n 
1  1284 GLU n 
1  1285 MET n 
1  1286 GLU n 
1  1287 TYR n 
1  1288 CYS n 
1  1289 THR n 
1  1290 ASP n 
1  1291 ARG n 
1  1292 GLU n 
1  1293 SER n 
1  1294 TYR n 
1  1295 SER n 
1  1296 LEU n 
1  1297 ALA n 
1  1298 ALA n 
1  1299 GLY n 
1  1300 LEU n 
1  1301 ALA n 
1  1302 LEU n 
1  1303 GLY n 
1  1304 MET n 
1  1305 VAL n 
1  1306 CYS n 
1  1307 LEU n 
1  1308 GLY n 
1  1309 HIS n 
1  1310 GLY n 
1  1311 SER n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 ILE n 
1  1315 GLY n 
1  1316 MET n 
1  1317 SER n 
1  1318 ASP n 
1  1319 LEU n 
1  1320 ASN n 
1  1321 VAL n 
1  1322 PRO n 
1  1323 GLU n 
1  1324 GLN n 
1  1325 LEU n 
1  1326 TYR n 
1  1327 GLN n 
1  1328 TYR n 
1  1329 MET n 
1  1330 VAL n 
1  1331 GLY n 
1  1332 GLY n 
1  1333 HIS n 
1  1334 ARG n 
1  1335 ARG n 
1  1336 PHE n 
1  1337 GLN n 
1  1338 THR n 
1  1339 GLY n 
1  1340 MET n 
1  1341 HIS n 
1  1342 ARG n 
1  1343 GLU n 
1  1344 LYS n 
1  1345 HIS n 
1  1346 LYS n 
1  1347 SER n 
1  1348 PRO n 
1  1349 SER n 
1  1350 TYR n 
1  1351 GLN n 
1  1352 ILE n 
1  1353 LYS n 
1  1354 GLU n 
1  1355 GLY n 
1  1356 ASP n 
1  1357 THR n 
1  1358 ILE n 
1  1359 ASN n 
1  1360 VAL n 
1  1361 ASP n 
1  1362 VAL n 
1  1363 THR n 
1  1364 CYS n 
1  1365 PRO n 
1  1366 GLY n 
1  1367 ALA n 
1  1368 THR n 
1  1369 LEU n 
1  1370 ALA n 
1  1371 LEU n 
1  1372 ALA n 
1  1373 MET n 
1  1374 ILE n 
1  1375 TYR n 
1  1376 LEU n 
1  1377 LYS n 
1  1378 THR n 
1  1379 ASN n 
1  1380 ASN n 
1  1381 ARG n 
1  1382 SER n 
1  1383 ILE n 
1  1384 ALA n 
1  1385 ASP n 
1  1386 TRP n 
1  1387 LEU n 
1  1388 ARG n 
1  1389 ALA n 
1  1390 PRO n 
1  1391 ASP n 
1  1392 THR n 
1  1393 MET n 
1  1394 TYR n 
1  1395 LEU n 
1  1396 LEU n 
1  1397 ASP n 
1  1398 PHE n 
1  1399 VAL n 
1  1400 LYS n 
1  1401 PRO n 
1  1402 GLU n 
1  1403 PHE n 
1  1404 LEU n 
1  1405 LEU n 
1  1406 LEU n 
1  1407 ARG n 
1  1408 THR n 
1  1409 LEU n 
1  1410 ALA n 
1  1411 ARG n 
1  1412 CYS n 
1  1413 LEU n 
1  1414 ILE n 
1  1415 LEU n 
1  1416 TRP n 
1  1417 ASP n 
1  1418 ASP n 
1  1419 ILE n 
1  1420 LEU n 
1  1421 PRO n 
1  1422 ASN n 
1  1423 SER n 
1  1424 LYS n 
1  1425 TRP n 
1  1426 VAL n 
1  1427 ASP n 
1  1428 SER n 
1  1429 ASN n 
1  1430 VAL n 
1  1431 PRO n 
1  1432 GLN n 
1  1433 ILE n 
1  1434 ILE n 
1  1435 ARG n 
1  1436 GLU n 
1  1437 ASN n 
1  1438 SER n 
1  1439 ILE n 
1  1440 SER n 
1  1441 LEU n 
1  1442 SER n 
1  1443 GLU n 
1  1444 ILE n 
1  1445 GLU n 
1  1446 LEU n 
1  1447 PRO n 
1  1448 CYS n 
1  1449 SER n 
1  1450 GLU n 
1  1451 ASP n 
1  1452 LEU n 
1  1453 ASN n 
1  1454 LEU n 
1  1455 GLU n 
1  1456 THR n 
1  1457 LEU n 
1  1458 SER n 
1  1459 GLN n 
1  1460 ALA n 
1  1461 HIS n 
1  1462 VAL n 
1  1463 TYR n 
1  1464 ILE n 
1  1465 ILE n 
1  1466 ALA n 
1  1467 GLY n 
1  1468 ALA n 
1  1469 CYS n 
1  1470 LEU n 
1  1471 SER n 
1  1472 LEU n 
1  1473 GLY n 
1  1474 PHE n 
1  1475 ARG n 
1  1476 PHE n 
1  1477 ALA n 
1  1478 GLY n 
1  1479 SER n 
1  1480 GLU n 
1  1481 ASN n 
1  1482 LEU n 
1  1483 SER n 
1  1484 ALA n 
1  1485 PHE n 
1  1486 ASN n 
1  1487 CYS n 
1  1488 LEU n 
1  1489 HIS n 
1  1490 LYS n 
1  1491 PHE n 
1  1492 ALA n 
1  1493 LYS n 
1  1494 ASP n 
1  1495 PHE n 
1  1496 MET n 
1  1497 THR n 
1  1498 TYR n 
1  1499 LEU n 
1  1500 SER n 
1  1501 ALA n 
1  1502 PRO n 
1  1503 ASN n 
1  1504 ALA n 
1  1505 SER n 
1  1506 VAL n 
1  1507 THR n 
1  1508 GLY n 
1  1509 PRO n 
1  1510 HIS n 
1  1511 ASN n 
1  1512 LEU n 
1  1513 GLU n 
1  1514 THR n 
1  1515 CYS n 
1  1516 LEU n 
1  1517 SER n 
1  1518 VAL n 
1  1519 VAL n 
1  1520 LEU n 
1  1521 LEU n 
1  1522 SER n 
1  1523 LEU n 
1  1524 ALA n 
1  1525 MET n 
1  1526 VAL n 
1  1527 MET n 
1  1528 ALA n 
1  1529 GLY n 
1  1530 SER n 
1  1531 GLY n 
1  1532 ASN n 
1  1533 LEU n 
1  1534 LYS n 
1  1535 VAL n 
1  1536 LEU n 
1  1537 GLN n 
1  1538 LEU n 
1  1539 CYS n 
1  1540 ARG n 
1  1541 PHE n 
1  1542 LEU n 
1  1543 HIS n 
1  1544 MET n 
1  1545 LYS n 
1  1546 THR n 
1  1547 GLY n 
1  1548 GLY n 
1  1549 GLU n 
1  1550 MET n 
1  1551 ASN n 
1  1552 TYR n 
1  1553 GLY n 
1  1554 PHE n 
1  1555 HIS n 
1  1556 LEU n 
1  1557 ALA n 
1  1558 HIS n 
1  1559 HIS n 
1  1560 MET n 
1  1561 ALA n 
1  1562 LEU n 
1  1563 GLY n 
1  1564 LEU n 
1  1565 LEU n 
1  1566 PHE n 
1  1567 LEU n 
1  1568 GLY n 
1  1569 GLY n 
1  1570 GLY n 
1  1571 ARG n 
1  1572 TYR n 
1  1573 SER n 
1  1574 LEU n 
1  1575 SER n 
1  1576 THR n 
1  1577 SER n 
1  1578 ASN n 
1  1579 SER n 
1  1580 SER n 
1  1581 ILE n 
1  1582 ALA n 
1  1583 ALA n 
1  1584 LEU n 
1  1585 LEU n 
1  1586 CYS n 
1  1587 ALA n 
1  1588 LEU n 
1  1589 TYR n 
1  1590 PRO n 
1  1591 HIS n 
1  1592 PHE n 
1  1593 PRO n 
1  1594 ALA n 
1  1595 HIS n 
1  1596 SER n 
1  1597 THR n 
1  1598 ASP n 
1  1599 ASN n 
1  1600 ARG n 
1  1601 TYR n 
1  1602 HIS n 
1  1603 LEU n 
1  1604 GLN n 
1  1605 ALA n 
1  1606 LEU n 
1  1607 ARG n 
1  1608 HIS n 
1  1609 LEU n 
1  1610 TYR n 
1  1611 VAL n 
1  1612 LEU n 
1  1613 ALA n 
1  1614 ALA n 
1  1615 GLU n 
1  1616 PRO n 
1  1617 ARG n 
1  1618 LEU n 
1  1619 LEU n 
1  1620 VAL n 
1  1621 PRO n 
1  1622 VAL n 
1  1623 ASP n 
1  1624 VAL n 
1  1625 ASP n 
1  1626 THR n 
1  1627 ASN n 
1  1628 THR n 
1  1629 PRO n 
1  1630 CYS n 
1  1631 TYR n 
1  1632 ALA n 
1  1633 LEU n 
1  1634 LEU n 
1  1635 GLU n 
1  1636 VAL n 
1  1637 THR n 
1  1638 TYR n 
1  1639 LYS n 
1  1640 GLY n 
1  1641 THR n 
1  1642 GLN n 
1  1643 TRP n 
1  1644 TYR n 
1  1645 GLU n 
1  1646 GLN n 
1  1647 THR n 
1  1648 LYS n 
1  1649 GLU n 
1  1650 GLU n 
1  1651 LEU n 
1  1652 MET n 
1  1653 ALA n 
1  1654 PRO n 
1  1655 THR n 
1  1656 LEU n 
1  1657 LEU n 
1  1658 PRO n 
1  1659 GLU n 
1  1660 LEU n 
1  1661 HIS n 
1  1662 LEU n 
1  1663 LEU n 
1  1664 LYS n 
1  1665 GLN n 
1  1666 ILE n 
1  1667 LYS n 
1  1668 VAL n 
1  1669 LYS n 
1  1670 GLY n 
1  1671 PRO n 
1  1672 ARG n 
1  1673 TYR n 
1  1674 TRP n 
1  1675 GLU n 
1  1676 LEU n 
1  1677 LEU n 
1  1678 ILE n 
1  1679 ASP n 
1  1680 LEU n 
1  1681 SER n 
1  1682 LYS n 
1  1683 GLY n 
1  1684 THR n 
1  1685 GLN n 
1  1686 HIS n 
1  1687 LEU n 
1  1688 LYS n 
1  1689 SER n 
1  1690 ILE n 
1  1691 LEU n 
1  1692 SER n 
1  1693 LYS n 
1  1694 ASP n 
1  1695 GLY n 
1  1696 VAL n 
1  1697 LEU n 
1  1698 TYR n 
1  1699 VAL n 
1  1700 LYS n 
1  1701 LEU n 
1  1702 ARG n 
1  1703 ALA n 
1  1704 GLY n 
1  1705 GLN n 
1  1706 LEU n 
1  1707 SER n 
1  1708 TYR n 
1  1709 LYS n 
1  1710 GLU n 
1  1711 ASP n 
1  1712 PRO n 
1  1713 MET n 
1  1714 GLY n 
1  1715 TRP n 
1  1716 GLN n 
1  1717 SER n 
1  1718 LEU n 
1  1719 LEU n 
1  1720 ALA n 
1  1721 GLN n 
1  1722 THR n 
1  1723 VAL n 
1  1724 ALA n 
1  1725 ASN n 
1  1726 ARG n 
1  1727 ASN n 
1  1728 SER n 
1  1729 GLU n 
1  1730 ALA n 
1  1731 ARG n 
1  1732 ALA n 
1  1733 PHE n 
1  1734 LYS n 
1  1735 PRO n 
1  1736 GLU n 
1  1737 THR n 
1  1738 ILE n 
1  1739 SER n 
1  1740 ALA n 
1  1741 PHE n 
1  1742 THR n 
1  1743 SER n 
1  1744 ASP n 
1  1745 PRO n 
1  1746 ALA n 
1  1747 LEU n 
1  1748 LEU n 
1  1749 SER n 
1  1750 PHE n 
1  1751 ALA n 
1  1752 GLU n 
1  1753 TYR n 
1  1754 PHE n 
1  1755 CYS n 
1  1756 LYS n 
1  1757 PRO n 
1  1758 THR n 
1  1759 VAL n 
1  1760 ASN n 
1  1761 MET n 
1  1762 GLY n 
1  1763 GLN n 
1  1764 LYS n 
1  1765 GLN n 
1  1766 GLU n 
1  1767 ILE n 
1  1768 LEU n 
1  1769 ASP n 
1  1770 LEU n 
1  1771 PHE n 
1  1772 SER n 
1  1773 SER n 
1  1774 VAL n 
1  1775 LEU n 
1  1776 TYR n 
1  1777 GLU n 
1  1778 CYS n 
1  1779 VAL n 
1  1780 THR n 
1  1781 GLN n 
1  1782 GLU n 
1  1783 THR n 
1  1784 PRO n 
1  1785 GLU n 
1  1786 MET n 
1  1787 LEU n 
1  1788 PRO n 
1  1789 ALA n 
1  1790 TYR n 
1  1791 ILE n 
1  1792 ALA n 
1  1793 MET n 
1  1794 ASP n 
1  1795 GLN n 
1  1796 ALA n 
1  1797 ILE n 
1  1798 ARG n 
1  1799 ARG n 
1  1800 LEU n 
1  1801 GLY n 
1  1802 ARG n 
1  1803 ARG n 
1  1804 GLU n 
1  1805 MET n 
1  1806 SER n 
1  1807 GLU n 
1  1808 THR n 
1  1809 SER n 
1  1810 GLU n 
1  1811 LEU n 
1  1812 TRP n 
1  1813 GLN n 
1  1814 ILE n 
1  1815 LYS n 
1  1816 LEU n 
1  1817 VAL n 
1  1818 LEU n 
1  1819 GLU n 
1  1820 PHE n 
1  1821 PHE n 
1  1822 SER n 
1  1823 SER n 
1  1824 ARG n 
1  1825 SER n 
1  1826 HIS n 
1  1827 GLN n 
1  1828 GLU n 
1  1829 ARG n 
1  1830 LEU n 
1  1831 GLN n 
1  1832 ASN n 
1  1833 HIS n 
1  1834 PRO n 
1  1835 LYS n 
1  1836 ARG n 
1  1837 GLY n 
1  1838 LEU n 
1  1839 PHE n 
1  1840 MET n 
1  1841 ASN n 
1  1842 SER n 
1  1843 GLU n 
1  1844 PHE n 
1  1845 LEU n 
1  1846 PRO n 
1  1847 VAL n 
1  1848 VAL n 
1  1849 LYS n 
1  1850 CYS n 
1  1851 THR n 
1  1852 ILE n 
1  1853 ASP n 
1  1854 ASN n 
1  1855 THR n 
1  1856 LEU n 
1  1857 ASP n 
1  1858 GLN n 
1  1859 TRP n 
1  1860 LEU n 
1  1861 GLN n 
1  1862 VAL n 
1  1863 GLY n 
1  1864 GLY n 
1  1865 ASP n 
1  1866 MET n 
1  1867 CYS n 
1  1868 VAL n 
1  1869 HIS n 
1  1870 ALA n 
1  1871 TYR n 
1  1872 LEU n 
1  1873 SER n 
1  1874 GLY n 
1  1875 GLN n 
1  1876 PRO n 
1  1877 LEU n 
1  1878 GLU n 
1  1879 GLU n 
1  1880 SER n 
1  1881 GLN n 
1  1882 LEU n 
1  1883 SER n 
1  1884 MET n 
1  1885 LEU n 
1  1886 ALA n 
1  1887 CYS n 
1  1888 PHE n 
1  1889 LEU n 
1  1890 VAL n 
1  1891 TYR n 
1  1892 HIS n 
1  1893 SER n 
1  1894 VAL n 
1  1895 PRO n 
1  1896 ALA n 
1  1897 PRO n 
1  1898 GLN n 
1  1899 HIS n 
1  1900 LEU n 
1  1901 PRO n 
1  1902 PRO n 
1  1903 ILE n 
1  1904 GLY n 
1  1905 LEU n 
1  1906 GLU n 
1  1907 GLY n 
1  1908 SER n 
1  1909 THR n 
1  1910 SER n 
1  1911 PHE n 
1  1912 ALA n 
1  1913 GLU n 
1  1914 LEU n 
1  1915 LEU n 
1  1916 PHE n 
1  1917 LYS n 
1  1918 PHE n 
1  1919 LYS n 
1  1920 GLN n 
1  1921 LEU n 
1  1922 LYS n 
1  1923 MET n 
1  1924 PRO n 
1  1925 VAL n 
1  1926 ARG n 
1  1927 ALA n 
1  1928 LEU n 
1  1929 LEU n 
1  1930 ARG n 
1  1931 LEU n 
1  1932 ALA n 
1  1933 PRO n 
1  1934 LEU n 
1  1935 LEU n 
1  1936 LEU n 
1  1937 GLY n 
1  1938 ASN n 
1  1939 PRO n 
1  1940 GLN n 
1  1941 PRO n 
1  1942 MET n 
1  1943 VAL n 
1  1944 MET n 
2  1    MET n 
2  2    LYS n 
2  3    VAL n 
2  4    LYS n 
2  5    ILE n 
2  6    LYS n 
2  7    CYS n 
2  8    TRP n 
2  9    ASN n 
2  10   GLY n 
2  11   VAL n 
2  12   ALA n 
2  13   THR n 
2  14   TRP n 
2  15   LEU n 
2  16   TRP n 
2  17   VAL n 
2  18   ALA n 
2  19   ASN n 
2  20   ASP n 
2  21   GLU n 
2  22   ASN n 
2  23   CYS n 
2  24   GLY n 
2  25   ILE n 
2  26   CYS n 
2  27   ARG n 
2  28   MET n 
2  29   ALA n 
2  30   PHE n 
2  31   ASN n 
2  32   GLY n 
2  33   CYS n 
2  34   CYS n 
2  35   PRO n 
2  36   ASP n 
2  37   CYS n 
2  38   LYS n 
2  39   VAL n 
2  40   PRO n 
2  41   GLY n 
2  42   ASP n 
2  43   ASP n 
2  44   CYS n 
2  45   PRO n 
2  46   LEU n 
2  47   VAL n 
2  48   TRP n 
2  49   GLY n 
2  50   GLN n 
2  51   CYS n 
2  52   SER n 
2  53   HIS n 
2  54   CYS n 
2  55   PHE n 
2  56   HIS n 
2  57   MET n 
2  58   HIS n 
2  59   CYS n 
2  60   ILE n 
2  61   LEU n 
2  62   LYS n 
2  63   TRP n 
2  64   LEU n 
2  65   HIS n 
2  66   ALA n 
2  67   GLN n 
2  68   GLN n 
2  69   VAL n 
2  70   GLN n 
2  71   GLN n 
2  72   HIS n 
2  73   CYS n 
2  74   PRO n 
2  75   MET n 
2  76   CYS n 
2  77   ARG n 
2  78   GLN n 
2  79   GLU n 
2  80   TRP n 
2  81   LYS n 
2  82   PHE n 
2  83   LYS n 
2  84   GLU n 
3  1    MET n 
3  2    ALA n 
3  3    ALA n 
3  4    SER n 
3  5    THR n 
3  6    SER n 
3  7    MET n 
3  8    VAL n 
3  9    PRO n 
3  10   VAL n 
3  11   ALA n 
3  12   VAL n 
3  13   THR n 
3  14   ALA n 
3  15   ALA n 
3  16   VAL n 
3  17   ALA n 
3  18   PRO n 
3  19   VAL n 
3  20   LEU n 
3  21   SER n 
3  22   ILE n 
3  23   ASN n 
3  24   SER n 
3  25   ASP n 
3  26   PHE n 
3  27   SER n 
3  28   ASP n 
3  29   LEU n 
3  30   ARG n 
3  31   GLU n 
3  32   ILE n 
3  33   LYS n 
3  34   LYS n 
3  35   GLN n 
3  36   LEU n 
3  37   LEU n 
3  38   LEU n 
3  39   ILE n 
3  40   ALA n 
3  41   GLY n 
3  42   LEU n 
3  43   THR n 
3  44   ARG n 
3  45   GLU n 
3  46   ARG n 
3  47   GLY n 
3  48   LEU n 
3  49   LEU n 
3  50   HIS n 
3  51   SER n 
3  52   SER n 
3  53   LYS n 
3  54   TRP n 
3  55   SER n 
3  56   ALA n 
3  57   GLU n 
3  58   LEU n 
3  59   ALA n 
3  60   PHE n 
3  61   SER n 
3  62   LEU n 
3  63   PRO n 
3  64   ALA n 
3  65   LEU n 
3  66   PRO n 
3  67   LEU n 
3  68   ALA n 
3  69   GLU n 
3  70   LEU n 
3  71   GLN n 
3  72   PRO n 
3  73   PRO n 
3  74   PRO n 
3  75   PRO n 
3  76   ILE n 
3  77   THR n 
3  78   GLU n 
3  79   GLU n 
3  80   ASP n 
3  81   ALA n 
3  82   GLN n 
3  83   ASP n 
3  84   MET n 
3  85   ASP n 
3  86   ALA n 
3  87   TYR n 
3  88   THR n 
3  89   LEU n 
3  90   ALA n 
3  91   LYS n 
3  92   ALA n 
3  93   TYR n 
3  94   PHE n 
3  95   ASP n 
3  96   VAL n 
3  97   LYS n 
3  98   GLU n 
3  99   TYR n 
3  100  ASP n 
3  101  ARG n 
3  102  ALA n 
3  103  ALA n 
3  104  HIS n 
3  105  PHE n 
3  106  LEU n 
3  107  HIS n 
3  108  GLY n 
3  109  CYS n 
3  110  ASN n 
3  111  SER n 
3  112  LYS n 
3  113  LYS n 
3  114  ALA n 
3  115  TYR n 
3  116  PHE n 
3  117  LEU n 
3  118  TYR n 
3  119  MET n 
3  120  TYR n 
3  121  SER n 
3  122  ARG n 
3  123  TYR n 
3  124  LEU n 
3  125  SER n 
3  126  GLY n 
3  127  GLU n 
3  128  LYS n 
3  129  LYS n 
3  130  LYS n 
3  131  ASP n 
3  132  ASP n 
3  133  GLU n 
3  134  THR n 
3  135  VAL n 
3  136  ASP n 
3  137  SER n 
3  138  LEU n 
3  139  GLY n 
3  140  PRO n 
3  141  LEU n 
3  142  GLU n 
3  143  LYS n 
3  144  GLY n 
3  145  GLN n 
3  146  VAL n 
3  147  LYS n 
3  148  ASN n 
3  149  GLU n 
3  150  ALA n 
3  151  LEU n 
3  152  ARG n 
3  153  GLU n 
3  154  LEU n 
3  155  ARG n 
3  156  VAL n 
3  157  GLU n 
3  158  LEU n 
3  159  SER n 
3  160  LYS n 
3  161  LYS n 
3  162  HIS n 
3  163  GLN n 
3  164  ALA n 
3  165  ARG n 
3  166  GLU n 
3  167  LEU n 
3  168  ASP n 
3  169  GLY n 
3  170  PHE n 
3  171  GLY n 
3  172  LEU n 
3  173  TYR n 
3  174  LEU n 
3  175  TYR n 
3  176  GLY n 
3  177  VAL n 
3  178  VAL n 
3  179  LEU n 
3  180  ARG n 
3  181  LYS n 
3  182  LEU n 
3  183  ASP n 
3  184  LEU n 
3  185  VAL n 
3  186  LYS n 
3  187  GLU n 
3  188  ALA n 
3  189  ILE n 
3  190  ASP n 
3  191  VAL n 
3  192  PHE n 
3  193  VAL n 
3  194  GLU n 
3  195  ALA n 
3  196  THR n 
3  197  HIS n 
3  198  VAL n 
3  199  LEU n 
3  200  PRO n 
3  201  LEU n 
3  202  HIS n 
3  203  TRP n 
3  204  GLY n 
3  205  ALA n 
3  206  TRP n 
3  207  LEU n 
3  208  GLU n 
3  209  LEU n 
3  210  CYS n 
3  211  ASN n 
3  212  LEU n 
3  213  ILE n 
3  214  THR n 
3  215  ASP n 
3  216  LYS n 
3  217  GLU n 
3  218  MET n 
3  219  LEU n 
3  220  LYS n 
3  221  PHE n 
3  222  LEU n 
3  223  SER n 
3  224  LEU n 
3  225  PRO n 
3  226  ASP n 
3  227  THR n 
3  228  TRP n 
3  229  MET n 
3  230  LYS n 
3  231  GLU n 
3  232  PHE n 
3  233  PHE n 
3  234  LEU n 
3  235  ALA n 
3  236  HIS n 
3  237  ILE n 
3  238  TYR n 
3  239  THR n 
3  240  GLU n 
3  241  LEU n 
3  242  GLN n 
3  243  LEU n 
3  244  ILE n 
3  245  GLU n 
3  246  GLU n 
3  247  ALA n 
3  248  LEU n 
3  249  GLN n 
3  250  LYS n 
3  251  TYR n 
3  252  GLN n 
3  253  ASN n 
3  254  LEU n 
3  255  ILE n 
3  256  ASP n 
3  257  VAL n 
3  258  GLY n 
3  259  PHE n 
3  260  SER n 
3  261  LYS n 
3  262  SER n 
3  263  SER n 
3  264  TYR n 
3  265  ILE n 
3  266  VAL n 
3  267  SER n 
3  268  GLN n 
3  269  ILE n 
3  270  ALA n 
3  271  VAL n 
3  272  ALA n 
3  273  TYR n 
3  274  HIS n 
3  275  ASN n 
3  276  ILE n 
3  277  ARG n 
3  278  ASP n 
3  279  ILE n 
3  280  ASP n 
3  281  LYS n 
3  282  ALA n 
3  283  LEU n 
3  284  SER n 
3  285  ILE n 
3  286  PHE n 
3  287  ASN n 
3  288  GLU n 
3  289  LEU n 
3  290  ARG n 
3  291  LYS n 
3  292  GLN n 
3  293  ASP n 
3  294  PRO n 
3  295  TYR n 
3  296  ARG n 
3  297  ILE n 
3  298  GLU n 
3  299  ASN n 
3  300  MET n 
3  301  ASP n 
3  302  THR n 
3  303  PHE n 
3  304  SER n 
3  305  ASN n 
3  306  LEU n 
3  307  LEU n 
3  308  TYR n 
3  309  VAL n 
3  310  ARG n 
3  311  SER n 
3  312  MET n 
3  313  LYS n 
3  314  SER n 
3  315  GLU n 
3  316  LEU n 
3  317  SER n 
3  318  TYR n 
3  319  LEU n 
3  320  ALA n 
3  321  HIS n 
3  322  ASN n 
3  323  LEU n 
3  324  CYS n 
3  325  GLU n 
3  326  ILE n 
3  327  ASP n 
3  328  LYS n 
3  329  TYR n 
3  330  ARG n 
3  331  VAL n 
3  332  GLU n 
3  333  THR n 
3  334  CYS n 
3  335  CYS n 
3  336  VAL n 
3  337  ILE n 
3  338  GLY n 
3  339  ASN n 
3  340  TYR n 
3  341  TYR n 
3  342  SER n 
3  343  LEU n 
3  344  ARG n 
3  345  SER n 
3  346  GLN n 
3  347  HIS n 
3  348  GLU n 
3  349  LYS n 
3  350  ALA n 
3  351  ALA n 
3  352  LEU n 
3  353  TYR n 
3  354  PHE n 
3  355  GLN n 
3  356  ARG n 
3  357  ALA n 
3  358  LEU n 
3  359  LYS n 
3  360  LEU n 
3  361  ASN n 
3  362  PRO n 
3  363  ARG n 
3  364  TYR n 
3  365  LEU n 
3  366  GLY n 
3  367  ALA n 
3  368  TRP n 
3  369  THR n 
3  370  LEU n 
3  371  MET n 
3  372  GLY n 
3  373  HIS n 
3  374  GLU n 
3  375  TYR n 
3  376  MET n 
3  377  GLU n 
3  378  MET n 
3  379  LYS n 
3  380  ASN n 
3  381  THR n 
3  382  SER n 
3  383  ALA n 
3  384  ALA n 
3  385  ILE n 
3  386  GLN n 
3  387  ALA n 
3  388  TYR n 
3  389  ARG n 
3  390  HIS n 
3  391  ALA n 
3  392  ILE n 
3  393  GLU n 
3  394  VAL n 
3  395  ASN n 
3  396  LYS n 
3  397  ARG n 
3  398  ASP n 
3  399  TYR n 
3  400  ARG n 
3  401  ALA n 
3  402  TRP n 
3  403  TYR n 
3  404  GLY n 
3  405  LEU n 
3  406  GLY n 
3  407  GLN n 
3  408  THR n 
3  409  TYR n 
3  410  GLU n 
3  411  ILE n 
3  412  LEU n 
3  413  LYS n 
3  414  MET n 
3  415  PRO n 
3  416  PHE n 
3  417  TYR n 
3  418  CYS n 
3  419  LEU n 
3  420  TYR n 
3  421  TYR n 
3  422  TYR n 
3  423  ARG n 
3  424  ARG n 
3  425  ALA n 
3  426  HIS n 
3  427  GLN n 
3  428  LEU n 
3  429  ARG n 
3  430  PRO n 
3  431  ASN n 
3  432  ASP n 
3  433  SER n 
3  434  ARG n 
3  435  MET n 
3  436  LEU n 
3  437  VAL n 
3  438  ALA n 
3  439  LEU n 
3  440  GLY n 
3  441  GLU n 
3  442  CYS n 
3  443  TYR n 
3  444  GLU n 
3  445  LYS n 
3  446  LEU n 
3  447  ASN n 
3  448  GLN n 
3  449  LEU n 
3  450  VAL n 
3  451  GLU n 
3  452  ALA n 
3  453  LYS n 
3  454  LYS n 
3  455  CYS n 
3  456  TYR n 
3  457  TRP n 
3  458  ARG n 
3  459  ALA n 
3  460  TYR n 
3  461  ALA n 
3  462  VAL n 
3  463  GLY n 
3  464  ASP n 
3  465  VAL n 
3  466  GLU n 
3  467  LYS n 
3  468  MET n 
3  469  ALA n 
3  470  LEU n 
3  471  VAL n 
3  472  LYS n 
3  473  LEU n 
3  474  ALA n 
3  475  LYS n 
3  476  LEU n 
3  477  HIS n 
3  478  GLU n 
3  479  GLN n 
3  480  LEU n 
3  481  THR n 
3  482  GLU n 
3  483  SER n 
3  484  GLU n 
3  485  GLN n 
3  486  ALA n 
3  487  ALA n 
3  488  GLN n 
3  489  CYS n 
3  490  TYR n 
3  491  ILE n 
3  492  LYS n 
3  493  TYR n 
3  494  ILE n 
3  495  GLN n 
3  496  ASP n 
3  497  ILE n 
3  498  TYR n 
3  499  SER n 
3  500  CYS n 
3  501  GLY n 
3  502  GLU n 
3  503  ILE n 
3  504  VAL n 
3  505  GLU n 
3  506  HIS n 
3  507  LEU n 
3  508  GLU n 
3  509  GLU n 
3  510  SER n 
3  511  THR n 
3  512  ALA n 
3  513  PHE n 
3  514  ARG n 
3  515  TYR n 
3  516  LEU n 
3  517  ALA n 
3  518  GLN n 
3  519  TYR n 
3  520  TYR n 
3  521  PHE n 
3  522  LYS n 
3  523  CYS n 
3  524  LYS n 
3  525  LEU n 
3  526  TRP n 
3  527  ASP n 
3  528  GLU n 
3  529  ALA n 
3  530  SER n 
3  531  THR n 
3  532  CYS n 
3  533  ALA n 
3  534  GLN n 
3  535  LYS n 
3  536  CYS n 
3  537  CYS n 
3  538  ALA n 
3  539  PHE n 
3  540  ASN n 
3  541  ASP n 
3  542  THR n 
3  543  ARG n 
3  544  GLU n 
3  545  GLU n 
3  546  GLY n 
3  547  LYS n 
3  548  ALA n 
3  549  LEU n 
3  550  LEU n 
3  551  ARG n 
3  552  GLN n 
3  553  ILE n 
3  554  LEU n 
3  555  GLN n 
3  556  LEU n 
3  557  ARG n 
3  558  ASN n 
3  559  GLN n 
3  560  GLY n 
3  561  GLU n 
3  562  THR n 
3  563  PRO n 
3  564  THR n 
3  565  THR n 
3  566  GLU n 
3  567  VAL n 
3  568  PRO n 
3  569  ALA n 
3  570  PRO n 
3  571  PHE n 
3  572  PHE n 
3  573  LEU n 
3  574  PRO n 
3  575  ALA n 
3  576  SER n 
3  577  LEU n 
3  578  SER n 
3  579  ALA n 
3  580  ASN n 
3  581  ASN n 
3  582  THR n 
3  583  PRO n 
3  584  THR n 
3  585  ARG n 
3  586  ARG n 
3  587  VAL n 
3  588  SER n 
3  589  PRO n 
3  590  LEU n 
3  591  ASN n 
3  592  LEU n 
3  593  SER n 
3  594  SER n 
3  595  VAL n 
3  596  THR n 
3  597  PRO n 
4  1    MET n 
4  2    ALA n 
4  3    ALA n 
4  4    SER n 
4  5    SER n 
4  6    SER n 
4  7    SER n 
4  8    SER n 
4  9    SER n 
4  10   ALA n 
4  11   GLY n 
4  12   GLY n 
4  13   VAL n 
4  14   SER n 
4  15   GLY n 
4  16   SER n 
4  17   SER n 
4  18   VAL n 
4  19   THR n 
4  20   GLY n 
4  21   SER n 
4  22   GLY n 
4  23   PHE n 
4  24   SER n 
4  25   VAL n 
4  26   SER n 
4  27   ASP n 
4  28   LEU n 
4  29   ALA n 
4  30   PRO n 
4  31   PRO n 
4  32   ARG n 
4  33   LYS n 
4  34   ALA n 
4  35   LEU n 
4  36   PHE n 
4  37   THR n 
4  38   TYR n 
4  39   PRO n 
4  40   LYS n 
4  41   GLY n 
4  42   ALA n 
4  43   GLY n 
4  44   GLU n 
4  45   MET n 
4  46   LEU n 
4  47   GLU n 
4  48   ASP n 
4  49   GLY n 
4  50   SER n 
4  51   GLU n 
4  52   ARG n 
4  53   PHE n 
4  54   LEU n 
4  55   CYS n 
4  56   GLU n 
4  57   SER n 
4  58   VAL n 
4  59   PHE n 
4  60   SER n 
4  61   TYR n 
4  62   GLN n 
4  63   VAL n 
4  64   ALA n 
4  65   SER n 
4  66   THR n 
4  67   LEU n 
4  68   LYS n 
4  69   GLN n 
4  70   VAL n 
4  71   LYS n 
4  72   HIS n 
4  73   ASP n 
4  74   GLN n 
4  75   GLN n 
4  76   VAL n 
4  77   ALA n 
4  78   ARG n 
4  79   MET n 
4  80   GLU n 
4  81   LYS n 
4  82   LEU n 
4  83   ALA n 
4  84   GLY n 
4  85   LEU n 
4  86   VAL n 
4  87   GLU n 
4  88   GLU n 
4  89   LEU n 
4  90   GLU n 
4  91   ALA n 
4  92   ASP n 
4  93   GLU n 
4  94   TRP n 
4  95   ARG n 
4  96   PHE n 
4  97   LYS n 
4  98   PRO n 
4  99   ILE n 
4  100  GLU n 
4  101  GLN n 
4  102  LEU n 
4  103  LEU n 
4  104  GLY n 
4  105  PHE n 
4  106  THR n 
4  107  PRO n 
4  108  SER n 
4  109  SER n 
4  110  GLY n 
5  1    MET n 
5  2    THR n 
5  3    VAL n 
5  4    LEU n 
5  5    GLN n 
5  6    GLU n 
5  7    PRO n 
5  8    VAL n 
5  9    GLN n 
5  10   ALA n 
5  11   ALA n 
5  12   ILE n 
5  13   TRP n 
5  14   GLN n 
5  15   ALA n 
5  16   LEU n 
5  17   ASN n 
5  18   HIS n 
5  19   TYR n 
5  20   ALA n 
5  21   TYR n 
5  22   ARG n 
5  23   ASP n 
5  24   ALA n 
5  25   VAL n 
5  26   PHE n 
5  27   LEU n 
5  28   ALA n 
5  29   GLU n 
5  30   ARG n 
5  31   LEU n 
5  32   TYR n 
5  33   ALA n 
5  34   GLU n 
5  35   VAL n 
5  36   HIS n 
5  37   SER n 
5  38   GLU n 
5  39   GLU n 
5  40   ALA n 
5  41   LEU n 
5  42   PHE n 
5  43   LEU n 
5  44   LEU n 
5  45   ALA n 
5  46   THR n 
5  47   CYS n 
5  48   TYR n 
5  49   TYR n 
5  50   ARG n 
5  51   SER n 
5  52   GLY n 
5  53   LYS n 
5  54   ALA n 
5  55   TYR n 
5  56   LYS n 
5  57   ALA n 
5  58   TYR n 
5  59   ARG n 
5  60   LEU n 
5  61   LEU n 
5  62   LYS n 
5  63   GLY n 
5  64   HIS n 
5  65   SER n 
5  66   CYS n 
5  67   THR n 
5  68   THR n 
5  69   PRO n 
5  70   GLN n 
5  71   CYS n 
5  72   LYS n 
5  73   TYR n 
5  74   LEU n 
5  75   LEU n 
5  76   ALA n 
5  77   LYS n 
5  78   CYS n 
5  79   CYS n 
5  80   VAL n 
5  81   ASP n 
5  82   LEU n 
5  83   SER n 
5  84   LYS n 
5  85   LEU n 
5  86   ALA n 
5  87   GLU n 
5  88   GLY n 
5  89   GLU n 
5  90   GLN n 
5  91   ILE n 
5  92   LEU n 
5  93   SER n 
5  94   GLY n 
5  95   GLY n 
5  96   VAL n 
5  97   PHE n 
5  98   ASN n 
5  99   LYS n 
5  100  GLN n 
5  101  LYS n 
5  102  SER n 
5  103  HIS n 
5  104  ASP n 
5  105  ASP n 
5  106  ILE n 
5  107  VAL n 
5  108  THR n 
5  109  GLU n 
5  110  PHE n 
5  111  GLY n 
5  112  ASP n 
5  113  SER n 
5  114  ALA n 
5  115  CYS n 
5  116  PHE n 
5  117  THR n 
5  118  LEU n 
5  119  SER n 
5  120  LEU n 
5  121  LEU n 
5  122  GLY n 
5  123  HIS n 
5  124  VAL n 
5  125  TYR n 
5  126  CYS n 
5  127  LYS n 
5  128  THR n 
5  129  ASP n 
5  130  ARG n 
5  131  LEU n 
5  132  ALA n 
5  133  LYS n 
5  134  GLY n 
5  135  SER n 
5  136  GLU n 
5  137  CYS n 
5  138  TYR n 
5  139  GLN n 
5  140  LYS n 
5  141  SER n 
5  142  LEU n 
5  143  SER n 
5  144  LEU n 
5  145  ASN n 
5  146  PRO n 
5  147  PHE n 
5  148  LEU n 
5  149  TRP n 
5  150  SER n 
5  151  PRO n 
5  152  PHE n 
5  153  GLU n 
5  154  SER n 
5  155  LEU n 
5  156  CYS n 
5  157  GLU n 
5  158  ILE n 
5  159  GLY n 
5  160  GLU n 
5  161  LYS n 
5  162  PRO n 
5  163  ASP n 
5  164  PRO n 
5  165  ASP n 
5  166  GLN n 
5  167  THR n 
5  168  PHE n 
5  169  LYS n 
5  170  PHE n 
5  171  THR n 
5  172  SER n 
5  173  LEU n 
5  174  GLN n 
5  175  ASN n 
5  176  PHE n 
5  177  SER n 
5  178  ASN n 
5  179  CYS n 
5  180  LEU n 
5  181  PRO n 
5  182  ASN n 
5  183  SER n 
5  184  CYS n 
5  185  THR n 
5  186  THR n 
5  187  GLN n 
5  188  VAL n 
5  189  PRO n 
5  190  ASN n 
5  191  HIS n 
5  192  SER n 
5  193  LEU n 
5  194  SER n 
5  195  HIS n 
5  196  ARG n 
5  197  GLN n 
5  198  PRO n 
5  199  GLU n 
5  200  THR n 
5  201  VAL n 
5  202  LEU n 
5  203  THR n 
5  204  GLU n 
5  205  THR n 
5  206  PRO n 
5  207  GLN n 
5  208  ASP n 
5  209  THR n 
5  210  ILE n 
5  211  GLU n 
5  212  LEU n 
5  213  ASN n 
5  214  ARG n 
5  215  LEU n 
5  216  ASN n 
5  217  LEU n 
5  218  GLU n 
5  219  SER n 
5  220  SER n 
5  221  ASN n 
5  222  SER n 
5  223  LYS n 
5  224  TYR n 
5  225  SER n 
5  226  LEU n 
5  227  ASN n 
5  228  THR n 
5  229  ASP n 
5  230  SER n 
5  231  SER n 
5  232  VAL n 
5  233  SER n 
5  234  TYR n 
5  235  ILE n 
5  236  ASP n 
5  237  SER n 
5  238  ALA n 
5  239  VAL n 
5  240  ILE n 
5  241  SER n 
5  242  PRO n 
5  243  ASP n 
5  244  THR n 
5  245  VAL n 
5  246  PRO n 
5  247  LEU n 
5  248  GLY n 
5  249  THR n 
5  250  GLY n 
5  251  THR n 
5  252  SER n 
5  253  ILE n 
5  254  LEU n 
5  255  SER n 
5  256  LYS n 
5  257  GLN n 
5  258  VAL n 
5  259  GLN n 
5  260  ASN n 
5  261  LYS n 
5  262  PRO n 
5  263  LYS n 
5  264  THR n 
5  265  GLY n 
5  266  ARG n 
5  267  SER n 
5  268  LEU n 
5  269  LEU n 
5  270  GLY n 
5  271  GLY n 
5  272  PRO n 
5  273  ALA n 
5  274  ALA n 
5  275  LEU n 
5  276  SER n 
5  277  PRO n 
5  278  LEU n 
5  279  THR n 
5  280  PRO n 
5  281  SER n 
5  282  PHE n 
5  283  GLY n 
5  284  ILE n 
5  285  LEU n 
5  286  PRO n 
5  287  LEU n 
5  288  GLU n 
5  289  THR n 
5  290  PRO n 
5  291  SER n 
5  292  PRO n 
5  293  GLY n 
5  294  ASP n 
5  295  GLY n 
5  296  SER n 
5  297  TYR n 
5  298  LEU n 
5  299  GLN n 
5  300  ASN n 
5  301  TYR n 
5  302  THR n 
5  303  ASN n 
5  304  THR n 
5  305  PRO n 
5  306  PRO n 
5  307  VAL n 
5  308  ILE n 
5  309  ASP n 
5  310  VAL n 
5  311  PRO n 
5  312  SER n 
5  313  THR n 
5  314  GLY n 
5  315  ALA n 
5  316  PRO n 
5  317  SER n 
5  318  LYS n 
5  319  LYS n 
5  320  SER n 
5  321  VAL n 
5  322  ALA n 
5  323  ARG n 
5  324  ILE n 
5  325  GLY n 
5  326  GLN n 
5  327  THR n 
5  328  GLY n 
5  329  THR n 
5  330  LYS n 
5  331  SER n 
5  332  VAL n 
5  333  PHE n 
5  334  SER n 
5  335  GLN n 
5  336  SER n 
5  337  GLY n 
5  338  ASN n 
5  339  SER n 
5  340  ARG n 
5  341  GLU n 
5  342  VAL n 
5  343  THR n 
5  344  PRO n 
5  345  ILE n 
5  346  LEU n 
5  347  ALA n 
5  348  GLN n 
5  349  THR n 
5  350  GLN n 
5  351  SER n 
5  352  SER n 
5  353  GLY n 
5  354  PRO n 
5  355  GLN n 
5  356  THR n 
5  357  SER n 
5  358  THR n 
5  359  THR n 
5  360  PRO n 
5  361  GLN n 
5  362  VAL n 
5  363  LEU n 
5  364  SER n 
5  365  PRO n 
5  366  THR n 
5  367  ILE n 
5  368  THR n 
5  369  SER n 
5  370  PRO n 
5  371  PRO n 
5  372  ASN n 
5  373  ALA n 
5  374  LEU n 
5  375  PRO n 
5  376  ARG n 
5  377  ARG n 
5  378  SER n 
5  379  SER n 
5  380  ARG n 
5  381  LEU n 
5  382  PHE n 
5  383  THR n 
5  384  SER n 
5  385  ASP n 
5  386  SER n 
5  387  SER n 
5  388  THR n 
5  389  THR n 
5  390  LYS n 
5  391  GLU n 
5  392  ASN n 
5  393  SER n 
5  394  LYS n 
5  395  LYS n 
5  396  LEU n 
5  397  LYS n 
5  398  MET n 
5  399  LYS n 
5  400  PHE n 
5  401  PRO n 
5  402  PRO n 
5  403  LYS n 
5  404  ILE n 
5  405  PRO n 
5  406  ASN n 
5  407  ARG n 
5  408  LYS n 
5  409  THR n 
5  410  LYS n 
5  411  SER n 
5  412  LYS n 
5  413  THR n 
5  414  ASN n 
5  415  LYS n 
5  416  GLY n 
5  417  GLY n 
5  418  ILE n 
5  419  THR n 
5  420  GLN n 
5  421  PRO n 
5  422  ASN n 
5  423  ILE n 
5  424  ASN n 
5  425  ASP n 
5  426  SER n 
5  427  LEU n 
5  428  GLU n 
5  429  ILE n 
5  430  THR n 
5  431  LYS n 
5  432  LEU n 
5  433  ASP n 
5  434  SER n 
5  435  SER n 
5  436  ILE n 
5  437  ILE n 
5  438  SER n 
5  439  GLU n 
5  440  GLY n 
5  441  LYS n 
5  442  ILE n 
5  443  SER n 
5  444  THR n 
5  445  ILE n 
5  446  THR n 
5  447  PRO n 
5  448  GLN n 
5  449  ILE n 
5  450  GLN n 
5  451  ALA n 
5  452  PHE n 
5  453  ASN n 
5  454  LEU n 
5  455  GLN n 
5  456  LYS n 
5  457  ALA n 
5  458  ALA n 
5  459  ALA n 
5  460  GLU n 
5  461  GLY n 
5  462  LEU n 
5  463  MET n 
5  464  SER n 
5  465  LEU n 
5  466  LEU n 
5  467  ARG n 
5  468  GLU n 
5  469  MET n 
5  470  GLY n 
5  471  LYS n 
5  472  GLY n 
5  473  TYR n 
5  474  LEU n 
5  475  ALA n 
5  476  LEU n 
5  477  CYS n 
5  478  SER n 
5  479  TYR n 
5  480  ASN n 
5  481  CYS n 
5  482  LYS n 
5  483  GLU n 
5  484  ALA n 
5  485  ILE n 
5  486  ASN n 
5  487  ILE n 
5  488  LEU n 
5  489  SER n 
5  490  HIS n 
5  491  LEU n 
5  492  PRO n 
5  493  SER n 
5  494  HIS n 
5  495  HIS n 
5  496  TYR n 
5  497  ASN n 
5  498  THR n 
5  499  GLY n 
5  500  TRP n 
5  501  VAL n 
5  502  LEU n 
5  503  CYS n 
5  504  GLN n 
5  505  ILE n 
5  506  GLY n 
5  507  ARG n 
5  508  ALA n 
5  509  TYR n 
5  510  PHE n 
5  511  GLU n 
5  512  LEU n 
5  513  SER n 
5  514  GLU n 
5  515  TYR n 
5  516  MET n 
5  517  GLN n 
5  518  ALA n 
5  519  GLU n 
5  520  ARG n 
5  521  ILE n 
5  522  PHE n 
5  523  SER n 
5  524  GLU n 
5  525  VAL n 
5  526  ARG n 
5  527  ARG n 
5  528  ILE n 
5  529  GLU n 
5  530  ASN n 
5  531  TYR n 
5  532  ARG n 
5  533  VAL n 
5  534  GLU n 
5  535  GLY n 
5  536  MET n 
5  537  GLU n 
5  538  ILE n 
5  539  TYR n 
5  540  SER n 
5  541  THR n 
5  542  THR n 
5  543  LEU n 
5  544  TRP n 
5  545  HIS n 
5  546  LEU n 
5  547  GLN n 
5  548  LYS n 
5  549  ASP n 
5  550  VAL n 
5  551  ALA n 
5  552  LEU n 
5  553  SER n 
5  554  VAL n 
5  555  LEU n 
5  556  SER n 
5  557  LYS n 
5  558  ASP n 
5  559  LEU n 
5  560  THR n 
5  561  ASP n 
5  562  MET n 
5  563  ASP n 
5  564  LYS n 
5  565  ASN n 
5  566  SER n 
5  567  PRO n 
5  568  GLU n 
5  569  ALA n 
5  570  TRP n 
5  571  CYS n 
5  572  ALA n 
5  573  ALA n 
5  574  GLY n 
5  575  ASN n 
5  576  CYS n 
5  577  PHE n 
5  578  SER n 
5  579  LEU n 
5  580  GLN n 
5  581  ARG n 
5  582  GLU n 
5  583  HIS n 
5  584  ASP n 
5  585  ILE n 
5  586  ALA n 
5  587  ILE n 
5  588  LYS n 
5  589  PHE n 
5  590  PHE n 
5  591  GLN n 
5  592  ARG n 
5  593  ALA n 
5  594  ILE n 
5  595  GLN n 
5  596  VAL n 
5  597  ASP n 
5  598  PRO n 
5  599  ASN n 
5  600  TYR n 
5  601  ALA n 
5  602  TYR n 
5  603  ALA n 
5  604  TYR n 
5  605  THR n 
5  606  LEU n 
5  607  LEU n 
5  608  GLY n 
5  609  HIS n 
5  610  GLU n 
5  611  PHE n 
5  612  VAL n 
5  613  LEU n 
5  614  THR n 
5  615  GLU n 
5  616  GLU n 
5  617  LEU n 
5  618  ASP n 
5  619  LYS n 
5  620  ALA n 
5  621  LEU n 
5  622  ALA n 
5  623  CYS n 
5  624  PHE n 
5  625  ARG n 
5  626  ASN n 
5  627  ALA n 
5  628  ILE n 
5  629  ARG n 
5  630  VAL n 
5  631  ASN n 
5  632  PRO n 
5  633  ARG n 
5  634  HIS n 
5  635  TYR n 
5  636  ASN n 
5  637  ALA n 
5  638  TRP n 
5  639  TYR n 
5  640  GLY n 
5  641  LEU n 
5  642  GLY n 
5  643  MET n 
5  644  ILE n 
5  645  TYR n 
5  646  TYR n 
5  647  LYS n 
5  648  GLN n 
5  649  GLU n 
5  650  LYS n 
5  651  PHE n 
5  652  SER n 
5  653  LEU n 
5  654  ALA n 
5  655  GLU n 
5  656  MET n 
5  657  HIS n 
5  658  PHE n 
5  659  GLN n 
5  660  LYS n 
5  661  ALA n 
5  662  LEU n 
5  663  ASP n 
5  664  ILE n 
5  665  ASN n 
5  666  PRO n 
5  667  GLN n 
5  668  SER n 
5  669  SER n 
5  670  VAL n 
5  671  LEU n 
5  672  LEU n 
5  673  CYS n 
5  674  HIS n 
5  675  ILE n 
5  676  GLY n 
5  677  VAL n 
5  678  VAL n 
5  679  GLN n 
5  680  HIS n 
5  681  ALA n 
5  682  LEU n 
5  683  LYS n 
5  684  LYS n 
5  685  SER n 
5  686  GLU n 
5  687  LYS n 
5  688  ALA n 
5  689  LEU n 
5  690  ASP n 
5  691  THR n 
5  692  LEU n 
5  693  ASN n 
5  694  LYS n 
5  695  ALA n 
5  696  ILE n 
5  697  VAL n 
5  698  ILE n 
5  699  ASP n 
5  700  PRO n 
5  701  LYS n 
5  702  ASN n 
5  703  PRO n 
5  704  LEU n 
5  705  CYS n 
5  706  LYS n 
5  707  PHE n 
5  708  HIS n 
5  709  ARG n 
5  710  ALA n 
5  711  SER n 
5  712  VAL n 
5  713  LEU n 
5  714  PHE n 
5  715  ALA n 
5  716  ASN n 
5  717  GLU n 
5  718  LYS n 
5  719  TYR n 
5  720  LYS n 
5  721  SER n 
5  722  ALA n 
5  723  LEU n 
5  724  GLN n 
5  725  GLU n 
5  726  LEU n 
5  727  GLU n 
5  728  GLU n 
5  729  LEU n 
5  730  LYS n 
5  731  GLN n 
5  732  ILE n 
5  733  VAL n 
5  734  PRO n 
5  735  LYS n 
5  736  GLU n 
5  737  SER n 
5  738  LEU n 
5  739  VAL n 
5  740  TYR n 
5  741  PHE n 
5  742  LEU n 
5  743  ILE n 
5  744  GLY n 
5  745  LYS n 
5  746  VAL n 
5  747  TYR n 
5  748  LYS n 
5  749  LYS n 
5  750  LEU n 
5  751  GLY n 
5  752  GLN n 
5  753  THR n 
5  754  HIS n 
5  755  LEU n 
5  756  ALA n 
5  757  LEU n 
5  758  MET n 
5  759  ASN n 
5  760  PHE n 
5  761  SER n 
5  762  TRP n 
5  763  ALA n 
5  764  MET n 
5  765  ASP n 
5  766  LEU n 
5  767  ASP n 
5  768  PRO n 
5  769  LYS n 
5  770  GLY n 
5  771  ALA n 
5  772  ASN n 
5  773  ASN n 
5  774  GLN n 
5  775  ILE n 
5  776  LYS n 
5  777  GLU n 
5  778  ALA n 
5  779  ILE n 
5  780  ASP n 
5  781  LYS n 
5  782  ARG n 
5  783  TYR n 
5  784  LEU n 
5  785  PRO n 
5  786  ASP n 
5  787  ASP n 
5  788  GLU n 
5  789  GLU n 
5  790  PRO n 
5  791  ILE n 
5  792  THR n 
5  793  GLN n 
5  794  GLU n 
5  795  GLU n 
5  796  GLN n 
5  797  ILE n 
5  798  MET n 
5  799  GLY n 
5  800  THR n 
5  801  ASP n 
5  802  GLU n 
5  803  SER n 
5  804  GLN n 
5  805  GLU n 
5  806  SER n 
5  807  SER n 
5  808  MET n 
5  809  THR n 
5  810  ASP n 
5  811  ALA n 
5  812  ASP n 
5  813  ASP n 
5  814  THR n 
5  815  GLN n 
5  816  LEU n 
5  817  HIS n 
5  818  ALA n 
5  819  ALA n 
5  820  GLU n 
5  821  SER n 
5  822  ASP n 
5  823  GLU n 
5  824  PHE n 
6  1    MET n 
6  2    LEU n 
6  3    ARG n 
6  4    ARG n 
6  5    LYS n 
6  6    PRO n 
6  7    THR n 
6  8    ARG n 
6  9    LEU n 
6  10   GLU n 
6  11   LEU n 
6  12   LYS n 
6  13   LEU n 
6  14   ASP n 
6  15   ASP n 
6  16   ILE n 
6  17   GLU n 
6  18   GLU n 
6  19   PHE n 
6  20   GLU n 
6  21   ASN n 
6  22   ILE n 
6  23   ARG n 
6  24   LYS n 
6  25   ASP n 
6  26   LEU n 
6  27   GLU n 
6  28   THR n 
6  29   ARG n 
6  30   LYS n 
6  31   LYS n 
6  32   GLN n 
6  33   LYS n 
6  34   GLU n 
6  35   ASP n 
6  36   VAL n 
6  37   GLU n 
6  38   VAL n 
6  39   VAL n 
6  40   GLY n 
6  41   GLY n 
6  42   SER n 
6  43   ASP n 
6  44   GLY n 
6  45   GLU n 
6  46   GLY n 
6  47   ALA n 
6  48   ILE n 
6  49   GLY n 
6  50   LEU n 
6  51   SER n 
6  52   SER n 
6  53   ASP n 
6  54   PRO n 
6  55   LYS n 
6  56   SER n 
6  57   ARG n 
6  58   GLU n 
6  59   GLN n 
6  60   MET n 
6  61   ILE n 
6  62   ASN n 
6  63   ASP n 
6  64   ARG n 
6  65   ILE n 
6  66   GLY n 
6  67   TYR n 
6  68   LYS n 
6  69   PRO n 
6  70   GLN n 
6  71   PRO n 
6  72   LYS n 
6  73   PRO n 
6  74   ASN n 
6  75   ASN n 
6  76   ARG n 
6  77   SER n 
6  78   SER n 
6  79   GLN n 
6  80   PHE n 
6  81   GLY n 
6  82   SER n 
6  83   LEU n 
6  84   GLU n 
6  85   PHE n 
7  1    MET n 
7  2    LEU n 
7  3    ARG n 
7  4    PHE n 
7  5    PRO n 
7  6    THR n 
7  7    CYS n 
7  8    PHE n 
7  9    PRO n 
7  10   SER n 
7  11   PHE n 
7  12   ARG n 
7  13   VAL n 
7  14   VAL n 
7  15   GLY n 
7  16   GLU n 
7  17   LYS n 
7  18   GLN n 
7  19   LEU n 
7  20   PRO n 
7  21   GLN n 
7  22   GLU n 
7  23   ILE n 
7  24   ILE n 
7  25   PHE n 
7  26   LEU n 
7  27   VAL n 
7  28   TRP n 
7  29   SER n 
7  30   PRO n 
7  31   LYS n 
7  32   ARG n 
7  33   ASP n 
7  34   LEU n 
7  35   ILE n 
7  36   ALA n 
7  37   LEU n 
7  38   ALA n 
7  39   ASN n 
7  40   THR n 
7  41   ALA n 
7  42   GLY n 
7  43   GLU n 
7  44   VAL n 
7  45   LEU n 
7  46   LEU n 
7  47   HIS n 
7  48   ARG n 
7  49   LEU n 
7  50   ALA n 
7  51   SER n 
7  52   PHE n 
7  53   HIS n 
7  54   ARG n 
7  55   VAL n 
7  56   TRP n 
7  57   SER n 
7  58   PHE n 
7  59   PRO n 
7  60   PRO n 
7  61   ASN n 
7  62   GLU n 
7  63   ASN n 
7  64   THR n 
7  65   GLY n 
7  66   LYS n 
7  67   GLU n 
7  68   VAL n 
7  69   THR n 
7  70   CYS n 
7  71   LEU n 
7  72   ALA n 
7  73   TRP n 
7  74   ARG n 
7  75   PRO n 
7  76   ASP n 
7  77   GLY n 
7  78   LYS n 
7  79   LEU n 
7  80   LEU n 
7  81   ALA n 
7  82   PHE n 
7  83   ALA n 
7  84   LEU n 
7  85   ALA n 
7  86   ASP n 
7  87   THR n 
7  88   LYS n 
7  89   LYS n 
7  90   ILE n 
7  91   VAL n 
7  92   LEU n 
7  93   CYS n 
7  94   ASP n 
7  95   VAL n 
7  96   GLU n 
7  97   LYS n 
7  98   PRO n 
7  99   GLU n 
7  100  SER n 
7  101  LEU n 
7  102  HIS n 
7  103  SER n 
7  104  PHE n 
7  105  SER n 
7  106  VAL n 
7  107  GLU n 
7  108  ALA n 
7  109  PRO n 
7  110  VAL n 
7  111  SER n 
7  112  CYS n 
7  113  MET n 
7  114  HIS n 
7  115  TRP n 
7  116  MET n 
7  117  GLU n 
7  118  VAL n 
7  119  THR n 
7  120  VAL n 
7  121  GLU n 
7  122  SER n 
7  123  SER n 
7  124  VAL n 
7  125  LEU n 
7  126  THR n 
7  127  SER n 
7  128  PHE n 
7  129  TYR n 
7  130  ASN n 
7  131  ALA n 
7  132  GLU n 
7  133  ASP n 
7  134  GLU n 
7  135  SER n 
7  136  ASN n 
7  137  LEU n 
7  138  LEU n 
7  139  LEU n 
7  140  PRO n 
7  141  LYS n 
7  142  LEU n 
7  143  PRO n 
7  144  THR n 
7  145  LEU n 
7  146  PRO n 
7  147  LYS n 
7  148  ASN n 
7  149  TYR n 
7  150  SER n 
7  151  ASN n 
7  152  THR n 
7  153  SER n 
7  154  LYS n 
7  155  ILE n 
7  156  PHE n 
7  157  SER n 
7  158  GLU n 
7  159  GLU n 
7  160  ASN n 
7  161  SER n 
7  162  ASP n 
7  163  GLU n 
7  164  ILE n 
7  165  ILE n 
7  166  LYS n 
7  167  LEU n 
7  168  LEU n 
7  169  GLY n 
7  170  ASP n 
7  171  VAL n 
7  172  ARG n 
7  173  LEU n 
7  174  ASN n 
7  175  ILE n 
7  176  LEU n 
7  177  VAL n 
7  178  LEU n 
7  179  GLY n 
7  180  GLY n 
7  181  SER n 
7  182  SER n 
7  183  GLY n 
7  184  PHE n 
7  185  ILE n 
7  186  GLU n 
7  187  LEU n 
7  188  TYR n 
7  189  ALA n 
7  190  TYR n 
7  191  GLY n 
7  192  MET n 
7  193  PHE n 
7  194  LYS n 
7  195  ILE n 
7  196  ALA n 
7  197  ARG n 
7  198  VAL n 
7  199  THR n 
7  200  GLY n 
7  201  ILE n 
7  202  ALA n 
7  203  GLY n 
7  204  THR n 
7  205  CYS n 
7  206  LEU n 
7  207  ALA n 
7  208  LEU n 
7  209  CYS n 
7  210  LEU n 
7  211  SER n 
7  212  SER n 
7  213  ASP n 
7  214  LEU n 
7  215  LYS n 
7  216  SER n 
7  217  LEU n 
7  218  SER n 
7  219  VAL n 
7  220  VAL n 
7  221  THR n 
7  222  GLU n 
7  223  VAL n 
7  224  SER n 
7  225  THR n 
7  226  ASN n 
7  227  GLY n 
7  228  ALA n 
7  229  SER n 
7  230  GLU n 
7  231  VAL n 
7  232  SER n 
7  233  TYR n 
7  234  PHE n 
7  235  GLN n 
7  236  LEU n 
7  237  GLU n 
7  238  THR n 
7  239  ASN n 
7  240  LEU n 
7  241  LEU n 
7  242  TYR n 
7  243  SER n 
7  244  PHE n 
7  245  LEU n 
7  246  PRO n 
7  247  GLU n 
7  248  VAL n 
7  249  THR n 
7  250  ARG n 
7  251  MET n 
7  252  ALA n 
7  253  ARG n 
7  254  LYS n 
7  255  PHE n 
7  256  THR n 
7  257  HIS n 
7  258  ILE n 
7  259  SER n 
7  260  ALA n 
7  261  LEU n 
7  262  LEU n 
7  263  GLN n 
7  264  TYR n 
7  265  ILE n 
7  266  ASN n 
7  267  LEU n 
7  268  SER n 
7  269  LEU n 
7  270  THR n 
7  271  CYS n 
7  272  MET n 
7  273  CYS n 
7  274  GLU n 
7  275  ALA n 
7  276  TRP n 
7  277  GLU n 
7  278  GLU n 
7  279  ILE n 
7  280  LEU n 
7  281  MET n 
7  282  GLN n 
7  283  MET n 
7  284  ASP n 
7  285  SER n 
7  286  ARG n 
7  287  LEU n 
7  288  THR n 
7  289  LYS n 
7  290  PHE n 
7  291  VAL n 
7  292  GLN n 
7  293  GLU n 
7  294  LYS n 
7  295  ASN n 
7  296  THR n 
7  297  THR n 
7  298  THR n 
7  299  SER n 
7  300  VAL n 
7  301  GLN n 
7  302  ASP n 
7  303  GLU n 
7  304  PHE n 
7  305  MET n 
7  306  HIS n 
7  307  LEU n 
7  308  LEU n 
7  309  LEU n 
7  310  TRP n 
7  311  GLY n 
7  312  LYS n 
7  313  ALA n 
7  314  SER n 
7  315  ALA n 
7  316  GLU n 
7  317  LEU n 
7  318  GLN n 
7  319  THR n 
7  320  LEU n 
7  321  LEU n 
7  322  MET n 
7  323  ASN n 
7  324  GLN n 
7  325  LEU n 
7  326  THR n 
7  327  VAL n 
7  328  LYS n 
7  329  GLY n 
7  330  LEU n 
7  331  LYS n 
7  332  LYS n 
7  333  LEU n 
7  334  GLY n 
7  335  GLN n 
7  336  SER n 
7  337  ILE n 
7  338  GLU n 
7  339  SER n 
7  340  SER n 
7  341  TYR n 
7  342  SER n 
7  343  SER n 
7  344  ILE n 
7  345  GLN n 
7  346  LYS n 
7  347  LEU n 
7  348  VAL n 
7  349  ILE n 
7  350  SER n 
7  351  HIS n 
7  352  LEU n 
7  353  GLN n 
7  354  SER n 
7  355  GLY n 
7  356  SER n 
7  357  GLU n 
7  358  SER n 
7  359  LEU n 
7  360  LEU n 
7  361  TYR n 
7  362  HIS n 
7  363  LEU n 
7  364  SER n 
7  365  GLU n 
7  366  LEU n 
7  367  LYS n 
7  368  GLY n 
7  369  MET n 
7  370  ALA n 
7  371  SER n 
7  372  TRP n 
7  373  LYS n 
7  374  GLN n 
7  375  LYS n 
7  376  TYR n 
7  377  GLU n 
7  378  PRO n 
7  379  LEU n 
7  380  GLY n 
7  381  LEU n 
7  382  ASP n 
7  383  ALA n 
7  384  ALA n 
7  385  GLY n 
7  386  ILE n 
7  387  GLU n 
7  388  GLU n 
7  389  ALA n 
7  390  ILE n 
7  391  THR n 
7  392  ALA n 
7  393  VAL n 
7  394  GLY n 
7  395  SER n 
7  396  PHE n 
7  397  ILE n 
7  398  LEU n 
7  399  LYS n 
7  400  ALA n 
7  401  ASN n 
7  402  GLU n 
7  403  LEU n 
7  404  LEU n 
7  405  GLN n 
7  406  VAL n 
7  407  ILE n 
7  408  ASP n 
7  409  SER n 
7  410  SER n 
7  411  MET n 
7  412  LYS n 
7  413  ASN n 
7  414  PHE n 
7  415  LYS n 
7  416  ALA n 
7  417  PHE n 
7  418  PHE n 
7  419  ARG n 
7  420  TRP n 
7  421  LEU n 
7  422  TYR n 
7  423  VAL n 
7  424  ALA n 
7  425  MET n 
7  426  LEU n 
7  427  ARG n 
7  428  MET n 
7  429  THR n 
7  430  GLU n 
7  431  ASP n 
7  432  HIS n 
7  433  VAL n 
7  434  LEU n 
7  435  PRO n 
7  436  GLU n 
7  437  LEU n 
7  438  ASN n 
7  439  LYS n 
7  440  MET n 
7  441  THR n 
7  442  GLN n 
7  443  LYS n 
7  444  ASP n 
7  445  ILE n 
7  446  THR n 
7  447  PHE n 
7  448  VAL n 
7  449  ALA n 
7  450  GLU n 
7  451  PHE n 
7  452  LEU n 
7  453  THR n 
7  454  GLU n 
7  455  HIS n 
7  456  PHE n 
7  457  ASN n 
7  458  GLU n 
7  459  ALA n 
7  460  PRO n 
7  461  ASP n 
7  462  LEU n 
7  463  TYR n 
7  464  ASN n 
7  465  ARG n 
7  466  LYS n 
7  467  GLY n 
7  468  LYS n 
7  469  TYR n 
7  470  PHE n 
7  471  ASN n 
7  472  VAL n 
7  473  GLU n 
7  474  ARG n 
7  475  VAL n 
7  476  GLY n 
7  477  GLN n 
7  478  TYR n 
7  479  LEU n 
7  480  LYS n 
7  481  ASP n 
7  482  GLU n 
7  483  ASP n 
7  484  ASP n 
7  485  ASP n 
7  486  LEU n 
7  487  VAL n 
7  488  SER n 
7  489  PRO n 
7  490  PRO n 
7  491  ASN n 
7  492  THR n 
7  493  GLU n 
7  494  GLY n 
7  495  ASN n 
7  496  GLN n 
7  497  TRP n 
7  498  TYR n 
7  499  ASP n 
7  500  PHE n 
7  501  LEU n 
7  502  GLN n 
7  503  ASN n 
7  504  SER n 
7  505  SER n 
7  506  HIS n 
7  507  LEU n 
7  508  LYS n 
7  509  GLU n 
7  510  SER n 
7  511  PRO n 
7  512  LEU n 
7  513  LEU n 
7  514  PHE n 
7  515  PRO n 
7  516  TYR n 
7  517  TYR n 
7  518  PRO n 
7  519  ARG n 
7  520  LYS n 
7  521  SER n 
7  522  LEU n 
7  523  HIS n 
7  524  PHE n 
7  525  VAL n 
7  526  LYS n 
7  527  ARG n 
7  528  ARG n 
7  529  MET n 
7  530  GLU n 
7  531  ASN n 
7  532  ILE n 
7  533  ILE n 
7  534  ASP n 
7  535  GLN n 
7  536  CYS n 
7  537  LEU n 
7  538  GLN n 
7  539  LYS n 
7  540  PRO n 
7  541  ALA n 
7  542  ASP n 
7  543  VAL n 
7  544  ILE n 
7  545  GLY n 
7  546  LYS n 
7  547  SER n 
7  548  MET n 
7  549  ASN n 
7  550  GLN n 
7  551  ALA n 
7  552  ILE n 
7  553  CYS n 
7  554  ILE n 
7  555  PRO n 
7  556  LEU n 
7  557  TYR n 
7  558  ARG n 
7  559  ASP n 
7  560  THR n 
7  561  ARG n 
7  562  SER n 
7  563  GLU n 
7  564  ASP n 
7  565  SER n 
7  566  THR n 
7  567  ARG n 
7  568  ARG n 
7  569  LEU n 
7  570  PHE n 
7  571  LYS n 
7  572  PHE n 
7  573  PRO n 
7  574  PHE n 
7  575  LEU n 
7  576  TRP n 
7  577  ASN n 
7  578  ASN n 
7  579  LYS n 
7  580  THR n 
7  581  SER n 
7  582  ASN n 
7  583  LEU n 
7  584  HIS n 
7  585  TYR n 
7  586  LEU n 
7  587  LEU n 
7  588  PHE n 
7  589  THR n 
7  590  ILE n 
7  591  LEU n 
7  592  GLU n 
7  593  ASP n 
7  594  SER n 
7  595  LEU n 
7  596  TYR n 
7  597  LYS n 
7  598  MET n 
7  599  CYS n 
7  600  ILE n 
7  601  LEU n 
7  602  ARG n 
7  603  ARG n 
7  604  HIS n 
7  605  THR n 
7  606  ASP n 
7  607  ILE n 
7  608  SER n 
7  609  GLN n 
7  610  SER n 
7  611  VAL n 
7  612  SER n 
7  613  ASN n 
7  614  GLY n 
7  615  LEU n 
7  616  ILE n 
7  617  ALA n 
7  618  ILE n 
7  619  LYS n 
7  620  PHE n 
7  621  GLY n 
7  622  SER n 
7  623  PHE n 
7  624  THR n 
7  625  TYR n 
7  626  ALA n 
7  627  THR n 
7  628  THR n 
7  629  GLU n 
7  630  LYS n 
7  631  VAL n 
7  632  ARG n 
7  633  ARG n 
7  634  SER n 
7  635  ILE n 
7  636  TYR n 
7  637  SER n 
7  638  CYS n 
7  639  LEU n 
7  640  ASP n 
7  641  ALA n 
7  642  GLN n 
7  643  PHE n 
7  644  TYR n 
7  645  ASP n 
7  646  ASP n 
7  647  GLU n 
7  648  THR n 
7  649  VAL n 
7  650  THR n 
7  651  VAL n 
7  652  VAL n 
7  653  LEU n 
7  654  LYS n 
7  655  ASP n 
7  656  THR n 
7  657  VAL n 
7  658  GLY n 
7  659  ARG n 
7  660  GLU n 
7  661  GLY n 
7  662  ARG n 
7  663  ASP n 
7  664  ARG n 
7  665  LEU n 
7  666  LEU n 
7  667  VAL n 
7  668  GLN n 
7  669  LEU n 
7  670  PRO n 
7  671  LEU n 
7  672  SER n 
7  673  LEU n 
7  674  VAL n 
7  675  TYR n 
7  676  ASN n 
7  677  SER n 
7  678  GLU n 
7  679  ASP n 
7  680  SER n 
7  681  ALA n 
7  682  GLU n 
7  683  TYR n 
7  684  GLN n 
7  685  PHE n 
7  686  THR n 
7  687  GLY n 
7  688  THR n 
7  689  TYR n 
7  690  SER n 
7  691  THR n 
7  692  ARG n 
7  693  LEU n 
7  694  ASP n 
7  695  GLU n 
7  696  GLN n 
7  697  CYS n 
7  698  SER n 
7  699  ALA n 
7  700  ILE n 
7  701  PRO n 
7  702  THR n 
7  703  ARG n 
7  704  THR n 
7  705  MET n 
7  706  HIS n 
7  707  PHE n 
7  708  GLU n 
7  709  LYS n 
7  710  HIS n 
7  711  TRP n 
7  712  ARG n 
7  713  LEU n 
7  714  LEU n 
7  715  GLU n 
7  716  SER n 
7  717  MET n 
7  718  LYS n 
7  719  ALA n 
7  720  GLN n 
7  721  TYR n 
7  722  VAL n 
7  723  ALA n 
7  724  GLY n 
7  725  ASN n 
7  726  GLY n 
7  727  PHE n 
7  728  ARG n 
7  729  LYS n 
7  730  VAL n 
7  731  SER n 
7  732  CYS n 
7  733  VAL n 
7  734  LEU n 
7  735  SER n 
7  736  SER n 
7  737  ASN n 
7  738  LEU n 
7  739  ARG n 
7  740  HIS n 
7  741  VAL n 
7  742  ARG n 
7  743  VAL n 
7  744  PHE n 
7  745  GLU n 
7  746  MET n 
7  747  ASP n 
7  748  ILE n 
7  749  ASP n 
7  750  ASP n 
7  751  GLU n 
7  752  TRP n 
7  753  GLU n 
7  754  LEU n 
7  755  ASP n 
7  756  GLU n 
7  757  SER n 
7  758  SER n 
7  759  ASP n 
7  760  GLU n 
7  761  GLU n 
7  762  GLU n 
7  763  GLU n 
7  764  ALA n 
7  765  SER n 
7  766  ASN n 
7  767  LYS n 
7  768  PRO n 
7  769  VAL n 
7  770  LYS n 
7  771  ILE n 
7  772  LYS n 
7  773  GLU n 
7  774  GLU n 
7  775  VAL n 
7  776  LEU n 
7  777  SER n 
7  778  GLU n 
7  779  SER n 
7  780  GLU n 
7  781  ALA n 
7  782  GLU n 
7  783  ASN n 
7  784  GLN n 
7  785  GLN n 
7  786  ALA n 
7  787  GLY n 
7  788  ALA n 
7  789  ALA n 
7  790  ALA n 
7  791  LEU n 
7  792  ALA n 
7  793  PRO n 
7  794  GLU n 
7  795  ILE n 
7  796  VAL n 
7  797  ILE n 
7  798  LYS n 
7  799  VAL n 
7  800  GLU n 
7  801  LYS n 
7  802  LEU n 
7  803  ASP n 
7  804  PRO n 
7  805  GLU n 
7  806  LEU n 
7  807  ASP n 
7  808  SER n 
7  809  GLY n 
7  810  GLY n 
7  811  SER n 
7  812  LEU n 
7  813  GLU n 
7  814  VAL n 
7  815  LEU n 
7  816  PHE n 
7  817  GLN n 
7  818  GLY n 
8  1    MET n 
8  2    ASN n 
8  3    LEU n 
8  4    GLU n 
8  5    ARG n 
8  6    LEU n 
8  7    ARG n 
8  8    LYS n 
8  9    ARG n 
8  10   VAL n 
8  11   ARG n 
8  12   GLN n 
8  13   TYR n 
8  14   LEU n 
8  15   ASP n 
8  16   GLN n 
8  17   GLN n 
8  18   GLN n 
8  19   TYR n 
8  20   GLN n 
8  21   SER n 
8  22   ALA n 
8  23   LEU n 
8  24   PHE n 
8  25   TRP n 
8  26   ALA n 
8  27   ASP n 
8  28   LYS n 
8  29   VAL n 
8  30   ALA n 
8  31   SER n 
8  32   LEU n 
8  33   SER n 
8  34   ARG n 
8  35   GLU n 
8  36   GLU n 
8  37   PRO n 
8  38   GLN n 
8  39   ASP n 
8  40   ILE n 
8  41   TYR n 
8  42   TRP n 
8  43   LEU n 
8  44   ALA n 
8  45   GLN n 
8  46   CYS n 
8  47   LEU n 
8  48   TYR n 
8  49   LEU n 
8  50   THR n 
8  51   ALA n 
8  52   GLN n 
8  53   TYR n 
8  54   HIS n 
8  55   ARG n 
8  56   ALA n 
8  57   ALA n 
8  58   HIS n 
8  59   ALA n 
8  60   LEU n 
8  61   ARG n 
8  62   SER n 
8  63   ARG n 
8  64   LYS n 
8  65   LEU n 
8  66   ASP n 
8  67   LYS n 
8  68   LEU n 
8  69   TYR n 
8  70   GLU n 
8  71   ALA n 
8  72   CYS n 
8  73   ARG n 
8  74   TYR n 
8  75   LEU n 
8  76   ALA n 
8  77   ALA n 
8  78   ARG n 
8  79   CYS n 
8  80   HIS n 
8  81   TYR n 
8  82   ALA n 
8  83   ALA n 
8  84   LYS n 
8  85   GLU n 
8  86   HIS n 
8  87   GLN n 
8  88   GLN n 
8  89   ALA n 
8  90   LEU n 
8  91   ASP n 
8  92   VAL n 
8  93   LEU n 
8  94   ASP n 
8  95   MET n 
8  96   GLU n 
8  97   GLU n 
8  98   PRO n 
8  99   ILE n 
8  100  ASN n 
8  101  LYS n 
8  102  ARG n 
8  103  LEU n 
8  104  PHE n 
8  105  GLU n 
8  106  LYS n 
8  107  TYR n 
8  108  LEU n 
8  109  LYS n 
8  110  ASP n 
8  111  GLU n 
8  112  SER n 
8  113  GLY n 
8  114  PHE n 
8  115  LYS n 
8  116  ASP n 
8  117  PRO n 
8  118  SER n 
8  119  SER n 
8  120  ASP n 
8  121  TRP n 
8  122  GLU n 
8  123  MET n 
8  124  SER n 
8  125  GLN n 
8  126  SER n 
8  127  SER n 
8  128  ILE n 
8  129  LYS n 
8  130  SER n 
8  131  SER n 
8  132  ILE n 
8  133  CYS n 
8  134  LEU n 
8  135  LEU n 
8  136  ARG n 
8  137  GLY n 
8  138  LYS n 
8  139  ILE n 
8  140  TYR n 
8  141  ASP n 
8  142  ALA n 
8  143  LEU n 
8  144  ASP n 
8  145  ASN n 
8  146  ARG n 
8  147  THR n 
8  148  LEU n 
8  149  ALA n 
8  150  THR n 
8  151  TYR n 
8  152  SER n 
8  153  TYR n 
8  154  LYS n 
8  155  GLU n 
8  156  ALA n 
8  157  LEU n 
8  158  LYS n 
8  159  LEU n 
8  160  ASP n 
8  161  VAL n 
8  162  TYR n 
8  163  CYS n 
8  164  PHE n 
8  165  GLU n 
8  166  ALA n 
8  167  PHE n 
8  168  ASP n 
8  169  LEU n 
8  170  LEU n 
8  171  THR n 
8  172  SER n 
8  173  HIS n 
8  174  HIS n 
8  175  MET n 
8  176  LEU n 
8  177  THR n 
8  178  ALA n 
8  179  GLN n 
8  180  GLU n 
8  181  GLU n 
8  182  LYS n 
8  183  GLU n 
8  184  LEU n 
8  185  LEU n 
8  186  GLU n 
8  187  SER n 
8  188  LEU n 
8  189  PRO n 
8  190  LEU n 
8  191  SER n 
8  192  LYS n 
8  193  LEU n 
8  194  CYS n 
8  195  ASN n 
8  196  GLU n 
8  197  GLU n 
8  198  GLN n 
8  199  GLU n 
8  200  LEU n 
8  201  LEU n 
8  202  ARG n 
8  203  PHE n 
8  204  LEU n 
8  205  PHE n 
8  206  GLU n 
8  207  ASN n 
8  208  LYS n 
8  209  LEU n 
8  210  LYS n 
8  211  LYS n 
8  212  TYR n 
8  213  ASN n 
8  214  LYS n 
8  215  PRO n 
8  216  SER n 
8  217  GLU n 
8  218  THR n 
8  219  VAL n 
8  220  ILE n 
8  221  PRO n 
8  222  GLU n 
8  223  SER n 
8  224  VAL n 
8  225  ASP n 
8  226  GLY n 
8  227  LEU n 
8  228  GLN n 
8  229  GLU n 
8  230  ASN n 
8  231  LEU n 
8  232  ASP n 
8  233  VAL n 
8  234  VAL n 
8  235  VAL n 
8  236  SER n 
8  237  LEU n 
8  238  ALA n 
8  239  GLU n 
8  240  ARG n 
8  241  HIS n 
8  242  TYR n 
8  243  TYR n 
8  244  ASN n 
8  245  CYS n 
8  246  ASP n 
8  247  PHE n 
8  248  LYS n 
8  249  MET n 
8  250  CYS n 
8  251  TYR n 
8  252  LYS n 
8  253  LEU n 
8  254  THR n 
8  255  SER n 
8  256  VAL n 
8  257  VAL n 
8  258  MET n 
8  259  GLU n 
8  260  LYS n 
8  261  ASP n 
8  262  PRO n 
8  263  PHE n 
8  264  HIS n 
8  265  ALA n 
8  266  SER n 
8  267  CYS n 
8  268  LEU n 
8  269  PRO n 
8  270  VAL n 
8  271  HIS n 
8  272  ILE n 
8  273  GLY n 
8  274  THR n 
8  275  LEU n 
8  276  VAL n 
8  277  GLU n 
8  278  LEU n 
8  279  ASN n 
8  280  LYS n 
8  281  ALA n 
8  282  ASN n 
8  283  GLU n 
8  284  LEU n 
8  285  PHE n 
8  286  TYR n 
8  287  LEU n 
8  288  SER n 
8  289  HIS n 
8  290  LYS n 
8  291  LEU n 
8  292  VAL n 
8  293  ASP n 
8  294  LEU n 
8  295  TYR n 
8  296  PRO n 
8  297  SER n 
8  298  ASN n 
8  299  PRO n 
8  300  VAL n 
8  301  SER n 
8  302  TRP n 
8  303  PHE n 
8  304  ALA n 
8  305  VAL n 
8  306  GLY n 
8  307  CYS n 
8  308  TYR n 
8  309  TYR n 
8  310  LEU n 
8  311  MET n 
8  312  VAL n 
8  313  GLY n 
8  314  HIS n 
8  315  LYS n 
8  316  ASN n 
8  317  GLU n 
8  318  HIS n 
8  319  ALA n 
8  320  ARG n 
8  321  ARG n 
8  322  TYR n 
8  323  LEU n 
8  324  SER n 
8  325  LYS n 
8  326  ALA n 
8  327  THR n 
8  328  THR n 
8  329  LEU n 
8  330  GLU n 
8  331  LYS n 
8  332  THR n 
8  333  TYR n 
8  334  GLY n 
8  335  PRO n 
8  336  ALA n 
8  337  TRP n 
8  338  ILE n 
8  339  ALA n 
8  340  TYR n 
8  341  GLY n 
8  342  HIS n 
8  343  SER n 
8  344  PHE n 
8  345  ALA n 
8  346  VAL n 
8  347  GLU n 
8  348  SER n 
8  349  GLU n 
8  350  HIS n 
8  351  ASP n 
8  352  GLN n 
8  353  ALA n 
8  354  MET n 
8  355  ALA n 
8  356  ALA n 
8  357  TYR n 
8  358  PHE n 
8  359  THR n 
8  360  ALA n 
8  361  ALA n 
8  362  GLN n 
8  363  LEU n 
8  364  MET n 
8  365  LYS n 
8  366  GLY n 
8  367  CYS n 
8  368  HIS n 
8  369  LEU n 
8  370  PRO n 
8  371  MET n 
8  372  LEU n 
8  373  TYR n 
8  374  ILE n 
8  375  GLY n 
8  376  LEU n 
8  377  GLU n 
8  378  TYR n 
8  379  GLY n 
8  380  LEU n 
8  381  THR n 
8  382  ASN n 
8  383  ASN n 
8  384  SER n 
8  385  LYS n 
8  386  LEU n 
8  387  ALA n 
8  388  GLU n 
8  389  ARG n 
8  390  PHE n 
8  391  PHE n 
8  392  SER n 
8  393  GLN n 
8  394  ALA n 
8  395  LEU n 
8  396  SER n 
8  397  ILE n 
8  398  ALA n 
8  399  PRO n 
8  400  GLU n 
8  401  ASP n 
8  402  PRO n 
8  403  PHE n 
8  404  VAL n 
8  405  MET n 
8  406  HIS n 
8  407  GLU n 
8  408  VAL n 
8  409  GLY n 
8  410  VAL n 
8  411  VAL n 
8  412  ALA n 
8  413  PHE n 
8  414  GLN n 
8  415  ASN n 
8  416  GLY n 
8  417  GLU n 
8  418  TRP n 
8  419  LYS n 
8  420  THR n 
8  421  ALA n 
8  422  GLU n 
8  423  LYS n 
8  424  TRP n 
8  425  PHE n 
8  426  LEU n 
8  427  ASP n 
8  428  ALA n 
8  429  LEU n 
8  430  GLU n 
8  431  LYS n 
8  432  ILE n 
8  433  LYS n 
8  434  ALA n 
8  435  ILE n 
8  436  GLY n 
8  437  ASN n 
8  438  GLU n 
8  439  VAL n 
8  440  THR n 
8  441  VAL n 
8  442  ASP n 
8  443  LYS n 
8  444  TRP n 
8  445  GLU n 
8  446  PRO n 
8  447  LEU n 
8  448  LEU n 
8  449  ASN n 
8  450  ASN n 
8  451  LEU n 
8  452  GLY n 
8  453  HIS n 
8  454  VAL n 
8  455  CYS n 
8  456  ARG n 
8  457  LYS n 
8  458  LEU n 
8  459  LYS n 
8  460  LYS n 
8  461  TYR n 
8  462  ALA n 
8  463  GLU n 
8  464  ALA n 
8  465  LEU n 
8  466  ASP n 
8  467  TYR n 
8  468  HIS n 
8  469  ARG n 
8  470  GLN n 
8  471  ALA n 
8  472  LEU n 
8  473  VAL n 
8  474  LEU n 
8  475  ILE n 
8  476  PRO n 
8  477  GLN n 
8  478  ASN n 
8  479  ALA n 
8  480  SER n 
8  481  THR n 
8  482  TYR n 
8  483  SER n 
8  484  ALA n 
8  485  ILE n 
8  486  GLY n 
8  487  TYR n 
8  488  ILE n 
8  489  HIS n 
8  490  SER n 
8  491  LEU n 
8  492  MET n 
8  493  GLY n 
8  494  ASN n 
8  495  PHE n 
8  496  GLU n 
8  497  ASN n 
8  498  ALA n 
8  499  VAL n 
8  500  ASP n 
8  501  TYR n 
8  502  PHE n 
8  503  HIS n 
8  504  THR n 
8  505  ALA n 
8  506  LEU n 
8  507  GLY n 
8  508  LEU n 
8  509  ARG n 
8  510  ARG n 
8  511  ASP n 
8  512  ASP n 
8  513  THR n 
8  514  PHE n 
8  515  SER n 
8  516  VAL n 
8  517  THR n 
8  518  MET n 
8  519  LEU n 
8  520  GLY n 
8  521  HIS n 
8  522  CYS n 
8  523  ILE n 
8  524  GLU n 
8  525  MET n 
8  526  TYR n 
8  527  ILE n 
8  528  GLY n 
8  529  ASP n 
8  530  SER n 
8  531  GLU n 
8  532  ALA n 
8  533  TYR n 
8  534  ILE n 
8  535  GLY n 
8  536  ALA n 
8  537  ASP n 
8  538  ILE n 
8  539  LYS n 
8  540  ASP n 
8  541  LYS n 
8  542  LEU n 
8  543  LYS n 
8  544  CYS n 
8  545  TYR n 
8  546  ASP n 
8  547  PHE n 
8  548  ASP n 
8  549  VAL n 
8  550  HIS n 
8  551  THR n 
8  552  MET n 
8  553  LYS n 
8  554  THR n 
8  555  LEU n 
8  556  LYS n 
8  557  ASN n 
8  558  ILE n 
8  559  ILE n 
8  560  SER n 
8  561  PRO n 
8  562  PRO n 
8  563  TRP n 
8  564  ASP n 
8  565  PHE n 
8  566  ARG n 
8  567  GLU n 
8  568  PHE n 
8  569  GLU n 
8  570  VAL n 
8  571  GLU n 
8  572  LYS n 
8  573  GLN n 
8  574  THR n 
8  575  ALA n 
8  576  GLU n 
8  577  GLU n 
8  578  THR n 
8  579  GLY n 
8  580  LEU n 
8  581  THR n 
8  582  PRO n 
8  583  LEU n 
8  584  GLU n 
8  585  THR n 
8  586  SER n 
8  587  ARG n 
8  588  LYS n 
8  589  THR n 
8  590  PRO n 
8  591  ASP n 
8  592  SER n 
8  593  ARG n 
8  594  PRO n 
8  595  SER n 
8  596  LEU n 
8  597  GLU n 
8  598  GLU n 
8  599  THR n 
8  600  PHE n 
8  601  GLU n 
8  602  ILE n 
8  603  GLU n 
8  604  MET n 
8  605  ASN n 
8  606  GLU n 
8  607  SER n 
8  608  ASP n 
8  609  MET n 
8  610  MET n 
8  611  LEU n 
8  612  GLU n 
8  613  THR n 
8  614  SER n 
8  615  MET n 
8  616  SER n 
8  617  ASP n 
8  618  HIS n 
8  619  SER n 
8  620  THR n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PRO n 
9  5    ASN n 
9  6    LYS n 
9  7    THR n 
9  8    PRO n 
9  9    PRO n 
9  10   GLY n 
9  11   ALA n 
9  12   ASP n 
9  13   PRO n 
9  14   LYS n 
9  15   GLN n 
9  16   LEU n 
9  17   GLU n 
9  18   ARG n 
9  19   THR n 
9  20   GLY n 
9  21   THR n 
9  22   VAL n 
9  23   ARG n 
9  24   GLU n 
9  25   ILE n 
9  26   GLY n 
9  27   SER n 
9  28   GLN n 
9  29   ALA n 
9  30   VAL n 
9  31   TRP n 
9  32   SER n 
9  33   LEU n 
9  34   SER n 
9  35   SER n 
9  36   CYS n 
9  37   LYS n 
9  38   PRO n 
9  39   GLY n 
9  40   PHE n 
9  41   GLY n 
9  42   VAL n 
9  43   ASP n 
9  44   GLN n 
9  45   LEU n 
9  46   ARG n 
9  47   ASP n 
9  48   ASP n 
9  49   ASN n 
9  50   LEU n 
9  51   GLU n 
9  52   THR n 
9  53   TYR n 
9  54   TRP n 
9  55   GLN n 
9  56   SER n 
9  57   ASP n 
9  58   GLY n 
9  59   SER n 
9  60   GLN n 
9  61   PRO n 
9  62   HIS n 
9  63   LEU n 
9  64   VAL n 
9  65   ASN n 
9  66   ILE n 
9  67   GLN n 
9  68   PHE n 
9  69   ARG n 
9  70   ARG n 
9  71   LYS n 
9  72   THR n 
9  73   THR n 
9  74   VAL n 
9  75   LYS n 
9  76   THR n 
9  77   LEU n 
9  78   CYS n 
9  79   ILE n 
9  80   TYR n 
9  81   ALA n 
9  82   ASP n 
9  83   TYR n 
9  84   LYS n 
9  85   SER n 
9  86   ASP n 
9  87   GLU n 
9  88   SER n 
9  89   TYR n 
9  90   THR n 
9  91   PRO n 
9  92   SER n 
9  93   LYS n 
9  94   ILE n 
9  95   SER n 
9  96   VAL n 
9  97   ARG n 
9  98   VAL n 
9  99   GLY n 
9  100  ASN n 
9  101  ASN n 
9  102  PHE n 
9  103  HIS n 
9  104  ASN n 
9  105  LEU n 
9  106  GLN n 
9  107  GLU n 
9  108  ILE n 
9  109  ARG n 
9  110  GLN n 
9  111  LEU n 
9  112  GLU n 
9  113  LEU n 
9  114  VAL n 
9  115  GLU n 
9  116  PRO n 
9  117  SER n 
9  118  GLY n 
9  119  TRP n 
9  120  ILE n 
9  121  HIS n 
9  122  VAL n 
9  123  PRO n 
9  124  LEU n 
9  125  THR n 
9  126  ASP n 
9  127  ASN n 
9  128  HIS n 
9  129  LYS n 
9  130  LYS n 
9  131  PRO n 
9  132  THR n 
9  133  ARG n 
9  134  THR n 
9  135  PHE n 
9  136  MET n 
9  137  ILE n 
9  138  GLN n 
9  139  ILE n 
9  140  ALA n 
9  141  VAL n 
9  142  LEU n 
9  143  ALA n 
9  144  ASN n 
9  145  HIS n 
9  146  GLN n 
9  147  ASN n 
9  148  GLY n 
9  149  ARG n 
9  150  ASP n 
9  151  THR n 
9  152  HIS n 
9  153  MET n 
9  154  ARG n 
9  155  GLN n 
9  156  ILE n 
9  157  LYS n 
9  158  ILE n 
9  159  TYR n 
9  160  THR n 
9  161  PRO n 
9  162  VAL n 
9  163  GLU n 
9  164  GLU n 
9  165  SER n 
9  166  SER n 
9  167  ILE n 
9  168  GLY n 
9  169  LYS n 
9  170  PHE n 
9  171  PRO n 
9  172  ARG n 
9  173  CYS n 
9  174  THR n 
9  175  THR n 
9  176  ILE n 
9  177  ASP n 
9  178  PHE n 
9  179  MET n 
9  180  MET n 
9  181  TYR n 
9  182  ARG n 
9  183  SER n 
9  184  ILE n 
9  185  ARG n 
10 1    MET n 
10 2    ASP n 
10 3    SER n 
10 4    GLU n 
10 5    VAL n 
10 6    GLN n 
10 7    ARG n 
10 8    ASP n 
10 9    GLY n 
10 10   ARG n 
10 11   ILE n 
10 12   LEU n 
10 13   ASP n 
10 14   LEU n 
10 15   ILE n 
10 16   ASP n 
10 17   ASP n 
10 18   ALA n 
10 19   TRP n 
10 20   ARG n 
10 21   GLU n 
10 22   ASP n 
10 23   LYS n 
10 24   LEU n 
10 25   PRO n 
10 26   TYR n 
10 27   GLU n 
10 28   ASP n 
10 29   VAL n 
10 30   ALA n 
10 31   ILE n 
10 32   PRO n 
10 33   LEU n 
10 34   ASN n 
10 35   GLU n 
10 36   LEU n 
10 37   PRO n 
10 38   GLU n 
10 39   PRO n 
10 40   GLU n 
10 41   GLN n 
10 42   ASP n 
10 43   ASN n 
10 44   GLY n 
10 45   GLY n 
10 46   THR n 
10 47   THR n 
10 48   GLU n 
10 49   SER n 
10 50   VAL n 
10 51   LYS n 
10 52   GLU n 
10 53   GLN n 
10 54   GLU n 
10 55   MET n 
10 56   LYS n 
10 57   TRP n 
10 58   THR n 
10 59   ASP n 
10 60   LEU n 
10 61   ALA n 
10 62   LEU n 
10 63   GLN n 
10 64   TYR n 
10 65   LEU n 
10 66   HIS n 
10 67   GLU n 
10 68   ASN n 
10 69   VAL n 
10 70   PRO n 
10 71   PRO n 
10 72   ILE n 
10 73   GLY n 
10 74   ASN n 
11 1    MET n 
11 2    ALA n 
11 3    ALA n 
11 4    ALA n 
11 5    VAL n 
11 6    VAL n 
11 7    VAL n 
11 8    ALA n 
11 9    GLU n 
11 10   GLY n 
11 11   ASP n 
11 12   SER n 
11 13   ASP n 
11 14   SER n 
11 15   ARG n 
11 16   PRO n 
11 17   GLY n 
11 18   GLN n 
11 19   GLU n 
11 20   LEU n 
11 21   LEU n 
11 22   VAL n 
11 23   ALA n 
11 24   TRP n 
11 25   ASN n 
11 26   THR n 
11 27   VAL n 
11 28   SER n 
11 29   THR n 
11 30   GLY n 
11 31   LEU n 
11 32   VAL n 
11 33   PRO n 
11 34   PRO n 
11 35   ALA n 
11 36   ALA n 
11 37   LEU n 
11 38   GLY n 
11 39   LEU n 
11 40   VAL n 
11 41   SER n 
11 42   SER n 
11 43   ARG n 
11 44   THR n 
11 45   SER n 
11 46   GLY n 
11 47   ALA n 
11 48   VAL n 
11 49   PRO n 
11 50   PRO n 
11 51   LYS n 
11 52   GLU n 
11 53   GLU n 
11 54   GLU n 
11 55   LEU n 
11 56   ARG n 
11 57   ALA n 
11 58   ALA n 
11 59   VAL n 
11 60   GLU n 
11 61   VAL n 
11 62   LEU n 
11 63   ARG n 
11 64   GLY n 
11 65   HIS n 
11 66   GLY n 
11 67   LEU n 
11 68   HIS n 
11 69   SER n 
11 70   VAL n 
11 71   LEU n 
11 72   GLU n 
11 73   GLU n 
11 74   TRP n 
11 75   PHE n 
11 76   VAL n 
11 77   GLU n 
11 78   VAL n 
11 79   LEU n 
11 80   GLN n 
11 81   ASN n 
11 82   ASP n 
11 83   LEU n 
11 84   GLN n 
11 85   ALA n 
11 86   ASN n 
11 87   ILE n 
11 88   SER n 
11 89   PRO n 
11 90   GLU n 
11 91   PHE n 
11 92   TRP n 
11 93   ASN n 
11 94   ALA n 
11 95   ILE n 
11 96   SER n 
11 97   GLN n 
11 98   CYS n 
11 99   GLU n 
11 100  ASN n 
11 101  SER n 
11 102  ALA n 
11 103  ASP n 
11 104  GLU n 
11 105  PRO n 
11 106  GLN n 
11 107  CYS n 
11 108  LEU n 
11 109  LEU n 
11 110  LEU n 
11 111  LEU n 
11 112  LEU n 
11 113  ASP n 
11 114  ALA n 
11 115  PHE n 
11 116  GLY n 
11 117  LEU n 
11 118  LEU n 
11 119  GLU n 
11 120  SER n 
11 121  ARG n 
11 122  LEU n 
11 123  ASP n 
11 124  PRO n 
11 125  TYR n 
11 126  LEU n 
11 127  ARG n 
11 128  SER n 
11 129  LEU n 
11 130  GLU n 
11 131  LEU n 
11 132  LEU n 
11 133  GLU n 
11 134  LYS n 
11 135  TRP n 
11 136  THR n 
11 137  ARG n 
11 138  LEU n 
11 139  GLY n 
11 140  LEU n 
11 141  LEU n 
11 142  MET n 
11 143  GLY n 
11 144  THR n 
11 145  GLY n 
11 146  ALA n 
11 147  GLN n 
11 148  GLY n 
11 149  LEU n 
11 150  ARG n 
11 151  GLU n 
11 152  GLU n 
11 153  VAL n 
11 154  HIS n 
11 155  THR n 
11 156  MET n 
11 157  LEU n 
11 158  ARG n 
11 159  GLY n 
11 160  VAL n 
11 161  LEU n 
11 162  PHE n 
11 163  PHE n 
11 164  SER n 
11 165  THR n 
11 166  PRO n 
11 167  ARG n 
11 168  THR n 
11 169  PHE n 
11 170  GLN n 
11 171  GLU n 
11 172  MET n 
11 173  ILE n 
11 174  GLN n 
11 175  ARG n 
11 176  LEU n 
11 177  TYR n 
11 178  GLY n 
11 179  CYS n 
11 180  PHE n 
11 181  LEU n 
11 182  ARG n 
11 183  VAL n 
11 184  TYR n 
11 185  MET n 
11 186  GLN n 
11 187  SER n 
11 188  LYS n 
11 189  ARG n 
11 190  LYS n 
11 191  GLY n 
11 192  GLU n 
11 193  GLY n 
11 194  GLY n 
11 195  THR n 
11 196  ASP n 
11 197  PRO n 
11 198  GLU n 
11 199  LEU n 
11 200  GLU n 
11 201  GLY n 
11 202  GLU n 
11 203  LEU n 
11 204  ASP n 
11 205  SER n 
11 206  ARG n 
11 207  TYR n 
11 208  ALA n 
11 209  ARG n 
11 210  ARG n 
11 211  ARG n 
11 212  TYR n 
11 213  TYR n 
11 214  ARG n 
11 215  LEU n 
11 216  LEU n 
11 217  GLN n 
11 218  SER n 
11 219  PRO n 
11 220  LEU n 
11 221  CYS n 
11 222  ALA n 
11 223  GLY n 
11 224  CYS n 
11 225  SER n 
11 226  SER n 
11 227  ASP n 
11 228  LYS n 
11 229  GLN n 
11 230  GLN n 
11 231  CYS n 
11 232  TRP n 
11 233  CYS n 
11 234  ARG n 
11 235  GLN n 
11 236  ALA n 
11 237  LEU n 
11 238  GLU n 
11 239  GLN n 
11 240  PHE n 
11 241  HIS n 
11 242  GLN n 
11 243  LEU n 
11 244  SER n 
11 245  GLN n 
11 246  VAL n 
11 247  LEU n 
11 248  HIS n 
11 249  ARG n 
11 250  LEU n 
11 251  SER n 
11 252  LEU n 
11 253  LEU n 
11 254  GLU n 
11 255  ARG n 
11 256  VAL n 
11 257  SER n 
11 258  ALA n 
11 259  GLU n 
11 260  ALA n 
11 261  VAL n 
11 262  THR n 
11 263  THR n 
11 264  THR n 
11 265  LEU n 
11 266  HIS n 
11 267  GLN n 
11 268  VAL n 
11 269  THR n 
11 270  ARG n 
11 271  GLU n 
11 272  ARG n 
11 273  MET n 
11 274  GLU n 
11 275  ASP n 
11 276  ARG n 
11 277  CYS n 
11 278  ARG n 
11 279  GLY n 
11 280  GLU n 
11 281  TYR n 
11 282  GLU n 
11 283  ARG n 
11 284  SER n 
11 285  PHE n 
11 286  LEU n 
11 287  ARG n 
11 288  GLU n 
11 289  PHE n 
11 290  HIS n 
11 291  LYS n 
11 292  TRP n 
11 293  ILE n 
11 294  GLU n 
11 295  ARG n 
11 296  VAL n 
11 297  VAL n 
11 298  GLY n 
11 299  TRP n 
11 300  LEU n 
11 301  GLY n 
11 302  LYS n 
11 303  VAL n 
11 304  PHE n 
11 305  LEU n 
11 306  GLN n 
11 307  ASP n 
11 308  GLY n 
11 309  PRO n 
11 310  ALA n 
11 311  ARG n 
11 312  PRO n 
11 313  ALA n 
11 314  SER n 
11 315  PRO n 
11 316  GLU n 
11 317  ALA n 
11 318  GLY n 
11 319  ASN n 
11 320  THR n 
11 321  LEU n 
11 322  ARG n 
11 323  ARG n 
11 324  TRP n 
11 325  ARG n 
11 326  CYS n 
11 327  HIS n 
11 328  VAL n 
11 329  GLN n 
11 330  ARG n 
11 331  PHE n 
11 332  PHE n 
11 333  TYR n 
11 334  ARG n 
11 335  ILE n 
11 336  TYR n 
11 337  ALA n 
11 338  SER n 
11 339  LEU n 
11 340  ARG n 
11 341  ILE n 
11 342  GLU n 
11 343  GLU n 
11 344  LEU n 
11 345  PHE n 
11 346  SER n 
11 347  ILE n 
11 348  VAL n 
11 349  ARG n 
11 350  ASP n 
11 351  PHE n 
11 352  PRO n 
11 353  ASP n 
11 354  SER n 
11 355  ARG n 
11 356  PRO n 
11 357  ALA n 
11 358  ILE n 
11 359  GLU n 
11 360  ASP n 
11 361  LEU n 
11 362  LYS n 
11 363  TYR n 
11 364  CYS n 
11 365  LEU n 
11 366  GLU n 
11 367  ARG n 
11 368  THR n 
11 369  ASP n 
11 370  GLN n 
11 371  ARG n 
11 372  GLN n 
11 373  GLN n 
11 374  LEU n 
11 375  LEU n 
11 376  VAL n 
11 377  SER n 
11 378  LEU n 
11 379  LYS n 
11 380  ALA n 
11 381  ALA n 
11 382  LEU n 
11 383  GLU n 
11 384  THR n 
11 385  ARG n 
11 386  LEU n 
11 387  LEU n 
11 388  HIS n 
11 389  PRO n 
11 390  GLY n 
11 391  VAL n 
11 392  ASN n 
11 393  THR n 
11 394  CYS n 
11 395  ASP n 
11 396  ILE n 
11 397  ILE n 
11 398  THR n 
11 399  LEU n 
11 400  TYR n 
11 401  ILE n 
11 402  SER n 
11 403  ALA n 
11 404  ILE n 
11 405  LYS n 
11 406  ALA n 
11 407  LEU n 
11 408  ARG n 
11 409  VAL n 
11 410  LEU n 
11 411  ASP n 
11 412  PRO n 
11 413  SER n 
11 414  MET n 
11 415  VAL n 
11 416  ILE n 
11 417  LEU n 
11 418  GLU n 
11 419  VAL n 
11 420  ALA n 
11 421  CYS n 
11 422  GLU n 
11 423  PRO n 
11 424  ILE n 
11 425  ARG n 
11 426  ARG n 
11 427  TYR n 
11 428  LEU n 
11 429  ARG n 
11 430  THR n 
11 431  ARG n 
11 432  GLU n 
11 433  ASP n 
11 434  THR n 
11 435  VAL n 
11 436  ARG n 
11 437  GLN n 
11 438  ILE n 
11 439  VAL n 
11 440  ALA n 
11 441  GLY n 
11 442  LEU n 
11 443  THR n 
11 444  GLY n 
11 445  ASP n 
11 446  SER n 
11 447  ASP n 
11 448  GLY n 
11 449  THR n 
11 450  GLY n 
11 451  ASP n 
11 452  LEU n 
11 453  ALA n 
11 454  VAL n 
11 455  GLU n 
11 456  LEU n 
11 457  SER n 
11 458  LYS n 
11 459  THR n 
11 460  ASP n 
11 461  PRO n 
11 462  ALA n 
11 463  SER n 
11 464  LEU n 
11 465  GLU n 
11 466  THR n 
11 467  GLY n 
11 468  GLN n 
11 469  ASP n 
11 470  SER n 
11 471  GLU n 
11 472  ASP n 
11 473  ASP n 
11 474  SER n 
11 475  GLY n 
11 476  GLU n 
11 477  PRO n 
11 478  GLU n 
11 479  ASP n 
11 480  TRP n 
11 481  VAL n 
11 482  PRO n 
11 483  ASP n 
11 484  PRO n 
11 485  VAL n 
11 486  ASP n 
11 487  ALA n 
11 488  ASP n 
11 489  PRO n 
11 490  GLY n 
11 491  LYS n 
11 492  SER n 
11 493  SER n 
11 494  SER n 
11 495  LYS n 
11 496  ARG n 
11 497  ARG n 
11 498  SER n 
11 499  SER n 
11 500  ASP n 
11 501  ILE n 
11 502  ILE n 
11 503  SER n 
11 504  LEU n 
11 505  LEU n 
11 506  VAL n 
11 507  SER n 
11 508  ILE n 
11 509  TYR n 
11 510  GLY n 
11 511  SER n 
11 512  LYS n 
11 513  ASP n 
11 514  LEU n 
11 515  PHE n 
11 516  ILE n 
11 517  ASN n 
11 518  GLU n 
11 519  TYR n 
11 520  ARG n 
11 521  SER n 
11 522  LEU n 
11 523  LEU n 
11 524  ALA n 
11 525  ASP n 
11 526  ARG n 
11 527  LEU n 
11 528  LEU n 
11 529  HIS n 
11 530  GLN n 
11 531  PHE n 
11 532  SER n 
11 533  PHE n 
11 534  GLU n 
11 535  PRO n 
11 536  GLU n 
11 537  ARG n 
11 538  GLU n 
11 539  ILE n 
11 540  ARG n 
11 541  ASN n 
11 542  VAL n 
11 543  GLU n 
11 544  LEU n 
11 545  LEU n 
11 546  LYS n 
11 547  LEU n 
11 548  ARG n 
11 549  PHE n 
11 550  GLY n 
11 551  GLU n 
11 552  ALA n 
11 553  PRO n 
11 554  MET n 
11 555  HIS n 
11 556  PHE n 
11 557  CYS n 
11 558  GLU n 
11 559  VAL n 
11 560  MET n 
11 561  LEU n 
11 562  LYS n 
11 563  ASP n 
11 564  MET n 
11 565  ALA n 
11 566  ASP n 
11 567  SER n 
11 568  ARG n 
11 569  ARG n 
11 570  ILE n 
11 571  ASN n 
11 572  ALA n 
11 573  ASN n 
11 574  ILE n 
11 575  ARG n 
11 576  GLU n 
11 577  GLU n 
11 578  ASP n 
11 579  GLU n 
11 580  LYS n 
11 581  ARG n 
11 582  PRO n 
11 583  ALA n 
11 584  GLU n 
11 585  GLU n 
11 586  GLN n 
11 587  PRO n 
11 588  PRO n 
11 589  PHE n 
11 590  GLY n 
11 591  VAL n 
11 592  TYR n 
11 593  ALA n 
11 594  VAL n 
11 595  ILE n 
11 596  LEU n 
11 597  SER n 
11 598  SER n 
11 599  GLU n 
11 600  PHE n 
11 601  TRP n 
11 602  PRO n 
11 603  PRO n 
11 604  PHE n 
11 605  LYS n 
11 606  ASP n 
11 607  GLU n 
11 608  LYS n 
11 609  LEU n 
11 610  GLU n 
11 611  VAL n 
11 612  PRO n 
11 613  GLU n 
11 614  ASP n 
11 615  ILE n 
11 616  ARG n 
11 617  ALA n 
11 618  ALA n 
11 619  LEU n 
11 620  GLU n 
11 621  ALA n 
11 622  TYR n 
11 623  CYS n 
11 624  LYS n 
11 625  LYS n 
11 626  TYR n 
11 627  GLU n 
11 628  GLN n 
11 629  LEU n 
11 630  LYS n 
11 631  ALA n 
11 632  MET n 
11 633  ARG n 
11 634  THR n 
11 635  LEU n 
11 636  SER n 
11 637  TRP n 
11 638  LYS n 
11 639  HIS n 
11 640  THR n 
11 641  LEU n 
11 642  GLY n 
11 643  LEU n 
11 644  VAL n 
11 645  THR n 
11 646  MET n 
11 647  ASP n 
11 648  VAL n 
11 649  GLU n 
11 650  LEU n 
11 651  ALA n 
11 652  ASP n 
11 653  ARG n 
11 654  THR n 
11 655  LEU n 
11 656  SER n 
11 657  VAL n 
11 658  ALA n 
11 659  VAL n 
11 660  THR n 
11 661  PRO n 
11 662  VAL n 
11 663  GLN n 
11 664  ALA n 
11 665  VAL n 
11 666  ILE n 
11 667  LEU n 
11 668  LEU n 
11 669  TYR n 
11 670  PHE n 
11 671  GLN n 
11 672  ASP n 
11 673  GLN n 
11 674  ALA n 
11 675  SER n 
11 676  TRP n 
11 677  THR n 
11 678  LEU n 
11 679  GLU n 
11 680  GLU n 
11 681  LEU n 
11 682  SER n 
11 683  LYS n 
11 684  ALA n 
11 685  VAL n 
11 686  LYS n 
11 687  MET n 
11 688  PRO n 
11 689  VAL n 
11 690  ALA n 
11 691  LEU n 
11 692  LEU n 
11 693  ARG n 
11 694  ARG n 
11 695  ARG n 
11 696  MET n 
11 697  SER n 
11 698  VAL n 
11 699  TRP n 
11 700  LEU n 
11 701  GLN n 
11 702  GLN n 
11 703  GLY n 
11 704  VAL n 
11 705  LEU n 
11 706  ARG n 
11 707  GLU n 
11 708  GLU n 
11 709  PRO n 
11 710  PRO n 
11 711  GLY n 
11 712  THR n 
11 713  PHE n 
11 714  SER n 
11 715  VAL n 
11 716  ILE n 
11 717  GLU n 
11 718  GLU n 
11 719  GLU n 
11 720  ARG n 
11 721  PRO n 
11 722  GLN n 
11 723  ASP n 
11 724  ARG n 
11 725  ASP n 
11 726  ASN n 
11 727  MET n 
11 728  VAL n 
11 729  LEU n 
11 730  ILE n 
11 731  ASP n 
11 732  SER n 
11 733  ASP n 
11 734  ASP n 
11 735  GLU n 
11 736  SER n 
11 737  ASP n 
11 738  SER n 
11 739  GLY n 
11 740  MET n 
11 741  ALA n 
11 742  SER n 
11 743  GLN n 
11 744  ALA n 
11 745  ASP n 
11 746  GLN n 
11 747  LYS n 
11 748  GLU n 
11 749  GLU n 
11 750  GLU n 
11 751  LEU n 
11 752  LEU n 
11 753  LEU n 
11 754  PHE n 
11 755  TRP n 
11 756  THR n 
11 757  TYR n 
11 758  ILE n 
11 759  GLN n 
11 760  ALA n 
11 761  MET n 
11 762  LEU n 
11 763  THR n 
11 764  ASN n 
11 765  LEU n 
11 766  GLU n 
11 767  SER n 
11 768  LEU n 
11 769  SER n 
11 770  LEU n 
11 771  ASP n 
11 772  ARG n 
11 773  ILE n 
11 774  TYR n 
11 775  ASN n 
11 776  MET n 
11 777  LEU n 
11 778  ARG n 
11 779  MET n 
11 780  PHE n 
11 781  VAL n 
11 782  VAL n 
11 783  THR n 
11 784  GLY n 
11 785  PRO n 
11 786  ALA n 
11 787  LEU n 
11 788  ALA n 
11 789  GLU n 
11 790  ILE n 
11 791  ASP n 
11 792  LEU n 
11 793  GLN n 
11 794  GLU n 
11 795  LEU n 
11 796  GLN n 
11 797  GLY n 
11 798  TYR n 
11 799  LEU n 
11 800  GLN n 
11 801  LYS n 
11 802  LYS n 
11 803  VAL n 
11 804  ARG n 
11 805  ASP n 
11 806  GLN n 
11 807  GLN n 
11 808  LEU n 
11 809  VAL n 
11 810  TYR n 
11 811  GLU n 
11 812  ALA n 
11 813  GLY n 
11 814  VAL n 
11 815  TYR n 
11 816  ARG n 
11 817  LEU n 
11 818  PRO n 
11 819  LYS n 
11 820  ASN n 
11 821  CYS n 
11 822  SER n 
12 1    MET n 
12 2    ALA n 
12 3    SER n 
12 4    VAL n 
12 5    HIS n 
12 6    GLU n 
12 7    SER n 
12 8    LEU n 
12 9    TYR n 
12 10   PHE n 
12 11   ASN n 
12 12   PRO n 
12 13   MET n 
12 14   MET n 
12 15   THR n 
12 16   ASN n 
12 17   GLY n 
12 18   VAL n 
12 19   VAL n 
12 20   HIS n 
12 21   ALA n 
12 22   ASN n 
12 23   VAL n 
12 24   PHE n 
12 25   GLY n 
12 26   ILE n 
12 27   LYS n 
12 28   ASP n 
12 29   TRP n 
12 30   VAL n 
12 31   THR n 
12 32   PRO n 
12 33   TYR n 
12 34   LYS n 
12 35   ILE n 
12 36   ALA n 
12 37   VAL n 
12 38   LEU n 
12 39   VAL n 
12 40   LEU n 
12 41   LEU n 
12 42   ASN n 
12 43   GLU n 
12 44   MET n 
12 45   SER n 
12 46   ARG n 
12 47   THR n 
12 48   GLY n 
12 49   GLU n 
12 50   GLY n 
12 51   ALA n 
12 52   VAL n 
12 53   SER n 
12 54   LEU n 
12 55   MET n 
12 56   GLU n 
12 57   ARG n 
12 58   ARG n 
12 59   ARG n 
12 60   LEU n 
12 61   ASN n 
12 62   GLN n 
12 63   LEU n 
12 64   LEU n 
12 65   LEU n 
12 66   PRO n 
12 67   LEU n 
12 68   LEU n 
12 69   GLN n 
12 70   GLY n 
12 71   PRO n 
12 72   ASP n 
12 73   ILE n 
12 74   THR n 
12 75   LEU n 
12 76   SER n 
12 77   LYS n 
12 78   LEU n 
12 79   TYR n 
12 80   LYS n 
12 81   LEU n 
12 82   ILE n 
12 83   GLU n 
12 84   GLU n 
12 85   SER n 
12 86   CYS n 
12 87   PRO n 
12 88   GLN n 
12 89   LEU n 
12 90   ALA n 
12 91   ASN n 
12 92   SER n 
12 93   VAL n 
12 94   GLN n 
12 95   ILE n 
12 96   ARG n 
12 97   ILE n 
12 98   LYS n 
12 99   LEU n 
12 100  MET n 
12 101  ALA n 
12 102  GLU n 
12 103  GLY n 
12 104  GLU n 
12 105  LEU n 
12 106  LYS n 
12 107  ASP n 
12 108  MET n 
12 109  GLU n 
12 110  GLN n 
12 111  PHE n 
12 112  PHE n 
12 113  ASP n 
12 114  ASP n 
12 115  LEU n 
12 116  SER n 
12 117  ASP n 
12 118  SER n 
12 119  PHE n 
12 120  SER n 
12 121  GLY n 
12 122  THR n 
12 123  GLU n 
12 124  PRO n 
12 125  GLU n 
12 126  VAL n 
12 127  HIS n 
12 128  LYS n 
12 129  THR n 
12 130  SER n 
12 131  VAL n 
12 132  VAL n 
12 133  GLY n 
12 134  LEU n 
12 135  PHE n 
12 136  LEU n 
12 137  ARG n 
12 138  HIS n 
12 139  MET n 
12 140  ILE n 
12 141  LEU n 
12 142  ALA n 
12 143  TYR n 
12 144  SER n 
12 145  LYS n 
12 146  LEU n 
12 147  SER n 
12 148  PHE n 
12 149  SER n 
12 150  GLN n 
12 151  VAL n 
12 152  PHE n 
12 153  LYS n 
12 154  LEU n 
12 155  TYR n 
12 156  THR n 
12 157  ALA n 
12 158  LEU n 
12 159  GLN n 
12 160  GLN n 
12 161  TYR n 
12 162  PHE n 
12 163  GLN n 
12 164  ASN n 
12 165  GLY n 
12 166  GLU n 
12 167  LYS n 
12 168  LYS n 
12 169  THR n 
12 170  VAL n 
12 171  GLU n 
12 172  ASP n 
12 173  ALA n 
12 174  ASP n 
12 175  MET n 
12 176  GLU n 
12 177  LEU n 
12 178  THR n 
12 179  SER n 
12 180  ARG n 
12 181  ASP n 
12 182  GLU n 
12 183  GLY n 
12 184  GLU n 
12 185  ARG n 
12 186  LYS n 
12 187  MET n 
12 188  GLU n 
12 189  LYS n 
12 190  GLU n 
12 191  GLU n 
12 192  LEU n 
12 193  ASP n 
12 194  VAL n 
12 195  SER n 
12 196  VAL n 
12 197  ARG n 
12 198  GLU n 
12 199  GLU n 
12 200  GLU n 
12 201  VAL n 
12 202  SER n 
12 203  CYS n 
12 204  SER n 
12 205  GLY n 
12 206  PRO n 
12 207  LEU n 
12 208  SER n 
12 209  GLN n 
12 210  LYS n 
12 211  GLN n 
12 212  ALA n 
12 213  GLU n 
12 214  PHE n 
12 215  PHE n 
12 216  LEU n 
12 217  SER n 
12 218  GLN n 
12 219  GLN n 
12 220  ALA n 
12 221  GLU n 
12 222  LEU n 
12 223  LEU n 
12 224  LYS n 
12 225  ASN n 
12 226  ASP n 
12 227  GLU n 
12 228  THR n 
12 229  LYS n 
12 230  ALA n 
12 231  LEU n 
12 232  GLU n 
12 233  PRO n 
12 234  ALA n 
12 235  SER n 
12 236  LEU n 
12 237  GLN n 
12 238  LYS n 
12 239  GLU n 
12 240  LEU n 
12 241  ASN n 
12 242  ASN n 
12 243  LEU n 
12 244  LEU n 
12 245  LYS n 
12 246  PHE n 
12 247  ASN n 
12 248  PRO n 
12 249  ASP n 
12 250  PHE n 
12 251  ALA n 
12 252  GLU n 
12 253  ALA n 
12 254  HIS n 
12 255  TYR n 
12 256  LEU n 
12 257  SER n 
12 258  TYR n 
12 259  LEU n 
12 260  ASN n 
12 261  ASN n 
12 262  LEU n 
12 263  ARG n 
12 264  VAL n 
12 265  GLN n 
12 266  ASP n 
12 267  VAL n 
12 268  PHE n 
12 269  SER n 
12 270  SER n 
12 271  THR n 
12 272  HIS n 
12 273  SER n 
12 274  LEU n 
12 275  LEU n 
12 276  HIS n 
12 277  TYR n 
12 278  PHE n 
12 279  ASP n 
12 280  ARG n 
12 281  LEU n 
12 282  ILE n 
12 283  LEU n 
12 284  THR n 
12 285  GLY n 
12 286  ALA n 
12 287  GLU n 
12 288  SER n 
12 289  LYS n 
12 290  SER n 
12 291  ASN n 
12 292  GLY n 
12 293  GLU n 
12 294  GLU n 
12 295  GLY n 
12 296  TYR n 
12 297  GLY n 
12 298  ARG n 
12 299  SER n 
12 300  LEU n 
12 301  ARG n 
12 302  TYR n 
12 303  ALA n 
12 304  ALA n 
12 305  LEU n 
12 306  ASN n 
12 307  LEU n 
12 308  ALA n 
12 309  ALA n 
12 310  LEU n 
12 311  HIS n 
12 312  CYS n 
12 313  ARG n 
12 314  PHE n 
12 315  GLY n 
12 316  HIS n 
12 317  TYR n 
12 318  GLN n 
12 319  GLN n 
12 320  ALA n 
12 321  GLU n 
12 322  LEU n 
12 323  ALA n 
12 324  LEU n 
12 325  GLN n 
12 326  GLU n 
12 327  ALA n 
12 328  ILE n 
12 329  ARG n 
12 330  ILE n 
12 331  ALA n 
12 332  GLN n 
12 333  GLU n 
12 334  SER n 
12 335  ASN n 
12 336  ASP n 
12 337  HIS n 
12 338  VAL n 
12 339  CYS n 
12 340  LEU n 
12 341  GLN n 
12 342  HIS n 
12 343  CYS n 
12 344  LEU n 
12 345  SER n 
12 346  TRP n 
12 347  LEU n 
12 348  TYR n 
12 349  VAL n 
12 350  LEU n 
12 351  GLY n 
12 352  GLN n 
12 353  LYS n 
12 354  ARG n 
12 355  SER n 
12 356  ASP n 
12 357  SER n 
12 358  TYR n 
12 359  VAL n 
12 360  LEU n 
12 361  LEU n 
12 362  GLU n 
12 363  HIS n 
12 364  SER n 
12 365  VAL n 
12 366  LYS n 
12 367  LYS n 
12 368  ALA n 
12 369  VAL n 
12 370  HIS n 
12 371  PHE n 
12 372  GLY n 
12 373  LEU n 
12 374  PRO n 
12 375  TYR n 
12 376  LEU n 
12 377  ALA n 
12 378  SER n 
12 379  LEU n 
12 380  GLY n 
12 381  ILE n 
12 382  GLN n 
12 383  SER n 
12 384  LEU n 
12 385  VAL n 
12 386  GLN n 
12 387  GLN n 
12 388  ARG n 
12 389  ALA n 
12 390  PHE n 
12 391  ALA n 
12 392  GLY n 
12 393  LYS n 
12 394  THR n 
12 395  ALA n 
12 396  ASN n 
12 397  LYS n 
12 398  LEU n 
12 399  MET n 
12 400  ASP n 
12 401  ALA n 
12 402  LEU n 
12 403  LYS n 
12 404  ASP n 
12 405  SER n 
12 406  ASP n 
12 407  LEU n 
12 408  LEU n 
12 409  HIS n 
12 410  TRP n 
12 411  LYS n 
12 412  HIS n 
12 413  SER n 
12 414  LEU n 
12 415  SER n 
12 416  GLU n 
12 417  LEU n 
12 418  ILE n 
12 419  ASP n 
12 420  ILE n 
12 421  SER n 
12 422  ILE n 
12 423  ALA n 
12 424  GLN n 
12 425  LYS n 
12 426  THR n 
12 427  ALA n 
12 428  ILE n 
12 429  TRP n 
12 430  ARG n 
12 431  LEU n 
12 432  TYR n 
12 433  GLY n 
12 434  ARG n 
12 435  SER n 
12 436  THR n 
12 437  MET n 
12 438  ALA n 
12 439  LEU n 
12 440  GLN n 
12 441  GLN n 
12 442  ALA n 
12 443  GLN n 
12 444  MET n 
12 445  LEU n 
12 446  LEU n 
12 447  SER n 
12 448  MET n 
12 449  ASN n 
12 450  SER n 
12 451  LEU n 
12 452  GLU n 
12 453  ALA n 
12 454  VAL n 
12 455  ASN n 
12 456  ALA n 
12 457  GLY n 
12 458  VAL n 
12 459  GLN n 
12 460  GLN n 
12 461  ASN n 
12 462  ASN n 
12 463  THR n 
12 464  GLU n 
12 465  SER n 
12 466  PHE n 
12 467  ALA n 
12 468  VAL n 
12 469  ALA n 
12 470  LEU n 
12 471  CYS n 
12 472  HIS n 
12 473  LEU n 
12 474  ALA n 
12 475  GLU n 
12 476  LEU n 
12 477  HIS n 
12 478  ALA n 
12 479  GLU n 
12 480  GLN n 
12 481  GLY n 
12 482  CYS n 
12 483  PHE n 
12 484  ALA n 
12 485  ALA n 
12 486  ALA n 
12 487  SER n 
12 488  GLU n 
12 489  VAL n 
12 490  LEU n 
12 491  LYS n 
12 492  HIS n 
12 493  LEU n 
12 494  LYS n 
12 495  GLU n 
12 496  ARG n 
12 497  PHE n 
12 498  PRO n 
12 499  PRO n 
12 500  ASN n 
12 501  SER n 
12 502  GLN n 
12 503  HIS n 
12 504  ALA n 
12 505  GLN n 
12 506  LEU n 
12 507  TRP n 
12 508  MET n 
12 509  LEU n 
12 510  CYS n 
12 511  ASP n 
12 512  GLN n 
12 513  LYS n 
12 514  ILE n 
12 515  GLN n 
12 516  PHE n 
12 517  ASP n 
12 518  ARG n 
12 519  ALA n 
12 520  MET n 
12 521  ASN n 
12 522  ASP n 
12 523  GLY n 
12 524  LYS n 
12 525  TYR n 
12 526  HIS n 
12 527  LEU n 
12 528  ALA n 
12 529  ASP n 
12 530  SER n 
12 531  LEU n 
12 532  VAL n 
12 533  THR n 
12 534  GLY n 
12 535  ILE n 
12 536  THR n 
12 537  ALA n 
12 538  LEU n 
12 539  ASN n 
12 540  SER n 
12 541  ILE n 
12 542  GLU n 
12 543  GLY n 
12 544  VAL n 
12 545  TYR n 
12 546  ARG n 
12 547  LYS n 
12 548  ALA n 
12 549  VAL n 
12 550  VAL n 
12 551  LEU n 
12 552  GLN n 
12 553  ALA n 
12 554  GLN n 
12 555  ASN n 
12 556  GLN n 
12 557  MET n 
12 558  SER n 
12 559  GLU n 
12 560  ALA n 
12 561  HIS n 
12 562  LYS n 
12 563  LEU n 
12 564  LEU n 
12 565  GLN n 
12 566  LYS n 
12 567  LEU n 
12 568  LEU n 
12 569  VAL n 
12 570  HIS n 
12 571  CYS n 
12 572  GLN n 
12 573  LYS n 
12 574  LEU n 
12 575  LYS n 
12 576  ASN n 
12 577  THR n 
12 578  GLU n 
12 579  MET n 
12 580  VAL n 
12 581  ILE n 
12 582  SER n 
12 583  VAL n 
12 584  LEU n 
12 585  LEU n 
12 586  SER n 
12 587  VAL n 
12 588  ALA n 
12 589  GLU n 
12 590  LEU n 
12 591  TYR n 
12 592  TRP n 
12 593  ARG n 
12 594  SER n 
12 595  SER n 
12 596  SER n 
12 597  PRO n 
12 598  THR n 
12 599  ILE n 
12 600  ALA n 
12 601  LEU n 
12 602  PRO n 
12 603  MET n 
12 604  LEU n 
12 605  LEU n 
12 606  GLN n 
12 607  ALA n 
12 608  LEU n 
12 609  ALA n 
12 610  LEU n 
12 611  SER n 
12 612  LYS n 
12 613  GLU n 
12 614  TYR n 
12 615  ARG n 
12 616  LEU n 
12 617  GLN n 
12 618  TYR n 
12 619  LEU n 
12 620  ALA n 
12 621  SER n 
12 622  GLU n 
12 623  THR n 
12 624  VAL n 
12 625  LEU n 
12 626  ASN n 
12 627  LEU n 
12 628  ALA n 
12 629  PHE n 
12 630  ALA n 
12 631  GLN n 
12 632  LEU n 
12 633  ILE n 
12 634  LEU n 
12 635  GLY n 
12 636  ILE n 
12 637  PRO n 
12 638  GLU n 
12 639  GLN n 
12 640  ALA n 
12 641  LEU n 
12 642  SER n 
12 643  LEU n 
12 644  LEU n 
12 645  HIS n 
12 646  MET n 
12 647  ALA n 
12 648  ILE n 
12 649  GLU n 
12 650  PRO n 
12 651  ILE n 
12 652  LEU n 
12 653  ALA n 
12 654  ASP n 
12 655  GLY n 
12 656  ALA n 
12 657  ILE n 
12 658  LEU n 
12 659  ASP n 
12 660  LYS n 
12 661  GLY n 
12 662  ARG n 
12 663  ALA n 
12 664  MET n 
12 665  PHE n 
12 666  LEU n 
12 667  VAL n 
12 668  ALA n 
12 669  LYS n 
12 670  CYS n 
12 671  GLN n 
12 672  VAL n 
12 673  ALA n 
12 674  SER n 
12 675  ALA n 
12 676  ALA n 
12 677  SER n 
12 678  TYR n 
12 679  ASP n 
12 680  GLN n 
12 681  PRO n 
12 682  LYS n 
12 683  LYS n 
12 684  ALA n 
12 685  GLU n 
12 686  ALA n 
12 687  LEU n 
12 688  GLU n 
12 689  ALA n 
12 690  ALA n 
12 691  ILE n 
12 692  GLU n 
12 693  ASN n 
12 694  LEU n 
12 695  ASN n 
12 696  GLU n 
12 697  ALA n 
12 698  LYS n 
12 699  ASN n 
12 700  TYR n 
12 701  PHE n 
12 702  ALA n 
12 703  LYS n 
12 704  VAL n 
12 705  ASP n 
12 706  CYS n 
12 707  LYS n 
12 708  GLU n 
12 709  ARG n 
12 710  ILE n 
12 711  ARG n 
12 712  ASP n 
12 713  VAL n 
12 714  VAL n 
12 715  TYR n 
12 716  PHE n 
12 717  GLN n 
12 718  ALA n 
12 719  ARG n 
12 720  LEU n 
12 721  TYR n 
12 722  HIS n 
12 723  THR n 
12 724  LEU n 
12 725  GLY n 
12 726  LYS n 
12 727  THR n 
12 728  GLN n 
12 729  GLU n 
12 730  ARG n 
12 731  ASN n 
12 732  ARG n 
12 733  CYS n 
12 734  ALA n 
12 735  MET n 
12 736  LEU n 
12 737  PHE n 
12 738  ARG n 
12 739  GLN n 
12 740  LEU n 
12 741  HIS n 
12 742  GLN n 
12 743  GLU n 
12 744  LEU n 
12 745  PRO n 
12 746  SER n 
12 747  HIS n 
12 748  GLY n 
12 749  VAL n 
12 750  PRO n 
12 751  LEU n 
12 752  ILE n 
12 753  ASN n 
12 754  HIS n 
12 755  LEU n 
13 1    MET n 
13 2    ALA n 
13 3    SER n 
13 4    GLN n 
13 5    ASN n 
13 6    ARG n 
13 7    ASP n 
13 8    PRO n 
13 9    ALA n 
13 10   ALA n 
13 11   THR n 
13 12   SER n 
13 13   VAL n 
13 14   ALA n 
13 15   ALA n 
13 16   ALA n 
13 17   ARG n 
13 18   LYS n 
13 19   GLY n 
13 20   ALA n 
13 21   GLU n 
13 22   PRO n 
13 23   SER n 
13 24   GLY n 
13 25   GLY n 
13 26   ALA n 
13 27   ALA n 
13 28   ARG n 
13 29   GLY n 
13 30   PRO n 
13 31   VAL n 
13 32   GLY n 
13 33   LYS n 
13 34   ARG n 
13 35   LEU n 
13 36   GLN n 
13 37   GLN n 
13 38   GLU n 
13 39   LEU n 
13 40   MET n 
13 41   THR n 
13 42   LEU n 
13 43   MET n 
13 44   MET n 
13 45   SER n 
13 46   GLY n 
13 47   ASP n 
13 48   LYS n 
13 49   GLY n 
13 50   ILE n 
13 51   SER n 
13 52   ALA n 
13 53   PHE n 
13 54   PRO n 
13 55   GLU n 
13 56   SER n 
13 57   ASP n 
13 58   ASN n 
13 59   LEU n 
13 60   PHE n 
13 61   LYS n 
13 62   TRP n 
13 63   VAL n 
13 64   GLY n 
13 65   THR n 
13 66   ILE n 
13 67   HIS n 
13 68   GLY n 
13 69   ALA n 
13 70   ALA n 
13 71   GLY n 
13 72   THR n 
13 73   VAL n 
13 74   TYR n 
13 75   GLU n 
13 76   ASP n 
13 77   LEU n 
13 78   ARG n 
13 79   TYR n 
13 80   LYS n 
13 81   LEU n 
13 82   SER n 
13 83   LEU n 
13 84   GLU n 
13 85   PHE n 
13 86   PRO n 
13 87   SER n 
13 88   GLY n 
13 89   TYR n 
13 90   PRO n 
13 91   TYR n 
13 92   ASN n 
13 93   ALA n 
13 94   PRO n 
13 95   THR n 
13 96   VAL n 
13 97   LYS n 
13 98   PHE n 
13 99   LEU n 
13 100  THR n 
13 101  PRO n 
13 102  CYS n 
13 103  TYR n 
13 104  HIS n 
13 105  PRO n 
13 106  ASN n 
13 107  VAL n 
13 108  ASP n 
13 109  THR n 
13 110  GLN n 
13 111  GLY n 
13 112  ASN n 
13 113  ILE n 
13 114  CYS n 
13 115  LEU n 
13 116  ASP n 
13 117  ILE n 
13 118  LEU n 
13 119  LYS n 
13 120  GLU n 
13 121  LYS n 
13 122  TRP n 
13 123  SER n 
13 124  ALA n 
13 125  LEU n 
13 126  TYR n 
13 127  ASP n 
13 128  VAL n 
13 129  ARG n 
13 130  THR n 
13 131  ILE n 
13 132  LEU n 
13 133  LEU n 
13 134  SER n 
13 135  ILE n 
13 136  GLN n 
13 137  SER n 
13 138  LEU n 
13 139  LEU n 
13 140  GLY n 
13 141  GLU n 
13 142  PRO n 
13 143  ASN n 
13 144  ILE n 
13 145  ASP n 
13 146  SER n 
13 147  PRO n 
13 148  LEU n 
13 149  ASN n 
13 150  THR n 
13 151  HIS n 
13 152  ALA n 
13 153  ALA n 
13 154  GLU n 
13 155  LEU n 
13 156  TRP n 
13 157  LYS n 
13 158  ASN n 
13 159  PRO n 
13 160  THR n 
13 161  ALA n 
13 162  PHE n 
13 163  LYS n 
13 164  LYS n 
13 165  TYR n 
13 166  LEU n 
13 167  GLN n 
13 168  GLU n 
13 169  THR n 
13 170  TYR n 
13 171  SER n 
13 172  LYS n 
13 173  GLN n 
13 174  VAL n 
13 175  THR n 
13 176  SER n 
13 177  GLN n 
13 178  GLU n 
13 179  PRO n 
13 180  GLY n 
13 181  GLY n 
13 182  SER n 
13 183  GLY n 
13 184  SER n 
13 185  LEU n 
13 186  GLU n 
13 187  VAL n 
13 188  LEU n 
13 189  PHE n 
13 190  GLN n 
14 1    MET n 
14 2    ALA n 
14 3    GLN n 
14 4    PHE n 
14 5    ALA n 
14 6    PHE n 
14 7    GLU n 
14 8    SER n 
14 9    ASP n 
14 10   LEU n 
14 11   HIS n 
14 12   SER n 
14 13   LEU n 
14 14   LEU n 
14 15   GLN n 
14 16   LEU n 
14 17   ASP n 
14 18   ALA n 
14 19   PRO n 
14 20   ILE n 
14 21   PRO n 
14 22   ASN n 
14 23   ALA n 
14 24   PRO n 
14 25   PRO n 
14 26   ALA n 
14 27   ARG n 
14 28   TRP n 
14 29   GLN n 
14 30   ARG n 
14 31   LYS n 
14 32   ALA n 
14 33   LYS n 
14 34   GLU n 
14 35   ALA n 
14 36   ALA n 
14 37   GLY n 
14 38   PRO n 
14 39   ALA n 
14 40   PRO n 
14 41   SER n 
14 42   PRO n 
14 43   MET n 
14 44   ARG n 
14 45   ALA n 
14 46   ALA n 
14 47   ASN n 
14 48   ARG n 
14 49   SER n 
14 50   HIS n 
14 51   SER n 
14 52   ALA n 
14 53   GLY n 
14 54   ARG n 
14 55   THR n 
14 56   PRO n 
14 57   GLY n 
14 58   ARG n 
14 59   THR n 
14 60   PRO n 
14 61   GLY n 
14 62   LYS n 
14 63   SER n 
14 64   SER n 
14 65   SER n 
14 66   LYS n 
14 67   VAL n 
14 68   GLN n 
14 69   THR n 
14 70   THR n 
14 71   PRO n 
14 72   SER n 
14 73   LYS n 
14 74   PRO n 
14 75   GLY n 
14 76   GLY n 
14 77   ASP n 
14 78   ARG n 
14 79   TYR n 
14 80   ILE n 
14 81   PRO n 
14 82   HIS n 
14 83   ARG n 
14 84   SER n 
14 85   ALA n 
14 86   ALA n 
14 87   GLN n 
14 88   MET n 
14 89   GLU n 
14 90   VAL n 
14 91   ALA n 
14 92   SER n 
14 93   PHE n 
14 94   LEU n 
14 95   LEU n 
14 96   SER n 
14 97   LYS n 
14 98   GLU n 
14 99   ASN n 
14 100  GLN n 
14 101  PRO n 
14 102  GLU n 
14 103  ASN n 
14 104  SER n 
14 105  GLN n 
14 106  THR n 
14 107  PRO n 
14 108  THR n 
14 109  LYS n 
14 110  LYS n 
14 111  GLU n 
14 112  HIS n 
14 113  GLN n 
14 114  LYS n 
14 115  ALA n 
14 116  TRP n 
14 117  ALA n 
14 118  LEU n 
14 119  ASN n 
14 120  LEU n 
14 121  ASN n 
14 122  GLY n 
14 123  PHE n 
14 124  ASP n 
14 125  VAL n 
14 126  GLU n 
14 127  GLU n 
14 128  ALA n 
14 129  LYS n 
14 130  ILE n 
14 131  LEU n 
14 132  ARG n 
14 133  LEU n 
14 134  SER n 
14 135  GLY n 
14 136  LYS n 
14 137  PRO n 
14 138  GLN n 
14 139  ASN n 
14 140  ALA n 
14 141  PRO n 
14 142  GLU n 
14 143  GLY n 
14 144  TYR n 
14 145  GLN n 
14 146  ASN n 
14 147  ARG n 
14 148  LEU n 
14 149  LYS n 
14 150  VAL n 
14 151  LEU n 
14 152  TYR n 
14 153  SER n 
14 154  GLN n 
14 155  LYS n 
14 156  ALA n 
14 157  THR n 
14 158  PRO n 
14 159  GLY n 
14 160  SER n 
14 161  SER n 
14 162  ARG n 
14 163  LYS n 
14 164  THR n 
14 165  CYS n 
14 166  ARG n 
14 167  TYR n 
14 168  ILE n 
14 169  PRO n 
14 170  SER n 
14 171  LEU n 
14 172  PRO n 
14 173  ASP n 
14 174  ARG n 
14 175  ILE n 
14 176  LEU n 
14 177  ASP n 
14 178  ALA n 
14 179  PRO n 
14 180  GLU n 
14 181  ILE n 
14 182  ARG n 
14 183  ASN n 
14 184  ASP n 
14 185  TYR n 
14 186  TYR n 
14 187  LEU n 
14 188  ASN n 
14 189  LEU n 
14 190  VAL n 
14 191  ASP n 
14 192  TRP n 
14 193  SER n 
14 194  SER n 
14 195  GLY n 
14 196  ASN n 
14 197  VAL n 
14 198  LEU n 
14 199  ALA n 
14 200  VAL n 
14 201  ALA n 
14 202  LEU n 
14 203  ASP n 
14 204  ASN n 
14 205  SER n 
14 206  VAL n 
14 207  TYR n 
14 208  LEU n 
14 209  TRP n 
14 210  SER n 
14 211  ALA n 
14 212  SER n 
14 213  SER n 
14 214  GLY n 
14 215  ASP n 
14 216  ILE n 
14 217  LEU n 
14 218  GLN n 
14 219  LEU n 
14 220  LEU n 
14 221  GLN n 
14 222  MET n 
14 223  GLU n 
14 224  GLN n 
14 225  PRO n 
14 226  GLY n 
14 227  GLU n 
14 228  TYR n 
14 229  ILE n 
14 230  SER n 
14 231  SER n 
14 232  VAL n 
14 233  ALA n 
14 234  TRP n 
14 235  ILE n 
14 236  LYS n 
14 237  GLU n 
14 238  GLY n 
14 239  ASN n 
14 240  TYR n 
14 241  LEU n 
14 242  ALA n 
14 243  VAL n 
14 244  GLY n 
14 245  THR n 
14 246  SER n 
14 247  SER n 
14 248  ALA n 
14 249  GLU n 
14 250  VAL n 
14 251  GLN n 
14 252  LEU n 
14 253  TRP n 
14 254  ASP n 
14 255  VAL n 
14 256  GLN n 
14 257  GLN n 
14 258  GLN n 
14 259  LYS n 
14 260  ARG n 
14 261  LEU n 
14 262  ARG n 
14 263  ASN n 
14 264  MET n 
14 265  THR n 
14 266  SER n 
14 267  HIS n 
14 268  SER n 
14 269  ALA n 
14 270  ARG n 
14 271  VAL n 
14 272  GLY n 
14 273  SER n 
14 274  LEU n 
14 275  SER n 
14 276  TRP n 
14 277  ASN n 
14 278  SER n 
14 279  TYR n 
14 280  ILE n 
14 281  LEU n 
14 282  SER n 
14 283  SER n 
14 284  GLY n 
14 285  SER n 
14 286  ARG n 
14 287  SER n 
14 288  GLY n 
14 289  HIS n 
14 290  ILE n 
14 291  HIS n 
14 292  HIS n 
14 293  HIS n 
14 294  ASP n 
14 295  VAL n 
14 296  ARG n 
14 297  VAL n 
14 298  ALA n 
14 299  GLU n 
14 300  HIS n 
14 301  HIS n 
14 302  VAL n 
14 303  ALA n 
14 304  THR n 
14 305  LEU n 
14 306  SER n 
14 307  GLY n 
14 308  HIS n 
14 309  SER n 
14 310  GLN n 
14 311  GLU n 
14 312  VAL n 
14 313  CYS n 
14 314  GLY n 
14 315  LEU n 
14 316  ARG n 
14 317  TRP n 
14 318  ALA n 
14 319  PRO n 
14 320  ASP n 
14 321  GLY n 
14 322  ARG n 
14 323  HIS n 
14 324  LEU n 
14 325  ALA n 
14 326  SER n 
14 327  GLY n 
14 328  GLY n 
14 329  ASN n 
14 330  ASP n 
14 331  ASN n 
14 332  LEU n 
14 333  VAL n 
14 334  ASN n 
14 335  VAL n 
14 336  TRP n 
14 337  PRO n 
14 338  SER n 
14 339  ALA n 
14 340  PRO n 
14 341  GLY n 
14 342  GLU n 
14 343  GLY n 
14 344  GLY n 
14 345  TRP n 
14 346  VAL n 
14 347  PRO n 
14 348  LEU n 
14 349  GLN n 
14 350  THR n 
14 351  PHE n 
14 352  THR n 
14 353  GLN n 
14 354  HIS n 
14 355  GLN n 
14 356  GLY n 
14 357  ALA n 
14 358  VAL n 
14 359  LYS n 
14 360  ALA n 
14 361  VAL n 
14 362  ALA n 
14 363  TRP n 
14 364  CYS n 
14 365  PRO n 
14 366  TRP n 
14 367  GLN n 
14 368  SER n 
14 369  ASN n 
14 370  VAL n 
14 371  LEU n 
14 372  ALA n 
14 373  THR n 
14 374  GLY n 
14 375  GLY n 
14 376  GLY n 
14 377  THR n 
14 378  SER n 
14 379  ASP n 
14 380  ARG n 
14 381  HIS n 
14 382  ILE n 
14 383  ARG n 
14 384  ILE n 
14 385  TRP n 
14 386  ASN n 
14 387  VAL n 
14 388  CYS n 
14 389  SER n 
14 390  GLY n 
14 391  ALA n 
14 392  CYS n 
14 393  LEU n 
14 394  SER n 
14 395  ALA n 
14 396  VAL n 
14 397  ASP n 
14 398  ALA n 
14 399  HIS n 
14 400  SER n 
14 401  GLN n 
14 402  VAL n 
14 403  CYS n 
14 404  SER n 
14 405  ILE n 
14 406  LEU n 
14 407  TRP n 
14 408  SER n 
14 409  PRO n 
14 410  HIS n 
14 411  TYR n 
14 412  LYS n 
14 413  GLU n 
14 414  LEU n 
14 415  ILE n 
14 416  SER n 
14 417  GLY n 
14 418  HIS n 
14 419  GLY n 
14 420  PHE n 
14 421  ALA n 
14 422  GLN n 
14 423  ASN n 
14 424  GLN n 
14 425  LEU n 
14 426  VAL n 
14 427  ILE n 
14 428  TRP n 
14 429  LYS n 
14 430  TYR n 
14 431  PRO n 
14 432  THR n 
14 433  MET n 
14 434  ALA n 
14 435  LYS n 
14 436  VAL n 
14 437  ALA n 
14 438  GLU n 
14 439  LEU n 
14 440  LYS n 
14 441  GLY n 
14 442  HIS n 
14 443  THR n 
14 444  SER n 
14 445  ARG n 
14 446  VAL n 
14 447  LEU n 
14 448  SER n 
14 449  LEU n 
14 450  THR n 
14 451  MET n 
14 452  SER n 
14 453  PRO n 
14 454  ASP n 
14 455  GLY n 
14 456  ALA n 
14 457  THR n 
14 458  VAL n 
14 459  ALA n 
14 460  SER n 
14 461  ALA n 
14 462  ALA n 
14 463  ALA n 
14 464  ASP n 
14 465  GLU n 
14 466  THR n 
14 467  LEU n 
14 468  ARG n 
14 469  LEU n 
14 470  TRP n 
14 471  ARG n 
14 472  CYS n 
14 473  PHE n 
14 474  GLU n 
14 475  LEU n 
14 476  ASP n 
14 477  PRO n 
14 478  ALA n 
14 479  ARG n 
14 480  ARG n 
14 481  ARG n 
14 482  GLU n 
14 483  ARG n 
14 484  GLU n 
14 485  LYS n 
14 486  ALA n 
14 487  SER n 
14 488  ALA n 
14 489  ALA n 
14 490  LYS n 
14 491  SER n 
14 492  SER n 
14 493  LEU n 
14 494  ILE n 
14 495  HIS n 
14 496  GLN n 
14 497  GLY n 
14 498  ILE n 
14 499  ARG n 
15 1    ASN n 
15 2    LYS n 
15 3    GLU n 
15 4    ASN n 
15 5    GLU n 
15 6    GLY n 
15 7    PRO n 
15 8    GLU n 
15 9    TYR n 
15 10   PRO n 
15 11   THR n 
15 12   LYS n 
15 13   ILE n 
15 14   GLU n 
15 15   UNK n 
15 16   TYR n 
15 17   LEU n 
15 18   GLU n 
15 19   GLU n 
15 20   GLN n 
15 21   LYS n 
15 22   PRO n 
15 23   LYS n 
15 24   ARG n 
15 25   ALA n 
15 26   ALA n 
15 27   LEU n 
15 28   SER n 
15 29   ASP n 
15 30   ILE n 
15 31   THR n 
15 32   ASN n 
15 33   SER n 
16 1    MET n 
16 2    ASN n 
16 3    VAL n 
16 4    ILE n 
16 5    ASP n 
16 6    HIS n 
16 7    VAL n 
16 8    ARG n 
16 9    ASP n 
16 10   MET n 
16 11   ALA n 
16 12   ALA n 
16 13   ALA n 
16 14   GLY n 
16 15   LEU n 
16 16   HIS n 
16 17   SER n 
16 18   ASN n 
16 19   VAL n 
16 20   ARG n 
16 21   LEU n 
16 22   LEU n 
16 23   SER n 
16 24   SER n 
16 25   LEU n 
16 26   LEU n 
16 27   LEU n 
16 28   THR n 
16 29   MET n 
16 30   SER n 
16 31   ASN n 
16 32   ASN n 
16 33   ASN n 
16 34   PRO n 
16 35   GLU n 
16 36   LEU n 
16 37   PHE n 
16 38   SER n 
16 39   PRO n 
16 40   PRO n 
16 41   GLN n 
16 42   LYS n 
16 43   TYR n 
16 44   GLN n 
16 45   LEU n 
16 46   LEU n 
16 47   VAL n 
16 48   TYR n 
16 49   HIS n 
16 50   ALA n 
16 51   ASP n 
16 52   SER n 
16 53   LEU n 
16 54   PHE n 
16 55   HIS n 
16 56   ASP n 
16 57   LYS n 
16 58   GLU n 
16 59   TYR n 
16 60   ARG n 
16 61   ASN n 
16 62   ALA n 
16 63   VAL n 
16 64   SER n 
16 65   LYS n 
16 66   TYR n 
16 67   THR n 
16 68   MET n 
16 69   ALA n 
16 70   LEU n 
16 71   GLN n 
16 72   GLN n 
16 73   LYS n 
16 74   LYS n 
16 75   ALA n 
16 76   LEU n 
16 77   SER n 
16 78   LYS n 
16 79   THR n 
16 80   SER n 
16 81   LYS n 
16 82   VAL n 
16 83   ARG n 
16 84   PRO n 
16 85   SER n 
16 86   THR n 
16 87   GLY n 
16 88   ASN n 
16 89   SER n 
16 90   ALA n 
16 91   SER n 
16 92   THR n 
16 93   PRO n 
16 94   GLN n 
16 95   SER n 
16 96   GLN n 
16 97   CYS n 
16 98   LEU n 
16 99   PRO n 
16 100  SER n 
16 101  GLU n 
16 102  ILE n 
16 103  GLU n 
16 104  VAL n 
16 105  LYS n 
16 106  TYR n 
16 107  LYS n 
16 108  MET n 
16 109  ALA n 
16 110  GLU n 
16 111  CYS n 
16 112  TYR n 
16 113  THR n 
16 114  MET n 
16 115  LEU n 
16 116  LYS n 
16 117  GLN n 
16 118  ASP n 
16 119  LYS n 
16 120  ASP n 
16 121  ALA n 
16 122  ILE n 
16 123  ALA n 
16 124  ILE n 
16 125  LEU n 
16 126  ASP n 
16 127  GLY n 
16 128  ILE n 
16 129  PRO n 
16 130  SER n 
16 131  ARG n 
16 132  GLN n 
16 133  ARG n 
16 134  THR n 
16 135  PRO n 
16 136  LYS n 
16 137  ILE n 
16 138  ASN n 
16 139  MET n 
16 140  MET n 
16 141  LEU n 
16 142  ALA n 
16 143  ASN n 
16 144  LEU n 
16 145  TYR n 
16 146  LYS n 
16 147  LYS n 
16 148  ALA n 
16 149  GLY n 
16 150  GLN n 
16 151  GLU n 
16 152  ARG n 
16 153  PRO n 
16 154  SER n 
16 155  VAL n 
16 156  THR n 
16 157  SER n 
16 158  TYR n 
16 159  LYS n 
16 160  GLU n 
16 161  VAL n 
16 162  LEU n 
16 163  ARG n 
16 164  GLN n 
16 165  CYS n 
16 166  PRO n 
16 167  LEU n 
16 168  ALA n 
16 169  LEU n 
16 170  ASP n 
16 171  ALA n 
16 172  ILE n 
16 173  LEU n 
16 174  GLY n 
16 175  LEU n 
16 176  LEU n 
16 177  SER n 
16 178  LEU n 
16 179  SER n 
16 180  VAL n 
16 181  LYS n 
16 182  GLY n 
16 183  ALA n 
16 184  GLU n 
16 185  VAL n 
16 186  ALA n 
16 187  SER n 
16 188  MET n 
16 189  THR n 
16 190  MET n 
16 191  ASN n 
16 192  VAL n 
16 193  ILE n 
16 194  GLN n 
16 195  THR n 
16 196  VAL n 
16 197  PRO n 
16 198  ASN n 
16 199  LEU n 
16 200  ASP n 
16 201  TRP n 
16 202  LEU n 
16 203  SER n 
16 204  VAL n 
16 205  TRP n 
16 206  ILE n 
16 207  LYS n 
16 208  ALA n 
16 209  TYR n 
16 210  ALA n 
16 211  PHE n 
16 212  VAL n 
16 213  HIS n 
16 214  THR n 
16 215  GLY n 
16 216  ASP n 
16 217  ASN n 
16 218  SER n 
16 219  ARG n 
16 220  ALA n 
16 221  ILE n 
16 222  SER n 
16 223  THR n 
16 224  ILE n 
16 225  CYS n 
16 226  SER n 
16 227  LEU n 
16 228  GLU n 
16 229  LYS n 
16 230  LYS n 
16 231  SER n 
16 232  LEU n 
16 233  LEU n 
16 234  ARG n 
16 235  ASP n 
16 236  ASN n 
16 237  VAL n 
16 238  ASP n 
16 239  LEU n 
16 240  LEU n 
16 241  GLY n 
16 242  SER n 
16 243  LEU n 
16 244  ALA n 
16 245  ASP n 
16 246  LEU n 
16 247  TYR n 
16 248  PHE n 
16 249  ARG n 
16 250  ALA n 
16 251  GLY n 
16 252  ASP n 
16 253  ASN n 
16 254  LYS n 
16 255  ASN n 
16 256  SER n 
16 257  VAL n 
16 258  LEU n 
16 259  LYS n 
16 260  PHE n 
16 261  GLU n 
16 262  GLN n 
16 263  ALA n 
16 264  GLN n 
16 265  MET n 
16 266  LEU n 
16 267  ASP n 
16 268  PRO n 
16 269  TYR n 
16 270  LEU n 
16 271  ILE n 
16 272  LYS n 
16 273  GLY n 
16 274  MET n 
16 275  ASP n 
16 276  VAL n 
16 277  TYR n 
16 278  GLY n 
16 279  TYR n 
16 280  LEU n 
16 281  LEU n 
16 282  ALA n 
16 283  ARG n 
16 284  GLU n 
16 285  GLY n 
16 286  ARG n 
16 287  LEU n 
16 288  GLU n 
16 289  ASP n 
16 290  VAL n 
16 291  GLU n 
16 292  ASN n 
16 293  LEU n 
16 294  GLY n 
16 295  CYS n 
16 296  ARG n 
16 297  LEU n 
16 298  PHE n 
16 299  ASN n 
16 300  ILE n 
16 301  SER n 
16 302  ASP n 
16 303  GLN n 
16 304  HIS n 
16 305  ALA n 
16 306  GLU n 
16 307  PRO n 
16 308  TRP n 
16 309  VAL n 
16 310  VAL n 
16 311  SER n 
16 312  GLY n 
16 313  CYS n 
16 314  HIS n 
16 315  SER n 
16 316  PHE n 
16 317  TYR n 
16 318  SER n 
16 319  LYS n 
16 320  ARG n 
16 321  TYR n 
16 322  SER n 
16 323  ARG n 
16 324  ALA n 
16 325  LEU n 
16 326  TYR n 
16 327  LEU n 
16 328  GLY n 
16 329  ALA n 
16 330  LYS n 
16 331  ALA n 
16 332  ILE n 
16 333  GLN n 
16 334  LEU n 
16 335  ASN n 
16 336  SER n 
16 337  ASN n 
16 338  SER n 
16 339  VAL n 
16 340  GLN n 
16 341  ALA n 
16 342  LEU n 
16 343  LEU n 
16 344  LEU n 
16 345  LYS n 
16 346  GLY n 
16 347  ALA n 
16 348  ALA n 
16 349  LEU n 
16 350  ARG n 
16 351  ASN n 
16 352  MET n 
16 353  GLY n 
16 354  ARG n 
16 355  VAL n 
16 356  GLN n 
16 357  GLU n 
16 358  ALA n 
16 359  ILE n 
16 360  ILE n 
16 361  HIS n 
16 362  PHE n 
16 363  ARG n 
16 364  GLU n 
16 365  ALA n 
16 366  ILE n 
16 367  ARG n 
16 368  LEU n 
16 369  ALA n 
16 370  PRO n 
16 371  CYS n 
16 372  ARG n 
16 373  LEU n 
16 374  ASP n 
16 375  CYS n 
16 376  TYR n 
16 377  GLU n 
16 378  GLY n 
16 379  LEU n 
16 380  ILE n 
16 381  GLU n 
16 382  CYS n 
16 383  TYR n 
16 384  LEU n 
16 385  ALA n 
16 386  SER n 
16 387  ASN n 
16 388  SER n 
16 389  ILE n 
16 390  ARG n 
16 391  GLU n 
16 392  ALA n 
16 393  MET n 
16 394  VAL n 
16 395  MET n 
16 396  ALA n 
16 397  ASN n 
16 398  ASN n 
16 399  VAL n 
16 400  TYR n 
16 401  LYS n 
16 402  THR n 
16 403  LEU n 
16 404  GLY n 
16 405  ALA n 
16 406  ASN n 
16 407  ALA n 
16 408  GLN n 
16 409  THR n 
16 410  LEU n 
16 411  THR n 
16 412  LEU n 
16 413  LEU n 
16 414  ALA n 
16 415  THR n 
16 416  VAL n 
16 417  CYS n 
16 418  LEU n 
16 419  GLU n 
16 420  ASP n 
16 421  PRO n 
16 422  VAL n 
16 423  THR n 
16 424  GLN n 
16 425  GLU n 
16 426  LYS n 
16 427  ALA n 
16 428  LYS n 
16 429  THR n 
16 430  LEU n 
16 431  LEU n 
16 432  ASP n 
16 433  LYS n 
16 434  ALA n 
16 435  LEU n 
16 436  THR n 
16 437  GLN n 
16 438  ARG n 
16 439  PRO n 
16 440  ASP n 
16 441  TYR n 
16 442  ILE n 
16 443  LYS n 
16 444  ALA n 
16 445  VAL n 
16 446  VAL n 
16 447  LYS n 
16 448  LYS n 
16 449  ALA n 
16 450  GLU n 
16 451  LEU n 
16 452  LEU n 
16 453  SER n 
16 454  ARG n 
16 455  GLU n 
16 456  GLN n 
16 457  LYS n 
16 458  TYR n 
16 459  GLU n 
16 460  ASP n 
16 461  GLY n 
16 462  ILE n 
16 463  ALA n 
16 464  LEU n 
16 465  LEU n 
16 466  ARG n 
16 467  ASN n 
16 468  ALA n 
16 469  LEU n 
16 470  ALA n 
16 471  ASN n 
16 472  GLN n 
16 473  SER n 
16 474  ASP n 
16 475  CYS n 
16 476  VAL n 
16 477  LEU n 
16 478  HIS n 
16 479  ARG n 
16 480  ILE n 
16 481  LEU n 
16 482  GLY n 
16 483  ASP n 
16 484  PHE n 
16 485  LEU n 
16 486  VAL n 
16 487  ALA n 
16 488  VAL n 
16 489  ASN n 
16 490  GLU n 
16 491  TYR n 
16 492  GLN n 
16 493  GLU n 
16 494  ALA n 
16 495  MET n 
16 496  ASP n 
16 497  GLN n 
16 498  TYR n 
16 499  SER n 
16 500  ILE n 
16 501  ALA n 
16 502  LEU n 
16 503  SER n 
16 504  LEU n 
16 505  ASP n 
16 506  PRO n 
16 507  ASN n 
16 508  ASP n 
16 509  GLN n 
16 510  LYS n 
16 511  SER n 
16 512  LEU n 
16 513  GLU n 
16 514  GLY n 
16 515  MET n 
16 516  GLN n 
16 517  LYS n 
16 518  MET n 
16 519  GLU n 
16 520  LYS n 
16 521  GLU n 
16 522  GLU n 
16 523  SER n 
16 524  PRO n 
16 525  THR n 
16 526  ASP n 
16 527  ALA n 
16 528  THR n 
16 529  GLN n 
16 530  GLU n 
16 531  GLU n 
16 532  ASP n 
16 533  VAL n 
16 534  ASP n 
16 535  ASP n 
16 536  MET n 
16 537  GLU n 
16 538  GLY n 
16 539  SER n 
16 540  GLY n 
16 541  GLU n 
16 542  GLU n 
16 543  GLY n 
16 544  ASP n 
16 545  LEU n 
16 546  GLU n 
16 547  GLY n 
16 548  SER n 
16 549  ASP n 
16 550  SER n 
16 551  GLU n 
16 552  ALA n 
16 553  ALA n 
16 554  GLN n 
16 555  TRP n 
16 556  ALA n 
16 557  ASP n 
16 558  GLN n 
16 559  GLU n 
16 560  GLN n 
16 561  TRP n 
16 562  PHE n 
16 563  GLY n 
16 564  MET n 
16 565  GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1  1 sample 'Biological sequence' 1 1944 Human ? 'ANAPC1, TSG24'                     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 'Biological sequence' 1 84   Human ? 'ANAPC11, HSPC214'                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 'Biological sequence' 1 597  Human ? 'CDC23, ANAPC8'                     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 'Biological sequence' 1 110  Human ? 'ANAPC16, C10orf104, CENP-27'       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 'Biological sequence' 1 824  Human ? 'CDC27, ANAPC3, D0S1430E, D17S978E' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 'Biological sequence' 1 85   Human ? 'CDC26, ANAPC12, C9orf17'           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 'Biological sequence' 1 818  Human ? 'ANAPC4, APC4'                      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 'Biological sequence' 1 620  Human ? 'CDC16, ANAPC6'                     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 'Biological sequence' 1 185  Human ? 'ANAPC10, APC10'                    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 'Biological sequence' 1 74   Human ? ANAPC13                             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 'Biological sequence' 1 822  Human ? 'ANAPC2, APC2, KIAA1406'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 'Biological sequence' 1 755  Human ? 'ANAPC5, APC5'                      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 'Biological sequence' 1 190  Human ? 'UBE2C, UBCH10'                     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 'Biological sequence' 1 499  Human ? CDC20                               ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 'Biological sequence' 1 565  Human ? 'ANAPC7, APC7'                      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              15 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       33 
_pdbx_entity_src_syn.organism_scientific    'Saccharomyces cerevisiae' 
_pdbx_entity_src_syn.organism_common_name   
;Baker's yeast
;
_pdbx_entity_src_syn.ncbi_taxonomy_id       4932 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP APC1_HUMAN  Q9H1A4 ? 1  
;MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGV
SEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCIN
MHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSPVTSPFQ
NYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVHSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPET
EPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKPLSKLLGSLDEVVLLSPVPEL
RDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVK
WYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLG
PYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALY
ILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRL
LQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDL
NSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRP
PGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINV
DVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVL
LSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNR
YHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVN
MGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFM
NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
;
1  
2  UNP APC11_HUMAN Q9NYG5 ? 2  
;MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEW
KFKE
;
1  
3  UNP CDC23_HUMAN Q9UJX2 ? 3  
;MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEED
AQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSK
KHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLA
HNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYR
AWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQG
ETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
;
1  
4  UNP APC16_HUMAN Q96DE5 ? 4  
;MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARME
KLAGLVEELEADEWRFKPIEQLLGFTPSSG
;
1  
5  UNP CDC27_HUMAN P30260 ? 5  
;MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCV
DLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGE
KPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKS
VARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKF
PPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYG
LGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGT
DESQESSMTDADDTQLHAAESDEF
;
1  
6  UNP CDC26_HUMAN Q8NHZ8 ? 6  
;MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF
GSLEF
;
1  
7  UNP APC4_HUMAN  Q9UJX5 ? 7  
;MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLL
AFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEEN
SDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTL
LMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKA
NELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLD
AQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVE
KLDPELDS
;
1  
8  UNP CDC16_HUMAN Q13042 ? 8  
;MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCH
YAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLD
VYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHAR
RYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPE
DPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
;
1  
9  UNP APC10_HUMAN Q9UM13 ? 9  
;MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIY
ADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYT
PVEESSIGKFPRCTTIDFMMYRSIR
;
1  
10 UNP APC13_HUMAN Q9BS18 ? 10 MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN 1  
11 UNP ANC2_HUMAN  Q9UJX6 ? 11 
;MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQ
NDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGV
LFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNT
LRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLY
ISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVM
LKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHT
LGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQ
KKVRDQQLVYSAGVYRLPKNCS
;
1  
12 UNP APC5_HUMAN  Q9UJX4 ? 12 
;MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYK
LIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQ
YFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQA
ELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD
ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQA
LSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
;
1  
13 UNP UBE2C_HUMAN O00762 ? 13 
;MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYK
LSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPT
AFKKYLQETYSKQVTSQEP
;
1  
14 UNP CDC20_HUMAN Q12834 ? 14 
;MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYI
PHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGS
SRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPD
GRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS
QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
;
1  
15 PDB 5KHR        5KHR   ? 15 ? 1  
16 UNP APC7_HUMAN  Q9UJX3 ? 16 
;MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTS
KVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKE
VLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLL
GSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKR
YSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVY
KTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQ
WFGMQ
;
35 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5KHR A 1 ? 1944 ? Q9H1A4 1   ? 1944 ? 1   1944 
2  2  5KHR B 1 ? 84   ? Q9NYG5 1   ? 84   ? 1   84   
3  3  5KHR C 1 ? 597  ? Q9UJX2 1   ? 597  ? 1   597  
4  4  5KHR E 1 ? 110  ? Q96DE5 1   ? 110  ? 1   110  
5  5  5KHR F 1 ? 824  ? P30260 1   ? 824  ? 1   824  
6  6  5KHR G 1 ? 85   ? Q8NHZ8 1   ? 85   ? 1   85   
7  5  5KHR H 1 ? 824  ? P30260 1   ? 824  ? 1   824  
8  7  5KHR I 1 ? 808  ? Q9UJX5 1   ? 808  ? 1   808  
9  8  5KHR J 1 ? 620  ? Q13042 1   ? 620  ? 1   620  
10 8  5KHR K 1 ? 620  ? Q13042 1   ? 620  ? 1   620  
11 9  5KHR L 1 ? 185  ? Q9UM13 1   ? 185  ? 1   184  
12 10 5KHR M 1 ? 74   ? Q9BS18 1   ? 74   ? 1   74   
13 11 5KHR N 1 ? 822  ? Q9UJX6 1   ? 822  ? 1   822  
14 12 5KHR O 1 ? 755  ? Q9UJX4 1   ? 755  ? 1   755  
15 3  5KHR P 1 ? 597  ? Q9UJX2 1   ? 597  ? 1   597  
16 13 5KHR Q 1 ? 179  ? O00762 1   ? 179  ? 1   179  
17 14 5KHR R 1 ? 499  ? Q12834 1   ? 499  ? 1   499  
18 15 5KHR S 1 ? 33   ? 5KHR   805 ? 837  ? 805 837  
19 6  5KHR W 1 ? 85   ? Q8NHZ8 1   ? 85   ? 1   85   
20 16 5KHR X 1 ? 565  ? Q9UJX3 35  ? 599  ? 35  599  
21 16 5KHR Y 1 ? 565  ? Q9UJX3 35  ? 599  ? 35  599  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
8  5KHR GLY I 809 ? UNP Q9UJX5 ?   ?   'expression tag'      809 1  
8  5KHR GLY I 810 ? UNP Q9UJX5 ?   ?   'expression tag'      810 2  
8  5KHR SER I 811 ? UNP Q9UJX5 ?   ?   'expression tag'      811 3  
8  5KHR LEU I 812 ? UNP Q9UJX5 ?   ?   'expression tag'      812 4  
8  5KHR GLU I 813 ? UNP Q9UJX5 ?   ?   'expression tag'      813 5  
8  5KHR VAL I 814 ? UNP Q9UJX5 ?   ?   'expression tag'      814 6  
8  5KHR LEU I 815 ? UNP Q9UJX5 ?   ?   'expression tag'      815 7  
8  5KHR PHE I 816 ? UNP Q9UJX5 ?   ?   'expression tag'      816 8  
8  5KHR GLN I 817 ? UNP Q9UJX5 ?   ?   'expression tag'      817 9  
8  5KHR GLY I 818 ? UNP Q9UJX5 ?   ?   'expression tag'      818 10 
13 5KHR GLU N 534 ? UNP Q9UJX6 SER 534 'engineered mutation' 534 11 
13 5KHR GLU N 811 ? UNP Q9UJX6 SER 811 'engineered mutation' 811 12 
14 5KHR GLU O 221 ? UNP Q9UJX4 SER 221 'engineered mutation' 221 13 
14 5KHR GLU O 232 ? UNP Q9UJX4 THR 232 'engineered mutation' 232 14 
16 5KHR GLY Q 180 ? UNP O00762 ?   ?   'expression tag'      180 15 
16 5KHR GLY Q 181 ? UNP O00762 ?   ?   'expression tag'      181 16 
16 5KHR SER Q 182 ? UNP O00762 ?   ?   'expression tag'      182 17 
16 5KHR GLY Q 183 ? UNP O00762 ?   ?   'expression tag'      183 18 
16 5KHR SER Q 184 ? UNP O00762 ?   ?   'expression tag'      184 19 
16 5KHR LEU Q 185 ? UNP O00762 ?   ?   'expression tag'      185 20 
16 5KHR GLU Q 186 ? UNP O00762 ?   ?   'expression tag'      186 21 
16 5KHR VAL Q 187 ? UNP O00762 ?   ?   'expression tag'      187 22 
16 5KHR LEU Q 188 ? UNP O00762 ?   ?   'expression tag'      188 23 
16 5KHR PHE Q 189 ? UNP O00762 ?   ?   'expression tag'      189 24 
16 5KHR GLN Q 190 ? UNP O00762 ?   ?   'expression tag'      190 25 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking' . UNKNOWN         ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KHR 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5KHR 
_struct.title                        
;Model of human Anaphase-promoting complex/Cyclosome complex (APC15 deletion mutant) in complex with the E2 UBE2C/UBCH10 poised for ubiquitin ligation to substrate (APC/C-CDC20-substrate-UBE2C)
;
_struct.pdbx_descriptor              
;Anaphase-promoting complex subunit 1, Anaphase-promoting complex subunit 11, Cell division cycle protein 23 homolog, Anaphase-promoting complex subunit 16, Cell division cycle protein 27 homolog, Anaphase-promoting complex subunit CDC26, Anaphase-promoting complex subunit 4, Cell division cycle protein 16 homolog, Anaphase-promoting complex subunit 10, Anaphase-promoting complex subunit 13, Anaphase-promoting complex subunit 2, Anaphase-promoting complex subunit 5, Ubiquitin-conjugating enzyme E2 C (E.C.2.3.2.23,2.3.2.24), Cell division cycle protein 20 homolog, HSL1 peptide, Anaphase-promoting complex subunit 7
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KHR 
_struct_keywords.text            'ubiquitination, cell cycle, protein complex, mitosis' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 5  ? 
H N N 7  ? 
I N N 8  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
M N N 11 ? 
N N N 12 ? 
O N N 3  ? 
P N N 13 ? 
Q N N 14 ? 
R N N 15 ? 
S N N 6  ? 
T N N 16 ? 
U N N 16 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   PHE A 23   ? HIS A 27   ? PHE A 23   HIS A 27   1 ? 5  
HELX_P HELX_P2   2   GLU A 616  ? ILE A 628  ? GLU A 616  ILE A 628  1 ? 13 
HELX_P HELX_P3   3   GLU A 632  ? SER A 646  ? GLU A 632  SER A 646  1 ? 15 
HELX_P HELX_P4   4   GLU A 656  ? MET A 668  ? GLU A 656  MET A 668  1 ? 13 
HELX_P HELX_P5   5   ILE A 759  ? LEU A 775  ? ILE A 759  LEU A 775  1 ? 17 
HELX_P HELX_P6   6   GLY A 782  ? LEU A 789  ? GLY A 782  LEU A 789  1 ? 8  
HELX_P HELX_P7   7   PRO A 801  ? ASP A 809  ? PRO A 801  ASP A 809  1 ? 9  
HELX_P HELX_P8   8   ILE A 844  ? LYS A 853  ? ILE A 844  LYS A 853  1 ? 10 
HELX_P HELX_P9   9   GLU A 868  ? ILE A 881  ? GLU A 868  ILE A 881  1 ? 14 
HELX_P HELX_P10  10  SER A 925  ? ASN A 936  ? SER A 925  ASN A 936  1 ? 12 
HELX_P HELX_P11  11  LEU A 941  ? GLU A 945  ? LEU A 941  GLU A 945  1 ? 5  
HELX_P HELX_P12  12  PHE A 949  ? GLU A 964  ? PHE A 949  GLU A 964  1 ? 16 
HELX_P HELX_P13  13  GLU A 972  ? LEU A 977  ? GLU A 972  LEU A 977  1 ? 6  
HELX_P HELX_P14  14  GLN A 981  ? SER A 984  ? GLN A 981  SER A 984  1 ? 4  
HELX_P HELX_P15  15  HIS A 1021 ? ILE A 1027 ? HIS A 1021 ILE A 1027 1 ? 7  
HELX_P HELX_P16  16  ARG A 1033 ? LEU A 1040 ? ARG A 1033 LEU A 1040 1 ? 8  
HELX_P HELX_P17  17  ASP A 1059 ? PHE A 1087 ? ASP A 1059 PHE A 1087 1 ? 29 
HELX_P HELX_P18  18  SER A 1133 ? LEU A 1145 ? SER A 1133 LEU A 1145 1 ? 13 
HELX_P HELX_P19  19  SER A 1155 ? ASN A 1161 ? SER A 1155 ASN A 1161 1 ? 7  
HELX_P HELX_P20  20  ALA A 1169 ? ASN A 1182 ? ALA A 1169 ASN A 1182 1 ? 14 
HELX_P HELX_P21  21  HIS A 1184 ? LYS A 1187 ? HIS A 1184 LYS A 1187 1 ? 4  
HELX_P HELX_P22  22  THR A 1190 ? ASN A 1192 ? THR A 1190 ASN A 1192 1 ? 3  
HELX_P HELX_P23  23  GLU A 1202 ? LYS A 1216 ? GLU A 1202 LYS A 1216 1 ? 15 
HELX_P HELX_P24  24  MET A 1222 ? SER A 1229 ? MET A 1222 SER A 1229 1 ? 8  
HELX_P HELX_P25  25  HIS A 1247 ? VAL A 1260 ? HIS A 1247 VAL A 1260 1 ? 14 
HELX_P HELX_P26  26  ARG A 1267 ? ILE A 1277 ? ARG A 1267 ILE A 1277 1 ? 11 
HELX_P HELX_P27  27  ARG A 1291 ? CYS A 1306 ? ARG A 1291 CYS A 1306 1 ? 16 
HELX_P HELX_P28  28  VAL A 1321 ? VAL A 1330 ? VAL A 1321 VAL A 1330 1 ? 10 
HELX_P HELX_P29  29  VAL A 1360 ? ILE A 1374 ? VAL A 1360 ILE A 1374 1 ? 15 
HELX_P HELX_P30  30  ARG A 1381 ? TRP A 1386 ? ARG A 1381 TRP A 1386 1 ? 6  
HELX_P HELX_P31  31  MET A 1393 ? PHE A 1398 ? MET A 1393 PHE A 1398 1 ? 6  
HELX_P HELX_P32  32  PRO A 1401 ? ILE A 1414 ? PRO A 1401 ILE A 1414 1 ? 14 
HELX_P HELX_P33  33  SER A 1423 ? ASN A 1429 ? SER A 1423 ASN A 1429 1 ? 7  
HELX_P HELX_P34  34  GLN A 1432 ? GLU A 1436 ? GLN A 1432 GLU A 1436 1 ? 5  
HELX_P HELX_P35  35  LEU A 1454 ? ARG A 1475 ? LEU A 1454 ARG A 1475 1 ? 22 
HELX_P HELX_P36  36  LEU A 1482 ? LEU A 1499 ? LEU A 1482 LEU A 1499 1 ? 18 
HELX_P HELX_P37  37  ALA A 1504 ? THR A 1507 ? ALA A 1504 THR A 1507 1 ? 4  
HELX_P HELX_P38  38  PRO A 1509 ? VAL A 1526 ? PRO A 1509 VAL A 1526 1 ? 18 
HELX_P HELX_P39  39  LEU A 1533 ? LYS A 1545 ? LEU A 1533 LYS A 1545 1 ? 13 
HELX_P HELX_P40  40  TYR A 1552 ? LEU A 1565 ? TYR A 1552 LEU A 1565 1 ? 14 
HELX_P HELX_P41  41  LEU A 1567 ? GLY A 1570 ? LEU A 1567 GLY A 1570 1 ? 4  
HELX_P HELX_P42  42  SER A 1579 ? ALA A 1587 ? SER A 1579 ALA A 1587 1 ? 9  
HELX_P HELX_P43  43  GLN A 1604 ? ALA A 1613 ? GLN A 1604 ALA A 1613 1 ? 10 
HELX_P HELX_P44  44  GLN A 1685 ? SER A 1692 ? GLN A 1685 SER A 1692 1 ? 8  
HELX_P HELX_P45  45  PRO A 1745 ? CYS A 1755 ? PRO A 1745 CYS A 1755 1 ? 11 
HELX_P HELX_P46  46  GLN A 1765 ? THR A 1780 ? GLN A 1765 THR A 1780 1 ? 16 
HELX_P HELX_P47  47  PRO A 1784 ? ARG A 1802 ? PRO A 1784 ARG A 1802 1 ? 19 
HELX_P HELX_P48  48  SER A 1809 ? PHE A 1821 ? SER A 1809 PHE A 1821 1 ? 13 
HELX_P HELX_P49  49  LEU A 1845 ? VAL A 1862 ? LEU A 1845 VAL A 1862 1 ? 18 
HELX_P HELX_P50  50  ASP A 1865 ? LEU A 1872 ? ASP A 1865 LEU A 1872 1 ? 8  
HELX_P HELX_P51  51  GLU A 1879 ? HIS A 1892 ? GLU A 1879 HIS A 1892 1 ? 14 
HELX_P HELX_P52  52  ALA A 1912 ? LYS A 1919 ? ALA A 1912 LYS A 1919 1 ? 8  
HELX_P HELX_P53  53  VAL A 1925 ? ARG A 1930 ? VAL A 1925 ARG A 1930 1 ? 6  
HELX_P HELX_P54  54  MET B 57   ? ALA B 66   ? MET B 57   ALA B 66   1 ? 10 
HELX_P HELX_P55  55  ARG C 30   ? ARG C 46   ? ARG C 30   ARG C 46   1 ? 17 
HELX_P HELX_P56  56  LEU C 49   ? SER C 61   ? LEU C 49   SER C 61   1 ? 13 
HELX_P HELX_P57  57  GLU C 78   ? ASP C 95   ? GLU C 78   ASP C 95   1 ? 18 
HELX_P HELX_P58  58  TYR C 99   ? GLY C 108  ? TYR C 99   GLY C 108  1 ? 10 
HELX_P HELX_P59  59  LYS C 113  ? ASP C 136  ? LYS C 113  ASP C 136  1 ? 24 
HELX_P HELX_P60  60  LEU C 151  ? ALA C 164  ? LEU C 151  ALA C 164  1 ? 14 
HELX_P HELX_P61  61  GLY C 169  ? LYS C 181  ? GLY C 169  LYS C 181  1 ? 13 
HELX_P HELX_P62  62  VAL C 185  ? VAL C 198  ? VAL C 185  VAL C 198  1 ? 14 
HELX_P HELX_P63  63  TRP C 203  ? LEU C 212  ? TRP C 203  LEU C 212  1 ? 10 
HELX_P HELX_P64  64  LYS C 216  ? PHE C 221  ? LYS C 216  PHE C 221  1 ? 6  
HELX_P HELX_P65  65  TRP C 228  ? LEU C 241  ? TRP C 228  LEU C 241  1 ? 14 
HELX_P HELX_P66  66  ILE C 244  ? LYS C 261  ? ILE C 244  LYS C 261  1 ? 18 
HELX_P HELX_P67  67  SER C 263  ? ILE C 276  ? SER C 263  ILE C 276  1 ? 14 
HELX_P HELX_P68  68  ILE C 279  ? GLN C 292  ? ILE C 279  GLN C 292  1 ? 14 
HELX_P HELX_P69  69  MET C 300  ? VAL C 309  ? MET C 300  VAL C 309  1 ? 10 
HELX_P HELX_P70  70  LYS C 313  ? ILE C 326  ? LYS C 313  ILE C 326  1 ? 14 
HELX_P HELX_P71  71  VAL C 331  ? LEU C 343  ? VAL C 331  LEU C 343  1 ? 13 
HELX_P HELX_P72  72  HIS C 347  ? LEU C 360  ? HIS C 347  LEU C 360  1 ? 14 
HELX_P HELX_P73  73  LEU C 365  ? GLU C 377  ? LEU C 365  GLU C 377  1 ? 13 
HELX_P HELX_P74  74  THR C 381  ? VAL C 394  ? THR C 381  VAL C 394  1 ? 14 
HELX_P HELX_P75  75  TYR C 399  ? ILE C 411  ? TYR C 399  ILE C 411  1 ? 13 
HELX_P HELX_P76  76  PRO C 415  ? LEU C 428  ? PRO C 415  LEU C 428  1 ? 14 
HELX_P HELX_P77  77  SER C 433  ? ALA C 438  ? SER C 433  ALA C 438  1 ? 6  
HELX_P HELX_P78  78  CYS C 442  ? LEU C 446  ? CYS C 442  LEU C 446  1 ? 5  
HELX_P HELX_P79  79  LEU C 449  ? VAL C 462  ? LEU C 449  VAL C 462  1 ? 14 
HELX_P HELX_P80  80  ALA C 469  ? GLN C 479  ? ALA C 469  GLN C 479  1 ? 11 
HELX_P HELX_P81  81  GLU C 484  ? SER C 499  ? GLU C 484  SER C 499  1 ? 16 
HELX_P HELX_P82  82  PHE D 53   ? ARG D 95   ? PHE E 53   ARG E 95   1 ? 43 
HELX_P HELX_P83  83  ILE D 99   ? LEU D 102  ? ILE E 99   LEU E 102  1 ? 4  
HELX_P HELX_P84  84  PRO E 7    ? ASN E 17   ? PRO F 7    ASN F 17   1 ? 11 
HELX_P HELX_P85  85  TYR E 21   ? VAL E 35   ? TYR F 21   VAL F 35   1 ? 15 
HELX_P HELX_P86  86  GLU E 38   ? ARG E 50   ? GLU F 38   ARG F 50   1 ? 13 
HELX_P HELX_P87  87  ALA E 54   ? GLY E 63   ? ALA F 54   GLY F 63   1 ? 10 
HELX_P HELX_P88  88  PRO E 69   ? ASP E 81   ? PRO F 69   ASP F 81   1 ? 13 
HELX_P HELX_P89  89  LEU E 85   ? SER E 93   ? LEU F 85   SER F 93   1 ? 9  
HELX_P HELX_P90  90  ASP E 104  ? THR E 128  ? ASP F 104  THR F 128  1 ? 25 
HELX_P HELX_P91  91  LEU E 131  ? LEU E 144  ? LEU F 131  LEU F 144  1 ? 14 
HELX_P HELX_P92  92  TRP E 149  ? GLU E 157  ? TRP F 149  GLU F 157  1 ? 9  
HELX_P HELX_P93  93  PHE E 452  ? CYS E 477  ? PHE F 452  CYS F 477  1 ? 26 
HELX_P HELX_P94  94  CYS E 481  ? HIS E 490  ? CYS F 481  HIS F 490  1 ? 10 
HELX_P HELX_P95  95  GLY E 499  ? LEU E 512  ? GLY F 499  LEU F 512  1 ? 14 
HELX_P HELX_P96  96  TYR E 515  ? ILE E 528  ? TYR F 515  ILE F 528  1 ? 14 
HELX_P HELX_P97  97  MET E 536  ? HIS E 545  ? MET F 536  HIS F 545  1 ? 10 
HELX_P HELX_P98  98  ASP E 549  ? MET E 562  ? ASP F 549  MET F 562  1 ? 14 
HELX_P HELX_P99  99  PRO E 567  ? LEU E 579  ? PRO F 567  LEU F 579  1 ? 13 
HELX_P HELX_P100 100 HIS E 583  ? VAL E 596  ? HIS F 583  VAL F 596  1 ? 14 
HELX_P HELX_P101 101 ALA E 601  ? THR E 614  ? ALA F 601  THR F 614  1 ? 14 
HELX_P HELX_P102 102 LEU E 617  ? VAL E 630  ? LEU F 617  VAL F 630  1 ? 14 
HELX_P HELX_P103 103 TYR E 635  ? LYS E 647  ? TYR F 635  LYS F 647  1 ? 13 
HELX_P HELX_P104 104 PHE E 651  ? ILE E 664  ? PHE F 651  ILE F 664  1 ? 14 
HELX_P HELX_P105 105 SER E 669  ? LEU E 682  ? SER F 669  LEU F 682  1 ? 14 
HELX_P HELX_P106 106 SER E 685  ? ILE E 698  ? SER F 685  ILE F 698  1 ? 14 
HELX_P HELX_P107 107 PRO E 703  ? ALA E 715  ? PRO F 703  ALA F 715  1 ? 13 
HELX_P HELX_P108 108 TYR E 719  ? ILE E 732  ? TYR F 719  ILE F 732  1 ? 14 
HELX_P HELX_P109 109 SER E 737  ? LEU E 750  ? SER F 737  LEU F 750  1 ? 14 
HELX_P HELX_P110 110 THR E 753  ? MET E 764  ? THR F 753  MET F 764  1 ? 12 
HELX_P HELX_P111 111 LEU F 13   ? LYS F 24   ? LEU G 13   LYS G 24   1 ? 12 
HELX_P HELX_P112 112 PRO G 7    ? ASN G 17   ? PRO H 7    ASN H 17   1 ? 11 
HELX_P HELX_P113 113 TYR G 21   ? VAL G 35   ? TYR H 21   VAL H 35   1 ? 15 
HELX_P HELX_P114 114 GLU G 38   ? ARG G 50   ? GLU H 38   ARG H 50   1 ? 13 
HELX_P HELX_P115 115 ALA G 54   ? GLY G 63   ? ALA H 54   GLY H 63   1 ? 10 
HELX_P HELX_P116 116 PRO G 69   ? ASP G 81   ? PRO H 69   ASP H 81   1 ? 13 
HELX_P HELX_P117 117 LEU G 85   ? SER G 93   ? LEU H 85   SER H 93   1 ? 9  
HELX_P HELX_P118 118 ASP G 104  ? THR G 128  ? ASP H 104  THR H 128  1 ? 25 
HELX_P HELX_P119 119 LEU G 131  ? LEU G 144  ? LEU H 131  LEU H 144  1 ? 14 
HELX_P HELX_P120 120 TRP G 149  ? GLU G 157  ? TRP H 149  GLU H 157  1 ? 9  
HELX_P HELX_P121 121 ASP G 165  ? PHE G 168  ? ASP H 165  PHE H 168  1 ? 4  
HELX_P HELX_P122 122 PHE G 452  ? CYS G 477  ? PHE H 452  CYS H 477  1 ? 26 
HELX_P HELX_P123 123 CYS G 481  ? HIS G 490  ? CYS H 481  HIS H 490  1 ? 10 
HELX_P HELX_P124 124 GLY G 499  ? LEU G 512  ? GLY H 499  LEU H 512  1 ? 14 
HELX_P HELX_P125 125 TYR G 515  ? ILE G 528  ? TYR H 515  ILE H 528  1 ? 14 
HELX_P HELX_P126 126 MET G 536  ? HIS G 545  ? MET H 536  HIS H 545  1 ? 10 
HELX_P HELX_P127 127 ASP G 549  ? MET G 562  ? ASP H 549  MET H 562  1 ? 14 
HELX_P HELX_P128 128 PRO G 567  ? LEU G 579  ? PRO H 567  LEU H 579  1 ? 13 
HELX_P HELX_P129 129 HIS G 583  ? VAL G 596  ? HIS H 583  VAL H 596  1 ? 14 
HELX_P HELX_P130 130 ALA G 601  ? THR G 614  ? ALA H 601  THR H 614  1 ? 14 
HELX_P HELX_P131 131 LEU G 617  ? VAL G 630  ? LEU H 617  VAL H 630  1 ? 14 
HELX_P HELX_P132 132 TYR G 635  ? LYS G 647  ? TYR H 635  LYS H 647  1 ? 13 
HELX_P HELX_P133 133 PHE G 651  ? ILE G 664  ? PHE H 651  ILE H 664  1 ? 14 
HELX_P HELX_P134 134 SER G 669  ? LEU G 682  ? SER H 669  LEU H 682  1 ? 14 
HELX_P HELX_P135 135 SER G 685  ? ILE G 698  ? SER H 685  ILE H 698  1 ? 14 
HELX_P HELX_P136 136 PRO G 703  ? ALA G 715  ? PRO H 703  ALA H 715  1 ? 13 
HELX_P HELX_P137 137 TYR G 719  ? ILE G 732  ? TYR H 719  ILE H 732  1 ? 14 
HELX_P HELX_P138 138 SER G 737  ? LEU G 750  ? SER H 737  LEU H 750  1 ? 14 
HELX_P HELX_P139 139 THR G 753  ? LEU G 766  ? THR H 753  LEU H 766  1 ? 14 
HELX_P HELX_P140 140 ALA H 50   ? PHE H 52   ? ALA I 50   PHE I 52   1 ? 3  
HELX_P HELX_P141 141 ASP H 133  ? ASN H 136  ? ASP I 133  ASN I 136  1 ? 4  
HELX_P HELX_P142 142 ILE H 165  ? GLY H 169  ? ILE I 165  GLY I 169  1 ? 5  
HELX_P HELX_P143 143 ALA H 189  ? GLY H 191  ? ALA I 189  GLY I 191  1 ? 3  
HELX_P HELX_P144 144 ASN H 239  ? TYR H 242  ? ASN I 239  TYR I 242  1 ? 4  
HELX_P HELX_P145 145 VAL H 300  ? LEU H 309  ? VAL I 300  LEU I 309  1 ? 10 
HELX_P HELX_P146 146 GLU H 316  ? GLN H 324  ? GLU I 316  GLN I 324  1 ? 9  
HELX_P HELX_P147 147 VAL H 327  ? SER H 371  ? VAL I 327  SER I 371  1 ? 45 
HELX_P HELX_P148 148 LYS H 373  ? TYR H 376  ? LYS I 373  TYR I 376  1 ? 4  
HELX_P HELX_P149 149 ALA H 383  ? MET H 428  ? ALA I 383  MET I 428  1 ? 46 
HELX_P HELX_P150 150 GLN H 442  ? HIS H 455  ? GLN I 442  HIS I 455  1 ? 14 
HELX_P HELX_P151 151 VAL H 475  ? LEU H 479  ? VAL I 475  LEU I 479  1 ? 5  
HELX_P HELX_P152 152 GLN H 496  ? GLN H 502  ? GLN I 496  GLN I 502  1 ? 7  
HELX_P HELX_P153 153 HIS H 506  ? GLU H 509  ? HIS I 506  GLU I 509  1 ? 4  
HELX_P HELX_P154 154 LEU H 522  ? MET H 548  ? LEU I 522  MET I 548  1 ? 27 
HELX_P HELX_P155 155 LEU H 671  ? VAL H 674  ? LEU I 671  VAL I 674  1 ? 4  
HELX_P HELX_P156 156 SER H 680  ? GLU H 682  ? SER I 680  GLU I 682  1 ? 3  
HELX_P HELX_P157 157 LEU I 3    ? GLN I 16   ? LEU J 3    GLN J 16   1 ? 14 
HELX_P HELX_P158 158 TYR I 19   ? SER I 33   ? TYR J 19   SER J 33   1 ? 15 
HELX_P HELX_P159 159 PRO I 37   ? LEU I 49   ? PRO J 37   LEU J 49   1 ? 13 
HELX_P HELX_P160 160 TYR I 53   ? SER I 62   ? TYR J 53   SER J 62   1 ? 10 
HELX_P HELX_P161 161 LEU I 65   ? TYR I 69   ? LEU J 65   TYR J 69   1 ? 5  
HELX_P HELX_P162 162 ALA I 71   ? ALA I 82   ? ALA J 71   ALA J 82   1 ? 12 
HELX_P HELX_P163 163 ALA I 89   ? LEU I 93   ? ALA J 89   LEU J 93   1 ? 5  
HELX_P HELX_P164 164 GLN I 125  ? ALA I 142  ? GLN J 125  ALA J 142  1 ? 18 
HELX_P HELX_P165 165 ARG I 146  ? ASP I 160  ? ARG J 146  ASP J 160  1 ? 15 
HELX_P HELX_P166 166 PHE I 164  ? SER I 172  ? PHE J 164  SER J 172  1 ? 9  
HELX_P HELX_P167 167 ALA I 178  ? SER I 187  ? ALA J 178  SER J 187  1 ? 10 
HELX_P HELX_P168 168 ASN I 195  ? LYS I 208  ? ASN J 195  LYS J 208  1 ? 14 
HELX_P HELX_P169 169 LEU I 231  ? ASN I 244  ? LEU J 231  ASN J 244  1 ? 14 
HELX_P HELX_P170 170 PHE I 247  ? LYS I 260  ? PHE J 247  LYS J 260  1 ? 14 
HELX_P HELX_P171 171 CYS I 267  ? LEU I 278  ? CYS J 267  LEU J 278  1 ? 12 
HELX_P HELX_P172 172 ALA I 281  ? LEU I 294  ? ALA J 281  LEU J 294  1 ? 14 
HELX_P HELX_P173 173 PRO I 299  ? VAL I 312  ? PRO J 299  VAL J 312  1 ? 14 
HELX_P HELX_P174 174 ASN I 316  ? LEU I 329  ? ASN J 316  LEU J 329  1 ? 14 
HELX_P HELX_P175 175 GLY I 334  ? GLU I 347  ? GLY J 334  GLU J 347  1 ? 14 
HELX_P HELX_P176 176 HIS I 350  ? LEU I 363  ? HIS J 350  LEU J 363  1 ? 14 
HELX_P HELX_P177 177 HIS I 368  ? THR I 381  ? HIS J 368  THR J 381  1 ? 14 
HELX_P HELX_P178 178 SER I 384  ? SER I 396  ? SER J 384  SER J 396  1 ? 13 
HELX_P HELX_P179 179 PRO I 402  ? ASN I 415  ? PRO J 402  ASN J 415  1 ? 14 
HELX_P HELX_P180 180 LYS I 419  ? LYS I 433  ? LYS J 419  LYS J 433  1 ? 15 
HELX_P HELX_P181 181 GLU I 445  ? LEU I 458  ? GLU J 445  LEU J 458  1 ? 14 
HELX_P HELX_P182 182 TYR I 461  ? LEU I 474  ? TYR J 461  LEU J 474  1 ? 14 
HELX_P HELX_P183 183 ALA I 479  ? LEU I 491  ? ALA J 479  LEU J 491  1 ? 13 
HELX_P HELX_P184 184 PHE I 495  ? LEU I 508  ? PHE J 495  LEU J 508  1 ? 14 
HELX_P HELX_P185 185 THR I 513  ? GLY I 528  ? THR J 513  GLY J 528  1 ? 16 
HELX_P HELX_P186 186 LEU J 3    ? GLN J 16   ? LEU K 3    GLN K 16   1 ? 14 
HELX_P HELX_P187 187 TYR J 19   ? SER J 33   ? TYR K 19   SER K 33   1 ? 15 
HELX_P HELX_P188 188 PRO J 37   ? LEU J 49   ? PRO K 37   LEU K 49   1 ? 13 
HELX_P HELX_P189 189 TYR J 53   ? LEU J 68   ? TYR K 53   LEU K 68   1 ? 16 
HELX_P HELX_P190 190 GLU J 70   ? ALA J 83   ? GLU K 70   ALA K 83   1 ? 14 
HELX_P HELX_P191 191 ALA J 89   ? VAL J 92   ? ALA K 89   VAL K 92   1 ? 4  
HELX_P HELX_P192 192 SER J 131  ? ALA J 142  ? SER K 131  ALA K 142  1 ? 12 
HELX_P HELX_P193 193 ARG J 146  ? ASP J 160  ? ARG K 146  ASP K 160  1 ? 15 
HELX_P HELX_P194 194 PHE J 164  ? HIS J 174  ? PHE K 164  HIS K 174  1 ? 11 
HELX_P HELX_P195 195 GLN J 179  ? SER J 187  ? GLN K 179  SER K 187  1 ? 9  
HELX_P HELX_P196 196 ASN J 195  ? LYS J 210  ? ASN K 195  LYS K 210  1 ? 16 
HELX_P HELX_P197 197 VAL J 219  ? VAL J 224  ? VAL K 219  VAL K 224  1 ? 6  
HELX_P HELX_P198 198 LEU J 227  ? GLU J 229  ? LEU K 227  GLU K 229  1 ? 3  
HELX_P HELX_P199 199 LEU J 231  ? ASN J 244  ? LEU K 231  ASN K 244  1 ? 14 
HELX_P HELX_P200 200 PHE J 247  ? LYS J 260  ? PHE K 247  LYS K 260  1 ? 14 
HELX_P HELX_P201 201 CYS J 267  ? LEU J 278  ? CYS K 267  LEU K 278  1 ? 12 
HELX_P HELX_P202 202 ALA J 281  ? LEU J 294  ? ALA K 281  LEU K 294  1 ? 14 
HELX_P HELX_P203 203 PRO J 299  ? VAL J 312  ? PRO K 299  VAL K 312  1 ? 14 
HELX_P HELX_P204 204 ASN J 316  ? LEU J 329  ? ASN K 316  LEU K 329  1 ? 14 
HELX_P HELX_P205 205 PRO J 335  ? GLU J 347  ? PRO K 335  GLU K 347  1 ? 13 
HELX_P HELX_P206 206 HIS J 350  ? LEU J 363  ? HIS K 350  LEU K 363  1 ? 14 
HELX_P HELX_P207 207 HIS J 368  ? LEU J 380  ? HIS K 368  LEU K 380  1 ? 13 
HELX_P HELX_P208 208 SER J 384  ? ILE J 397  ? SER K 384  ILE K 397  1 ? 14 
HELX_P HELX_P209 209 PRO J 402  ? ASN J 415  ? PRO K 402  ASN K 415  1 ? 14 
HELX_P HELX_P210 210 TRP J 418  ? ALA J 434  ? TRP K 418  ALA K 434  1 ? 17 
HELX_P HELX_P211 211 VAL J 441  ? LEU J 458  ? VAL K 441  LEU K 458  1 ? 18 
HELX_P HELX_P212 212 TYR J 461  ? LEU J 474  ? TYR K 461  LEU K 474  1 ? 14 
HELX_P HELX_P213 213 ALA J 479  ? LEU J 491  ? ALA K 479  LEU K 491  1 ? 13 
HELX_P HELX_P214 214 PHE J 495  ? LEU J 508  ? PHE K 495  LEU K 508  1 ? 14 
HELX_P HELX_P215 215 THR J 513  ? TYR J 526  ? THR K 513  TYR K 526  1 ? 14 
HELX_P HELX_P216 216 PRO K 13   ? ARG K 18   ? PRO L 13   ARG L 18   1 ? 6  
HELX_P HELX_P217 217 VAL K 42   ? ASP K 47   ? VAL L 42   ASP L 47   1 ? 6  
HELX_P HELX_P218 218 HIS K 145  ? ASN K 147  ? HIS L 145  ASN L 147  1 ? 3  
HELX_P HELX_P219 219 ILE K 176  ? TYR K 181  ? ILE L 175  TYR L 180  1 ? 6  
HELX_P HELX_P220 220 GLY L 9    ? ILE L 15   ? GLY M 9    ILE M 15   1 ? 7  
HELX_P HELX_P221 221 PRO M 16   ? SER M 28   ? PRO N 16   SER N 28   1 ? 13 
HELX_P HELX_P222 222 GLU M 54   ? LEU M 62   ? GLU N 54   LEU N 62   1 ? 9  
HELX_P HELX_P223 223 LEU M 79   ? CYS M 98   ? LEU N 79   CYS N 98   1 ? 20 
HELX_P HELX_P224 224 LEU M 108  ? LEU M 122  ? LEU N 108  LEU N 122  1 ? 15 
HELX_P HELX_P225 225 ARG M 127  ? LEU M 138  ? ARG N 127  LEU N 138  1 ? 12 
HELX_P HELX_P226 226 ARG M 150  ? LEU M 161  ? ARG N 150  LEU N 161  1 ? 12 
HELX_P HELX_P227 227 ARG M 167  ? LYS M 190  ? ARG N 167  LYS N 190  1 ? 24 
HELX_P HELX_P228 228 GLN M 235  ? SER M 251  ? GLN N 235  SER N 251  1 ? 17 
HELX_P HELX_P229 229 LEU M 253  ? CYS M 277  ? LEU N 253  CYS N 277  1 ? 25 
HELX_P HELX_P230 230 GLU M 288  ? VAL M 303  ? GLU N 288  VAL N 303  1 ? 16 
HELX_P HELX_P231 231 ARG M 323  ? VAL M 348  ? ARG N 323  VAL N 348  1 ? 26 
HELX_P HELX_P232 232 ARG M 355  ? GLU M 366  ? ARG N 355  GLU N 366  1 ? 12 
HELX_P HELX_P233 233 ARG M 371  ? ARG M 385  ? ARG N 371  ARG N 385  1 ? 15 
HELX_P HELX_P234 234 ILE M 396  ? ARG M 408  ? ILE N 396  ARG N 408  1 ? 13 
HELX_P HELX_P235 235 LEU M 417  ? ALA M 420  ? LEU N 417  ALA N 420  1 ? 4  
HELX_P HELX_P236 236 GLU M 422  ? ARG M 431  ? GLU N 422  ARG N 431  1 ? 10 
HELX_P HELX_P237 237 THR M 434  ? GLY M 441  ? THR N 434  GLY N 441  1 ? 8  
HELX_P HELX_P238 238 LEU M 452  ? SER M 457  ? LEU N 452  SER N 457  1 ? 6  
HELX_P HELX_P239 239 ASP M 500  ? ILE M 508  ? ASP N 500  ILE N 508  1 ? 9  
HELX_P HELX_P240 240 ASP M 513  ? HIS M 529  ? ASP N 513  HIS N 529  1 ? 17 
HELX_P HELX_P241 241 ARG M 537  ? ARG M 548  ? ARG N 537  ARG N 548  1 ? 12 
HELX_P HELX_P242 242 HIS M 555  ? GLU M 579  ? HIS N 555  GLU N 579  1 ? 25 
HELX_P HELX_P243 243 GLU M 613  ? LEU M 629  ? GLU N 613  LEU N 629  1 ? 17 
HELX_P HELX_P244 244 PRO M 661  ? GLN M 671  ? PRO N 661  GLN N 671  1 ? 11 
HELX_P HELX_P245 245 LEU M 678  ? VAL M 685  ? LEU N 678  VAL N 685  1 ? 8  
HELX_P HELX_P246 246 VAL M 689  ? GLN M 702  ? VAL N 689  GLN N 702  1 ? 14 
HELX_P HELX_P247 247 LEU M 752  ? LEU M 765  ? LEU N 752  LEU N 765  1 ? 14 
HELX_P HELX_P248 248 LEU M 770  ? VAL M 782  ? LEU N 770  VAL N 782  1 ? 13 
HELX_P HELX_P249 249 LEU M 792  ? ARG M 804  ? LEU N 792  ARG N 804  1 ? 13 
HELX_P HELX_P250 250 PRO N 32   ? MET N 44   ? PRO O 32   MET O 44   1 ? 13 
HELX_P HELX_P251 251 LEU N 54   ? GLN N 69   ? LEU O 54   GLN O 69   1 ? 16 
HELX_P HELX_P252 252 LEU N 75   ? SER N 85   ? LEU O 75   SER O 85   1 ? 11 
HELX_P HELX_P253 253 PRO N 87   ? GLU N 102  ? PRO O 87   GLU O 102  1 ? 16 
HELX_P HELX_P254 254 SER N 130  ? LYS N 145  ? SER O 130  LYS O 145  1 ? 16 
HELX_P HELX_P255 255 PHE N 148  ? LYS N 168  ? PHE O 148  LYS O 168  1 ? 21 
HELX_P HELX_P256 256 GLN N 209  ? ASN N 225  ? GLN O 209  ASN O 225  1 ? 17 
HELX_P HELX_P257 257 PRO N 233  ? PHE N 246  ? PRO O 233  PHE O 246  1 ? 14 
HELX_P HELX_P258 258 ALA N 251  ? ARG N 263  ? ALA O 251  ARG O 263  1 ? 13 
HELX_P HELX_P259 259 VAL N 267  ? ARG N 280  ? VAL O 267  ARG O 280  1 ? 14 
HELX_P HELX_P260 260 SER N 299  ? ARG N 313  ? SER O 299  ARG O 313  1 ? 15 
HELX_P HELX_P261 261 TYR N 317  ? GLU N 333  ? TYR O 317  GLU O 333  1 ? 17 
HELX_P HELX_P262 262 HIS N 337  ? LEU N 350  ? HIS O 337  LEU O 350  1 ? 14 
HELX_P HELX_P263 263 SER N 415  ? LEU N 431  ? SER O 415  LEU O 431  1 ? 17 
HELX_P HELX_P264 264 SER N 435  ? LEU N 446  ? SER O 435  LEU O 446  1 ? 12 
HELX_P HELX_P265 265 THR N 463  ? GLU N 479  ? THR O 463  GLU O 479  1 ? 17 
HELX_P HELX_P266 266 PHE N 483  ? ARG N 496  ? PHE O 483  ARG O 496  1 ? 14 
HELX_P HELX_P267 267 ALA N 504  ? ASP N 522  ? ALA O 504  ASP O 522  1 ? 19 
HELX_P HELX_P268 268 TYR N 525  ? LEU N 538  ? TYR O 525  LEU O 538  1 ? 14 
HELX_P HELX_P269 269 ILE N 541  ? GLN N 554  ? ILE O 541  GLN O 554  1 ? 14 
HELX_P HELX_P270 270 MET N 557  ? LYS N 573  ? MET O 557  LYS O 573  1 ? 17 
HELX_P HELX_P271 271 THR N 577  ? ARG N 593  ? THR O 577  ARG O 593  1 ? 17 
HELX_P HELX_P272 272 PRO N 597  ? TYR N 614  ? PRO O 597  TYR O 614  1 ? 18 
HELX_P HELX_P273 273 GLN N 617  ? ILE N 633  ? GLN O 617  ILE O 633  1 ? 17 
HELX_P HELX_P274 274 PRO N 637  ? ALA N 653  ? PRO O 637  ALA O 653  1 ? 17 
HELX_P HELX_P275 275 LEU N 658  ? ALA N 675  ? LEU O 658  ALA O 675  1 ? 18 
HELX_P HELX_P276 276 LYS N 683  ? VAL N 704  ? LYS O 683  VAL O 704  1 ? 22 
HELX_P HELX_P277 277 ILE N 710  ? LEU N 724  ? ILE O 710  LEU O 724  1 ? 15 
HELX_P HELX_P278 278 THR N 727  ? GLN N 742  ? THR O 727  GLN O 742  1 ? 16 
HELX_P HELX_P279 279 LEU O 29   ? ARG O 46   ? LEU P 29   ARG P 46   1 ? 18 
HELX_P HELX_P280 280 LEU O 49   ? SER O 61   ? LEU P 49   SER P 61   1 ? 13 
HELX_P HELX_P281 281 GLU O 78   ? ASP O 95   ? GLU P 78   ASP P 95   1 ? 18 
HELX_P HELX_P282 282 TYR O 99   ? GLY O 108  ? TYR P 99   GLY P 108  1 ? 10 
HELX_P HELX_P283 283 LYS O 112  ? GLU O 133  ? LYS P 112  GLU P 133  1 ? 22 
HELX_P HELX_P284 284 GLU O 149  ? ALA O 164  ? GLU P 149  ALA P 164  1 ? 16 
HELX_P HELX_P285 285 PHE O 170  ? LYS O 181  ? PHE P 170  LYS P 181  1 ? 12 
HELX_P HELX_P286 286 VAL O 185  ? VAL O 198  ? VAL P 185  VAL P 198  1 ? 14 
HELX_P HELX_P287 287 TRP O 203  ? LEU O 212  ? TRP P 203  LEU P 212  1 ? 10 
HELX_P HELX_P288 288 LYS O 216  ? PHE O 221  ? LYS P 216  PHE P 221  1 ? 6  
HELX_P HELX_P289 289 TRP O 228  ? GLU O 240  ? TRP P 228  GLU P 240  1 ? 13 
HELX_P HELX_P290 290 ILE O 244  ? PHE O 259  ? ILE P 244  PHE P 259  1 ? 16 
HELX_P HELX_P291 291 SER O 263  ? ASN O 275  ? SER P 263  ASN P 275  1 ? 13 
HELX_P HELX_P292 292 ILE O 279  ? GLN O 292  ? ILE P 279  GLN P 292  1 ? 14 
HELX_P HELX_P293 293 MET O 300  ? VAL O 309  ? MET P 300  VAL P 309  1 ? 10 
HELX_P HELX_P294 294 LYS O 313  ? ILE O 326  ? LYS P 313  ILE P 326  1 ? 14 
HELX_P HELX_P295 295 VAL O 331  ? LEU O 343  ? VAL P 331  LEU P 343  1 ? 13 
HELX_P HELX_P296 296 HIS O 347  ? LEU O 360  ? HIS P 347  LEU P 360  1 ? 14 
HELX_P HELX_P297 297 LEU O 365  ? GLU O 377  ? LEU P 365  GLU P 377  1 ? 13 
HELX_P HELX_P298 298 THR O 381  ? VAL O 394  ? THR P 381  VAL P 394  1 ? 14 
HELX_P HELX_P299 299 TYR O 399  ? ILE O 411  ? TYR P 399  ILE P 411  1 ? 13 
HELX_P HELX_P300 300 PRO O 415  ? LEU O 428  ? PRO P 415  LEU P 428  1 ? 14 
HELX_P HELX_P301 301 SER O 433  ? LEU O 446  ? SER P 433  LEU P 446  1 ? 14 
HELX_P HELX_P302 302 LEU O 449  ? VAL O 462  ? LEU P 449  VAL P 462  1 ? 14 
HELX_P HELX_P303 303 ALA O 469  ? HIS O 477  ? ALA P 469  HIS P 477  1 ? 9  
HELX_P HELX_P304 304 PRO P 30   ? SER P 45   ? PRO Q 30   SER Q 45   1 ? 16 
HELX_P HELX_P305 305 ASP P 116  ? LEU P 118  ? ASP Q 116  LEU Q 118  1 ? 3  
HELX_P HELX_P306 306 VAL P 128  ? GLY P 140  ? VAL Q 128  GLY Q 140  1 ? 13 
HELX_P HELX_P307 307 THR P 150  ? LYS P 157  ? THR Q 150  LYS Q 157  1 ? 8  
HELX_P HELX_P308 308 PRO P 159  ? LYS P 172  ? PRO Q 159  LYS Q 172  1 ? 14 
HELX_P HELX_P309 309 ALA Q 85   ? SER Q 96   ? ALA R 85   SER R 96   1 ? 12 
HELX_P HELX_P310 310 THR Q 108  ? LEU Q 120  ? THR R 108  LEU R 120  1 ? 13 
HELX_P HELX_P311 311 VAL Q 125  ? GLU Q 127  ? VAL R 125  GLU R 127  1 ? 3  
HELX_P HELX_P312 312 LEU S 13   ? LYS S 24   ? LEU W 13   LYS W 24   1 ? 12 
HELX_P HELX_P313 313 VAL T 3    ? ALA T 13   ? VAL X 37   ALA X 47   1 ? 11 
HELX_P HELX_P314 314 HIS T 16   ? ASN T 32   ? HIS X 50   ASN X 66   1 ? 17 
HELX_P HELX_P315 315 PRO T 39   ? HIS T 55   ? PRO X 73   HIS X 89   1 ? 17 
HELX_P HELX_P316 316 TYR T 59   ? ALA T 75   ? TYR X 93   ALA X 109  1 ? 17 
HELX_P HELX_P317 317 GLU T 101  ? LEU T 115  ? GLU X 135  LEU X 149  1 ? 15 
HELX_P HELX_P318 318 ASP T 118  ? ASP T 126  ? ASP X 152  ASP X 160  1 ? 9  
HELX_P HELX_P319 319 PRO T 135  ? ALA T 148  ? PRO X 169  ALA X 182  1 ? 14 
HELX_P HELX_P320 320 GLU T 151  ? GLN T 164  ? GLU X 185  GLN X 198  1 ? 14 
HELX_P HELX_P321 321 LEU T 169  ? LEU T 178  ? LEU X 203  LEU X 212  1 ? 10 
HELX_P HELX_P322 322 LYS T 181  ? GLN T 194  ? LYS X 215  GLN X 228  1 ? 14 
HELX_P HELX_P323 323 LEU T 202  ? THR T 214  ? LEU X 236  THR X 248  1 ? 13 
HELX_P HELX_P324 324 ASN T 217  ? LYS T 229  ? ASN X 251  LYS X 263  1 ? 13 
HELX_P HELX_P325 325 VAL T 237  ? ALA T 250  ? VAL X 271  ALA X 284  1 ? 14 
HELX_P HELX_P326 326 ASN T 253  ? LEU T 266  ? ASN X 287  LEU X 300  1 ? 14 
HELX_P HELX_P327 327 ILE T 271  ? GLU T 284  ? ILE X 305  GLU X 318  1 ? 14 
HELX_P HELX_P328 328 LEU T 287  ? ILE T 300  ? LEU X 321  ILE X 334  1 ? 14 
HELX_P HELX_P329 329 ALA T 305  ? SER T 318  ? ALA X 339  SER X 352  1 ? 14 
HELX_P HELX_P330 330 TYR T 321  ? LEU T 334  ? TYR X 355  LEU X 368  1 ? 14 
HELX_P HELX_P331 331 VAL T 339  ? ASN T 351  ? VAL X 373  ASN X 385  1 ? 13 
HELX_P HELX_P332 332 VAL T 355  ? LEU T 368  ? VAL X 389  LEU X 402  1 ? 14 
HELX_P HELX_P333 333 LEU T 373  ? SER T 386  ? LEU X 407  SER X 420  1 ? 14 
HELX_P HELX_P334 334 ILE T 389  ? LEU T 403  ? ILE X 423  LEU X 437  1 ? 15 
HELX_P HELX_P335 335 GLN T 408  ? CYS T 417  ? GLN X 442  CYS X 451  1 ? 10 
HELX_P HELX_P336 336 VAL U 3    ? ALA U 13   ? VAL Y 37   ALA Y 47   1 ? 11 
HELX_P HELX_P337 337 HIS U 16   ? ASN U 32   ? HIS Y 50   ASN Y 66   1 ? 17 
HELX_P HELX_P338 338 PRO U 39   ? ASP U 56   ? PRO Y 73   ASP Y 90   1 ? 18 
HELX_P HELX_P339 339 TYR U 59   ? ALA U 75   ? TYR Y 93   ALA Y 109  1 ? 17 
HELX_P HELX_P340 340 GLU U 101  ? LEU U 115  ? GLU Y 135  LEU Y 149  1 ? 15 
HELX_P HELX_P341 341 ASP U 118  ? ASP U 126  ? ASP Y 152  ASP Y 160  1 ? 9  
HELX_P HELX_P342 342 PRO U 135  ? ALA U 148  ? PRO Y 169  ALA Y 182  1 ? 14 
HELX_P HELX_P343 343 GLU U 151  ? GLN U 164  ? GLU Y 185  GLN Y 198  1 ? 14 
HELX_P HELX_P344 344 LEU U 169  ? LEU U 178  ? LEU Y 203  LEU Y 212  1 ? 10 
HELX_P HELX_P345 345 LYS U 181  ? GLN U 194  ? LYS Y 215  GLN Y 228  1 ? 14 
HELX_P HELX_P346 346 LEU U 202  ? THR U 214  ? LEU Y 236  THR Y 248  1 ? 13 
HELX_P HELX_P347 347 ASN U 217  ? LYS U 229  ? ASN Y 251  LYS Y 263  1 ? 13 
HELX_P HELX_P348 348 VAL U 237  ? ALA U 250  ? VAL Y 271  ALA Y 284  1 ? 14 
HELX_P HELX_P349 349 ASN U 253  ? LEU U 266  ? ASN Y 287  LEU Y 300  1 ? 14 
HELX_P HELX_P350 350 ILE U 271  ? GLU U 284  ? ILE Y 305  GLU Y 318  1 ? 14 
HELX_P HELX_P351 351 LEU U 287  ? ILE U 300  ? LEU Y 321  ILE Y 334  1 ? 14 
HELX_P HELX_P352 352 ALA U 305  ? SER U 318  ? ALA Y 339  SER Y 352  1 ? 14 
HELX_P HELX_P353 353 TYR U 321  ? LEU U 334  ? TYR Y 355  LEU Y 368  1 ? 14 
HELX_P HELX_P354 354 VAL U 339  ? MET U 352  ? VAL Y 373  MET Y 386  1 ? 14 
HELX_P HELX_P355 355 VAL U 355  ? LEU U 368  ? VAL Y 389  LEU Y 402  1 ? 14 
HELX_P HELX_P356 356 LEU U 373  ? SER U 386  ? LEU Y 407  SER Y 420  1 ? 14 
HELX_P HELX_P357 357 ILE U 389  ? LEU U 403  ? ILE Y 423  LEU Y 437  1 ? 15 
HELX_P HELX_P358 358 GLN U 408  ? GLU U 419  ? GLN Y 442  GLU Y 453  1 ? 12 
HELX_P HELX_P359 359 GLN U 424  ? THR U 436  ? GLN Y 458  THR Y 470  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1   ? 1 ? 
2   ? 1 ? 
3   ? 1 ? 
4   ? 1 ? 
5   ? 1 ? 
6   ? 1 ? 
7   ? 1 ? 
8   ? 1 ? 
9   ? 1 ? 
10  ? 1 ? 
11  ? 1 ? 
12  ? 1 ? 
13  ? 1 ? 
14  ? 1 ? 
15  ? 1 ? 
16  ? 1 ? 
17  ? 1 ? 
18  ? 1 ? 
19  ? 1 ? 
20  ? 1 ? 
21  ? 1 ? 
22  ? 1 ? 
23  ? 1 ? 
24  ? 1 ? 
25  ? 1 ? 
26  ? 1 ? 
27  ? 1 ? 
28  ? 1 ? 
29  ? 1 ? 
30  ? 1 ? 
31  ? 1 ? 
32  ? 1 ? 
33  ? 1 ? 
34  ? 1 ? 
35  ? 1 ? 
36  ? 1 ? 
37  ? 1 ? 
38  ? 1 ? 
39  ? 1 ? 
40  ? 1 ? 
41  ? 1 ? 
42  ? 1 ? 
43  ? 1 ? 
44  ? 1 ? 
45  ? 1 ? 
46  ? 1 ? 
47  ? 1 ? 
48  ? 1 ? 
49  ? 1 ? 
50  ? 1 ? 
51  ? 1 ? 
52  ? 1 ? 
53  ? 1 ? 
54  ? 1 ? 
55  ? 1 ? 
56  ? 1 ? 
57  ? 1 ? 
58  ? 1 ? 
59  ? 1 ? 
60  ? 1 ? 
61  ? 1 ? 
62  ? 1 ? 
63  ? 1 ? 
64  ? 1 ? 
65  ? 1 ? 
66  ? 1 ? 
67  ? 1 ? 
68  ? 1 ? 
69  ? 1 ? 
70  ? 1 ? 
71  ? 1 ? 
72  ? 1 ? 
73  ? 1 ? 
74  ? 1 ? 
75  ? 1 ? 
76  ? 1 ? 
77  ? 1 ? 
78  ? 1 ? 
79  ? 1 ? 
80  ? 1 ? 
81  ? 1 ? 
82  ? 1 ? 
83  ? 1 ? 
84  ? 1 ? 
85  ? 1 ? 
86  ? 1 ? 
87  ? 1 ? 
88  ? 1 ? 
89  ? 1 ? 
90  ? 1 ? 
91  ? 1 ? 
92  ? 1 ? 
93  ? 1 ? 
94  ? 1 ? 
95  ? 1 ? 
96  ? 1 ? 
97  ? 1 ? 
98  ? 1 ? 
99  ? 1 ? 
100 ? 1 ? 
101 ? 1 ? 
102 ? 1 ? 
103 ? 1 ? 
104 ? 1 ? 
105 ? 1 ? 
106 ? 1 ? 
107 ? 1 ? 
108 ? 1 ? 
109 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1   1 SER A 73   ? LYS A 78   ? SER A 73   LYS A 78   
2   1 ASP A 90   ? VAL A 95   ? ASP A 90   VAL A 95   
3   1 MET A 99   ? SER A 103  ? MET A 99   SER A 103  
4   1 VAL A 113  ? THR A 118  ? VAL A 113  THR A 118  
5   1 LEU A 127  ? ILE A 132  ? LEU A 127  ILE A 132  
6   1 VAL A 147  ? CYS A 152  ? VAL A 147  CYS A 152  
7   1 CYS A 158  ? HIS A 162  ? CYS A 158  HIS A 162  
8   1 ASP A 168  ? SER A 172  ? ASP A 168  SER A 172  
9   1 VAL A 177  ? VAL A 180  ? VAL A 177  VAL A 180  
10  1 PHE A 189  ? ARG A 191  ? PHE A 189  ARG A 191  
11  1 LYS A 245  ? ASN A 250  ? LYS A 245  ASN A 250  
12  1 ILE A 255  ? TYR A 259  ? ILE A 255  TYR A 259  
13  1 HIS A 266  ? TRP A 269  ? HIS A 266  TRP A 269  
14  1 ILE A 432  ? SER A 434  ? ILE A 432  SER A 434  
15  1 LYS A 440  ? LEU A 445  ? LYS A 440  LEU A 445  
16  1 LEU A 452  ? CYS A 454  ? LEU A 452  CYS A 454  
17  1 MET A 488  ? GLU A 492  ? MET A 488  GLU A 492  
18  1 ASN A 496  ? TYR A 500  ? ASN A 496  TYR A 500  
19  1 ARG A 505  ? LYS A 508  ? ARG A 505  LYS A 508  
20  1 SER A 586  ? ARG A 588  ? SER A 586  ARG A 588  
21  1 ARG A 594  ? GLU A 598  ? ARG A 594  GLU A 598  
22  1 MET A 604  ? THR A 608  ? MET A 604  THR A 608  
23  1 THR A 1108 ? ALA A 1111 ? THR A 1108 ALA A 1111 
24  1 THR A 1116 ? ASP A 1119 ? THR A 1116 ASP A 1119 
25  1 TYR A 1572 ? LEU A 1574 ? TYR A 1572 LEU A 1574 
26  1 ALA A 1614 ? PRO A 1616 ? ALA A 1614 PRO A 1616 
27  1 VAL A 1620 ? VAL A 1622 ? VAL A 1620 VAL A 1622 
28  1 LEU A 1633 ? TYR A 1638 ? LEU A 1633 TYR A 1638 
29  1 LYS A 1648 ? MET A 1652 ? LYS A 1648 MET A 1652 
30  1 LEU A 1663 ? VAL A 1668 ? LEU A 1663 VAL A 1668 
31  1 GLU A 1675 ? ILE A 1678 ? GLU A 1675 ILE A 1678 
32  1 VAL A 1696 ? TYR A 1698 ? VAL A 1696 TYR A 1698 
33  1 VAL B 3    ? GLY B 10   ? VAL B 3    GLY B 10   
34  1 LEU B 46   ? TRP B 48   ? LEU B 46   TRP B 48   
35  1 CYS B 54   ? HIS B 56   ? CYS B 54   HIS B 56   
36  1 ILE H 23   ? TRP H 28   ? ILE I 23   TRP I 28   
37  1 ILE H 35   ? ASN H 39   ? ILE I 35   ASN I 39   
38  1 VAL H 44   ? HIS H 47   ? VAL I 44   HIS I 47   
39  1 ARG H 54   ? PHE H 58   ? ARG I 54   PHE I 58   
40  1 VAL H 68   ? TRP H 73   ? VAL I 68   TRP I 73   
41  1 LEU H 79   ? LEU H 84   ? LEU I 79   LEU I 84   
42  1 ILE H 90   ? ASP H 94   ? ILE I 90   ASP I 94   
43  1 CYS H 112  ? GLU H 117  ? CYS I 112  GLU I 117  
44  1 ASN H 174  ? GLY H 179  ? ASN I 174  GLY I 179  
45  1 PHE H 184  ? ALA H 189  ? PHE I 184  ALA I 189  
46  1 PHE H 193  ? THR H 199  ? PHE I 193  THR I 199  
47  1 THR H 204  ? LEU H 210  ? THR I 204  LEU I 210  
48  1 SER H 216  ? GLU H 222  ? SER I 216  GLU I 222  
49  1 TYR H 233  ? GLU H 237  ? TYR I 233  GLU I 237  
50  1 ALA H 551  ? ILE H 554  ? ALA I 551  ILE I 554  
51  1 PHE H 574  ? ASN H 578  ? PHE I 574  ASN I 578  
52  1 LEU H 583  ? LEU H 591  ? LEU I 583  LEU I 591  
53  1 TYR H 596  ? HIS H 604  ? TYR I 596  HIS I 604  
54  1 LEU H 615  ? PHE H 623  ? LEU I 615  PHE I 623  
55  1 TYR H 636  ? PHE H 643  ? TYR I 636  PHE I 643  
56  1 THR H 648  ? ASP H 655  ? THR I 648  ASP I 655  
57  1 ARG H 664  ? PRO H 670  ? ARG I 664  PRO I 670  
58  1 THR H 702  ? PHE H 707  ? THR I 702  PHE I 707  
59  1 TRP H 711  ? LEU H 714  ? TRP I 711  LEU I 714  
60  1 ALA H 719  ? GLY H 724  ? ALA I 719  GLY I 724  
61  1 VAL H 730  ? SER H 735  ? VAL I 730  SER I 735  
62  1 VAL H 741  ? GLU H 745  ? VAL I 741  GLU I 745  
63  1 VAL K 22   ? GLU K 24   ? VAL L 22   GLU L 24   
64  1 VAL K 30   ? LEU K 33   ? VAL L 30   LEU L 33   
65  1 VAL K 64   ? GLN K 67   ? VAL L 64   GLN L 67   
66  1 THR K 72   ? VAL K 74   ? THR L 72   VAL L 74   
67  1 THR K 76   ? TYR K 80   ? THR L 76   TYR L 80   
68  1 LYS K 93   ? GLY K 99   ? LYS L 93   GLY L 99   
69  1 GLN K 106  ? GLU K 112  ? GLN L 106  GLU L 112  
70  1 TRP K 119  ? PRO K 123  ? TRP L 119  PRO L 123  
71  1 THR K 132  ? THR K 134  ? THR L 132  THR L 134  
72  1 MET K 136  ? VAL K 141  ? MET L 136  VAL L 141  
73  1 GLN K 155  ? PRO K 161  ? GLN L 155  PRO L 161  
74  1 GLY M 590  ? ALA M 593  ? GLY N 590  ALA N 593  
75  1 LEU M 643  ? VAL M 648  ? LEU N 643  VAL N 648  
76  1 VAL M 809  ? GLU M 811  ? VAL N 809  GLU N 811  
77  1 VAL M 814  ? ARG M 816  ? VAL N 814  ARG N 816  
78  1 ILE P 50   ? PRO P 54   ? ILE Q 50   PRO Q 54   
79  1 LYS P 61   ? HIS P 67   ? LYS Q 61   HIS Q 67   
80  1 ARG P 78   ? GLU P 84   ? ARG Q 78   GLU Q 84   
81  1 THR P 95   ? PHE P 98   ? THR Q 95   PHE Q 98   
82  1 ARG Q 174  ? ASP Q 177  ? ARG R 174  ASP R 177  
83  1 VAL Q 190  ? TRP Q 192  ? VAL R 190  TRP R 192  
84  1 VAL Q 197  ? LEU Q 202  ? VAL R 197  LEU R 202  
85  1 SER Q 205  ? SER Q 210  ? SER R 205  SER R 210  
86  1 ILE Q 216  ? GLN Q 221  ? ILE R 216  GLN R 221  
87  1 ILE Q 229  ? TRP Q 234  ? ILE R 229  TRP R 234  
88  1 TYR Q 240  ? THR Q 245  ? TYR R 240  THR R 245  
89  1 VAL Q 250  ? ASP Q 254  ? VAL R 250  ASP R 254  
90  1 LYS Q 259  ? MET Q 264  ? LYS R 259  MET R 264  
91  1 VAL Q 271  ? ASN Q 277  ? VAL R 271  ASN R 277  
92  1 ILE Q 280  ? SER Q 285  ? ILE R 280  SER R 285  
93  1 HIS Q 289  ? ASP Q 294  ? HIS R 289  ASP R 294  
94  1 HIS Q 301  ? SER Q 306  ? HIS R 301  SER R 306  
95  1 VAL Q 312  ? TRP Q 317  ? VAL R 312  TRP R 317  
96  1 HIS Q 323  ? GLY Q 328  ? HIS R 323  GLY R 328  
97  1 LEU Q 332  ? PRO Q 337  ? LEU R 332  PRO R 337  
98  1 GLN Q 349  ? PHE Q 351  ? GLN R 349  PHE R 351  
99  1 ALA Q 360  ? TRP Q 363  ? ALA R 360  TRP R 363  
100 1 VAL Q 370  ? GLY Q 374  ? VAL R 370  GLY R 374  
101 1 HIS Q 381  ? ASN Q 386  ? HIS R 381  ASN R 386  
102 1 CYS Q 392  ? ASP Q 397  ? CYS R 392  ASP R 397  
103 1 VAL Q 402  ? SER Q 408  ? VAL R 402  SER R 408  
104 1 GLU Q 413  ? HIS Q 418  ? GLU R 413  HIS R 418  
105 1 LEU Q 425  ? LYS Q 429  ? LEU R 425  LYS R 429  
106 1 LYS Q 435  ? LEU Q 439  ? LYS R 435  LEU R 439  
107 1 VAL Q 446  ? MET Q 451  ? VAL R 446  MET R 451  
108 1 VAL Q 458  ? ALA Q 462  ? VAL R 458  ALA R 462  
109 1 THR Q 466  ? TRP Q 470  ? THR R 466  TRP R 470  
# 
_atom_sites.entry_id                    5KHR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_type.symbol   C 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    C CA . MET A 1  11   ? 241.765 220.973 119.810 1.00 291.97 ? 11   MET A CA 1 
ATOM 2    C CA . ILE A 1  12   ? 240.081 219.967 123.174 1.00 222.51 ? 12   ILE A CA 1 
ATOM 3    C CA . ALA A 1  13   ? 236.330 219.290 122.971 1.00 240.08 ? 13   ALA A CA 1 
ATOM 4    C CA . ALA A 1  14   ? 234.653 219.238 126.407 1.00 253.60 ? 14   ALA A CA 1 
ATOM 5    C CA . ARG A 1  15   ? 232.824 216.060 127.472 1.00 232.37 ? 15   ARG A CA 1 
ATOM 6    C CA . ASP A 1  16   ? 229.269 217.334 128.218 1.00 259.53 ? 16   ASP A CA 1 
ATOM 7    C CA . LEU A 1  17   ? 226.814 220.134 127.728 1.00 320.41 ? 17   LEU A CA 1 
ATOM 8    C CA . GLN A 1  18   ? 224.371 220.877 130.529 1.00 500.00 ? 18   GLN A CA 1 
ATOM 9    C CA . GLU A 1  19   ? 222.219 224.000 130.699 1.00 500.00 ? 19   GLU A CA 1 
ATOM 10   C CA . PHE A 1  20   ? 222.774 224.957 134.330 1.00 500.00 ? 20   PHE A CA 1 
ATOM 11   C CA . VAL A 1  21   ? 220.228 227.021 136.221 1.00 500.00 ? 21   VAL A CA 1 
ATOM 12   C CA . PRO A 1  22   ? 220.572 226.955 140.047 1.00 480.69 ? 22   PRO A CA 1 
ATOM 13   C CA . PHE A 1  23   ? 217.652 224.856 141.344 1.00 241.11 ? 23   PHE A CA 1 
ATOM 14   C CA . GLY A 1  24   ? 216.782 227.294 144.141 1.00 153.45 ? 24   GLY A CA 1 
ATOM 15   C CA . ARG A 1  25   ? 215.961 229.820 141.400 1.00 197.32 ? 25   ARG A CA 1 
ATOM 16   C CA . ASP A 1  26   ? 213.630 227.152 140.013 1.00 208.12 ? 26   ASP A CA 1 
ATOM 17   C CA . HIS A 1  27   ? 212.164 226.674 143.461 1.00 192.04 ? 27   HIS A CA 1 
ATOM 18   C CA . CYS A 1  28   ? 212.503 230.131 145.105 1.00 205.89 ? 28   CYS A CA 1 
ATOM 19   C CA . LYS A 1  29   ? 209.996 231.654 142.604 1.00 333.59 ? 29   LYS A CA 1 
ATOM 20   C CA . HIS A 1  30   ? 207.330 229.502 144.316 1.00 177.62 ? 30   HIS A CA 1 
ATOM 21   C CA . HIS A 1  31   ? 208.462 229.150 147.971 1.00 188.99 ? 31   HIS A CA 1 
ATOM 22   C CA . PRO A 1  32   ? 206.517 230.413 151.087 1.00 133.89 ? 32   PRO A CA 1 
ATOM 23   C CA . LYS A 1  71   ? 219.907 240.545 143.867 1.00 236.94 ? 71   LYS A CA 1 
ATOM 24   C CA . GLU A 1  72   ? 220.680 236.812 144.486 1.00 334.12 ? 72   GLU A CA 1 
ATOM 25   C CA . SER A 1  73   ? 223.817 234.621 144.219 1.00 212.84 ? 73   SER A CA 1 
ATOM 26   C CA . TRP A 1  74   ? 225.069 231.053 144.999 1.00 297.48 ? 74   TRP A CA 1 
ATOM 27   C CA . GLN A 1  75   ? 228.232 228.910 145.632 1.00 318.83 ? 75   GLN A CA 1 
ATOM 28   C CA . LEU A 1  76   ? 229.441 225.397 144.783 1.00 139.59 ? 76   LEU A CA 1 
ATOM 29   C CA . ARG A 1  77   ? 231.065 222.689 146.838 1.00 146.27 ? 77   ARG A CA 1 
ATOM 30   C CA . LYS A 1  78   ? 232.670 219.452 145.859 1.00 180.38 ? 78   LYS A CA 1 
ATOM 31   C CA . GLY A 1  79   ? 229.932 217.317 147.364 1.00 240.90 ? 79   GLY A CA 1 
ATOM 32   C CA . VAL A 1  80   ? 230.334 214.811 150.149 1.00 201.55 ? 80   VAL A CA 1 
ATOM 33   C CA . SER A 1  81   ? 228.925 211.257 150.312 1.00 220.70 ? 81   SER A CA 1 
ATOM 34   C CA . GLU A 1  82   ? 229.231 209.589 153.757 1.00 237.40 ? 82   GLU A CA 1 
ATOM 35   C CA . ILE A 1  83   ? 231.033 206.196 153.612 1.00 344.80 ? 83   ILE A CA 1 
ATOM 36   C CA . GLY A 1  84   ? 231.699 206.711 149.905 1.00 325.51 ? 84   GLY A CA 1 
ATOM 37   C CA . GLU A 1  85   ? 234.414 209.403 149.429 1.00 276.67 ? 85   GLU A CA 1 
ATOM 38   C CA . ASP A 1  86   ? 234.343 208.602 145.680 1.00 263.02 ? 86   ASP A CA 1 
ATOM 39   C CA . VAL A 1  87   ? 231.731 211.358 145.423 1.00 230.94 ? 87   VAL A CA 1 
ATOM 40   C CA . ASP A 1  88   ? 231.988 213.265 142.061 1.00 218.82 ? 88   ASP A CA 1 
ATOM 41   C CA . TYR A 1  89   ? 228.699 215.201 142.644 1.00 180.33 ? 89   TYR A CA 1 
ATOM 42   C CA . ASP A 1  90   ? 227.927 218.847 143.446 1.00 177.15 ? 90   ASP A CA 1 
ATOM 43   C CA . GLU A 1  91   ? 226.079 220.665 146.204 1.00 167.63 ? 91   GLU A CA 1 
ATOM 44   C CA . GLU A 1  92   ? 224.732 224.183 145.673 1.00 192.14 ? 92   GLU A CA 1 
ATOM 45   C CA . LEU A 1  93   ? 224.212 226.945 148.325 1.00 257.67 ? 93   LEU A CA 1 
ATOM 46   C CA . TYR A 1  94   ? 221.622 229.442 147.027 1.00 372.56 ? 94   TYR A CA 1 
ATOM 47   C CA . VAL A 1  95   ? 221.119 232.882 148.592 1.00 263.74 ? 95   VAL A CA 1 
ATOM 48   C CA . ALA A 1  96   ? 218.140 234.993 147.350 1.00 268.44 ? 96   ALA A CA 1 
ATOM 49   C CA . GLY A 1  97   ? 217.036 237.144 150.353 1.00 205.71 ? 97   GLY A CA 1 
ATOM 50   C CA . ASN A 1  98   ? 215.302 235.662 153.375 1.00 129.27 ? 98   ASN A CA 1 
ATOM 51   C CA . MET A 1  99   ? 215.539 232.085 152.072 1.00 132.40 ? 99   MET A CA 1 
ATOM 52   C CA . VAL A 1  100  ? 218.610 229.972 151.472 1.00 142.15 ? 100  VAL A CA 1 
ATOM 53   C CA . ILE A 1  101  ? 218.324 226.656 149.669 1.00 143.50 ? 101  ILE A CA 1 
ATOM 54   C CA . TRP A 1  102  ? 220.747 223.745 149.888 1.00 128.43 ? 102  TRP A CA 1 
ATOM 55   C CA . SER A 1  103  ? 220.595 221.788 146.691 1.00 178.28 ? 103  SER A CA 1 
ATOM 56   C CA . LYS A 1  104  ? 222.347 218.587 145.654 1.00 175.45 ? 104  LYS A CA 1 
ATOM 57   C CA . GLY A 1  105  ? 222.559 217.732 141.905 1.00 182.33 ? 105  GLY A CA 1 
ATOM 58   C CA . SER A 1  106  ? 223.220 219.935 138.882 1.00 207.19 ? 106  SER A CA 1 
ATOM 59   C CA . LYS A 1  107  ? 221.028 218.428 136.088 1.00 181.16 ? 107  LYS A CA 1 
ATOM 60   C CA . SER A 1  108  ? 217.487 218.611 134.581 1.00 217.76 ? 108  SER A CA 1 
ATOM 61   C CA . GLN A 1  109  ? 217.344 214.948 135.518 1.00 221.47 ? 109  GLN A CA 1 
ATOM 62   C CA . ALA A 1  110  ? 219.056 215.266 138.920 1.00 191.03 ? 110  ALA A CA 1 
ATOM 63   C CA . LEU A 1  111  ? 218.092 218.554 140.646 1.00 158.84 ? 111  LEU A CA 1 
ATOM 64   C CA . ALA A 1  112  ? 217.310 217.791 144.273 1.00 186.62 ? 112  ALA A CA 1 
ATOM 65   C CA . VAL A 1  113  ? 216.561 220.172 147.080 1.00 161.65 ? 113  VAL A CA 1 
ATOM 66   C CA . TYR A 1  114  ? 218.275 219.064 150.319 1.00 184.72 ? 114  TYR A CA 1 
ATOM 67   C CA . LYS A 1  115  ? 216.673 221.557 152.795 1.00 180.77 ? 115  LYS A CA 1 
ATOM 68   C CA . ALA A 1  116  ? 215.303 225.162 152.763 1.00 162.52 ? 116  ALA A CA 1 
ATOM 69   C CA . PHE A 1  117  ? 216.576 227.850 155.135 1.00 161.72 ? 117  PHE A CA 1 
ATOM 70   C CA . THR A 1  118  ? 214.167 230.815 155.544 1.00 170.73 ? 118  THR A CA 1 
ATOM 71   C CA . VAL A 1  119  ? 215.249 233.694 157.749 1.00 155.32 ? 119  VAL A CA 1 
ATOM 72   C CA . ASP A 1  120  ? 212.710 236.557 157.457 1.00 216.44 ? 120  ASP A CA 1 
ATOM 73   C CA . SER A 1  121  ? 215.545 239.180 157.014 1.00 202.91 ? 121  SER A CA 1 
ATOM 74   C CA . PRO A 1  122  ? 218.120 239.474 154.214 1.00 196.25 ? 122  PRO A CA 1 
ATOM 75   C CA . VAL A 1  123  ? 220.860 236.733 154.226 1.00 247.10 ? 123  VAL A CA 1 
ATOM 76   C CA . GLN A 1  124  ? 224.360 238.229 153.855 1.00 249.76 ? 124  GLN A CA 1 
ATOM 77   C CA . GLN A 1  125  ? 226.515 235.276 153.268 1.00 143.98 ? 125  GLN A CA 1 
ATOM 78   C CA . ALA A 1  126  ? 225.352 231.669 153.755 1.00 164.45 ? 126  ALA A CA 1 
ATOM 79   C CA . LEU A 1  127  ? 228.607 229.739 153.446 1.00 130.78 ? 127  LEU A CA 1 
ATOM 80   C CA . TRP A 1  128  ? 229.231 226.228 154.907 1.00 143.72 ? 128  TRP A CA 1 
ATOM 81   C CA . CYS A 1  129  ? 231.815 225.324 157.594 1.00 179.00 ? 129  CYS A CA 1 
ATOM 82   C CA . ASP A 1  130  ? 233.007 222.869 160.288 1.00 193.49 ? 130  ASP A CA 1 
ATOM 83   C CA . PHE A 1  131  ? 233.587 223.296 164.033 1.00 161.72 ? 131  PHE A CA 1 
ATOM 84   C CA . ILE A 1  132  ? 235.843 221.177 166.270 1.00 205.03 ? 132  ILE A CA 1 
ATOM 85   C CA . ILE A 1  133  ? 234.267 220.712 169.762 1.00 184.32 ? 133  ILE A CA 1 
ATOM 86   C CA . SER A 1  134  ? 236.711 220.042 172.670 1.00 242.63 ? 134  SER A CA 1 
ATOM 87   C CA . GLU A 1  146  ? 234.079 215.212 166.390 1.00 213.12 ? 146  GLU A CA 1 
ATOM 88   C CA . VAL A 1  147  ? 233.351 218.008 163.778 1.00 188.29 ? 147  VAL A CA 1 
ATOM 89   C CA . GLU A 1  148  ? 229.801 219.267 163.061 1.00 163.93 ? 148  GLU A CA 1 
ATOM 90   C CA . LYS A 1  149  ? 229.295 220.309 159.390 1.00 201.03 ? 149  LYS A CA 1 
ATOM 91   C CA . CYS A 1  150  ? 226.826 223.222 159.328 1.00 169.13 ? 150  CYS A CA 1 
ATOM 92   C CA . ILE A 1  151  ? 225.443 225.771 156.915 1.00 152.13 ? 151  ILE A CA 1 
ATOM 93   C CA . CYS A 1  152  ? 226.148 229.278 158.308 1.00 132.45 ? 152  CYS A CA 1 
ATOM 94   C CA . ILE A 1  153  ? 223.519 231.824 157.385 1.00 113.99 ? 153  ILE A CA 1 
ATOM 95   C CA . LEU A 1  154  ? 224.739 235.327 158.294 1.00 103.26 ? 154  LEU A CA 1 
ATOM 96   C CA . GLN A 1  155  ? 222.534 238.466 158.206 1.00 169.69 ? 155  GLN A CA 1 
ATOM 97   C CA . SER A 1  156  ? 223.335 242.124 159.302 1.00 251.20 ? 156  SER A CA 1 
ATOM 98   C CA . SER A 1  157  ? 221.754 241.456 162.750 1.00 230.01 ? 157  SER A CA 1 
ATOM 99   C CA . CYS A 1  158  ? 222.836 237.809 163.399 1.00 177.40 ? 158  CYS A CA 1 
ATOM 100  C CA . ILE A 1  159  ? 224.111 234.355 162.357 1.00 135.90 ? 159  ILE A CA 1 
ATOM 101  C CA . ASN A 1  160  ? 222.416 230.949 162.092 1.00 126.71 ? 160  ASN A CA 1 
ATOM 102  C CA . MET A 1  161  ? 223.954 227.542 161.962 1.00 115.92 ? 161  MET A CA 1 
ATOM 103  C CA . HIS A 1  162  ? 222.219 224.333 161.252 1.00 130.55 ? 162  HIS A CA 1 
ATOM 104  C CA . SER A 1  163  ? 224.156 221.032 161.549 1.00 177.82 ? 163  SER A CA 1 
ATOM 105  C CA . ILE A 1  164  ? 223.796 218.087 159.178 1.00 153.64 ? 164  ILE A CA 1 
ATOM 106  C CA . GLU A 1  165  ? 223.241 216.306 162.506 1.00 182.77 ? 165  GLU A CA 1 
ATOM 107  C CA . GLY A 1  166  ? 220.311 218.698 162.965 1.00 149.52 ? 166  GLY A CA 1 
ATOM 108  C CA . LYS A 1  167  ? 221.702 220.780 165.790 1.00 139.46 ? 167  LYS A CA 1 
ATOM 109  C CA . ASP A 1  168  ? 221.060 224.474 165.150 1.00 150.69 ? 168  ASP A CA 1 
ATOM 110  C CA . TYR A 1  169  ? 222.778 227.485 166.582 1.00 150.02 ? 169  TYR A CA 1 
ATOM 111  C CA . ILE A 1  170  ? 222.014 231.102 166.706 1.00 139.40 ? 170  ILE A CA 1 
ATOM 112  C CA . ALA A 1  171  ? 224.887 233.430 167.217 1.00 265.72 ? 171  ALA A CA 1 
ATOM 113  C CA . SER A 1  172  ? 224.088 237.140 167.204 1.00 214.58 ? 172  SER A CA 1 
ATOM 114  C CA . LEU A 1  173  ? 226.574 239.859 166.359 1.00 239.35 ? 173  LEU A CA 1 
ATOM 115  C CA . PRO A 1  174  ? 228.289 242.538 168.635 1.00 316.15 ? 174  PRO A CA 1 
ATOM 116  C CA . PHE A 1  175  ? 228.993 244.618 165.453 1.00 166.55 ? 175  PHE A CA 1 
ATOM 117  C CA . GLN A 1  176  ? 228.441 245.367 161.691 1.00 231.92 ? 176  GLN A CA 1 
ATOM 118  C CA . VAL A 1  177  ? 230.106 242.595 159.649 1.00 171.03 ? 177  VAL A CA 1 
ATOM 119  C CA . ALA A 1  178  ? 231.235 242.685 155.965 1.00 170.01 ? 178  ALA A CA 1 
ATOM 120  C CA . ASN A 1  179  ? 232.299 239.068 155.570 1.00 217.04 ? 179  ASN A CA 1 
ATOM 121  C CA . VAL A 1  180  ? 232.291 235.636 157.082 1.00 300.66 ? 180  VAL A CA 1 
ATOM 122  C CA . TRP A 1  181  ? 235.020 233.243 155.998 1.00 300.93 ? 181  TRP A CA 1 
ATOM 123  C CA . PRO A 1  182  ? 234.296 229.452 155.955 1.00 230.73 ? 182  PRO A CA 1 
ATOM 124  C CA . THR A 1  183  ? 237.669 228.585 157.548 1.00 278.71 ? 183  THR A CA 1 
ATOM 125  C CA . LYS A 1  184  ? 239.264 225.243 158.393 1.00 187.69 ? 184  LYS A CA 1 
ATOM 126  C CA . TYR A 1  185  ? 240.176 225.451 162.056 1.00 207.61 ? 185  TYR A CA 1 
ATOM 127  C CA . GLY A 1  186  ? 237.149 227.697 162.941 1.00 161.10 ? 186  GLY A CA 1 
ATOM 128  C CA . LEU A 1  187  ? 235.202 230.572 161.460 1.00 282.65 ? 187  LEU A CA 1 
ATOM 129  C CA . LEU A 1  188  ? 236.051 234.255 160.673 1.00 305.21 ? 188  LEU A CA 1 
ATOM 130  C CA . PHE A 1  189  ? 234.606 237.793 160.546 1.00 186.16 ? 189  PHE A CA 1 
ATOM 131  C CA . GLU A 1  190  ? 235.904 240.884 158.844 1.00 194.85 ? 190  GLU A CA 1 
ATOM 132  C CA . ARG A 1  191  ? 234.254 243.863 160.516 1.00 190.19 ? 191  ARG A CA 1 
ATOM 133  C CA . SER A 1  192  ? 233.104 247.381 159.388 1.00 232.00 ? 192  SER A CA 1 
ATOM 134  C CA . PRO A 1  206  ? 242.132 251.045 167.468 1.00 208.14 ? 206  PRO A CA 1 
ATOM 135  C CA . LEU A 1  207  ? 239.529 248.288 167.751 1.00 235.81 ? 207  LEU A CA 1 
ATOM 136  C CA . PRO A 1  208  ? 240.163 244.937 165.971 1.00 196.31 ? 208  PRO A CA 1 
ATOM 137  C CA . THR A 1  209  ? 238.531 244.097 162.543 1.00 201.32 ? 209  THR A CA 1 
ATOM 138  C CA . MET A 1  210  ? 239.356 240.378 162.262 1.00 182.14 ? 210  MET A CA 1 
ATOM 139  C CA . PHE A 1  211  ? 237.112 238.212 164.391 1.00 185.47 ? 211  PHE A CA 1 
ATOM 140  C CA . SER A 1  212  ? 236.617 234.508 164.670 1.00 166.51 ? 212  SER A CA 1 
ATOM 141  C CA . MET A 1  213  ? 234.556 231.825 166.330 1.00 174.19 ? 213  MET A CA 1 
ATOM 142  C CA . LEU A 1  214  ? 235.978 228.285 166.462 1.00 188.88 ? 214  LEU A CA 1 
ATOM 143  C CA . HIS A 1  215  ? 232.450 227.342 167.676 1.00 178.65 ? 215  HIS A CA 1 
ATOM 144  C CA . PRO A 1  216  ? 228.965 229.006 167.668 1.00 163.88 ? 216  PRO A CA 1 
ATOM 145  C CA . LEU A 1  217  ? 228.785 229.162 171.503 1.00 165.96 ? 217  LEU A CA 1 
ATOM 146  C CA . ASP A 1  218  ? 232.245 230.564 172.320 1.00 350.52 ? 218  ASP A CA 1 
ATOM 147  C CA . GLU A 1  219  ? 232.409 234.400 172.713 1.00 168.00 ? 219  GLU A CA 1 
ATOM 148  C CA . ILE A 1  220  ? 233.377 235.584 169.195 1.00 187.94 ? 220  ILE A CA 1 
ATOM 149  C CA . THR A 1  221  ? 236.928 236.842 169.460 1.00 250.06 ? 221  THR A CA 1 
ATOM 150  C CA . PRO A 1  222  ? 239.631 238.779 167.608 1.00 195.27 ? 222  PRO A CA 1 
ATOM 151  C CA . LEU A 1  223  ? 242.456 237.924 165.206 1.00 237.41 ? 223  LEU A CA 1 
ATOM 152  C CA . VAL A 1  224  ? 246.168 238.707 165.922 1.00 276.49 ? 224  VAL A CA 1 
ATOM 153  C CA . CYS A 1  225  ? 249.093 239.247 163.492 1.00 411.36 ? 225  CYS A CA 1 
ATOM 154  C CA . LYS A 1  226  ? 252.835 238.349 163.713 1.00 390.60 ? 226  LYS A CA 1 
ATOM 155  C CA . GLN A 1  237  ? 250.986 243.619 166.474 1.00 207.30 ? 237  GLN A CA 1 
ATOM 156  C CA . TYR A 1  238  ? 247.221 243.144 166.318 1.00 171.06 ? 238  TYR A CA 1 
ATOM 157  C CA . VAL A 1  239  ? 245.359 243.726 162.996 1.00 177.72 ? 239  VAL A CA 1 
ATOM 158  C CA . VAL A 1  240  ? 244.036 247.216 162.071 1.00 205.45 ? 240  VAL A CA 1 
ATOM 159  C CA . ASP A 1  241  ? 242.066 245.709 160.383 1.00 177.74 ? 241  ASP A CA 1 
ATOM 160  C CA . HIS A 1  242  ? 240.138 247.836 157.818 1.00 204.16 ? 242  HIS A CA 1 
ATOM 161  C CA . ALA A 1  243  ? 242.645 248.775 155.061 1.00 192.71 ? 243  ALA A CA 1 
ATOM 162  C CA . MET A 1  244  ? 243.545 245.069 154.991 1.00 205.30 ? 244  MET A CA 1 
ATOM 163  C CA . LYS A 1  245  ? 240.764 242.975 153.451 1.00 210.91 ? 245  LYS A CA 1 
ATOM 164  C CA . ILE A 1  246  ? 240.614 239.175 153.449 1.00 206.41 ? 246  ILE A CA 1 
ATOM 165  C CA . VAL A 1  247  ? 240.070 238.233 149.773 1.00 199.94 ? 247  VAL A CA 1 
ATOM 166  C CA . PHE A 1  248  ? 240.937 234.527 150.381 1.00 207.13 ? 248  PHE A CA 1 
ATOM 167  C CA . LEU A 1  249  ? 240.532 231.507 152.764 1.00 285.90 ? 249  LEU A CA 1 
ATOM 168  C CA . ASN A 1  250  ? 241.588 227.805 152.429 1.00 168.02 ? 250  ASN A CA 1 
ATOM 169  C CA . THR A 1  251  ? 240.781 224.613 154.273 1.00 259.63 ? 251  THR A CA 1 
ATOM 170  C CA . ASP A 1  252  ? 243.595 222.408 152.735 1.00 275.30 ? 252  ASP A CA 1 
ATOM 171  C CA . PRO A 1  253  ? 246.644 224.498 153.720 1.00 203.11 ? 253  PRO A CA 1 
ATOM 172  C CA . SER A 1  254  ? 245.690 227.249 156.168 1.00 200.87 ? 254  SER A CA 1 
ATOM 173  C CA . ILE A 1  255  ? 246.131 230.450 154.149 1.00 183.34 ? 255  ILE A CA 1 
ATOM 174  C CA . VAL A 1  256  ? 244.951 234.111 154.252 1.00 341.20 ? 256  VAL A CA 1 
ATOM 175  C CA . MET A 1  257  ? 244.864 236.586 151.330 1.00 285.43 ? 257  MET A CA 1 
ATOM 176  C CA . THR A 1  258  ? 244.881 240.375 152.030 1.00 270.12 ? 258  THR A CA 1 
ATOM 177  C CA . TYR A 1  259  ? 244.527 243.482 149.979 1.00 272.92 ? 259  TYR A CA 1 
ATOM 178  C CA . ASP A 1  260  ? 246.189 246.451 151.646 1.00 250.46 ? 260  ASP A CA 1 
ATOM 179  C CA . ALA A 1  261  ? 244.468 249.624 150.319 1.00 265.49 ? 261  ALA A CA 1 
ATOM 180  C CA . VAL A 1  262  ? 247.424 252.055 150.853 1.00 400.49 ? 262  VAL A CA 1 
ATOM 181  C CA . GLN A 1  263  ? 249.844 250.175 148.532 1.00 403.95 ? 263  GLN A CA 1 
ATOM 182  C CA . ASN A 1  264  ? 248.956 247.739 145.658 1.00 399.14 ? 264  ASN A CA 1 
ATOM 183  C CA . VAL A 1  265  ? 249.253 244.966 147.270 1.00 418.32 ? 265  VAL A CA 1 
ATOM 184  C CA . HIS A 1  266  ? 248.655 241.192 147.837 1.00 441.30 ? 266  HIS A CA 1 
ATOM 185  C CA . SER A 1  267  ? 249.800 239.384 151.035 1.00 429.89 ? 267  SER A CA 1 
ATOM 186  C CA . VAL A 1  268  ? 249.921 235.648 152.010 1.00 429.52 ? 268  VAL A CA 1 
ATOM 187  C CA . TRP A 1  269  ? 249.450 234.631 155.684 1.00 350.86 ? 269  TRP A CA 1 
ATOM 188  C CA . THR A 1  270  ? 248.412 231.418 157.543 1.00 261.09 ? 270  THR A CA 1 
ATOM 189  C CA . LEU A 1  271  ? 245.907 230.906 160.411 1.00 358.68 ? 271  LEU A CA 1 
ATOM 190  C CA . ARG A 1  272  ? 247.261 229.094 163.457 1.00 180.68 ? 272  ARG A CA 1 
ATOM 191  C CA . ARG A 1  273  ? 245.978 228.246 166.878 1.00 162.54 ? 273  ARG A CA 1 
ATOM 192  C CA . VAL A 1  274  ? 248.083 230.976 168.608 1.00 420.27 ? 274  VAL A CA 1 
ATOM 193  C CA . LYS A 1  275  ? 250.167 228.326 170.508 1.00 500.00 ? 275  LYS A CA 1 
ATOM 194  C CA . SER A 1  276  ? 252.417 230.018 173.145 1.00 500.00 ? 276  SER A CA 1 
ATOM 195  C CA . GLU A 1  277  ? 252.692 233.798 172.607 1.00 500.00 ? 277  GLU A CA 1 
ATOM 196  C CA . GLU A 1  278  ? 253.073 236.802 174.956 1.00 500.00 ? 278  GLU A CA 1 
ATOM 197  C CA . GLU A 1  279  ? 250.096 238.899 176.177 1.00 500.00 ? 279  GLU A CA 1 
ATOM 198  C CA . ASN A 1  280  ? 248.604 240.697 173.143 1.00 500.00 ? 280  ASN A CA 1 
ATOM 199  C CA . VAL A 1  281  ? 248.834 244.495 172.504 1.00 500.00 ? 281  VAL A CA 1 
ATOM 200  C CA . PRO A 1  402  ? 238.378 238.696 179.499 1.00 317.28 ? 402  PRO A CA 1 
ATOM 201  C CA . ILE A 1  403  ? 238.576 238.650 175.616 1.00 262.83 ? 403  ILE A CA 1 
ATOM 202  C CA . VAL A 1  404  ? 241.672 236.831 174.515 1.00 224.14 ? 404  VAL A CA 1 
ATOM 203  C CA . PRO A 1  405  ? 242.404 236.211 170.784 1.00 309.13 ? 405  PRO A CA 1 
ATOM 204  C CA . GLU A 1  406  ? 242.302 232.734 169.203 1.00 370.57 ? 406  GLU A CA 1 
ATOM 205  C CA . LEU A 1  407  ? 243.890 232.167 165.715 1.00 322.39 ? 407  LEU A CA 1 
ATOM 206  C CA . CYS A 1  408  ? 247.061 234.122 164.734 1.00 342.59 ? 408  CYS A CA 1 
ATOM 207  C CA . ILE A 1  409  ? 248.424 235.023 161.290 1.00 345.58 ? 409  ILE A CA 1 
ATOM 208  C CA . ASP A 1  410  ? 252.062 234.067 160.726 1.00 358.73 ? 410  ASP A CA 1 
ATOM 209  C CA . HIS A 1  411  ? 252.215 236.089 157.505 1.00 235.79 ? 411  HIS A CA 1 
ATOM 210  C CA . LEU A 1  412  ? 254.902 236.198 154.803 1.00 175.70 ? 412  LEU A CA 1 
ATOM 211  C CA . TRP A 1  413  ? 257.431 238.896 153.963 1.00 296.64 ? 413  TRP A CA 1 
ATOM 212  C CA . THR A 1  414  ? 258.098 238.220 150.279 1.00 192.79 ? 414  THR A CA 1 
ATOM 213  C CA . SER A 1  425  ? 241.707 247.231 142.687 1.00 218.21 ? 425  SER A CA 1 
ATOM 214  C CA . GLN A 1  426  ? 241.383 244.054 144.849 1.00 352.78 ? 426  GLN A CA 1 
ATOM 215  C CA . ALA A 1  427  ? 242.181 240.474 143.732 1.00 389.82 ? 427  ALA A CA 1 
ATOM 216  C CA . SER A 1  428  ? 239.003 239.087 142.154 1.00 422.01 ? 428  SER A CA 1 
ATOM 217  C CA . LYS A 1  429  ? 239.942 235.412 141.994 1.00 363.35 ? 429  LYS A CA 1 
ATOM 218  C CA . VAL A 1  430  ? 241.838 233.583 144.711 1.00 214.07 ? 430  VAL A CA 1 
ATOM 219  C CA . PHE A 1  431  ? 242.452 229.868 144.288 1.00 178.60 ? 431  PHE A CA 1 
ATOM 220  C CA . ILE A 1  432  ? 245.127 227.222 144.691 1.00 172.94 ? 432  ILE A CA 1 
ATOM 221  C CA . THR A 1  433  ? 245.915 224.745 141.905 1.00 201.22 ? 433  THR A CA 1 
ATOM 222  C CA . SER A 1  434  ? 248.366 221.956 141.543 1.00 230.58 ? 434  SER A CA 1 
ATOM 223  C CA . ASP A 1  435  ? 249.483 221.093 138.027 1.00 242.18 ? 435  ASP A CA 1 
ATOM 224  C CA . LEU A 1  436  ? 249.575 217.408 136.832 1.00 265.10 ? 436  LEU A CA 1 
ATOM 225  C CA . CYS A 1  437  ? 252.919 217.097 138.737 1.00 266.90 ? 437  CYS A CA 1 
ATOM 226  C CA . GLY A 1  438  ? 253.259 217.983 142.416 1.00 244.68 ? 438  GLY A CA 1 
ATOM 227  C CA . GLN A 1  439  ? 253.606 221.779 142.238 1.00 256.59 ? 439  GLN A CA 1 
ATOM 228  C CA . LYS A 1  440  ? 251.414 224.526 143.752 1.00 219.15 ? 440  LYS A CA 1 
ATOM 229  C CA . PHE A 1  441  ? 250.055 227.649 142.073 1.00 185.51 ? 441  PHE A CA 1 
ATOM 230  C CA . LEU A 1  442  ? 248.009 229.812 144.342 1.00 190.24 ? 442  LEU A CA 1 
ATOM 231  C CA . CYS A 1  443  ? 246.945 232.484 141.871 1.00 369.46 ? 443  CYS A CA 1 
ATOM 232  C CA . PHE A 1  444  ? 245.851 236.114 142.171 1.00 409.16 ? 444  PHE A CA 1 
ATOM 233  C CA . LEU A 1  445  ? 243.569 237.555 139.481 1.00 460.94 ? 445  LEU A CA 1 
ATOM 234  C CA . VAL A 1  446  ? 243.328 241.374 139.333 1.00 471.98 ? 446  VAL A CA 1 
ATOM 235  C CA . GLU A 1  447  ? 240.362 243.104 137.634 1.00 500.00 ? 447  GLU A CA 1 
ATOM 236  C CA . SER A 1  448  ? 242.099 246.503 137.202 1.00 500.00 ? 448  SER A CA 1 
ATOM 237  C CA . GLN A 1  449  ? 245.621 245.431 136.075 1.00 500.00 ? 449  GLN A CA 1 
ATOM 238  C CA . LEU A 1  450  ? 243.724 242.726 134.061 1.00 500.00 ? 450  LEU A CA 1 
ATOM 239  C CA . GLN A 1  451  ? 246.481 240.071 134.567 1.00 500.00 ? 451  GLN A CA 1 
ATOM 240  C CA . LEU A 1  452  ? 246.541 236.950 136.833 1.00 500.00 ? 452  LEU A CA 1 
ATOM 241  C CA . ARG A 1  453  ? 249.772 236.230 138.770 1.00 500.00 ? 453  ARG A CA 1 
ATOM 242  C CA . CYS A 1  454  ? 250.811 232.611 139.363 1.00 454.89 ? 454  CYS A CA 1 
ATOM 243  C CA . VAL A 1  455  ? 253.076 232.200 142.426 1.00 237.35 ? 455  VAL A CA 1 
ATOM 244  C CA . LYS A 1  456  ? 254.935 228.887 142.753 1.00 203.99 ? 456  LYS A CA 1 
ATOM 245  C CA . PHE A 1  457  ? 254.279 227.335 146.242 1.00 215.53 ? 457  PHE A CA 1 
ATOM 246  C CA . GLN A 1  458  ? 255.719 224.437 148.326 1.00 209.55 ? 458  GLN A CA 1 
ATOM 247  C CA . GLU A 1  459  ? 255.445 222.831 151.787 1.00 237.89 ? 459  GLU A CA 1 
ATOM 248  C CA . SER A 1  460  ? 258.490 222.300 154.089 1.00 349.68 ? 460  SER A CA 1 
ATOM 249  C CA . THR A 1  464  ? 255.298 221.326 157.405 1.00 286.13 ? 464  THR A CA 1 
ATOM 250  C CA . GLN A 1  465  ? 255.924 225.059 156.632 1.00 298.95 ? 465  GLN A CA 1 
ATOM 251  C CA . LEU A 1  466  ? 255.525 227.202 153.402 1.00 262.36 ? 466  LEU A CA 1 
ATOM 252  C CA . ILE A 1  467  ? 257.848 228.708 150.684 1.00 218.25 ? 467  ILE A CA 1 
ATOM 253  C CA . PHE A 1  468  ? 257.319 230.836 147.542 1.00 230.15 ? 468  PHE A CA 1 
ATOM 254  C CA . GLY A 1  469  ? 258.381 230.534 143.926 1.00 252.59 ? 469  GLY A CA 1 
ATOM 255  C CA . SER A 1  470  ? 258.864 233.097 141.169 1.00 259.49 ? 470  SER A CA 1 
ATOM 256  C CA . VAL A 1  471  ? 255.675 234.311 139.484 1.00 404.61 ? 471  VAL A CA 1 
ATOM 257  C CA . THR A 1  472  ? 254.639 234.013 135.820 1.00 401.54 ? 472  THR A CA 1 
ATOM 258  C CA . ASN A 1  473  ? 252.416 236.711 134.226 1.00 496.92 ? 473  ASN A CA 1 
ATOM 259  C CA . ILE A 1  474  ? 249.433 235.752 132.037 1.00 500.00 ? 474  ILE A CA 1 
ATOM 260  C CA . PRO A 1  475  ? 247.391 238.684 130.503 1.00 500.00 ? 475  PRO A CA 1 
ATOM 261  C CA . ALA A 1  476  ? 243.619 237.961 129.993 1.00 500.00 ? 476  ALA A CA 1 
ATOM 262  C CA . LYS A 1  477  ? 241.106 237.854 131.837 1.00 500.00 ? 477  LYS A CA 1 
ATOM 263  C CA . ASP A 1  478  ? 239.059 235.872 134.456 1.00 500.00 ? 478  ASP A CA 1 
ATOM 264  C CA . ALA A 1  479  ? 240.488 232.593 135.847 1.00 425.46 ? 479  ALA A CA 1 
ATOM 265  C CA . ALA A 1  480  ? 239.514 229.407 137.777 1.00 390.57 ? 480  ALA A CA 1 
ATOM 266  C CA . PRO A 1  481  ? 241.234 226.015 138.483 1.00 218.16 ? 481  PRO A CA 1 
ATOM 267  C CA . VAL A 1  482  ? 239.913 222.486 138.084 1.00 229.65 ? 482  VAL A CA 1 
ATOM 268  C CA . GLU A 1  483  ? 240.331 219.863 140.862 1.00 236.55 ? 483  GLU A CA 1 
ATOM 269  C CA . LYS A 1  484  ? 240.055 216.470 139.051 1.00 207.32 ? 484  LYS A CA 1 
ATOM 270  C CA . ILE A 1  485  ? 242.613 216.943 136.227 1.00 191.11 ? 485  ILE A CA 1 
ATOM 271  C CA . ASP A 1  486  ? 244.399 219.601 138.338 1.00 256.94 ? 486  ASP A CA 1 
ATOM 272  C CA . THR A 1  487  ? 244.624 222.146 135.453 1.00 367.21 ? 487  THR A CA 1 
ATOM 273  C CA . MET A 1  488  ? 243.704 225.908 135.578 1.00 408.45 ? 488  MET A CA 1 
ATOM 274  C CA . LEU A 1  489  ? 241.426 227.682 132.970 1.00 284.29 ? 489  LEU A CA 1 
ATOM 275  C CA . VAL A 1  490  ? 241.471 231.249 131.664 1.00 433.70 ? 490  VAL A CA 1 
ATOM 276  C CA . LEU A 1  491  ? 239.730 233.083 128.773 1.00 495.64 ? 491  LEU A CA 1 
ATOM 277  C CA . GLU A 1  492  ? 242.219 234.956 126.536 1.00 500.00 ? 492  GLU A CA 1 
ATOM 278  C CA . GLY A 1  493  ? 241.225 237.977 124.407 1.00 500.00 ? 493  GLY A CA 1 
ATOM 279  C CA . SER A 1  494  ? 237.646 237.762 123.118 1.00 500.00 ? 494  SER A CA 1 
ATOM 280  C CA . GLY A 1  495  ? 235.776 234.447 123.542 1.00 500.00 ? 495  GLY A CA 1 
ATOM 281  C CA . ASN A 1  496  ? 238.871 232.212 123.322 1.00 500.00 ? 496  ASN A CA 1 
ATOM 282  C CA . LEU A 1  497  ? 238.868 229.950 126.416 1.00 500.00 ? 497  LEU A CA 1 
ATOM 283  C CA . VAL A 1  498  ? 242.204 228.176 127.129 1.00 486.03 ? 498  VAL A CA 1 
ATOM 284  C CA . LEU A 1  499  ? 243.681 225.663 129.628 1.00 387.01 ? 499  LEU A CA 1 
ATOM 285  C CA . TYR A 1  500  ? 246.968 225.832 131.576 1.00 498.84 ? 500  TYR A CA 1 
ATOM 286  C CA . THR A 1  501  ? 248.468 222.801 133.434 1.00 500.00 ? 501  THR A CA 1 
ATOM 287  C CA . GLY A 1  502  ? 250.382 225.276 135.605 1.00 500.00 ? 502  GLY A CA 1 
ATOM 288  C CA . VAL A 1  503  ? 252.476 227.813 133.680 1.00 500.00 ? 503  VAL A CA 1 
ATOM 289  C CA . VAL A 1  504  ? 252.218 226.102 130.258 1.00 500.00 ? 504  VAL A CA 1 
ATOM 290  C CA . ARG A 1  505  ? 249.529 226.193 127.525 1.00 500.00 ? 505  ARG A CA 1 
ATOM 291  C CA . VAL A 1  506  ? 247.485 222.989 126.995 1.00 485.62 ? 506  VAL A CA 1 
ATOM 292  C CA . GLY A 1  507  ? 245.243 224.309 124.183 1.00 441.47 ? 507  GLY A CA 1 
ATOM 293  C CA . LYS A 1  508  ? 241.946 225.954 123.257 1.00 394.00 ? 508  LYS A CA 1 
ATOM 294  C CA . VAL A 1  509  ? 238.933 224.194 124.868 1.00 344.77 ? 509  VAL A CA 1 
ATOM 295  C CA . PHE A 1  510  ? 235.923 224.043 122.505 1.00 500.00 ? 510  PHE A CA 1 
ATOM 296  C CA . ILE A 1  511  ? 232.166 224.001 123.183 1.00 500.00 ? 511  ILE A CA 1 
ATOM 297  C CA . PRO A 1  512  ? 229.784 222.310 120.649 1.00 500.00 ? 512  PRO A CA 1 
ATOM 298  C CA . GLY A 1  581  ? 226.840 224.642 121.527 1.00 500.00 ? 581  GLY A CA 1 
ATOM 299  C CA . THR A 1  582  ? 232.036 238.444 123.547 1.00 500.00 ? 582  THR A CA 1 
ATOM 300  C CA . TYR A 1  583  ? 231.049 235.565 123.297 1.00 500.00 ? 583  TYR A CA 1 
ATOM 301  C CA . ILE A 1  584  ? 231.478 233.681 126.627 1.00 500.00 ? 584  ILE A CA 1 
ATOM 302  C CA . HIS A 1  585  ? 231.690 236.453 129.361 1.00 500.00 ? 585  HIS A CA 1 
ATOM 303  C CA . SER A 1  586  ? 233.238 234.633 132.423 1.00 500.00 ? 586  SER A CA 1 
ATOM 304  C CA . ILE A 1  587  ? 234.180 231.351 134.133 1.00 500.00 ? 587  ILE A CA 1 
ATOM 305  C CA . ARG A 1  588  ? 232.476 230.611 137.512 1.00 461.48 ? 588  ARG A CA 1 
ATOM 306  C CA . ASP A 1  589  ? 231.902 227.950 140.268 1.00 348.43 ? 589  ASP A CA 1 
ATOM 307  C CA . PRO A 1  590  ? 234.476 225.124 139.788 1.00 207.40 ? 590  PRO A CA 1 
ATOM 308  C CA . VAL A 1  591  ? 233.900 221.586 141.326 1.00 169.30 ? 591  VAL A CA 1 
ATOM 309  C CA . HIS A 1  592  ? 235.760 218.304 140.662 1.00 179.51 ? 592  HIS A CA 1 
ATOM 310  C CA . ASN A 1  593  ? 236.257 218.479 136.827 1.00 179.58 ? 593  ASN A CA 1 
ATOM 311  C CA . ARG A 1  594  ? 233.178 220.691 136.288 1.00 223.96 ? 594  ARG A CA 1 
ATOM 312  C CA . VAL A 1  595  ? 233.322 224.380 135.593 1.00 196.51 ? 595  VAL A CA 1 
ATOM 313  C CA . THR A 1  596  ? 230.439 226.784 134.753 1.00 366.56 ? 596  THR A CA 1 
ATOM 314  C CA . LEU A 1  597  ? 230.520 229.575 132.146 1.00 438.08 ? 597  LEU A CA 1 
ATOM 315  C CA . GLU A 1  598  ? 228.255 232.624 132.049 1.00 500.00 ? 598  GLU A CA 1 
ATOM 316  C CA . LEU A 1  599  ? 227.742 233.649 128.400 1.00 500.00 ? 599  LEU A CA 1 
ATOM 317  C CA . SER A 1  600  ? 226.852 237.105 126.971 1.00 500.00 ? 600  SER A CA 1 
ATOM 318  C CA . ASN A 1  601  ? 223.406 235.562 126.309 1.00 500.00 ? 601  ASN A CA 1 
ATOM 319  C CA . GLY A 1  602  ? 222.980 235.259 130.100 1.00 500.00 ? 602  GLY A CA 1 
ATOM 320  C CA . SER A 1  603  ? 222.561 231.469 129.943 1.00 500.00 ? 603  SER A CA 1 
ATOM 321  C CA . MET A 1  604  ? 224.930 229.342 132.053 1.00 471.28 ? 604  MET A CA 1 
ATOM 322  C CA . VAL A 1  605  ? 226.375 226.029 130.781 1.00 397.12 ? 605  VAL A CA 1 
ATOM 323  C CA . ARG A 1  606  ? 228.578 223.477 132.607 1.00 315.41 ? 606  ARG A CA 1 
ATOM 324  C CA . ILE A 1  607  ? 231.792 222.283 130.982 1.00 252.50 ? 607  ILE A CA 1 
ATOM 325  C CA . THR A 1  608  ? 233.832 219.305 132.047 1.00 165.57 ? 608  THR A CA 1 
ATOM 326  C CA . ILE A 1  609  ? 237.342 219.130 130.741 1.00 168.15 ? 609  ILE A CA 1 
ATOM 327  C CA . PRO A 1  610  ? 238.523 215.524 129.959 1.00 201.00 ? 610  PRO A CA 1 
ATOM 328  C CA . GLU A 1  611  ? 240.772 213.824 132.589 1.00 228.40 ? 611  GLU A CA 1 
ATOM 329  C CA . ILE A 1  612  ? 244.263 212.878 131.357 1.00 185.96 ? 612  ILE A CA 1 
ATOM 330  C CA . ALA A 1  613  ? 243.993 209.065 131.124 1.00 176.05 ? 613  ALA A CA 1 
ATOM 331  C CA . THR A 1  614  ? 240.750 206.990 131.549 1.00 217.63 ? 614  THR A CA 1 
ATOM 332  C CA . SER A 1  615  ? 242.539 203.587 131.472 1.00 214.95 ? 615  SER A CA 1 
ATOM 333  C CA . GLU A 1  616  ? 244.809 202.151 134.140 1.00 197.74 ? 616  GLU A CA 1 
ATOM 334  C CA . LEU A 1  617  ? 247.864 201.104 131.996 1.00 160.28 ? 617  LEU A CA 1 
ATOM 335  C CA . VAL A 1  618  ? 247.565 204.499 130.292 1.00 158.13 ? 618  VAL A CA 1 
ATOM 336  C CA . GLN A 1  619  ? 247.314 206.229 133.740 1.00 171.03 ? 619  GLN A CA 1 
ATOM 337  C CA . THR A 1  620  ? 250.201 204.371 135.349 1.00 192.53 ? 620  THR A CA 1 
ATOM 338  C CA . CYS A 1  621  ? 252.424 204.987 132.308 1.00 160.95 ? 621  CYS A CA 1 
ATOM 339  C CA . LEU A 1  622  ? 251.699 208.685 132.514 1.00 175.70 ? 622  LEU A CA 1 
ATOM 340  C CA . GLN A 1  623  ? 252.684 208.790 136.195 1.00 281.55 ? 623  GLN A CA 1 
ATOM 341  C CA . ALA A 1  624  ? 255.993 206.956 135.446 1.00 425.67 ? 624  ALA A CA 1 
ATOM 342  C CA . ILE A 1  625  ? 256.982 208.924 132.277 1.00 402.56 ? 625  ILE A CA 1 
ATOM 343  C CA . LYS A 1  626  ? 256.486 212.264 134.125 1.00 326.32 ? 626  LYS A CA 1 
ATOM 344  C CA . PHE A 1  627  ? 258.482 210.944 137.162 1.00 197.72 ? 627  PHE A CA 1 
ATOM 345  C CA . ILE A 1  628  ? 261.771 210.181 135.332 1.00 195.25 ? 628  ILE A CA 1 
ATOM 346  C CA . LEU A 1  629  ? 262.528 213.200 133.064 1.00 223.91 ? 629  LEU A CA 1 
ATOM 347  C CA . PRO A 1  630  ? 262.584 216.813 134.449 1.00 246.75 ? 630  PRO A CA 1 
ATOM 348  C CA . LYS A 1  631  ? 259.799 219.447 134.268 1.00 251.37 ? 631  LYS A CA 1 
ATOM 349  C CA . GLU A 1  632  ? 260.815 221.020 130.920 1.00 232.71 ? 632  GLU A CA 1 
ATOM 350  C CA . ILE A 1  633  ? 260.307 217.915 128.773 1.00 219.83 ? 633  ILE A CA 1 
ATOM 351  C CA . ALA A 1  634  ? 257.126 216.815 130.598 1.00 289.45 ? 634  ALA A CA 1 
ATOM 352  C CA . VAL A 1  635  ? 255.680 220.113 129.337 1.00 203.24 ? 635  VAL A CA 1 
ATOM 353  C CA . GLN A 1  636  ? 256.120 219.093 125.760 1.00 211.67 ? 636  GLN A CA 1 
ATOM 354  C CA . MET A 1  637  ? 255.269 215.376 126.238 1.00 292.97 ? 637  MET A CA 1 
ATOM 355  C CA . LEU A 1  638  ? 251.936 215.538 128.147 1.00 296.89 ? 638  LEU A CA 1 
ATOM 356  C CA . VAL A 1  639  ? 250.477 218.487 126.208 1.00 256.08 ? 639  VAL A CA 1 
ATOM 357  C CA . LYS A 1  640  ? 251.321 216.665 123.003 1.00 228.31 ? 640  LYS A CA 1 
ATOM 358  C CA . TRP A 1  641  ? 249.303 213.663 124.052 1.00 270.69 ? 641  TRP A CA 1 
ATOM 359  C CA . TYR A 1  642  ? 246.563 215.538 125.933 1.00 255.64 ? 642  TYR A CA 1 
ATOM 360  C CA . ASN A 1  643  ? 245.628 217.317 122.701 1.00 255.11 ? 643  ASN A CA 1 
ATOM 361  C CA . VAL A 1  644  ? 245.402 213.939 120.862 1.00 247.04 ? 644  VAL A CA 1 
ATOM 362  C CA . HIS A 1  645  ? 243.674 212.141 123.807 1.00 244.30 ? 645  HIS A CA 1 
ATOM 363  C CA . SER A 1  646  ? 240.550 214.346 123.532 1.00 300.93 ? 646  SER A CA 1 
ATOM 364  C CA . ALA A 1  647  ? 240.401 213.043 119.895 1.00 392.43 ? 647  ALA A CA 1 
ATOM 365  C CA . PRO A 1  648  ? 238.059 215.456 118.101 1.00 485.77 ? 648  PRO A CA 1 
ATOM 366  C CA . GLY A 1  649  ? 239.816 214.731 114.784 1.00 451.88 ? 649  GLY A CA 1 
ATOM 367  C CA . GLY A 1  650  ? 238.451 212.846 111.774 1.00 455.49 ? 650  GLY A CA 1 
ATOM 368  C CA . PRO A 1  651  ? 236.757 209.525 112.506 1.00 378.54 ? 651  PRO A CA 1 
ATOM 369  C CA . SER A 1  652  ? 238.854 208.686 115.638 1.00 303.15 ? 652  SER A CA 1 
ATOM 370  C CA . TYR A 1  653  ? 238.187 204.879 115.279 1.00 442.96 ? 653  TYR A CA 1 
ATOM 371  C CA . HIS A 1  654  ? 240.722 203.598 117.880 1.00 287.36 ? 654  HIS A CA 1 
ATOM 372  C CA . SER A 1  655  ? 241.053 202.969 121.685 1.00 240.32 ? 655  SER A CA 1 
ATOM 373  C CA . GLU A 1  656  ? 242.784 204.847 124.571 1.00 226.96 ? 656  GLU A CA 1 
ATOM 374  C CA . TRP A 1  657  ? 245.968 202.754 124.508 1.00 189.71 ? 657  TRP A CA 1 
ATOM 375  C CA . ASN A 1  658  ? 245.711 202.211 120.722 1.00 237.59 ? 658  ASN A CA 1 
ATOM 376  C CA . LEU A 1  659  ? 246.051 205.989 120.706 1.00 194.83 ? 659  LEU A CA 1 
ATOM 377  C CA . PHE A 1  660  ? 248.508 206.246 123.627 1.00 181.85 ? 660  PHE A CA 1 
ATOM 378  C CA . VAL A 1  661  ? 250.823 204.027 121.545 1.00 199.56 ? 661  VAL A CA 1 
ATOM 379  C CA . THR A 1  662  ? 250.706 206.411 118.557 1.00 178.69 ? 662  THR A CA 1 
ATOM 380  C CA . CYS A 1  663  ? 251.310 209.072 121.223 1.00 223.47 ? 663  CYS A CA 1 
ATOM 381  C CA . LEU A 1  664  ? 254.585 207.490 122.329 1.00 197.02 ? 664  LEU A CA 1 
ATOM 382  C CA . MET A 1  665  ? 255.342 206.378 118.755 1.00 237.20 ? 665  MET A CA 1 
ATOM 383  C CA . ASN A 1  666  ? 255.808 210.057 117.764 1.00 213.79 ? 666  ASN A CA 1 
ATOM 384  C CA . MET A 1  667  ? 257.330 210.829 121.171 1.00 289.40 ? 667  MET A CA 1 
ATOM 385  C CA . MET A 1  668  ? 260.825 209.922 119.950 1.00 274.38 ? 668  MET A CA 1 
ATOM 386  C CA . GLY A 1  669  ? 260.088 208.686 116.392 1.00 263.57 ? 669  GLY A CA 1 
ATOM 387  C CA . TYR A 1  670  ? 258.418 206.302 113.860 1.00 205.02 ? 670  TYR A CA 1 
ATOM 388  C CA . ASN A 1  671  ? 256.177 206.742 110.740 1.00 253.56 ? 671  ASN A CA 1 
ATOM 389  C CA . THR A 1  757  ? 265.841 212.335 122.755 1.00 239.85 ? 757  THR A CA 1 
ATOM 390  C CA . HIS A 1  758  ? 265.348 210.445 126.008 1.00 236.59 ? 758  HIS A CA 1 
ATOM 391  C CA . ILE A 1  759  ? 264.294 206.781 125.045 1.00 182.80 ? 759  ILE A CA 1 
ATOM 392  C CA . PRO A 1  760  ? 266.908 205.040 127.309 1.00 204.33 ? 760  PRO A CA 1 
ATOM 393  C CA . ALA A 1  761  ? 265.118 206.965 130.148 1.00 306.58 ? 761  ALA A CA 1 
ATOM 394  C CA . ILE A 1  762  ? 261.498 206.132 129.080 1.00 283.71 ? 762  ILE A CA 1 
ATOM 395  C CA . PHE A 1  763  ? 261.596 202.441 128.154 1.00 202.11 ? 763  PHE A CA 1 
ATOM 396  C CA . PHE A 1  764  ? 263.290 201.277 131.442 1.00 357.48 ? 764  PHE A CA 1 
ATOM 397  C CA . VAL A 1  765  ? 260.742 203.089 133.620 1.00 280.84 ? 765  VAL A CA 1 
ATOM 398  C CA . LEU A 1  766  ? 258.145 201.709 131.208 1.00 172.84 ? 766  LEU A CA 1 
ATOM 399  C CA . HIS A 1  767  ? 259.624 198.225 131.656 1.00 263.67 ? 767  HIS A CA 1 
ATOM 400  C CA . LEU A 1  768  ? 259.358 198.816 135.450 1.00 377.82 ? 768  LEU A CA 1 
ATOM 401  C CA . VAL A 1  769  ? 255.632 199.591 134.882 1.00 313.19 ? 769  VAL A CA 1 
ATOM 402  C CA . TYR A 1  770  ? 255.259 196.127 133.220 1.00 189.07 ? 770  TYR A CA 1 
ATOM 403  C CA . GLU A 1  771  ? 256.832 194.559 136.310 1.00 250.56 ? 771  GLU A CA 1 
ATOM 404  C CA . GLU A 1  772  ? 254.542 196.526 138.607 1.00 192.13 ? 772  GLU A CA 1 
ATOM 405  C CA . LEU A 1  773  ? 251.458 195.481 136.502 1.00 201.88 ? 773  LEU A CA 1 
ATOM 406  C CA . LYS A 1  774  ? 252.633 191.880 136.440 1.00 198.15 ? 774  LYS A CA 1 
ATOM 407  C CA . LEU A 1  775  ? 251.835 191.977 140.141 1.00 225.97 ? 775  LEU A CA 1 
ATOM 408  C CA . ASN A 1  776  ? 248.304 193.530 139.910 1.00 211.59 ? 776  ASN A CA 1 
ATOM 409  C CA . THR A 1  777  ? 246.386 190.713 138.124 1.00 154.77 ? 777  THR A CA 1 
ATOM 410  C CA . LEU A 1  778  ? 243.564 192.949 137.121 1.00 186.77 ? 778  LEU A CA 1 
ATOM 411  C CA . MET A 1  779  ? 245.691 194.254 134.304 1.00 199.57 ? 779  MET A CA 1 
ATOM 412  C CA . GLY A 1  780  ? 244.674 191.141 132.335 1.00 282.75 ? 780  GLY A CA 1 
ATOM 413  C CA . GLU A 1  781  ? 245.226 191.593 128.574 1.00 319.74 ? 781  GLU A CA 1 
ATOM 414  C CA . GLY A 1  782  ? 246.276 195.162 129.454 1.00 250.75 ? 782  GLY A CA 1 
ATOM 415  C CA . ILE A 1  783  ? 249.741 193.960 130.398 1.00 203.70 ? 783  ILE A CA 1 
ATOM 416  C CA . CYS A 1  784  ? 249.747 192.015 127.111 1.00 226.49 ? 784  CYS A CA 1 
ATOM 417  C CA . SER A 1  785  ? 249.162 195.166 125.036 1.00 199.90 ? 785  SER A CA 1 
ATOM 418  C CA . LEU A 1  786  ? 251.905 197.035 126.993 1.00 151.08 ? 786  LEU A CA 1 
ATOM 419  C CA . VAL A 1  787  ? 254.235 194.120 126.114 1.00 218.11 ? 787  VAL A CA 1 
ATOM 420  C CA . GLU A 1  788  ? 253.554 194.850 122.446 1.00 236.30 ? 788  GLU A CA 1 
ATOM 421  C CA . LEU A 1  789  ? 254.705 198.572 123.113 1.00 241.32 ? 789  LEU A CA 1 
ATOM 422  C CA . LEU A 1  790  ? 257.786 197.258 124.852 1.00 157.73 ? 790  LEU A CA 1 
ATOM 423  C CA . VAL A 1  791  ? 258.811 195.410 121.563 1.00 139.42 ? 791  VAL A CA 1 
ATOM 424  C CA . GLN A 1  792  ? 258.219 197.748 118.660 1.00 232.35 ? 792  GLN A CA 1 
ATOM 425  C CA . LEU A 1  793  ? 261.118 199.454 120.615 1.00 237.01 ? 793  LEU A CA 1 
ATOM 426  C CA . ALA A 1  794  ? 263.335 199.023 122.615 1.00 207.64 ? 794  ALA A CA 1 
ATOM 427  C CA . ARG A 1  795  ? 264.118 195.789 120.614 1.00 262.31 ? 795  ARG A CA 1 
ATOM 428  C CA . ASP A 1  796  ? 265.099 198.253 117.847 1.00 263.38 ? 796  ASP A CA 1 
ATOM 429  C CA . LEU A 1  797  ? 267.182 200.284 120.442 1.00 194.71 ? 797  LEU A CA 1 
ATOM 430  C CA . LYS A 1  798  ? 269.161 196.935 120.697 1.00 271.25 ? 798  LYS A CA 1 
ATOM 431  C CA . LEU A 1  799  ? 269.714 195.960 124.326 1.00 253.91 ? 799  LEU A CA 1 
ATOM 432  C CA . GLY A 1  800  ? 269.050 192.212 123.831 1.00 319.18 ? 800  GLY A CA 1 
ATOM 433  C CA . PRO A 1  801  ? 268.538 190.625 127.348 1.00 462.42 ? 801  PRO A CA 1 
ATOM 434  C CA . TYR A 1  802  ? 265.235 192.567 127.663 1.00 433.20 ? 802  TYR A CA 1 
ATOM 435  C CA . VAL A 1  803  ? 263.904 191.090 124.344 1.00 303.22 ? 803  VAL A CA 1 
ATOM 436  C CA . ASP A 1  804  ? 264.283 187.377 125.276 1.00 419.55 ? 804  ASP A CA 1 
ATOM 437  C CA . HIS A 1  805  ? 262.853 187.999 128.786 1.00 366.39 ? 805  HIS A CA 1 
ATOM 438  C CA . TYR A 1  806  ? 259.563 189.148 127.265 1.00 204.30 ? 806  TYR A CA 1 
ATOM 439  C CA . TYR A 1  807  ? 259.815 186.079 125.003 1.00 238.30 ? 807  TYR A CA 1 
ATOM 440  C CA . ARG A 1  808  ? 260.059 183.991 128.190 1.00 262.15 ? 808  ARG A CA 1 
ATOM 441  C CA . ASP A 1  809  ? 256.785 185.266 129.630 1.00 238.20 ? 809  ASP A CA 1 
ATOM 442  C CA . TYR A 1  810  ? 254.915 186.052 126.414 1.00 234.97 ? 810  TYR A CA 1 
ATOM 443  C CA . PRO A 1  811  ? 255.760 183.432 123.756 1.00 238.37 ? 811  PRO A CA 1 
ATOM 444  C CA . THR A 1  812  ? 253.821 185.019 120.852 1.00 223.99 ? 812  THR A CA 1 
ATOM 445  C CA . LEU A 1  813  ? 254.523 188.797 120.452 1.00 260.08 ? 813  LEU A CA 1 
ATOM 446  C CA . VAL A 1  814  ? 258.200 187.702 120.183 1.00 273.63 ? 814  VAL A CA 1 
ATOM 447  C CA . PHE A 1  837  ? 271.618 205.682 133.027 1.00 195.41 ? 837  PHE A CA 1 
ATOM 448  C CA . THR A 1  838  ? 269.857 202.290 132.946 1.00 443.40 ? 838  THR A CA 1 
ATOM 449  C CA . SER A 1  839  ? 270.506 198.773 134.374 1.00 500.00 ? 839  SER A CA 1 
ATOM 450  C CA . GLU A 1  840  ? 270.338 195.037 133.440 1.00 500.00 ? 840  GLU A CA 1 
ATOM 451  C CA . PRO A 1  841  ? 266.739 193.687 133.088 1.00 500.00 ? 841  PRO A CA 1 
ATOM 452  C CA . PRO A 1  842  ? 264.855 193.643 136.453 1.00 500.00 ? 842  PRO A CA 1 
ATOM 453  C CA . SER A 1  843  ? 262.287 190.835 136.865 1.00 500.00 ? 843  SER A CA 1 
ATOM 454  C CA . ILE A 1  844  ? 260.301 190.642 140.130 1.00 500.00 ? 844  ILE A CA 1 
ATOM 455  C CA . TYR A 1  845  ? 259.714 186.911 139.438 1.00 427.32 ? 845  TYR A CA 1 
ATOM 456  C CA . GLN A 1  846  ? 263.444 186.185 138.960 1.00 498.62 ? 846  GLN A CA 1 
ATOM 457  C CA . TRP A 1  847  ? 264.175 188.315 142.066 1.00 500.00 ? 847  TRP A CA 1 
ATOM 458  C CA . VAL A 1  848  ? 261.865 186.202 144.307 1.00 500.00 ? 848  VAL A CA 1 
ATOM 459  C CA . SER A 1  849  ? 263.082 182.754 143.079 1.00 500.00 ? 849  SER A CA 1 
ATOM 460  C CA . SER A 1  850  ? 266.790 183.685 143.396 1.00 453.95 ? 850  SER A CA 1 
ATOM 461  C CA . CYS A 1  851  ? 266.102 185.353 146.798 1.00 466.98 ? 851  CYS A CA 1 
ATOM 462  C CA . LEU A 1  852  ? 264.481 182.281 148.412 1.00 288.88 ? 852  LEU A CA 1 
ATOM 463  C CA . LYS A 1  853  ? 267.163 179.902 147.188 1.00 253.70 ? 853  LYS A CA 1 
ATOM 464  C CA . GLY A 1  854  ? 270.297 182.084 147.653 1.00 223.14 ? 854  GLY A CA 1 
ATOM 465  C CA . GLU A 1  855  ? 270.598 185.161 149.891 1.00 365.41 ? 855  GLU A CA 1 
ATOM 466  C CA . GLY A 1  856  ? 270.356 188.742 148.549 1.00 500.00 ? 856  GLY A CA 1 
ATOM 467  C CA . MET A 1  857  ? 271.433 189.107 144.868 1.00 500.00 ? 857  MET A CA 1 
ATOM 468  C CA . PRO A 1  858  ? 269.841 192.412 143.699 1.00 500.00 ? 858  PRO A CA 1 
ATOM 469  C CA . PRO A 1  859  ? 268.892 195.233 146.176 1.00 500.00 ? 859  PRO A CA 1 
ATOM 470  C CA . TYR A 1  860  ? 266.120 196.360 143.700 1.00 500.00 ? 860  TYR A CA 1 
ATOM 471  C CA . PRO A 1  861  ? 264.867 199.635 142.129 1.00 500.00 ? 861  PRO A CA 1 
ATOM 472  C CA . TYR A 1  862  ? 261.393 200.726 143.326 1.00 500.00 ? 862  TYR A CA 1 
ATOM 473  C CA . LEU A 1  863  ? 259.732 204.067 142.505 1.00 500.00 ? 863  LEU A CA 1 
ATOM 474  C CA . PRO A 1  864  ? 257.927 205.515 145.592 1.00 500.00 ? 864  PRO A CA 1 
ATOM 475  C CA . GLY A 1  865  ? 254.651 206.879 144.141 1.00 346.54 ? 865  GLY A CA 1 
ATOM 476  C CA . ILE A 1  866  ? 253.495 204.453 141.454 1.00 420.43 ? 866  ILE A CA 1 
ATOM 477  C CA . CYS A 1  867  ? 255.265 201.181 142.322 1.00 442.35 ? 867  CYS A CA 1 
ATOM 478  C CA . GLU A 1  868  ? 253.307 201.125 145.603 1.00 236.67 ? 868  GLU A CA 1 
ATOM 479  C CA . ARG A 1  869  ? 251.763 197.675 145.033 1.00 258.11 ? 869  ARG A CA 1 
ATOM 480  C CA . SER A 1  870  ? 255.336 196.499 144.121 1.00 439.39 ? 870  SER A CA 1 
ATOM 481  C CA . ARG A 1  871  ? 257.002 198.230 147.133 1.00 458.31 ? 871  ARG A CA 1 
ATOM 482  C CA . LEU A 1  872  ? 254.534 196.288 149.316 1.00 500.00 ? 872  LEU A CA 1 
ATOM 483  C CA . VAL A 1  873  ? 255.657 192.855 148.014 1.00 500.00 ? 873  VAL A CA 1 
ATOM 484  C CA . VAL A 1  874  ? 259.445 193.549 148.045 1.00 500.00 ? 874  VAL A CA 1 
ATOM 485  C CA . LEU A 1  875  ? 259.327 194.808 151.670 1.00 500.00 ? 875  LEU A CA 1 
ATOM 486  C CA . SER A 1  876  ? 256.867 192.024 152.650 1.00 500.00 ? 876  SER A CA 1 
ATOM 487  C CA . ILE A 1  877  ? 259.287 189.306 151.384 1.00 500.00 ? 877  ILE A CA 1 
ATOM 488  C CA . ALA A 1  878  ? 262.215 191.128 153.081 1.00 500.00 ? 878  ALA A CA 1 
ATOM 489  C CA . LEU A 1  879  ? 260.394 191.191 156.468 1.00 500.00 ? 879  LEU A CA 1 
ATOM 490  C CA . TYR A 1  880  ? 259.298 187.518 156.247 1.00 500.00 ? 880  TYR A CA 1 
ATOM 491  C CA . ILE A 1  881  ? 262.472 185.921 154.777 1.00 500.00 ? 881  ILE A CA 1 
ATOM 492  C CA . LEU A 1  882  ? 265.196 188.428 155.861 1.00 500.00 ? 882  LEU A CA 1 
ATOM 493  C CA . SER A 1  924  ? 255.648 184.000 166.118 1.00 500.00 ? 924  SER A CA 1 
ATOM 494  C CA . SER A 1  925  ? 257.066 187.573 166.269 1.00 500.00 ? 925  SER A CA 1 
ATOM 495  C CA . LEU A 1  926  ? 258.285 187.410 162.627 1.00 500.00 ? 926  LEU A CA 1 
ATOM 496  C CA . ALA A 1  927  ? 254.841 186.404 161.256 1.00 500.00 ? 927  ALA A CA 1 
ATOM 497  C CA . GLU A 1  928  ? 253.003 188.987 163.440 1.00 500.00 ? 928  GLU A CA 1 
ATOM 498  C CA . ARG A 1  929  ? 255.384 191.783 162.303 1.00 500.00 ? 929  ARG A CA 1 
ATOM 499  C CA . LEU A 1  930  ? 254.391 191.265 158.642 1.00 500.00 ? 930  LEU A CA 1 
ATOM 500  C CA . VAL A 1  931  ? 250.620 191.372 159.396 1.00 500.00 ? 931  VAL A CA 1 
ATOM 501  C CA . VAL A 1  932  ? 250.936 194.555 161.556 1.00 500.00 ? 932  VAL A CA 1 
ATOM 502  C CA . TRP A 1  933  ? 252.935 196.377 158.811 1.00 477.18 ? 933  TRP A CA 1 
ATOM 503  C CA . MET A 1  934  ? 250.303 195.429 156.156 1.00 500.00 ? 934  MET A CA 1 
ATOM 504  C CA . THR A 1  935  ? 247.697 197.294 158.280 1.00 489.86 ? 935  THR A CA 1 
ATOM 505  C CA . ASN A 1  936  ? 249.941 200.449 157.993 1.00 308.85 ? 936  ASN A CA 1 
ATOM 506  C CA . VAL A 1  937  ? 249.954 200.030 154.191 1.00 231.29 ? 937  VAL A CA 1 
ATOM 507  C CA . GLY A 1  938  ? 246.542 200.729 152.482 1.00 362.79 ? 938  GLY A CA 1 
ATOM 508  C CA . PHE A 1  939  ? 246.253 196.938 151.940 1.00 366.06 ? 939  PHE A CA 1 
ATOM 509  C CA . THR A 1  940  ? 242.939 195.097 152.761 1.00 254.65 ? 940  THR A CA 1 
ATOM 510  C CA . LEU A 1  941  ? 241.936 191.382 152.871 1.00 166.40 ? 941  LEU A CA 1 
ATOM 511  C CA . ARG A 1  942  ? 239.484 191.626 149.978 1.00 201.94 ? 942  ARG A CA 1 
ATOM 512  C CA . ASP A 1  943  ? 242.258 193.167 147.791 1.00 365.16 ? 943  ASP A CA 1 
ATOM 513  C CA . LEU A 1  944  ? 244.730 190.402 148.807 1.00 392.30 ? 944  LEU A CA 1 
ATOM 514  C CA . GLU A 1  945  ? 242.524 188.198 146.571 1.00 363.54 ? 945  GLU A CA 1 
ATOM 515  C CA . THR A 1  946  ? 243.819 189.843 143.298 1.00 387.19 ? 946  THR A CA 1 
ATOM 516  C CA . LEU A 1  947  ? 247.601 189.441 144.004 1.00 334.11 ? 947  LEU A CA 1 
ATOM 517  C CA . PRO A 1  948  ? 248.929 186.550 141.847 1.00 229.29 ? 948  PRO A CA 1 
ATOM 518  C CA . PHE A 1  949  ? 248.530 183.368 144.025 1.00 173.52 ? 949  PHE A CA 1 
ATOM 519  C CA . GLY A 1  950  ? 252.174 182.146 143.706 1.00 179.17 ? 950  GLY A CA 1 
ATOM 520  C CA . ILE A 1  951  ? 253.393 185.547 144.936 1.00 416.74 ? 951  ILE A CA 1 
ATOM 521  C CA . ALA A 1  952  ? 250.443 185.569 147.421 1.00 426.64 ? 952  ALA A CA 1 
ATOM 522  C CA . LEU A 1  953  ? 251.546 182.269 149.060 1.00 372.75 ? 953  LEU A CA 1 
ATOM 523  C CA . PRO A 1  954  ? 254.502 183.896 151.009 1.00 481.10 ? 954  PRO A CA 1 
ATOM 524  C CA . ILE A 1  955  ? 252.071 186.612 152.253 1.00 498.94 ? 955  ILE A CA 1 
ATOM 525  C CA . ARG A 1  956  ? 249.203 184.161 152.971 1.00 444.11 ? 956  ARG A CA 1 
ATOM 526  C CA . ASP A 1  957  ? 251.573 181.758 154.810 1.00 483.00 ? 957  ASP A CA 1 
ATOM 527  C CA . ALA A 1  958  ? 252.165 184.592 157.326 1.00 500.00 ? 958  ALA A CA 1 
ATOM 528  C CA . ILE A 1  959  ? 248.370 184.921 157.733 1.00 500.00 ? 959  ILE A CA 1 
ATOM 529  C CA . TYR A 1  960  ? 248.025 181.091 158.188 1.00 458.60 ? 960  TYR A CA 1 
ATOM 530  C CA . HIS A 1  961  ? 250.810 181.282 160.807 1.00 479.55 ? 961  HIS A CA 1 
ATOM 531  C CA . CYS A 1  962  ? 249.255 184.360 162.529 1.00 500.00 ? 962  CYS A CA 1 
ATOM 532  C CA . ARG A 1  963  ? 245.863 182.525 162.665 1.00 426.22 ? 963  ARG A CA 1 
ATOM 533  C CA . GLU A 1  964  ? 247.220 179.521 164.589 1.00 215.72 ? 964  GLU A CA 1 
ATOM 534  C CA . GLN A 1  965  ? 248.754 181.870 167.224 1.00 332.74 ? 965  GLN A CA 1 
ATOM 535  C CA . PRO A 1  966  ? 246.473 184.850 168.149 1.00 445.71 ? 966  PRO A CA 1 
ATOM 536  C CA . ALA A 1  967  ? 248.260 186.751 170.955 1.00 493.53 ? 967  ALA A CA 1 
ATOM 537  C CA . SER A 1  968  ? 246.741 190.080 172.123 1.00 500.00 ? 968  SER A CA 1 
ATOM 538  C CA . ASP A 1  969  ? 243.880 192.454 171.227 1.00 500.00 ? 969  ASP A CA 1 
ATOM 539  C CA . TRP A 1  970  ? 244.802 194.208 167.999 1.00 383.11 ? 970  TRP A CA 1 
ATOM 540  C CA . PRO A 1  971  ? 243.047 197.221 166.350 1.00 272.57 ? 971  PRO A CA 1 
ATOM 541  C CA . GLU A 1  972  ? 239.931 196.092 164.415 1.00 375.03 ? 972  GLU A CA 1 
ATOM 542  C CA . ALA A 1  973  ? 241.697 196.274 160.981 1.00 500.00 ? 973  ALA A CA 1 
ATOM 543  C CA . VAL A 1  974  ? 244.416 193.722 161.939 1.00 500.00 ? 974  VAL A CA 1 
ATOM 544  C CA . CYS A 1  975  ? 241.776 191.189 163.119 1.00 500.00 ? 975  CYS A CA 1 
ATOM 545  C CA . LEU A 1  976  ? 239.931 191.478 159.762 1.00 500.00 ? 976  LEU A CA 1 
ATOM 546  C CA . LEU A 1  977  ? 243.143 190.961 157.737 1.00 500.00 ? 977  LEU A CA 1 
ATOM 547  C CA . ILE A 1  978  ? 243.694 187.604 159.504 1.00 500.00 ? 978  ILE A CA 1 
ATOM 548  C CA . GLY A 1  979  ? 240.936 184.991 158.950 1.00 500.00 ? 979  GLY A CA 1 
ATOM 549  C CA . ARG A 1  980  ? 239.942 185.427 162.617 1.00 479.52 ? 980  ARG A CA 1 
ATOM 550  C CA . GLN A 1  981  ? 237.224 188.107 162.733 1.00 425.26 ? 981  GLN A CA 1 
ATOM 551  C CA . ASP A 1  982  ? 235.904 187.005 166.150 1.00 216.09 ? 982  ASP A CA 1 
ATOM 552  C CA . LEU A 1  983  ? 238.604 188.731 168.162 1.00 206.62 ? 983  LEU A CA 1 
ATOM 553  C CA . SER A 1  984  ? 237.241 192.281 167.274 1.00 378.02 ? 984  SER A CA 1 
ATOM 554  C CA . LYS A 1  985  ? 233.521 191.501 166.418 1.00 314.67 ? 985  LYS A CA 1 
ATOM 555  C CA . GLN A 1  986  ? 232.405 194.340 168.845 1.00 260.35 ? 986  GLN A CA 1 
ATOM 556  C CA . ASP A 1  1013 ? 199.685 186.720 181.563 1.00 420.59 ? 1013 ASP A CA 1 
ATOM 557  C CA . ASP A 1  1014 ? 201.679 184.710 184.211 1.00 371.88 ? 1014 ASP A CA 1 
ATOM 558  C CA . GLY A 1  1015 ? 204.939 186.584 183.604 1.00 297.13 ? 1015 GLY A CA 1 
ATOM 559  C CA . MET A 1  1016 ? 207.849 184.378 182.636 1.00 173.37 ? 1016 MET A CA 1 
ATOM 560  C CA . ASN A 1  1017 ? 207.123 185.655 179.120 1.00 254.20 ? 1017 ASN A CA 1 
ATOM 561  C CA . ASP A 1  1018 ? 210.461 187.238 178.444 1.00 217.64 ? 1018 ASP A CA 1 
ATOM 562  C CA . MET A 1  1019 ? 212.911 184.411 179.107 1.00 202.37 ? 1019 MET A CA 1 
ATOM 563  C CA . ASN A 1  1020 ? 215.406 184.386 176.186 1.00 212.60 ? 1020 ASN A CA 1 
ATOM 564  C CA . HIS A 1  1021 ? 214.780 180.695 175.657 1.00 373.97 ? 1021 HIS A CA 1 
ATOM 565  C CA . GLU A 1  1022 ? 217.451 180.451 172.825 1.00 323.47 ? 1022 GLU A CA 1 
ATOM 566  C CA . VAL A 1  1023 ? 220.259 180.813 175.402 1.00 146.15 ? 1023 VAL A CA 1 
ATOM 567  C CA . MET A 1  1024 ? 218.128 179.088 178.103 1.00 130.90 ? 1024 MET A CA 1 
ATOM 568  C CA . SER A 1  1025 ? 217.390 176.053 175.849 1.00 151.33 ? 1025 SER A CA 1 
ATOM 569  C CA . LEU A 1  1026 ? 221.165 175.659 175.440 1.00 173.80 ? 1026 LEU A CA 1 
ATOM 570  C CA . ILE A 1  1027 ? 221.577 175.305 179.199 1.00 131.31 ? 1027 ILE A CA 1 
ATOM 571  C CA . TRP A 1  1028 ? 218.915 172.616 179.635 1.00 163.82 ? 1028 TRP A CA 1 
ATOM 572  C CA . SER A 1  1029 ? 218.620 170.514 176.472 1.00 244.15 ? 1029 SER A CA 1 
ATOM 573  C CA . GLU A 1  1030 ? 216.943 167.050 176.225 1.00 329.77 ? 1030 GLU A CA 1 
ATOM 574  C CA . ASP A 1  1031 ? 214.397 167.432 179.080 1.00 295.79 ? 1031 ASP A CA 1 
ATOM 575  C CA . LEU A 1  1032 ? 212.478 170.687 179.620 1.00 196.12 ? 1032 LEU A CA 1 
ATOM 576  C CA . ARG A 1  1033 ? 213.073 171.762 183.219 1.00 194.20 ? 1033 ARG A CA 1 
ATOM 577  C CA . VAL A 1  1034 ? 211.713 175.316 182.462 1.00 228.93 ? 1034 VAL A CA 1 
ATOM 578  C CA . GLN A 1  1035 ? 208.207 174.204 181.383 1.00 420.34 ? 1035 GLN A CA 1 
ATOM 579  C CA . ASP A 1  1036 ? 207.973 172.446 184.771 1.00 458.33 ? 1036 ASP A CA 1 
ATOM 580  C CA . VAL A 1  1037 ? 209.388 175.604 186.489 1.00 370.21 ? 1037 VAL A CA 1 
ATOM 581  C CA . ARG A 1  1038 ? 206.817 177.969 184.801 1.00 215.93 ? 1038 ARG A CA 1 
ATOM 582  C CA . ARG A 1  1039 ? 204.090 175.500 185.993 1.00 402.16 ? 1039 ARG A CA 1 
ATOM 583  C CA . LEU A 1  1040 ? 205.567 175.298 189.528 1.00 437.66 ? 1040 LEU A CA 1 
ATOM 584  C CA . LEU A 1  1041 ? 205.775 179.112 189.953 1.00 468.75 ? 1041 LEU A CA 1 
ATOM 585  C CA . GLN A 1  1042 ? 202.637 180.229 187.995 1.00 481.76 ? 1042 GLN A CA 1 
ATOM 586  C CA . SER A 1  1043 ? 200.532 182.651 190.060 1.00 500.00 ? 1043 SER A CA 1 
ATOM 587  C CA . ALA A 1  1044 ? 198.005 183.483 187.314 1.00 500.00 ? 1044 ALA A CA 1 
ATOM 588  C CA . HIS A 1  1045 ? 195.291 180.968 186.191 1.00 500.00 ? 1045 HIS A CA 1 
ATOM 589  C CA . PRO A 1  1046 ? 193.017 179.200 188.704 1.00 500.00 ? 1046 PRO A CA 1 
ATOM 590  C CA . VAL A 1  1047 ? 194.276 176.349 190.914 1.00 500.00 ? 1047 VAL A CA 1 
ATOM 591  C CA . ARG A 1  1048 ? 192.244 173.172 190.351 1.00 500.00 ? 1048 ARG A CA 1 
ATOM 592  C CA . VAL A 1  1049 ? 190.664 171.880 193.582 1.00 500.00 ? 1049 VAL A CA 1 
ATOM 593  C CA . ASN A 1  1050 ? 189.755 168.159 193.623 1.00 500.00 ? 1050 ASN A CA 1 
ATOM 594  C CA . VAL A 1  1051 ? 187.763 166.652 196.531 1.00 500.00 ? 1051 VAL A CA 1 
ATOM 595  C CA . VAL A 1  1052 ? 185.673 163.449 196.312 1.00 500.00 ? 1052 VAL A CA 1 
ATOM 596  C CA . GLN A 1  1053 ? 182.464 163.566 198.402 1.00 500.00 ? 1053 GLN A CA 1 
ATOM 597  C CA . TYR A 1  1054 ? 180.804 160.719 200.329 1.00 500.00 ? 1054 TYR A CA 1 
ATOM 598  C CA . PRO A 1  1055 ? 176.936 160.713 200.638 1.00 500.00 ? 1055 PRO A CA 1 
ATOM 599  C CA . GLU A 1  1056 ? 177.004 162.679 203.935 1.00 500.00 ? 1056 GLU A CA 1 
ATOM 600  C CA . LEU A 1  1057 ? 177.273 166.329 202.796 1.00 500.00 ? 1057 LEU A CA 1 
ATOM 601  C CA . SER A 1  1058 ? 174.759 168.901 201.489 1.00 500.00 ? 1058 SER A CA 1 
ATOM 602  C CA . ASP A 1  1059 ? 175.546 171.131 198.462 1.00 500.00 ? 1059 ASP A CA 1 
ATOM 603  C CA . HIS A 1  1060 ? 176.151 173.986 200.956 1.00 500.00 ? 1060 HIS A CA 1 
ATOM 604  C CA . GLU A 1  1061 ? 178.122 171.592 203.201 1.00 500.00 ? 1061 GLU A CA 1 
ATOM 605  C CA . PHE A 1  1062 ? 180.236 170.409 200.216 1.00 500.00 ? 1062 PHE A CA 1 
ATOM 606  C CA . ILE A 1  1063 ? 181.146 173.965 199.039 1.00 500.00 ? 1063 ILE A CA 1 
ATOM 607  C CA . GLU A 1  1064 ? 182.780 174.545 202.478 1.00 500.00 ? 1064 GLU A CA 1 
ATOM 608  C CA . GLU A 1  1065 ? 184.934 171.393 202.005 1.00 500.00 ? 1065 GLU A CA 1 
ATOM 609  C CA . LYS A 1  1066 ? 186.392 172.430 198.614 1.00 500.00 ? 1066 LYS A CA 1 
ATOM 610  C CA . GLU A 1  1067 ? 187.084 176.015 199.788 1.00 500.00 ? 1067 GLU A CA 1 
ATOM 611  C CA . ASN A 1  1068 ? 189.023 174.637 202.817 1.00 500.00 ? 1068 ASN A CA 1 
ATOM 612  C CA . ARG A 1  1069 ? 191.130 172.557 200.397 1.00 500.00 ? 1069 ARG A CA 1 
ATOM 613  C CA . LEU A 1  1070 ? 191.483 175.750 198.286 1.00 500.00 ? 1070 LEU A CA 1 
ATOM 614  C CA . LEU A 1  1071 ? 192.719 177.827 201.288 1.00 500.00 ? 1071 LEU A CA 1 
ATOM 615  C CA . GLN A 1  1072 ? 195.581 175.301 201.756 1.00 500.00 ? 1072 GLN A CA 1 
ATOM 616  C CA . LEU A 1  1073 ? 196.450 175.662 198.022 1.00 500.00 ? 1073 LEU A CA 1 
ATOM 617  C CA . CYS A 1  1074 ? 196.354 179.473 198.475 1.00 500.00 ? 1074 CYS A CA 1 
ATOM 618  C CA . GLN A 1  1075 ? 199.090 179.315 201.163 1.00 500.00 ? 1075 GLN A CA 1 
ATOM 619  C CA . ARG A 1  1076 ? 201.284 177.931 198.355 1.00 500.00 ? 1076 ARG A CA 1 
ATOM 620  C CA . THR A 1  1077 ? 200.204 180.645 195.819 1.00 500.00 ? 1077 THR A CA 1 
ATOM 621  C CA . MET A 1  1078 ? 201.291 183.652 198.002 1.00 500.00 ? 1078 MET A CA 1 
ATOM 622  C CA . ALA A 1  1079 ? 204.747 182.110 198.377 1.00 500.00 ? 1079 ALA A CA 1 
ATOM 623  C CA . LEU A 1  1080 ? 205.187 181.539 194.609 1.00 493.16 ? 1080 LEU A CA 1 
ATOM 624  C CA . PRO A 1  1081 ? 205.957 185.246 193.727 1.00 500.00 ? 1081 PRO A CA 1 
ATOM 625  C CA . VAL A 1  1082 ? 209.166 185.324 195.878 1.00 444.01 ? 1082 VAL A CA 1 
ATOM 626  C CA . GLY A 1  1083 ? 210.602 182.235 194.122 1.00 405.70 ? 1083 GLY A CA 1 
ATOM 627  C CA . ARG A 1  1084 ? 209.215 183.445 190.758 1.00 434.73 ? 1084 ARG A CA 1 
ATOM 628  C CA . GLY A 1  1085 ? 211.228 186.708 190.929 1.00 269.84 ? 1085 GLY A CA 1 
ATOM 629  C CA . MET A 1  1086 ? 214.506 184.810 191.274 1.00 144.44 ? 1086 MET A CA 1 
ATOM 630  C CA . PHE A 1  1087 ? 213.756 182.863 188.149 1.00 149.63 ? 1087 PHE A CA 1 
ATOM 631  C CA . THR A 1  1088 ? 212.863 185.580 185.841 1.00 152.09 ? 1088 THR A CA 1 
ATOM 632  C CA . LEU A 1  1089 ? 215.249 188.197 187.291 1.00 216.21 ? 1089 LEU A CA 1 
ATOM 633  C CA . PHE A 1  1090 ? 216.906 191.087 185.461 1.00 126.16 ? 1090 PHE A CA 1 
ATOM 634  C CA . SER A 1  1091 ? 216.012 189.407 182.143 1.00 156.19 ? 1091 SER A CA 1 
ATOM 635  C CA . TYR A 1  1092 ? 213.937 192.096 180.512 1.00 243.55 ? 1092 TYR A CA 1 
ATOM 636  C CA . HIS A 1  1093 ? 214.580 195.612 179.403 1.00 158.54 ? 1093 HIS A CA 1 
ATOM 637  C CA . PRO A 1  1094 ? 211.077 197.112 179.266 1.00 169.66 ? 1094 PRO A CA 1 
ATOM 638  C CA . VAL A 1  1095 ? 209.869 199.206 176.265 1.00 171.40 ? 1095 VAL A CA 1 
ATOM 639  C CA . PRO A 1  1096 ? 209.831 202.981 177.102 1.00 287.89 ? 1096 PRO A CA 1 
ATOM 640  C CA . THR A 1  1097 ? 206.216 203.195 175.747 1.00 418.78 ? 1097 THR A CA 1 
ATOM 641  C CA . GLU A 1  1098 ? 204.502 200.172 177.426 1.00 453.37 ? 1098 GLU A CA 1 
ATOM 642  C CA . PRO A 1  1099 ? 203.918 199.698 181.207 1.00 411.43 ? 1099 PRO A CA 1 
ATOM 643  C CA . LEU A 1  1100 ? 205.423 196.334 182.293 1.00 399.39 ? 1100 LEU A CA 1 
ATOM 644  C CA . PRO A 1  1101 ? 203.071 194.438 182.720 1.00 500.00 ? 1101 PRO A CA 1 
ATOM 645  C CA . ILE A 1  1102 ? 202.551 192.814 186.172 1.00 500.00 ? 1102 ILE A CA 1 
ATOM 646  C CA . PRO A 1  1103 ? 200.767 189.387 186.067 1.00 500.00 ? 1103 PRO A CA 1 
ATOM 647  C CA . LYS A 1  1104 ? 197.447 189.035 187.926 1.00 500.00 ? 1104 LYS A CA 1 
ATOM 648  C CA . LEU A 1  1105 ? 197.647 187.528 191.432 1.00 500.00 ? 1105 LEU A CA 1 
ATOM 649  C CA . ASN A 1  1106 ? 194.370 185.563 191.671 1.00 500.00 ? 1106 ASN A CA 1 
ATOM 650  C CA . LEU A 1  1107 ? 193.045 183.128 194.302 1.00 500.00 ? 1107 LEU A CA 1 
ATOM 651  C CA . THR A 1  1108 ? 190.317 181.104 192.550 1.00 500.00 ? 1108 THR A CA 1 
ATOM 652  C CA . GLY A 1  1109 ? 189.697 177.341 192.249 1.00 500.00 ? 1109 GLY A CA 1 
ATOM 653  C CA . ARG A 1  1110 ? 188.212 175.305 189.382 1.00 500.00 ? 1110 ARG A CA 1 
ATOM 654  C CA . ALA A 1  1111 ? 186.614 172.057 190.609 1.00 500.00 ? 1111 ALA A CA 1 
ATOM 655  C CA . PRO A 1  1112 ? 186.168 168.880 188.421 1.00 500.00 ? 1112 PRO A CA 1 
ATOM 656  C CA . PRO A 1  1113 ? 184.148 167.713 186.629 1.00 500.00 ? 1113 PRO A CA 1 
ATOM 657  C CA . ARG A 1  1114 ? 181.744 170.694 186.243 1.00 500.00 ? 1114 ARG A CA 1 
ATOM 658  C CA . ASN A 1  1115 ? 184.766 173.106 186.139 1.00 500.00 ? 1115 ASN A CA 1 
ATOM 659  C CA . THR A 1  1116 ? 183.002 175.509 188.569 1.00 500.00 ? 1116 THR A CA 1 
ATOM 660  C CA . THR A 1  1117 ? 184.818 178.422 190.270 1.00 500.00 ? 1117 THR A CA 1 
ATOM 661  C CA . VAL A 1  1118 ? 185.160 178.993 194.049 1.00 500.00 ? 1118 VAL A CA 1 
ATOM 662  C CA . ASP A 1  1119 ? 186.188 182.348 195.574 1.00 500.00 ? 1119 ASP A CA 1 
ATOM 663  C CA . LEU A 1  1120 ? 187.334 182.914 199.190 1.00 459.33 ? 1120 LEU A CA 1 
ATOM 664  C CA . ASN A 1  1121 ? 186.463 186.643 198.888 1.00 312.86 ? 1121 ASN A CA 1 
ATOM 665  C CA . SER A 1  1122 ? 182.795 185.628 198.630 1.00 329.69 ? 1122 SER A CA 1 
ATOM 666  C CA . GLY A 1  1123 ? 180.886 184.677 201.862 1.00 433.17 ? 1123 GLY A CA 1 
ATOM 667  C CA . ASN A 1  1124 ? 182.184 181.152 202.661 1.00 436.35 ? 1124 ASN A CA 1 
ATOM 668  C CA . ILE A 1  1125 ? 185.148 180.297 205.001 1.00 290.63 ? 1125 ILE A CA 1 
ATOM 669  C CA . ASP A 1  1126 ? 187.099 182.381 207.526 1.00 250.57 ? 1126 ASP A CA 1 
ATOM 670  C CA . VAL A 1  1127 ? 190.191 184.502 206.702 1.00 203.91 ? 1127 VAL A CA 1 
ATOM 671  C CA . PRO A 1  1128 ? 192.223 187.016 208.707 1.00 278.72 ? 1128 PRO A CA 1 
ATOM 672  C CA . PRO A 1  1129 ? 191.127 190.195 206.858 1.00 272.39 ? 1129 PRO A CA 1 
ATOM 673  C CA . ASN A 1  1130 ? 194.493 191.452 205.608 1.00 222.57 ? 1130 ASN A CA 1 
ATOM 674  C CA . MET A 1  1131 ? 195.546 188.136 203.925 1.00 231.49 ? 1131 MET A CA 1 
ATOM 675  C CA . THR A 1  1132 ? 196.931 188.781 200.366 1.00 239.85 ? 1132 THR A CA 1 
ATOM 676  C CA . SER A 1  1133 ? 198.263 192.215 201.328 1.00 157.91 ? 1133 SER A CA 1 
ATOM 677  C CA . TRP A 1  1134 ? 201.576 190.443 201.830 1.00 263.04 ? 1134 TRP A CA 1 
ATOM 678  C CA . ALA A 1  1135 ? 201.305 188.145 198.719 1.00 388.12 ? 1135 ALA A CA 1 
ATOM 679  C CA . SER A 1  1136 ? 200.472 191.089 196.409 1.00 347.74 ? 1136 SER A CA 1 
ATOM 680  C CA . PHE A 1  1137 ? 203.584 192.968 197.570 1.00 303.87 ? 1137 PHE A CA 1 
ATOM 681  C CA . HIS A 1  1138 ? 205.819 190.017 196.647 1.00 383.36 ? 1138 HIS A CA 1 
ATOM 682  C CA . ASN A 1  1139 ? 203.949 189.698 193.307 1.00 380.71 ? 1139 ASN A CA 1 
ATOM 683  C CA . GLY A 1  1140 ? 204.874 193.313 192.304 1.00 267.22 ? 1140 GLY A CA 1 
ATOM 684  C CA . VAL A 1  1141 ? 208.554 193.190 193.295 1.00 124.86 ? 1141 VAL A CA 1 
ATOM 685  C CA . ALA A 1  1142 ? 208.766 189.844 191.346 1.00 287.18 ? 1142 ALA A CA 1 
ATOM 686  C CA . ALA A 1  1143 ? 207.632 191.598 188.117 1.00 314.13 ? 1143 ALA A CA 1 
ATOM 687  C CA . GLY A 1  1144 ? 209.927 194.629 188.785 1.00 294.08 ? 1144 GLY A CA 1 
ATOM 688  C CA . LEU A 1  1145 ? 212.917 192.269 189.365 1.00 254.26 ? 1145 LEU A CA 1 
ATOM 689  C CA . LYS A 1  1146 ? 212.687 191.091 185.718 1.00 269.74 ? 1146 LYS A CA 1 
ATOM 690  C CA . ILE A 1  1147 ? 213.678 194.648 184.586 1.00 195.42 ? 1147 ILE A CA 1 
ATOM 691  C CA . ALA A 1  1148 ? 217.387 194.447 183.676 1.00 163.45 ? 1148 ALA A CA 1 
ATOM 692  C CA . PRO A 1  1149 ? 219.875 196.736 185.539 1.00 155.31 ? 1149 PRO A CA 1 
ATOM 693  C CA . ALA A 1  1150 ? 221.587 197.857 182.367 1.00 213.58 ? 1150 ALA A CA 1 
ATOM 694  C CA . SER A 1  1151 ? 218.512 199.508 180.698 1.00 212.57 ? 1151 SER A CA 1 
ATOM 695  C CA . GLN A 1  1152 ? 217.344 203.098 181.031 1.00 187.95 ? 1152 GLN A CA 1 
ATOM 696  C CA . ILE A 1  1153 ? 214.200 204.058 182.799 1.00 311.80 ? 1153 ILE A CA 1 
ATOM 697  C CA . ASP A 1  1154 ? 213.117 207.694 183.212 1.00 441.51 ? 1154 ASP A CA 1 
ATOM 698  C CA . SER A 1  1155 ? 211.335 209.105 186.307 1.00 475.07 ? 1155 SER A CA 1 
ATOM 699  C CA . ALA A 1  1156 ? 207.924 209.374 184.549 1.00 476.02 ? 1156 ALA A CA 1 
ATOM 700  C CA . TRP A 1  1157 ? 207.955 205.617 183.691 1.00 469.19 ? 1157 TRP A CA 1 
ATOM 701  C CA . ILE A 1  1158 ? 207.976 204.654 187.403 1.00 469.73 ? 1158 ILE A CA 1 
ATOM 702  C CA . VAL A 1  1159 ? 204.968 207.041 187.772 1.00 500.00 ? 1159 VAL A CA 1 
ATOM 703  C CA . TYR A 1  1160 ? 203.350 205.404 184.678 1.00 500.00 ? 1160 TYR A CA 1 
ATOM 704  C CA . ASN A 1  1161 ? 203.333 201.931 186.348 1.00 500.00 ? 1161 ASN A CA 1 
ATOM 705  C CA . LYS A 1  1162 ? 201.202 203.136 189.333 1.00 500.00 ? 1162 LYS A CA 1 
ATOM 706  C CA . PRO A 1  1163 ? 197.935 201.148 188.942 1.00 498.73 ? 1163 PRO A CA 1 
ATOM 707  C CA . LYS A 1  1164 ? 195.381 203.969 189.764 1.00 454.14 ? 1164 LYS A CA 1 
ATOM 708  C CA . HIS A 1  1165 ? 192.983 201.159 190.884 1.00 328.95 ? 1165 HIS A CA 1 
ATOM 709  C CA . ALA A 1  1166 ? 193.729 202.133 194.565 1.00 269.90 ? 1166 ALA A CA 1 
ATOM 710  C CA . GLU A 1  1167 ? 193.163 198.496 195.575 1.00 225.50 ? 1167 GLU A CA 1 
ATOM 711  C CA . LEU A 1  1168 ? 196.186 196.463 194.587 1.00 284.16 ? 1168 LEU A CA 1 
ATOM 712  C CA . ALA A 1  1169 ? 198.155 199.679 195.151 1.00 313.10 ? 1169 ALA A CA 1 
ATOM 713  C CA . ASN A 1  1170 ? 199.739 197.079 197.472 1.00 270.01 ? 1170 ASN A CA 1 
ATOM 714  C CA . GLU A 1  1171 ? 201.288 195.079 194.530 1.00 328.84 ? 1171 GLU A CA 1 
ATOM 715  C CA . TYR A 1  1172 ? 202.654 198.338 193.097 1.00 281.82 ? 1172 TYR A CA 1 
ATOM 716  C CA . ALA A 1  1173 ? 204.156 198.805 196.539 1.00 188.78 ? 1173 ALA A CA 1 
ATOM 717  C CA . GLY A 1  1174 ? 206.225 195.828 195.614 1.00 189.49 ? 1174 GLY A CA 1 
ATOM 718  C CA . PHE A 1  1175 ? 207.017 197.106 192.188 1.00 151.93 ? 1175 PHE A CA 1 
ATOM 719  C CA . LEU A 1  1176 ? 208.379 200.351 193.568 1.00 161.37 ? 1176 LEU A CA 1 
ATOM 720  C CA . MET A 1  1177 ? 210.841 198.539 195.782 1.00 146.54 ? 1177 MET A CA 1 
ATOM 721  C CA . ALA A 1  1178 ? 211.975 196.114 193.135 1.00 152.33 ? 1178 ALA A CA 1 
ATOM 722  C CA . LEU A 1  1179 ? 213.459 199.007 191.191 1.00 174.86 ? 1179 LEU A CA 1 
ATOM 723  C CA . GLY A 1  1180 ? 215.641 200.202 194.043 1.00 139.12 ? 1180 GLY A CA 1 
ATOM 724  C CA . LEU A 1  1181 ? 216.989 196.676 194.563 1.00 132.10 ? 1181 LEU A CA 1 
ATOM 725  C CA . ASN A 1  1182 ? 217.628 196.661 190.807 1.00 205.55 ? 1182 ASN A CA 1 
ATOM 726  C CA . GLY A 1  1183 ? 219.442 200.061 191.177 1.00 350.44 ? 1183 GLY A CA 1 
ATOM 727  C CA . HIS A 1  1184 ? 217.003 202.182 189.090 1.00 274.62 ? 1184 HIS A CA 1 
ATOM 728  C CA . LEU A 1  1185 ? 215.201 204.185 191.750 1.00 152.19 ? 1185 LEU A CA 1 
ATOM 729  C CA . THR A 1  1186 ? 218.084 206.671 191.683 1.00 224.69 ? 1186 THR A CA 1 
ATOM 730  C CA . LYS A 1  1187 ? 216.905 208.181 188.360 1.00 252.04 ? 1187 LYS A CA 1 
ATOM 731  C CA . LEU A 1  1188 ? 213.551 209.069 189.981 1.00 445.91 ? 1188 LEU A CA 1 
ATOM 732  C CA . ALA A 1  1189 ? 213.330 212.783 190.907 1.00 500.00 ? 1189 ALA A CA 1 
ATOM 733  C CA . THR A 1  1190 ? 214.317 212.543 194.656 1.00 500.00 ? 1190 THR A CA 1 
ATOM 734  C CA . LEU A 1  1191 ? 211.490 214.899 195.810 1.00 500.00 ? 1191 LEU A CA 1 
ATOM 735  C CA . ASN A 1  1192 ? 209.308 212.411 193.839 1.00 500.00 ? 1192 ASN A CA 1 
ATOM 736  C CA . ILE A 1  1193 ? 210.150 209.706 196.443 1.00 447.67 ? 1193 ILE A CA 1 
ATOM 737  C CA . HIS A 1  1194 ? 209.127 211.768 199.506 1.00 482.98 ? 1194 HIS A CA 1 
ATOM 738  C CA . ASP A 1  1195 ? 205.756 212.151 197.700 1.00 482.43 ? 1195 ASP A CA 1 
ATOM 739  C CA . TYR A 1  1196 ? 205.044 208.397 198.243 1.00 404.58 ? 1196 TYR A CA 1 
ATOM 740  C CA . LEU A 1  1197 ? 206.289 207.973 201.841 1.00 249.30 ? 1197 LEU A CA 1 
ATOM 741  C CA . THR A 1  1198 ? 203.271 209.975 202.877 1.00 144.35 ? 1198 THR A CA 1 
ATOM 742  C CA . LYS A 1  1199 ? 200.468 208.366 200.894 1.00 239.85 ? 1199 LYS A CA 1 
ATOM 743  C CA . GLY A 1  1200 ? 200.137 206.592 204.207 1.00 224.54 ? 1200 GLY A CA 1 
ATOM 744  C CA . HIS A 1  1201 ? 199.877 203.136 202.768 1.00 202.67 ? 1201 HIS A CA 1 
ATOM 745  C CA . GLU A 1  1202 ? 202.253 201.186 204.929 1.00 177.28 ? 1202 GLU A CA 1 
ATOM 746  C CA . MET A 1  1203 ? 203.279 198.550 202.393 1.00 142.86 ? 1203 MET A CA 1 
ATOM 747  C CA . THR A 1  1204 ? 204.558 201.125 199.834 1.00 237.44 ? 1204 THR A CA 1 
ATOM 748  C CA . SER A 1  1205 ? 206.529 202.664 202.649 1.00 169.92 ? 1205 SER A CA 1 
ATOM 749  C CA . ILE A 1  1206 ? 208.114 199.110 203.012 1.00 171.85 ? 1206 ILE A CA 1 
ATOM 750  C CA . GLY A 1  1207 ? 208.669 198.948 199.186 1.00 117.56 ? 1207 GLY A CA 1 
ATOM 751  C CA . LEU A 1  1208 ? 210.223 202.451 198.812 1.00 173.88 ? 1208 LEU A CA 1 
ATOM 752  C CA . LEU A 1  1209 ? 212.467 202.252 201.844 1.00 183.22 ? 1209 LEU A CA 1 
ATOM 753  C CA . LEU A 1  1210 ? 214.317 199.022 201.083 1.00 187.88 ? 1210 LEU A CA 1 
ATOM 754  C CA . GLY A 1  1211 ? 214.199 200.118 197.428 1.00 173.72 ? 1211 GLY A CA 1 
ATOM 755  C CA . VAL A 1  1212 ? 215.839 203.511 198.086 1.00 165.19 ? 1212 VAL A CA 1 
ATOM 756  C CA . SER A 1  1213 ? 218.352 201.803 200.461 1.00 139.22 ? 1213 SER A CA 1 
ATOM 757  C CA . ALA A 1  1214 ? 219.527 199.092 198.058 1.00 153.96 ? 1214 ALA A CA 1 
ATOM 758  C CA . ALA A 1  1215 ? 220.321 201.801 195.492 1.00 182.65 ? 1215 ALA A CA 1 
ATOM 759  C CA . LYS A 1  1216 ? 222.498 203.617 198.084 1.00 175.99 ? 1216 LYS A CA 1 
ATOM 760  C CA . LEU A 1  1217 ? 224.028 200.309 199.320 1.00 188.28 ? 1217 LEU A CA 1 
ATOM 761  C CA . GLY A 1  1218 ? 226.679 201.663 201.671 1.00 212.76 ? 1218 GLY A CA 1 
ATOM 762  C CA . THR A 1  1219 ? 227.331 204.908 199.764 1.00 295.94 ? 1219 THR A CA 1 
ATOM 763  C CA . MET A 1  1220 ? 225.981 207.106 202.656 1.00 455.12 ? 1220 MET A CA 1 
ATOM 764  C CA . ASP A 1  1221 ? 223.926 209.778 200.878 1.00 500.00 ? 1221 ASP A CA 1 
ATOM 765  C CA . MET A 1  1222 ? 222.798 212.786 202.950 1.00 500.00 ? 1222 MET A CA 1 
ATOM 766  C CA . SER A 1  1223 ? 219.334 212.924 201.283 1.00 500.00 ? 1223 SER A CA 1 
ATOM 767  C CA . ILE A 1  1224 ? 218.669 209.190 201.862 1.00 500.00 ? 1224 ILE A CA 1 
ATOM 768  C CA . THR A 1  1225 ? 220.009 209.254 205.460 1.00 500.00 ? 1225 THR A CA 1 
ATOM 769  C CA . ARG A 1  1226 ? 217.504 212.048 206.347 1.00 500.00 ? 1226 ARG A CA 1 
ATOM 770  C CA . LEU A 1  1227 ? 214.642 210.097 204.695 1.00 500.00 ? 1227 LEU A CA 1 
ATOM 771  C CA . LEU A 1  1228 ? 215.375 206.889 206.656 1.00 446.72 ? 1228 LEU A CA 1 
ATOM 772  C CA . SER A 1  1229 ? 216.783 210.107 209.820 1.00 500.00 ? 1229 SER A CA 1 
ATOM 773  C CA . ILE A 1  1230 ? 213.024 210.508 209.856 1.00 500.00 ? 1230 ILE A CA 1 
ATOM 774  C CA . HIS A 1  1231 ? 211.510 206.965 210.137 1.00 500.00 ? 1231 HIS A CA 1 
ATOM 775  C CA . ILE A 1  1232 ? 213.563 205.090 212.784 1.00 500.00 ? 1232 ILE A CA 1 
ATOM 776  C CA . PRO A 1  1233 ? 212.904 207.000 216.102 1.00 500.00 ? 1233 PRO A CA 1 
ATOM 777  C CA . ALA A 1  1234 ? 216.655 207.328 216.857 1.00 500.00 ? 1234 ALA A CA 1 
ATOM 778  C CA . LEU A 1  1235 ? 218.003 208.602 213.490 1.00 495.68 ? 1235 LEU A CA 1 
ATOM 779  C CA . LEU A 1  1236 ? 216.070 211.952 213.223 1.00 406.35 ? 1236 LEU A CA 1 
ATOM 780  C CA . PRO A 1  1237 ? 217.746 214.782 215.250 1.00 362.95 ? 1237 PRO A CA 1 
ATOM 781  C CA . PRO A 1  1238 ? 216.840 218.276 213.988 1.00 329.78 ? 1238 PRO A CA 1 
ATOM 782  C CA . THR A 1  1239 ? 214.125 217.576 212.687 1.00 281.65 ? 1239 THR A CA 1 
ATOM 783  C CA . SER A 1  1240 ? 212.423 216.182 214.911 1.00 299.91 ? 1240 SER A CA 1 
ATOM 784  C CA . THR A 1  1241 ? 208.676 216.063 214.399 1.00 350.26 ? 1241 THR A CA 1 
ATOM 785  C CA . GLU A 1  1242 ? 205.856 213.868 215.907 1.00 267.91 ? 1242 GLU A CA 1 
ATOM 786  C CA . LEU A 1  1243 ? 207.032 210.807 213.982 1.00 265.67 ? 1243 LEU A CA 1 
ATOM 787  C CA . ASP A 1  1244 ? 203.961 208.565 214.474 1.00 209.80 ? 1244 ASP A CA 1 
ATOM 788  C CA . VAL A 1  1245 ? 205.455 205.802 212.215 1.00 158.47 ? 1245 VAL A CA 1 
ATOM 789  C CA . PRO A 1  1246 ? 203.880 202.304 211.906 1.00 209.09 ? 1246 PRO A CA 1 
ATOM 790  C CA . HIS A 1  1247 ? 206.101 199.624 213.509 1.00 267.16 ? 1247 HIS A CA 1 
ATOM 791  C CA . ASN A 1  1248 ? 205.961 197.451 210.425 1.00 150.47 ? 1248 ASN A CA 1 
ATOM 792  C CA . VAL A 1  1249 ? 207.606 200.335 208.496 1.00 191.49 ? 1249 VAL A CA 1 
ATOM 793  C CA . GLN A 1  1250 ? 210.610 201.037 210.833 1.00 350.65 ? 1250 GLN A CA 1 
ATOM 794  C CA . VAL A 1  1251 ? 212.170 197.503 210.762 1.00 397.03 ? 1251 VAL A CA 1 
ATOM 795  C CA . ALA A 1  1252 ? 212.710 197.878 206.979 1.00 377.76 ? 1252 ALA A CA 1 
ATOM 796  C CA . ALA A 1  1253 ? 214.387 201.323 207.312 1.00 308.10 ? 1253 ALA A CA 1 
ATOM 797  C CA . VAL A 1  1254 ? 216.370 199.921 210.212 1.00 286.04 ? 1254 VAL A CA 1 
ATOM 798  C CA . VAL A 1  1255 ? 217.522 197.301 207.575 1.00 202.95 ? 1255 VAL A CA 1 
ATOM 799  C CA . GLY A 1  1256 ? 217.527 200.146 205.137 1.00 161.66 ? 1256 GLY A CA 1 
ATOM 800  C CA . ILE A 1  1257 ? 220.036 201.879 207.340 1.00 129.92 ? 1257 ILE A CA 1 
ATOM 801  C CA . GLY A 1  1258 ? 222.255 198.802 207.192 1.00 151.66 ? 1258 GLY A CA 1 
ATOM 802  C CA . LEU A 1  1259 ? 222.435 198.897 203.437 1.00 139.13 ? 1259 LEU A CA 1 
ATOM 803  C CA . VAL A 1  1260 ? 223.104 202.697 203.500 1.00 141.82 ? 1260 VAL A CA 1 
ATOM 804  C CA . TYR A 1  1261 ? 226.033 202.315 205.775 1.00 137.66 ? 1261 TYR A CA 1 
ATOM 805  C CA . GLN A 1  1262 ? 227.240 198.868 204.515 1.00 138.54 ? 1262 GLN A CA 1 
ATOM 806  C CA . GLY A 1  1263 ? 230.989 198.423 204.721 1.00 180.24 ? 1263 GLY A CA 1 
ATOM 807  C CA . THR A 1  1264 ? 231.461 201.941 206.185 1.00 197.31 ? 1264 THR A CA 1 
ATOM 808  C CA . ALA A 1  1265 ? 231.728 201.086 209.904 1.00 294.52 ? 1265 ALA A CA 1 
ATOM 809  C CA . HIS A 1  1266 ? 230.055 204.462 210.757 1.00 444.40 ? 1266 HIS A CA 1 
ATOM 810  C CA . ARG A 1  1267 ? 230.599 205.674 214.356 1.00 485.12 ? 1267 ARG A CA 1 
ATOM 811  C CA . HIS A 1  1268 ? 227.121 207.026 215.266 1.00 500.00 ? 1268 HIS A CA 1 
ATOM 812  C CA . THR A 1  1269 ? 225.071 204.308 213.469 1.00 500.00 ? 1269 THR A CA 1 
ATOM 813  C CA . ALA A 1  1270 ? 226.610 201.428 215.482 1.00 500.00 ? 1270 ALA A CA 1 
ATOM 814  C CA . GLU A 1  1271 ? 225.659 203.336 218.679 1.00 500.00 ? 1271 GLU A CA 1 
ATOM 815  C CA . VAL A 1  1272 ? 221.929 203.717 217.820 1.00 500.00 ? 1272 VAL A CA 1 
ATOM 816  C CA . LEU A 1  1273 ? 221.595 200.173 216.392 1.00 500.00 ? 1273 LEU A CA 1 
ATOM 817  C CA . LEU A 1  1274 ? 223.107 198.763 219.626 1.00 500.00 ? 1274 LEU A CA 1 
ATOM 818  C CA . ALA A 1  1275 ? 220.494 200.738 221.597 1.00 500.00 ? 1275 ALA A CA 1 
ATOM 819  C CA . GLU A 1  1276 ? 217.828 199.361 219.207 1.00 500.00 ? 1276 GLU A CA 1 
ATOM 820  C CA . ILE A 1  1277 ? 218.957 195.678 219.342 1.00 500.00 ? 1277 ILE A CA 1 
ATOM 821  C CA . GLY A 1  1278 ? 217.918 195.571 223.027 1.00 500.00 ? 1278 GLY A CA 1 
ATOM 822  C CA . ARG A 1  1279 ? 214.997 197.928 223.568 1.00 500.00 ? 1279 ARG A CA 1 
ATOM 823  C CA . PRO A 1  1280 ? 212.353 198.346 226.309 1.00 500.00 ? 1280 PRO A CA 1 
ATOM 824  C CA . PRO A 1  1281 ? 208.893 196.888 225.285 1.00 500.00 ? 1281 PRO A CA 1 
ATOM 825  C CA . GLY A 1  1282 ? 207.987 200.501 224.368 1.00 500.00 ? 1282 GLY A CA 1 
ATOM 826  C CA . PRO A 1  1283 ? 205.870 203.397 225.623 1.00 406.67 ? 1283 PRO A CA 1 
ATOM 827  C CA . GLU A 1  1284 ? 202.309 202.570 226.878 1.00 243.32 ? 1284 GLU A CA 1 
ATOM 828  C CA . MET A 1  1285 ? 200.172 200.354 224.565 1.00 211.22 ? 1285 MET A CA 1 
ATOM 829  C CA . GLU A 1  1286 ? 202.433 201.396 221.609 1.00 249.84 ? 1286 GLU A CA 1 
ATOM 830  C CA . TYR A 1  1287 ? 205.374 199.453 220.025 1.00 288.01 ? 1287 TYR A CA 1 
ATOM 831  C CA . CYS A 1  1288 ? 204.604 196.110 221.823 1.00 367.70 ? 1288 CYS A CA 1 
ATOM 832  C CA . THR A 1  1289 ? 203.727 193.892 218.807 1.00 243.71 ? 1289 THR A CA 1 
ATOM 833  C CA . ASP A 1  1290 ? 206.206 191.676 216.851 1.00 237.09 ? 1290 ASP A CA 1 
ATOM 834  C CA . ARG A 1  1291 ? 209.215 193.269 218.651 1.00 395.53 ? 1291 ARG A CA 1 
ATOM 835  C CA . GLU A 1  1292 ? 211.448 190.225 217.888 1.00 401.67 ? 1292 GLU A CA 1 
ATOM 836  C CA . SER A 1  1293 ? 211.377 191.216 214.164 1.00 394.87 ? 1293 SER A CA 1 
ATOM 837  C CA . TYR A 1  1294 ? 212.610 194.750 215.002 1.00 500.00 ? 1294 TYR A CA 1 
ATOM 838  C CA . SER A 1  1295 ? 215.568 193.389 217.005 1.00 500.00 ? 1295 SER A CA 1 
ATOM 839  C CA . LEU A 1  1296 ? 216.619 191.058 214.159 1.00 500.00 ? 1296 LEU A CA 1 
ATOM 840  C CA . ALA A 1  1297 ? 216.427 193.985 211.680 1.00 500.00 ? 1297 ALA A CA 1 
ATOM 841  C CA . ALA A 1  1298 ? 218.635 196.156 213.956 1.00 500.00 ? 1298 ALA A CA 1 
ATOM 842  C CA . GLY A 1  1299 ? 221.155 193.368 214.693 1.00 500.00 ? 1299 GLY A CA 1 
ATOM 843  C CA . LEU A 1  1300 ? 221.409 192.364 211.021 1.00 492.88 ? 1300 LEU A CA 1 
ATOM 844  C CA . ALA A 1  1301 ? 221.763 196.048 209.991 1.00 500.00 ? 1301 ALA A CA 1 
ATOM 845  C CA . LEU A 1  1302 ? 224.602 196.587 212.516 1.00 457.35 ? 1302 LEU A CA 1 
ATOM 846  C CA . GLY A 1  1303 ? 226.410 193.571 211.013 1.00 280.62 ? 1303 GLY A CA 1 
ATOM 847  C CA . MET A 1  1304 ? 226.236 195.016 207.499 1.00 139.01 ? 1304 MET A CA 1 
ATOM 848  C CA . VAL A 1  1305 ? 227.705 198.369 208.609 1.00 165.53 ? 1305 VAL A CA 1 
ATOM 849  C CA . CYS A 1  1306 ? 230.852 196.720 210.089 1.00 297.23 ? 1306 CYS A CA 1 
ATOM 850  C CA . LEU A 1  1307 ? 230.832 193.714 207.669 1.00 195.29 ? 1307 LEU A CA 1 
ATOM 851  C CA . GLY A 1  1308 ? 233.960 191.783 208.690 1.00 186.18 ? 1308 GLY A CA 1 
ATOM 852  C CA . HIS A 1  1309 ? 236.239 194.725 209.469 1.00 335.57 ? 1309 HIS A CA 1 
ATOM 853  C CA . GLY A 1  1310 ? 237.467 192.749 212.516 1.00 394.63 ? 1310 GLY A CA 1 
ATOM 854  C CA . SER A 1  1311 ? 237.944 193.062 216.289 1.00 406.07 ? 1311 SER A CA 1 
ATOM 855  C CA . ASN A 1  1312 ? 239.869 196.414 216.633 1.00 347.40 ? 1312 ASN A CA 1 
ATOM 856  C CA . LEU A 1  1313 ? 238.202 199.033 214.418 1.00 278.35 ? 1313 LEU A CA 1 
ATOM 857  C CA . ILE A 1  1314 ? 238.955 202.692 213.573 1.00 270.54 ? 1314 ILE A CA 1 
ATOM 858  C CA . GLY A 1  1315 ? 237.639 204.589 216.629 1.00 282.04 ? 1315 GLY A CA 1 
ATOM 859  C CA . MET A 1  1316 ? 234.967 202.200 217.928 1.00 323.89 ? 1316 MET A CA 1 
ATOM 860  C CA . SER A 1  1317 ? 236.917 200.929 220.943 1.00 277.92 ? 1317 SER A CA 1 
ATOM 861  C CA . ASP A 1  1318 ? 235.185 203.554 223.131 1.00 257.07 ? 1318 ASP A CA 1 
ATOM 862  C CA . LEU A 1  1319 ? 231.992 201.635 222.333 1.00 338.35 ? 1319 LEU A CA 1 
ATOM 863  C CA . ASN A 1  1320 ? 231.982 197.874 222.983 1.00 492.21 ? 1320 ASN A CA 1 
ATOM 864  C CA . VAL A 1  1321 ? 230.562 195.718 220.165 1.00 500.00 ? 1321 VAL A CA 1 
ATOM 865  C CA . PRO A 1  1322 ? 231.854 192.249 221.256 1.00 500.00 ? 1322 PRO A CA 1 
ATOM 866  C CA . GLU A 1  1323 ? 230.855 192.916 224.911 1.00 500.00 ? 1323 GLU A CA 1 
ATOM 867  C CA . GLN A 1  1324 ? 227.312 194.017 224.014 1.00 500.00 ? 1324 GLN A CA 1 
ATOM 868  C CA . LEU A 1  1325 ? 226.647 191.277 221.428 1.00 500.00 ? 1325 LEU A CA 1 
ATOM 869  C CA . TYR A 1  1326 ? 227.895 188.584 223.854 1.00 500.00 ? 1326 TYR A CA 1 
ATOM 870  C CA . GLN A 1  1327 ? 225.512 189.838 226.609 1.00 408.47 ? 1327 GLN A CA 1 
ATOM 871  C CA . TYR A 1  1328 ? 222.510 190.122 224.231 1.00 283.19 ? 1328 TYR A CA 1 
ATOM 872  C CA . MET A 1  1329 ? 222.897 186.682 222.690 1.00 178.56 ? 1329 MET A CA 1 
ATOM 873  C CA . VAL A 1  1330 ? 223.940 184.877 225.857 1.00 212.54 ? 1330 VAL A CA 1 
ATOM 874  C CA . GLY A 1  1331 ? 221.723 186.670 228.465 1.00 325.06 ? 1331 GLY A CA 1 
ATOM 875  C CA . GLY A 1  1332 ? 222.200 188.889 231.539 1.00 424.61 ? 1332 GLY A CA 1 
ATOM 876  C CA . HIS A 1  1333 ? 221.823 192.598 232.395 1.00 452.94 ? 1333 HIS A CA 1 
ATOM 877  C CA . GLU A 1  1354 ? 210.619 192.024 231.015 1.00 461.73 ? 1354 GLU A CA 1 
ATOM 878  C CA . GLY A 1  1355 ? 211.588 190.708 234.468 1.00 499.12 ? 1355 GLY A CA 1 
ATOM 879  C CA . ASP A 1  1356 ? 215.240 191.902 234.299 1.00 500.00 ? 1356 ASP A CA 1 
ATOM 880  C CA . THR A 1  1357 ? 218.476 189.932 233.501 1.00 500.00 ? 1357 THR A CA 1 
ATOM 881  C CA . ILE A 1  1358 ? 217.328 190.208 229.810 1.00 440.38 ? 1358 ILE A CA 1 
ATOM 882  C CA . ASN A 1  1359 ? 215.215 187.938 227.578 1.00 302.98 ? 1359 ASN A CA 1 
ATOM 883  C CA . VAL A 1  1360 ? 217.123 186.631 224.642 1.00 135.36 ? 1360 VAL A CA 1 
ATOM 884  C CA . ASP A 1  1361 ? 214.096 185.501 222.761 1.00 203.02 ? 1361 ASP A CA 1 
ATOM 885  C CA . VAL A 1  1362 ? 213.797 188.993 221.211 1.00 331.02 ? 1362 VAL A CA 1 
ATOM 886  C CA . THR A 1  1363 ? 217.532 189.994 221.232 1.00 265.98 ? 1363 THR A CA 1 
ATOM 887  C CA . CYS A 1  1364 ? 219.545 186.826 220.676 1.00 161.39 ? 1364 CYS A CA 1 
ATOM 888  C CA . PRO A 1  1365 ? 218.911 186.061 216.949 1.00 148.38 ? 1365 PRO A CA 1 
ATOM 889  C CA . GLY A 1  1366 ? 220.063 189.505 215.736 1.00 184.43 ? 1366 GLY A CA 1 
ATOM 890  C CA . ALA A 1  1367 ? 223.030 189.471 218.095 1.00 162.45 ? 1367 ALA A CA 1 
ATOM 891  C CA . THR A 1  1368 ? 224.441 186.169 216.649 1.00 182.47 ? 1368 THR A CA 1 
ATOM 892  C CA . LEU A 1  1369 ? 223.908 187.508 213.143 1.00 239.72 ? 1369 LEU A CA 1 
ATOM 893  C CA . ALA A 1  1370 ? 225.858 190.724 213.866 1.00 320.94 ? 1370 ALA A CA 1 
ATOM 894  C CA . LEU A 1  1371 ? 228.832 188.644 215.146 1.00 377.07 ? 1371 LEU A CA 1 
ATOM 895  C CA . ALA A 1  1372 ? 228.743 186.557 211.876 1.00 256.31 ? 1372 ALA A CA 1 
ATOM 896  C CA . MET A 1  1373 ? 229.103 189.696 209.677 1.00 182.56 ? 1373 MET A CA 1 
ATOM 897  C CA . ILE A 1  1374 ? 231.459 191.875 211.914 1.00 329.50 ? 1374 ILE A CA 1 
ATOM 898  C CA . TYR A 1  1375 ? 233.910 188.957 212.169 1.00 339.05 ? 1375 TYR A CA 1 
ATOM 899  C CA . LEU A 1  1376 ? 233.326 187.379 208.809 1.00 171.80 ? 1376 LEU A CA 1 
ATOM 900  C CA . LYS A 1  1377 ? 236.124 185.116 207.659 1.00 198.20 ? 1377 LYS A CA 1 
ATOM 901  C CA . THR A 1  1378 ? 238.242 186.954 210.259 1.00 237.67 ? 1378 THR A CA 1 
ATOM 902  C CA . ASN A 1  1379 ? 238.851 183.522 211.809 1.00 222.23 ? 1379 ASN A CA 1 
ATOM 903  C CA . ASN A 1  1380 ? 238.351 184.642 215.343 1.00 237.90 ? 1380 ASN A CA 1 
ATOM 904  C CA . ARG A 1  1381 ? 238.484 181.363 217.374 1.00 228.56 ? 1381 ARG A CA 1 
ATOM 905  C CA . SER A 1  1382 ? 237.728 183.666 220.432 1.00 345.72 ? 1382 SER A CA 1 
ATOM 906  C CA . ILE A 1  1383 ? 234.262 184.720 219.165 1.00 237.58 ? 1383 ILE A CA 1 
ATOM 907  C CA . ALA A 1  1384 ? 233.781 181.292 217.451 1.00 168.83 ? 1384 ALA A CA 1 
ATOM 908  C CA . ASP A 1  1385 ? 234.424 179.505 220.898 1.00 291.57 ? 1385 ASP A CA 1 
ATOM 909  C CA . TRP A 1  1386 ? 231.580 181.271 222.683 1.00 382.01 ? 1386 TRP A CA 1 
ATOM 910  C CA . LEU A 1  1387 ? 229.443 180.979 219.528 1.00 223.68 ? 1387 LEU A CA 1 
ATOM 911  C CA . ARG A 1  1388 ? 230.157 177.206 219.949 1.00 200.61 ? 1388 ARG A CA 1 
ATOM 912  C CA . ALA A 1  1389 ? 227.313 174.777 220.798 1.00 209.76 ? 1389 ALA A CA 1 
ATOM 913  C CA . PRO A 1  1390 ? 227.157 174.246 224.622 1.00 211.70 ? 1390 PRO A CA 1 
ATOM 914  C CA . ASP A 1  1391 ? 228.391 170.559 225.001 1.00 263.19 ? 1391 ASP A CA 1 
ATOM 915  C CA . THR A 1  1392 ? 226.932 169.899 228.523 1.00 215.35 ? 1392 THR A CA 1 
ATOM 916  C CA . MET A 1  1393 ? 223.412 168.687 229.394 1.00 187.30 ? 1393 MET A CA 1 
ATOM 917  C CA . TYR A 1  1394 ? 222.853 171.870 231.495 1.00 231.78 ? 1394 TYR A CA 1 
ATOM 918  C CA . LEU A 1  1395 ? 223.916 174.477 228.995 1.00 202.12 ? 1395 LEU A CA 1 
ATOM 919  C CA . LEU A 1  1396 ? 221.805 173.037 226.075 1.00 187.68 ? 1396 LEU A CA 1 
ATOM 920  C CA . ASP A 1  1397 ? 218.687 173.678 228.213 1.00 212.07 ? 1397 ASP A CA 1 
ATOM 921  C CA . PHE A 1  1398 ? 219.242 177.449 228.022 1.00 223.35 ? 1398 PHE A CA 1 
ATOM 922  C CA . VAL A 1  1399 ? 219.572 177.570 224.207 1.00 212.69 ? 1399 VAL A CA 1 
ATOM 923  C CA . LYS A 1  1400 ? 216.408 177.590 222.090 1.00 166.58 ? 1400 LYS A CA 1 
ATOM 924  C CA . PRO A 1  1401 ? 216.846 174.843 219.472 1.00 207.29 ? 1401 PRO A CA 1 
ATOM 925  C CA . GLU A 1  1402 ? 215.874 177.388 216.787 1.00 181.35 ? 1402 GLU A CA 1 
ATOM 926  C CA . PHE A 1  1403 ? 218.860 179.773 217.680 1.00 160.32 ? 1403 PHE A CA 1 
ATOM 927  C CA . LEU A 1  1404 ? 221.158 176.770 217.769 1.00 182.16 ? 1404 LEU A CA 1 
ATOM 928  C CA . LEU A 1  1405 ? 220.731 176.750 213.982 1.00 164.66 ? 1405 LEU A CA 1 
ATOM 929  C CA . LEU A 1  1406 ? 221.677 180.482 213.745 1.00 159.82 ? 1406 LEU A CA 1 
ATOM 930  C CA . ARG A 1  1407 ? 224.496 179.833 216.161 1.00 128.67 ? 1407 ARG A CA 1 
ATOM 931  C CA . THR A 1  1408 ? 225.881 176.987 213.989 1.00 143.30 ? 1408 THR A CA 1 
ATOM 932  C CA . LEU A 1  1409 ? 225.732 179.042 210.794 1.00 144.14 ? 1409 LEU A CA 1 
ATOM 933  C CA . ALA A 1  1410 ? 227.259 182.171 212.320 1.00 179.23 ? 1410 ALA A CA 1 
ATOM 934  C CA . ARG A 1  1411 ? 230.175 180.215 213.741 1.00 153.13 ? 1411 ARG A CA 1 
ATOM 935  C CA . CYS A 1  1412 ? 231.182 178.619 210.403 1.00 145.08 ? 1412 CYS A CA 1 
ATOM 936  C CA . LEU A 1  1413 ? 230.975 181.892 208.516 1.00 138.26 ? 1413 LEU A CA 1 
ATOM 937  C CA . ILE A 1  1414 ? 233.510 183.198 211.042 1.00 122.73 ? 1414 ILE A CA 1 
ATOM 938  C CA . LEU A 1  1415 ? 235.768 180.080 210.525 1.00 175.70 ? 1415 LEU A CA 1 
ATOM 939  C CA . TRP A 1  1416 ? 235.618 180.371 206.693 1.00 178.00 ? 1416 TRP A CA 1 
ATOM 940  C CA . ASP A 1  1417 ? 238.735 178.398 205.979 1.00 216.26 ? 1417 ASP A CA 1 
ATOM 941  C CA . ASP A 1  1418 ? 237.746 175.585 208.339 1.00 251.16 ? 1418 ASP A CA 1 
ATOM 942  C CA . ILE A 1  1419 ? 234.686 174.522 206.236 1.00 180.39 ? 1419 ILE A CA 1 
ATOM 943  C CA . LEU A 1  1420 ? 234.967 171.192 204.397 1.00 182.45 ? 1420 LEU A CA 1 
ATOM 944  C CA . PRO A 1  1421 ? 232.351 169.687 201.994 1.00 199.23 ? 1421 PRO A CA 1 
ATOM 945  C CA . ASN A 1  1422 ? 233.058 166.183 203.462 1.00 199.65 ? 1422 ASN A CA 1 
ATOM 946  C CA . SER A 1  1423 ? 229.975 164.735 205.252 1.00 210.51 ? 1423 SER A CA 1 
ATOM 947  C CA . LYS A 1  1424 ? 232.262 164.070 208.245 1.00 260.15 ? 1424 LYS A CA 1 
ATOM 948  C CA . TRP A 1  1425 ? 232.804 167.849 208.858 1.00 207.19 ? 1425 TRP A CA 1 
ATOM 949  C CA . VAL A 1  1426 ? 229.042 168.463 209.183 1.00 198.34 ? 1426 VAL A CA 1 
ATOM 950  C CA . ASP A 1  1427 ? 228.720 165.487 211.597 1.00 260.66 ? 1427 ASP A CA 1 
ATOM 951  C CA . SER A 1  1428 ? 231.632 166.884 213.654 1.00 232.98 ? 1428 SER A CA 1 
ATOM 952  C CA . ASN A 1  1429 ? 229.823 170.117 214.631 1.00 201.19 ? 1429 ASN A CA 1 
ATOM 953  C CA . VAL A 1  1430 ? 227.239 168.417 216.877 1.00 249.78 ? 1430 VAL A CA 1 
ATOM 954  C CA . PRO A 1  1431 ? 228.389 167.927 220.567 1.00 211.93 ? 1431 PRO A CA 1 
ATOM 955  C CA . GLN A 1  1432 ? 229.315 164.621 222.284 1.00 236.26 ? 1432 GLN A CA 1 
ATOM 956  C CA . ILE A 1  1433 ? 226.151 164.648 224.417 1.00 220.67 ? 1433 ILE A CA 1 
ATOM 957  C CA . ILE A 1  1434 ? 224.196 164.513 221.133 1.00 211.51 ? 1434 ILE A CA 1 
ATOM 958  C CA . ARG A 1  1435 ? 226.544 162.442 218.943 1.00 204.76 ? 1435 ARG A CA 1 
ATOM 959  C CA . GLU A 1  1436 ? 226.298 159.821 221.760 1.00 225.84 ? 1436 GLU A CA 1 
ATOM 960  C CA . ASN A 1  1437 ? 222.496 159.951 222.239 1.00 229.47 ? 1437 ASN A CA 1 
ATOM 961  C CA . LEU A 1  1452 ? 218.269 162.638 229.407 1.00 295.16 ? 1452 LEU A CA 1 
ATOM 962  C CA . ASN A 1  1453 ? 215.752 164.925 227.679 1.00 198.77 ? 1453 ASN A CA 1 
ATOM 963  C CA . LEU A 1  1454 ? 215.396 163.577 224.177 1.00 199.59 ? 1454 LEU A CA 1 
ATOM 964  C CA . GLU A 1  1455 ? 213.141 166.493 223.167 1.00 216.05 ? 1455 GLU A CA 1 
ATOM 965  C CA . THR A 1  1456 ? 215.930 168.990 224.019 1.00 202.75 ? 1456 THR A CA 1 
ATOM 966  C CA . LEU A 1  1457 ? 218.573 166.697 222.543 1.00 202.19 ? 1457 LEU A CA 1 
ATOM 967  C CA . SER A 1  1458 ? 216.626 165.491 219.479 1.00 208.97 ? 1458 SER A CA 1 
ATOM 968  C CA . GLN A 1  1459 ? 215.557 168.942 218.347 1.00 155.57 ? 1459 GLN A CA 1 
ATOM 969  C CA . ALA A 1  1460 ? 218.967 170.506 218.861 1.00 134.64 ? 1460 ALA A CA 1 
ATOM 970  C CA . HIS A 1  1461 ? 220.674 167.694 216.918 1.00 144.57 ? 1461 HIS A CA 1 
ATOM 971  C CA . VAL A 1  1462 ? 218.687 168.329 213.746 1.00 204.52 ? 1462 VAL A CA 1 
ATOM 972  C CA . TYR A 1  1463 ? 219.026 172.193 214.084 1.00 308.79 ? 1463 TYR A CA 1 
ATOM 973  C CA . ILE A 1  1464 ? 222.761 172.058 214.756 1.00 270.31 ? 1464 ILE A CA 1 
ATOM 974  C CA . ILE A 1  1465 ? 223.289 170.118 211.486 1.00 144.43 ? 1465 ILE A CA 1 
ATOM 975  C CA . ALA A 1  1466 ? 220.802 172.373 209.728 1.00 156.94 ? 1466 ALA A CA 1 
ATOM 976  C CA . GLY A 1  1467 ? 222.724 175.566 210.558 1.00 154.76 ? 1467 GLY A CA 1 
ATOM 977  C CA . ALA A 1  1468 ? 226.004 173.771 209.769 1.00 164.52 ? 1468 ALA A CA 1 
ATOM 978  C CA . CYS A 1  1469 ? 224.953 172.465 206.367 1.00 140.11 ? 1469 CYS A CA 1 
ATOM 979  C CA . LEU A 1  1470 ? 223.285 175.883 205.713 1.00 147.34 ? 1470 LEU A CA 1 
ATOM 980  C CA . SER A 1  1471 ? 226.559 177.503 206.514 1.00 136.50 ? 1471 SER A CA 1 
ATOM 981  C CA . LEU A 1  1472 ? 228.114 175.060 204.042 1.00 138.50 ? 1472 LEU A CA 1 
ATOM 982  C CA . GLY A 1  1473 ? 225.534 176.378 201.511 1.00 127.41 ? 1473 GLY A CA 1 
ATOM 983  C CA . PHE A 1  1474 ? 226.590 179.987 202.301 1.00 137.58 ? 1474 PHE A CA 1 
ATOM 984  C CA . ARG A 1  1475 ? 230.184 178.940 201.649 1.00 120.71 ? 1475 ARG A CA 1 
ATOM 985  C CA . PHE A 1  1476 ? 229.472 177.269 198.387 1.00 138.28 ? 1476 PHE A CA 1 
ATOM 986  C CA . ALA A 1  1477 ? 226.931 179.758 197.057 1.00 145.13 ? 1477 ALA A CA 1 
ATOM 987  C CA . GLY A 1  1478 ? 226.980 179.340 193.262 1.00 175.19 ? 1478 GLY A CA 1 
ATOM 988  C CA . SER A 1  1479 ? 230.171 177.339 192.917 1.00 186.22 ? 1479 SER A CA 1 
ATOM 989  C CA . GLU A 1  1480 ? 227.788 174.421 192.061 1.00 198.21 ? 1480 GLU A CA 1 
ATOM 990  C CA . ASN A 1  1481 ? 230.169 172.259 194.048 1.00 233.81 ? 1481 ASN A CA 1 
ATOM 991  C CA . LEU A 1  1482 ? 230.459 168.467 193.467 1.00 186.01 ? 1482 LEU A CA 1 
ATOM 992  C CA . SER A 1  1483 ? 231.302 167.065 196.887 1.00 196.24 ? 1483 SER A CA 1 
ATOM 993  C CA . ALA A 1  1484 ? 229.463 169.744 198.862 1.00 145.49 ? 1484 ALA A CA 1 
ATOM 994  C CA . PHE A 1  1485 ? 226.402 168.653 196.798 1.00 139.42 ? 1485 PHE A CA 1 
ATOM 995  C CA . ASN A 1  1486 ? 226.998 164.930 197.554 1.00 179.04 ? 1486 ASN A CA 1 
ATOM 996  C CA . CYS A 1  1487 ? 226.921 165.470 201.334 1.00 237.17 ? 1487 CYS A CA 1 
ATOM 997  C CA . LEU A 1  1488 ? 223.993 168.031 201.290 1.00 193.78 ? 1488 LEU A CA 1 
ATOM 998  C CA . HIS A 1  1489 ? 222.004 165.833 198.911 1.00 154.11 ? 1489 HIS A CA 1 
ATOM 999  C CA . LYS A 1  1490 ? 222.445 163.010 201.434 1.00 199.20 ? 1490 LYS A CA 1 
ATOM 1000 C CA . PHE A 1  1491 ? 221.440 165.253 204.343 1.00 156.98 ? 1491 PHE A CA 1 
ATOM 1001 C CA . ALA A 1  1492 ? 218.257 166.233 202.509 1.00 170.91 ? 1492 ALA A CA 1 
ATOM 1002 C CA . LYS A 1  1493 ? 217.334 162.630 201.835 1.00 202.95 ? 1493 LYS A CA 1 
ATOM 1003 C CA . ASP A 1  1494 ? 218.311 161.957 205.553 1.00 284.06 ? 1494 ASP A CA 1 
ATOM 1004 C CA . PHE A 1  1495 ? 216.043 164.789 206.886 1.00 335.68 ? 1495 PHE A CA 1 
ATOM 1005 C CA . MET A 1  1496 ? 213.046 163.425 204.868 1.00 323.56 ? 1496 MET A CA 1 
ATOM 1006 C CA . THR A 1  1497 ? 213.422 159.914 206.447 1.00 322.46 ? 1497 THR A CA 1 
ATOM 1007 C CA . TYR A 1  1498 ? 213.410 161.344 210.040 1.00 272.79 ? 1498 TYR A CA 1 
ATOM 1008 C CA . LEU A 1  1499 ? 209.824 162.730 209.488 1.00 302.76 ? 1499 LEU A CA 1 
ATOM 1009 C CA . SER A 1  1500 ? 208.611 159.382 208.097 1.00 357.25 ? 1500 SER A CA 1 
ATOM 1010 C CA . ALA A 1  1501 ? 209.712 157.494 211.214 1.00 241.36 ? 1501 ALA A CA 1 
ATOM 1011 C CA . PRO A 1  1502 ? 208.815 156.906 214.844 1.00 280.07 ? 1502 PRO A CA 1 
ATOM 1012 C CA . ASN A 1  1503 ? 210.769 159.565 216.818 1.00 268.50 ? 1503 ASN A CA 1 
ATOM 1013 C CA . ALA A 1  1504 ? 209.164 162.150 214.492 1.00 231.35 ? 1504 ALA A CA 1 
ATOM 1014 C CA . SER A 1  1505 ? 206.657 162.874 217.236 1.00 240.52 ? 1505 SER A CA 1 
ATOM 1015 C CA . VAL A 1  1506 ? 209.308 163.680 219.912 1.00 233.65 ? 1506 VAL A CA 1 
ATOM 1016 C CA . THR A 1  1507 ? 211.442 166.029 217.770 1.00 202.13 ? 1507 THR A CA 1 
ATOM 1017 C CA . GLY A 1  1508 ? 208.318 167.850 216.470 1.00 211.09 ? 1508 GLY A CA 1 
ATOM 1018 C CA . PRO A 1  1509 ? 207.058 167.736 212.823 1.00 216.41 ? 1509 PRO A CA 1 
ATOM 1019 C CA . HIS A 1  1510 ? 207.258 171.527 212.720 1.00 199.08 ? 1510 HIS A CA 1 
ATOM 1020 C CA . ASN A 1  1511 ? 210.794 171.576 214.076 1.00 157.58 ? 1511 ASN A CA 1 
ATOM 1021 C CA . LEU A 1  1512 ? 211.836 169.034 211.438 1.00 280.22 ? 1512 LEU A CA 1 
ATOM 1022 C CA . GLU A 1  1513 ? 210.276 171.037 208.499 1.00 415.40 ? 1513 GLU A CA 1 
ATOM 1023 C CA . THR A 1  1514 ? 212.316 174.156 209.471 1.00 377.70 ? 1514 THR A CA 1 
ATOM 1024 C CA . CYS A 1  1515 ? 215.634 172.289 209.321 1.00 388.25 ? 1515 CYS A CA 1 
ATOM 1025 C CA . LEU A 1  1516 ? 214.562 170.397 206.103 1.00 413.42 ? 1516 LEU A CA 1 
ATOM 1026 C CA . SER A 1  1517 ? 213.924 173.719 204.306 1.00 361.67 ? 1517 SER A CA 1 
ATOM 1027 C CA . VAL A 1  1518 ? 217.412 174.865 205.571 1.00 181.54 ? 1518 VAL A CA 1 
ATOM 1028 C CA . VAL A 1  1519 ? 219.346 171.760 204.293 1.00 153.88 ? 1519 VAL A CA 1 
ATOM 1029 C CA . LEU A 1  1520 ? 217.640 172.034 200.854 1.00 155.03 ? 1520 LEU A CA 1 
ATOM 1030 C CA . LEU A 1  1521 ? 218.134 175.898 200.556 1.00 221.98 ? 1521 LEU A CA 1 
ATOM 1031 C CA . SER A 1  1522 ? 221.800 175.272 201.214 1.00 138.25 ? 1522 SER A CA 1 
ATOM 1032 C CA . LEU A 1  1523 ? 221.510 172.733 198.456 1.00 147.94 ? 1523 LEU A CA 1 
ATOM 1033 C CA . ALA A 1  1524 ? 219.922 175.164 196.019 1.00 158.37 ? 1524 ALA A CA 1 
ATOM 1034 C CA . MET A 1  1525 ? 222.369 177.867 197.099 1.00 149.09 ? 1525 MET A CA 1 
ATOM 1035 C CA . VAL A 1  1526 ? 225.445 175.664 196.461 1.00 165.98 ? 1526 VAL A CA 1 
ATOM 1036 C CA . MET A 1  1527 ? 224.310 174.779 192.997 1.00 166.06 ? 1527 MET A CA 1 
ATOM 1037 C CA . ALA A 1  1528 ? 222.352 177.915 192.279 1.00 166.47 ? 1528 ALA A CA 1 
ATOM 1038 C CA . GLY A 1  1529 ? 221.550 179.251 188.884 1.00 120.14 ? 1529 GLY A CA 1 
ATOM 1039 C CA . SER A 1  1530 ? 222.193 175.811 187.456 1.00 177.11 ? 1530 SER A CA 1 
ATOM 1040 C CA . GLY A 1  1531 ? 218.918 173.922 187.335 1.00 139.16 ? 1531 GLY A CA 1 
ATOM 1041 C CA . ASN A 1  1532 ? 219.443 170.401 188.525 1.00 174.50 ? 1532 ASN A CA 1 
ATOM 1042 C CA . LEU A 1  1533 ? 216.981 167.561 187.949 1.00 169.33 ? 1533 LEU A CA 1 
ATOM 1043 C CA . LYS A 1  1534 ? 218.327 166.162 191.280 1.00 172.53 ? 1534 LYS A CA 1 
ATOM 1044 C CA . VAL A 1  1535 ? 217.496 169.196 193.375 1.00 155.92 ? 1535 VAL A CA 1 
ATOM 1045 C CA . LEU A 1  1536 ? 214.563 170.186 191.257 1.00 150.03 ? 1536 LEU A CA 1 
ATOM 1046 C CA . GLN A 1  1537 ? 212.920 166.771 191.613 1.00 170.64 ? 1537 GLN A CA 1 
ATOM 1047 C CA . LEU A 1  1538 ? 213.539 167.119 195.359 1.00 175.52 ? 1538 LEU A CA 1 
ATOM 1048 C CA . CYS A 1  1539 ? 211.927 170.599 195.249 1.00 173.57 ? 1539 CYS A CA 1 
ATOM 1049 C CA . ARG A 1  1540 ? 209.065 169.372 193.061 1.00 164.75 ? 1540 ARG A CA 1 
ATOM 1050 C CA . PHE A 1  1541 ? 208.258 166.586 195.578 1.00 226.47 ? 1541 PHE A CA 1 
ATOM 1051 C CA . LEU A 1  1542 ? 207.997 169.149 198.418 1.00 187.84 ? 1542 LEU A CA 1 
ATOM 1052 C CA . HIS A 1  1543 ? 205.976 171.656 196.337 1.00 190.06 ? 1543 HIS A CA 1 
ATOM 1053 C CA . MET A 1  1544 ? 203.482 168.859 195.563 1.00 160.84 ? 1544 MET A CA 1 
ATOM 1054 C CA . LYS A 1  1545 ? 203.267 167.970 199.322 1.00 225.98 ? 1545 LYS A CA 1 
ATOM 1055 C CA . THR A 1  1546 ? 200.999 170.834 200.694 1.00 397.52 ? 1546 THR A CA 1 
ATOM 1056 C CA . GLY A 1  1547 ? 198.309 169.636 203.200 1.00 424.14 ? 1547 GLY A CA 1 
ATOM 1057 C CA . GLY A 1  1548 ? 198.402 170.121 206.997 1.00 343.65 ? 1548 GLY A CA 1 
ATOM 1058 C CA . GLU A 1  1549 ? 201.572 171.077 208.948 1.00 189.89 ? 1549 GLU A CA 1 
ATOM 1059 C CA . MET A 1  1550 ? 202.894 172.742 205.824 1.00 217.19 ? 1550 MET A CA 1 
ATOM 1060 C CA . ASN A 1  1551 ? 202.263 176.440 206.542 1.00 397.54 ? 1551 ASN A CA 1 
ATOM 1061 C CA . TYR A 1  1552 ? 202.726 179.531 204.301 1.00 408.24 ? 1552 TYR A CA 1 
ATOM 1062 C CA . GLY A 1  1553 ? 206.330 179.973 205.576 1.00 419.09 ? 1553 GLY A CA 1 
ATOM 1063 C CA . PHE A 1  1554 ? 207.546 176.537 204.449 1.00 453.49 ? 1554 PHE A CA 1 
ATOM 1064 C CA . HIS A 1  1555 ? 205.933 176.913 200.996 1.00 463.94 ? 1555 HIS A CA 1 
ATOM 1065 C CA . LEU A 1  1556 ? 207.851 180.231 200.675 1.00 440.11 ? 1556 LEU A CA 1 
ATOM 1066 C CA . ALA A 1  1557 ? 211.137 178.409 201.482 1.00 272.98 ? 1557 ALA A CA 1 
ATOM 1067 C CA . HIS A 1  1558 ? 210.496 175.604 199.084 1.00 131.43 ? 1558 HIS A CA 1 
ATOM 1068 C CA . HIS A 1  1559 ? 209.883 177.886 196.270 1.00 162.58 ? 1559 HIS A CA 1 
ATOM 1069 C CA . MET A 1  1560 ? 212.724 180.140 197.282 1.00 279.47 ? 1560 MET A CA 1 
ATOM 1070 C CA . ALA A 1  1561 ? 214.861 176.988 196.881 1.00 187.68 ? 1561 ALA A CA 1 
ATOM 1071 C CA . LEU A 1  1562 ? 213.353 176.126 193.495 1.00 117.84 ? 1562 LEU A CA 1 
ATOM 1072 C CA . GLY A 1  1563 ? 213.929 179.659 192.091 1.00 113.92 ? 1563 GLY A CA 1 
ATOM 1073 C CA . LEU A 1  1564 ? 217.535 179.721 193.216 1.00 121.95 ? 1564 LEU A CA 1 
ATOM 1074 C CA . LEU A 1  1565 ? 218.163 176.571 191.138 1.00 126.26 ? 1565 LEU A CA 1 
ATOM 1075 C CA . PHE A 1  1566 ? 216.991 178.635 188.217 1.00 138.20 ? 1566 PHE A CA 1 
ATOM 1076 C CA . LEU A 1  1567 ? 218.253 182.025 189.346 1.00 106.24 ? 1567 LEU A CA 1 
ATOM 1077 C CA . GLY A 1  1568 ? 218.064 184.466 186.441 1.00 144.90 ? 1568 GLY A CA 1 
ATOM 1078 C CA . GLY A 1  1569 ? 216.749 181.606 184.280 1.00 165.33 ? 1569 GLY A CA 1 
ATOM 1079 C CA . GLY A 1  1570 ? 220.238 180.158 184.357 1.00 132.01 ? 1570 GLY A CA 1 
ATOM 1080 C CA . ARG A 1  1571 ? 221.780 183.637 183.910 1.00 144.85 ? 1571 ARG A CA 1 
ATOM 1081 C CA . TYR A 1  1572 ? 222.584 184.712 187.447 1.00 160.19 ? 1572 TYR A CA 1 
ATOM 1082 C CA . SER A 1  1573 ? 224.384 182.688 190.144 1.00 159.97 ? 1573 SER A CA 1 
ATOM 1083 C CA . LEU A 1  1574 ? 224.578 184.257 193.557 1.00 147.60 ? 1574 LEU A CA 1 
ATOM 1084 C CA . SER A 1  1575 ? 228.140 184.883 194.671 1.00 233.52 ? 1575 SER A CA 1 
ATOM 1085 C CA . THR A 1  1576 ? 229.577 185.066 198.171 1.00 242.79 ? 1576 THR A CA 1 
ATOM 1086 C CA . SER A 1  1577 ? 231.910 188.085 197.957 1.00 241.44 ? 1577 SER A CA 1 
ATOM 1087 C CA . ASN A 1  1578 ? 231.780 189.560 201.436 1.00 213.55 ? 1578 ASN A CA 1 
ATOM 1088 C CA . SER A 1  1579 ? 228.929 192.100 201.069 1.00 211.55 ? 1579 SER A CA 1 
ATOM 1089 C CA . SER A 1  1580 ? 226.833 189.641 199.119 1.00 198.81 ? 1580 SER A CA 1 
ATOM 1090 C CA . ILE A 1  1581 ? 226.724 187.192 202.086 1.00 157.57 ? 1581 ILE A CA 1 
ATOM 1091 C CA . ALA A 1  1582 ? 225.043 190.105 203.842 1.00 160.68 ? 1582 ALA A CA 1 
ATOM 1092 C CA . ALA A 1  1583 ? 222.253 190.158 201.211 1.00 204.14 ? 1583 ALA A CA 1 
ATOM 1093 C CA . LEU A 1  1584 ? 221.840 186.365 201.290 1.00 163.65 ? 1584 LEU A CA 1 
ATOM 1094 C CA . LEU A 1  1585 ? 221.642 186.214 205.109 1.00 156.87 ? 1585 LEU A CA 1 
ATOM 1095 C CA . CYS A 1  1586 ? 218.719 188.636 205.207 1.00 260.78 ? 1586 CYS A CA 1 
ATOM 1096 C CA . ALA A 1  1587 ? 216.860 186.677 202.470 1.00 307.14 ? 1587 ALA A CA 1 
ATOM 1097 C CA . LEU A 1  1588 ? 217.791 183.189 203.778 1.00 330.15 ? 1588 LEU A CA 1 
ATOM 1098 C CA . TYR A 1  1589 ? 217.296 183.719 207.568 1.00 444.91 ? 1589 TYR A CA 1 
ATOM 1099 C CA . PRO A 1  1590 ? 216.197 180.267 209.042 1.00 407.22 ? 1590 PRO A CA 1 
ATOM 1100 C CA . HIS A 1  1591 ? 212.848 181.323 210.664 1.00 484.53 ? 1591 HIS A CA 1 
ATOM 1101 C CA . PHE A 1  1592 ? 209.841 181.390 208.305 1.00 482.60 ? 1592 PHE A CA 1 
ATOM 1102 C CA . PRO A 1  1593 ? 206.544 183.425 208.660 1.00 468.80 ? 1593 PRO A CA 1 
ATOM 1103 C CA . ALA A 1  1594 ? 203.693 181.827 210.690 1.00 347.36 ? 1594 ALA A CA 1 
ATOM 1104 C CA . HIS A 1  1595 ? 201.176 182.572 207.889 1.00 380.67 ? 1595 HIS A CA 1 
ATOM 1105 C CA . SER A 1  1596 ? 200.681 185.167 205.072 1.00 465.28 ? 1596 SER A CA 1 
ATOM 1106 C CA . THR A 1  1597 ? 199.968 188.628 206.629 1.00 306.97 ? 1597 THR A CA 1 
ATOM 1107 C CA . ASP A 1  1598 ? 202.040 187.579 209.729 1.00 241.78 ? 1598 ASP A CA 1 
ATOM 1108 C CA . ASN A 1  1599 ? 205.700 188.425 210.166 1.00 255.44 ? 1599 ASN A CA 1 
ATOM 1109 C CA . ARG A 1  1600 ? 206.434 188.439 213.858 1.00 184.33 ? 1600 ARG A CA 1 
ATOM 1110 C CA . TYR A 1  1601 ? 210.065 187.269 213.592 1.00 335.30 ? 1601 TYR A CA 1 
ATOM 1111 C CA . HIS A 1  1602 ? 211.475 188.520 210.259 1.00 407.79 ? 1602 HIS A CA 1 
ATOM 1112 C CA . LEU A 1  1603 ? 209.455 190.946 208.045 1.00 415.71 ? 1603 LEU A CA 1 
ATOM 1113 C CA . GLN A 1  1604 ? 208.516 189.409 204.670 1.00 435.84 ? 1604 GLN A CA 1 
ATOM 1114 C CA . ALA A 1  1605 ? 209.816 192.168 202.319 1.00 441.95 ? 1605 ALA A CA 1 
ATOM 1115 C CA . LEU A 1  1606 ? 213.464 191.285 203.194 1.00 402.36 ? 1606 LEU A CA 1 
ATOM 1116 C CA . ARG A 1  1607 ? 213.031 188.004 201.252 1.00 404.66 ? 1607 ARG A CA 1 
ATOM 1117 C CA . HIS A 1  1608 ? 213.698 189.956 198.001 1.00 257.83 ? 1608 HIS A CA 1 
ATOM 1118 C CA . LEU A 1  1609 ? 217.102 190.999 199.193 1.00 118.30 ? 1609 LEU A CA 1 
ATOM 1119 C CA . TYR A 1  1610 ? 218.633 187.968 197.242 1.00 141.30 ? 1610 TYR A CA 1 
ATOM 1120 C CA . VAL A 1  1611 ? 218.647 190.207 194.227 1.00 112.07 ? 1611 VAL A CA 1 
ATOM 1121 C CA . LEU A 1  1612 ? 221.791 192.106 195.536 1.00 170.73 ? 1612 LEU A CA 1 
ATOM 1122 C CA . ALA A 1  1613 ? 223.358 188.645 196.205 1.00 160.65 ? 1613 ALA A CA 1 
ATOM 1123 C CA . ALA A 1  1614 ? 222.925 187.590 192.582 1.00 123.57 ? 1614 ALA A CA 1 
ATOM 1124 C CA . GLU A 1  1615 ? 225.698 188.260 190.047 1.00 154.46 ? 1615 GLU A CA 1 
ATOM 1125 C CA . PRO A 1  1616 ? 225.694 187.324 186.289 1.00 204.48 ? 1616 PRO A CA 1 
ATOM 1126 C CA . ARG A 1  1617 ? 228.171 184.528 185.558 1.00 212.41 ? 1617 ARG A CA 1 
ATOM 1127 C CA . LEU A 1  1618 ? 226.473 182.649 182.755 1.00 160.95 ? 1618 LEU A CA 1 
ATOM 1128 C CA . LEU A 1  1619 ? 228.751 182.882 179.797 1.00 177.97 ? 1619 LEU A CA 1 
ATOM 1129 C CA . VAL A 1  1620 ? 227.431 182.200 176.333 1.00 184.66 ? 1620 VAL A CA 1 
ATOM 1130 C CA . PRO A 1  1621 ? 229.486 181.895 173.162 1.00 210.21 ? 1621 PRO A CA 1 
ATOM 1131 C CA . VAL A 1  1622 ? 227.817 183.248 170.086 1.00 217.33 ? 1622 VAL A CA 1 
ATOM 1132 C CA . ASP A 1  1623 ? 228.564 181.658 166.663 1.00 208.87 ? 1623 ASP A CA 1 
ATOM 1133 C CA . VAL A 1  1624 ? 229.790 184.955 165.037 1.00 228.56 ? 1624 VAL A CA 1 
ATOM 1134 C CA . ASP A 1  1625 ? 229.457 183.672 161.467 1.00 291.14 ? 1625 ASP A CA 1 
ATOM 1135 C CA . THR A 1  1626 ? 225.749 183.082 161.985 1.00 216.93 ? 1626 THR A CA 1 
ATOM 1136 C CA . ASN A 1  1627 ? 225.621 185.349 165.119 1.00 205.84 ? 1627 ASN A CA 1 
ATOM 1137 C CA . THR A 1  1628 ? 223.477 182.839 167.005 1.00 185.18 ? 1628 THR A CA 1 
ATOM 1138 C CA . PRO A 1  1629 ? 224.135 181.229 170.360 1.00 172.87 ? 1629 PRO A CA 1 
ATOM 1139 C CA . CYS A 1  1630 ? 225.743 177.727 170.365 1.00 195.81 ? 1630 CYS A CA 1 
ATOM 1140 C CA . TYR A 1  1631 ? 227.675 175.454 172.794 1.00 179.53 ? 1631 TYR A CA 1 
ATOM 1141 C CA . ALA A 1  1632 ? 231.446 175.769 172.840 1.00 152.33 ? 1632 ALA A CA 1 
ATOM 1142 C CA . LEU A 1  1633 ? 234.041 173.721 174.701 1.00 175.31 ? 1633 LEU A CA 1 
ATOM 1143 C CA . LEU A 1  1634 ? 235.916 175.420 177.559 1.00 169.45 ? 1634 LEU A CA 1 
ATOM 1144 C CA . GLU A 1  1635 ? 238.558 174.886 180.190 1.00 246.39 ? 1635 GLU A CA 1 
ATOM 1145 C CA . VAL A 1  1636 ? 238.837 176.867 183.492 1.00 200.02 ? 1636 VAL A CA 1 
ATOM 1146 C CA . THR A 1  1637 ? 241.790 177.195 185.920 1.00 172.02 ? 1637 THR A CA 1 
ATOM 1147 C CA . TYR A 1  1638 ? 241.494 178.409 189.505 1.00 170.82 ? 1638 TYR A CA 1 
ATOM 1148 C CA . LYS A 1  1639 ? 244.374 179.628 191.681 1.00 206.85 ? 1639 LYS A CA 1 
ATOM 1149 C CA . GLY A 1  1640 ? 244.230 177.310 194.755 1.00 224.44 ? 1640 GLY A CA 1 
ATOM 1150 C CA . THR A 1  1641 ? 245.204 179.952 197.378 1.00 283.80 ? 1641 THR A CA 1 
ATOM 1151 C CA . GLN A 1  1642 ? 245.235 177.288 200.095 1.00 235.96 ? 1642 GLN A CA 1 
ATOM 1152 C CA . TRP A 1  1643 ? 242.597 174.686 199.424 1.00 197.03 ? 1643 TRP A CA 1 
ATOM 1153 C CA . TYR A 1  1644 ? 242.917 173.218 195.875 1.00 210.32 ? 1644 TYR A CA 1 
ATOM 1154 C CA . GLU A 1  1645 ? 246.330 173.894 194.220 1.00 259.33 ? 1645 GLU A CA 1 
ATOM 1155 C CA . GLN A 1  1646 ? 245.766 174.861 190.500 1.00 189.42 ? 1646 GLN A CA 1 
ATOM 1156 C CA . THR A 1  1647 ? 243.430 172.732 188.398 1.00 233.28 ? 1647 THR A CA 1 
ATOM 1157 C CA . LYS A 1  1648 ? 241.824 172.871 184.916 1.00 213.30 ? 1648 LYS A CA 1 
ATOM 1158 C CA . GLU A 1  1649 ? 238.218 171.696 184.530 1.00 244.95 ? 1649 GLU A CA 1 
ATOM 1159 C CA . GLU A 1  1650 ? 236.933 171.141 180.948 1.00 203.34 ? 1650 GLU A CA 1 
ATOM 1160 C CA . LEU A 1  1651 ? 233.291 172.252 180.419 1.00 185.86 ? 1651 LEU A CA 1 
ATOM 1161 C CA . MET A 1  1652 ? 230.568 172.987 177.886 1.00 216.47 ? 1652 MET A CA 1 
ATOM 1162 C CA . ALA A 1  1653 ? 230.247 176.723 177.361 1.00 208.85 ? 1653 ALA A CA 1 
ATOM 1163 C CA . PRO A 1  1654 ? 226.667 177.981 177.648 1.00 191.67 ? 1654 PRO A CA 1 
ATOM 1164 C CA . THR A 1  1655 ? 226.970 177.450 181.478 1.00 185.10 ? 1655 THR A CA 1 
ATOM 1165 C CA . LEU A 1  1656 ? 227.988 179.553 184.483 1.00 184.53 ? 1656 LEU A CA 1 
ATOM 1166 C CA . LEU A 1  1657 ? 231.490 180.246 185.655 1.00 192.16 ? 1657 LEU A CA 1 
ATOM 1167 C CA . PRO A 1  1658 ? 233.064 179.659 189.027 1.00 201.44 ? 1658 PRO A CA 1 
ATOM 1168 C CA . GLU A 1  1659 ? 233.218 182.874 191.142 1.00 203.77 ? 1659 GLU A CA 1 
ATOM 1169 C CA . LEU A 1  1660 ? 235.194 185.224 188.917 1.00 202.52 ? 1660 LEU A CA 1 
ATOM 1170 C CA . HIS A 1  1661 ? 237.866 186.370 191.419 1.00 205.53 ? 1661 HIS A CA 1 
ATOM 1171 C CA . LEU A 1  1662 ? 239.331 182.885 191.988 1.00 201.00 ? 1662 LEU A CA 1 
ATOM 1172 C CA . LEU A 1  1663 ? 239.442 181.863 188.324 1.00 225.53 ? 1663 LEU A CA 1 
ATOM 1173 C CA . LYS A 1  1664 ? 242.982 182.110 186.867 1.00 232.71 ? 1664 LYS A CA 1 
ATOM 1174 C CA . GLN A 1  1665 ? 241.946 181.702 183.234 1.00 330.68 ? 1665 GLN A CA 1 
ATOM 1175 C CA . ILE A 1  1666 ? 238.841 180.879 181.187 1.00 207.75 ? 1666 ILE A CA 1 
ATOM 1176 C CA . LYS A 1  1667 ? 239.755 179.391 177.798 1.00 194.82 ? 1667 LYS A CA 1 
ATOM 1177 C CA . VAL A 1  1668 ? 237.863 178.031 174.790 1.00 170.24 ? 1668 VAL A CA 1 
ATOM 1178 C CA . LYS A 1  1669 ? 239.354 174.619 174.142 1.00 195.88 ? 1669 LYS A CA 1 
ATOM 1179 C CA . GLY A 1  1670 ? 239.278 172.491 170.982 1.00 249.90 ? 1670 GLY A CA 1 
ATOM 1180 C CA . PRO A 1  1671 ? 238.806 171.208 168.488 1.00 285.51 ? 1671 PRO A CA 1 
ATOM 1181 C CA . ARG A 1  1672 ? 235.921 173.442 166.988 1.00 222.92 ? 1672 ARG A CA 1 
ATOM 1182 C CA . TYR A 1  1673 ? 236.880 176.891 168.282 1.00 173.90 ? 1673 TYR A CA 1 
ATOM 1183 C CA . TRP A 1  1674 ? 240.141 178.443 169.578 1.00 155.99 ? 1674 TRP A CA 1 
ATOM 1184 C CA . GLU A 1  1675 ? 240.014 181.259 172.259 1.00 196.92 ? 1675 GLU A CA 1 
ATOM 1185 C CA . LEU A 1  1676 ? 241.779 182.578 175.390 1.00 323.13 ? 1676 LEU A CA 1 
ATOM 1186 C CA . LEU A 1  1677 ? 240.764 184.845 178.289 1.00 334.96 ? 1677 LEU A CA 1 
ATOM 1187 C CA . ILE A 1  1678 ? 243.365 185.435 181.053 1.00 371.08 ? 1678 ILE A CA 1 
ATOM 1188 C CA . ASP A 1  1679 ? 242.872 187.064 184.531 1.00 242.57 ? 1679 ASP A CA 1 
ATOM 1189 C CA . LEU A 1  1680 ? 246.265 187.739 186.232 1.00 218.69 ? 1680 LEU A CA 1 
ATOM 1190 C CA . THR A 1  1684 ? 239.842 190.591 185.516 1.00 215.49 ? 1684 THR A CA 1 
ATOM 1191 C CA . GLN A 1  1685 ? 237.211 193.358 185.685 1.00 324.48 ? 1685 GLN A CA 1 
ATOM 1192 C CA . HIS A 1  1686 ? 237.311 192.969 181.850 1.00 210.08 ? 1686 HIS A CA 1 
ATOM 1193 C CA . LEU A 1  1687 ? 235.533 189.615 182.092 1.00 165.29 ? 1687 LEU A CA 1 
ATOM 1194 C CA . LYS A 1  1688 ? 232.807 191.060 184.353 1.00 173.97 ? 1688 LYS A CA 1 
ATOM 1195 C CA . SER A 1  1689 ? 232.079 193.748 181.732 1.00 202.11 ? 1689 SER A CA 1 
ATOM 1196 C CA . ILE A 1  1690 ? 231.437 191.029 179.015 1.00 192.61 ? 1690 ILE A CA 1 
ATOM 1197 C CA . LEU A 1  1691 ? 229.040 189.396 181.429 1.00 180.71 ? 1691 LEU A CA 1 
ATOM 1198 C CA . SER A 1  1692 ? 227.459 192.742 182.405 1.00 195.18 ? 1692 SER A CA 1 
ATOM 1199 C CA . LYS A 1  1693 ? 225.929 192.920 178.917 1.00 180.76 ? 1693 LYS A CA 1 
ATOM 1200 C CA . ASP A 1  1694 ? 224.176 189.497 178.578 1.00 242.47 ? 1694 ASP A CA 1 
ATOM 1201 C CA . GLY A 1  1695 ? 227.421 187.452 178.755 1.00 205.29 ? 1695 GLY A CA 1 
ATOM 1202 C CA . VAL A 1  1696 ? 228.102 187.181 175.044 1.00 189.84 ? 1696 VAL A CA 1 
ATOM 1203 C CA . LEU A 1  1697 ? 231.435 185.724 173.850 1.00 180.30 ? 1697 LEU A CA 1 
ATOM 1204 C CA . TYR A 1  1698 ? 232.309 185.639 170.172 1.00 182.09 ? 1698 TYR A CA 1 
ATOM 1205 C CA . VAL A 1  1699 ? 233.928 182.327 169.048 1.00 157.92 ? 1699 VAL A CA 1 
ATOM 1206 C CA . LYS A 1  1700 ? 235.133 181.285 165.665 1.00 213.90 ? 1700 LYS A CA 1 
ATOM 1207 C CA . LEU A 1  1701 ? 234.109 177.848 164.633 1.00 178.22 ? 1701 LEU A CA 1 
ATOM 1208 C CA . ARG A 1  1702 ? 236.969 176.161 162.768 1.00 381.17 ? 1702 ARG A CA 1 
ATOM 1209 C CA . ALA A 1  1703 ? 236.488 175.285 159.081 1.00 428.67 ? 1703 ALA A CA 1 
ATOM 1210 C CA . GLY A 1  1704 ? 236.310 171.466 159.007 1.00 427.25 ? 1704 GLY A CA 1 
ATOM 1211 C CA . GLN A 1  1705 ? 234.416 170.890 162.297 1.00 341.28 ? 1705 GLN A CA 1 
ATOM 1212 C CA . LEU A 1  1706 ? 230.627 171.457 162.704 1.00 234.58 ? 1706 LEU A CA 1 
ATOM 1213 C CA . SER A 1  1707 ? 229.011 173.085 165.781 1.00 180.43 ? 1707 SER A CA 1 
ATOM 1214 C CA . ASN A 1  1727 ? 246.914 160.400 158.808 1.00 359.81 ? 1727 ASN A CA 1 
ATOM 1215 C CA . SER A 1  1728 ? 246.808 159.191 155.155 1.00 307.91 ? 1728 SER A CA 1 
ATOM 1216 C CA . GLU A 1  1729 ? 245.019 161.945 153.104 1.00 230.15 ? 1729 GLU A CA 1 
ATOM 1217 C CA . ALA A 1  1730 ? 241.540 160.637 152.138 1.00 180.20 ? 1730 ALA A CA 1 
ATOM 1218 C CA . ARG A 1  1731 ? 241.104 161.413 148.413 1.00 348.52 ? 1731 ARG A CA 1 
ATOM 1219 C CA . ALA A 1  1732 ? 237.349 160.478 148.080 1.00 476.85 ? 1732 ALA A CA 1 
ATOM 1220 C CA . PHE A 1  1733 ? 234.508 162.842 149.228 1.00 500.00 ? 1733 PHE A CA 1 
ATOM 1221 C CA . LYS A 1  1734 ? 231.200 164.545 148.240 1.00 500.00 ? 1734 LYS A CA 1 
ATOM 1222 C CA . SER A 1  1739 ? 229.377 167.591 152.968 1.00 163.11 ? 1739 SER A CA 1 
ATOM 1223 C CA . ALA A 1  1740 ? 229.161 165.733 155.547 1.00 313.68 ? 1740 ALA A CA 1 
ATOM 1224 C CA . PHE A 1  1741 ? 231.861 167.485 157.707 1.00 245.99 ? 1741 PHE A CA 1 
ATOM 1225 C CA . THR A 1  1742 ? 231.075 171.252 157.862 1.00 374.87 ? 1742 THR A CA 1 
ATOM 1226 C CA . SER A 1  1743 ? 228.453 173.948 157.276 1.00 290.52 ? 1743 SER A CA 1 
ATOM 1227 C CA . ASP A 1  1744 ? 230.199 176.922 155.682 1.00 317.22 ? 1744 ASP A CA 1 
ATOM 1228 C CA . PRO A 1  1745 ? 227.821 178.111 152.940 1.00 270.86 ? 1745 PRO A CA 1 
ATOM 1229 C CA . ALA A 1  1746 ? 230.655 178.932 150.450 1.00 250.75 ? 1746 ALA A CA 1 
ATOM 1230 C CA . LEU A 1  1747 ? 232.403 175.545 150.581 1.00 205.05 ? 1747 LEU A CA 1 
ATOM 1231 C CA . LEU A 1  1748 ? 229.192 173.630 151.280 1.00 159.99 ? 1748 LEU A CA 1 
ATOM 1232 C CA . SER A 1  1749 ? 227.611 175.262 148.179 1.00 175.76 ? 1749 SER A CA 1 
ATOM 1233 C CA . PHE A 1  1750 ? 230.770 174.802 145.991 1.00 170.66 ? 1750 PHE A CA 1 
ATOM 1234 C CA . ALA A 1  1751 ? 230.252 170.987 146.294 1.00 205.22 ? 1751 ALA A CA 1 
ATOM 1235 C CA . GLU A 1  1752 ? 226.577 170.865 145.255 1.00 188.06 ? 1752 GLU A CA 1 
ATOM 1236 C CA . TYR A 1  1753 ? 227.361 172.969 142.188 1.00 212.71 ? 1753 TYR A CA 1 
ATOM 1237 C CA . PHE A 1  1754 ? 230.852 172.032 140.938 1.00 184.07 ? 1754 PHE A CA 1 
ATOM 1238 C CA . CYS A 1  1755 ? 231.548 168.629 142.409 1.00 176.06 ? 1755 CYS A CA 1 
ATOM 1239 C CA . LYS A 1  1756 ? 228.488 166.354 141.912 1.00 169.79 ? 1756 LYS A CA 1 
ATOM 1240 C CA . PRO A 1  1757 ? 228.619 164.197 138.672 1.00 229.24 ? 1757 PRO A CA 1 
ATOM 1241 C CA . THR A 1  1758 ? 224.888 164.582 137.491 1.00 275.92 ? 1758 THR A CA 1 
ATOM 1242 C CA . VAL A 1  1759 ? 225.039 163.924 133.673 1.00 361.29 ? 1759 VAL A CA 1 
ATOM 1243 C CA . ASN A 1  1760 ? 226.600 160.677 132.190 1.00 290.49 ? 1760 ASN A CA 1 
ATOM 1244 C CA . MET A 1  1761 ? 230.284 161.368 132.962 1.00 272.95 ? 1761 MET A CA 1 
ATOM 1245 C CA . GLY A 1  1762 ? 233.122 158.762 133.121 1.00 338.39 ? 1762 GLY A CA 1 
ATOM 1246 C CA . GLN A 1  1763 ? 236.675 159.703 131.920 1.00 259.25 ? 1763 GLN A CA 1 
ATOM 1247 C CA . LYS A 1  1764 ? 235.570 163.381 131.915 1.00 248.25 ? 1764 LYS A CA 1 
ATOM 1248 C CA . GLN A 1  1765 ? 234.602 162.624 135.504 1.00 157.07 ? 1765 GLN A CA 1 
ATOM 1249 C CA . GLU A 1  1766 ? 238.361 162.718 136.241 1.00 227.02 ? 1766 GLU A CA 1 
ATOM 1250 C CA . ILE A 1  1767 ? 238.265 166.557 136.013 1.00 240.80 ? 1767 ILE A CA 1 
ATOM 1251 C CA . LEU A 1  1768 ? 235.446 166.786 138.592 1.00 181.20 ? 1768 LEU A CA 1 
ATOM 1252 C CA . ASP A 1  1769 ? 237.253 164.232 140.801 1.00 189.23 ? 1769 ASP A CA 1 
ATOM 1253 C CA . LEU A 1  1770 ? 240.355 166.416 141.138 1.00 207.34 ? 1770 LEU A CA 1 
ATOM 1254 C CA . PHE A 1  1771 ? 238.086 169.290 142.238 1.00 187.31 ? 1771 PHE A CA 1 
ATOM 1255 C CA . SER A 1  1772 ? 236.672 167.216 145.125 1.00 366.61 ? 1772 SER A CA 1 
ATOM 1256 C CA . SER A 1  1773 ? 240.209 166.037 146.051 1.00 404.08 ? 1773 SER A CA 1 
ATOM 1257 C CA . VAL A 1  1774 ? 241.070 169.764 146.256 1.00 325.13 ? 1774 VAL A CA 1 
ATOM 1258 C CA . LEU A 1  1775 ? 237.899 170.613 148.286 1.00 381.60 ? 1775 LEU A CA 1 
ATOM 1259 C CA . TYR A 1  1776 ? 238.834 167.878 150.846 1.00 284.78 ? 1776 TYR A CA 1 
ATOM 1260 C CA . GLU A 1  1777 ? 242.193 169.577 151.475 1.00 214.72 ? 1777 GLU A CA 1 
ATOM 1261 C CA . CYS A 1  1778 ? 240.492 172.948 152.139 1.00 279.69 ? 1778 CYS A CA 1 
ATOM 1262 C CA . VAL A 1  1779 ? 238.046 171.106 154.467 1.00 430.54 ? 1779 VAL A CA 1 
ATOM 1263 C CA . THR A 1  1780 ? 240.923 169.230 156.239 1.00 377.81 ? 1780 THR A CA 1 
ATOM 1264 C CA . GLN A 1  1781 ? 243.169 172.326 156.707 1.00 385.12 ? 1781 GLN A CA 1 
ATOM 1265 C CA . GLU A 1  1782 ? 241.589 175.493 158.194 1.00 412.52 ? 1782 GLU A CA 1 
ATOM 1266 C CA . THR A 1  1783 ? 241.843 177.442 154.838 1.00 402.28 ? 1783 THR A CA 1 
ATOM 1267 C CA . PRO A 1  1784 ? 238.833 178.665 152.625 1.00 244.56 ? 1784 PRO A CA 1 
ATOM 1268 C CA . GLU A 1  1785 ? 241.277 181.104 150.889 1.00 281.32 ? 1785 GLU A CA 1 
ATOM 1269 C CA . MET A 1  1786 ? 243.246 178.261 149.370 1.00 153.36 ? 1786 MET A CA 1 
ATOM 1270 C CA . LEU A 1  1787 ? 240.371 177.098 147.157 1.00 212.35 ? 1787 LEU A CA 1 
ATOM 1271 C CA . PRO A 1  1788 ? 241.113 179.589 144.352 1.00 203.93 ? 1788 PRO A CA 1 
ATOM 1272 C CA . ALA A 1  1789 ? 244.844 178.775 144.320 1.00 197.49 ? 1789 ALA A CA 1 
ATOM 1273 C CA . TYR A 1  1790 ? 244.096 175.042 144.374 1.00 260.76 ? 1790 TYR A CA 1 
ATOM 1274 C CA . ILE A 1  1791 ? 241.760 175.070 141.336 1.00 190.51 ? 1791 ILE A CA 1 
ATOM 1275 C CA . ALA A 1  1792 ? 244.087 177.492 139.535 1.00 159.89 ? 1792 ALA A CA 1 
ATOM 1276 C CA . MET A 1  1793 ? 246.755 174.823 140.096 1.00 138.69 ? 1793 MET A CA 1 
ATOM 1277 C CA . ASP A 1  1794 ? 244.439 172.378 138.345 1.00 199.73 ? 1794 ASP A CA 1 
ATOM 1278 C CA . GLN A 1  1795 ? 243.647 174.846 135.563 1.00 199.83 ? 1795 GLN A CA 1 
ATOM 1279 C CA . ALA A 1  1796 ? 247.308 175.164 134.640 1.00 178.62 ? 1796 ALA A CA 1 
ATOM 1280 C CA . ILE A 1  1797 ? 248.210 171.436 134.876 1.00 181.09 ? 1797 ILE A CA 1 
ATOM 1281 C CA . ARG A 1  1798 ? 245.350 170.457 132.554 1.00 217.95 ? 1798 ARG A CA 1 
ATOM 1282 C CA . ARG A 1  1799 ? 246.259 173.440 130.303 1.00 223.18 ? 1799 ARG A CA 1 
ATOM 1283 C CA . LEU A 1  1800 ? 249.760 172.029 129.881 1.00 174.24 ? 1800 LEU A CA 1 
ATOM 1284 C CA . GLY A 1  1801 ? 248.509 168.553 128.890 1.00 225.05 ? 1801 GLY A CA 1 
ATOM 1285 C CA . ARG A 1  1802 ? 246.158 170.244 126.414 1.00 244.94 ? 1802 ARG A CA 1 
ATOM 1286 C CA . ARG A 1  1803 ? 249.069 172.482 125.292 1.00 211.23 ? 1803 ARG A CA 1 
ATOM 1287 C CA . GLU A 1  1804 ? 246.243 174.950 124.622 1.00 299.34 ? 1804 GLU A CA 1 
ATOM 1288 C CA . MET A 1  1805 ? 247.205 178.237 126.257 1.00 273.55 ? 1805 MET A CA 1 
ATOM 1289 C CA . SER A 1  1806 ? 250.743 179.549 126.233 1.00 252.34 ? 1806 SER A CA 1 
ATOM 1290 C CA . GLU A 1  1807 ? 250.354 182.825 128.200 1.00 229.58 ? 1807 GLU A CA 1 
ATOM 1291 C CA . THR A 1  1808 ? 252.756 181.299 130.856 1.00 225.37 ? 1808 THR A CA 1 
ATOM 1292 C CA . SER A 1  1809 ? 252.269 184.000 133.542 1.00 194.90 ? 1809 SER A CA 1 
ATOM 1293 C CA . GLU A 1  1810 ? 250.141 181.420 135.342 1.00 182.48 ? 1810 GLU A CA 1 
ATOM 1294 C CA . LEU A 1  1811 ? 253.037 178.908 135.364 1.00 181.21 ? 1811 LEU A CA 1 
ATOM 1295 C CA . TRP A 1  1812 ? 255.452 181.395 136.931 1.00 214.68 ? 1812 TRP A CA 1 
ATOM 1296 C CA . GLN A 1  1813 ? 253.256 181.361 140.065 1.00 212.42 ? 1813 GLN A CA 1 
ATOM 1297 C CA . ILE A 1  1814 ? 253.285 177.544 140.086 1.00 232.17 ? 1814 ILE A CA 1 
ATOM 1298 C CA . LYS A 1  1815 ? 257.126 177.525 139.868 1.00 312.00 ? 1815 LYS A CA 1 
ATOM 1299 C CA . LEU A 1  1816 ? 257.422 179.942 142.851 1.00 341.70 ? 1816 LEU A CA 1 
ATOM 1300 C CA . VAL A 1  1817 ? 254.837 177.934 144.868 1.00 210.40 ? 1817 VAL A CA 1 
ATOM 1301 C CA . LEU A 1  1818 ? 257.062 174.936 144.432 1.00 177.43 ? 1818 LEU A CA 1 
ATOM 1302 C CA . GLU A 1  1819 ? 260.169 176.831 145.339 1.00 184.90 ? 1819 GLU A CA 1 
ATOM 1303 C CA . PHE A 1  1820 ? 258.476 178.329 148.467 1.00 210.06 ? 1820 PHE A CA 1 
ATOM 1304 C CA . PHE A 1  1821 ? 257.128 174.824 149.176 1.00 226.83 ? 1821 PHE A CA 1 
ATOM 1305 C CA . SER A 1  1822 ? 260.766 173.662 149.609 1.00 250.14 ? 1822 SER A CA 1 
ATOM 1306 C CA . SER A 1  1823 ? 263.500 176.377 150.130 1.00 293.56 ? 1823 SER A CA 1 
ATOM 1307 C CA . ARG A 1  1824 ? 265.692 177.695 152.979 1.00 282.61 ? 1824 ARG A CA 1 
ATOM 1308 C CA . SER A 1  1825 ? 262.669 178.820 154.955 1.00 255.76 ? 1825 SER A CA 1 
ATOM 1309 C CA . HIS A 1  1826 ? 264.472 178.394 158.261 1.00 224.72 ? 1826 HIS A CA 1 
ATOM 1310 C CA . GLN A 1  1827 ? 261.991 176.756 160.535 1.00 189.18 ? 1827 GLN A CA 1 
ATOM 1311 C CA . PHE A 1  1839 ? 251.826 175.542 154.977 1.00 221.93 ? 1839 PHE A CA 1 
ATOM 1312 C CA . MET A 1  1840 ? 250.538 172.744 152.805 1.00 260.89 ? 1840 MET A CA 1 
ATOM 1313 C CA . ASN A 1  1841 ? 251.093 169.388 154.540 1.00 251.74 ? 1841 ASN A CA 1 
ATOM 1314 C CA . SER A 1  1842 ? 249.188 167.448 151.854 1.00 228.68 ? 1842 SER A CA 1 
ATOM 1315 C CA . GLU A 1  1843 ? 250.594 165.278 149.061 1.00 219.96 ? 1843 GLU A CA 1 
ATOM 1316 C CA . PHE A 1  1844 ? 248.832 167.208 146.336 1.00 298.84 ? 1844 PHE A CA 1 
ATOM 1317 C CA . LEU A 1  1845 ? 251.924 169.394 145.975 1.00 157.24 ? 1845 LEU A CA 1 
ATOM 1318 C CA . PRO A 1  1846 ? 254.480 166.720 144.970 1.00 205.90 ? 1846 PRO A CA 1 
ATOM 1319 C CA . VAL A 1  1847 ? 251.935 165.373 142.356 1.00 332.08 ? 1847 VAL A CA 1 
ATOM 1320 C CA . VAL A 1  1848 ? 251.439 168.863 140.764 1.00 331.09 ? 1848 VAL A CA 1 
ATOM 1321 C CA . LYS A 1  1849 ? 255.278 169.131 140.335 1.00 256.94 ? 1849 LYS A CA 1 
ATOM 1322 C CA . CYS A 1  1850 ? 255.188 165.620 138.746 1.00 318.32 ? 1850 CYS A CA 1 
ATOM 1323 C CA . THR A 1  1851 ? 252.318 166.279 136.208 1.00 207.83 ? 1851 THR A CA 1 
ATOM 1324 C CA . ILE A 1  1852 ? 254.398 169.228 134.910 1.00 169.02 ? 1852 ILE A CA 1 
ATOM 1325 C CA . ASP A 1  1853 ? 257.597 167.191 134.611 1.00 300.07 ? 1853 ASP A CA 1 
ATOM 1326 C CA . ASN A 1  1854 ? 255.533 164.286 133.202 1.00 217.95 ? 1854 ASN A CA 1 
ATOM 1327 C CA . THR A 1  1855 ? 254.145 166.582 130.454 1.00 240.71 ? 1855 THR A CA 1 
ATOM 1328 C CA . LEU A 1  1856 ? 257.424 168.170 129.411 1.00 222.77 ? 1856 LEU A CA 1 
ATOM 1329 C CA . ASP A 1  1857 ? 259.323 164.874 129.736 1.00 242.56 ? 1857 ASP A CA 1 
ATOM 1330 C CA . GLN A 1  1858 ? 257.205 163.270 127.005 1.00 283.45 ? 1858 GLN A CA 1 
ATOM 1331 C CA . TRP A 1  1859 ? 257.363 166.354 124.733 1.00 262.50 ? 1859 TRP A CA 1 
ATOM 1332 C CA . LEU A 1  1860 ? 261.184 166.362 124.831 1.00 237.86 ? 1860 LEU A CA 1 
ATOM 1333 C CA . GLN A 1  1861 ? 261.108 162.643 123.825 1.00 230.35 ? 1861 GLN A CA 1 
ATOM 1334 C CA . VAL A 1  1862 ? 258.597 163.103 120.938 1.00 256.36 ? 1862 VAL A CA 1 
ATOM 1335 C CA . GLY A 1  1863 ? 260.587 166.012 119.471 1.00 253.58 ? 1863 GLY A CA 1 
ATOM 1336 C CA . GLY A 1  1864 ? 261.948 169.525 120.002 1.00 270.86 ? 1864 GLY A CA 1 
ATOM 1337 C CA . ASP A 1  1865 ? 264.534 167.949 122.277 1.00 262.93 ? 1865 ASP A CA 1 
ATOM 1338 C CA . MET A 1  1866 ? 267.177 169.043 119.734 1.00 358.52 ? 1866 MET A CA 1 
ATOM 1339 C CA . CYS A 1  1867 ? 265.329 172.368 119.269 1.00 293.62 ? 1867 CYS A CA 1 
ATOM 1340 C CA . VAL A 1  1868 ? 265.762 173.114 123.035 1.00 211.65 ? 1868 VAL A CA 1 
ATOM 1341 C CA . HIS A 1  1869 ? 269.519 172.550 122.616 1.00 276.46 ? 1869 HIS A CA 1 
ATOM 1342 C CA . ALA A 1  1870 ? 269.424 174.876 119.544 1.00 273.65 ? 1870 ALA A CA 1 
ATOM 1343 C CA . TYR A 1  1871 ? 267.918 177.746 121.588 1.00 243.61 ? 1871 TYR A CA 1 
ATOM 1344 C CA . LEU A 1  1872 ? 270.375 177.726 124.501 1.00 236.90 ? 1872 LEU A CA 1 
ATOM 1345 C CA . SER A 1  1873 ? 273.223 178.006 121.944 1.00 303.96 ? 1873 SER A CA 1 
ATOM 1346 C CA . LEU A 1  1877 ? 263.575 177.743 116.929 1.00 259.92 ? 1877 LEU A CA 1 
ATOM 1347 C CA . GLU A 1  1878 ? 260.147 176.886 115.438 1.00 284.90 ? 1878 GLU A CA 1 
ATOM 1348 C CA . GLU A 1  1879 ? 256.792 178.735 115.749 1.00 263.44 ? 1879 GLU A CA 1 
ATOM 1349 C CA . SER A 1  1880 ? 255.053 175.502 116.877 1.00 288.29 ? 1880 SER A CA 1 
ATOM 1350 C CA . GLN A 1  1881 ? 257.904 174.651 119.258 1.00 296.25 ? 1881 GLN A CA 1 
ATOM 1351 C CA . LEU A 1  1882 ? 258.002 178.274 120.564 1.00 244.75 ? 1882 LEU A CA 1 
ATOM 1352 C CA . SER A 1  1883 ? 254.906 177.864 122.769 1.00 253.68 ? 1883 SER A CA 1 
ATOM 1353 C CA . MET A 1  1884 ? 256.177 174.764 124.589 1.00 236.29 ? 1884 MET A CA 1 
ATOM 1354 C CA . LEU A 1  1885 ? 259.775 176.009 124.952 1.00 201.72 ? 1885 LEU A CA 1 
ATOM 1355 C CA . ALA A 1  1886 ? 258.620 179.171 126.661 1.00 246.73 ? 1886 ALA A CA 1 
ATOM 1356 C CA . CYS A 1  1887 ? 257.090 177.279 129.605 1.00 225.90 ? 1887 CYS A CA 1 
ATOM 1357 C CA . PHE A 1  1888 ? 260.073 174.859 129.798 1.00 205.28 ? 1888 PHE A CA 1 
ATOM 1358 C CA . LEU A 1  1889 ? 262.625 177.680 129.921 1.00 197.16 ? 1889 LEU A CA 1 
ATOM 1359 C CA . VAL A 1  1890 ? 260.535 179.298 132.718 1.00 252.49 ? 1890 VAL A CA 1 
ATOM 1360 C CA . TYR A 1  1891 ? 260.050 176.223 134.878 1.00 238.00 ? 1891 TYR A CA 1 
ATOM 1361 C CA . HIS A 1  1892 ? 263.621 174.898 134.414 1.00 208.46 ? 1892 HIS A CA 1 
ATOM 1362 C CA . SER A 1  1893 ? 265.346 178.312 134.650 1.00 197.60 ? 1893 SER A CA 1 
ATOM 1363 C CA . VAL A 1  1894 ? 267.705 178.085 131.586 1.00 175.09 ? 1894 VAL A CA 1 
ATOM 1364 C CA . PRO A 1  1895 ? 269.826 181.000 130.172 1.00 240.68 ? 1895 PRO A CA 1 
ATOM 1365 C CA . ALA A 1  1896 ? 271.802 182.239 127.081 1.00 277.26 ? 1896 ALA A CA 1 
ATOM 1366 C CA . PRO A 1  1897 ? 274.000 184.828 128.910 1.00 288.88 ? 1897 PRO A CA 1 
ATOM 1367 C CA . SER A 1  1910 ? 273.903 167.918 125.839 1.00 230.56 ? 1910 SER A CA 1 
ATOM 1368 C CA . PHE A 1  1911 ? 270.644 165.935 126.348 1.00 257.27 ? 1911 PHE A CA 1 
ATOM 1369 C CA . ALA A 1  1912 ? 272.128 165.117 129.790 1.00 272.84 ? 1912 ALA A CA 1 
ATOM 1370 C CA . GLU A 1  1913 ? 271.743 168.888 130.543 1.00 307.40 ? 1913 GLU A CA 1 
ATOM 1371 C CA . LEU A 1  1914 ? 267.955 168.371 130.355 1.00 249.22 ? 1914 LEU A CA 1 
ATOM 1372 C CA . LEU A 1  1915 ? 268.282 165.722 133.136 1.00 223.01 ? 1915 LEU A CA 1 
ATOM 1373 C CA . PHE A 1  1916 ? 270.619 168.139 134.948 1.00 216.49 ? 1916 PHE A CA 1 
ATOM 1374 C CA . LYS A 1  1917 ? 268.092 170.950 134.457 1.00 239.68 ? 1917 LYS A CA 1 
ATOM 1375 C CA . PHE A 1  1918 ? 265.413 168.803 136.123 1.00 298.51 ? 1918 PHE A CA 1 
ATOM 1376 C CA . LYS A 1  1919 ? 267.851 168.095 138.992 1.00 291.70 ? 1919 LYS A CA 1 
ATOM 1377 C CA . GLN A 1  1920 ? 269.121 171.661 139.426 1.00 241.22 ? 1920 GLN A CA 1 
ATOM 1378 C CA . LEU A 1  1921 ? 267.911 175.064 138.267 1.00 273.87 ? 1921 LEU A CA 1 
ATOM 1379 C CA . LYS A 1  1922 ? 270.566 177.614 137.138 1.00 311.27 ? 1922 LYS A CA 1 
ATOM 1380 C CA . MET A 1  1923 ? 270.936 180.507 139.641 1.00 265.93 ? 1923 MET A CA 1 
ATOM 1381 C CA . PRO A 1  1924 ? 274.631 181.266 140.202 1.00 274.94 ? 1924 PRO A CA 1 
ATOM 1382 C CA . VAL A 1  1925 ? 278.052 179.688 139.461 1.00 296.63 ? 1925 VAL A CA 1 
ATOM 1383 C CA . ARG A 1  1926 ? 276.358 176.421 140.568 1.00 278.73 ? 1926 ARG A CA 1 
ATOM 1384 C CA . ALA A 1  1927 ? 275.025 176.382 136.953 1.00 294.21 ? 1927 ALA A CA 1 
ATOM 1385 C CA . LEU A 1  1928 ? 278.538 175.499 135.645 1.00 276.70 ? 1928 LEU A CA 1 
ATOM 1386 C CA . LEU A 1  1929 ? 279.371 173.225 138.646 1.00 238.81 ? 1929 LEU A CA 1 
ATOM 1387 C CA . ARG A 1  1930 ? 276.313 171.052 137.824 1.00 238.59 ? 1930 ARG A CA 1 
ATOM 1388 C CA . LEU A 1  1931 ? 277.793 170.949 134.292 1.00 254.45 ? 1931 LEU A CA 1 
ATOM 1389 C CA . ALA A 1  1932 ? 280.741 169.287 136.050 1.00 237.44 ? 1932 ALA A CA 1 
ATOM 1390 C CA . PRO A 1  1933 ? 278.219 166.474 136.870 1.00 254.26 ? 1933 PRO A CA 1 
ATOM 1391 C CA . LEU A 1  1934 ? 277.741 166.221 133.073 1.00 270.36 ? 1934 LEU A CA 1 
ATOM 1392 C CA . MET B 2  1    ? 148.531 123.962 154.408 1.00 500.00 ? 1    MET B CA 1 
ATOM 1393 C CA . LYS B 2  2    ? 149.303 123.152 158.076 1.00 500.00 ? 2    LYS B CA 1 
ATOM 1394 C CA . VAL B 2  3    ? 151.751 124.863 160.434 1.00 500.00 ? 3    VAL B CA 1 
ATOM 1395 C CA . LYS B 2  4    ? 152.296 123.588 164.011 1.00 500.00 ? 4    LYS B CA 1 
ATOM 1396 C CA . ILE B 2  5    ? 154.048 125.409 166.859 1.00 500.00 ? 5    ILE B CA 1 
ATOM 1397 C CA . LYS B 2  6    ? 156.584 122.996 168.467 1.00 500.00 ? 6    LYS B CA 1 
ATOM 1398 C CA . CYS B 2  7    ? 158.319 125.426 170.886 1.00 500.00 ? 7    CYS B CA 1 
ATOM 1399 C CA . TRP B 2  8    ? 158.186 129.043 172.023 1.00 500.00 ? 8    TRP B CA 1 
ATOM 1400 C CA . ASN B 2  9    ? 161.135 130.995 173.498 1.00 458.82 ? 9    ASN B CA 1 
ATOM 1401 C CA . GLY B 2  10   ? 159.245 134.239 174.395 1.00 381.35 ? 10   GLY B CA 1 
ATOM 1402 C CA . VAL B 2  11   ? 160.402 137.500 175.925 1.00 454.29 ? 11   VAL B CA 1 
ATOM 1403 C CA . ALA B 2  12   ? 158.494 140.241 177.756 1.00 500.00 ? 12   ALA B CA 1 
ATOM 1404 C CA . THR B 2  13   ? 160.240 142.619 180.158 1.00 500.00 ? 13   THR B CA 1 
ATOM 1405 C CA . TRP B 2  14   ? 158.120 143.942 183.026 1.00 500.00 ? 14   TRP B CA 1 
ATOM 1406 C CA . LEU B 2  15   ? 158.482 147.414 184.539 1.00 500.00 ? 15   LEU B CA 1 
ATOM 1407 C CA . TRP B 2  16   ? 157.203 146.188 187.905 1.00 500.00 ? 16   TRP B CA 1 
ATOM 1408 C CA . ASN B 2  22   ? 155.572 154.351 187.679 1.00 28.81  ? 22   ASN B CA 1 
ATOM 1409 C CA . CYS B 2  23   ? 155.876 155.711 191.208 1.00 17.51  ? 23   CYS B CA 1 
ATOM 1410 C CA . GLY B 2  24   ? 154.746 159.325 191.158 1.00 26.55  ? 24   GLY B CA 1 
ATOM 1411 C CA . ILE B 2  25   ? 157.617 160.376 193.411 1.00 25.75  ? 25   ILE B CA 1 
ATOM 1412 C CA . CYS B 2  26   ? 160.793 158.920 191.868 1.00 19.03  ? 26   CYS B CA 1 
ATOM 1413 C CA . ARG B 2  27   ? 159.310 158.202 188.404 1.00 22.11  ? 27   ARG B CA 1 
ATOM 1414 C CA . MET B 2  28   ? 160.776 154.694 188.445 1.00 20.11  ? 28   MET B CA 1 
ATOM 1415 C CA . ALA B 2  29   ? 158.869 151.500 187.608 1.00 20.48  ? 29   ALA B CA 1 
ATOM 1416 C CA A CYS B 2  33   ? 163.307 149.508 192.732 0.48 34.47  ? 33   CYS B CA 1 
ATOM 1417 C CA B CYS B 2  33   ? 163.363 149.501 192.730 0.52 34.42  ? 33   CYS B CA 1 
ATOM 1418 C CA . CYS B 2  34   ? 163.529 153.168 193.767 1.00 16.18  ? 34   CYS B CA 1 
ATOM 1419 C CA . PRO B 2  35   ? 166.657 155.383 193.177 1.00 25.74  ? 35   PRO B CA 1 
ATOM 1420 C CA . ASP B 2  36   ? 168.127 154.492 196.582 1.00 25.15  ? 36   ASP B CA 1 
ATOM 1421 C CA . CYS B 2  37   ? 167.988 150.775 195.960 1.00 29.56  ? 37   CYS B CA 1 
ATOM 1422 C CA . CYS B 2  44   ? 161.951 147.742 197.705 1.00 29.46  ? 44   CYS B CA 1 
ATOM 1423 C CA . PRO B 2  45   ? 158.332 147.031 198.505 1.00 19.76  ? 45   PRO B CA 1 
ATOM 1424 C CA . LEU B 2  46   ? 155.298 148.961 197.285 1.00 11.46  ? 46   LEU B CA 1 
ATOM 1425 C CA . VAL B 2  47   ? 152.665 150.638 199.469 1.00 20.09  ? 47   VAL B CA 1 
ATOM 1426 C CA . TRP B 2  48   ? 149.219 152.117 198.887 1.00 17.60  ? 48   TRP B CA 1 
ATOM 1427 C CA . GLY B 2  49   ? 147.411 155.171 200.264 1.00 21.03  ? 49   GLY B CA 1 
ATOM 1428 C CA . GLN B 2  50   ? 143.687 155.303 201.109 1.00 21.32  ? 50   GLN B CA 1 
ATOM 1429 C CA . CYS B 2  51   ? 143.433 157.552 198.027 1.00 23.58  ? 51   CYS B CA 1 
ATOM 1430 C CA . SER B 2  52   ? 144.478 154.535 195.935 1.00 26.96  ? 52   SER B CA 1 
ATOM 1431 C CA . HIS B 2  53   ? 147.480 155.771 194.909 1.00 18.94  ? 53   HIS B CA 1 
ATOM 1432 C CA . CYS B 2  54   ? 150.876 153.618 194.954 1.00 22.17  ? 54   CYS B CA 1 
ATOM 1433 C CA . PHE B 2  55   ? 154.515 154.368 195.768 1.00 18.59  ? 55   PHE B CA 1 
ATOM 1434 C CA . HIS B 2  56   ? 157.699 152.517 196.659 1.00 16.66  ? 56   HIS B CA 1 
ATOM 1435 C CA . MET B 2  57   ? 157.697 152.499 200.434 1.00 11.89  ? 57   MET B CA 1 
ATOM 1436 C CA . HIS B 2  58   ? 161.171 154.071 200.379 1.00 16.52  ? 58   HIS B CA 1 
ATOM 1437 C CA . CYS B 2  59   ? 159.891 157.072 198.376 1.00 13.01  ? 59   CYS B CA 1 
ATOM 1438 C CA . ILE B 2  60   ? 156.724 157.773 200.400 1.00 18.74  ? 60   ILE B CA 1 
ATOM 1439 C CA . LEU B 2  61   ? 158.727 157.483 203.639 1.00 19.26  ? 61   LEU B CA 1 
ATOM 1440 C CA . LYS B 2  62   ? 161.103 160.280 202.489 1.00 23.44  ? 62   LYS B CA 1 
ATOM 1441 C CA . TRP B 2  63   ? 158.129 162.387 201.436 1.00 18.00  ? 63   TRP B CA 1 
ATOM 1442 C CA . LEU B 2  64   ? 156.284 161.868 204.730 1.00 28.19  ? 64   LEU B CA 1 
ATOM 1443 C CA . HIS B 2  65   ? 159.353 162.437 206.880 1.00 30.82  ? 65   HIS B CA 1 
ATOM 1444 C CA . ALA B 2  66   ? 159.806 165.812 205.172 1.00 33.80  ? 66   ALA B CA 1 
ATOM 1445 C CA . GLN B 2  67   ? 156.219 167.094 205.430 1.00 41.05  ? 67   GLN B CA 1 
ATOM 1446 C CA . GLN B 2  68   ? 155.816 169.887 208.007 1.00 54.68  ? 68   GLN B CA 1 
ATOM 1447 C CA . VAL B 2  69   ? 152.058 169.909 207.434 1.00 33.54  ? 69   VAL B CA 1 
ATOM 1448 C CA . GLN B 2  70   ? 149.280 167.270 207.824 1.00 37.00  ? 70   GLN B CA 1 
ATOM 1449 C CA . GLN B 2  71   ? 150.515 164.146 206.031 1.00 28.69  ? 71   GLN B CA 1 
ATOM 1450 C CA . HIS B 2  72   ? 149.172 163.974 202.493 1.00 24.99  ? 72   HIS B CA 1 
ATOM 1451 C CA . CYS B 2  73   ? 149.590 162.198 199.180 1.00 15.82  ? 73   CYS B CA 1 
ATOM 1452 C CA . PRO B 2  74   ? 152.171 163.828 196.845 1.00 24.65  ? 74   PRO B CA 1 
ATOM 1453 C CA . MET B 2  75   ? 149.946 163.288 193.789 1.00 28.31  ? 75   MET B CA 1 
ATOM 1454 C CA . CYS B 2  76   ? 146.341 164.093 194.806 1.00 31.80  ? 76   CYS B CA 1 
ATOM 1455 C CA . ARG B 2  77   ? 147.070 165.816 198.136 1.00 24.85  ? 77   ARG B CA 1 
ATOM 1456 C CA . GLN B 2  78   ? 144.282 163.944 199.931 1.00 30.76  ? 78   GLN B CA 1 
ATOM 1457 C CA . GLU B 2  79   ? 144.858 162.961 203.592 1.00 28.36  ? 79   GLU B CA 1 
ATOM 1458 C CA . TRP B 2  80   ? 147.499 160.225 203.772 1.00 25.38  ? 80   TRP B CA 1 
ATOM 1459 C CA . LYS B 2  81   ? 146.681 156.857 205.331 1.00 22.95  ? 81   LYS B CA 1 
ATOM 1460 C CA . PHE B 2  82   ? 148.357 153.557 204.519 1.00 20.14  ? 82   PHE B CA 1 
ATOM 1461 C CA . LYS B 2  83   ? 146.007 150.953 203.090 1.00 21.03  ? 83   LYS B CA 1 
ATOM 1462 C CA . PHE C 3  26   ? 221.896 276.535 178.890 1.00 254.96 ? 26   PHE C CA 1 
ATOM 1463 C CA . SER C 3  27   ? 223.297 279.791 180.467 1.00 295.40 ? 27   SER C CA 1 
ATOM 1464 C CA . ASP C 3  28   ? 220.057 281.254 182.006 1.00 312.43 ? 28   ASP C CA 1 
ATOM 1465 C CA . LEU C 3  29   ? 217.058 279.804 183.866 1.00 231.30 ? 29   LEU C CA 1 
ATOM 1466 C CA . ARG C 3  30   ? 214.695 282.696 184.232 1.00 292.58 ? 30   ARG C CA 1 
ATOM 1467 C CA . GLU C 3  31   ? 214.990 283.014 180.457 1.00 236.18 ? 31   GLU C CA 1 
ATOM 1468 C CA . ILE C 3  32   ? 214.356 279.282 179.995 1.00 210.97 ? 32   ILE C CA 1 
ATOM 1469 C CA . LYS C 3  33   ? 211.429 279.187 182.377 1.00 200.64 ? 33   LYS C CA 1 
ATOM 1470 C CA . LYS C 3  34   ? 209.845 282.208 180.635 1.00 272.40 ? 34   LYS C CA 1 
ATOM 1471 C CA . GLN C 3  35   ? 210.374 280.719 177.231 1.00 172.65 ? 35   GLN C CA 1 
ATOM 1472 C CA . LEU C 3  36   ? 209.114 277.261 178.411 1.00 212.40 ? 36   LEU C CA 1 
ATOM 1473 C CA . LEU C 3  37   ? 206.018 278.911 179.869 1.00 347.34 ? 37   LEU C CA 1 
ATOM 1474 C CA . LEU C 3  38   ? 205.140 280.536 176.526 1.00 390.26 ? 38   LEU C CA 1 
ATOM 1475 C CA . ILE C 3  39   ? 205.267 277.145 174.760 1.00 282.65 ? 39   ILE C CA 1 
ATOM 1476 C CA . ALA C 3  40   ? 202.978 275.625 177.431 1.00 285.67 ? 40   ALA C CA 1 
ATOM 1477 C CA . GLY C 3  41   ? 200.517 278.552 176.739 1.00 373.42 ? 41   GLY C CA 1 
ATOM 1478 C CA . LEU C 3  42   ? 200.751 278.150 172.894 1.00 244.85 ? 42   LEU C CA 1 
ATOM 1479 C CA . THR C 3  43   ? 200.140 274.348 173.016 1.00 180.16 ? 43   THR C CA 1 
ATOM 1480 C CA . ARG C 3  44   ? 197.244 274.687 175.515 1.00 171.88 ? 44   ARG C CA 1 
ATOM 1481 C CA . GLU C 3  45   ? 195.604 277.172 173.168 1.00 198.82 ? 45   GLU C CA 1 
ATOM 1482 C CA . ARG C 3  46   ? 195.870 274.636 170.326 1.00 193.94 ? 46   ARG C CA 1 
ATOM 1483 C CA . GLY C 3  47   ? 194.706 271.782 172.596 1.00 199.03 ? 47   GLY C CA 1 
ATOM 1484 C CA . LEU C 3  48   ? 197.857 269.694 172.501 1.00 223.47 ? 48   LEU C CA 1 
ATOM 1485 C CA . LEU C 3  49   ? 197.269 268.625 176.072 1.00 238.53 ? 49   LEU C CA 1 
ATOM 1486 C CA . HIS C 3  50   ? 200.008 266.168 176.749 1.00 206.78 ? 50   HIS C CA 1 
ATOM 1487 C CA . SER C 3  51   ? 202.773 268.352 175.405 1.00 223.58 ? 51   SER C CA 1 
ATOM 1488 C CA . SER C 3  52   ? 201.347 271.266 177.477 1.00 159.24 ? 52   SER C CA 1 
ATOM 1489 C CA . LYS C 3  53   ? 201.343 269.119 180.671 1.00 175.74 ? 53   LYS C CA 1 
ATOM 1490 C CA . TRP C 3  54   ? 205.006 268.093 180.051 1.00 184.60 ? 54   TRP C CA 1 
ATOM 1491 C CA . SER C 3  55   ? 206.153 271.649 179.377 1.00 164.78 ? 55   SER C CA 1 
ATOM 1492 C CA . ALA C 3  56   ? 204.251 272.954 182.455 1.00 142.15 ? 56   ALA C CA 1 
ATOM 1493 C CA . GLU C 3  57   ? 205.905 270.307 184.631 1.00 192.80 ? 57   GLU C CA 1 
ATOM 1494 C CA . LEU C 3  58   ? 209.372 271.547 183.856 1.00 171.66 ? 58   LEU C CA 1 
ATOM 1495 C CA . ALA C 3  59   ? 208.294 275.213 184.287 1.00 169.48 ? 59   ALA C CA 1 
ATOM 1496 C CA . PHE C 3  60   ? 207.031 274.308 187.812 1.00 224.53 ? 60   PHE C CA 1 
ATOM 1497 C CA . SER C 3  61   ? 210.426 272.733 188.568 1.00 198.85 ? 61   SER C CA 1 
ATOM 1498 C CA . LEU C 3  62   ? 212.165 276.068 187.855 1.00 267.87 ? 62   LEU C CA 1 
ATOM 1499 C CA . PRO C 3  63   ? 212.280 278.902 190.438 1.00 431.77 ? 63   PRO C CA 1 
ATOM 1500 C CA . ALA C 3  64   ? 209.035 280.970 190.603 1.00 500.00 ? 64   ALA C CA 1 
ATOM 1501 C CA . LEU C 3  65   ? 208.979 284.326 188.796 1.00 500.00 ? 65   LEU C CA 1 
ATOM 1502 C CA . PRO C 3  66   ? 208.399 287.502 190.910 1.00 500.00 ? 66   PRO C CA 1 
ATOM 1503 C CA . LEU C 3  67   ? 206.347 289.511 188.302 1.00 500.00 ? 67   LEU C CA 1 
ATOM 1504 C CA . ALA C 3  68   ? 209.405 291.255 186.759 1.00 500.00 ? 68   ALA C CA 1 
ATOM 1505 C CA . GLU C 3  69   ? 210.423 289.022 183.788 1.00 500.00 ? 69   GLU C CA 1 
ATOM 1506 C CA . LEU C 3  70   ? 206.759 288.072 183.149 1.00 500.00 ? 70   LEU C CA 1 
ATOM 1507 C CA . GLN C 3  71   ? 205.513 289.018 179.673 1.00 500.00 ? 71   GLN C CA 1 
ATOM 1508 C CA . PRO C 3  72   ? 202.050 290.131 178.496 1.00 500.00 ? 72   PRO C CA 1 
ATOM 1509 C CA . PRO C 3  73   ? 200.508 287.833 175.794 1.00 500.00 ? 73   PRO C CA 1 
ATOM 1510 C CA . PRO C 3  74   ? 201.419 288.856 172.167 1.00 500.00 ? 74   PRO C CA 1 
ATOM 1511 C CA . PRO C 3  75   ? 199.382 291.735 170.694 1.00 500.00 ? 75   PRO C CA 1 
ATOM 1512 C CA . ILE C 3  76   ? 196.468 290.429 168.607 1.00 435.54 ? 76   ILE C CA 1 
ATOM 1513 C CA . THR C 3  77   ? 197.375 290.022 164.894 1.00 259.67 ? 77   THR C CA 1 
ATOM 1514 C CA . GLU C 3  78   ? 195.169 291.057 161.937 1.00 284.92 ? 78   GLU C CA 1 
ATOM 1515 C CA . GLU C 3  79   ? 194.307 287.526 160.859 1.00 297.27 ? 79   GLU C CA 1 
ATOM 1516 C CA . ASP C 3  80   ? 193.484 286.553 164.519 1.00 285.71 ? 80   ASP C CA 1 
ATOM 1517 C CA . ALA C 3  81   ? 190.788 289.245 164.576 1.00 396.70 ? 81   ALA C CA 1 
ATOM 1518 C CA . GLN C 3  82   ? 189.266 287.815 161.368 1.00 313.41 ? 82   GLN C CA 1 
ATOM 1519 C CA . ASP C 3  83   ? 189.137 284.266 162.827 1.00 258.10 ? 83   ASP C CA 1 
ATOM 1520 C CA . MET C 3  84   ? 188.519 285.234 166.509 1.00 332.10 ? 84   MET C CA 1 
ATOM 1521 C CA . ASP C 3  85   ? 184.832 284.285 166.431 1.00 284.56 ? 85   ASP C CA 1 
ATOM 1522 C CA . ALA C 3  86   ? 185.380 280.976 164.731 1.00 220.17 ? 86   ALA C CA 1 
ATOM 1523 C CA . TYR C 3  87   ? 188.422 280.072 166.811 1.00 207.97 ? 87   TYR C CA 1 
ATOM 1524 C CA . THR C 3  88   ? 187.019 280.766 170.221 1.00 173.18 ? 88   THR C CA 1 
ATOM 1525 C CA . LEU C 3  89   ? 183.791 278.931 169.423 1.00 178.10 ? 89   LEU C CA 1 
ATOM 1526 C CA . ALA C 3  90   ? 185.620 276.028 167.749 1.00 198.65 ? 90   ALA C CA 1 
ATOM 1527 C CA . LYS C 3  91   ? 188.037 275.676 170.657 1.00 177.92 ? 91   LYS C CA 1 
ATOM 1528 C CA . ALA C 3  92   ? 185.276 275.425 173.130 1.00 181.70 ? 92   ALA C CA 1 
ATOM 1529 C CA . TYR C 3  93   ? 183.584 272.679 171.182 1.00 177.24 ? 93   TYR C CA 1 
ATOM 1530 C CA . PHE C 3  94   ? 186.922 271.037 170.763 1.00 194.67 ? 94   PHE C CA 1 
ATOM 1531 C CA . ASP C 3  95   ? 187.271 270.913 174.555 1.00 165.60 ? 95   ASP C CA 1 
ATOM 1532 C CA . VAL C 3  96   ? 183.784 269.469 175.175 1.00 187.66 ? 96   VAL C CA 1 
ATOM 1533 C CA . LYS C 3  97   ? 184.969 267.456 173.150 1.00 176.78 ? 97   LYS C CA 1 
ATOM 1534 C CA . GLU C 3  98   ? 183.002 267.042 169.917 1.00 200.05 ? 98   GLU C CA 1 
ATOM 1535 C CA . TYR C 3  99   ? 185.740 267.297 167.433 1.00 207.97 ? 99   TYR C CA 1 
ATOM 1536 C CA . ASP C 3  100  ? 183.701 266.874 164.250 1.00 202.11 ? 100  ASP C CA 1 
ATOM 1537 C CA . ARG C 3  101  ? 181.575 269.863 165.133 1.00 232.32 ? 101  ARG C CA 1 
ATOM 1538 C CA . ALA C 3  102  ? 184.623 271.990 165.973 1.00 187.34 ? 102  ALA C CA 1 
ATOM 1539 C CA . ALA C 3  103  ? 186.129 271.088 162.577 1.00 226.64 ? 103  ALA C CA 1 
ATOM 1540 C CA . HIS C 3  104  ? 183.028 272.223 160.751 1.00 191.62 ? 104  HIS C CA 1 
ATOM 1541 C CA . PHE C 3  105  ? 183.218 275.755 162.160 1.00 197.16 ? 105  PHE C CA 1 
ATOM 1542 C CA . LEU C 3  106  ? 186.770 276.471 161.279 1.00 201.87 ? 106  LEU C CA 1 
ATOM 1543 C CA . HIS C 3  107  ? 186.400 275.046 157.743 1.00 234.08 ? 107  HIS C CA 1 
ATOM 1544 C CA . GLY C 3  108  ? 186.930 278.422 156.102 1.00 271.26 ? 108  GLY C CA 1 
ATOM 1545 C CA . CYS C 3  109  ? 189.590 279.889 158.365 1.00 240.90 ? 109  CYS C CA 1 
ATOM 1546 C CA . ASN C 3  110  ? 193.124 280.641 157.148 1.00 251.56 ? 110  ASN C CA 1 
ATOM 1547 C CA . SER C 3  111  ? 194.938 281.764 160.353 1.00 255.86 ? 111  SER C CA 1 
ATOM 1548 C CA . LYS C 3  112  ? 197.900 279.649 161.404 1.00 243.85 ? 112  LYS C CA 1 
ATOM 1549 C CA . LYS C 3  113  ? 196.383 279.009 164.859 1.00 267.24 ? 113  LYS C CA 1 
ATOM 1550 C CA . ALA C 3  114  ? 193.075 278.196 163.170 1.00 225.35 ? 114  ALA C CA 1 
ATOM 1551 C CA . TYR C 3  115  ? 193.567 275.757 160.309 1.00 222.89 ? 115  TYR C CA 1 
ATOM 1552 C CA . PHE C 3  116  ? 195.931 274.000 162.721 1.00 192.86 ? 116  PHE C CA 1 
ATOM 1553 C CA . LEU C 3  117  ? 193.094 273.462 165.127 1.00 179.09 ? 117  LEU C CA 1 
ATOM 1554 C CA . TYR C 3  118  ? 190.862 272.524 162.180 1.00 207.38 ? 118  TYR C CA 1 
ATOM 1555 C CA . MET C 3  119  ? 193.261 269.877 160.956 1.00 164.21 ? 119  MET C CA 1 
ATOM 1556 C CA . TYR C 3  120  ? 194.091 268.611 164.441 1.00 160.68 ? 120  TYR C CA 1 
ATOM 1557 C CA . SER C 3  121  ? 190.354 268.388 165.191 1.00 224.13 ? 121  SER C CA 1 
ATOM 1558 C CA . ARG C 3  122  ? 189.773 266.382 162.017 1.00 178.03 ? 122  ARG C CA 1 
ATOM 1559 C CA . TYR C 3  123  ? 192.692 264.132 162.976 1.00 160.44 ? 123  TYR C CA 1 
ATOM 1560 C CA . LEU C 3  124  ? 191.299 263.462 166.490 1.00 203.86 ? 124  LEU C CA 1 
ATOM 1561 C CA . SER C 3  125  ? 187.755 262.981 165.128 1.00 215.01 ? 125  SER C CA 1 
ATOM 1562 C CA . GLY C 3  126  ? 189.227 260.138 163.048 1.00 140.79 ? 126  GLY C CA 1 
ATOM 1563 C CA . GLU C 3  127  ? 190.933 258.865 166.188 1.00 165.78 ? 127  GLU C CA 1 
ATOM 1564 C CA . LYS C 3  128  ? 187.792 259.068 168.358 1.00 244.61 ? 128  LYS C CA 1 
ATOM 1565 C CA . LYS C 3  129  ? 186.033 256.945 165.834 1.00 325.13 ? 129  LYS C CA 1 
ATOM 1566 C CA . LYS C 3  130  ? 188.977 254.495 165.602 1.00 208.76 ? 130  LYS C CA 1 
ATOM 1567 C CA . ASP C 3  131  ? 188.697 254.045 169.356 1.00 179.36 ? 131  ASP C CA 1 
ATOM 1568 C CA . ASP C 3  132  ? 184.892 253.779 169.244 1.00 216.18 ? 132  ASP C CA 1 
ATOM 1569 C CA . GLU C 3  133  ? 184.747 251.246 166.386 1.00 240.88 ? 133  GLU C CA 1 
ATOM 1570 C CA . THR C 3  134  ? 187.496 249.250 168.212 1.00 181.04 ? 134  THR C CA 1 
ATOM 1571 C CA . VAL C 3  135  ? 185.427 248.799 171.345 1.00 186.23 ? 135  VAL C CA 1 
ATOM 1572 C CA . ASP C 3  136  ? 182.369 247.651 169.320 1.00 201.12 ? 136  ASP C CA 1 
ATOM 1573 C CA . SER C 3  137  ? 184.198 245.529 166.677 1.00 224.91 ? 137  SER C CA 1 
ATOM 1574 C CA . GLN C 3  145  ? 192.217 246.379 161.114 1.00 222.84 ? 145  GLN C CA 1 
ATOM 1575 C CA . VAL C 3  146  ? 190.613 249.538 162.546 1.00 196.22 ? 146  VAL C CA 1 
ATOM 1576 C CA . LYS C 3  147  ? 192.516 252.409 160.977 1.00 197.74 ? 147  LYS C CA 1 
ATOM 1577 C CA . ASN C 3  148  ? 192.262 256.034 161.938 1.00 142.20 ? 148  ASN C CA 1 
ATOM 1578 C CA . GLU C 3  149  ? 190.731 256.502 158.430 1.00 238.84 ? 149  GLU C CA 1 
ATOM 1579 C CA . ALA C 3  150  ? 190.936 260.306 158.617 1.00 241.34 ? 150  ALA C CA 1 
ATOM 1580 C CA . LEU C 3  151  ? 194.624 259.827 158.107 1.00 203.13 ? 151  LEU C CA 1 
ATOM 1581 C CA . ARG C 3  152  ? 194.684 258.713 154.455 1.00 200.03 ? 152  ARG C CA 1 
ATOM 1582 C CA . GLU C 3  153  ? 192.742 261.837 153.371 1.00 219.75 ? 153  GLU C CA 1 
ATOM 1583 C CA . LEU C 3  154  ? 194.822 263.962 155.762 1.00 207.80 ? 154  LEU C CA 1 
ATOM 1584 C CA . ARG C 3  155  ? 198.185 262.879 154.247 1.00 239.87 ? 155  ARG C CA 1 
ATOM 1585 C CA . VAL C 3  156  ? 197.171 264.223 150.838 1.00 243.69 ? 156  VAL C CA 1 
ATOM 1586 C CA . GLU C 3  157  ? 196.032 267.605 152.122 1.00 274.21 ? 157  GLU C CA 1 
ATOM 1587 C CA . LEU C 3  158  ? 198.945 267.983 154.549 1.00 245.89 ? 158  LEU C CA 1 
ATOM 1588 C CA . SER C 3  159  ? 201.525 267.028 151.904 1.00 288.81 ? 159  SER C CA 1 
ATOM 1589 C CA . LYS C 3  160  ? 200.260 269.743 149.589 1.00 241.56 ? 160  LYS C CA 1 
ATOM 1590 C CA . LYS C 3  161  ? 200.654 272.344 152.302 1.00 220.87 ? 161  LYS C CA 1 
ATOM 1591 C CA . HIS C 3  162  ? 204.105 271.052 153.313 1.00 218.77 ? 162  HIS C CA 1 
ATOM 1592 C CA . GLN C 3  163  ? 205.372 271.238 149.724 1.00 263.33 ? 163  GLN C CA 1 
ATOM 1593 C CA . ALA C 3  164  ? 204.056 274.743 149.480 1.00 266.53 ? 164  ALA C CA 1 
ATOM 1594 C CA . ARG C 3  165  ? 205.827 275.488 152.780 1.00 249.48 ? 165  ARG C CA 1 
ATOM 1595 C CA . GLU C 3  166  ? 202.954 277.556 154.181 1.00 290.37 ? 166  GLU C CA 1 
ATOM 1596 C CA . LEU C 3  167  ? 202.605 275.149 157.115 1.00 278.00 ? 167  LEU C CA 1 
ATOM 1597 C CA . ASP C 3  168  ? 204.942 276.017 159.985 1.00 283.87 ? 168  ASP C CA 1 
ATOM 1598 C CA . GLY C 3  169  ? 206.069 274.822 163.415 1.00 388.39 ? 169  GLY C CA 1 
ATOM 1599 C CA . PHE C 3  170  ? 203.451 272.558 164.921 1.00 213.52 ? 170  PHE C CA 1 
ATOM 1600 C CA . GLY C 3  171  ? 201.774 271.887 161.576 1.00 248.76 ? 171  GLY C CA 1 
ATOM 1601 C CA . LEU C 3  172  ? 204.932 269.971 160.676 1.00 194.01 ? 172  LEU C CA 1 
ATOM 1602 C CA . TYR C 3  173  ? 204.415 268.043 163.950 1.00 226.54 ? 173  TYR C CA 1 
ATOM 1603 C CA . LEU C 3  174  ? 200.832 267.278 162.984 1.00 185.08 ? 174  LEU C CA 1 
ATOM 1604 C CA . TYR C 3  175  ? 202.034 266.020 159.579 1.00 192.54 ? 175  TYR C CA 1 
ATOM 1605 C CA . GLY C 3  176  ? 204.630 263.935 161.321 1.00 195.75 ? 176  GLY C CA 1 
ATOM 1606 C CA . VAL C 3  177  ? 201.990 262.330 163.590 1.00 222.04 ? 177  VAL C CA 1 
ATOM 1607 C CA . VAL C 3  178  ? 199.855 261.432 160.532 1.00 194.76 ? 178  VAL C CA 1 
ATOM 1608 C CA . LEU C 3  179  ? 202.693 259.771 158.610 1.00 236.03 ? 179  LEU C CA 1 
ATOM 1609 C CA . ARG C 3  180  ? 203.797 257.899 161.767 1.00 214.11 ? 180  ARG C CA 1 
ATOM 1610 C CA . LYS C 3  181  ? 200.276 256.517 162.045 1.00 216.64 ? 181  LYS C CA 1 
ATOM 1611 C CA . LEU C 3  182  ? 200.492 255.360 158.417 1.00 241.18 ? 182  LEU C CA 1 
ATOM 1612 C CA . ASP C 3  183  ? 203.792 253.594 159.401 1.00 323.09 ? 183  ASP C CA 1 
ATOM 1613 C CA . LEU C 3  184  ? 205.816 255.809 157.114 1.00 232.42 ? 184  LEU C CA 1 
ATOM 1614 C CA . VAL C 3  185  ? 208.684 255.806 159.576 1.00 270.54 ? 185  VAL C CA 1 
ATOM 1615 C CA . LYS C 3  186  ? 211.546 256.745 157.352 1.00 281.57 ? 186  LYS C CA 1 
ATOM 1616 C CA . GLU C 3  187  ? 209.640 259.698 155.994 1.00 247.50 ? 187  GLU C CA 1 
ATOM 1617 C CA . ALA C 3  188  ? 208.310 260.694 159.447 1.00 193.40 ? 188  ALA C CA 1 
ATOM 1618 C CA . ILE C 3  189  ? 211.751 261.052 160.962 1.00 203.10 ? 189  ILE C CA 1 
ATOM 1619 C CA . ASP C 3  190  ? 212.690 263.471 158.171 1.00 266.70 ? 190  ASP C CA 1 
ATOM 1620 C CA . VAL C 3  191  ? 209.596 265.579 158.877 1.00 228.14 ? 191  VAL C CA 1 
ATOM 1621 C CA . PHE C 3  192  ? 209.961 265.514 162.643 1.00 186.78 ? 192  PHE C CA 1 
ATOM 1622 C CA . VAL C 3  193  ? 213.624 266.472 162.438 1.00 241.43 ? 193  VAL C CA 1 
ATOM 1623 C CA . GLU C 3  194  ? 212.580 269.455 160.292 1.00 253.38 ? 194  GLU C CA 1 
ATOM 1624 C CA . ALA C 3  195  ? 209.777 270.331 162.863 1.00 199.42 ? 195  ALA C CA 1 
ATOM 1625 C CA . THR C 3  196  ? 212.177 270.584 165.734 1.00 269.79 ? 196  THR C CA 1 
ATOM 1626 C CA . HIS C 3  197  ? 214.665 272.582 163.648 1.00 328.40 ? 197  HIS C CA 1 
ATOM 1627 C CA . VAL C 3  198  ? 211.892 275.095 162.762 1.00 406.39 ? 198  VAL C CA 1 
ATOM 1628 C CA . LEU C 3  199  ? 210.202 275.213 166.183 1.00 414.01 ? 199  LEU C CA 1 
ATOM 1629 C CA . PRO C 3  200  ? 211.805 273.861 169.345 1.00 303.52 ? 200  PRO C CA 1 
ATOM 1630 C CA . LEU C 3  201  ? 210.328 273.592 172.865 1.00 166.67 ? 201  LEU C CA 1 
ATOM 1631 C CA . HIS C 3  202  ? 207.290 271.593 171.674 1.00 206.99 ? 202  HIS C CA 1 
ATOM 1632 C CA . TRP C 3  203  ? 207.799 268.307 173.413 1.00 186.33 ? 203  TRP C CA 1 
ATOM 1633 C CA . GLY C 3  204  ? 205.389 266.299 171.366 1.00 224.86 ? 204  GLY C CA 1 
ATOM 1634 C CA . ALA C 3  205  ? 207.528 266.697 168.184 1.00 258.69 ? 205  ALA C CA 1 
ATOM 1635 C CA . TRP C 3  206  ? 210.694 265.680 169.957 1.00 186.32 ? 206  TRP C CA 1 
ATOM 1636 C CA . LEU C 3  207  ? 208.926 262.846 171.731 1.00 213.67 ? 207  LEU C CA 1 
ATOM 1637 C CA . GLU C 3  208  ? 207.549 261.259 168.506 1.00 198.87 ? 208  GLU C CA 1 
ATOM 1638 C CA . LEU C 3  209  ? 211.213 261.183 167.423 1.00 227.50 ? 209  LEU C CA 1 
ATOM 1639 C CA . CYS C 3  210  ? 212.039 259.076 170.503 1.00 196.15 ? 210  CYS C CA 1 
ATOM 1640 C CA . ASN C 3  211  ? 209.578 256.332 169.406 1.00 237.47 ? 211  ASN C CA 1 
ATOM 1641 C CA . LEU C 3  212  ? 210.871 256.232 165.813 1.00 192.43 ? 212  LEU C CA 1 
ATOM 1642 C CA . ILE C 3  213  ? 214.685 256.058 166.301 1.00 222.37 ? 213  ILE C CA 1 
ATOM 1643 C CA . THR C 3  214  ? 215.754 252.450 166.694 1.00 249.38 ? 214  THR C CA 1 
ATOM 1644 C CA . ASP C 3  215  ? 219.609 252.833 166.884 1.00 269.11 ? 215  ASP C CA 1 
ATOM 1645 C CA . LYS C 3  216  ? 222.325 255.279 168.130 1.00 224.56 ? 216  LYS C CA 1 
ATOM 1646 C CA . GLU C 3  217  ? 223.790 255.270 164.570 1.00 285.77 ? 217  GLU C CA 1 
ATOM 1647 C CA . MET C 3  218  ? 220.478 256.641 163.179 1.00 244.81 ? 218  MET C CA 1 
ATOM 1648 C CA . LEU C 3  219  ? 220.701 259.377 165.843 1.00 243.11 ? 219  LEU C CA 1 
ATOM 1649 C CA . LYS C 3  220  ? 224.266 260.384 164.835 1.00 241.02 ? 220  LYS C CA 1 
ATOM 1650 C CA . PHE C 3  221  ? 223.107 260.638 161.167 1.00 269.65 ? 221  PHE C CA 1 
ATOM 1651 C CA . LEU C 3  222  ? 220.411 263.286 161.921 1.00 230.43 ? 222  LEU C CA 1 
ATOM 1652 C CA . SER C 3  223  ? 221.045 266.953 162.672 1.00 267.46 ? 223  SER C CA 1 
ATOM 1653 C CA . LEU C 3  224  ? 219.062 268.662 165.473 1.00 233.84 ? 224  LEU C CA 1 
ATOM 1654 C CA . PRO C 3  225  ? 218.840 272.265 166.854 1.00 417.00 ? 225  PRO C CA 1 
ATOM 1655 C CA . ASP C 3  226  ? 221.227 273.589 169.552 1.00 454.79 ? 226  ASP C CA 1 
ATOM 1656 C CA . THR C 3  227  ? 218.331 274.559 171.889 1.00 339.46 ? 227  THR C CA 1 
ATOM 1657 C CA . TRP C 3  228  ? 218.549 272.959 175.336 1.00 253.69 ? 228  TRP C CA 1 
ATOM 1658 C CA . MET C 3  229  ? 215.697 270.527 174.616 1.00 259.92 ? 229  MET C CA 1 
ATOM 1659 C CA . LYS C 3  230  ? 218.243 268.426 172.671 1.00 248.47 ? 230  LYS C CA 1 
ATOM 1660 C CA . GLU C 3  231  ? 219.709 267.537 176.093 1.00 259.26 ? 231  GLU C CA 1 
ATOM 1661 C CA . PHE C 3  232  ? 216.397 266.192 177.484 1.00 190.50 ? 232  PHE C CA 1 
ATOM 1662 C CA . PHE C 3  233  ? 215.974 264.319 174.180 1.00 202.77 ? 233  PHE C CA 1 
ATOM 1663 C CA . LEU C 3  234  ? 219.334 262.580 173.878 1.00 277.94 ? 234  LEU C CA 1 
ATOM 1664 C CA . ALA C 3  235  ? 218.966 261.568 177.528 1.00 264.16 ? 235  ALA C CA 1 
ATOM 1665 C CA . HIS C 3  236  ? 215.453 260.122 176.925 1.00 214.38 ? 236  HIS C CA 1 
ATOM 1666 C CA . ILE C 3  237  ? 216.736 258.291 173.807 1.00 249.33 ? 237  ILE C CA 1 
ATOM 1667 C CA . TYR C 3  238  ? 219.487 256.722 175.912 1.00 277.27 ? 238  TYR C CA 1 
ATOM 1668 C CA . THR C 3  239  ? 216.720 255.303 178.180 1.00 219.76 ? 239  THR C CA 1 
ATOM 1669 C CA . GLU C 3  240  ? 214.851 253.957 175.086 1.00 211.33 ? 240  GLU C CA 1 
ATOM 1670 C CA . LEU C 3  241  ? 218.154 252.479 173.857 1.00 217.89 ? 241  LEU C CA 1 
ATOM 1671 C CA . GLN C 3  242  ? 219.295 250.960 177.213 1.00 239.11 ? 242  GLN C CA 1 
ATOM 1672 C CA . LEU C 3  243  ? 222.585 252.981 177.179 1.00 251.21 ? 243  LEU C CA 1 
ATOM 1673 C CA . ILE C 3  244  ? 221.594 253.830 180.749 1.00 201.00 ? 244  ILE C CA 1 
ATOM 1674 C CA . GLU C 3  245  ? 225.024 254.545 182.278 1.00 222.19 ? 245  GLU C CA 1 
ATOM 1675 C CA . GLU C 3  246  ? 225.382 257.439 179.816 1.00 266.32 ? 246  GLU C CA 1 
ATOM 1676 C CA . ALA C 3  247  ? 221.699 258.404 180.281 1.00 180.59 ? 247  ALA C CA 1 
ATOM 1677 C CA . LEU C 3  248  ? 222.172 258.534 184.087 1.00 245.56 ? 248  LEU C CA 1 
ATOM 1678 C CA . GLN C 3  249  ? 225.117 260.959 183.570 1.00 271.80 ? 249  GLN C CA 1 
ATOM 1679 C CA . LYS C 3  250  ? 223.054 262.975 181.090 1.00 159.82 ? 250  LYS C CA 1 
ATOM 1680 C CA . TYR C 3  251  ? 220.231 263.187 183.616 1.00 213.58 ? 251  TYR C CA 1 
ATOM 1681 C CA . GLN C 3  252  ? 222.750 264.088 186.333 1.00 358.39 ? 252  GLN C CA 1 
ATOM 1682 C CA . ASN C 3  253  ? 223.533 267.280 184.352 1.00 333.60 ? 253  ASN C CA 1 
ATOM 1683 C CA . LEU C 3  254  ? 219.791 268.265 184.397 1.00 337.94 ? 254  LEU C CA 1 
ATOM 1684 C CA . ILE C 3  255  ? 219.439 267.760 188.187 1.00 379.16 ? 255  ILE C CA 1 
ATOM 1685 C CA . ASP C 3  256  ? 222.537 270.033 188.530 1.00 395.49 ? 256  ASP C CA 1 
ATOM 1686 C CA . VAL C 3  257  ? 221.079 272.742 186.189 1.00 248.30 ? 257  VAL C CA 1 
ATOM 1687 C CA . GLY C 3  258  ? 218.103 273.355 188.505 1.00 180.43 ? 258  GLY C CA 1 
ATOM 1688 C CA . PHE C 3  259  ? 215.525 270.980 187.078 1.00 178.10 ? 259  PHE C CA 1 
ATOM 1689 C CA . SER C 3  260  ? 215.911 268.906 190.304 1.00 238.21 ? 260  SER C CA 1 
ATOM 1690 C CA . LYS C 3  261  ? 212.458 269.862 191.537 1.00 180.18 ? 261  LYS C CA 1 
ATOM 1691 C CA . SER C 3  262  ? 210.642 268.530 188.423 1.00 189.06 ? 262  SER C CA 1 
ATOM 1692 C CA . SER C 3  263  ? 208.552 265.423 188.932 1.00 210.79 ? 263  SER C CA 1 
ATOM 1693 C CA . TYR C 3  264  ? 209.119 264.203 185.378 1.00 175.04 ? 264  TYR C CA 1 
ATOM 1694 C CA . ILE C 3  265  ? 212.889 264.103 185.840 1.00 170.60 ? 265  ILE C CA 1 
ATOM 1695 C CA . VAL C 3  266  ? 212.519 262.237 189.128 1.00 166.05 ? 266  VAL C CA 1 
ATOM 1696 C CA . SER C 3  267  ? 210.164 259.695 187.639 1.00 156.33 ? 267  SER C CA 1 
ATOM 1697 C CA . GLN C 3  268  ? 212.423 259.131 184.678 1.00 142.51 ? 268  GLN C CA 1 
ATOM 1698 C CA . ILE C 3  269  ? 215.415 258.628 186.966 1.00 158.92 ? 269  ILE C CA 1 
ATOM 1699 C CA . ALA C 3  270  ? 213.537 255.881 188.857 1.00 249.30 ? 270  ALA C CA 1 
ATOM 1700 C CA . VAL C 3  271  ? 212.518 254.189 185.593 1.00 164.13 ? 271  VAL C CA 1 
ATOM 1701 C CA . ALA C 3  272  ? 216.169 254.546 184.466 1.00 162.56 ? 272  ALA C CA 1 
ATOM 1702 C CA . TYR C 3  273  ? 217.517 252.883 187.621 1.00 159.63 ? 273  TYR C CA 1 
ATOM 1703 C CA . HIS C 3  274  ? 214.922 250.113 187.277 1.00 168.13 ? 274  HIS C CA 1 
ATOM 1704 C CA . ASN C 3  275  ? 216.332 249.433 183.804 1.00 150.83 ? 275  ASN C CA 1 
ATOM 1705 C CA . ILE C 3  276  ? 219.806 249.181 185.476 1.00 152.38 ? 276  ILE C CA 1 
ATOM 1706 C CA . ARG C 3  277  ? 218.219 246.931 188.108 1.00 297.46 ? 277  ARG C CA 1 
ATOM 1707 C CA . ASP C 3  278  ? 219.916 248.563 191.146 1.00 439.48 ? 278  ASP C CA 1 
ATOM 1708 C CA . ILE C 3  279  ? 216.773 248.273 193.298 1.00 338.62 ? 279  ILE C CA 1 
ATOM 1709 C CA . ASP C 3  280  ? 218.110 249.868 196.532 1.00 366.64 ? 280  ASP C CA 1 
ATOM 1710 C CA . LYS C 3  281  ? 219.221 253.119 194.802 1.00 322.54 ? 281  LYS C CA 1 
ATOM 1711 C CA . ALA C 3  282  ? 216.088 253.142 192.507 1.00 299.20 ? 282  ALA C CA 1 
ATOM 1712 C CA . LEU C 3  283  ? 213.647 252.483 195.358 1.00 148.06 ? 283  LEU C CA 1 
ATOM 1713 C CA . SER C 3  284  ? 214.783 255.439 197.484 1.00 172.75 ? 284  SER C CA 1 
ATOM 1714 C CA . ILE C 3  285  ? 214.044 257.706 194.437 1.00 324.43 ? 285  ILE C CA 1 
ATOM 1715 C CA . PHE C 3  286  ? 210.613 256.145 194.036 1.00 271.43 ? 286  PHE C CA 1 
ATOM 1716 C CA . ASN C 3  287  ? 209.912 256.967 197.669 1.00 182.70 ? 287  ASN C CA 1 
ATOM 1717 C CA . GLU C 3  288  ? 210.600 260.666 197.329 1.00 227.39 ? 288  GLU C CA 1 
ATOM 1718 C CA . LEU C 3  289  ? 208.769 260.556 193.993 1.00 181.99 ? 289  LEU C CA 1 
ATOM 1719 C CA . ARG C 3  290  ? 205.574 259.831 195.895 1.00 187.56 ? 290  ARG C CA 1 
ATOM 1720 C CA . LYS C 3  291  ? 206.473 262.660 198.260 1.00 186.49 ? 291  LYS C CA 1 
ATOM 1721 C CA . GLN C 3  292  ? 206.902 264.829 195.127 1.00 274.32 ? 292  GLN C CA 1 
ATOM 1722 C CA . ASP C 3  293  ? 203.486 263.846 193.688 1.00 146.56 ? 293  ASP C CA 1 
ATOM 1723 C CA . PRO C 3  294  ? 200.799 261.860 195.574 1.00 163.19 ? 294  PRO C CA 1 
ATOM 1724 C CA . TYR C 3  295  ? 198.345 261.489 192.703 1.00 150.78 ? 295  TYR C CA 1 
ATOM 1725 C CA . ARG C 3  296  ? 201.031 260.782 190.171 1.00 148.37 ? 296  ARG C CA 1 
ATOM 1726 C CA . ILE C 3  297  ? 199.963 257.424 188.827 1.00 143.77 ? 297  ILE C CA 1 
ATOM 1727 C CA . GLU C 3  298  ? 201.800 257.476 185.489 1.00 161.87 ? 298  GLU C CA 1 
ATOM 1728 C CA . ASN C 3  299  ? 204.891 255.488 186.527 1.00 142.97 ? 299  ASN C CA 1 
ATOM 1729 C CA . MET C 3  300  ? 203.542 253.542 189.491 1.00 202.49 ? 300  MET C CA 1 
ATOM 1730 C CA . ASP C 3  301  ? 203.375 250.412 187.402 1.00 221.53 ? 301  ASP C CA 1 
ATOM 1731 C CA . THR C 3  302  ? 207.165 250.141 187.298 1.00 264.49 ? 302  THR C CA 1 
ATOM 1732 C CA . PHE C 3  303  ? 207.212 251.212 191.036 1.00 263.65 ? 303  PHE C CA 1 
ATOM 1733 C CA . SER C 3  304  ? 205.010 248.310 191.967 1.00 319.67 ? 304  SER C CA 1 
ATOM 1734 C CA . ASN C 3  305  ? 207.182 245.886 189.915 1.00 288.52 ? 305  ASN C CA 1 
ATOM 1735 C CA . LEU C 3  306  ? 210.352 246.609 191.904 1.00 307.83 ? 306  LEU C CA 1 
ATOM 1736 C CA . LEU C 3  307  ? 208.528 246.798 195.208 1.00 130.93 ? 307  LEU C CA 1 
ATOM 1737 C CA . TYR C 3  308  ? 207.128 243.285 194.386 1.00 157.92 ? 308  TYR C CA 1 
ATOM 1738 C CA . VAL C 3  309  ? 210.617 241.795 193.724 1.00 169.47 ? 309  VAL C CA 1 
ATOM 1739 C CA . ARG C 3  310  ? 211.959 242.773 197.121 1.00 144.40 ? 310  ARG C CA 1 
ATOM 1740 C CA . SER C 3  311  ? 208.661 241.307 198.413 1.00 126.03 ? 311  SER C CA 1 
ATOM 1741 C CA . MET C 3  312  ? 207.275 244.152 200.566 1.00 167.85 ? 312  MET C CA 1 
ATOM 1742 C CA . LYS C 3  313  ? 203.577 243.191 200.729 1.00 173.92 ? 313  LYS C CA 1 
ATOM 1743 C CA . SER C 3  314  ? 202.929 245.966 203.246 1.00 177.14 ? 314  SER C CA 1 
ATOM 1744 C CA . GLU C 3  315  ? 204.420 248.750 201.156 1.00 152.22 ? 315  GLU C CA 1 
ATOM 1745 C CA . LEU C 3  316  ? 202.685 247.485 198.018 1.00 128.51 ? 316  LEU C CA 1 
ATOM 1746 C CA . SER C 3  317  ? 199.389 247.344 199.908 1.00 112.64 ? 317  SER C CA 1 
ATOM 1747 C CA . TYR C 3  318  ? 199.788 250.944 200.954 1.00 126.07 ? 318  TYR C CA 1 
ATOM 1748 C CA . LEU C 3  319  ? 200.435 251.831 197.243 1.00 180.62 ? 319  LEU C CA 1 
ATOM 1749 C CA . ALA C 3  320  ? 197.634 249.577 195.847 1.00 118.25 ? 320  ALA C CA 1 
ATOM 1750 C CA . HIS C 3  321  ? 194.731 250.658 198.143 1.00 120.22 ? 321  HIS C CA 1 
ATOM 1751 C CA . ASN C 3  322  ? 195.819 254.247 197.579 1.00 191.23 ? 322  ASN C CA 1 
ATOM 1752 C CA . LEU C 3  323  ? 195.820 254.017 193.804 1.00 136.68 ? 323  LEU C CA 1 
ATOM 1753 C CA . CYS C 3  324  ? 192.400 252.434 193.576 1.00 166.64 ? 324  CYS C CA 1 
ATOM 1754 C CA . GLU C 3  325  ? 191.103 255.550 195.421 1.00 226.58 ? 325  GLU C CA 1 
ATOM 1755 C CA . ILE C 3  326  ? 192.879 257.890 192.938 1.00 173.77 ? 326  ILE C CA 1 
ATOM 1756 C CA . ASP C 3  327  ? 192.028 256.262 189.524 1.00 190.08 ? 327  ASP C CA 1 
ATOM 1757 C CA . LYS C 3  328  ? 190.448 252.764 189.408 1.00 147.89 ? 328  LYS C CA 1 
ATOM 1758 C CA . TYR C 3  329  ? 190.434 252.582 185.609 1.00 156.36 ? 329  TYR C CA 1 
ATOM 1759 C CA . ARG C 3  330  ? 193.951 253.089 184.232 1.00 141.06 ? 330  ARG C CA 1 
ATOM 1760 C CA . VAL C 3  331  ? 196.517 250.442 183.039 1.00 156.49 ? 331  VAL C CA 1 
ATOM 1761 C CA . GLU C 3  332  ? 199.052 251.463 185.707 1.00 143.10 ? 332  GLU C CA 1 
ATOM 1762 C CA . THR C 3  333  ? 196.664 251.120 188.611 1.00 130.10 ? 333  THR C CA 1 
ATOM 1763 C CA . CYS C 3  334  ? 195.219 247.868 187.198 1.00 203.43 ? 334  CYS C CA 1 
ATOM 1764 C CA . CYS C 3  335  ? 198.713 246.382 187.119 1.00 207.42 ? 335  CYS C CA 1 
ATOM 1765 C CA . VAL C 3  336  ? 199.645 247.738 190.591 1.00 179.18 ? 336  VAL C CA 1 
ATOM 1766 C CA . ILE C 3  337  ? 196.492 246.064 191.997 1.00 138.05 ? 337  ILE C CA 1 
ATOM 1767 C CA . GLY C 3  338  ? 197.767 243.020 189.970 1.00 234.37 ? 338  GLY C CA 1 
ATOM 1768 C CA . ASN C 3  339  ? 201.230 243.048 191.584 1.00 275.20 ? 339  ASN C CA 1 
ATOM 1769 C CA . TYR C 3  340  ? 199.641 243.426 195.022 1.00 157.73 ? 340  TYR C CA 1 
ATOM 1770 C CA . TYR C 3  341  ? 197.362 240.438 194.260 1.00 298.41 ? 341  TYR C CA 1 
ATOM 1771 C CA . SER C 3  342  ? 200.287 238.336 193.043 1.00 275.39 ? 342  SER C CA 1 
ATOM 1772 C CA . LEU C 3  343  ? 202.285 238.991 196.224 1.00 139.54 ? 343  LEU C CA 1 
ATOM 1773 C CA . ARG C 3  344  ? 199.076 238.388 198.154 1.00 249.00 ? 344  ARG C CA 1 
ATOM 1774 C CA . SER C 3  345  ? 199.511 234.946 196.448 1.00 277.05 ? 345  SER C CA 1 
ATOM 1775 C CA . GLN C 3  346  ? 195.952 235.063 195.064 1.00 310.99 ? 346  GLN C CA 1 
ATOM 1776 C CA . HIS C 3  347  ? 197.050 234.287 191.472 1.00 157.42 ? 347  HIS C CA 1 
ATOM 1777 C CA . GLU C 3  348  ? 193.647 233.600 189.897 1.00 393.44 ? 348  GLU C CA 1 
ATOM 1778 C CA . LYS C 3  349  ? 192.697 237.218 190.698 1.00 435.96 ? 349  LYS C CA 1 
ATOM 1779 C CA . ALA C 3  350  ? 196.238 238.467 189.950 1.00 396.94 ? 350  ALA C CA 1 
ATOM 1780 C CA . ALA C 3  351  ? 196.238 237.152 186.332 1.00 316.18 ? 351  ALA C CA 1 
ATOM 1781 C CA . LEU C 3  352  ? 192.786 238.626 185.890 1.00 264.08 ? 352  LEU C CA 1 
ATOM 1782 C CA . TYR C 3  353  ? 193.789 242.180 186.819 1.00 141.41 ? 353  TYR C CA 1 
ATOM 1783 C CA . PHE C 3  354  ? 196.662 241.804 184.368 1.00 200.50 ? 354  PHE C CA 1 
ATOM 1784 C CA . GLN C 3  355  ? 194.078 240.545 181.900 1.00 179.75 ? 355  GLN C CA 1 
ATOM 1785 C CA . ARG C 3  356  ? 192.029 243.678 182.610 1.00 153.43 ? 356  ARG C CA 1 
ATOM 1786 C CA . ALA C 3  357  ? 195.023 246.022 182.373 1.00 122.01 ? 357  ALA C CA 1 
ATOM 1787 C CA . LEU C 3  358  ? 195.663 244.674 178.873 1.00 144.21 ? 358  LEU C CA 1 
ATOM 1788 C CA . LYS C 3  359  ? 191.972 245.081 178.174 1.00 181.80 ? 359  LYS C CA 1 
ATOM 1789 C CA . LEU C 3  360  ? 192.847 248.649 179.140 1.00 136.60 ? 360  LEU C CA 1 
ATOM 1790 C CA . ASN C 3  361  ? 195.711 248.834 176.629 1.00 215.86 ? 361  ASN C CA 1 
ATOM 1791 C CA . PRO C 3  362  ? 196.302 246.481 174.702 1.00 188.91 ? 362  PRO C CA 1 
ATOM 1792 C CA . ARG C 3  363  ? 199.749 247.675 173.474 1.00 179.25 ? 363  ARG C CA 1 
ATOM 1793 C CA . TYR C 3  364  ? 201.077 247.336 177.063 1.00 161.34 ? 364  TYR C CA 1 
ATOM 1794 C CA . LEU C 3  365  ? 203.372 244.353 176.555 1.00 185.25 ? 365  LEU C CA 1 
ATOM 1795 C CA . GLY C 3  366  ? 204.260 243.831 180.242 1.00 201.30 ? 366  GLY C CA 1 
ATOM 1796 C CA . ALA C 3  367  ? 200.901 242.230 180.911 1.00 155.19 ? 367  ALA C CA 1 
ATOM 1797 C CA . TRP C 3  368  ? 201.036 239.282 178.534 1.00 124.64 ? 368  TRP C CA 1 
ATOM 1798 C CA . THR C 3  369  ? 204.351 238.068 180.014 1.00 147.77 ? 369  THR C CA 1 
ATOM 1799 C CA . LEU C 3  370  ? 203.301 238.957 183.539 1.00 94.28  ? 370  LEU C CA 1 
ATOM 1800 C CA . MET C 3  371  ? 200.109 236.975 182.848 1.00 144.62 ? 371  MET C CA 1 
ATOM 1801 C CA . GLY C 3  372  ? 202.186 233.965 181.978 1.00 109.13 ? 372  GLY C CA 1 
ATOM 1802 C CA . HIS C 3  373  ? 203.964 233.864 185.318 1.00 121.46 ? 373  HIS C CA 1 
ATOM 1803 C CA . GLU C 3  374  ? 200.670 234.291 187.132 1.00 124.24 ? 374  GLU C CA 1 
ATOM 1804 C CA . TYR C 3  375  ? 199.158 231.377 185.188 1.00 135.27 ? 375  TYR C CA 1 
ATOM 1805 C CA . MET C 3  376  ? 202.377 229.589 185.971 1.00 125.34 ? 376  MET C CA 1 
ATOM 1806 C CA . GLU C 3  377  ? 201.868 230.118 189.719 1.00 214.37 ? 377  GLU C CA 1 
ATOM 1807 C CA . MET C 3  378  ? 198.327 228.636 189.830 1.00 368.85 ? 378  MET C CA 1 
ATOM 1808 C CA . LYS C 3  379  ? 199.950 225.774 187.791 1.00 394.95 ? 379  LYS C CA 1 
ATOM 1809 C CA . ASN C 3  380  ? 197.725 226.052 184.706 1.00 387.20 ? 380  ASN C CA 1 
ATOM 1810 C CA . THR C 3  381  ? 200.717 225.815 182.403 1.00 265.12 ? 381  THR C CA 1 
ATOM 1811 C CA . SER C 3  382  ? 198.976 225.527 178.946 1.00 294.54 ? 382  SER C CA 1 
ATOM 1812 C CA . ALA C 3  383  ? 197.386 228.839 179.824 1.00 130.51 ? 383  ALA C CA 1 
ATOM 1813 C CA . ALA C 3  384  ? 200.866 230.060 180.636 1.00 120.59 ? 384  ALA C CA 1 
ATOM 1814 C CA . ILE C 3  385  ? 202.212 228.935 177.231 1.00 107.54 ? 385  ILE C CA 1 
ATOM 1815 C CA . GLN C 3  386  ? 199.347 230.650 175.405 1.00 113.52 ? 386  GLN C CA 1 
ATOM 1816 C CA . ALA C 3  387  ? 199.917 233.643 177.617 1.00 93.01  ? 387  ALA C CA 1 
ATOM 1817 C CA . TYR C 3  388  ? 203.614 234.106 176.847 1.00 86.73  ? 388  TYR C CA 1 
ATOM 1818 C CA . ARG C 3  389  ? 202.855 233.164 173.257 1.00 115.26 ? 389  ARG C CA 1 
ATOM 1819 C CA . HIS C 3  390  ? 200.567 236.164 172.950 1.00 99.26  ? 390  HIS C CA 1 
ATOM 1820 C CA . ALA C 3  391  ? 203.414 238.436 174.038 1.00 100.47 ? 391  ALA C CA 1 
ATOM 1821 C CA . ILE C 3  392  ? 205.396 236.740 171.199 1.00 115.35 ? 392  ILE C CA 1 
ATOM 1822 C CA . GLU C 3  393  ? 202.506 237.238 168.671 1.00 156.24 ? 393  GLU C CA 1 
ATOM 1823 C CA . VAL C 3  394  ? 202.645 240.970 169.474 1.00 123.71 ? 394  VAL C CA 1 
ATOM 1824 C CA . ASN C 3  395  ? 206.483 241.102 169.773 1.00 123.90 ? 395  ASN C CA 1 
ATOM 1825 C CA . LYS C 3  396  ? 209.091 238.598 168.529 1.00 187.00 ? 396  LYS C CA 1 
ATOM 1826 C CA . ARG C 3  397  ? 211.204 241.377 170.183 1.00 173.34 ? 397  ARG C CA 1 
ATOM 1827 C CA . ASP C 3  398  ? 209.896 240.568 173.703 1.00 176.30 ? 398  ASP C CA 1 
ATOM 1828 C CA . TYR C 3  399  ? 212.713 238.597 175.273 1.00 154.43 ? 399  TYR C CA 1 
ATOM 1829 C CA . ARG C 3  400  ? 211.144 238.076 178.690 1.00 127.15 ? 400  ARG C CA 1 
ATOM 1830 C CA . ALA C 3  401  ? 208.203 236.217 177.051 1.00 150.32 ? 401  ALA C CA 1 
ATOM 1831 C CA . TRP C 3  402  ? 210.575 234.148 174.985 1.00 105.38 ? 402  TRP C CA 1 
ATOM 1832 C CA . TYR C 3  403  ? 212.502 233.259 178.129 1.00 85.06  ? 403  TYR C CA 1 
ATOM 1833 C CA . GLY C 3  404  ? 209.164 232.752 179.845 1.00 111.52 ? 404  GLY C CA 1 
ATOM 1834 C CA . LEU C 3  405  ? 208.237 230.149 177.243 1.00 98.12  ? 405  LEU C CA 1 
ATOM 1835 C CA . GLY C 3  406  ? 211.500 228.318 177.706 1.00 104.25 ? 406  GLY C CA 1 
ATOM 1836 C CA . GLN C 3  407  ? 211.160 228.565 181.491 1.00 116.47 ? 407  GLN C CA 1 
ATOM 1837 C CA . THR C 3  408  ? 207.626 227.201 181.385 1.00 108.47 ? 408  THR C CA 1 
ATOM 1838 C CA . TYR C 3  409  ? 208.543 224.339 179.019 1.00 119.36 ? 409  TYR C CA 1 
ATOM 1839 C CA . GLU C 3  410  ? 211.627 223.669 181.212 1.00 116.35 ? 410  GLU C CA 1 
ATOM 1840 C CA . ILE C 3  411  ? 209.394 223.348 184.276 1.00 108.70 ? 411  ILE C CA 1 
ATOM 1841 C CA . LEU C 3  412  ? 207.471 220.884 182.148 1.00 108.77 ? 412  LEU C CA 1 
ATOM 1842 C CA . LYS C 3  413  ? 210.822 218.969 182.281 1.00 134.38 ? 413  LYS C CA 1 
ATOM 1843 C CA . MET C 3  414  ? 211.001 218.733 178.459 1.00 114.36 ? 414  MET C CA 1 
ATOM 1844 C CA . PRO C 3  415  ? 214.680 219.773 177.972 1.00 125.45 ? 415  PRO C CA 1 
ATOM 1845 C CA . PHE C 3  416  ? 214.494 219.302 174.213 1.00 128.78 ? 416  PHE C CA 1 
ATOM 1846 C CA . TYR C 3  417  ? 211.569 221.572 173.385 1.00 122.17 ? 417  TYR C CA 1 
ATOM 1847 C CA . CYS C 3  418  ? 212.467 224.296 175.936 1.00 146.75 ? 418  CYS C CA 1 
ATOM 1848 C CA . LEU C 3  419  ? 215.942 224.604 174.424 1.00 143.36 ? 419  LEU C CA 1 
ATOM 1849 C CA . TYR C 3  420  ? 214.356 226.250 171.347 1.00 129.73 ? 420  TYR C CA 1 
ATOM 1850 C CA . TYR C 3  421  ? 212.850 229.265 173.081 1.00 122.80 ? 421  TYR C CA 1 
ATOM 1851 C CA . TYR C 3  422  ? 215.949 229.775 175.225 1.00 94.86  ? 422  TYR C CA 1 
ATOM 1852 C CA . ARG C 3  423  ? 218.233 230.102 172.157 1.00 104.25 ? 423  ARG C CA 1 
ATOM 1853 C CA . ARG C 3  424  ? 215.621 232.423 170.608 1.00 119.17 ? 424  ARG C CA 1 
ATOM 1854 C CA . ALA C 3  425  ? 215.705 234.492 173.820 1.00 100.61 ? 425  ALA C CA 1 
ATOM 1855 C CA . HIS C 3  426  ? 219.494 234.602 173.980 1.00 101.34 ? 426  HIS C CA 1 
ATOM 1856 C CA . GLN C 3  427  ? 219.445 235.846 170.360 1.00 123.86 ? 427  GLN C CA 1 
ATOM 1857 C CA . LEU C 3  428  ? 217.338 238.774 171.683 1.00 129.57 ? 428  LEU C CA 1 
ATOM 1858 C CA . ARG C 3  429  ? 219.708 239.608 174.561 1.00 139.38 ? 429  ARG C CA 1 
ATOM 1859 C CA . PRO C 3  430  ? 223.328 238.570 173.876 1.00 158.34 ? 430  PRO C CA 1 
ATOM 1860 C CA . ASN C 3  431  ? 225.061 240.238 176.842 1.00 193.90 ? 431  ASN C CA 1 
ATOM 1861 C CA . ASP C 3  432  ? 222.695 238.571 179.342 1.00 169.24 ? 432  ASP C CA 1 
ATOM 1862 C CA . SER C 3  433  ? 224.341 236.030 181.659 1.00 192.11 ? 433  SER C CA 1 
ATOM 1863 C CA . ARG C 3  434  ? 220.970 234.439 182.662 1.00 157.35 ? 434  ARG C CA 1 
ATOM 1864 C CA . MET C 3  435  ? 220.145 233.299 179.099 1.00 168.83 ? 435  MET C CA 1 
ATOM 1865 C CA . LEU C 3  436  ? 223.429 231.506 178.561 1.00 148.57 ? 436  LEU C CA 1 
ATOM 1866 C CA . VAL C 3  437  ? 223.090 229.812 181.965 1.00 115.10 ? 437  VAL C CA 1 
ATOM 1867 C CA . ALA C 3  438  ? 219.563 228.686 180.970 1.00 115.92 ? 438  ALA C CA 1 
ATOM 1868 C CA . LEU C 3  439  ? 221.032 227.301 177.739 1.00 134.66 ? 439  LEU C CA 1 
ATOM 1869 C CA . GLY C 3  440  ? 222.951 224.848 179.961 1.00 146.20 ? 440  GLY C CA 1 
ATOM 1870 C CA . GLU C 3  441  ? 221.015 222.204 181.974 1.00 182.21 ? 441  GLU C CA 1 
ATOM 1871 C CA . CYS C 3  442  ? 218.722 222.107 178.938 1.00 177.39 ? 442  CYS C CA 1 
ATOM 1872 C CA . TYR C 3  443  ? 221.822 221.012 177.048 1.00 156.06 ? 443  TYR C CA 1 
ATOM 1873 C CA . GLU C 3  444  ? 222.999 219.251 180.290 1.00 195.26 ? 444  GLU C CA 1 
ATOM 1874 C CA . LYS C 3  445  ? 219.656 217.383 180.805 1.00 150.59 ? 445  LYS C CA 1 
ATOM 1875 C CA . LEU C 3  446  ? 219.929 216.655 177.058 1.00 174.30 ? 446  LEU C CA 1 
ATOM 1876 C CA . ASN C 3  447  ? 223.301 215.042 177.924 1.00 155.28 ? 447  ASN C CA 1 
ATOM 1877 C CA . GLN C 3  448  ? 225.068 217.071 175.191 1.00 169.71 ? 448  GLN C CA 1 
ATOM 1878 C CA . LEU C 3  449  ? 227.657 218.268 177.699 1.00 161.44 ? 449  LEU C CA 1 
ATOM 1879 C CA . VAL C 3  450  ? 230.423 219.763 175.478 1.00 175.78 ? 450  VAL C CA 1 
ATOM 1880 C CA . GLU C 3  451  ? 227.807 222.304 174.160 1.00 197.76 ? 451  GLU C CA 1 
ATOM 1881 C CA . ALA C 3  452  ? 226.621 223.148 177.699 1.00 197.20 ? 452  ALA C CA 1 
ATOM 1882 C CA . LYS C 3  453  ? 230.152 223.560 179.048 1.00 170.78 ? 453  LYS C CA 1 
ATOM 1883 C CA . LYS C 3  454  ? 231.070 226.083 176.334 1.00 153.26 ? 454  LYS C CA 1 
ATOM 1884 C CA . CYS C 3  455  ? 227.818 227.976 177.029 1.00 156.83 ? 455  CYS C CA 1 
ATOM 1885 C CA . TYR C 3  456  ? 228.416 228.181 180.798 1.00 142.20 ? 456  TYR C CA 1 
ATOM 1886 C CA . TRP C 3  457  ? 232.026 229.227 180.055 1.00 181.12 ? 457  TRP C CA 1 
ATOM 1887 C CA . ARG C 3  458  ? 230.771 232.034 177.758 1.00 182.27 ? 458  ARG C CA 1 
ATOM 1888 C CA . ALA C 3  459  ? 228.283 232.961 180.578 1.00 159.04 ? 459  ALA C CA 1 
ATOM 1889 C CA . TYR C 3  460  ? 231.247 233.533 182.908 1.00 176.95 ? 460  TYR C CA 1 
ATOM 1890 C CA . ALA C 3  461  ? 233.044 235.501 180.171 1.00 214.51 ? 461  ALA C CA 1 
ATOM 1891 C CA . VAL C 3  462  ? 229.979 237.686 179.404 1.00 201.08 ? 462  VAL C CA 1 
ATOM 1892 C CA . GLY C 3  463  ? 228.734 238.692 182.914 1.00 174.95 ? 463  GLY C CA 1 
ATOM 1893 C CA . ASP C 3  464  ? 227.269 237.236 186.150 1.00 247.02 ? 464  ASP C CA 1 
ATOM 1894 C CA . VAL C 3  465  ? 224.227 237.267 188.496 1.00 268.07 ? 465  VAL C CA 1 
ATOM 1895 C CA . GLU C 3  466  ? 224.558 235.431 191.858 1.00 269.06 ? 466  GLU C CA 1 
ATOM 1896 C CA . LYS C 3  467  ? 227.852 234.112 190.377 1.00 233.80 ? 467  LYS C CA 1 
ATOM 1897 C CA . MET C 3  468  ? 225.947 230.918 189.537 1.00 227.33 ? 468  MET C CA 1 
ATOM 1898 C CA . ALA C 3  469  ? 227.431 229.965 186.098 1.00 242.41 ? 469  ALA C CA 1 
ATOM 1899 C CA . LEU C 3  470  ? 230.784 228.630 187.344 1.00 172.21 ? 470  LEU C CA 1 
ATOM 1900 C CA . VAL C 3  471  ? 229.323 226.158 189.866 1.00 218.74 ? 471  VAL C CA 1 
ATOM 1901 C CA . LYS C 3  472  ? 227.227 224.686 187.088 1.00 175.84 ? 472  LYS C CA 1 
ATOM 1902 C CA . LEU C 3  473  ? 230.134 224.459 184.611 1.00 200.19 ? 473  LEU C CA 1 
ATOM 1903 C CA . ALA C 3  474  ? 232.133 222.783 187.379 1.00 181.84 ? 474  ALA C CA 1 
ATOM 1904 C CA . LYS C 3  475  ? 229.464 220.245 188.195 1.00 193.35 ? 475  LYS C CA 1 
ATOM 1905 C CA . LEU C 3  476  ? 229.557 219.153 184.510 1.00 271.01 ? 476  LEU C CA 1 
ATOM 1906 C CA . HIS C 3  477  ? 233.332 218.745 184.772 1.00 243.52 ? 477  HIS C CA 1 
ATOM 1907 C CA . GLU C 3  478  ? 232.553 216.493 187.742 1.00 184.47 ? 478  GLU C CA 1 
ATOM 1908 C CA . GLN C 3  479  ? 230.206 214.589 185.386 1.00 200.51 ? 479  GLN C CA 1 
ATOM 1909 C CA . LEU C 3  480  ? 233.142 214.293 182.942 1.00 211.09 ? 480  LEU C CA 1 
ATOM 1910 C CA . THR C 3  481  ? 236.291 212.349 183.817 1.00 290.60 ? 481  THR C CA 1 
ATOM 1911 C CA . GLU C 3  482  ? 238.281 215.413 184.951 1.00 421.25 ? 482  GLU C CA 1 
ATOM 1912 C CA . SER C 3  483  ? 240.095 216.356 188.184 1.00 449.08 ? 483  SER C CA 1 
ATOM 1913 C CA . GLU C 3  484  ? 242.172 219.309 186.920 1.00 425.80 ? 484  GLU C CA 1 
ATOM 1914 C CA . GLN C 3  485  ? 239.678 221.567 185.096 1.00 235.64 ? 485  GLN C CA 1 
ATOM 1915 C CA . ALA C 3  486  ? 236.750 220.986 187.495 1.00 349.66 ? 486  ALA C CA 1 
ATOM 1916 C CA . ALA C 3  487  ? 238.947 221.922 190.450 1.00 398.76 ? 487  ALA C CA 1 
ATOM 1917 C CA . GLN C 3  488  ? 240.134 225.061 188.622 1.00 382.58 ? 488  GLN C CA 1 
ATOM 1918 C CA . CYS C 3  489  ? 236.573 226.189 188.063 1.00 431.44 ? 489  CYS C CA 1 
ATOM 1919 C CA . TYR C 3  490  ? 235.740 225.836 191.743 1.00 492.58 ? 490  TYR C CA 1 
ATOM 1920 C CA . ILE C 3  491  ? 238.752 227.916 192.777 1.00 500.00 ? 491  ILE C CA 1 
ATOM 1921 C CA . LYS C 3  492  ? 237.752 230.795 190.407 1.00 500.00 ? 492  LYS C CA 1 
ATOM 1922 C CA . TYR C 3  493  ? 234.245 230.648 191.980 1.00 500.00 ? 493  TYR C CA 1 
ATOM 1923 C CA . ILE C 3  494  ? 235.610 230.617 195.563 1.00 500.00 ? 494  ILE C CA 1 
ATOM 1924 C CA . GLN C 3  495  ? 237.846 233.558 194.545 1.00 471.47 ? 495  GLN C CA 1 
ATOM 1925 C CA . ASP C 3  496  ? 234.724 235.471 193.320 1.00 488.46 ? 496  ASP C CA 1 
ATOM 1926 C CA . ILE C 3  497  ? 232.772 234.927 196.654 1.00 453.67 ? 497  ILE C CA 1 
ATOM 1927 C CA . TYR C 3  498  ? 235.684 236.271 198.761 1.00 331.18 ? 498  TYR C CA 1 
ATOM 1928 C CA . SER C 3  499  ? 236.691 238.981 196.260 1.00 218.78 ? 499  SER C CA 1 
ATOM 1929 C CA . CYS C 3  500  ? 233.268 240.345 197.297 1.00 301.03 ? 500  CYS C CA 1 
ATOM 1930 C CA . ARG D 4  52   ? 186.613 160.238 290.455 1.00 225.20 ? 52   ARG E CA 1 
ATOM 1931 C CA . PHE D 4  53   ? 190.084 159.110 289.517 1.00 295.86 ? 53   PHE E CA 1 
ATOM 1932 C CA . LEU D 4  54   ? 189.279 157.775 286.010 1.00 500.00 ? 54   LEU E CA 1 
ATOM 1933 C CA . CYS D 4  55   ? 187.809 161.234 285.193 1.00 465.74 ? 55   CYS E CA 1 
ATOM 1934 C CA . GLU D 4  56   ? 191.124 162.750 286.340 1.00 264.09 ? 56   GLU E CA 1 
ATOM 1935 C CA . SER D 4  57   ? 192.943 160.613 283.698 1.00 222.45 ? 57   SER E CA 1 
ATOM 1936 C CA . VAL D 4  58   ? 190.650 162.030 280.997 1.00 222.62 ? 58   VAL E CA 1 
ATOM 1937 C CA . PHE D 4  59   ? 191.545 165.457 282.402 1.00 222.64 ? 59   PHE E CA 1 
ATOM 1938 C CA . SER D 4  60   ? 195.144 164.578 281.707 1.00 226.74 ? 60   SER E CA 1 
ATOM 1939 C CA . TYR D 4  61   ? 194.405 163.923 277.971 1.00 160.25 ? 61   TYR E CA 1 
ATOM 1940 C CA . GLN D 4  62   ? 192.383 167.138 277.834 1.00 311.95 ? 62   GLN E CA 1 
ATOM 1941 C CA . VAL D 4  63   ? 195.365 169.027 279.263 1.00 246.58 ? 63   VAL E CA 1 
ATOM 1942 C CA . ALA D 4  64   ? 197.642 167.503 276.609 1.00 216.73 ? 64   ALA E CA 1 
ATOM 1943 C CA . SER D 4  65   ? 195.186 168.670 273.893 1.00 367.66 ? 65   SER E CA 1 
ATOM 1944 C CA . THR D 4  66   ? 194.788 172.250 275.260 1.00 419.84 ? 66   THR E CA 1 
ATOM 1945 C CA . LEU D 4  67   ? 198.600 172.497 275.625 1.00 418.69 ? 67   LEU E CA 1 
ATOM 1946 C CA . LYS D 4  68   ? 198.898 171.952 271.832 1.00 436.14 ? 68   LYS E CA 1 
ATOM 1947 C CA . GLN D 4  69   ? 196.549 174.945 271.278 1.00 429.73 ? 69   GLN E CA 1 
ATOM 1948 C CA . VAL D 4  70   ? 198.515 177.130 273.762 1.00 360.23 ? 70   VAL E CA 1 
ATOM 1949 C CA . LYS D 4  71   ? 201.809 176.284 272.013 1.00 166.14 ? 71   LYS E CA 1 
ATOM 1950 C CA . HIS D 4  72   ? 200.239 176.924 268.565 1.00 321.96 ? 72   HIS E CA 1 
ATOM 1951 C CA . ASP D 4  73   ? 198.807 180.322 269.804 1.00 326.86 ? 73   ASP E CA 1 
ATOM 1952 C CA . GLN D 4  74   ? 202.232 181.793 270.737 1.00 310.58 ? 74   GLN E CA 1 
ATOM 1953 C CA . GLN D 4  75   ? 203.657 180.453 267.413 1.00 362.04 ? 75   GLN E CA 1 
ATOM 1954 C CA . VAL D 4  76   ? 201.015 182.479 265.473 1.00 268.86 ? 76   VAL E CA 1 
ATOM 1955 C CA . ALA D 4  77   ? 201.798 185.551 267.639 1.00 221.84 ? 77   ALA E CA 1 
ATOM 1956 C CA . ARG D 4  78   ? 205.565 185.234 266.737 1.00 160.54 ? 78   ARG E CA 1 
ATOM 1957 C CA . MET D 4  79   ? 205.098 184.934 262.941 1.00 229.03 ? 79   MET E CA 1 
ATOM 1958 C CA . GLU D 4  80   ? 202.196 187.603 263.125 1.00 266.14 ? 80   GLU E CA 1 
ATOM 1959 C CA . LYS D 4  81   ? 204.188 190.307 264.895 1.00 184.04 ? 81   LYS E CA 1 
ATOM 1960 C CA . LEU D 4  82   ? 206.887 189.495 262.237 1.00 305.79 ? 82   LEU E CA 1 
ATOM 1961 C CA . ALA D 4  83   ? 204.433 189.712 259.273 1.00 353.80 ? 83   ALA E CA 1 
ATOM 1962 C CA . GLY D 4  84   ? 203.698 193.274 260.464 1.00 366.67 ? 84   GLY E CA 1 
ATOM 1963 C CA . LEU D 4  85   ? 207.489 193.869 260.276 1.00 327.96 ? 85   LEU E CA 1 
ATOM 1964 C CA . VAL D 4  86   ? 207.683 193.261 256.445 1.00 322.70 ? 86   VAL E CA 1 
ATOM 1965 C CA . GLU D 4  87   ? 205.481 196.282 255.712 1.00 202.49 ? 87   GLU E CA 1 
ATOM 1966 C CA . GLU D 4  88   ? 207.596 198.420 258.038 1.00 198.66 ? 88   GLU E CA 1 
ATOM 1967 C CA . LEU D 4  89   ? 210.645 197.198 256.107 1.00 198.50 ? 89   LEU E CA 1 
ATOM 1968 C CA . GLU D 4  90   ? 209.133 198.992 253.076 1.00 195.88 ? 90   GLU E CA 1 
ATOM 1969 C CA . ALA D 4  91   ? 208.365 202.249 254.950 1.00 175.63 ? 91   ALA E CA 1 
ATOM 1970 C CA . ASP D 4  92   ? 211.853 202.856 256.325 1.00 159.02 ? 92   ASP E CA 1 
ATOM 1971 C CA . GLU D 4  93   ? 213.310 201.886 252.897 1.00 173.22 ? 93   GLU E CA 1 
ATOM 1972 C CA . TRP D 4  94   ? 214.394 205.451 252.147 1.00 138.61 ? 94   TRP E CA 1 
ATOM 1973 C CA . ARG D 4  95   ? 217.070 206.001 254.865 1.00 121.16 ? 95   ARG E CA 1 
ATOM 1974 C CA . PHE D 4  96   ? 219.352 203.130 253.835 1.00 143.73 ? 96   PHE E CA 1 
ATOM 1975 C CA . LYS D 4  97   ? 221.290 202.990 250.553 1.00 171.19 ? 97   LYS E CA 1 
ATOM 1976 C CA . PRO D 4  98   ? 219.351 201.438 247.621 1.00 178.30 ? 98   PRO E CA 1 
ATOM 1977 C CA . ILE D 4  99   ? 219.690 197.667 247.714 1.00 151.59 ? 99   ILE E CA 1 
ATOM 1978 C CA . GLU D 4  100  ? 220.336 197.153 243.969 1.00 163.84 ? 100  GLU E CA 1 
ATOM 1979 C CA . GLN D 4  101  ? 222.998 199.862 244.264 1.00 200.60 ? 101  GLN E CA 1 
ATOM 1980 C CA . LEU D 4  102  ? 224.850 197.927 247.100 1.00 195.42 ? 102  LEU E CA 1 
ATOM 1981 C CA . LEU D 4  103  ? 225.148 194.632 245.315 1.00 205.54 ? 103  LEU E CA 1 
ATOM 1982 C CA . GLY D 4  104  ? 226.323 196.638 242.311 1.00 203.97 ? 104  GLY E CA 1 
ATOM 1983 C CA . PHE D 4  105  ? 223.906 195.730 239.511 1.00 199.06 ? 105  PHE E CA 1 
ATOM 1984 C CA . THR D 4  106  ? 223.928 199.470 238.692 1.00 225.95 ? 106  THR E CA 1 
ATOM 1985 C CA . PRO D 4  107  ? 226.169 201.790 240.777 1.00 174.64 ? 107  PRO E CA 1 
ATOM 1986 C CA . GLN E 5  5    ? 246.423 201.675 290.515 1.00 286.50 ? 5    GLN F CA 1 
ATOM 1987 C CA . GLU E 5  6    ? 243.646 200.707 288.048 1.00 274.67 ? 6    GLU F CA 1 
ATOM 1988 C CA . PRO E 5  7    ? 245.548 201.153 284.759 1.00 260.74 ? 7    PRO F CA 1 
ATOM 1989 C CA . VAL E 5  8    ? 242.885 198.833 283.158 1.00 224.43 ? 8    VAL F CA 1 
ATOM 1990 C CA . GLN E 5  9    ? 240.115 201.227 284.117 1.00 177.99 ? 9    GLN F CA 1 
ATOM 1991 C CA . ALA E 5  10   ? 242.109 204.284 283.003 1.00 210.13 ? 10   ALA F CA 1 
ATOM 1992 C CA . ALA E 5  11   ? 242.890 202.597 279.647 1.00 171.00 ? 11   ALA F CA 1 
ATOM 1993 C CA . ILE E 5  12   ? 239.181 202.065 279.082 1.00 243.34 ? 12   ILE F CA 1 
ATOM 1994 C CA . TRP E 5  13   ? 238.429 205.766 279.739 1.00 189.75 ? 13   TRP F CA 1 
ATOM 1995 C CA . GLN E 5  14   ? 241.196 206.639 277.349 1.00 190.41 ? 14   GLN F CA 1 
ATOM 1996 C CA . ALA E 5  15   ? 239.640 204.379 274.703 1.00 178.35 ? 15   ALA F CA 1 
ATOM 1997 C CA . LEU E 5  16   ? 236.214 205.947 275.159 1.00 199.03 ? 16   LEU F CA 1 
ATOM 1998 C CA . ASN E 5  17   ? 237.746 209.400 274.754 1.00 189.55 ? 17   ASN F CA 1 
ATOM 1999 C CA . HIS E 5  18   ? 239.334 208.218 271.487 1.00 162.71 ? 18   HIS F CA 1 
ATOM 2000 C CA . TYR E 5  19   ? 235.997 206.670 270.397 1.00 171.86 ? 19   TYR F CA 1 
ATOM 2001 C CA . ALA E 5  20   ? 237.444 203.222 269.922 1.00 183.70 ? 20   ALA F CA 1 
ATOM 2002 C CA . TYR E 5  21   ? 234.402 201.524 271.141 1.00 357.70 ? 21   TYR F CA 1 
ATOM 2003 C CA . ARG E 5  22   ? 235.049 197.954 270.246 1.00 359.15 ? 22   ARG F CA 1 
ATOM 2004 C CA . ASP E 5  23   ? 238.263 198.018 272.206 1.00 313.22 ? 23   ASP F CA 1 
ATOM 2005 C CA . ALA E 5  24   ? 236.731 199.953 275.075 1.00 357.89 ? 24   ALA F CA 1 
ATOM 2006 C CA . VAL E 5  25   ? 233.735 197.670 275.380 1.00 221.79 ? 25   VAL F CA 1 
ATOM 2007 C CA . PHE E 5  26   ? 235.727 194.422 275.281 1.00 199.53 ? 26   PHE F CA 1 
ATOM 2008 C CA . LEU E 5  27   ? 238.163 195.624 277.850 1.00 174.92 ? 27   LEU F CA 1 
ATOM 2009 C CA . ALA E 5  28   ? 235.381 196.936 280.013 1.00 143.01 ? 28   ALA F CA 1 
ATOM 2010 C CA . GLU E 5  29   ? 233.530 193.644 279.783 1.00 134.80 ? 29   GLU F CA 1 
ATOM 2011 C CA . ARG E 5  30   ? 236.671 191.845 281.000 1.00 150.00 ? 30   ARG F CA 1 
ATOM 2012 C CA . LEU E 5  31   ? 237.035 194.196 283.908 1.00 155.78 ? 31   LEU F CA 1 
ATOM 2013 C CA . TYR E 5  32   ? 233.418 193.689 284.863 1.00 167.70 ? 32   TYR F CA 1 
ATOM 2014 C CA . ALA E 5  33   ? 234.041 189.930 284.859 1.00 179.35 ? 33   ALA F CA 1 
ATOM 2015 C CA . GLU E 5  34   ? 237.306 190.135 286.867 1.00 195.98 ? 34   GLU F CA 1 
ATOM 2016 C CA . VAL E 5  35   ? 236.143 192.592 289.511 1.00 170.18 ? 35   VAL F CA 1 
ATOM 2017 C CA . HIS E 5  36   ? 232.313 192.479 289.342 1.00 176.03 ? 36   HIS F CA 1 
ATOM 2018 C CA . SER E 5  37   ? 232.233 195.770 291.345 1.00 209.38 ? 37   SER F CA 1 
ATOM 2019 C CA . GLU E 5  38   ? 229.551 198.422 290.697 1.00 237.62 ? 38   GLU F CA 1 
ATOM 2020 C CA . GLU E 5  39   ? 232.254 200.801 289.450 1.00 212.70 ? 39   GLU F CA 1 
ATOM 2021 C CA . ALA E 5  40   ? 233.314 198.221 286.820 1.00 191.11 ? 40   ALA F CA 1 
ATOM 2022 C CA . LEU E 5  41   ? 229.604 197.748 285.951 1.00 183.71 ? 41   LEU F CA 1 
ATOM 2023 C CA . PHE E 5  42   ? 228.967 201.442 285.555 1.00 202.34 ? 42   PHE F CA 1 
ATOM 2024 C CA . LEU E 5  43   ? 232.058 201.726 283.312 1.00 159.00 ? 43   LEU F CA 1 
ATOM 2025 C CA . LEU E 5  44   ? 230.896 198.849 281.192 1.00 102.39 ? 44   LEU F CA 1 
ATOM 2026 C CA . ALA E 5  45   ? 227.337 200.228 280.793 1.00 171.26 ? 45   ALA F CA 1 
ATOM 2027 C CA . THR E 5  46   ? 228.862 203.577 279.826 1.00 161.32 ? 46   THR F CA 1 
ATOM 2028 C CA . CYS E 5  47   ? 230.829 201.854 277.081 1.00 134.49 ? 47   CYS F CA 1 
ATOM 2029 C CA . TYR E 5  48   ? 227.688 200.365 275.613 1.00 145.83 ? 48   TYR F CA 1 
ATOM 2030 C CA . TYR E 5  49   ? 225.895 203.635 275.935 1.00 147.59 ? 49   TYR F CA 1 
ATOM 2031 C CA . ARG E 5  50   ? 228.644 205.571 274.170 1.00 195.33 ? 50   ARG F CA 1 
ATOM 2032 C CA . SER E 5  51   ? 228.689 202.886 271.486 1.00 251.83 ? 51   SER F CA 1 
ATOM 2033 C CA . GLY E 5  52   ? 225.105 203.905 270.732 1.00 265.80 ? 52   GLY F CA 1 
ATOM 2034 C CA . LYS E 5  53   ? 223.931 200.570 271.947 1.00 255.35 ? 53   LYS F CA 1 
ATOM 2035 C CA . ALA E 5  54   ? 221.636 202.205 274.451 1.00 168.43 ? 54   ALA F CA 1 
ATOM 2036 C CA . TYR E 5  55   ? 219.553 199.063 274.820 1.00 158.53 ? 55   TYR F CA 1 
ATOM 2037 C CA . LYS E 5  56   ? 222.671 197.090 275.795 1.00 190.53 ? 56   LYS F CA 1 
ATOM 2038 C CA . ALA E 5  57   ? 223.422 199.519 278.609 1.00 171.25 ? 57   ALA F CA 1 
ATOM 2039 C CA . TYR E 5  58   ? 219.787 199.437 279.672 1.00 144.70 ? 58   TYR F CA 1 
ATOM 2040 C CA . ARG E 5  59   ? 219.744 195.707 279.866 1.00 159.31 ? 59   ARG F CA 1 
ATOM 2041 C CA . LEU E 5  60   ? 223.062 195.497 281.720 1.00 126.88 ? 60   LEU F CA 1 
ATOM 2042 C CA . LEU E 5  61   ? 221.908 198.089 284.239 1.00 146.84 ? 61   LEU F CA 1 
ATOM 2043 C CA . LYS E 5  62   ? 218.446 196.812 284.662 1.00 159.82 ? 62   LYS F CA 1 
ATOM 2044 C CA . GLY E 5  63   ? 219.790 193.309 285.365 1.00 178.54 ? 63   GLY F CA 1 
ATOM 2045 C CA . HIS E 5  64   ? 222.118 194.368 288.156 1.00 195.97 ? 64   HIS F CA 1 
ATOM 2046 C CA . SER E 5  65   ? 221.090 196.415 291.186 1.00 202.63 ? 65   SER F CA 1 
ATOM 2047 C CA . CYS E 5  66   ? 222.887 199.702 291.369 1.00 188.69 ? 66   CYS F CA 1 
ATOM 2048 C CA . THR E 5  67   ? 222.968 201.770 294.535 1.00 384.27 ? 67   THR F CA 1 
ATOM 2049 C CA . THR E 5  68   ? 225.471 204.292 293.091 1.00 368.53 ? 68   THR F CA 1 
ATOM 2050 C CA . PRO E 5  69   ? 224.228 207.687 291.969 1.00 315.65 ? 69   PRO F CA 1 
ATOM 2051 C CA . GLN E 5  70   ? 226.024 207.305 288.609 1.00 164.53 ? 70   GLN F CA 1 
ATOM 2052 C CA . CYS E 5  71   ? 224.355 204.037 287.763 1.00 208.79 ? 71   CYS F CA 1 
ATOM 2053 C CA . LYS E 5  72   ? 220.907 205.280 288.644 1.00 228.10 ? 72   LYS F CA 1 
ATOM 2054 C CA . TYR E 5  73   ? 221.478 208.260 286.398 1.00 216.34 ? 73   TYR F CA 1 
ATOM 2055 C CA . LEU E 5  74   ? 222.708 206.315 283.437 1.00 143.43 ? 74   LEU F CA 1 
ATOM 2056 C CA . LEU E 5  75   ? 219.881 203.823 283.932 1.00 173.44 ? 75   LEU F CA 1 
ATOM 2057 C CA . ALA E 5  76   ? 217.346 206.658 283.909 1.00 175.13 ? 76   ALA F CA 1 
ATOM 2058 C CA . LYS E 5  77   ? 219.042 208.211 280.863 1.00 179.22 ? 77   LYS F CA 1 
ATOM 2059 C CA . CYS E 5  78   ? 218.738 204.884 278.967 1.00 194.65 ? 78   CYS F CA 1 
ATOM 2060 C CA . CYS E 5  79   ? 215.093 204.531 279.975 1.00 271.45 ? 79   CYS F CA 1 
ATOM 2061 C CA . VAL E 5  80   ? 214.227 207.924 278.562 1.00 324.47 ? 80   VAL F CA 1 
ATOM 2062 C CA . ASP E 5  81   ? 216.256 207.305 275.411 1.00 343.78 ? 81   ASP F CA 1 
ATOM 2063 C CA . LEU E 5  82   ? 214.322 203.999 275.087 1.00 244.21 ? 82   LEU F CA 1 
ATOM 2064 C CA . SER E 5  83   ? 211.061 205.910 275.747 1.00 218.07 ? 83   SER F CA 1 
ATOM 2065 C CA . LYS E 5  84   ? 210.205 203.833 278.823 1.00 203.09 ? 84   LYS F CA 1 
ATOM 2066 C CA . LEU E 5  85   ? 209.323 207.056 280.641 1.00 211.51 ? 85   LEU F CA 1 
ATOM 2067 C CA . ALA E 5  86   ? 207.404 205.428 283.486 1.00 223.49 ? 86   ALA F CA 1 
ATOM 2068 C CA . GLU E 5  87   ? 210.349 203.154 284.287 1.00 206.79 ? 87   GLU F CA 1 
ATOM 2069 C CA . GLY E 5  88   ? 212.830 206.056 284.087 1.00 303.49 ? 88   GLY F CA 1 
ATOM 2070 C CA . GLU E 5  89   ? 211.023 208.215 286.655 1.00 470.67 ? 89   GLU F CA 1 
ATOM 2071 C CA . GLN E 5  90   ? 210.639 205.784 289.451 1.00 369.42 ? 90   GLN F CA 1 
ATOM 2072 C CA . ILE E 5  91   ? 214.440 205.139 289.607 1.00 384.92 ? 91   ILE F CA 1 
ATOM 2073 C CA . LEU E 5  92   ? 215.503 208.769 289.995 1.00 441.65 ? 92   LEU F CA 1 
ATOM 2074 C CA . SER E 5  93   ? 212.484 209.917 291.882 1.00 500.00 ? 93   SER F CA 1 
ATOM 2075 C CA . GLY E 5  94   ? 211.864 206.828 293.929 1.00 500.00 ? 94   GLY F CA 1 
ATOM 2076 C CA . GLY E 5  95   ? 208.247 208.076 293.672 1.00 500.00 ? 95   GLY F CA 1 
ATOM 2077 C CA . VAL E 5  96   ? 204.782 206.459 294.009 1.00 500.00 ? 96   VAL F CA 1 
ATOM 2078 C CA . PHE E 5  97   ? 204.096 204.094 296.994 1.00 500.00 ? 97   PHE F CA 1 
ATOM 2079 C CA . ASN E 5  98   ? 207.449 204.962 298.603 1.00 500.00 ? 98   ASN F CA 1 
ATOM 2080 C CA . LYS E 5  99   ? 206.247 208.561 299.454 1.00 500.00 ? 99   LYS F CA 1 
ATOM 2081 C CA . GLN E 5  100  ? 207.960 211.327 297.502 1.00 500.00 ? 100  GLN F CA 1 
ATOM 2082 C CA . LYS E 5  101  ? 211.649 212.257 297.686 1.00 500.00 ? 101  LYS F CA 1 
ATOM 2083 C CA . SER E 5  102  ? 211.841 215.976 298.516 1.00 500.00 ? 102  SER F CA 1 
ATOM 2084 C CA . HIS E 5  103  ? 214.297 217.138 295.760 1.00 500.00 ? 103  HIS F CA 1 
ATOM 2085 C CA . ASP E 5  104  ? 216.865 217.964 298.459 1.00 500.00 ? 104  ASP F CA 1 
ATOM 2086 C CA . ASP E 5  105  ? 216.975 214.161 299.013 1.00 500.00 ? 105  ASP F CA 1 
ATOM 2087 C CA . ILE E 5  106  ? 217.822 213.816 295.308 1.00 500.00 ? 106  ILE F CA 1 
ATOM 2088 C CA . VAL E 5  107  ? 220.448 216.599 295.746 1.00 500.00 ? 107  VAL F CA 1 
ATOM 2089 C CA . THR E 5  108  ? 222.020 214.686 298.710 1.00 500.00 ? 108  THR F CA 1 
ATOM 2090 C CA . GLU E 5  109  ? 221.866 211.304 296.900 1.00 500.00 ? 109  GLU F CA 1 
ATOM 2091 C CA . PHE E 5  110  ? 223.424 212.354 293.602 1.00 500.00 ? 110  PHE F CA 1 
ATOM 2092 C CA . GLY E 5  111  ? 225.588 215.178 295.054 1.00 500.00 ? 111  GLY F CA 1 
ATOM 2093 C CA . ASP E 5  112  ? 227.556 216.898 292.286 1.00 500.00 ? 112  ASP F CA 1 
ATOM 2094 C CA . SER E 5  113  ? 225.706 215.180 289.410 1.00 500.00 ? 113  SER F CA 1 
ATOM 2095 C CA . ALA E 5  114  ? 222.327 216.119 291.042 1.00 500.00 ? 114  ALA F CA 1 
ATOM 2096 C CA . CYS E 5  115  ? 221.785 219.131 288.785 1.00 500.00 ? 115  CYS F CA 1 
ATOM 2097 C CA . PHE E 5  116  ? 221.757 216.988 285.661 1.00 500.00 ? 116  PHE F CA 1 
ATOM 2098 C CA . THR E 5  117  ? 219.479 214.318 287.236 1.00 500.00 ? 117  THR F CA 1 
ATOM 2099 C CA . LEU E 5  118  ? 216.914 216.951 288.324 1.00 500.00 ? 118  LEU F CA 1 
ATOM 2100 C CA . SER E 5  119  ? 216.936 218.418 284.818 1.00 500.00 ? 119  SER F CA 1 
ATOM 2101 C CA . LEU E 5  120  ? 216.407 214.969 283.268 1.00 500.00 ? 120  LEU F CA 1 
ATOM 2102 C CA . LEU E 5  121  ? 213.761 214.334 285.888 1.00 500.00 ? 121  LEU F CA 1 
ATOM 2103 C CA . GLY E 5  122  ? 212.145 217.597 284.845 1.00 500.00 ? 122  GLY F CA 1 
ATOM 2104 C CA . HIS E 5  123  ? 212.127 216.566 281.193 1.00 500.00 ? 123  HIS F CA 1 
ATOM 2105 C CA . VAL E 5  124  ? 210.266 213.307 282.265 1.00 500.00 ? 124  VAL F CA 1 
ATOM 2106 C CA . TYR E 5  125  ? 207.642 215.211 284.220 1.00 500.00 ? 125  TYR F CA 1 
ATOM 2107 C CA . CYS E 5  126  ? 206.895 217.702 281.519 1.00 500.00 ? 126  CYS F CA 1 
ATOM 2108 C CA . LYS E 5  127  ? 206.599 214.963 278.835 1.00 500.00 ? 127  LYS F CA 1 
ATOM 2109 C CA . THR E 5  128  ? 204.537 212.965 281.378 1.00 500.00 ? 128  THR F CA 1 
ATOM 2110 C CA . ASP E 5  129  ? 202.095 215.951 281.737 1.00 500.00 ? 129  ASP F CA 1 
ATOM 2111 C CA . ARG E 5  130  ? 203.215 216.607 285.346 1.00 500.00 ? 130  ARG F CA 1 
ATOM 2112 C CA . LEU E 5  131  ? 204.029 220.205 284.087 1.00 500.00 ? 131  LEU F CA 1 
ATOM 2113 C CA . ALA E 5  132  ? 203.520 221.966 287.420 1.00 500.00 ? 132  ALA F CA 1 
ATOM 2114 C CA . LYS E 5  133  ? 205.669 219.483 289.325 1.00 500.00 ? 133  LYS F CA 1 
ATOM 2115 C CA . GLY E 5  134  ? 208.260 219.592 286.482 1.00 500.00 ? 134  GLY F CA 1 
ATOM 2116 C CA . SER E 5  135  ? 208.850 223.306 286.469 1.00 500.00 ? 135  SER F CA 1 
ATOM 2117 C CA . GLU E 5  136  ? 209.752 223.112 290.172 1.00 500.00 ? 136  GLU F CA 1 
ATOM 2118 C CA . CYS E 5  137  ? 212.177 220.296 289.353 1.00 500.00 ? 137  CYS F CA 1 
ATOM 2119 C CA . TYR E 5  138  ? 213.796 222.405 286.648 1.00 500.00 ? 138  TYR F CA 1 
ATOM 2120 C CA . GLN E 5  139  ? 214.273 225.399 288.968 1.00 500.00 ? 139  GLN F CA 1 
ATOM 2121 C CA . LYS E 5  140  ? 216.154 223.149 291.390 1.00 500.00 ? 140  LYS F CA 1 
ATOM 2122 C CA . SER E 5  141  ? 218.647 222.286 288.641 1.00 500.00 ? 141  SER F CA 1 
ATOM 2123 C CA . LEU E 5  142  ? 219.275 225.974 287.842 1.00 500.00 ? 142  LEU F CA 1 
ATOM 2124 C CA . SER E 5  143  ? 219.763 226.568 291.594 1.00 500.00 ? 143  SER F CA 1 
ATOM 2125 C CA . LEU E 5  144  ? 222.722 224.226 291.513 1.00 500.00 ? 144  LEU F CA 1 
ATOM 2126 C CA . ASN E 5  145  ? 225.026 226.047 289.066 1.00 500.00 ? 145  ASN F CA 1 
ATOM 2127 C CA . PRO E 5  146  ? 223.143 226.897 286.887 1.00 500.00 ? 146  PRO F CA 1 
ATOM 2128 C CA . PHE E 5  147  ? 225.391 227.008 283.788 1.00 500.00 ? 147  PHE F CA 1 
ATOM 2129 C CA . LEU E 5  148  ? 222.912 224.699 282.024 1.00 500.00 ? 148  LEU F CA 1 
ATOM 2130 C CA . TRP E 5  149  ? 220.906 226.238 279.264 1.00 500.00 ? 149  TRP F CA 1 
ATOM 2131 C CA . SER E 5  150  ? 218.618 223.268 278.631 1.00 500.00 ? 150  SER F CA 1 
ATOM 2132 C CA . PRO E 5  151  ? 216.770 223.409 281.968 1.00 500.00 ? 151  PRO F CA 1 
ATOM 2133 C CA . PHE E 5  152  ? 216.289 227.175 281.584 1.00 500.00 ? 152  PHE F CA 1 
ATOM 2134 C CA . GLU E 5  153  ? 215.146 226.832 277.884 1.00 500.00 ? 153  GLU F CA 1 
ATOM 2135 C CA . SER E 5  154  ? 212.655 224.105 278.737 1.00 500.00 ? 154  SER F CA 1 
ATOM 2136 C CA . LEU E 5  155  ? 211.424 226.032 281.818 1.00 500.00 ? 155  LEU F CA 1 
ATOM 2137 C CA . CYS E 5  156  ? 210.587 229.135 279.785 1.00 500.00 ? 156  CYS F CA 1 
ATOM 2138 C CA . GLU E 5  157  ? 208.941 227.132 276.942 1.00 500.00 ? 157  GLU F CA 1 
ATOM 2139 C CA . ILE E 5  158  ? 206.598 225.849 279.617 1.00 500.00 ? 158  ILE F CA 1 
ATOM 2140 C CA . GLY E 5  159  ? 204.047 228.381 280.972 1.00 500.00 ? 159  GLY F CA 1 
ATOM 2141 C CA . GLU E 5  160  ? 206.474 229.171 283.824 1.00 500.00 ? 160  GLU F CA 1 
ATOM 2142 C CA . LYS E 5  161  ? 208.733 232.190 283.293 1.00 500.00 ? 161  LYS F CA 1 
ATOM 2143 C CA . PRO E 5  162  ? 212.047 232.293 285.098 1.00 500.00 ? 162  PRO F CA 1 
ATOM 2144 C CA . ASP E 5  163  ? 213.895 235.476 285.977 1.00 500.00 ? 163  ASP F CA 1 
ATOM 2145 C CA . PRO E 5  164  ? 217.290 236.252 284.456 1.00 500.00 ? 164  PRO F CA 1 
ATOM 2146 C CA . ASP E 5  165  ? 219.015 236.184 287.876 1.00 500.00 ? 165  ASP F CA 1 
ATOM 2147 C CA . GLN E 5  166  ? 219.121 232.375 287.968 1.00 500.00 ? 166  GLN F CA 1 
ATOM 2148 C CA . THR E 5  167  ? 221.551 232.171 284.986 1.00 500.00 ? 167  THR F CA 1 
ATOM 2149 C CA . PHE E 5  168  ? 223.317 235.275 286.454 1.00 500.00 ? 168  PHE F CA 1 
ATOM 2150 C CA . LYS E 5  169  ? 224.236 234.094 289.974 1.00 500.00 ? 169  LYS F CA 1 
ATOM 2151 C CA . PHE E 5  170  ? 226.760 231.415 290.974 1.00 500.00 ? 170  PHE F CA 1 
ATOM 2152 C CA . ALA E 5  451  ? 238.993 230.285 296.524 1.00 500.00 ? 451  ALA F CA 1 
ATOM 2153 C CA . PHE E 5  452  ? 235.322 230.474 295.408 1.00 500.00 ? 452  PHE F CA 1 
ATOM 2154 C CA . ASN E 5  453  ? 235.497 234.183 294.431 1.00 500.00 ? 453  ASN F CA 1 
ATOM 2155 C CA . LEU E 5  454  ? 238.643 233.792 292.264 1.00 500.00 ? 454  LEU F CA 1 
ATOM 2156 C CA . GLN E 5  455  ? 237.175 230.903 290.205 1.00 500.00 ? 455  GLN F CA 1 
ATOM 2157 C CA . LYS E 5  456  ? 233.757 232.634 289.808 1.00 500.00 ? 456  LYS F CA 1 
ATOM 2158 C CA . ALA E 5  457  ? 235.334 235.931 288.558 1.00 500.00 ? 457  ALA F CA 1 
ATOM 2159 C CA . ALA E 5  458  ? 236.777 234.657 285.220 1.00 500.00 ? 458  ALA F CA 1 
ATOM 2160 C CA . ALA E 5  459  ? 233.532 232.804 284.412 1.00 500.00 ? 459  ALA F CA 1 
ATOM 2161 C CA . GLU E 5  460  ? 231.333 235.798 285.392 1.00 500.00 ? 460  GLU F CA 1 
ATOM 2162 C CA . GLY E 5  461  ? 232.215 237.336 282.045 1.00 500.00 ? 461  GLY F CA 1 
ATOM 2163 C CA . LEU E 5  462  ? 230.351 234.583 280.219 1.00 500.00 ? 462  LEU F CA 1 
ATOM 2164 C CA . MET E 5  463  ? 227.640 234.431 282.897 1.00 500.00 ? 463  MET F CA 1 
ATOM 2165 C CA . SER E 5  464  ? 226.932 238.126 282.227 1.00 500.00 ? 464  SER F CA 1 
ATOM 2166 C CA . LEU E 5  465  ? 226.338 237.379 278.563 1.00 500.00 ? 465  LEU F CA 1 
ATOM 2167 C CA . LEU E 5  466  ? 224.090 234.434 279.479 1.00 500.00 ? 466  LEU F CA 1 
ATOM 2168 C CA . ARG E 5  467  ? 221.796 236.680 281.581 1.00 500.00 ? 467  ARG F CA 1 
ATOM 2169 C CA . GLU E 5  468  ? 221.403 239.146 278.712 1.00 500.00 ? 468  GLU F CA 1 
ATOM 2170 C CA . MET E 5  469  ? 220.771 236.306 276.251 1.00 500.00 ? 469  MET F CA 1 
ATOM 2171 C CA . GLY E 5  470  ? 218.346 234.599 278.606 1.00 500.00 ? 470  GLY F CA 1 
ATOM 2172 C CA . LYS E 5  471  ? 216.103 237.702 278.815 1.00 500.00 ? 471  LYS F CA 1 
ATOM 2173 C CA . GLY E 5  472  ? 215.770 237.620 275.071 1.00 500.00 ? 472  GLY F CA 1 
ATOM 2174 C CA . TYR E 5  473  ? 215.035 233.932 274.847 1.00 500.00 ? 473  TYR F CA 1 
ATOM 2175 C CA . LEU E 5  474  ? 212.416 234.132 277.650 1.00 500.00 ? 474  LEU F CA 1 
ATOM 2176 C CA . ALA E 5  475  ? 210.780 237.104 275.875 1.00 500.00 ? 475  ALA F CA 1 
ATOM 2177 C CA . LEU E 5  476  ? 210.856 235.307 272.494 1.00 500.00 ? 476  LEU F CA 1 
ATOM 2178 C CA . CYS E 5  477  ? 209.238 232.225 273.939 1.00 500.00 ? 477  CYS F CA 1 
ATOM 2179 C CA . SER E 5  478  ? 206.629 234.449 275.663 1.00 500.00 ? 478  SER F CA 1 
ATOM 2180 C CA . TYR E 5  479  ? 205.995 235.808 272.100 1.00 500.00 ? 479  TYR F CA 1 
ATOM 2181 C CA . ASN E 5  480  ? 207.057 239.454 272.841 1.00 500.00 ? 480  ASN F CA 1 
ATOM 2182 C CA . CYS E 5  481  ? 209.238 239.558 269.739 1.00 500.00 ? 481  CYS F CA 1 
ATOM 2183 C CA . LYS E 5  482  ? 210.195 243.258 269.480 1.00 500.00 ? 482  LYS F CA 1 
ATOM 2184 C CA . GLU E 5  483  ? 211.679 243.349 273.000 1.00 500.00 ? 483  GLU F CA 1 
ATOM 2185 C CA . ALA E 5  484  ? 213.436 240.054 272.148 1.00 500.00 ? 484  ALA F CA 1 
ATOM 2186 C CA . ILE E 5  485  ? 214.990 241.446 268.924 1.00 500.00 ? 485  ILE F CA 1 
ATOM 2187 C CA . ASN E 5  486  ? 216.182 244.558 270.680 1.00 500.00 ? 486  ASN F CA 1 
ATOM 2188 C CA . ILE E 5  487  ? 217.429 242.694 273.734 1.00 500.00 ? 487  ILE F CA 1 
ATOM 2189 C CA . LEU E 5  488  ? 219.520 240.234 271.636 1.00 500.00 ? 488  LEU F CA 1 
ATOM 2190 C CA . SER E 5  489  ? 221.091 242.974 269.548 1.00 500.00 ? 489  SER F CA 1 
ATOM 2191 C CA . HIS E 5  490  ? 222.818 244.430 272.646 1.00 500.00 ? 490  HIS F CA 1 
ATOM 2192 C CA . LEU E 5  491  ? 224.954 241.239 272.768 1.00 500.00 ? 491  LEU F CA 1 
ATOM 2193 C CA . PRO E 5  492  ? 228.821 241.701 272.596 1.00 500.00 ? 492  PRO F CA 1 
ATOM 2194 C CA . SER E 5  493  ? 228.533 240.800 268.856 1.00 500.00 ? 493  SER F CA 1 
ATOM 2195 C CA . HIS E 5  494  ? 231.043 237.931 268.621 1.00 445.32 ? 494  HIS F CA 1 
ATOM 2196 C CA . HIS E 5  495  ? 227.957 236.331 270.138 1.00 453.36 ? 495  HIS F CA 1 
ATOM 2197 C CA . TYR E 5  496  ? 225.447 237.924 267.720 1.00 469.85 ? 496  TYR F CA 1 
ATOM 2198 C CA . ASN E 5  497  ? 227.468 236.562 264.747 1.00 456.38 ? 497  ASN F CA 1 
ATOM 2199 C CA . THR E 5  498  ? 227.189 232.890 265.806 1.00 267.61 ? 498  THR F CA 1 
ATOM 2200 C CA . GLY E 5  499  ? 224.595 230.711 264.174 1.00 171.08 ? 499  GLY F CA 1 
ATOM 2201 C CA . TRP E 5  500  ? 222.658 230.312 267.441 1.00 279.42 ? 500  TRP F CA 1 
ATOM 2202 C CA . VAL E 5  501  ? 221.868 233.984 268.054 1.00 354.28 ? 501  VAL F CA 1 
ATOM 2203 C CA . LEU E 5  502  ? 221.080 235.045 264.448 1.00 363.39 ? 502  LEU F CA 1 
ATOM 2204 C CA . CYS E 5  503  ? 218.832 231.972 264.259 1.00 277.64 ? 503  CYS F CA 1 
ATOM 2205 C CA . GLN E 5  504  ? 217.068 233.233 267.425 1.00 399.02 ? 504  GLN F CA 1 
ATOM 2206 C CA . ILE E 5  505  ? 216.242 236.655 265.895 1.00 322.54 ? 505  ILE F CA 1 
ATOM 2207 C CA . GLY E 5  506  ? 214.891 235.122 262.656 1.00 162.09 ? 506  GLY F CA 1 
ATOM 2208 C CA . ARG E 5  507  ? 212.581 232.860 264.707 1.00 179.87 ? 507  ARG F CA 1 
ATOM 2209 C CA . ALA E 5  508  ? 211.516 235.974 266.551 1.00 173.29 ? 508  ALA F CA 1 
ATOM 2210 C CA . TYR E 5  509  ? 211.024 238.024 263.390 1.00 157.07 ? 509  TYR F CA 1 
ATOM 2211 C CA . PHE E 5  510  ? 209.030 235.127 261.990 1.00 133.32 ? 510  PHE F CA 1 
ATOM 2212 C CA . GLU E 5  511  ? 206.599 235.136 264.892 1.00 217.73 ? 511  GLU F CA 1 
ATOM 2213 C CA . LEU E 5  512  ? 206.400 238.938 264.576 1.00 336.45 ? 512  LEU F CA 1 
ATOM 2214 C CA . SER E 5  513  ? 205.255 238.432 260.904 1.00 324.02 ? 513  SER F CA 1 
ATOM 2215 C CA . GLU E 5  514  ? 207.913 240.522 259.118 1.00 372.12 ? 514  GLU F CA 1 
ATOM 2216 C CA . TYR E 5  515  ? 208.828 237.622 256.769 1.00 237.54 ? 515  TYR F CA 1 
ATOM 2217 C CA . MET E 5  516  ? 210.765 239.787 254.299 1.00 361.94 ? 516  MET F CA 1 
ATOM 2218 C CA . GLN E 5  517  ? 212.831 241.014 257.237 1.00 386.15 ? 517  GLN F CA 1 
ATOM 2219 C CA . ALA E 5  518  ? 212.987 237.349 258.479 1.00 220.63 ? 518  ALA F CA 1 
ATOM 2220 C CA . GLU E 5  519  ? 214.237 235.625 255.263 1.00 175.31 ? 519  GLU F CA 1 
ATOM 2221 C CA . ARG E 5  520  ? 216.846 238.357 255.117 1.00 180.36 ? 520  ARG F CA 1 
ATOM 2222 C CA . ILE E 5  521  ? 218.033 237.335 258.621 1.00 174.47 ? 521  ILE F CA 1 
ATOM 2223 C CA . PHE E 5  522  ? 217.983 233.539 258.153 1.00 145.08 ? 522  PHE F CA 1 
ATOM 2224 C CA . SER E 5  523  ? 219.956 233.463 254.883 1.00 240.76 ? 523  SER F CA 1 
ATOM 2225 C CA . GLU E 5  524  ? 222.653 235.385 256.738 1.00 317.60 ? 524  GLU F CA 1 
ATOM 2226 C CA . VAL E 5  525  ? 222.839 232.639 259.385 1.00 172.47 ? 525  VAL F CA 1 
ATOM 2227 C CA . ARG E 5  526  ? 223.011 229.966 256.619 1.00 177.38 ? 526  ARG F CA 1 
ATOM 2228 C CA . ARG E 5  527  ? 226.048 231.539 255.047 1.00 162.53 ? 527  ARG F CA 1 
ATOM 2229 C CA . ILE E 5  528  ? 227.617 231.508 258.574 1.00 195.44 ? 528  ILE F CA 1 
ATOM 2230 C CA . GLU E 5  529  ? 226.864 227.969 259.704 1.00 210.69 ? 529  GLU F CA 1 
ATOM 2231 C CA . ASN E 5  530  ? 226.591 225.776 256.650 1.00 212.69 ? 530  ASN F CA 1 
ATOM 2232 C CA . TYR E 5  531  ? 226.271 223.092 259.284 1.00 201.09 ? 531  TYR F CA 1 
ATOM 2233 C CA . ARG E 5  532  ? 223.522 224.371 261.643 1.00 162.50 ? 532  ARG F CA 1 
ATOM 2234 C CA . VAL E 5  533  ? 220.313 222.511 260.883 1.00 184.06 ? 533  VAL F CA 1 
ATOM 2235 C CA . GLU E 5  534  ? 218.702 223.681 264.071 1.00 218.77 ? 534  GLU F CA 1 
ATOM 2236 C CA . GLY E 5  535  ? 216.040 226.211 263.075 1.00 161.86 ? 535  GLY F CA 1 
ATOM 2237 C CA . MET E 5  536  ? 215.525 225.665 259.342 1.00 168.29 ? 536  MET F CA 1 
ATOM 2238 C CA . GLU E 5  537  ? 211.877 224.461 259.536 1.00 199.72 ? 537  GLU F CA 1 
ATOM 2239 C CA . ILE E 5  538  ? 210.932 228.011 260.526 1.00 153.17 ? 538  ILE F CA 1 
ATOM 2240 C CA . TYR E 5  539  ? 213.207 229.437 257.800 1.00 153.68 ? 539  TYR F CA 1 
ATOM 2241 C CA . SER E 5  540  ? 211.647 227.073 255.186 1.00 163.21 ? 540  SER F CA 1 
ATOM 2242 C CA . THR E 5  541  ? 208.183 228.242 256.236 1.00 139.68 ? 541  THR F CA 1 
ATOM 2243 C CA . THR E 5  542  ? 209.566 231.801 255.931 1.00 118.82 ? 542  THR F CA 1 
ATOM 2244 C CA . LEU E 5  543  ? 210.462 231.188 252.284 1.00 124.94 ? 543  LEU F CA 1 
ATOM 2245 C CA . TRP E 5  544  ? 207.079 229.406 251.845 1.00 129.08 ? 544  TRP F CA 1 
ATOM 2246 C CA . HIS E 5  545  ? 205.426 232.609 252.926 1.00 135.52 ? 545  HIS F CA 1 
ATOM 2247 C CA . LEU E 5  546  ? 207.692 234.639 250.643 1.00 155.16 ? 546  LEU F CA 1 
ATOM 2248 C CA . GLN E 5  547  ? 206.679 232.309 247.761 1.00 145.08 ? 547  GLN F CA 1 
ATOM 2249 C CA . LYS E 5  548  ? 210.371 231.787 247.085 1.00 155.65 ? 548  LYS F CA 1 
ATOM 2250 C CA . ASP E 5  549  ? 210.155 228.475 245.131 1.00 226.24 ? 549  ASP F CA 1 
ATOM 2251 C CA . VAL E 5  550  ? 213.724 228.691 243.818 1.00 238.80 ? 550  VAL F CA 1 
ATOM 2252 C CA . ALA E 5  551  ? 215.335 229.767 247.141 1.00 167.35 ? 551  ALA F CA 1 
ATOM 2253 C CA . LEU E 5  552  ? 213.455 227.079 248.994 1.00 128.91 ? 552  LEU F CA 1 
ATOM 2254 C CA . SER E 5  553  ? 214.468 224.237 246.628 1.00 155.62 ? 553  SER F CA 1 
ATOM 2255 C CA . VAL E 5  554  ? 218.162 225.175 247.010 1.00 247.83 ? 554  VAL F CA 1 
ATOM 2256 C CA . LEU E 5  555  ? 217.504 224.806 250.783 1.00 147.22 ? 555  LEU F CA 1 
ATOM 2257 C CA . SER E 5  556  ? 215.829 221.459 250.490 1.00 175.14 ? 556  SER F CA 1 
ATOM 2258 C CA . LYS E 5  557  ? 218.302 219.647 248.204 1.00 192.95 ? 557  LYS F CA 1 
ATOM 2259 C CA . ASP E 5  558  ? 220.947 221.447 250.332 1.00 159.21 ? 558  ASP F CA 1 
ATOM 2260 C CA . LEU E 5  559  ? 219.782 220.134 253.687 1.00 122.91 ? 559  LEU F CA 1 
ATOM 2261 C CA . THR E 5  560  ? 218.851 216.550 252.625 1.00 188.61 ? 560  THR F CA 1 
ATOM 2262 C CA . ASP E 5  561  ? 222.087 216.074 250.676 1.00 240.50 ? 561  ASP F CA 1 
ATOM 2263 C CA . MET E 5  562  ? 224.193 217.407 253.593 1.00 225.52 ? 562  MET F CA 1 
ATOM 2264 C CA . ASP E 5  563  ? 222.244 215.316 256.139 1.00 217.10 ? 563  ASP F CA 1 
ATOM 2265 C CA . LYS E 5  564  ? 219.097 213.347 256.644 1.00 178.89 ? 564  LYS F CA 1 
ATOM 2266 C CA . ASN E 5  565  ? 218.136 211.857 260.010 1.00 200.10 ? 565  ASN F CA 1 
ATOM 2267 C CA . SER E 5  566  ? 217.201 215.108 261.581 1.00 197.69 ? 566  SER F CA 1 
ATOM 2268 C CA . PRO E 5  567  ? 213.522 216.168 261.687 1.00 180.97 ? 567  PRO F CA 1 
ATOM 2269 C CA . GLU E 5  568  ? 214.495 219.630 260.458 1.00 159.68 ? 568  GLU F CA 1 
ATOM 2270 C CA . ALA E 5  569  ? 216.025 218.625 257.097 1.00 136.80 ? 569  ALA F CA 1 
ATOM 2271 C CA . TRP E 5  570  ? 213.020 216.582 255.981 1.00 139.41 ? 570  TRP F CA 1 
ATOM 2272 C CA . CYS E 5  571  ? 210.607 219.269 257.071 1.00 127.34 ? 571  CYS F CA 1 
ATOM 2273 C CA . ALA E 5  572  ? 212.447 221.809 254.831 1.00 127.03 ? 572  ALA F CA 1 
ATOM 2274 C CA . ALA E 5  573  ? 212.189 219.488 251.800 1.00 114.09 ? 573  ALA F CA 1 
ATOM 2275 C CA . GLY E 5  574  ? 208.598 218.866 252.910 1.00 144.53 ? 574  GLY F CA 1 
ATOM 2276 C CA . ASN E 5  575  ? 207.872 222.581 252.427 1.00 125.79 ? 575  ASN F CA 1 
ATOM 2277 C CA . CYS E 5  576  ? 209.282 222.632 248.876 1.00 133.25 ? 576  CYS F CA 1 
ATOM 2278 C CA . PHE E 5  577  ? 206.704 220.146 247.653 1.00 157.48 ? 577  PHE F CA 1 
ATOM 2279 C CA . SER E 5  578  ? 203.943 221.876 249.709 1.00 131.83 ? 578  SER F CA 1 
ATOM 2280 C CA . LEU E 5  579  ? 204.762 225.003 247.766 1.00 137.05 ? 579  LEU F CA 1 
ATOM 2281 C CA . GLN E 5  580  ? 204.452 223.155 244.464 1.00 147.81 ? 580  GLN F CA 1 
ATOM 2282 C CA . ARG E 5  581  ? 200.968 222.096 245.647 1.00 180.45 ? 581  ARG F CA 1 
ATOM 2283 C CA . GLU E 5  582  ? 202.097 218.548 244.932 1.00 312.15 ? 582  GLU F CA 1 
ATOM 2284 C CA . HIS E 5  583  ? 200.644 217.762 248.383 1.00 412.23 ? 583  HIS F CA 1 
ATOM 2285 C CA . ASP E 5  584  ? 200.894 213.960 247.923 1.00 497.21 ? 584  ASP F CA 1 
ATOM 2286 C CA . ILE E 5  585  ? 204.721 214.129 247.616 1.00 449.48 ? 585  ILE F CA 1 
ATOM 2287 C CA . ALA E 5  586  ? 204.960 216.774 250.411 1.00 396.87 ? 586  ALA F CA 1 
ATOM 2288 C CA . ILE E 5  587  ? 203.164 214.441 252.834 1.00 221.58 ? 587  ILE F CA 1 
ATOM 2289 C CA . LYS E 5  588  ? 205.679 211.509 252.343 1.00 138.40 ? 588  LYS F CA 1 
ATOM 2290 C CA . PHE E 5  589  ? 208.542 213.900 253.242 1.00 121.29 ? 589  PHE F CA 1 
ATOM 2291 C CA . PHE E 5  590  ? 206.639 215.424 256.153 1.00 115.97 ? 590  PHE F CA 1 
ATOM 2292 C CA . GLN E 5  591  ? 205.612 212.076 257.694 1.00 132.61 ? 591  GLN F CA 1 
ATOM 2293 C CA . ARG E 5  592  ? 209.293 211.204 257.210 1.00 118.22 ? 592  ARG F CA 1 
ATOM 2294 C CA . ALA E 5  593  ? 210.362 214.172 259.384 1.00 130.27 ? 593  ALA F CA 1 
ATOM 2295 C CA . ILE E 5  594  ? 208.052 212.769 262.133 1.00 125.43 ? 594  ILE F CA 1 
ATOM 2296 C CA . GLN E 5  595  ? 209.288 209.240 261.334 1.00 151.60 ? 595  GLN F CA 1 
ATOM 2297 C CA . VAL E 5  596  ? 212.803 210.525 261.993 1.00 148.57 ? 596  VAL F CA 1 
ATOM 2298 C CA . ASP E 5  597  ? 211.969 212.310 265.284 1.00 199.87 ? 597  ASP F CA 1 
ATOM 2299 C CA . PRO E 5  598  ? 208.492 211.481 266.610 1.00 163.01 ? 598  PRO F CA 1 
ATOM 2300 C CA . ASN E 5  599  ? 209.144 213.819 269.524 1.00 155.63 ? 599  ASN F CA 1 
ATOM 2301 C CA . TYR E 5  600  ? 209.546 217.027 267.506 1.00 175.34 ? 600  TYR F CA 1 
ATOM 2302 C CA . ALA E 5  601  ? 206.587 219.376 267.369 1.00 199.70 ? 601  ALA F CA 1 
ATOM 2303 C CA . TYR E 5  602  ? 206.630 221.506 264.275 1.00 162.19 ? 602  TYR F CA 1 
ATOM 2304 C CA . ALA E 5  603  ? 206.912 218.505 261.990 1.00 169.00 ? 603  ALA F CA 1 
ATOM 2305 C CA . TYR E 5  604  ? 203.416 217.454 263.026 1.00 170.90 ? 604  TYR F CA 1 
ATOM 2306 C CA . THR E 5  605  ? 201.954 220.893 262.620 1.00 171.81 ? 605  THR F CA 1 
ATOM 2307 C CA . LEU E 5  606  ? 203.173 221.153 259.075 1.00 119.31 ? 606  LEU F CA 1 
ATOM 2308 C CA . LEU E 5  607  ? 201.888 217.704 258.264 1.00 138.69 ? 607  LEU F CA 1 
ATOM 2309 C CA . GLY E 5  608  ? 198.618 218.990 259.748 1.00 138.28 ? 608  GLY F CA 1 
ATOM 2310 C CA . HIS E 5  609  ? 198.380 221.986 257.383 1.00 136.13 ? 609  HIS F CA 1 
ATOM 2311 C CA . GLU E 5  610  ? 199.111 219.728 254.387 1.00 153.08 ? 610  GLU F CA 1 
ATOM 2312 C CA . PHE E 5  611  ? 196.091 217.563 255.207 1.00 159.06 ? 611  PHE F CA 1 
ATOM 2313 C CA . VAL E 5  612  ? 193.948 220.715 255.626 1.00 145.89 ? 612  VAL F CA 1 
ATOM 2314 C CA . LEU E 5  613  ? 194.980 221.738 252.066 1.00 135.56 ? 613  LEU F CA 1 
ATOM 2315 C CA . THR E 5  614  ? 194.428 218.254 250.574 1.00 180.21 ? 614  THR F CA 1 
ATOM 2316 C CA . GLU E 5  615  ? 190.970 218.457 252.245 1.00 269.54 ? 615  GLU F CA 1 
ATOM 2317 C CA . GLU E 5  616  ? 191.646 215.394 254.445 1.00 344.36 ? 616  GLU F CA 1 
ATOM 2318 C CA . LEU E 5  617  ? 190.267 217.369 257.452 1.00 218.63 ? 617  LEU F CA 1 
ATOM 2319 C CA . ASP E 5  618  ? 189.616 214.330 259.705 1.00 365.06 ? 618  ASP F CA 1 
ATOM 2320 C CA . LYS E 5  619  ? 193.110 212.848 259.098 1.00 202.47 ? 619  LYS F CA 1 
ATOM 2321 C CA . ALA E 5  620  ? 194.510 216.365 259.765 1.00 145.57 ? 620  ALA F CA 1 
ATOM 2322 C CA . LEU E 5  621  ? 192.732 216.619 263.131 1.00 166.95 ? 621  LEU F CA 1 
ATOM 2323 C CA . ALA E 5  622  ? 194.783 213.735 264.501 1.00 165.57 ? 622  ALA F CA 1 
ATOM 2324 C CA . CYS E 5  623  ? 198.111 215.308 263.377 1.00 189.38 ? 623  CYS F CA 1 
ATOM 2325 C CA . PHE E 5  624  ? 197.207 218.482 265.101 1.00 176.43 ? 624  PHE F CA 1 
ATOM 2326 C CA . ARG E 5  625  ? 196.311 216.798 268.367 1.00 211.65 ? 625  ARG F CA 1 
ATOM 2327 C CA . ASN E 5  626  ? 199.681 215.003 268.051 1.00 196.39 ? 626  ASN F CA 1 
ATOM 2328 C CA . ALA E 5  627  ? 201.331 218.350 267.641 1.00 131.81 ? 627  ALA F CA 1 
ATOM 2329 C CA . ILE E 5  628  ? 199.774 219.395 270.930 1.00 299.88 ? 628  ILE F CA 1 
ATOM 2330 C CA . ARG E 5  629  ? 201.059 216.151 272.492 1.00 366.77 ? 629  ARG F CA 1 
ATOM 2331 C CA . VAL E 5  630  ? 204.671 216.961 271.523 1.00 190.12 ? 630  VAL F CA 1 
ATOM 2332 C CA . ASN E 5  631  ? 204.448 220.571 272.546 1.00 284.57 ? 631  ASN F CA 1 
ATOM 2333 C CA . PRO E 5  632  ? 201.313 221.478 274.578 1.00 371.21 ? 632  PRO F CA 1 
ATOM 2334 C CA . ARG E 5  633  ? 202.159 225.164 274.144 1.00 378.83 ? 633  ARG F CA 1 
ATOM 2335 C CA . HIS E 5  634  ? 203.010 225.053 270.423 1.00 328.16 ? 634  HIS F CA 1 
ATOM 2336 C CA . TYR E 5  635  ? 200.174 227.245 269.211 1.00 218.63 ? 635  TYR F CA 1 
ATOM 2337 C CA . ASN E 5  636  ? 200.483 226.661 265.488 1.00 188.35 ? 636  ASN F CA 1 
ATOM 2338 C CA . ALA E 5  637  ? 198.781 223.323 265.986 1.00 145.92 ? 637  ALA F CA 1 
ATOM 2339 C CA . TRP E 5  638  ? 196.231 224.895 268.349 1.00 148.28 ? 638  TRP F CA 1 
ATOM 2340 C CA . TYR E 5  639  ? 195.347 227.286 265.555 1.00 159.06 ? 639  TYR F CA 1 
ATOM 2341 C CA . GLY E 5  640  ? 195.202 224.341 263.165 1.00 167.30 ? 640  GLY F CA 1 
ATOM 2342 C CA . LEU E 5  641  ? 192.705 222.494 265.338 1.00 164.08 ? 641  LEU F CA 1 
ATOM 2343 C CA . GLY E 5  642  ? 190.470 225.581 265.367 1.00 172.50 ? 642  GLY F CA 1 
ATOM 2344 C CA . MET E 5  643  ? 190.517 226.082 261.617 1.00 158.92 ? 643  MET F CA 1 
ATOM 2345 C CA . ILE E 5  644  ? 189.557 222.428 261.129 1.00 159.89 ? 644  ILE F CA 1 
ATOM 2346 C CA . TYR E 5  645  ? 186.666 222.742 263.596 1.00 289.75 ? 645  TYR F CA 1 
ATOM 2347 C CA . TYR E 5  646  ? 185.689 226.061 261.926 1.00 463.19 ? 646  TYR F CA 1 
ATOM 2348 C CA . LYS E 5  647  ? 185.420 224.382 258.489 1.00 421.33 ? 647  LYS F CA 1 
ATOM 2349 C CA . GLN E 5  648  ? 183.348 221.616 260.127 1.00 388.60 ? 648  GLN F CA 1 
ATOM 2350 C CA . GLU E 5  649  ? 181.166 224.539 261.455 1.00 470.58 ? 649  GLU F CA 1 
ATOM 2351 C CA . LYS E 5  650  ? 181.378 223.470 265.131 1.00 452.33 ? 650  LYS F CA 1 
ATOM 2352 C CA . PHE E 5  651  ? 181.805 227.166 266.010 1.00 500.00 ? 651  PHE F CA 1 
ATOM 2353 C CA . SER E 5  652  ? 181.832 227.240 269.850 1.00 500.00 ? 652  SER F CA 1 
ATOM 2354 C CA . LEU E 5  653  ? 184.794 224.763 269.815 1.00 496.74 ? 653  LEU F CA 1 
ATOM 2355 C CA . ALA E 5  654  ? 186.677 226.650 267.064 1.00 378.79 ? 654  ALA F CA 1 
ATOM 2356 C CA . GLU E 5  655  ? 186.484 229.817 269.183 1.00 474.89 ? 655  GLU F CA 1 
ATOM 2357 C CA . MET E 5  656  ? 188.010 228.114 272.252 1.00 500.00 ? 656  MET F CA 1 
ATOM 2358 C CA . HIS E 5  657  ? 190.794 226.319 270.315 1.00 469.06 ? 657  HIS F CA 1 
ATOM 2359 C CA . PHE E 5  658  ? 191.883 229.691 268.866 1.00 342.92 ? 658  PHE F CA 1 
ATOM 2360 C CA . GLN E 5  659  ? 191.407 231.242 272.317 1.00 500.00 ? 659  GLN F CA 1 
ATOM 2361 C CA . LYS E 5  660  ? 193.862 228.644 273.719 1.00 500.00 ? 660  LYS F CA 1 
ATOM 2362 C CA . ALA E 5  661  ? 196.327 229.562 270.913 1.00 500.00 ? 661  ALA F CA 1 
ATOM 2363 C CA . LEU E 5  662  ? 195.827 233.218 271.811 1.00 500.00 ? 662  LEU F CA 1 
ATOM 2364 C CA . ASP E 5  663  ? 196.544 232.328 275.460 1.00 500.00 ? 663  ASP F CA 1 
ATOM 2365 C CA . ILE E 5  664  ? 199.966 231.124 274.263 1.00 500.00 ? 664  ILE F CA 1 
ATOM 2366 C CA . ASN E 5  665  ? 200.647 233.920 271.728 1.00 500.00 ? 665  ASN F CA 1 
ATOM 2367 C CA . PRO E 5  666  ? 198.909 237.218 272.498 1.00 500.00 ? 666  PRO F CA 1 
ATOM 2368 C CA . GLN E 5  667  ? 199.611 239.889 269.837 1.00 500.00 ? 667  GLN F CA 1 
ATOM 2369 C CA . SER E 5  668  ? 199.150 237.529 266.796 1.00 500.00 ? 668  SER F CA 1 
ATOM 2370 C CA . SER E 5  669  ? 197.083 239.672 264.462 1.00 476.03 ? 669  SER F CA 1 
ATOM 2371 C CA . VAL E 5  670  ? 196.022 236.790 262.265 1.00 306.53 ? 670  VAL F CA 1 
ATOM 2372 C CA . LEU E 5  671  ? 194.816 234.650 265.175 1.00 436.05 ? 671  LEU F CA 1 
ATOM 2373 C CA . LEU E 5  672  ? 192.707 237.529 266.535 1.00 500.00 ? 672  LEU F CA 1 
ATOM 2374 C CA . CYS E 5  673  ? 191.029 238.020 263.102 1.00 500.00 ? 673  CYS F CA 1 
ATOM 2375 C CA . HIS E 5  674  ? 190.309 234.329 262.976 1.00 500.00 ? 674  HIS F CA 1 
ATOM 2376 C CA . ILE E 5  675  ? 188.799 234.317 266.434 1.00 500.00 ? 675  ILE F CA 1 
ATOM 2377 C CA . GLY E 5  676  ? 186.814 237.422 265.454 1.00 500.00 ? 676  GLY F CA 1 
ATOM 2378 C CA . VAL E 5  677  ? 185.310 235.687 262.459 1.00 500.00 ? 677  VAL F CA 1 
ATOM 2379 C CA . VAL E 5  678  ? 184.211 232.841 264.752 1.00 500.00 ? 678  VAL F CA 1 
ATOM 2380 C CA . GLN E 5  679  ? 182.550 235.134 267.288 1.00 500.00 ? 679  GLN F CA 1 
ATOM 2381 C CA . HIS E 5  680  ? 180.710 236.870 264.432 1.00 500.00 ? 680  HIS F CA 1 
ATOM 2382 C CA . ALA E 5  681  ? 179.472 233.440 263.246 1.00 500.00 ? 681  ALA F CA 1 
ATOM 2383 C CA . LEU E 5  682  ? 178.101 232.564 266.682 1.00 500.00 ? 682  LEU F CA 1 
ATOM 2384 C CA . LYS E 5  683  ? 176.226 235.954 266.582 1.00 500.00 ? 683  LYS F CA 1 
ATOM 2385 C CA . LYS E 5  684  ? 178.404 237.293 269.444 1.00 500.00 ? 684  LYS F CA 1 
ATOM 2386 C CA . SER E 5  685  ? 179.043 239.983 266.787 1.00 500.00 ? 685  SER F CA 1 
ATOM 2387 C CA . GLU E 5  686  ? 179.339 242.793 269.366 1.00 500.00 ? 686  GLU F CA 1 
ATOM 2388 C CA . LYS E 5  687  ? 182.261 240.935 271.038 1.00 500.00 ? 687  LYS F CA 1 
ATOM 2389 C CA . ALA E 5  688  ? 183.649 240.160 267.543 1.00 500.00 ? 688  ALA F CA 1 
ATOM 2390 C CA . LEU E 5  689  ? 184.147 243.840 266.604 1.00 500.00 ? 689  LEU F CA 1 
ATOM 2391 C CA . ASP E 5  690  ? 185.792 244.486 270.024 1.00 500.00 ? 690  ASP F CA 1 
ATOM 2392 C CA . THR E 5  691  ? 188.346 241.721 269.305 1.00 500.00 ? 691  THR F CA 1 
ATOM 2393 C CA . LEU E 5  692  ? 188.781 242.886 265.682 1.00 500.00 ? 692  LEU F CA 1 
ATOM 2394 C CA . ASN E 5  693  ? 189.350 246.522 266.700 1.00 500.00 ? 693  ASN F CA 1 
ATOM 2395 C CA . LYS E 5  694  ? 192.168 245.268 268.969 1.00 500.00 ? 694  LYS F CA 1 
ATOM 2396 C CA . ALA E 5  695  ? 193.810 243.390 266.056 1.00 500.00 ? 695  ALA F CA 1 
ATOM 2397 C CA . ILE E 5  696  ? 194.109 246.623 263.992 1.00 500.00 ? 696  ILE F CA 1 
ATOM 2398 C CA . VAL E 5  697  ? 195.690 248.339 267.055 1.00 500.00 ? 697  VAL F CA 1 
ATOM 2399 C CA . ILE E 5  698  ? 198.393 245.632 267.608 1.00 500.00 ? 698  ILE F CA 1 
ATOM 2400 C CA . ASP E 5  699  ? 199.461 245.459 263.915 1.00 500.00 ? 699  ASP F CA 1 
ATOM 2401 C CA . PRO E 5  700  ? 198.871 248.267 261.377 1.00 500.00 ? 700  PRO F CA 1 
ATOM 2402 C CA . LYS E 5  701  ? 198.257 247.527 257.662 1.00 500.00 ? 701  LYS F CA 1 
ATOM 2403 C CA . ASN E 5  702  ? 197.140 243.882 258.060 1.00 500.00 ? 702  ASN F CA 1 
ATOM 2404 C CA . PRO E 5  703  ? 194.930 243.326 254.972 1.00 413.02 ? 703  PRO F CA 1 
ATOM 2405 C CA . LEU E 5  704  ? 192.968 240.391 256.417 1.00 393.16 ? 704  LEU F CA 1 
ATOM 2406 C CA . CYS E 5  705  ? 192.232 242.211 259.702 1.00 500.00 ? 705  CYS F CA 1 
ATOM 2407 C CA . LYS E 5  706  ? 190.877 245.448 258.234 1.00 500.00 ? 706  LYS F CA 1 
ATOM 2408 C CA . PHE E 5  707  ? 188.761 243.503 255.735 1.00 500.00 ? 707  PHE F CA 1 
ATOM 2409 C CA . HIS E 5  708  ? 187.177 241.365 258.445 1.00 500.00 ? 708  HIS F CA 1 
ATOM 2410 C CA . ARG E 5  709  ? 186.282 244.447 260.494 1.00 500.00 ? 709  ARG F CA 1 
ATOM 2411 C CA . ALA E 5  710  ? 184.365 245.761 257.459 1.00 500.00 ? 710  ALA F CA 1 
ATOM 2412 C CA . SER E 5  711  ? 182.649 242.379 257.065 1.00 500.00 ? 711  SER F CA 1 
ATOM 2413 C CA . VAL E 5  712  ? 181.442 242.342 260.685 1.00 500.00 ? 712  VAL F CA 1 
ATOM 2414 C CA . LEU E 5  713  ? 180.268 245.987 260.420 1.00 500.00 ? 713  LEU F CA 1 
ATOM 2415 C CA . PHE E 5  714  ? 178.300 245.068 257.239 1.00 500.00 ? 714  PHE F CA 1 
ATOM 2416 C CA . ALA E 5  715  ? 176.237 242.570 259.349 1.00 500.00 ? 715  ALA F CA 1 
ATOM 2417 C CA . ASN E 5  716  ? 175.700 245.300 262.004 1.00 500.00 ? 716  ASN F CA 1 
ATOM 2418 C CA . GLU E 5  717  ? 174.231 247.453 259.162 1.00 500.00 ? 717  GLU F CA 1 
ATOM 2419 C CA . LYS E 5  718  ? 176.496 250.490 259.845 1.00 500.00 ? 718  LYS F CA 1 
ATOM 2420 C CA . TYR E 5  719  ? 177.211 250.986 256.145 1.00 500.00 ? 719  TYR F CA 1 
ATOM 2421 C CA . LYS E 5  720  ? 178.880 254.381 256.469 1.00 500.00 ? 720  LYS F CA 1 
ATOM 2422 C CA . SER E 5  721  ? 181.445 252.908 258.968 1.00 500.00 ? 721  SER F CA 1 
ATOM 2423 C CA . ALA E 5  722  ? 181.971 249.868 256.676 1.00 500.00 ? 722  ALA F CA 1 
ATOM 2424 C CA . LEU E 5  723  ? 182.682 251.858 253.485 1.00 500.00 ? 723  LEU F CA 1 
ATOM 2425 C CA . GLN E 5  724  ? 185.126 254.102 255.396 1.00 500.00 ? 724  GLN F CA 1 
ATOM 2426 C CA . GLU E 5  725  ? 187.169 250.976 256.315 1.00 500.00 ? 725  GLU F CA 1 
ATOM 2427 C CA . LEU E 5  726  ? 187.009 249.202 252.898 1.00 500.00 ? 726  LEU F CA 1 
ATOM 2428 C CA . GLU E 5  727  ? 188.416 252.277 251.111 1.00 500.00 ? 727  GLU F CA 1 
ATOM 2429 C CA . GLU E 5  728  ? 191.455 252.225 253.498 1.00 500.00 ? 728  GLU F CA 1 
ATOM 2430 C CA . LEU E 5  729  ? 191.789 248.508 252.712 1.00 477.41 ? 729  LEU F CA 1 
ATOM 2431 C CA . LYS E 5  730  ? 191.684 249.321 248.968 1.00 495.31 ? 730  LYS F CA 1 
ATOM 2432 C CA . GLN E 5  731  ? 194.776 251.536 249.456 1.00 424.23 ? 731  GLN F CA 1 
ATOM 2433 C CA . ILE E 5  732  ? 196.409 248.648 251.433 1.00 218.98 ? 732  ILE F CA 1 
ATOM 2434 C CA . VAL E 5  733  ? 195.360 245.849 248.948 1.00 197.63 ? 733  VAL F CA 1 
ATOM 2435 C CA . PRO E 5  734  ? 194.477 247.220 245.440 1.00 368.33 ? 734  PRO F CA 1 
ATOM 2436 C CA . LYS E 5  735  ? 194.204 243.904 243.534 1.00 327.69 ? 735  LYS F CA 1 
ATOM 2437 C CA . GLU E 5  736  ? 192.280 241.782 246.096 1.00 244.47 ? 736  GLU F CA 1 
ATOM 2438 C CA . SER E 5  737  ? 189.041 240.424 244.697 1.00 186.71 ? 737  SER F CA 1 
ATOM 2439 C CA . LEU E 5  738  ? 187.121 240.155 247.956 1.00 238.84 ? 738  LEU F CA 1 
ATOM 2440 C CA . VAL E 5  739  ? 187.594 243.837 248.815 1.00 355.87 ? 739  VAL F CA 1 
ATOM 2441 C CA . TYR E 5  740  ? 185.853 244.827 245.589 1.00 467.45 ? 740  TYR F CA 1 
ATOM 2442 C CA . PHE E 5  741  ? 183.133 242.163 245.906 1.00 500.00 ? 741  PHE F CA 1 
ATOM 2443 C CA . LEU E 5  742  ? 182.480 243.107 249.528 1.00 500.00 ? 742  LEU F CA 1 
ATOM 2444 C CA . ILE E 5  743  ? 182.187 246.812 248.651 1.00 500.00 ? 743  ILE F CA 1 
ATOM 2445 C CA . GLY E 5  744  ? 179.564 245.884 245.987 1.00 500.00 ? 744  GLY F CA 1 
ATOM 2446 C CA . LYS E 5  745  ? 177.450 244.123 248.624 1.00 500.00 ? 745  LYS F CA 1 
ATOM 2447 C CA . VAL E 5  746  ? 177.526 247.283 250.836 1.00 500.00 ? 746  VAL F CA 1 
ATOM 2448 C CA . TYR E 5  747  ? 176.242 249.413 247.915 1.00 500.00 ? 747  TYR F CA 1 
ATOM 2449 C CA . LYS E 5  748  ? 173.316 247.029 247.202 1.00 500.00 ? 748  LYS F CA 1 
ATOM 2450 C CA . LYS E 5  749  ? 172.030 247.854 250.741 1.00 500.00 ? 749  LYS F CA 1 
ATOM 2451 C CA . LEU E 5  750  ? 172.550 251.606 250.087 1.00 500.00 ? 750  LEU F CA 1 
ATOM 2452 C CA . GLY E 5  751  ? 170.684 251.061 246.790 1.00 500.00 ? 751  GLY F CA 1 
ATOM 2453 C CA . GLN E 5  752  ? 173.159 252.907 244.550 1.00 500.00 ? 752  GLN F CA 1 
ATOM 2454 C CA . THR E 5  753  ? 172.784 250.176 241.891 1.00 500.00 ? 753  THR F CA 1 
ATOM 2455 C CA . HIS E 5  754  ? 175.163 251.805 239.398 1.00 500.00 ? 754  HIS F CA 1 
ATOM 2456 C CA . LEU E 5  755  ? 178.008 251.808 241.961 1.00 500.00 ? 755  LEU F CA 1 
ATOM 2457 C CA . ALA E 5  756  ? 177.071 248.294 243.179 1.00 500.00 ? 756  ALA F CA 1 
ATOM 2458 C CA . LEU E 5  757  ? 177.385 246.853 239.645 1.00 500.00 ? 757  LEU F CA 1 
ATOM 2459 C CA . MET E 5  758  ? 180.719 248.635 238.991 1.00 488.77 ? 758  MET F CA 1 
ATOM 2460 C CA . ASN E 5  759  ? 182.154 246.984 242.126 1.00 464.61 ? 759  ASN F CA 1 
ATOM 2461 C CA . PHE E 5  760  ? 180.742 243.493 241.365 1.00 443.48 ? 760  PHE F CA 1 
ATOM 2462 C CA . SER E 5  761  ? 182.332 243.718 237.886 1.00 259.30 ? 761  SER F CA 1 
ATOM 2463 C CA . TRP E 5  762  ? 185.772 244.642 239.372 1.00 314.41 ? 762  TRP F CA 1 
ATOM 2464 C CA . ALA E 5  763  ? 185.774 241.439 241.477 1.00 211.53 ? 763  ALA F CA 1 
ATOM 2465 C CA . MET E 5  764  ? 185.081 239.470 238.252 1.00 242.51 ? 764  MET F CA 1 
ATOM 2466 C CA . ASP E 5  765  ? 188.147 241.176 236.682 1.00 281.19 ? 765  ASP F CA 1 
ATOM 2467 C CA . MET F 6  1    ? 189.763 258.006 222.046 1.00 190.42 ? 1    MET G CA 1 
ATOM 2468 C CA . LEU F 6  2    ? 186.843 256.879 219.946 1.00 217.18 ? 2    LEU G CA 1 
ATOM 2469 C CA . ARG F 6  3    ? 183.384 258.178 220.893 1.00 177.34 ? 3    ARG G CA 1 
ATOM 2470 C CA . ARG F 6  4    ? 180.006 256.516 220.368 1.00 179.44 ? 4    ARG G CA 1 
ATOM 2471 C CA . LYS F 6  5    ? 177.792 258.708 218.163 1.00 210.01 ? 5    LYS G CA 1 
ATOM 2472 C CA . PRO F 6  6    ? 174.847 260.106 220.169 1.00 184.93 ? 6    PRO G CA 1 
ATOM 2473 C CA . THR F 6  7    ? 171.751 257.902 220.041 1.00 217.73 ? 7    THR G CA 1 
ATOM 2474 C CA . ARG F 6  8    ? 169.075 258.901 217.607 1.00 260.81 ? 8    ARG G CA 1 
ATOM 2475 C CA . LEU F 6  9    ? 165.331 258.873 218.460 1.00 454.51 ? 9    LEU G CA 1 
ATOM 2476 C CA . GLU F 6  10   ? 163.249 257.562 215.539 1.00 481.98 ? 10   GLU G CA 1 
ATOM 2477 C CA . LEU F 6  11   ? 159.603 257.628 214.545 1.00 500.00 ? 11   LEU G CA 1 
ATOM 2478 C CA . LYS F 6  12   ? 157.314 254.969 215.926 1.00 500.00 ? 12   LYS G CA 1 
ATOM 2479 C CA . LEU F 6  13   ? 153.770 253.669 215.429 1.00 500.00 ? 13   LEU G CA 1 
ATOM 2480 C CA . ASP F 6  14   ? 153.060 255.253 218.842 1.00 500.00 ? 14   ASP G CA 1 
ATOM 2481 C CA . ASP F 6  15   ? 154.045 258.538 217.106 1.00 500.00 ? 15   ASP G CA 1 
ATOM 2482 C CA . ILE F 6  16   ? 151.286 257.793 214.483 1.00 500.00 ? 16   ILE G CA 1 
ATOM 2483 C CA . GLU F 6  17   ? 148.950 258.050 217.469 1.00 500.00 ? 17   GLU G CA 1 
ATOM 2484 C CA . GLU F 6  18   ? 149.817 261.754 217.627 1.00 500.00 ? 18   GLU G CA 1 
ATOM 2485 C CA . PHE F 6  19   ? 148.437 262.180 214.172 1.00 500.00 ? 19   PHE G CA 1 
ATOM 2486 C CA . GLU F 6  20   ? 145.129 260.524 215.075 1.00 500.00 ? 20   GLU G CA 1 
ATOM 2487 C CA . ASN F 6  21   ? 144.635 263.187 217.818 1.00 500.00 ? 21   ASN G CA 1 
ATOM 2488 C CA . ILE F 6  22   ? 144.810 266.035 215.324 1.00 500.00 ? 22   ILE G CA 1 
ATOM 2489 C CA . ARG F 6  23   ? 142.381 264.088 213.020 1.00 500.00 ? 23   ARG G CA 1 
ATOM 2490 C CA . LYS F 6  24   ? 139.744 264.332 215.801 1.00 500.00 ? 24   LYS G CA 1 
ATOM 2491 C CA . ASP F 6  25   ? 139.914 268.194 215.585 1.00 500.00 ? 25   ASP G CA 1 
ATOM 2492 C CA . GLN G 5  5    ? 239.936 228.723 286.144 1.00 500.00 ? 5    GLN H CA 1 
ATOM 2493 C CA . GLU G 5  6    ? 237.796 227.686 283.118 1.00 500.00 ? 6    GLU H CA 1 
ATOM 2494 C CA . PRO G 5  7    ? 234.594 226.707 284.971 1.00 500.00 ? 7    PRO H CA 1 
ATOM 2495 C CA . VAL G 5  8    ? 232.727 227.130 281.601 1.00 492.03 ? 8    VAL H CA 1 
ATOM 2496 C CA . GLN G 5  9    ? 234.912 224.510 279.974 1.00 280.87 ? 9    GLN H CA 1 
ATOM 2497 C CA . ALA G 5  10   ? 234.670 222.168 282.979 1.00 238.45 ? 10   ALA H CA 1 
ATOM 2498 C CA . ALA G 5  11   ? 230.859 222.530 282.995 1.00 236.89 ? 11   ALA H CA 1 
ATOM 2499 C CA . ILE G 5  12   ? 230.769 221.486 279.355 1.00 187.36 ? 12   ILE H CA 1 
ATOM 2500 C CA . TRP G 5  13   ? 232.831 218.340 280.086 1.00 169.75 ? 13   TRP H CA 1 
ATOM 2501 C CA . GLN G 5  14   ? 230.489 217.593 282.927 1.00 183.04 ? 14   GLN H CA 1 
ATOM 2502 C CA . ALA G 5  15   ? 227.505 217.933 280.580 1.00 175.41 ? 15   ALA H CA 1 
ATOM 2503 C CA . LEU G 5  16   ? 229.065 215.612 278.012 1.00 170.96 ? 16   LEU H CA 1 
ATOM 2504 C CA . ASN G 5  17   ? 229.682 213.027 280.730 1.00 162.59 ? 17   ASN H CA 1 
ATOM 2505 C CA . HIS G 5  18   ? 225.992 213.273 281.681 1.00 174.95 ? 18   HIS H CA 1 
ATOM 2506 C CA . TYR G 5  19   ? 225.002 213.041 277.979 1.00 150.10 ? 19   TYR H CA 1 
ATOM 2507 C CA . ALA G 5  20   ? 223.069 216.275 277.998 1.00 196.87 ? 20   ALA H CA 1 
ATOM 2508 C CA . TYR G 5  21   ? 224.083 217.186 274.579 1.00 180.65 ? 21   TYR H CA 1 
ATOM 2509 C CA . ARG G 5  22   ? 221.864 220.071 273.782 1.00 208.05 ? 22   ARG H CA 1 
ATOM 2510 C CA . ASP G 5  23   ? 223.102 222.026 276.715 1.00 215.55 ? 23   ASP H CA 1 
ATOM 2511 C CA . ALA G 5  24   ? 226.714 220.892 276.216 1.00 160.93 ? 24   ALA H CA 1 
ATOM 2512 C CA . VAL G 5  25   ? 226.668 221.929 272.583 1.00 173.35 ? 25   VAL H CA 1 
ATOM 2513 C CA . PHE G 5  26   ? 225.055 225.334 273.174 1.00 264.58 ? 26   PHE H CA 1 
ATOM 2514 C CA . LEU G 5  27   ? 227.455 226.183 275.918 1.00 326.12 ? 27   LEU H CA 1 
ATOM 2515 C CA . ALA G 5  28   ? 230.374 224.971 273.885 1.00 186.72 ? 28   ALA H CA 1 
ATOM 2516 C CA . GLU G 5  29   ? 229.264 227.025 270.906 1.00 171.00 ? 29   GLU H CA 1 
ATOM 2517 C CA . ARG G 5  30   ? 229.207 230.132 273.118 1.00 213.32 ? 30   ARG H CA 1 
ATOM 2518 C CA . LEU G 5  31   ? 232.665 229.436 274.404 1.00 146.99 ? 31   LEU H CA 1 
ATOM 2519 C CA . TYR G 5  32   ? 233.972 228.990 270.897 1.00 188.16 ? 32   TYR H CA 1 
ATOM 2520 C CA . ALA G 5  33   ? 232.494 232.379 269.993 1.00 332.78 ? 33   ALA H CA 1 
ATOM 2521 C CA . GLU G 5  34   ? 233.834 234.167 273.114 1.00 411.13 ? 34   GLU H CA 1 
ATOM 2522 C CA . VAL G 5  35   ? 237.354 232.759 273.065 1.00 315.45 ? 35   VAL H CA 1 
ATOM 2523 C CA . HIS G 5  36   ? 237.837 231.425 269.506 1.00 264.40 ? 36   HIS H CA 1 
ATOM 2524 C CA . SER G 5  37   ? 240.855 229.387 270.771 1.00 264.24 ? 37   SER H CA 1 
ATOM 2525 C CA . GLU G 5  38   ? 241.692 225.939 269.323 1.00 229.63 ? 38   GLU H CA 1 
ATOM 2526 C CA . GLU G 5  39   ? 240.927 224.385 272.725 1.00 225.44 ? 39   GLU H CA 1 
ATOM 2527 C CA . ALA G 5  40   ? 237.411 225.887 272.620 1.00 236.39 ? 40   ALA H CA 1 
ATOM 2528 C CA . LEU G 5  41   ? 237.093 224.639 269.000 1.00 195.06 ? 41   LEU H CA 1 
ATOM 2529 C CA . PHE G 5  42   ? 238.163 221.108 269.820 1.00 145.70 ? 42   PHE H CA 1 
ATOM 2530 C CA . LEU G 5  43   ? 235.675 221.040 272.717 1.00 155.16 ? 43   LEU H CA 1 
ATOM 2531 C CA . LEU G 5  44   ? 232.903 222.283 270.497 1.00 163.01 ? 44   LEU H CA 1 
ATOM 2532 C CA . ALA G 5  45   ? 233.621 219.739 267.727 1.00 180.23 ? 45   ALA H CA 1 
ATOM 2533 C CA . THR G 5  46   ? 233.671 217.009 270.378 1.00 146.97 ? 46   THR H CA 1 
ATOM 2534 C CA . CYS G 5  47   ? 230.213 218.058 271.508 1.00 146.83 ? 47   CYS H CA 1 
ATOM 2535 C CA . TYR G 5  48   ? 228.842 217.706 268.015 1.00 139.65 ? 48   TYR H CA 1 
ATOM 2536 C CA . TYR G 5  49   ? 230.603 214.435 267.559 1.00 128.46 ? 49   TYR H CA 1 
ATOM 2537 C CA . ARG G 5  50   ? 229.236 212.992 270.790 1.00 139.64 ? 50   ARG H CA 1 
ATOM 2538 C CA . SER G 5  51   ? 225.799 214.251 269.799 1.00 134.67 ? 51   SER H CA 1 
ATOM 2539 C CA . GLY G 5  52   ? 226.057 211.903 266.826 1.00 268.05 ? 52   GLY H CA 1 
ATOM 2540 C CA . LYS G 5  53   ? 226.168 214.847 264.544 1.00 164.72 ? 53   LYS H CA 1 
ATOM 2541 C CA . ALA G 5  54   ? 229.387 213.655 263.030 1.00 183.74 ? 54   ALA H CA 1 
ATOM 2542 C CA . TYR G 5  55   ? 228.954 215.802 259.944 1.00 153.05 ? 55   TYR H CA 1 
ATOM 2543 C CA . LYS G 5  56   ? 228.627 218.917 262.131 1.00 170.92 ? 56   LYS H CA 1 
ATOM 2544 C CA . ALA G 5  57   ? 231.953 218.191 263.797 1.00 160.53 ? 57   ALA H CA 1 
ATOM 2545 C CA . TYR G 5  58   ? 233.504 217.454 260.419 1.00 156.85 ? 58   TYR H CA 1 
ATOM 2546 C CA . ARG G 5  59   ? 232.361 220.709 258.980 1.00 171.21 ? 59   ARG H CA 1 
ATOM 2547 C CA . LEU G 5  60   ? 233.483 222.753 261.982 1.00 155.18 ? 60   LEU H CA 1 
ATOM 2548 C CA . LEU G 5  61   ? 236.897 221.085 261.956 1.00 184.19 ? 61   LEU H CA 1 
ATOM 2549 C CA . LYS G 5  62   ? 237.395 221.140 258.271 1.00 236.73 ? 62   LYS H CA 1 
ATOM 2550 C CA . GLY G 5  63   ? 236.651 224.879 258.208 1.00 291.98 ? 63   GLY H CA 1 
ATOM 2551 C CA . HIS G 5  64   ? 239.239 225.809 260.820 1.00 300.60 ? 64   HIS H CA 1 
ATOM 2552 C CA . SER G 5  65   ? 242.903 224.794 260.771 1.00 297.12 ? 65   SER H CA 1 
ATOM 2553 C CA . CYS G 5  66   ? 243.822 222.627 263.702 1.00 307.89 ? 66   CYS H CA 1 
ATOM 2554 C CA . THR G 5  67   ? 247.433 222.051 264.668 1.00 278.18 ? 67   THR H CA 1 
ATOM 2555 C CA . THR G 5  68   ? 246.585 220.189 267.907 1.00 302.27 ? 68   THR H CA 1 
ATOM 2556 C CA . PRO G 5  69   ? 246.961 216.420 268.028 1.00 277.90 ? 69   PRO H CA 1 
ATOM 2557 C CA . GLN G 5  70   ? 243.432 216.055 269.463 1.00 224.21 ? 70   GLN H CA 1 
ATOM 2558 C CA . CYS G 5  71   ? 241.784 217.953 266.654 1.00 205.48 ? 71   CYS H CA 1 
ATOM 2559 C CA . LYS G 5  72   ? 243.607 216.048 263.954 1.00 221.22 ? 72   LYS H CA 1 
ATOM 2560 C CA . TYR G 5  73   ? 242.478 212.823 265.555 1.00 190.28 ? 73   TYR H CA 1 
ATOM 2561 C CA . LEU G 5  74   ? 238.854 213.789 265.888 1.00 145.55 ? 74   LEU H CA 1 
ATOM 2562 C CA . LEU G 5  75   ? 238.928 215.155 262.338 1.00 150.03 ? 75   LEU H CA 1 
ATOM 2563 C CA . ALA G 5  76   ? 240.286 211.830 261.068 1.00 178.47 ? 76   ALA H CA 1 
ATOM 2564 C CA . LYS G 5  77   ? 237.713 209.937 263.143 1.00 160.34 ? 77   LYS H CA 1 
ATOM 2565 C CA . CYS G 5  78   ? 234.874 212.016 261.594 1.00 248.15 ? 78   CYS H CA 1 
ATOM 2566 C CA . CYS G 5  79   ? 236.258 211.446 258.109 1.00 186.43 ? 79   CYS H CA 1 
ATOM 2567 C CA . VAL G 5  80   ? 236.217 207.700 258.558 1.00 205.60 ? 80   VAL H CA 1 
ATOM 2568 C CA . ASP G 5  81   ? 232.758 207.762 260.121 1.00 218.37 ? 81   ASP H CA 1 
ATOM 2569 C CA . LEU G 5  82   ? 231.669 209.830 257.063 1.00 178.55 ? 82   LEU H CA 1 
ATOM 2570 C CA . SER G 5  83   ? 233.445 207.309 254.790 1.00 231.43 ? 83   SER H CA 1 
ATOM 2571 C CA . LYS G 5  84   ? 235.753 209.963 253.288 1.00 231.90 ? 84   LYS H CA 1 
ATOM 2572 C CA . LEU G 5  85   ? 238.661 207.572 253.691 1.00 180.29 ? 85   LEU H CA 1 
ATOM 2573 C CA . ALA G 5  86   ? 241.213 209.486 251.651 1.00 204.49 ? 86   ALA H CA 1 
ATOM 2574 C CA . GLU G 5  87   ? 240.580 212.692 253.569 1.00 174.48 ? 87   GLU H CA 1 
ATOM 2575 C CA . GLY G 5  88   ? 240.732 210.911 256.963 1.00 254.58 ? 88   GLY H CA 1 
ATOM 2576 C CA . GLU G 5  89   ? 243.937 209.085 256.086 1.00 169.42 ? 89   GLU H CA 1 
ATOM 2577 C CA . GLN G 5  90   ? 245.866 211.942 254.660 1.00 199.44 ? 90   GLN H CA 1 
ATOM 2578 C CA . ILE G 5  91   ? 245.497 213.988 257.924 1.00 197.48 ? 91   ILE H CA 1 
ATOM 2579 C CA . LEU G 5  92   ? 246.944 211.368 260.266 1.00 197.97 ? 92   LEU H CA 1 
ATOM 2580 C CA . SER G 5  93   ? 249.296 209.763 257.835 1.00 225.75 ? 93   SER H CA 1 
ATOM 2581 C CA . GLY G 5  94   ? 250.355 212.816 255.876 1.00 321.90 ? 94   GLY H CA 1 
ATOM 2582 C CA . GLY G 5  95   ? 250.289 210.390 252.942 1.00 279.29 ? 95   GLY H CA 1 
ATOM 2583 C CA . VAL G 5  96   ? 249.270 211.279 249.369 1.00 167.06 ? 96   VAL H CA 1 
ATOM 2584 C CA . PHE G 5  97   ? 250.908 214.546 248.217 1.00 349.24 ? 97   PHE H CA 1 
ATOM 2585 C CA . ASN G 5  98   ? 252.456 215.534 251.586 1.00 434.10 ? 98   ASN H CA 1 
ATOM 2586 C CA . LYS G 5  99   ? 255.062 212.660 251.626 1.00 401.21 ? 99   LYS H CA 1 
ATOM 2587 C CA . GLN G 5  100  ? 254.557 209.768 254.074 1.00 294.48 ? 100  GLN H CA 1 
ATOM 2588 C CA . LYS G 5  101  ? 254.960 209.985 257.844 1.00 275.93 ? 101  LYS H CA 1 
ATOM 2589 C CA . SER G 5  102  ? 257.278 207.428 259.481 1.00 278.64 ? 102  SER H CA 1 
ATOM 2590 C CA . HIS G 5  103  ? 254.808 205.880 262.053 1.00 202.90 ? 103  HIS H CA 1 
ATOM 2591 C CA . ASP G 5  104  ? 257.290 207.041 264.719 1.00 219.81 ? 104  ASP H CA 1 
ATOM 2592 C CA . ASP G 5  105  ? 256.470 210.593 263.512 1.00 250.92 ? 105  ASP H CA 1 
ATOM 2593 C CA . ILE G 5  106  ? 252.813 209.807 264.267 1.00 218.81 ? 106  ILE H CA 1 
ATOM 2594 C CA . VAL G 5  107  ? 253.922 208.398 267.676 1.00 241.25 ? 107  VAL H CA 1 
ATOM 2595 C CA . THR G 5  108  ? 255.823 211.675 268.431 1.00 247.79 ? 108  THR H CA 1 
ATOM 2596 C CA . GLU G 5  109  ? 252.968 213.901 267.148 1.00 222.87 ? 109  GLU H CA 1 
ATOM 2597 C CA . PHE G 5  110  ? 250.107 212.277 269.043 1.00 225.19 ? 110  PHE H CA 1 
ATOM 2598 C CA . GLY G 5  111  ? 252.186 211.062 272.029 1.00 250.37 ? 111  GLY H CA 1 
ATOM 2599 C CA . ASP G 5  112  ? 249.954 209.192 274.491 1.00 284.33 ? 112  ASP H CA 1 
ATOM 2600 C CA . SER G 5  113  ? 246.910 209.028 272.180 1.00 247.41 ? 113  SER H CA 1 
ATOM 2601 C CA . ALA G 5  114  ? 249.178 207.692 269.335 1.00 214.90 ? 114  ALA H CA 1 
ATOM 2602 C CA . CYS G 5  115  ? 248.135 204.073 269.906 1.00 213.36 ? 115  CYS H CA 1 
ATOM 2603 C CA . PHE G 5  116  ? 244.528 204.827 269.034 1.00 165.32 ? 116  PHE H CA 1 
ATOM 2604 C CA . THR G 5  117  ? 245.458 206.926 265.948 1.00 207.58 ? 117  THR H CA 1 
ATOM 2605 C CA . LEU G 5  118  ? 247.687 204.125 264.567 1.00 213.82 ? 118  LEU H CA 1 
ATOM 2606 C CA . SER G 5  119  ? 244.867 201.638 265.091 1.00 240.40 ? 119  SER H CA 1 
ATOM 2607 C CA . LEU G 5  120  ? 242.408 203.943 263.286 1.00 280.93 ? 120  LEU H CA 1 
ATOM 2608 C CA . LEU G 5  121  ? 245.048 204.458 260.630 1.00 201.51 ? 121  LEU H CA 1 
ATOM 2609 C CA . GLY G 5  122  ? 245.284 200.685 260.344 1.00 223.81 ? 122  GLY H CA 1 
ATOM 2610 C CA . HIS G 5  123  ? 241.544 200.352 259.875 1.00 204.01 ? 123  HIS H CA 1 
ATOM 2611 C CA . VAL G 5  124  ? 241.806 202.925 256.963 1.00 167.99 ? 124  VAL H CA 1 
ATOM 2612 C CA . TYR G 5  125  ? 244.608 200.981 255.275 1.00 183.10 ? 125  TYR H CA 1 
ATOM 2613 C CA . CYS G 5  126  ? 242.921 197.641 255.467 1.00 193.34 ? 126  CYS H CA 1 
ATOM 2614 C CA . LYS G 5  127  ? 239.628 199.021 254.074 1.00 198.29 ? 127  LYS H CA 1 
ATOM 2615 C CA . THR G 5  128  ? 241.714 200.846 251.422 1.00 256.20 ? 128  THR H CA 1 
ATOM 2616 C CA . ASP G 5  129  ? 243.281 197.473 250.382 1.00 301.45 ? 129  ASP H CA 1 
ATOM 2617 C CA . ARG G 5  130  ? 246.728 198.534 251.688 1.00 232.99 ? 130  ARG H CA 1 
ATOM 2618 C CA . LEU G 5  131  ? 246.543 195.263 253.799 1.00 239.66 ? 131  LEU H CA 1 
ATOM 2619 C CA . ALA G 5  132  ? 250.315 194.695 254.026 1.00 200.93 ? 132  ALA H CA 1 
ATOM 2620 C CA . LYS G 5  133  ? 251.003 198.256 255.129 1.00 221.57 ? 133  LYS H CA 1 
ATOM 2621 C CA . GLY G 5  134  ? 247.996 198.094 257.519 1.00 193.44 ? 134  GLY H CA 1 
ATOM 2622 C CA . SER G 5  135  ? 249.052 195.048 259.456 1.00 240.87 ? 135  SER H CA 1 
ATOM 2623 C CA . GLU G 5  136  ? 252.318 196.831 260.300 1.00 227.07 ? 136  GLU H CA 1 
ATOM 2624 C CA . CYS G 5  137  ? 250.284 199.835 261.451 1.00 257.36 ? 137  CYS H CA 1 
ATOM 2625 C CA . TYR G 5  138  ? 248.189 197.615 263.699 1.00 209.76 ? 138  TYR H CA 1 
ATOM 2626 C CA . GLN G 5  139  ? 251.254 196.008 265.303 1.00 192.89 ? 139  GLN H CA 1 
ATOM 2627 C CA . LYS G 5  140  ? 252.481 199.495 266.234 1.00 236.54 ? 140  LYS H CA 1 
ATOM 2628 C CA . SER G 5  141  ? 249.315 200.072 268.259 1.00 265.81 ? 141  SER H CA 1 
ATOM 2629 C CA . LEU G 5  142  ? 249.831 196.800 270.189 1.00 218.94 ? 142  LEU H CA 1 
ATOM 2630 C CA . SER G 5  143  ? 253.473 197.819 270.796 1.00 266.58 ? 143  SER H CA 1 
ATOM 2631 C CA . LEU G 5  144  ? 252.193 200.917 272.580 1.00 231.65 ? 144  LEU H CA 1 
ATOM 2632 C CA . ASN G 5  145  ? 250.201 199.301 275.433 1.00 297.26 ? 145  ASN H CA 1 
ATOM 2633 C CA . PRO G 5  146  ? 248.651 197.146 274.043 1.00 284.90 ? 146  PRO H CA 1 
ATOM 2634 C CA . PHE G 5  147  ? 245.495 196.785 276.175 1.00 234.34 ? 147  PHE H CA 1 
ATOM 2635 C CA . LEU G 5  148  ? 243.489 197.202 272.943 1.00 212.91 ? 148  LEU H CA 1 
ATOM 2636 C CA . TRP G 5  149  ? 241.688 194.149 271.703 1.00 162.45 ? 149  TRP H CA 1 
ATOM 2637 C CA . SER G 5  150  ? 240.403 195.684 268.474 1.00 184.28 ? 150  SER H CA 1 
ATOM 2638 C CA . PRO G 5  151  ? 243.779 196.058 266.756 1.00 125.48 ? 151  PRO H CA 1 
ATOM 2639 C CA . PHE G 5  152  ? 244.764 192.513 267.745 1.00 292.51 ? 152  PHE H CA 1 
ATOM 2640 C CA . GLU G 5  153  ? 241.312 191.088 266.653 1.00 349.84 ? 153  GLU H CA 1 
ATOM 2641 C CA . SER G 5  154  ? 241.511 192.857 263.310 1.00 413.87 ? 154  SER H CA 1 
ATOM 2642 C CA . LEU G 5  155  ? 245.164 191.835 262.818 1.00 478.35 ? 155  LEU H CA 1 
ATOM 2643 C CA . CYS G 5  156  ? 244.425 188.141 263.236 1.00 320.46 ? 156  CYS H CA 1 
ATOM 2644 C CA . GLU G 5  157  ? 241.287 188.203 261.023 1.00 422.57 ? 157  GLU H CA 1 
ATOM 2645 C CA . ILE G 5  158  ? 243.495 189.129 258.116 1.00 452.87 ? 158  ILE H CA 1 
ATOM 2646 C CA . GLY G 5  159  ? 245.979 186.451 256.878 1.00 433.08 ? 159  GLY H CA 1 
ATOM 2647 C CA . GLU G 5  160  ? 248.339 187.997 259.469 1.00 441.98 ? 160  GLU H CA 1 
ATOM 2648 C CA . LYS G 5  161  ? 248.853 186.029 262.688 1.00 322.98 ? 161  LYS H CA 1 
ATOM 2649 C CA . PRO G 5  162  ? 250.189 187.820 265.734 1.00 251.65 ? 162  PRO H CA 1 
ATOM 2650 C CA . ASP G 5  163  ? 251.841 186.289 268.767 1.00 295.27 ? 163  ASP H CA 1 
ATOM 2651 C CA . PRO G 5  164  ? 249.889 186.339 272.038 1.00 236.44 ? 164  PRO H CA 1 
ATOM 2652 C CA . ASP G 5  165  ? 253.122 188.004 273.503 1.00 238.95 ? 165  ASP H CA 1 
ATOM 2653 C CA . GLN G 5  166  ? 251.867 191.359 272.249 1.00 228.40 ? 166  GLN H CA 1 
ATOM 2654 C CA . THR G 5  167  ? 248.775 191.346 274.538 1.00 203.66 ? 167  THR H CA 1 
ATOM 2655 C CA . PHE G 5  168  ? 251.049 189.797 277.253 1.00 224.98 ? 168  PHE H CA 1 
ATOM 2656 C CA . LYS G 5  169  ? 253.856 192.371 277.570 1.00 201.80 ? 169  LYS H CA 1 
ATOM 2657 C CA . PHE G 5  170  ? 253.665 195.956 278.879 1.00 158.66 ? 170  PHE H CA 1 
ATOM 2658 C CA . ALA G 5  451  ? 255.673 203.450 291.261 1.00 492.70 ? 451  ALA H CA 1 
ATOM 2659 C CA . PHE G 5  452  ? 255.464 201.921 287.741 1.00 500.00 ? 452  PHE H CA 1 
ATOM 2660 C CA . ASN G 5  453  ? 256.053 198.323 288.941 1.00 500.00 ? 453  ASN H CA 1 
ATOM 2661 C CA . LEU G 5  454  ? 253.353 198.457 291.669 1.00 494.63 ? 454  LEU H CA 1 
ATOM 2662 C CA . GLN G 5  455  ? 250.628 199.685 289.262 1.00 403.71 ? 455  GLN H CA 1 
ATOM 2663 C CA . LYS G 5  456  ? 251.634 197.204 286.487 1.00 500.00 ? 456  LYS H CA 1 
ATOM 2664 C CA . ALA G 5  457  ? 251.445 194.247 288.959 1.00 464.00 ? 457  ALA H CA 1 
ATOM 2665 C CA . ALA G 5  458  ? 247.668 194.548 289.660 1.00 423.24 ? 458  ALA H CA 1 
ATOM 2666 C CA . ALA G 5  459  ? 246.886 194.826 285.927 1.00 309.46 ? 459  ALA H CA 1 
ATOM 2667 C CA . GLU G 5  460  ? 249.212 191.911 284.992 1.00 211.60 ? 460  GLU H CA 1 
ATOM 2668 C CA . GLY G 5  461  ? 246.489 189.628 286.313 1.00 257.75 ? 461  GLY H CA 1 
ATOM 2669 C CA . LEU G 5  462  ? 244.146 190.703 283.541 1.00 206.89 ? 462  LEU H CA 1 
ATOM 2670 C CA . MET G 5  463  ? 246.978 190.855 281.004 1.00 200.20 ? 463  MET H CA 1 
ATOM 2671 C CA . SER G 5  464  ? 247.665 187.183 281.754 1.00 224.54 ? 464  SER H CA 1 
ATOM 2672 C CA . LEU G 5  465  ? 244.090 186.297 280.939 1.00 218.00 ? 465  LEU H CA 1 
ATOM 2673 C CA . LEU G 5  466  ? 244.243 188.313 277.717 1.00 205.66 ? 466  LEU H CA 1 
ATOM 2674 C CA . ARG G 5  467  ? 247.220 186.284 276.456 1.00 216.29 ? 467  ARG H CA 1 
ATOM 2675 C CA . GLU G 5  468  ? 245.397 183.010 277.122 1.00 228.92 ? 468  GLU H CA 1 
ATOM 2676 C CA . MET G 5  469  ? 242.256 184.361 275.453 1.00 173.55 ? 469  MET H CA 1 
ATOM 2677 C CA . GLY G 5  470  ? 244.166 185.746 272.504 1.00 236.30 ? 470  GLY H CA 1 
ATOM 2678 C CA . LYS G 5  471  ? 245.684 182.338 271.677 1.00 195.14 ? 471  LYS H CA 1 
ATOM 2679 C CA . GLY G 5  472  ? 242.177 180.961 271.426 1.00 187.78 ? 472  GLY H CA 1 
ATOM 2680 C CA . TYR G 5  473  ? 240.793 183.744 269.280 1.00 199.27 ? 473  TYR H CA 1 
ATOM 2681 C CA . LEU G 5  474  ? 243.778 183.547 266.903 1.00 225.52 ? 474  LEU H CA 1 
ATOM 2682 C CA . ALA G 5  475  ? 243.308 179.769 266.594 1.00 220.46 ? 475  ALA H CA 1 
ATOM 2683 C CA . LEU G 5  476  ? 239.547 180.172 266.099 1.00 167.14 ? 476  LEU H CA 1 
ATOM 2684 C CA . CYS G 5  477  ? 240.005 182.677 263.329 1.00 255.54 ? 477  CYS H CA 1 
ATOM 2685 C CA . SER G 5  478  ? 242.633 180.391 261.754 1.00 196.47 ? 478  SER H CA 1 
ATOM 2686 C CA . TYR G 5  479  ? 239.873 177.685 261.875 1.00 201.43 ? 479  TYR H CA 1 
ATOM 2687 C CA . ASN G 5  480  ? 242.155 175.269 264.616 1.00 213.68 ? 480  ASN H CA 1 
ATOM 2688 C CA . CYS G 5  481  ? 238.595 174.389 265.829 1.00 240.88 ? 481  CYS H CA 1 
ATOM 2689 C CA . LYS G 5  482  ? 239.477 171.918 268.625 1.00 237.85 ? 482  LYS H CA 1 
ATOM 2690 C CA . GLU G 5  483  ? 242.552 173.690 270.029 1.00 191.63 ? 483  GLU H CA 1 
ATOM 2691 C CA . ALA G 5  484  ? 240.495 176.921 270.316 1.00 211.01 ? 484  ALA H CA 1 
ATOM 2692 C CA . ILE G 5  485  ? 237.697 175.244 272.343 1.00 193.77 ? 485  ILE H CA 1 
ATOM 2693 C CA . ASN G 5  486  ? 240.202 173.599 274.624 1.00 214.22 ? 486  ASN H CA 1 
ATOM 2694 C CA . ILE G 5  487  ? 242.334 176.706 274.976 1.00 191.20 ? 487  ILE H CA 1 
ATOM 2695 C CA . LEU G 5  488  ? 239.352 178.917 275.981 1.00 200.88 ? 488  LEU H CA 1 
ATOM 2696 C CA . SER G 5  489  ? 238.062 176.451 278.529 1.00 154.33 ? 489  SER H CA 1 
ATOM 2697 C CA . HIS G 5  490  ? 241.238 176.874 280.641 1.00 168.00 ? 490  HIS H CA 1 
ATOM 2698 C CA . LEU G 5  491  ? 240.142 180.487 281.312 1.00 215.71 ? 491  LEU H CA 1 
ATOM 2699 C CA . PRO G 5  492  ? 239.674 181.489 285.053 1.00 215.34 ? 492  PRO H CA 1 
ATOM 2700 C CA . SER G 5  493  ? 235.911 180.843 284.547 1.00 250.10 ? 493  SER H CA 1 
ATOM 2701 C CA . HIS G 5  494  ? 234.522 184.200 285.726 1.00 240.74 ? 494  HIS H CA 1 
ATOM 2702 C CA . HIS G 5  495  ? 235.763 184.894 282.226 1.00 143.58 ? 495  HIS H CA 1 
ATOM 2703 C CA . TYR G 5  496  ? 234.275 181.772 280.607 1.00 147.88 ? 496  TYR H CA 1 
ATOM 2704 C CA . ASN G 5  497  ? 230.813 182.718 281.997 1.00 153.71 ? 497  ASN H CA 1 
ATOM 2705 C CA . THR G 5  498  ? 230.705 186.137 280.263 1.00 201.29 ? 498  THR H CA 1 
ATOM 2706 C CA . GLY G 5  499  ? 228.742 186.453 277.072 1.00 199.90 ? 499  GLY H CA 1 
ATOM 2707 C CA . TRP G 5  500  ? 231.889 187.128 275.026 1.00 165.42 ? 500  TRP H CA 1 
ATOM 2708 C CA . VAL G 5  501  ? 233.715 183.880 275.752 1.00 153.69 ? 501  VAL H CA 1 
ATOM 2709 C CA . LEU G 5  502  ? 230.744 181.452 275.571 1.00 173.39 ? 502  LEU H CA 1 
ATOM 2710 C CA . CYS G 5  503  ? 229.828 183.163 272.293 1.00 174.45 ? 503  CYS H CA 1 
ATOM 2711 C CA . GLN G 5  504  ? 233.393 182.470 271.071 1.00 161.04 ? 504  GLN H CA 1 
ATOM 2712 C CA . ILE G 5  505  ? 233.153 178.697 271.724 1.00 153.75 ? 505  ILE H CA 1 
ATOM 2713 C CA . GLY G 5  506  ? 229.740 178.387 270.003 1.00 267.40 ? 506  GLY H CA 1 
ATOM 2714 C CA . ARG G 5  507  ? 231.161 180.133 266.903 1.00 233.59 ? 507  ARG H CA 1 
ATOM 2715 C CA . ALA G 5  508  ? 234.007 177.677 267.077 1.00 178.89 ? 508  ALA H CA 1 
ATOM 2716 C CA . TYR G 5  509  ? 231.753 174.655 267.583 1.00 153.82 ? 509  TYR H CA 1 
ATOM 2717 C CA . PHE G 5  510  ? 229.676 175.881 264.676 1.00 150.04 ? 510  PHE H CA 1 
ATOM 2718 C CA . GLU G 5  511  ? 232.637 175.922 262.311 1.00 185.84 ? 511  GLU H CA 1 
ATOM 2719 C CA . LEU G 5  512  ? 233.597 172.472 263.648 1.00 174.14 ? 512  LEU H CA 1 
ATOM 2720 C CA . SER G 5  513  ? 230.074 171.217 262.573 1.00 176.96 ? 513  SER H CA 1 
ATOM 2721 C CA . GLU G 5  514  ? 228.821 169.857 265.921 1.00 177.29 ? 514  GLU H CA 1 
ATOM 2722 C CA . TYR G 5  515  ? 225.536 171.832 265.679 1.00 136.86 ? 515  TYR H CA 1 
ATOM 2723 C CA . MET G 5  516  ? 223.711 169.978 268.461 1.00 152.86 ? 516  MET H CA 1 
ATOM 2724 C CA . GLN G 5  517  ? 226.705 170.705 270.696 1.00 154.50 ? 517  GLN H CA 1 
ATOM 2725 C CA . ALA G 5  518  ? 226.672 174.317 269.289 1.00 302.25 ? 518  ALA H CA 1 
ATOM 2726 C CA . GLU G 5  519  ? 222.962 175.217 269.897 1.00 176.94 ? 519  GLU H CA 1 
ATOM 2727 C CA . ARG G 5  520  ? 223.448 173.870 273.389 1.00 130.78 ? 520  ARG H CA 1 
ATOM 2728 C CA . ILE G 5  521  ? 226.301 176.377 273.935 1.00 264.45 ? 521  ILE H CA 1 
ATOM 2729 C CA . PHE G 5  522  ? 224.639 179.449 272.366 1.00 332.40 ? 522  PHE H CA 1 
ATOM 2730 C CA . SER G 5  523  ? 221.339 179.205 274.265 1.00 162.68 ? 523  SER H CA 1 
ATOM 2731 C CA . GLU G 5  524  ? 223.416 179.248 277.428 1.00 142.63 ? 524  GLU H CA 1 
ATOM 2732 C CA . VAL G 5  525  ? 225.016 182.550 276.370 1.00 256.39 ? 525  VAL H CA 1 
ATOM 2733 C CA . ARG G 5  526  ? 221.544 184.002 275.558 1.00 405.52 ? 526  ARG H CA 1 
ATOM 2734 C CA . ARG G 5  527  ? 220.246 183.316 279.027 1.00 367.64 ? 527  ARG H CA 1 
ATOM 2735 C CA . ILE G 5  528  ? 223.405 185.124 280.327 1.00 224.55 ? 528  ILE H CA 1 
ATOM 2736 C CA . GLU G 5  529  ? 223.447 188.234 278.172 1.00 169.86 ? 529  GLU H CA 1 
ATOM 2737 C CA . ASN G 5  530  ? 219.917 189.041 277.150 1.00 316.65 ? 530  ASN H CA 1 
ATOM 2738 C CA . TYR G 5  531  ? 221.641 192.070 275.690 1.00 139.68 ? 531  TYR H CA 1 
ATOM 2739 C CA . ARG G 5  532  ? 224.514 190.639 273.592 1.00 156.07 ? 532  ARG H CA 1 
ATOM 2740 C CA . VAL G 5  533  ? 223.558 190.758 269.936 1.00 278.80 ? 533  VAL H CA 1 
ATOM 2741 C CA . GLU G 5  534  ? 227.088 190.154 268.805 1.00 177.53 ? 534  GLU H CA 1 
ATOM 2742 C CA . GLY G 5  535  ? 227.180 186.568 267.505 1.00 303.69 ? 535  GLY H CA 1 
ATOM 2743 C CA . MET G 5  536  ? 223.530 185.655 266.921 1.00 461.59 ? 536  MET H CA 1 
ATOM 2744 C CA . GLU G 5  537  ? 223.701 185.303 263.094 1.00 456.09 ? 537  GLU H CA 1 
ATOM 2745 C CA . ILE G 5  538  ? 225.849 182.206 263.650 1.00 430.09 ? 538  ILE H CA 1 
ATOM 2746 C CA . TYR G 5  539  ? 223.467 180.988 266.393 1.00 448.78 ? 539  TYR H CA 1 
ATOM 2747 C CA . SER G 5  540  ? 220.405 181.564 264.125 1.00 450.02 ? 540  SER H CA 1 
ATOM 2748 C CA . THR G 5  541  ? 222.102 179.518 261.394 1.00 350.64 ? 541  THR H CA 1 
ATOM 2749 C CA . THR G 5  542  ? 222.774 176.901 264.108 1.00 213.65 ? 542  THR H CA 1 
ATOM 2750 C CA . LEU G 5  543  ? 219.053 176.618 264.831 1.00 180.71 ? 543  LEU H CA 1 
ATOM 2751 C CA . TRP G 5  544  ? 218.400 176.672 261.043 1.00 266.81 ? 544  TRP H CA 1 
ATOM 2752 C CA . HIS G 5  545  ? 220.561 173.607 260.791 1.00 151.02 ? 545  HIS H CA 1 
ATOM 2753 C CA . LEU G 5  546  ? 218.826 172.035 263.778 1.00 166.33 ? 546  LEU H CA 1 
ATOM 2754 C CA . GLN G 5  547  ? 215.461 172.710 262.034 1.00 357.01 ? 547  GLN H CA 1 
ATOM 2755 C CA . LYS G 5  548  ? 214.304 174.427 265.214 1.00 413.75 ? 548  LYS H CA 1 
ATOM 2756 C CA . ASP G 5  549  ? 211.466 176.564 263.717 1.00 449.71 ? 549  ASP H CA 1 
ATOM 2757 C CA . VAL G 5  550  ? 209.902 177.386 267.086 1.00 438.76 ? 550  VAL H CA 1 
ATOM 2758 C CA . ALA G 5  551  ? 213.205 178.168 268.893 1.00 394.98 ? 551  ALA H CA 1 
ATOM 2759 C CA . LEU G 5  552  ? 214.345 180.321 266.005 1.00 329.82 ? 552  LEU H CA 1 
ATOM 2760 C CA . SER G 5  553  ? 211.114 182.410 265.823 1.00 214.46 ? 553  SER H CA 1 
ATOM 2761 C CA . VAL G 5  554  ? 211.378 183.206 269.570 1.00 261.99 ? 554  VAL H CA 1 
ATOM 2762 C CA . LEU G 5  555  ? 214.920 184.451 268.705 1.00 212.79 ? 555  LEU H CA 1 
ATOM 2763 C CA . SER G 5  556  ? 213.786 186.566 265.830 1.00 143.45 ? 556  SER H CA 1 
ATOM 2764 C CA . LYS G 5  557  ? 210.843 188.397 267.420 1.00 157.45 ? 557  LYS H CA 1 
ATOM 2765 C CA . ASP G 5  558  ? 213.147 188.571 270.486 1.00 205.00 ? 558  ASP H CA 1 
ATOM 2766 C CA . LEU G 5  559  ? 216.037 190.308 268.754 1.00 127.83 ? 559  LEU H CA 1 
ATOM 2767 C CA . THR G 5  560  ? 214.008 192.662 266.461 1.00 155.71 ? 560  THR H CA 1 
ATOM 2768 C CA . ASP G 5  561  ? 211.695 193.752 269.274 1.00 203.37 ? 561  ASP H CA 1 
ATOM 2769 C CA . MET G 5  562  ? 214.662 194.420 271.612 1.00 168.62 ? 562  MET H CA 1 
ATOM 2770 C CA . ASP G 5  563  ? 216.580 196.246 268.842 1.00 169.18 ? 563  ASP H CA 1 
ATOM 2771 C CA . LYS G 5  564  ? 216.878 196.708 265.120 1.00 214.95 ? 564  LYS H CA 1 
ATOM 2772 C CA . ASN G 5  565  ? 219.698 198.654 263.402 1.00 193.83 ? 565  ASN H CA 1 
ATOM 2773 C CA . SER G 5  566  ? 222.410 196.129 263.859 1.00 191.71 ? 566  SER H CA 1 
ATOM 2774 C CA . PRO G 5  567  ? 223.242 193.690 261.010 1.00 146.79 ? 567  PRO H CA 1 
ATOM 2775 C CA . GLU G 5  568  ? 222.941 190.824 263.469 1.00 325.78 ? 568  GLU H CA 1 
ATOM 2776 C CA . ALA G 5  569  ? 219.295 191.206 264.583 1.00 331.03 ? 569  ALA H CA 1 
ATOM 2777 C CA . TRP G 5  570  ? 217.942 191.441 261.013 1.00 324.81 ? 570  TRP H CA 1 
ATOM 2778 C CA . CYS G 5  571  ? 219.993 188.445 259.914 1.00 396.83 ? 571  CYS H CA 1 
ATOM 2779 C CA . ALA G 5  572  ? 218.436 186.323 262.721 1.00 406.73 ? 572  ALA H CA 1 
ATOM 2780 C CA . ALA G 5  573  ? 214.896 187.272 261.632 1.00 380.28 ? 573  ALA H CA 1 
ATOM 2781 C CA . GLY G 5  574  ? 216.118 186.701 258.060 1.00 436.38 ? 574  GLY H CA 1 
ATOM 2782 C CA . ASN G 5  575  ? 216.821 183.059 258.945 1.00 438.42 ? 575  ASN H CA 1 
ATOM 2783 C CA . CYS G 5  576  ? 213.333 182.488 260.380 1.00 434.26 ? 576  CYS H CA 1 
ATOM 2784 C CA . PHE G 5  577  ? 211.685 183.217 257.048 1.00 500.00 ? 577  PHE H CA 1 
ATOM 2785 C CA . SER G 5  578  ? 214.403 181.242 255.182 1.00 500.00 ? 578  SER H CA 1 
ATOM 2786 C CA . LEU G 5  579  ? 213.407 178.270 257.292 1.00 468.39 ? 579  LEU H CA 1 
ATOM 2787 C CA . GLN G 5  580  ? 209.747 178.729 256.384 1.00 500.00 ? 580  GLN H CA 1 
ATOM 2788 C CA . ARG G 5  581  ? 210.869 178.601 252.731 1.00 500.00 ? 581  ARG H CA 1 
ATOM 2789 C CA . GLU G 5  582  ? 209.080 181.916 252.307 1.00 500.00 ? 582  GLU H CA 1 
ATOM 2790 C CA . HIS G 5  583  ? 212.289 183.032 250.539 1.00 500.00 ? 583  HIS H CA 1 
ATOM 2791 C CA . ASP G 5  584  ? 210.728 186.262 249.182 1.00 500.00 ? 584  ASP H CA 1 
ATOM 2792 C CA . ILE G 5  585  ? 210.121 187.603 252.731 1.00 500.00 ? 585  ILE H CA 1 
ATOM 2793 C CA . ALA G 5  586  ? 213.520 186.273 253.961 1.00 485.09 ? 586  ALA H CA 1 
ATOM 2794 C CA . ILE G 5  587  ? 215.324 188.277 251.258 1.00 428.72 ? 587  ILE H CA 1 
ATOM 2795 C CA . LYS G 5  588  ? 213.784 191.678 252.340 1.00 286.00 ? 588  LYS H CA 1 
ATOM 2796 C CA . PHE G 5  589  ? 215.053 191.078 255.900 1.00 328.03 ? 589  PHE H CA 1 
ATOM 2797 C CA . PHE G 5  590  ? 218.458 189.881 254.687 1.00 323.73 ? 590  PHE H CA 1 
ATOM 2798 C CA . GLN G 5  591  ? 219.035 192.814 252.282 1.00 160.30 ? 591  GLN H CA 1 
ATOM 2799 C CA . ARG G 5  592  ? 217.983 194.916 255.281 1.00 246.42 ? 592  ARG H CA 1 
ATOM 2800 C CA . ALA G 5  593  ? 220.811 193.469 257.430 1.00 175.21 ? 593  ALA H CA 1 
ATOM 2801 C CA . ILE G 5  594  ? 223.251 194.559 254.647 1.00 137.36 ? 594  ILE H CA 1 
ATOM 2802 C CA . GLN G 5  595  ? 221.336 197.854 254.294 1.00 128.74 ? 595  GLN H CA 1 
ATOM 2803 C CA . VAL G 5  596  ? 221.981 198.411 257.997 1.00 141.47 ? 596  VAL H CA 1 
ATOM 2804 C CA . ASP G 5  597  ? 225.717 197.518 257.893 1.00 156.01 ? 597  ASP H CA 1 
ATOM 2805 C CA . PRO G 5  598  ? 227.082 197.214 254.342 1.00 181.16 ? 598  PRO H CA 1 
ATOM 2806 C CA . ASN G 5  599  ? 230.496 196.423 255.813 1.00 157.16 ? 599  ASN H CA 1 
ATOM 2807 C CA . TYR G 5  600  ? 229.500 193.164 257.535 1.00 197.93 ? 600  TYR H CA 1 
ATOM 2808 C CA . ALA G 5  601  ? 230.323 189.917 255.793 1.00 185.19 ? 601  ALA H CA 1 
ATOM 2809 C CA . TYR G 5  602  ? 227.969 187.182 256.915 1.00 371.27 ? 602  TYR H CA 1 
ATOM 2810 C CA . ALA G 5  603  ? 224.898 189.178 255.993 1.00 290.11 ? 603  ALA H CA 1 
ATOM 2811 C CA . TYR G 5  604  ? 225.904 188.946 252.347 1.00 139.03 ? 604  TYR H CA 1 
ATOM 2812 C CA . THR G 5  605  ? 226.622 185.258 252.485 1.00 128.53 ? 605  THR H CA 1 
ATOM 2813 C CA . LEU G 5  606  ? 223.206 184.477 253.853 1.00 253.87 ? 606  LEU H CA 1 
ATOM 2814 C CA . LEU G 5  607  ? 221.554 186.667 251.259 1.00 246.56 ? 607  LEU H CA 1 
ATOM 2815 C CA . GLY G 5  608  ? 223.630 184.639 248.790 1.00 189.98 ? 608  GLY H CA 1 
ATOM 2816 C CA . HIS G 5  609  ? 222.269 181.260 249.971 1.00 192.17 ? 609  HIS H CA 1 
ATOM 2817 C CA . GLU G 5  610  ? 218.697 182.583 249.759 1.00 371.81 ? 610  GLU H CA 1 
ATOM 2818 C CA . PHE G 5  611  ? 219.139 183.410 246.071 1.00 435.63 ? 611  PHE H CA 1 
ATOM 2819 C CA . VAL G 5  612  ? 220.663 179.936 245.491 1.00 366.46 ? 612  VAL H CA 1 
ATOM 2820 C CA . LEU G 5  613  ? 217.472 178.416 246.993 1.00 336.84 ? 613  LEU H CA 1 
ATOM 2821 C CA . THR G 5  614  ? 215.098 180.716 245.045 1.00 445.42 ? 614  THR H CA 1 
ATOM 2822 C CA . GLU G 5  615  ? 217.096 179.580 241.953 1.00 452.97 ? 615  GLU H CA 1 
ATOM 2823 C CA . GLU G 5  616  ? 218.226 183.154 241.159 1.00 469.99 ? 616  GLU H CA 1 
ATOM 2824 C CA . LEU G 5  617  ? 221.789 181.785 240.645 1.00 456.19 ? 617  LEU H CA 1 
ATOM 2825 C CA . ASP G 5  618  ? 223.144 184.789 238.670 1.00 500.00 ? 618  ASP H CA 1 
ATOM 2826 C CA . LYS G 5  619  ? 221.799 187.345 241.206 1.00 462.21 ? 619  LYS H CA 1 
ATOM 2827 C CA . ALA G 5  620  ? 223.296 185.127 243.968 1.00 385.83 ? 620  ALA H CA 1 
ATOM 2828 C CA . LEU G 5  621  ? 226.764 185.147 242.352 1.00 405.96 ? 621  LEU H CA 1 
ATOM 2829 C CA . ALA G 5  622  ? 227.031 188.915 242.883 1.00 433.09 ? 622  ALA H CA 1 
ATOM 2830 C CA . CYS G 5  623  ? 226.069 188.665 246.604 1.00 305.33 ? 623  CYS H CA 1 
ATOM 2831 C CA . PHE G 5  624  ? 228.723 186.088 247.103 1.00 152.96 ? 624  PHE H CA 1 
ATOM 2832 C CA . ARG G 5  625  ? 231.420 188.128 245.403 1.00 205.53 ? 625  ARG H CA 1 
ATOM 2833 C CA . ASN G 5  626  ? 230.322 190.992 247.691 1.00 158.59 ? 626  ASN H CA 1 
ATOM 2834 C CA . ALA G 5  627  ? 230.738 188.717 250.644 1.00 178.12 ? 627  ALA H CA 1 
ATOM 2835 C CA . ILE G 5  628  ? 234.302 188.110 249.511 1.00 145.99 ? 628  ILE H CA 1 
ATOM 2836 C CA . ARG G 5  629  ? 234.762 191.900 249.188 1.00 176.74 ? 629  ARG H CA 1 
ATOM 2837 C CA . VAL G 5  630  ? 233.805 192.482 252.845 1.00 141.42 ? 630  VAL H CA 1 
ATOM 2838 C CA . ASN G 5  631  ? 235.856 189.593 254.122 1.00 166.21 ? 631  ASN H CA 1 
ATOM 2839 C CA . PRO G 5  632  ? 238.254 188.034 251.544 1.00 238.23 ? 632  PRO H CA 1 
ATOM 2840 C CA . ARG G 5  633  ? 238.820 185.088 253.877 1.00 170.72 ? 633  ARG H CA 1 
ATOM 2841 C CA . HIS G 5  634  ? 235.180 184.513 254.870 1.00 174.46 ? 634  HIS H CA 1 
ATOM 2842 C CA . TYR G 5  635  ? 234.893 181.074 253.323 1.00 131.88 ? 635  TYR H CA 1 
ATOM 2843 C CA . ASN G 5  636  ? 231.143 180.608 253.553 1.00 188.05 ? 636  ASN H CA 1 
ATOM 2844 C CA . ALA G 5  637  ? 230.810 182.853 250.534 1.00 195.89 ? 637  ALA H CA 1 
ATOM 2845 C CA . TRP G 5  638  ? 233.693 181.057 248.811 1.00 157.84 ? 638  TRP H CA 1 
ATOM 2846 C CA . TYR G 5  639  ? 231.752 177.836 249.284 1.00 128.64 ? 639  TYR H CA 1 
ATOM 2847 C CA . GLY G 5  640  ? 228.659 179.588 247.970 1.00 183.42 ? 640  GLY H CA 1 
ATOM 2848 C CA . LEU G 5  641  ? 230.415 180.607 244.764 1.00 152.50 ? 641  LEU H CA 1 
ATOM 2849 C CA . GLY G 5  642  ? 231.357 176.923 244.247 1.00 209.41 ? 642  GLY H CA 1 
ATOM 2850 C CA . MET G 5  643  ? 227.859 175.600 244.773 1.00 183.28 ? 643  MET H CA 1 
ATOM 2851 C CA . ILE G 5  644  ? 226.555 178.131 242.226 1.00 246.81 ? 644  ILE H CA 1 
ATOM 2852 C CA . TYR G 5  645  ? 229.180 177.052 239.685 1.00 282.38 ? 645  TYR H CA 1 
ATOM 2853 C CA . TYR G 5  646  ? 228.409 173.384 240.525 1.00 284.88 ? 646  TYR H CA 1 
ATOM 2854 C CA . LYS G 5  647  ? 224.691 173.878 239.706 1.00 398.30 ? 647  LYS H CA 1 
ATOM 2855 C CA . GLN G 5  648  ? 225.741 175.600 236.463 1.00 383.34 ? 648  GLN H CA 1 
ATOM 2856 C CA . GLU G 5  649  ? 227.844 172.389 235.868 1.00 397.91 ? 649  GLU H CA 1 
ATOM 2857 C CA . LYS G 5  650  ? 231.121 174.277 235.265 1.00 416.09 ? 650  LYS H CA 1 
ATOM 2858 C CA . PHE G 5  651  ? 232.863 171.580 237.344 1.00 271.32 ? 651  PHE H CA 1 
ATOM 2859 C CA . SER G 5  652  ? 236.592 172.469 237.155 1.00 231.14 ? 652  SER H CA 1 
ATOM 2860 C CA . LEU G 5  653  ? 235.750 175.988 238.542 1.00 279.15 ? 653  LEU H CA 1 
ATOM 2861 C CA . ALA G 5  654  ? 233.461 174.622 241.289 1.00 154.54 ? 654  ALA H CA 1 
ATOM 2862 C CA . GLU G 5  655  ? 236.325 172.409 242.483 1.00 196.11 ? 655  GLU H CA 1 
ATOM 2863 C CA . MET G 5  656  ? 238.751 175.365 242.755 1.00 177.46 ? 656  MET H CA 1 
ATOM 2864 C CA . HIS G 5  657  ? 236.260 177.690 244.517 1.00 200.59 ? 657  HIS H CA 1 
ATOM 2865 C CA . PHE G 5  658  ? 235.691 174.988 247.169 1.00 140.55 ? 658  PHE H CA 1 
ATOM 2866 C CA . GLN G 5  659  ? 239.454 174.391 247.211 1.00 173.82 ? 659  GLN H CA 1 
ATOM 2867 C CA . LYS G 5  660  ? 239.939 178.127 248.014 1.00 161.91 ? 660  LYS H CA 1 
ATOM 2868 C CA . ALA G 5  661  ? 237.357 177.772 250.850 1.00 180.00 ? 661  ALA H CA 1 
ATOM 2869 C CA . LEU G 5  662  ? 239.256 174.708 252.053 1.00 161.04 ? 662  LEU H CA 1 
ATOM 2870 C CA . ASP G 5  663  ? 242.470 176.783 251.961 1.00 227.16 ? 663  ASP H CA 1 
ATOM 2871 C CA . ILE G 5  664  ? 240.790 179.086 254.506 1.00 224.22 ? 664  ILE H CA 1 
ATOM 2872 C CA . ASN G 5  665  ? 239.116 176.357 256.605 1.00 228.34 ? 665  ASN H CA 1 
ATOM 2873 C CA . PRO G 5  666  ? 241.079 173.125 256.137 1.00 212.19 ? 666  PRO H CA 1 
ATOM 2874 C CA . GLN G 5  667  ? 239.191 170.720 258.440 1.00 241.96 ? 667  GLN H CA 1 
ATOM 2875 C CA . SER G 5  668  ? 235.518 171.345 257.407 1.00 209.21 ? 668  SER H CA 1 
ATOM 2876 C CA . SER G 5  669  ? 234.121 167.867 256.886 1.00 183.90 ? 669  SER H CA 1 
ATOM 2877 C CA . VAL G 5  670  ? 231.147 169.139 254.945 1.00 200.72 ? 670  VAL H CA 1 
ATOM 2878 C CA . LEU G 5  671  ? 233.316 171.162 252.534 1.00 188.07 ? 671  LEU H CA 1 
ATOM 2879 C CA . LEU G 5  672  ? 235.487 168.103 251.828 1.00 160.60 ? 672  LEU H CA 1 
ATOM 2880 C CA . CYS G 5  673  ? 232.421 165.956 250.985 1.00 206.24 ? 673  CYS H CA 1 
ATOM 2881 C CA . HIS G 5  674  ? 231.261 168.709 248.652 1.00 241.02 ? 674  HIS H CA 1 
ATOM 2882 C CA . ILE G 5  675  ? 234.677 168.947 246.953 1.00 196.70 ? 675  ILE H CA 1 
ATOM 2883 C CA . GLY G 5  676  ? 234.680 165.141 246.734 1.00 140.93 ? 676  GLY H CA 1 
ATOM 2884 C CA . VAL G 5  677  ? 231.382 164.988 244.945 1.00 158.27 ? 677  VAL H CA 1 
ATOM 2885 C CA . VAL G 5  678  ? 232.694 167.592 242.440 1.00 214.54 ? 678  VAL H CA 1 
ATOM 2886 C CA . GLN G 5  679  ? 235.808 165.535 241.723 1.00 180.86 ? 679  GLN H CA 1 
ATOM 2887 C CA . HIS G 5  680  ? 233.562 162.502 241.178 1.00 188.27 ? 680  HIS H CA 1 
ATOM 2888 C CA . ALA G 5  681  ? 231.461 164.545 238.713 1.00 209.84 ? 681  ALA H CA 1 
ATOM 2889 C CA . LEU G 5  682  ? 234.551 165.528 236.707 1.00 226.37 ? 682  LEU H CA 1 
ATOM 2890 C CA . LYS G 5  683  ? 235.413 161.747 236.535 1.00 243.63 ? 683  LYS H CA 1 
ATOM 2891 C CA . LYS G 5  684  ? 238.519 162.287 238.719 1.00 260.48 ? 684  LYS H CA 1 
ATOM 2892 C CA . SER G 5  685  ? 236.691 159.656 240.814 1.00 256.88 ? 685  SER H CA 1 
ATOM 2893 C CA . GLU G 5  686  ? 239.937 158.042 242.032 1.00 267.90 ? 686  GLU H CA 1 
ATOM 2894 C CA . LYS G 5  687  ? 241.012 161.386 243.585 1.00 211.21 ? 687  LYS H CA 1 
ATOM 2895 C CA . ALA G 5  688  ? 237.433 161.829 244.882 1.00 203.39 ? 688  ALA H CA 1 
ATOM 2896 C CA . LEU G 5  689  ? 237.534 158.709 247.093 1.00 194.27 ? 689  LEU H CA 1 
ATOM 2897 C CA . ASP G 5  690  ? 240.987 159.770 248.418 1.00 275.56 ? 690  ASP H CA 1 
ATOM 2898 C CA . THR G 5  691  ? 239.511 163.135 249.514 1.00 245.25 ? 691  THR H CA 1 
ATOM 2899 C CA . LEU G 5  692  ? 236.349 161.452 250.880 1.00 182.36 ? 692  LEU H CA 1 
ATOM 2900 C CA . ASN G 5  693  ? 238.363 158.903 252.896 1.00 204.17 ? 693  ASN H CA 1 
ATOM 2901 C CA . LYS G 5  694  ? 240.182 161.858 254.511 1.00 233.17 ? 694  LYS H CA 1 
ATOM 2902 C CA . ALA G 5  695  ? 236.864 163.498 255.494 1.00 237.80 ? 695  ALA H CA 1 
ATOM 2903 C CA . ILE G 5  696  ? 235.823 160.388 257.497 1.00 208.31 ? 696  ILE H CA 1 
ATOM 2904 C CA . VAL G 5  697  ? 239.240 160.463 259.257 1.00 233.83 ? 697  VAL H CA 1 
ATOM 2905 C CA . ILE G 5  698  ? 238.971 164.158 260.344 1.00 283.34 ? 698  ILE H CA 1 
ATOM 2906 C CA . ASP G 5  699  ? 235.364 163.887 261.662 1.00 303.06 ? 699  ASP H CA 1 
ATOM 2907 C CA . PRO G 5  700  ? 233.864 160.540 262.786 1.00 258.51 ? 700  PRO H CA 1 
ATOM 2908 C CA . LYS G 5  701  ? 230.203 161.584 263.124 1.00 256.96 ? 701  LYS H CA 1 
ATOM 2909 C CA . ASN G 5  702  ? 229.426 162.583 259.534 1.00 211.43 ? 702  ASN H CA 1 
ATOM 2910 C CA . PRO G 5  703  ? 226.369 160.989 257.895 1.00 213.22 ? 703  PRO H CA 1 
ATOM 2911 C CA . LEU G 5  704  ? 226.750 162.911 254.617 1.00 212.30 ? 704  LEU H CA 1 
ATOM 2912 C CA . CYS G 5  705  ? 230.446 161.999 254.237 1.00 208.94 ? 705  CYS H CA 1 
ATOM 2913 C CA . LYS G 5  706  ? 230.102 158.229 254.708 1.00 190.91 ? 706  LYS H CA 1 
ATOM 2914 C CA . PHE G 5  707  ? 227.037 158.151 252.448 1.00 184.80 ? 707  PHE H CA 1 
ATOM 2915 C CA . HIS G 5  708  ? 228.864 159.955 249.632 1.00 225.52 ? 708  HIS H CA 1 
ATOM 2916 C CA . ARG G 5  709  ? 231.724 157.478 249.756 1.00 210.17 ? 709  ARG H CA 1 
ATOM 2917 C CA . ALA G 5  710  ? 229.194 154.669 249.199 1.00 184.30 ? 710  ALA H CA 1 
ATOM 2918 C CA . SER G 5  711  ? 227.574 156.637 246.362 1.00 208.86 ? 711  SER H CA 1 
ATOM 2919 C CA . VAL G 5  712  ? 230.852 157.120 244.491 1.00 181.40 ? 712  VAL H CA 1 
ATOM 2920 C CA . LEU G 5  713  ? 231.741 153.413 244.976 1.00 259.64 ? 713  LEU H CA 1 
ATOM 2921 C CA . PHE G 5  714  ? 228.295 152.439 243.548 1.00 233.12 ? 714  PHE H CA 1 
ATOM 2922 C CA . ALA G 5  715  ? 229.266 154.219 240.247 1.00 176.01 ? 715  ALA H CA 1 
ATOM 2923 C CA . ASN G 5  716  ? 232.650 152.380 240.267 1.00 228.61 ? 716  ASN H CA 1 
ATOM 2924 C CA . GLU G 5  717  ? 230.619 149.109 240.426 1.00 217.82 ? 717  GLU H CA 1 
ATOM 2925 C CA . LYS G 5  718  ? 232.481 147.730 243.497 1.00 373.64 ? 718  LYS H CA 1 
ATOM 2926 C CA . TYR G 5  719  ? 229.255 146.565 245.127 1.00 380.86 ? 719  TYR H CA 1 
ATOM 2927 C CA . LYS G 5  720  ? 230.833 144.603 247.969 1.00 231.24 ? 720  LYS H CA 1 
ATOM 2928 C CA . SER G 5  721  ? 232.850 147.716 249.049 1.00 209.05 ? 721  SER H CA 1 
ATOM 2929 C CA . ALA G 5  722  ? 229.702 149.888 248.785 1.00 359.69 ? 722  ALA H CA 1 
ATOM 2930 C CA . LEU G 5  723  ? 227.456 147.642 250.929 1.00 500.00 ? 723  LEU H CA 1 
ATOM 2931 C CA . GLN G 5  724  ? 230.192 147.434 253.599 1.00 473.88 ? 724  GLN H CA 1 
ATOM 2932 C CA . GLU G 5  725  ? 230.107 151.258 253.933 1.00 345.14 ? 725  GLU H CA 1 
ATOM 2933 C CA . LEU G 5  726  ? 226.280 151.717 253.814 1.00 447.91 ? 726  LEU H CA 1 
ATOM 2934 C CA . GLU G 5  727  ? 225.842 149.274 256.728 1.00 465.09 ? 727  GLU H CA 1 
ATOM 2935 C CA . GLU G 5  728  ? 228.249 151.438 258.846 1.00 369.34 ? 728  GLU H CA 1 
ATOM 2936 C CA . LEU G 5  729  ? 226.191 154.478 257.807 1.00 173.05 ? 729  LEU H CA 1 
ATOM 2937 C CA . LYS G 5  730  ? 222.996 152.635 258.896 1.00 331.54 ? 730  LYS H CA 1 
ATOM 2938 C CA . GLN G 5  731  ? 224.463 152.290 262.425 1.00 342.79 ? 731  GLN H CA 1 
ATOM 2939 C CA . ILE G 5  732  ? 225.315 156.051 262.308 1.00 192.09 ? 732  ILE H CA 1 
ATOM 2940 C CA . VAL G 5  733  ? 221.903 157.153 260.786 1.00 336.49 ? 733  VAL H CA 1 
ATOM 2941 C CA . PRO G 5  734  ? 219.153 154.488 261.333 1.00 305.34 ? 734  PRO H CA 1 
ATOM 2942 C CA . LYS G 5  735  ? 216.098 156.399 260.087 1.00 176.63 ? 735  LYS H CA 1 
ATOM 2943 C CA . GLU G 5  736  ? 217.584 158.130 256.992 1.00 271.60 ? 736  GLU H CA 1 
ATOM 2944 C CA . SER G 5  737  ? 215.580 157.446 253.843 1.00 392.33 ? 737  SER H CA 1 
ATOM 2945 C CA . LEU G 5  738  ? 218.365 157.828 251.293 1.00 399.09 ? 738  LEU H CA 1 
ATOM 2946 C CA . VAL G 5  739  ? 220.565 155.218 252.977 1.00 429.62 ? 739  VAL H CA 1 
ATOM 2947 C CA . TYR G 5  740  ? 217.801 152.642 252.596 1.00 453.89 ? 740  TYR H CA 1 
ATOM 2948 C CA . PHE G 5  741  ? 216.956 153.682 249.009 1.00 368.02 ? 741  PHE H CA 1 
ATOM 2949 C CA . LEU G 5  742  ? 220.636 153.707 248.047 1.00 284.10 ? 742  LEU H CA 1 
ATOM 2950 C CA . ILE G 5  743  ? 221.129 150.203 249.476 1.00 473.67 ? 743  ILE H CA 1 
ATOM 2951 C CA . GLY G 5  744  ? 218.135 148.991 247.359 1.00 500.00 ? 744  GLY H CA 1 
ATOM 2952 C CA . LYS G 5  745  ? 219.830 150.291 244.192 1.00 445.17 ? 745  LYS H CA 1 
ATOM 2953 C CA . VAL G 5  746  ? 223.026 148.312 245.063 1.00 453.69 ? 746  VAL H CA 1 
ATOM 2954 C CA . TYR G 5  747  ? 220.974 145.083 245.419 1.00 500.00 ? 747  TYR H CA 1 
ATOM 2955 C CA . LYS G 5  748  ? 219.265 145.555 242.005 1.00 500.00 ? 748  LYS H CA 1 
ATOM 2956 C CA . LYS G 5  749  ? 222.779 145.295 240.436 1.00 500.00 ? 749  LYS H CA 1 
ATOM 2957 C CA . LEU G 5  750  ? 223.521 142.182 242.571 1.00 462.02 ? 750  LEU H CA 1 
ATOM 2958 C CA . GLY G 5  751  ? 220.122 140.852 241.418 1.00 436.35 ? 751  GLY H CA 1 
ATOM 2959 C CA . GLN G 5  752  ? 218.869 139.743 244.840 1.00 327.90 ? 752  GLN H CA 1 
ATOM 2960 C CA . THR G 5  753  ? 215.370 141.065 244.026 1.00 297.27 ? 753  THR H CA 1 
ATOM 2961 C CA . HIS G 5  754  ? 213.808 140.078 247.358 1.00 262.64 ? 754  HIS H CA 1 
ATOM 2962 C CA . LEU G 5  755  ? 216.407 142.124 249.289 1.00 338.26 ? 755  LEU H CA 1 
ATOM 2963 C CA . ALA G 5  756  ? 216.219 144.996 246.748 1.00 445.09 ? 756  ALA H CA 1 
ATOM 2964 C CA . LEU G 5  757  ? 212.429 145.320 247.233 1.00 500.00 ? 757  LEU H CA 1 
ATOM 2965 C CA . MET G 5  758  ? 212.686 145.172 251.059 1.00 495.00 ? 758  MET H CA 1 
ATOM 2966 C CA . ASN G 5  759  ? 215.117 148.125 250.946 1.00 490.03 ? 759  ASN H CA 1 
ATOM 2967 C CA . PHE G 5  760  ? 213.047 150.178 248.446 1.00 500.00 ? 760  PHE H CA 1 
ATOM 2968 C CA . SER G 5  761  ? 210.009 149.702 250.734 1.00 500.00 ? 761  SER H CA 1 
ATOM 2969 C CA . TRP G 5  762  ? 211.972 150.944 253.813 1.00 500.00 ? 762  TRP H CA 1 
ATOM 2970 C CA . ALA G 5  763  ? 212.733 154.242 252.021 1.00 500.00 ? 763  ALA H CA 1 
ATOM 2971 C CA . MET G 5  764  ? 208.972 154.607 251.323 1.00 500.00 ? 764  MET H CA 1 
ATOM 2972 C CA . ASP G 5  765  ? 208.519 153.586 254.990 1.00 500.00 ? 765  ASP H CA 1 
ATOM 2973 C CA . LEU G 5  766  ? 210.464 156.604 256.222 1.00 500.00 ? 766  LEU H CA 1 
ATOM 2974 C CA . ASP G 5  767  ? 209.075 159.250 253.818 1.00 500.00 ? 767  ASP H CA 1 
ATOM 2975 C CA . PRO H 7  9    ? 194.799 120.780 146.839 1.00 447.02 ? 9    PRO I CA 1 
ATOM 2976 C CA . SER H 7  10   ? 197.084 123.758 146.386 1.00 369.80 ? 10   SER I CA 1 
ATOM 2977 C CA . PHE H 7  11   ? 195.181 126.893 147.382 1.00 347.70 ? 11   PHE I CA 1 
ATOM 2978 C CA . ARG H 7  12   ? 193.104 128.060 150.436 1.00 286.98 ? 12   ARG I CA 1 
ATOM 2979 C CA . VAL H 7  13   ? 189.529 129.467 150.038 1.00 332.10 ? 13   VAL I CA 1 
ATOM 2980 C CA . VAL H 7  14   ? 189.112 132.342 152.511 1.00 431.37 ? 14   VAL I CA 1 
ATOM 2981 C CA . GLY H 7  15   ? 186.012 134.019 151.017 1.00 485.31 ? 15   GLY I CA 1 
ATOM 2982 C CA . GLU H 7  16   ? 183.101 132.491 149.082 1.00 500.00 ? 16   GLU I CA 1 
ATOM 2983 C CA . LYS H 7  17   ? 180.274 135.042 149.598 1.00 500.00 ? 17   LYS I CA 1 
ATOM 2984 C CA . GLN H 7  18   ? 177.648 135.575 146.862 1.00 500.00 ? 18   GLN I CA 1 
ATOM 2985 C CA . LEU H 7  19   ? 176.677 139.004 145.476 1.00 500.00 ? 19   LEU I CA 1 
ATOM 2986 C CA . PRO H 7  20   ? 172.970 139.974 145.089 1.00 500.00 ? 20   PRO I CA 1 
ATOM 2987 C CA . GLN H 7  21   ? 173.687 142.089 141.988 1.00 500.00 ? 21   GLN I CA 1 
ATOM 2988 C CA . GLU H 7  22   ? 175.694 140.854 138.998 1.00 500.00 ? 22   GLU I CA 1 
ATOM 2989 C CA . ILE H 7  23   ? 179.341 142.045 139.194 1.00 500.00 ? 23   ILE I CA 1 
ATOM 2990 C CA . ILE H 7  24   ? 180.039 143.966 135.956 1.00 500.00 ? 24   ILE I CA 1 
ATOM 2991 C CA . PHE H 7  25   ? 183.739 144.611 136.779 1.00 500.00 ? 25   PHE I CA 1 
ATOM 2992 C CA . LEU H 7  26   ? 186.115 144.192 139.706 1.00 500.00 ? 26   LEU I CA 1 
ATOM 2993 C CA . VAL H 7  27   ? 189.793 144.596 140.517 1.00 500.00 ? 27   VAL I CA 1 
ATOM 2994 C CA . TRP H 7  28   ? 192.333 143.931 143.161 1.00 500.00 ? 28   TRP I CA 1 
ATOM 2995 C CA . SER H 7  29   ? 194.052 146.797 144.928 1.00 500.00 ? 29   SER I CA 1 
ATOM 2996 C CA . PRO H 7  30   ? 197.715 147.086 143.844 1.00 500.00 ? 30   PRO I CA 1 
ATOM 2997 C CA . LYS H 7  31   ? 199.207 146.803 147.348 1.00 500.00 ? 31   LYS I CA 1 
ATOM 2998 C CA . ARG H 7  32   ? 196.321 145.749 149.593 1.00 500.00 ? 32   ARG I CA 1 
ATOM 2999 C CA . ASP H 7  33   ? 193.801 142.982 150.320 1.00 500.00 ? 33   ASP I CA 1 
ATOM 3000 C CA . LEU H 7  34   ? 190.738 145.106 149.734 1.00 500.00 ? 34   LEU I CA 1 
ATOM 3001 C CA . ILE H 7  35   ? 189.034 144.536 146.383 1.00 500.00 ? 35   ILE I CA 1 
ATOM 3002 C CA . ALA H 7  36   ? 186.768 146.859 144.372 1.00 500.00 ? 36   ALA I CA 1 
ATOM 3003 C CA . LEU H 7  37   ? 183.870 145.864 142.114 1.00 500.00 ? 37   LEU I CA 1 
ATOM 3004 C CA . ALA H 7  38   ? 181.152 147.578 140.232 1.00 500.00 ? 38   ALA I CA 1 
ATOM 3005 C CA . ASN H 7  39   ? 177.812 145.911 139.851 1.00 500.00 ? 39   ASN I CA 1 
ATOM 3006 C CA . THR H 7  40   ? 174.908 146.440 137.456 1.00 500.00 ? 40   THR I CA 1 
ATOM 3007 C CA . ALA H 7  41   ? 173.177 148.750 139.886 1.00 500.00 ? 41   ALA I CA 1 
ATOM 3008 C CA . GLY H 7  42   ? 176.045 151.058 139.022 1.00 500.00 ? 42   GLY I CA 1 
ATOM 3009 C CA . GLU H 7  43   ? 177.329 151.030 142.606 1.00 500.00 ? 43   GLU I CA 1 
ATOM 3010 C CA . VAL H 7  44   ? 180.979 150.559 143.509 1.00 500.00 ? 44   VAL I CA 1 
ATOM 3011 C CA . LEU H 7  45   ? 181.619 148.411 146.579 1.00 500.00 ? 45   LEU I CA 1 
ATOM 3012 C CA . LEU H 7  46   ? 184.778 147.670 148.421 1.00 500.00 ? 46   LEU I CA 1 
ATOM 3013 C CA . HIS H 7  47   ? 185.507 144.428 150.266 1.00 500.00 ? 47   HIS I CA 1 
ATOM 3014 C CA . ARG H 7  48   ? 188.191 143.013 152.611 1.00 500.00 ? 48   ARG I CA 1 
ATOM 3015 C CA . LEU H 7  49   ? 189.828 139.655 151.921 1.00 500.00 ? 49   LEU I CA 1 
ATOM 3016 C CA . ALA H 7  50   ? 188.901 138.074 155.266 1.00 500.00 ? 50   ALA I CA 1 
ATOM 3017 C CA . SER H 7  51   ? 185.471 136.415 154.782 1.00 500.00 ? 51   SER I CA 1 
ATOM 3018 C CA . PHE H 7  52   ? 184.959 138.755 151.757 1.00 500.00 ? 52   PHE I CA 1 
ATOM 3019 C CA . HIS H 7  53   ? 183.473 141.193 154.299 1.00 500.00 ? 53   HIS I CA 1 
ATOM 3020 C CA . ARG H 7  54   ? 182.205 144.454 152.746 1.00 500.00 ? 54   ARG I CA 1 
ATOM 3021 C CA . VAL H 7  55   ? 184.345 147.446 153.684 1.00 500.00 ? 55   VAL I CA 1 
ATOM 3022 C CA . TRP H 7  56   ? 182.227 150.235 152.150 1.00 500.00 ? 56   TRP I CA 1 
ATOM 3023 C CA . SER H 7  57   ? 179.463 150.955 149.741 1.00 500.00 ? 57   SER I CA 1 
ATOM 3024 C CA . PHE H 7  58   ? 179.171 153.723 147.128 1.00 500.00 ? 58   PHE I CA 1 
ATOM 3025 C CA . PRO H 7  59   ? 175.724 154.108 145.533 1.00 500.00 ? 59   PRO I CA 1 
ATOM 3026 C CA . PRO H 7  60   ? 175.108 156.085 142.321 1.00 500.00 ? 60   PRO I CA 1 
ATOM 3027 C CA . ASN H 7  61   ? 173.663 159.568 142.995 1.00 500.00 ? 61   ASN I CA 1 
ATOM 3028 C CA . GLU H 7  62   ? 172.342 162.598 141.097 1.00 500.00 ? 62   GLU I CA 1 
ATOM 3029 C CA . ASN H 7  63   ? 175.835 164.022 140.577 1.00 500.00 ? 63   ASN I CA 1 
ATOM 3030 C CA . THR H 7  64   ? 177.456 160.686 139.796 1.00 500.00 ? 64   THR I CA 1 
ATOM 3031 C CA . GLY H 7  65   ? 176.748 158.861 136.533 1.00 500.00 ? 65   GLY I CA 1 
ATOM 3032 C CA . LYS H 7  66   ? 174.035 156.253 136.573 1.00 500.00 ? 66   LYS I CA 1 
ATOM 3033 C CA . GLU H 7  67   ? 176.229 153.517 135.023 1.00 500.00 ? 67   GLU I CA 1 
ATOM 3034 C CA . VAL H 7  68   ? 179.943 152.766 135.565 1.00 500.00 ? 68   VAL I CA 1 
ATOM 3035 C CA . THR H 7  69   ? 181.934 150.653 133.145 1.00 500.00 ? 69   THR I CA 1 
ATOM 3036 C CA . CYS H 7  70   ? 185.521 150.784 134.506 1.00 500.00 ? 70   CYS I CA 1 
ATOM 3037 C CA . LEU H 7  71   ? 187.499 150.820 137.778 1.00 485.22 ? 71   LEU I CA 1 
ATOM 3038 C CA . ALA H 7  72   ? 191.025 152.043 138.245 1.00 405.05 ? 72   ALA I CA 1 
ATOM 3039 C CA . TRP H 7  73   ? 193.377 151.827 141.215 1.00 360.67 ? 73   TRP I CA 1 
ATOM 3040 C CA . ARG H 7  74   ? 196.319 154.196 141.515 1.00 444.92 ? 74   ARG I CA 1 
ATOM 3041 C CA . PRO H 7  75   ? 199.588 152.244 142.143 1.00 320.82 ? 75   PRO I CA 1 
ATOM 3042 C CA . ASP H 7  76   ? 199.746 153.513 145.736 1.00 422.74 ? 76   ASP I CA 1 
ATOM 3043 C CA . GLY H 7  77   ? 196.134 152.344 146.037 1.00 475.12 ? 77   GLY I CA 1 
ATOM 3044 C CA . LYS H 7  78   ? 195.020 155.417 147.988 1.00 500.00 ? 78   LYS I CA 1 
ATOM 3045 C CA . LEU H 7  79   ? 192.882 156.472 144.979 1.00 500.00 ? 79   LEU I CA 1 
ATOM 3046 C CA . LEU H 7  80   ? 190.453 154.319 143.114 1.00 500.00 ? 80   LEU I CA 1 
ATOM 3047 C CA . ALA H 7  81   ? 189.094 156.231 140.140 1.00 500.00 ? 81   ALA I CA 1 
ATOM 3048 C CA . PHE H 7  82   ? 186.008 154.975 138.203 1.00 500.00 ? 82   PHE I CA 1 
ATOM 3049 C CA . ALA H 7  83   ? 184.335 156.217 135.014 1.00 500.00 ? 83   ALA I CA 1 
ATOM 3050 C CA . LEU H 7  84   ? 180.640 156.943 134.641 1.00 500.00 ? 84   LEU I CA 1 
ATOM 3051 C CA . ALA H 7  85   ? 178.991 155.533 131.545 1.00 500.00 ? 85   ALA I CA 1 
ATOM 3052 C CA . ASP H 7  86   ? 176.205 158.017 130.875 1.00 500.00 ? 86   ASP I CA 1 
ATOM 3053 C CA . THR H 7  87   ? 177.479 161.227 132.390 1.00 500.00 ? 87   THR I CA 1 
ATOM 3054 C CA . LYS H 7  88   ? 181.021 160.177 131.313 1.00 500.00 ? 88   LYS I CA 1 
ATOM 3055 C CA . LYS H 7  89   ? 182.372 162.002 134.356 1.00 500.00 ? 89   LYS I CA 1 
ATOM 3056 C CA . ILE H 7  90   ? 185.395 160.301 135.815 1.00 500.00 ? 90   ILE I CA 1 
ATOM 3057 C CA . VAL H 7  91   ? 185.425 160.049 139.626 1.00 500.00 ? 91   VAL I CA 1 
ATOM 3058 C CA . LEU H 7  92   ? 188.362 159.232 141.940 1.00 500.00 ? 92   LEU I CA 1 
ATOM 3059 C CA . CYS H 7  93   ? 186.983 158.357 145.294 1.00 500.00 ? 93   CYS I CA 1 
ATOM 3060 C CA . ASP H 7  94   ? 189.415 158.267 148.168 1.00 500.00 ? 94   ASP I CA 1 
ATOM 3061 C CA . VAL H 7  95   ? 189.656 154.866 149.776 1.00 500.00 ? 95   VAL I CA 1 
ATOM 3062 C CA . GLU H 7  96   ? 189.234 156.186 153.388 1.00 500.00 ? 96   GLU I CA 1 
ATOM 3063 C CA . LYS H 7  97   ? 185.725 157.526 152.726 1.00 500.00 ? 97   LYS I CA 1 
ATOM 3064 C CA . PRO H 7  98   ? 183.340 156.396 150.018 1.00 500.00 ? 98   PRO I CA 1 
ATOM 3065 C CA . GLU H 7  99   ? 182.739 159.799 148.371 1.00 500.00 ? 99   GLU I CA 1 
ATOM 3066 C CA . SER H 7  100  ? 183.813 161.406 145.092 1.00 500.00 ? 100  SER I CA 1 
ATOM 3067 C CA . LEU H 7  101  ? 186.896 163.359 146.010 1.00 500.00 ? 101  LEU I CA 1 
ATOM 3068 C CA . HIS H 7  102  ? 187.458 164.949 142.569 1.00 500.00 ? 102  HIS I CA 1 
ATOM 3069 C CA . SER H 7  103  ? 185.751 164.564 139.151 1.00 493.34 ? 103  SER I CA 1 
ATOM 3070 C CA . PHE H 7  104  ? 186.739 165.672 135.627 1.00 281.98 ? 104  PHE I CA 1 
ATOM 3071 C CA . SER H 7  105  ? 184.394 165.542 132.601 1.00 215.34 ? 105  SER I CA 1 
ATOM 3072 C CA . VAL H 7  106  ? 185.381 163.653 129.447 1.00 274.94 ? 106  VAL I CA 1 
ATOM 3073 C CA . GLU H 7  107  ? 184.412 163.920 125.851 1.00 455.83 ? 107  GLU I CA 1 
ATOM 3074 C CA . ALA H 7  108  ? 182.756 160.515 125.320 1.00 497.56 ? 108  ALA I CA 1 
ATOM 3075 C CA . PRO H 7  109  ? 182.191 157.243 127.259 1.00 500.00 ? 109  PRO I CA 1 
ATOM 3076 C CA . VAL H 7  110  ? 185.162 155.278 128.562 1.00 500.00 ? 110  VAL I CA 1 
ATOM 3077 C CA . SER H 7  111  ? 185.532 151.526 127.988 1.00 500.00 ? 111  SER I CA 1 
ATOM 3078 C CA . CYS H 7  112  ? 188.965 151.165 129.572 1.00 500.00 ? 112  CYS I CA 1 
ATOM 3079 C CA . MET H 7  113  ? 191.346 152.838 132.106 1.00 367.72 ? 113  MET I CA 1 
ATOM 3080 C CA . HIS H 7  114  ? 194.950 152.009 133.063 1.00 249.12 ? 114  HIS I CA 1 
ATOM 3081 C CA . TRP H 7  115  ? 196.862 153.801 135.809 1.00 229.28 ? 115  TRP I CA 1 
ATOM 3082 C CA . MET H 7  116  ? 200.671 153.785 135.936 1.00 234.94 ? 116  MET I CA 1 
ATOM 3083 C CA . GLU H 7  117  ? 203.528 155.256 137.797 1.00 305.65 ? 117  GLU I CA 1 
ATOM 3084 C CA . VAL H 7  118  ? 206.991 156.275 136.474 1.00 309.13 ? 118  VAL I CA 1 
ATOM 3085 C CA . THR H 7  119  ? 210.036 154.422 137.929 1.00 343.25 ? 119  THR I CA 1 
ATOM 3086 C CA . VAL H 7  120  ? 211.413 155.422 141.361 1.00 378.93 ? 120  VAL I CA 1 
ATOM 3087 C CA . GLU H 7  121  ? 214.769 156.047 139.680 1.00 457.34 ? 121  GLU I CA 1 
ATOM 3088 C CA . SER H 7  122  ? 213.053 158.893 137.793 1.00 392.23 ? 122  SER I CA 1 
ATOM 3089 C CA . SER H 7  123  ? 211.372 160.534 140.765 1.00 500.00 ? 123  SER I CA 1 
ATOM 3090 C CA . VAL H 7  124  ? 214.747 162.025 141.733 1.00 457.78 ? 124  VAL I CA 1 
ATOM 3091 C CA . LEU H 7  125  ? 214.671 165.790 141.517 1.00 376.13 ? 125  LEU I CA 1 
ATOM 3092 C CA . THR H 7  126  ? 217.238 168.471 140.581 1.00 438.96 ? 126  THR I CA 1 
ATOM 3093 C CA . SER H 7  127  ? 215.951 171.264 142.789 1.00 500.00 ? 127  SER I CA 1 
ATOM 3094 C CA . PHE H 7  128  ? 213.825 173.798 140.934 1.00 500.00 ? 128  PHE I CA 1 
ATOM 3095 C CA . TYR H 7  129  ? 211.895 174.295 144.178 1.00 497.61 ? 129  TYR I CA 1 
ATOM 3096 C CA . GLU H 7  132  ? 209.968 176.907 147.817 1.00 383.38 ? 132  GLU I CA 1 
ATOM 3097 C CA . ASP H 7  133  ? 206.893 175.155 149.284 1.00 472.98 ? 133  ASP I CA 1 
ATOM 3098 C CA . GLU H 7  134  ? 204.290 176.381 146.799 1.00 377.66 ? 134  GLU I CA 1 
ATOM 3099 C CA . SER H 7  135  ? 206.056 175.379 143.553 1.00 282.79 ? 135  SER I CA 1 
ATOM 3100 C CA . ASN H 7  136  ? 206.332 171.655 144.364 1.00 254.31 ? 136  ASN I CA 1 
ATOM 3101 C CA . LEU H 7  137  ? 202.662 171.439 145.343 1.00 311.97 ? 137  LEU I CA 1 
ATOM 3102 C CA . LEU H 7  138  ? 200.191 170.012 142.852 1.00 295.66 ? 138  LEU I CA 1 
ATOM 3103 C CA . LEU H 7  139  ? 197.082 171.764 144.210 1.00 335.36 ? 139  LEU I CA 1 
ATOM 3104 C CA . PRO H 7  140  ? 196.681 175.237 145.710 1.00 287.86 ? 140  PRO I CA 1 
ATOM 3105 C CA . LYS H 7  141  ? 195.840 175.624 149.389 1.00 440.53 ? 141  LYS I CA 1 
ATOM 3106 C CA . LEU H 7  142  ? 193.432 178.495 149.835 1.00 443.22 ? 142  LEU I CA 1 
ATOM 3107 C CA . PRO H 7  143  ? 190.927 179.589 152.499 1.00 445.90 ? 143  PRO I CA 1 
ATOM 3108 C CA . THR H 7  144  ? 187.858 177.459 152.299 1.00 346.27 ? 144  THR I CA 1 
ATOM 3109 C CA . LEU H 7  145  ? 184.851 178.790 150.426 1.00 270.49 ? 145  LEU I CA 1 
ATOM 3110 C CA . PRO H 7  146  ? 181.643 179.474 152.393 1.00 447.03 ? 146  PRO I CA 1 
ATOM 3111 C CA . LYS H 7  147  ? 179.477 177.640 149.829 1.00 391.96 ? 147  LYS I CA 1 
ATOM 3112 C CA . ASN H 7  148  ? 179.576 173.992 150.906 1.00 435.61 ? 148  ASN I CA 1 
ATOM 3113 C CA . ILE H 7  164  ? 193.809 165.628 150.351 1.00 500.00 ? 164  ILE I CA 1 
ATOM 3114 C CA . ILE H 7  165  ? 196.461 167.551 148.397 1.00 500.00 ? 165  ILE I CA 1 
ATOM 3115 C CA . LYS H 7  166  ? 199.331 165.459 149.822 1.00 500.00 ? 166  LYS I CA 1 
ATOM 3116 C CA . LEU H 7  167  ? 198.032 162.118 148.540 1.00 500.00 ? 167  LEU I CA 1 
ATOM 3117 C CA . LEU H 7  168  ? 197.156 163.512 145.113 1.00 500.00 ? 168  LEU I CA 1 
ATOM 3118 C CA . GLY H 7  169  ? 200.287 165.533 144.878 1.00 500.00 ? 169  GLY I CA 1 
ATOM 3119 C CA . ASP H 7  170  ? 203.038 164.298 147.271 1.00 500.00 ? 170  ASP I CA 1 
ATOM 3120 C CA . VAL H 7  171  ? 203.762 161.284 145.092 1.00 459.84 ? 171  VAL I CA 1 
ATOM 3121 C CA . ARG H 7  172  ? 205.807 160.733 141.898 1.00 288.60 ? 172  ARG I CA 1 
ATOM 3122 C CA . LEU H 7  173  ? 204.316 161.324 138.441 1.00 208.19 ? 173  LEU I CA 1 
ATOM 3123 C CA . ASN H 7  174  ? 201.539 158.949 137.565 1.00 213.14 ? 174  ASN I CA 1 
ATOM 3124 C CA . ILE H 7  175  ? 199.571 158.854 134.313 1.00 211.25 ? 175  ILE I CA 1 
ATOM 3125 C CA . LEU H 7  176  ? 195.984 157.649 134.058 1.00 174.47 ? 176  LEU I CA 1 
ATOM 3126 C CA . VAL H 7  177  ? 195.345 156.402 130.496 1.00 228.43 ? 177  VAL I CA 1 
ATOM 3127 C CA . LEU H 7  178  ? 191.766 156.426 129.212 1.00 392.58 ? 178  LEU I CA 1 
ATOM 3128 C CA . GLY H 7  179  ? 190.176 154.644 126.310 1.00 477.19 ? 179  GLY I CA 1 
ATOM 3129 C CA . GLY H 7  180  ? 186.922 153.927 124.560 1.00 500.00 ? 180  GLY I CA 1 
ATOM 3130 C CA . SER H 7  181  ? 184.990 153.482 121.311 1.00 500.00 ? 181  SER I CA 1 
ATOM 3131 C CA . SER H 7  182  ? 185.085 157.232 120.727 1.00 500.00 ? 182  SER I CA 1 
ATOM 3132 C CA . GLY H 7  183  ? 188.134 157.242 118.427 1.00 475.11 ? 183  GLY I CA 1 
ATOM 3133 C CA . PHE H 7  184  ? 190.882 158.396 120.780 1.00 407.45 ? 184  PHE I CA 1 
ATOM 3134 C CA . ILE H 7  185  ? 193.047 157.845 123.880 1.00 369.82 ? 185  ILE I CA 1 
ATOM 3135 C CA . GLU H 7  186  ? 193.544 160.491 126.561 1.00 200.79 ? 186  GLU I CA 1 
ATOM 3136 C CA . LEU H 7  187  ? 196.226 160.594 129.276 1.00 203.28 ? 187  LEU I CA 1 
ATOM 3137 C CA . TYR H 7  188  ? 195.734 162.340 132.523 1.00 228.17 ? 188  TYR I CA 1 
ATOM 3138 C CA . ALA H 7  189  ? 198.694 163.216 134.766 1.00 197.08 ? 189  ALA I CA 1 
ATOM 3139 C CA . TYR H 7  190  ? 198.008 162.613 138.447 1.00 211.66 ? 190  TYR I CA 1 
ATOM 3140 C CA . GLY H 7  191  ? 194.481 161.718 137.377 1.00 303.99 ? 191  GLY I CA 1 
ATOM 3141 C CA . MET H 7  192  ? 193.801 165.431 137.425 1.00 365.85 ? 192  MET I CA 1 
ATOM 3142 C CA . PHE H 7  193  ? 195.075 166.996 134.223 1.00 214.95 ? 193  PHE I CA 1 
ATOM 3143 C CA . LYS H 7  194  ? 195.172 165.918 130.563 1.00 253.22 ? 194  LYS I CA 1 
ATOM 3144 C CA . ILE H 7  195  ? 198.762 165.677 129.297 1.00 242.83 ? 195  ILE I CA 1 
ATOM 3145 C CA . ALA H 7  196  ? 198.035 163.992 125.936 1.00 288.79 ? 196  ALA I CA 1 
ATOM 3146 C CA . ARG H 7  197  ? 195.420 162.872 123.457 1.00 297.27 ? 197  ARG I CA 1 
ATOM 3147 C CA . VAL H 7  198  ? 196.064 160.389 120.659 1.00 357.80 ? 198  VAL I CA 1 
ATOM 3148 C CA . THR H 7  199  ? 193.835 159.877 117.683 1.00 465.95 ? 199  THR I CA 1 
ATOM 3149 C CA . GLY H 7  200  ? 193.177 157.494 114.836 1.00 500.00 ? 200  GLY I CA 1 
ATOM 3150 C CA . ILE H 7  201  ? 192.210 154.847 117.385 1.00 500.00 ? 201  ILE I CA 1 
ATOM 3151 C CA . ALA H 7  202  ? 189.784 152.687 115.518 1.00 500.00 ? 202  ALA I CA 1 
ATOM 3152 C CA . GLY H 7  203  ? 186.901 150.900 117.199 1.00 500.00 ? 203  GLY I CA 1 
ATOM 3153 C CA . THR H 7  204  ? 186.716 150.097 120.946 1.00 500.00 ? 204  THR I CA 1 
ATOM 3154 C CA . CYS H 7  205  ? 189.794 149.512 123.149 1.00 484.90 ? 205  CYS I CA 1 
ATOM 3155 C CA . LEU H 7  206  ? 189.826 147.101 126.033 1.00 329.50 ? 206  LEU I CA 1 
ATOM 3156 C CA . ALA H 7  207  ? 193.529 147.138 126.891 1.00 329.05 ? 207  ALA I CA 1 
ATOM 3157 C CA . LEU H 7  208  ? 196.042 149.945 127.599 1.00 303.09 ? 208  LEU I CA 1 
ATOM 3158 C CA . CYS H 7  209  ? 199.660 149.410 128.530 1.00 254.80 ? 209  CYS I CA 1 
ATOM 3159 C CA . LEU H 7  210  ? 201.928 152.342 129.260 1.00 243.38 ? 210  LEU I CA 1 
ATOM 3160 C CA . SER H 7  211  ? 205.627 151.454 130.000 1.00 247.06 ? 211  SER I CA 1 
ATOM 3161 C CA . SER H 7  212  ? 207.441 152.236 133.296 1.00 247.28 ? 212  SER I CA 1 
ATOM 3162 C CA . ASP H 7  213  ? 209.958 153.992 131.036 1.00 285.18 ? 213  ASP I CA 1 
ATOM 3163 C CA . LEU H 7  214  ? 207.117 155.696 129.093 1.00 250.99 ? 214  LEU I CA 1 
ATOM 3164 C CA . LYS H 7  215  ? 208.866 154.602 125.870 1.00 231.85 ? 215  LYS I CA 1 
ATOM 3165 C CA . SER H 7  216  ? 205.672 153.006 124.439 1.00 240.85 ? 216  SER I CA 1 
ATOM 3166 C CA . LEU H 7  217  ? 201.947 152.773 124.881 1.00 266.17 ? 217  LEU I CA 1 
ATOM 3167 C CA . SER H 7  218  ? 200.485 149.435 123.645 1.00 263.74 ? 218  SER I CA 1 
ATOM 3168 C CA . VAL H 7  219  ? 196.774 149.251 122.995 1.00 367.64 ? 219  VAL I CA 1 
ATOM 3169 C CA . VAL H 7  220  ? 194.205 146.680 122.020 1.00 374.93 ? 220  VAL I CA 1 
ATOM 3170 C CA . THR H 7  221  ? 191.487 148.018 119.676 1.00 500.00 ? 221  THR I CA 1 
ATOM 3171 C CA . GLU H 7  222  ? 188.490 146.083 118.236 1.00 500.00 ? 222  GLU I CA 1 
ATOM 3172 C CA . VAL H 7  223  ? 186.826 147.209 114.984 1.00 500.00 ? 223  VAL I CA 1 
ATOM 3173 C CA . SER H 7  224  ? 184.725 144.952 112.860 1.00 500.00 ? 224  SER I CA 1 
ATOM 3174 C CA . THR H 7  225  ? 182.016 144.235 110.386 1.00 500.00 ? 225  THR I CA 1 
ATOM 3175 C CA . ASN H 7  226  ? 178.537 143.184 111.477 1.00 500.00 ? 226  ASN I CA 1 
ATOM 3176 C CA . GLY H 7  227  ? 179.186 139.509 110.581 1.00 500.00 ? 227  GLY I CA 1 
ATOM 3177 C CA . ALA H 7  228  ? 182.441 139.148 112.490 1.00 500.00 ? 228  ALA I CA 1 
ATOM 3178 C CA . SER H 7  229  ? 184.574 140.981 115.124 1.00 500.00 ? 229  SER I CA 1 
ATOM 3179 C CA . GLU H 7  230  ? 188.355 141.589 114.610 1.00 500.00 ? 230  GLU I CA 1 
ATOM 3180 C CA . VAL H 7  231  ? 190.809 142.293 117.375 1.00 366.86 ? 231  VAL I CA 1 
ATOM 3181 C CA . SER H 7  232  ? 193.827 144.548 116.907 1.00 401.18 ? 232  SER I CA 1 
ATOM 3182 C CA . TYR H 7  233  ? 197.046 145.345 118.722 1.00 284.51 ? 233  TYR I CA 1 
ATOM 3183 C CA . PHE H 7  234  ? 198.364 148.973 118.605 1.00 267.13 ? 234  PHE I CA 1 
ATOM 3184 C CA . GLN H 7  235  ? 201.827 149.669 120.159 1.00 381.21 ? 235  GLN I CA 1 
ATOM 3185 C CA . LEU H 7  236  ? 202.460 153.423 119.952 1.00 193.00 ? 236  LEU I CA 1 
ATOM 3186 C CA . GLU H 7  237  ? 205.877 155.015 120.344 1.00 265.16 ? 237  GLU I CA 1 
ATOM 3187 C CA . THR H 7  238  ? 206.019 157.866 122.939 1.00 252.89 ? 238  THR I CA 1 
ATOM 3188 C CA . ASN H 7  239  ? 209.517 159.257 122.296 1.00 274.32 ? 239  ASN I CA 1 
ATOM 3189 C CA . LEU H 7  240  ? 208.706 162.772 123.532 1.00 264.80 ? 240  LEU I CA 1 
ATOM 3190 C CA . LEU H 7  241  ? 207.162 161.687 126.824 1.00 249.09 ? 241  LEU I CA 1 
ATOM 3191 C CA . TYR H 7  242  ? 210.362 159.714 127.553 1.00 234.93 ? 242  TYR I CA 1 
ATOM 3192 C CA . SER H 7  243  ? 212.991 162.286 126.538 1.00 214.93 ? 243  SER I CA 1 
ATOM 3193 C CA . PHE H 7  244  ? 211.555 165.617 127.499 1.00 209.56 ? 244  PHE I CA 1 
ATOM 3194 C CA . LEU H 7  245  ? 210.047 163.364 130.134 1.00 191.11 ? 245  LEU I CA 1 
ATOM 3195 C CA . PRO H 7  246  ? 211.204 165.762 132.915 1.00 227.02 ? 246  PRO I CA 1 
ATOM 3196 C CA . GLU H 7  247  ? 209.846 168.638 130.789 1.00 233.29 ? 247  GLU I CA 1 
ATOM 3197 C CA . VAL H 7  248  ? 206.443 166.869 130.528 1.00 194.71 ? 248  VAL I CA 1 
ATOM 3198 C CA . THR H 7  249  ? 206.502 165.987 134.303 1.00 212.36 ? 249  THR I CA 1 
ATOM 3199 C CA . ARG H 7  250  ? 207.138 169.640 135.192 1.00 237.68 ? 250  ARG I CA 1 
ATOM 3200 C CA . MET H 7  251  ? 204.771 171.038 132.567 1.00 173.30 ? 251  MET I CA 1 
ATOM 3201 C CA . ALA H 7  252  ? 201.989 168.676 133.698 1.00 175.71 ? 252  ALA I CA 1 
ATOM 3202 C CA . ARG H 7  253  ? 202.078 169.566 137.382 1.00 182.32 ? 253  ARG I CA 1 
ATOM 3203 C CA . LYS H 7  254  ? 202.075 173.291 136.520 1.00 214.72 ? 254  LYS I CA 1 
ATOM 3204 C CA . PHE H 7  255  ? 199.195 172.977 134.071 1.00 165.68 ? 255  PHE I CA 1 
ATOM 3205 C CA . THR H 7  256  ? 197.150 170.951 136.534 1.00 170.45 ? 256  THR I CA 1 
ATOM 3206 C CA . HIS H 7  257  ? 197.887 173.752 139.002 1.00 199.02 ? 257  HIS I CA 1 
ATOM 3207 C CA . ILE H 7  258  ? 196.632 176.264 136.449 1.00 195.90 ? 258  ILE I CA 1 
ATOM 3208 C CA . SER H 7  259  ? 193.569 174.128 135.575 1.00 157.60 ? 259  SER I CA 1 
ATOM 3209 C CA . ALA H 7  260  ? 192.629 173.541 139.203 1.00 141.14 ? 260  ALA I CA 1 
ATOM 3210 C CA . LEU H 7  261  ? 192.992 177.245 139.932 1.00 160.16 ? 261  LEU I CA 1 
ATOM 3211 C CA . LEU H 7  262  ? 190.464 177.930 137.185 1.00 146.60 ? 262  LEU I CA 1 
ATOM 3212 C CA . GLN H 7  263  ? 187.951 175.598 138.886 1.00 168.58 ? 263  GLN I CA 1 
ATOM 3213 C CA . TYR H 7  264  ? 188.776 177.395 142.151 1.00 152.31 ? 264  TYR I CA 1 
ATOM 3214 C CA . ILE H 7  265  ? 188.507 180.897 140.791 1.00 219.12 ? 265  ILE I CA 1 
ATOM 3215 C CA . ASN H 7  266  ? 185.318 179.636 139.076 1.00 181.28 ? 266  ASN I CA 1 
ATOM 3216 C CA . LEU H 7  267  ? 183.751 178.043 142.149 1.00 206.84 ? 267  LEU I CA 1 
ATOM 3217 C CA . SER H 7  268  ? 184.194 181.324 144.185 1.00 193.96 ? 268  SER I CA 1 
ATOM 3218 C CA . LEU H 7  269  ? 181.944 183.704 142.109 1.00 173.66 ? 269  LEU I CA 1 
ATOM 3219 C CA . THR H 7  270  ? 178.603 181.871 142.271 1.00 219.34 ? 270  THR I CA 1 
ATOM 3220 C CA . CYS H 7  271  ? 178.573 181.986 146.070 1.00 220.43 ? 271  CYS I CA 1 
ATOM 3221 C CA . MET H 7  272  ? 179.440 185.662 146.039 1.00 246.74 ? 272  MET I CA 1 
ATOM 3222 C CA . CYS H 7  273  ? 176.572 186.309 143.612 1.00 242.72 ? 273  CYS I CA 1 
ATOM 3223 C CA . GLU H 7  274  ? 174.053 184.406 145.729 1.00 259.30 ? 274  GLU I CA 1 
ATOM 3224 C CA . ALA H 7  275  ? 174.880 186.479 148.794 1.00 237.13 ? 275  ALA I CA 1 
ATOM 3225 C CA . TRP H 7  276  ? 174.472 189.672 146.806 1.00 255.71 ? 276  TRP I CA 1 
ATOM 3226 C CA . GLU H 7  277  ? 171.112 188.466 145.517 1.00 425.01 ? 277  GLU I CA 1 
ATOM 3227 C CA . GLU H 7  278  ? 169.694 187.806 149.001 1.00 493.68 ? 278  GLU I CA 1 
ATOM 3228 C CA . ILE H 7  279  ? 170.730 191.239 150.164 1.00 408.58 ? 279  ILE I CA 1 
ATOM 3229 C CA . LEU H 7  280  ? 169.136 192.838 147.092 1.00 377.48 ? 280  LEU I CA 1 
ATOM 3230 C CA . MET H 7  281  ? 166.051 190.792 147.876 1.00 500.00 ? 281  MET I CA 1 
ATOM 3231 C CA . GLN H 7  282  ? 165.045 192.198 151.367 1.00 500.00 ? 282  GLN I CA 1 
ATOM 3232 C CA . MET H 7  283  ? 165.211 195.793 149.957 1.00 421.60 ? 283  MET I CA 1 
ATOM 3233 C CA . ASP H 7  284  ? 163.982 194.816 146.442 1.00 450.82 ? 284  ASP I CA 1 
ATOM 3234 C CA . SER H 7  285  ? 160.371 194.210 147.591 1.00 500.00 ? 285  SER I CA 1 
ATOM 3235 C CA . ARG H 7  286  ? 159.909 197.600 149.352 1.00 492.87 ? 286  ARG I CA 1 
ATOM 3236 C CA . LEU H 7  287  ? 160.752 199.741 146.281 1.00 429.75 ? 287  LEU I CA 1 
ATOM 3237 C CA . THR H 7  288  ? 159.457 197.783 143.192 1.00 331.38 ? 288  THR I CA 1 
ATOM 3238 C CA . LYS H 7  289  ? 156.077 197.340 145.087 1.00 466.54 ? 289  LYS I CA 1 
ATOM 3239 C CA . PHE H 7  290  ? 155.590 200.986 146.248 1.00 500.00 ? 290  PHE I CA 1 
ATOM 3240 C CA . VAL H 7  291  ? 155.893 202.865 142.909 1.00 500.00 ? 291  VAL I CA 1 
ATOM 3241 C CA . THR H 7  298  ? 155.489 211.001 143.019 1.00 484.00 ? 298  THR I CA 1 
ATOM 3242 C CA . SER H 7  299  ? 158.553 208.687 142.910 1.00 433.43 ? 299  SER I CA 1 
ATOM 3243 C CA . VAL H 7  300  ? 160.776 207.185 145.695 1.00 259.37 ? 300  VAL I CA 1 
ATOM 3244 C CA . GLN H 7  301  ? 163.747 209.476 144.917 1.00 227.42 ? 301  GLN I CA 1 
ATOM 3245 C CA . ASP H 7  302  ? 161.748 212.619 145.190 1.00 318.66 ? 302  ASP I CA 1 
ATOM 3246 C CA . GLU H 7  303  ? 159.447 211.792 148.162 1.00 342.02 ? 303  GLU I CA 1 
ATOM 3247 C CA . PHE H 7  304  ? 162.412 210.666 150.225 1.00 166.45 ? 304  PHE I CA 1 
ATOM 3248 C CA . MET H 7  305  ? 164.409 213.763 149.205 1.00 192.86 ? 305  MET I CA 1 
ATOM 3249 C CA . HIS H 7  306  ? 161.662 215.924 150.680 1.00 352.72 ? 306  HIS I CA 1 
ATOM 3250 C CA . LEU H 7  307  ? 162.089 213.799 153.873 1.00 331.95 ? 307  LEU I CA 1 
ATOM 3251 C CA . LEU H 7  308  ? 165.877 214.434 153.695 1.00 212.47 ? 308  LEU I CA 1 
ATOM 3252 C CA . LEU H 7  309  ? 165.553 218.251 153.471 1.00 273.69 ? 309  LEU I CA 1 
ATOM 3253 C CA . TRP H 7  310  ? 162.273 218.762 155.438 1.00 399.70 ? 310  TRP I CA 1 
ATOM 3254 C CA . GLY H 7  311  ? 161.109 216.883 158.552 1.00 445.41 ? 311  GLY I CA 1 
ATOM 3255 C CA . LYS H 7  312  ? 157.652 216.968 156.887 1.00 479.16 ? 312  LYS I CA 1 
ATOM 3256 C CA . ALA H 7  313  ? 158.164 213.804 154.725 1.00 493.44 ? 313  ALA I CA 1 
ATOM 3257 C CA . SER H 7  314  ? 154.504 214.101 153.488 1.00 500.00 ? 314  SER I CA 1 
ATOM 3258 C CA . ALA H 7  315  ? 151.631 211.887 154.773 1.00 500.00 ? 315  ALA I CA 1 
ATOM 3259 C CA . GLU H 7  316  ? 151.746 208.891 152.365 1.00 500.00 ? 316  GLU I CA 1 
ATOM 3260 C CA . LEU H 7  317  ? 155.305 207.867 153.346 1.00 500.00 ? 317  LEU I CA 1 
ATOM 3261 C CA . GLN H 7  318  ? 154.586 208.160 157.107 1.00 500.00 ? 318  GLN I CA 1 
ATOM 3262 C CA . THR H 7  319  ? 151.913 205.410 156.971 1.00 500.00 ? 319  THR I CA 1 
ATOM 3263 C CA . LEU H 7  320  ? 153.907 203.371 154.375 1.00 500.00 ? 320  LEU I CA 1 
ATOM 3264 C CA . LEU H 7  321  ? 157.150 203.432 156.401 1.00 500.00 ? 321  LEU I CA 1 
ATOM 3265 C CA . MET H 7  322  ? 156.046 202.813 160.031 1.00 500.00 ? 322  MET I CA 1 
ATOM 3266 C CA . ASN H 7  323  ? 153.365 200.158 159.411 1.00 500.00 ? 323  ASN I CA 1 
ATOM 3267 C CA . GLN H 7  324  ? 155.484 197.857 157.249 1.00 500.00 ? 324  GLN I CA 1 
ATOM 3268 C CA . LEU H 7  325  ? 158.265 197.550 159.818 1.00 500.00 ? 325  LEU I CA 1 
ATOM 3269 C CA . THR H 7  326  ? 159.145 198.472 163.399 1.00 500.00 ? 326  THR I CA 1 
ATOM 3270 C CA . VAL H 7  327  ? 161.918 201.027 163.916 1.00 500.00 ? 327  VAL I CA 1 
ATOM 3271 C CA . LYS H 7  328  ? 164.035 198.227 165.373 1.00 500.00 ? 328  LYS I CA 1 
ATOM 3272 C CA . GLY H 7  329  ? 163.152 196.003 162.441 1.00 500.00 ? 329  GLY I CA 1 
ATOM 3273 C CA . LEU H 7  330  ? 164.386 198.660 160.028 1.00 500.00 ? 330  LEU I CA 1 
ATOM 3274 C CA . LYS H 7  331  ? 167.637 198.959 161.958 1.00 480.00 ? 331  LYS I CA 1 
ATOM 3275 C CA . LYS H 7  332  ? 168.028 195.180 161.829 1.00 363.77 ? 332  LYS I CA 1 
ATOM 3276 C CA . LEU H 7  333  ? 167.431 195.222 158.081 1.00 217.31 ? 333  LEU I CA 1 
ATOM 3277 C CA . GLY H 7  334  ? 170.137 197.843 157.648 1.00 197.43 ? 334  GLY I CA 1 
ATOM 3278 C CA . GLN H 7  335  ? 172.525 195.745 159.701 1.00 219.64 ? 335  GLN I CA 1 
ATOM 3279 C CA . SER H 7  336  ? 171.708 192.711 157.558 1.00 204.31 ? 336  SER I CA 1 
ATOM 3280 C CA . ILE H 7  337  ? 172.380 194.746 154.430 1.00 155.79 ? 337  ILE I CA 1 
ATOM 3281 C CA . GLU H 7  338  ? 175.816 195.742 155.733 1.00 302.89 ? 338  GLU I CA 1 
ATOM 3282 C CA . SER H 7  339  ? 176.455 192.076 156.659 1.00 325.81 ? 339  SER I CA 1 
ATOM 3283 C CA . SER H 7  340  ? 175.787 190.813 153.103 1.00 203.21 ? 340  SER I CA 1 
ATOM 3284 C CA . TYR H 7  341  ? 178.245 193.415 151.851 1.00 194.41 ? 341  TYR I CA 1 
ATOM 3285 C CA . SER H 7  342  ? 180.726 192.349 154.508 1.00 199.35 ? 342  SER I CA 1 
ATOM 3286 C CA . SER H 7  343  ? 180.375 188.744 153.247 1.00 251.27 ? 343  SER I CA 1 
ATOM 3287 C CA . ILE H 7  344  ? 181.102 189.580 149.573 1.00 218.88 ? 344  ILE I CA 1 
ATOM 3288 C CA . GLN H 7  345  ? 183.931 191.942 150.348 1.00 180.36 ? 345  GLN I CA 1 
ATOM 3289 C CA . LYS H 7  346  ? 185.412 189.457 152.884 1.00 222.69 ? 346  LYS I CA 1 
ATOM 3290 C CA . LEU H 7  347  ? 185.302 186.845 150.164 1.00 269.35 ? 347  LEU I CA 1 
ATOM 3291 C CA . VAL H 7  348  ? 186.884 188.979 147.348 1.00 142.06 ? 348  VAL I CA 1 
ATOM 3292 C CA . ILE H 7  349  ? 190.233 189.887 148.860 1.00 166.64 ? 349  ILE I CA 1 
ATOM 3293 C CA . SER H 7  350  ? 190.778 186.721 150.985 1.00 293.30 ? 350  SER I CA 1 
ATOM 3294 C CA . HIS H 7  351  ? 189.968 184.025 148.405 1.00 266.21 ? 351  HIS I CA 1 
ATOM 3295 C CA . LEU H 7  352  ? 189.278 185.248 144.858 1.00 190.50 ? 352  LEU I CA 1 
ATOM 3296 C CA . GLN H 7  353  ? 192.215 187.657 144.837 1.00 158.90 ? 353  GLN I CA 1 
ATOM 3297 C CA . SER H 7  354  ? 194.726 185.131 146.090 1.00 163.93 ? 354  SER I CA 1 
ATOM 3298 C CA . GLY H 7  355  ? 193.396 182.935 143.237 1.00 185.53 ? 355  GLY I CA 1 
ATOM 3299 C CA . SER H 7  356  ? 193.704 185.657 140.621 1.00 163.48 ? 356  SER I CA 1 
ATOM 3300 C CA . GLU H 7  357  ? 197.271 186.449 141.661 1.00 305.85 ? 357  GLU I CA 1 
ATOM 3301 C CA . SER H 7  358  ? 198.633 182.833 141.888 1.00 327.53 ? 358  SER I CA 1 
ATOM 3302 C CA . LEU H 7  359  ? 196.916 181.887 138.569 1.00 193.70 ? 359  LEU I CA 1 
ATOM 3303 C CA . LEU H 7  360  ? 198.811 184.795 136.926 1.00 134.76 ? 360  LEU I CA 1 
ATOM 3304 C CA . TYR H 7  361  ? 201.953 183.818 138.893 1.00 155.39 ? 361  TYR I CA 1 
ATOM 3305 C CA . HIS H 7  362  ? 201.859 180.269 137.569 1.00 170.58 ? 362  HIS I CA 1 
ATOM 3306 C CA . LEU H 7  363  ? 201.015 181.326 134.041 1.00 172.17 ? 363  LEU I CA 1 
ATOM 3307 C CA . SER H 7  364  ? 204.038 183.634 134.143 1.00 139.47 ? 364  SER I CA 1 
ATOM 3308 C CA . GLU H 7  365  ? 206.126 180.684 135.385 1.00 157.19 ? 365  GLU I CA 1 
ATOM 3309 C CA . LEU H 7  366  ? 204.772 178.690 132.509 1.00 156.35 ? 366  LEU I CA 1 
ATOM 3310 C CA . LYS H 7  367  ? 205.926 181.615 130.250 1.00 163.20 ? 367  LYS I CA 1 
ATOM 3311 C CA . GLY H 7  368  ? 209.510 180.535 130.880 1.00 176.94 ? 368  GLY I CA 1 
ATOM 3312 C CA . MET H 7  369  ? 208.639 177.186 129.300 1.00 138.45 ? 369  MET I CA 1 
ATOM 3313 C CA . ALA H 7  370  ? 207.018 179.012 126.366 1.00 176.36 ? 370  ALA I CA 1 
ATOM 3314 C CA . SER H 7  371  ? 210.047 181.278 126.009 1.00 185.74 ? 371  SER I CA 1 
ATOM 3315 C CA . TRP H 7  372  ? 212.537 178.339 125.678 1.00 191.91 ? 372  TRP I CA 1 
ATOM 3316 C CA . LYS H 7  373  ? 211.326 177.488 122.183 1.00 213.14 ? 373  LYS I CA 1 
ATOM 3317 C CA . GLN H 7  374  ? 213.531 174.550 121.021 1.00 219.56 ? 374  GLN I CA 1 
ATOM 3318 C CA . LYS H 7  375  ? 212.672 172.578 124.261 1.00 197.68 ? 375  LYS I CA 1 
ATOM 3319 C CA . TYR H 7  376  ? 208.946 173.299 124.776 1.00 190.94 ? 376  TYR I CA 1 
ATOM 3320 C CA . GLU H 7  377  ? 207.733 173.876 121.182 1.00 217.80 ? 377  GLU I CA 1 
ATOM 3321 C CA . PRO H 7  378  ? 207.844 170.037 120.851 1.00 213.82 ? 378  PRO I CA 1 
ATOM 3322 C CA . LEU H 7  379  ? 205.332 170.063 123.743 1.00 194.45 ? 379  LEU I CA 1 
ATOM 3323 C CA . GLY H 7  380  ? 203.181 172.697 121.939 1.00 251.02 ? 380  GLY I CA 1 
ATOM 3324 C CA . LEU H 7  381  ? 203.587 175.654 124.314 1.00 224.61 ? 381  LEU I CA 1 
ATOM 3325 C CA . ASP H 7  382  ? 202.655 178.829 122.425 1.00 254.68 ? 382  ASP I CA 1 
ATOM 3326 C CA . ALA H 7  383  ? 204.750 181.790 123.528 1.00 247.15 ? 383  ALA I CA 1 
ATOM 3327 C CA . ALA H 7  384  ? 202.166 184.178 122.044 1.00 317.15 ? 384  ALA I CA 1 
ATOM 3328 C CA . GLY H 7  385  ? 199.320 182.111 123.526 1.00 236.85 ? 385  GLY I CA 1 
ATOM 3329 C CA . ILE H 7  386  ? 200.588 182.023 127.130 1.00 179.66 ? 386  ILE I CA 1 
ATOM 3330 C CA . GLU H 7  387  ? 201.510 185.706 127.117 1.00 231.30 ? 387  GLU I CA 1 
ATOM 3331 C CA . GLU H 7  388  ? 197.830 186.202 125.965 1.00 229.67 ? 388  GLU I CA 1 
ATOM 3332 C CA . ALA H 7  389  ? 196.506 183.877 128.704 1.00 174.07 ? 389  ALA I CA 1 
ATOM 3333 C CA . ILE H 7  390  ? 198.460 186.077 131.117 1.00 141.07 ? 390  ILE I CA 1 
ATOM 3334 C CA . THR H 7  391  ? 196.830 189.254 129.791 1.00 166.50 ? 391  THR I CA 1 
ATOM 3335 C CA . ALA H 7  392  ? 193.483 187.696 130.310 1.00 163.09 ? 392  ALA I CA 1 
ATOM 3336 C CA . VAL H 7  393  ? 194.280 186.913 133.987 1.00 155.99 ? 393  VAL I CA 1 
ATOM 3337 C CA . GLY H 7  394  ? 196.085 190.196 134.597 1.00 170.10 ? 394  GLY I CA 1 
ATOM 3338 C CA . SER H 7  395  ? 193.190 192.330 133.417 1.00 155.75 ? 395  SER I CA 1 
ATOM 3339 C CA . PHE H 7  396  ? 190.769 190.097 135.307 1.00 136.70 ? 396  PHE I CA 1 
ATOM 3340 C CA . ILE H 7  397  ? 192.245 190.972 138.713 1.00 153.14 ? 397  ILE I CA 1 
ATOM 3341 C CA . LEU H 7  398  ? 192.204 194.693 137.900 1.00 179.54 ? 398  LEU I CA 1 
ATOM 3342 C CA . LYS H 7  399  ? 188.430 194.263 137.247 1.00 202.60 ? 399  LYS I CA 1 
ATOM 3343 C CA . ALA H 7  400  ? 188.035 192.282 140.507 1.00 146.44 ? 400  ALA I CA 1 
ATOM 3344 C CA . ASN H 7  401  ? 189.980 195.060 142.194 1.00 175.64 ? 401  ASN I CA 1 
ATOM 3345 C CA . GLU H 7  402  ? 187.828 197.736 140.538 1.00 200.13 ? 402  GLU I CA 1 
ATOM 3346 C CA . LEU H 7  403  ? 184.983 195.715 142.092 1.00 151.45 ? 403  LEU I CA 1 
ATOM 3347 C CA . LEU H 7  404  ? 186.559 196.132 145.562 1.00 158.91 ? 404  LEU I CA 1 
ATOM 3348 C CA . GLN H 7  405  ? 186.576 199.945 145.561 1.00 167.67 ? 405  GLN I CA 1 
ATOM 3349 C CA . VAL H 7  406  ? 182.900 199.485 144.438 1.00 222.90 ? 406  VAL I CA 1 
ATOM 3350 C CA . ILE H 7  407  ? 181.992 197.245 147.377 1.00 144.70 ? 407  ILE I CA 1 
ATOM 3351 C CA . ASP H 7  408  ? 183.927 199.701 149.596 1.00 236.84 ? 408  ASP I CA 1 
ATOM 3352 C CA . SER H 7  409  ? 182.275 202.940 148.274 1.00 230.81 ? 409  SER I CA 1 
ATOM 3353 C CA . SER H 7  410  ? 178.958 201.136 148.106 1.00 199.76 ? 410  SER I CA 1 
ATOM 3354 C CA . MET H 7  411  ? 179.285 199.988 151.689 1.00 180.05 ? 411  MET I CA 1 
ATOM 3355 C CA . LYS H 7  412  ? 180.691 203.412 152.659 1.00 174.73 ? 412  LYS I CA 1 
ATOM 3356 C CA . ASN H 7  413  ? 177.867 205.410 150.979 1.00 172.91 ? 413  ASN I CA 1 
ATOM 3357 C CA . PHE H 7  414  ? 175.024 203.328 152.420 1.00 349.97 ? 414  PHE I CA 1 
ATOM 3358 C CA . LYS H 7  415  ? 175.914 203.316 156.128 1.00 366.52 ? 415  LYS I CA 1 
ATOM 3359 C CA . ALA H 7  416  ? 175.341 207.068 156.433 1.00 215.77 ? 416  ALA I CA 1 
ATOM 3360 C CA . PHE H 7  417  ? 171.972 206.682 154.713 1.00 348.34 ? 417  PHE I CA 1 
ATOM 3361 C CA . PHE H 7  418  ? 171.033 203.869 157.088 1.00 481.35 ? 418  PHE I CA 1 
ATOM 3362 C CA . ARG H 7  419  ? 171.985 206.092 160.011 1.00 500.00 ? 419  ARG I CA 1 
ATOM 3363 C CA . TRP H 7  420  ? 169.816 208.906 158.638 1.00 500.00 ? 420  TRP I CA 1 
ATOM 3364 C CA . LEU H 7  421  ? 166.648 206.774 158.408 1.00 500.00 ? 421  LEU I CA 1 
ATOM 3365 C CA . TYR H 7  422  ? 166.957 205.710 162.085 1.00 500.00 ? 422  TYR I CA 1 
ATOM 3366 C CA . VAL H 7  423  ? 167.362 209.367 163.253 1.00 500.00 ? 423  VAL I CA 1 
ATOM 3367 C CA . ALA H 7  424  ? 164.429 210.427 160.992 1.00 500.00 ? 424  ALA I CA 1 
ATOM 3368 C CA . MET H 7  425  ? 162.054 207.888 162.636 1.00 500.00 ? 425  MET I CA 1 
ATOM 3369 C CA . LEU H 7  426  ? 162.932 209.060 166.200 1.00 500.00 ? 426  LEU I CA 1 
ATOM 3370 C CA . ARG H 7  427  ? 161.593 212.592 165.519 1.00 500.00 ? 427  ARG I CA 1 
ATOM 3371 C CA . MET H 7  428  ? 158.294 211.083 164.245 1.00 500.00 ? 428  MET I CA 1 
ATOM 3372 C CA . THR H 7  429  ? 157.703 209.294 167.580 1.00 500.00 ? 429  THR I CA 1 
ATOM 3373 C CA . LYS H 7  439  ? 173.969 213.322 165.354 1.00 411.62 ? 439  LYS I CA 1 
ATOM 3374 C CA . MET H 7  440  ? 174.228 214.351 161.671 1.00 432.94 ? 440  MET I CA 1 
ATOM 3375 C CA . THR H 7  441  ? 177.556 215.510 160.161 1.00 364.72 ? 441  THR I CA 1 
ATOM 3376 C CA . GLN H 7  442  ? 177.477 217.859 157.173 1.00 401.41 ? 442  GLN I CA 1 
ATOM 3377 C CA . LYS H 7  443  ? 179.650 215.429 155.107 1.00 344.25 ? 443  LYS I CA 1 
ATOM 3378 C CA . ASP H 7  444  ? 177.106 212.715 155.959 1.00 318.42 ? 444  ASP I CA 1 
ATOM 3379 C CA . ILE H 7  445  ? 174.284 214.979 154.498 1.00 415.66 ? 445  ILE I CA 1 
ATOM 3380 C CA . THR H 7  446  ? 176.023 215.779 151.124 1.00 310.12 ? 446  THR I CA 1 
ATOM 3381 C CA . PHE H 7  447  ? 176.644 211.995 150.908 1.00 243.56 ? 447  PHE I CA 1 
ATOM 3382 C CA . VAL H 7  448  ? 173.030 210.838 151.411 1.00 234.52 ? 448  VAL I CA 1 
ATOM 3383 C CA . ALA H 7  449  ? 171.788 213.580 149.111 1.00 213.94 ? 449  ALA I CA 1 
ATOM 3384 C CA . GLU H 7  450  ? 173.841 212.142 146.220 1.00 223.27 ? 450  GLU I CA 1 
ATOM 3385 C CA . PHE H 7  451  ? 172.930 208.527 147.279 1.00 189.17 ? 451  PHE I CA 1 
ATOM 3386 C CA . LEU H 7  452  ? 169.285 209.384 146.776 1.00 170.36 ? 452  LEU I CA 1 
ATOM 3387 C CA . THR H 7  453  ? 170.042 211.101 143.466 1.00 233.40 ? 453  THR I CA 1 
ATOM 3388 C CA . GLU H 7  454  ? 172.126 208.261 141.936 1.00 251.65 ? 454  GLU I CA 1 
ATOM 3389 C CA . HIS H 7  455  ? 170.218 205.187 143.133 1.00 214.46 ? 455  HIS I CA 1 
ATOM 3390 C CA . PHE H 7  456  ? 166.581 206.045 143.450 1.00 217.05 ? 456  PHE I CA 1 
ATOM 3391 C CA . GLU H 7  473  ? 173.675 199.076 144.925 1.00 271.34 ? 473  GLU I CA 1 
ATOM 3392 C CA . ARG H 7  474  ? 176.342 199.010 142.172 1.00 255.89 ? 474  ARG I CA 1 
ATOM 3393 C CA . VAL H 7  475  ? 177.788 195.674 143.484 1.00 263.30 ? 475  VAL I CA 1 
ATOM 3394 C CA . GLY H 7  476  ? 175.030 193.769 141.617 1.00 244.20 ? 476  GLY I CA 1 
ATOM 3395 C CA . GLN H 7  477  ? 176.002 194.867 138.085 1.00 248.26 ? 477  GLN I CA 1 
ATOM 3396 C CA . TYR H 7  478  ? 179.361 193.110 138.506 1.00 202.57 ? 478  TYR I CA 1 
ATOM 3397 C CA . LEU H 7  479  ? 178.092 189.851 139.984 1.00 237.54 ? 479  LEU I CA 1 
ATOM 3398 C CA . LYS H 7  480  ? 174.677 189.118 138.303 1.00 243.54 ? 480  LYS I CA 1 
ATOM 3399 C CA . ASP H 7  481  ? 175.931 186.637 135.559 1.00 380.23 ? 481  ASP I CA 1 
ATOM 3400 C CA . GLU H 7  482  ? 174.924 186.456 131.832 1.00 283.40 ? 482  GLU I CA 1 
ATOM 3401 C CA . ASP H 7  483  ? 174.236 190.062 130.509 1.00 288.26 ? 483  ASP I CA 1 
ATOM 3402 C CA . ASP H 7  484  ? 177.804 191.546 130.137 1.00 237.01 ? 484  ASP I CA 1 
ATOM 3403 C CA . ASP H 7  485  ? 176.069 194.996 130.086 1.00 260.68 ? 485  ASP I CA 1 
ATOM 3404 C CA . LEU H 7  486  ? 177.126 196.510 133.499 1.00 224.34 ? 486  LEU I CA 1 
ATOM 3405 C CA . VAL H 7  487  ? 174.561 199.328 134.148 1.00 257.17 ? 487  VAL I CA 1 
ATOM 3406 C CA . SER H 7  488  ? 176.647 202.435 135.173 1.00 251.69 ? 488  SER I CA 1 
ATOM 3407 C CA . PRO H 7  489  ? 180.241 202.764 133.659 1.00 277.60 ? 489  PRO I CA 1 
ATOM 3408 C CA . PRO H 7  490  ? 181.539 202.892 136.609 1.00 293.98 ? 490  PRO I CA 1 
ATOM 3409 C CA . ASN H 7  491  ? 183.628 206.086 136.470 1.00 277.38 ? 491  ASN I CA 1 
ATOM 3410 C CA . THR H 7  492  ? 184.125 208.902 133.941 1.00 298.57 ? 492  THR I CA 1 
ATOM 3411 C CA . GLU H 7  493  ? 187.909 209.493 134.145 1.00 298.74 ? 493  GLU I CA 1 
ATOM 3412 C CA . GLY H 7  494  ? 188.279 211.165 137.534 1.00 265.30 ? 494  GLY I CA 1 
ATOM 3413 C CA . ASN H 7  495  ? 191.397 208.925 137.851 1.00 231.14 ? 495  ASN I CA 1 
ATOM 3414 C CA . GLN H 7  496  ? 194.531 210.769 136.689 1.00 212.32 ? 496  GLN I CA 1 
ATOM 3415 C CA . TRP H 7  497  ? 196.218 207.625 135.308 1.00 381.45 ? 497  TRP I CA 1 
ATOM 3416 C CA . TYR H 7  498  ? 192.867 206.841 133.502 1.00 266.94 ? 498  TYR I CA 1 
ATOM 3417 C CA . ASP H 7  499  ? 193.003 210.387 132.071 1.00 204.18 ? 499  ASP I CA 1 
ATOM 3418 C CA . PHE H 7  500  ? 196.578 209.774 130.812 1.00 365.29 ? 500  PHE I CA 1 
ATOM 3419 C CA . LEU H 7  501  ? 196.249 206.176 129.524 1.00 420.72 ? 501  LEU I CA 1 
ATOM 3420 C CA . GLN H 7  502  ? 193.038 207.226 127.706 1.00 500.00 ? 502  GLN I CA 1 
ATOM 3421 C CA . ASN H 7  503  ? 194.989 210.045 125.950 1.00 500.00 ? 503  ASN I CA 1 
ATOM 3422 C CA . SER H 7  504  ? 198.045 209.834 123.621 1.00 500.00 ? 504  SER I CA 1 
ATOM 3423 C CA . SER H 7  505  ? 200.854 207.435 124.637 1.00 500.00 ? 505  SER I CA 1 
ATOM 3424 C CA . HIS H 7  506  ? 202.986 204.456 123.579 1.00 476.96 ? 506  HIS I CA 1 
ATOM 3425 C CA . LEU H 7  507  ? 201.625 202.948 126.846 1.00 457.88 ? 507  LEU I CA 1 
ATOM 3426 C CA . LYS H 7  508  ? 198.327 201.868 125.198 1.00 455.00 ? 508  LYS I CA 1 
ATOM 3427 C CA . GLU H 7  509  ? 200.391 200.280 122.376 1.00 452.37 ? 509  GLU I CA 1 
ATOM 3428 C CA . SER H 7  510  ? 202.930 198.673 124.798 1.00 345.63 ? 510  SER I CA 1 
ATOM 3429 C CA . PRO H 7  511  ? 202.856 194.920 125.557 1.00 186.35 ? 511  PRO I CA 1 
ATOM 3430 C CA . LEU H 7  512  ? 203.951 195.240 129.207 1.00 252.59 ? 512  LEU I CA 1 
ATOM 3431 C CA . LEU H 7  513  ? 200.650 196.721 130.556 1.00 381.24 ? 513  LEU I CA 1 
ATOM 3432 C CA . PHE H 7  514  ? 197.247 195.038 131.284 1.00 300.25 ? 514  PHE I CA 1 
ATOM 3433 C CA . PRO H 7  515  ? 194.018 196.130 129.608 1.00 167.42 ? 515  PRO I CA 1 
ATOM 3434 C CA . TYR H 7  516  ? 190.979 197.765 131.196 1.00 227.80 ? 516  TYR I CA 1 
ATOM 3435 C CA . TYR H 7  517  ? 187.483 196.502 130.487 1.00 202.34 ? 517  TYR I CA 1 
ATOM 3436 C CA . PRO H 7  518  ? 185.045 199.192 131.610 1.00 223.26 ? 518  PRO I CA 1 
ATOM 3437 C CA . ARG H 7  519  ? 181.264 198.737 131.002 1.00 239.13 ? 519  ARG I CA 1 
ATOM 3438 C CA . LYS H 7  520  ? 181.533 194.989 131.732 1.00 190.14 ? 520  LYS I CA 1 
ATOM 3439 C CA . SER H 7  521  ? 180.649 192.517 134.538 1.00 201.32 ? 521  SER I CA 1 
ATOM 3440 C CA . LEU H 7  522  ? 183.161 190.311 136.335 1.00 171.25 ? 522  LEU I CA 1 
ATOM 3441 C CA . HIS H 7  523  ? 181.609 187.192 134.748 1.00 200.80 ? 523  HIS I CA 1 
ATOM 3442 C CA . PHE H 7  524  ? 182.479 188.795 131.387 1.00 196.93 ? 524  PHE I CA 1 
ATOM 3443 C CA . VAL H 7  525  ? 186.200 189.010 132.183 1.00 195.83 ? 525  VAL I CA 1 
ATOM 3444 C CA . LYS H 7  526  ? 186.228 185.472 133.572 1.00 162.86 ? 526  LYS I CA 1 
ATOM 3445 C CA . ARG H 7  527  ? 184.646 184.081 130.314 1.00 222.94 ? 527  ARG I CA 1 
ATOM 3446 C CA . ARG H 7  528  ? 187.369 185.879 128.339 1.00 240.34 ? 528  ARG I CA 1 
ATOM 3447 C CA . MET H 7  529  ? 190.008 184.637 130.860 1.00 200.02 ? 529  MET I CA 1 
ATOM 3448 C CA . GLU H 7  530  ? 189.087 180.941 130.967 1.00 198.38 ? 530  GLU I CA 1 
ATOM 3449 C CA . ASN H 7  531  ? 188.652 180.807 127.157 1.00 220.78 ? 531  ASN I CA 1 
ATOM 3450 C CA . ILE H 7  532  ? 192.196 182.038 126.473 1.00 200.65 ? 532  ILE I CA 1 
ATOM 3451 C CA . ILE H 7  533  ? 193.654 179.614 129.063 1.00 205.66 ? 533  ILE I CA 1 
ATOM 3452 C CA . ASP H 7  534  ? 191.671 176.751 127.441 1.00 252.61 ? 534  ASP I CA 1 
ATOM 3453 C CA . GLN H 7  535  ? 193.155 177.330 123.970 1.00 239.21 ? 535  GLN I CA 1 
ATOM 3454 C CA . CYS H 7  536  ? 196.597 177.163 125.624 1.00 233.41 ? 536  CYS I CA 1 
ATOM 3455 C CA . LEU H 7  537  ? 195.636 174.133 127.708 1.00 228.67 ? 537  LEU I CA 1 
ATOM 3456 C CA . GLN H 7  538  ? 194.219 172.254 124.638 1.00 244.12 ? 538  GLN I CA 1 
ATOM 3457 C CA . LYS H 7  539  ? 197.222 172.965 122.349 1.00 192.99 ? 539  LYS I CA 1 
ATOM 3458 C CA . PRO H 7  540  ? 199.827 170.749 124.206 1.00 184.85 ? 540  PRO I CA 1 
ATOM 3459 C CA . ALA H 7  541  ? 197.644 167.608 124.008 1.00 181.40 ? 541  ALA I CA 1 
ATOM 3460 C CA . ASP H 7  542  ? 197.064 168.314 120.285 1.00 233.62 ? 542  ASP I CA 1 
ATOM 3461 C CA . VAL H 7  543  ? 200.758 168.773 119.366 1.00 226.02 ? 543  VAL I CA 1 
ATOM 3462 C CA . ILE H 7  544  ? 201.995 165.836 121.462 1.00 232.30 ? 544  ILE I CA 1 
ATOM 3463 C CA . GLY H 7  545  ? 199.894 163.538 119.281 1.00 187.24 ? 545  GLY I CA 1 
ATOM 3464 C CA . LYS H 7  546  ? 202.285 163.545 116.344 1.00 217.64 ? 546  LYS I CA 1 
ATOM 3465 C CA . SER H 7  547  ? 205.079 163.610 118.921 1.00 283.65 ? 547  SER I CA 1 
ATOM 3466 C CA . MET H 7  548  ? 204.306 160.080 120.093 1.00 205.29 ? 548  MET I CA 1 
ATOM 3467 C CA . ASN H 7  549  ? 202.858 158.960 116.756 1.00 245.89 ? 549  ASN I CA 1 
ATOM 3468 C CA . GLN H 7  550  ? 204.121 155.869 114.967 1.00 238.11 ? 550  GLN I CA 1 
ATOM 3469 C CA . ALA H 7  551  ? 202.744 152.475 115.817 1.00 392.56 ? 551  ALA I CA 1 
ATOM 3470 C CA . ILE H 7  552  ? 203.482 148.763 115.496 1.00 383.87 ? 552  ILE I CA 1 
ATOM 3471 C CA . CYS H 7  553  ? 200.561 146.642 114.416 1.00 339.70 ? 553  CYS I CA 1 
ATOM 3472 C CA . ILE H 7  554  ? 199.806 142.962 114.888 1.00 399.19 ? 554  ILE I CA 1 
ATOM 3473 C CA . PRO H 7  555  ? 196.347 141.632 114.204 1.00 379.84 ? 555  PRO I CA 1 
ATOM 3474 C CA . LEU H 7  556  ? 195.219 138.889 116.546 1.00 379.14 ? 556  LEU I CA 1 
ATOM 3475 C CA . TYR H 7  557  ? 191.964 137.278 115.518 1.00 383.29 ? 557  TYR I CA 1 
ATOM 3476 C CA . ARG H 7  558  ? 188.487 137.524 113.941 1.00 420.00 ? 558  ARG I CA 1 
ATOM 3477 C CA . ASP H 7  559  ? 185.506 135.622 115.260 1.00 461.21 ? 559  ASP I CA 1 
ATOM 3478 C CA . THR H 7  560  ? 181.966 135.757 116.571 1.00 500.00 ? 560  THR I CA 1 
ATOM 3479 C CA . ARG H 7  561  ? 182.856 134.991 120.221 1.00 486.05 ? 561  ARG I CA 1 
ATOM 3480 C CA . SER H 7  562  ? 181.790 138.468 121.504 1.00 436.16 ? 562  SER I CA 1 
ATOM 3481 C CA . GLU H 7  563  ? 178.615 138.603 119.412 1.00 483.91 ? 563  GLU I CA 1 
ATOM 3482 C CA . ASP H 7  564  ? 176.708 136.306 121.885 1.00 491.00 ? 564  ASP I CA 1 
ATOM 3483 C CA . SER H 7  565  ? 175.604 138.825 124.487 1.00 495.78 ? 565  SER I CA 1 
ATOM 3484 C CA . THR H 7  566  ? 176.390 138.453 128.112 1.00 500.00 ? 566  THR I CA 1 
ATOM 3485 C CA . ARG H 7  567  ? 178.485 141.258 129.700 1.00 500.00 ? 567  ARG I CA 1 
ATOM 3486 C CA . ARG H 7  568  ? 182.098 140.679 128.597 1.00 500.00 ? 568  ARG I CA 1 
ATOM 3487 C CA . LEU H 7  569  ? 183.762 142.483 131.567 1.00 494.94 ? 569  LEU I CA 1 
ATOM 3488 C CA . PHE H 7  570  ? 186.699 143.602 129.313 1.00 305.17 ? 570  PHE I CA 1 
ATOM 3489 C CA . LYS H 7  571  ? 189.020 141.587 131.474 1.00 299.35 ? 571  LYS I CA 1 
ATOM 3490 C CA . PHE H 7  572  ? 190.290 139.749 128.433 1.00 277.31 ? 572  PHE I CA 1 
ATOM 3491 C CA . PRO H 7  573  ? 192.503 140.028 126.460 1.00 250.25 ? 573  PRO I CA 1 
ATOM 3492 C CA . PHE H 7  574  ? 194.897 141.327 129.048 1.00 267.45 ? 574  PHE I CA 1 
ATOM 3493 C CA . LEU H 7  575  ? 197.844 143.626 128.757 1.00 288.30 ? 575  LEU I CA 1 
ATOM 3494 C CA . TRP H 7  576  ? 200.665 143.696 131.276 1.00 280.27 ? 576  TRP I CA 1 
ATOM 3495 C CA . ASN H 7  577  ? 204.080 145.207 131.422 1.00 304.02 ? 577  ASN I CA 1 
ATOM 3496 C CA . ASN H 7  578  ? 206.869 143.799 133.482 1.00 322.03 ? 578  ASN I CA 1 
ATOM 3497 C CA . LYS H 7  579  ? 208.764 146.749 134.986 1.00 317.83 ? 579  LYS I CA 1 
ATOM 3498 C CA . THR H 7  580  ? 211.879 144.731 135.781 1.00 328.91 ? 580  THR I CA 1 
ATOM 3499 C CA . SER H 7  581  ? 212.151 142.999 132.356 1.00 280.84 ? 581  SER I CA 1 
ATOM 3500 C CA . ASN H 7  582  ? 210.921 146.135 130.606 1.00 256.25 ? 582  ASN I CA 1 
ATOM 3501 C CA . LEU H 7  583  ? 208.552 144.173 128.308 1.00 255.97 ? 583  LEU I CA 1 
ATOM 3502 C CA . HIS H 7  584  ? 204.903 144.279 127.238 1.00 237.95 ? 584  HIS I CA 1 
ATOM 3503 C CA . TYR H 7  585  ? 202.888 141.112 127.572 1.00 273.31 ? 585  TYR I CA 1 
ATOM 3504 C CA . LEU H 7  586  ? 199.620 140.483 125.835 1.00 293.46 ? 586  LEU I CA 1 
ATOM 3505 C CA . LEU H 7  587  ? 197.534 137.421 126.835 1.00 305.67 ? 587  LEU I CA 1 
ATOM 3506 C CA . PHE H 7  588  ? 194.863 136.276 124.392 1.00 308.48 ? 588  PHE I CA 1 
ATOM 3507 C CA . THR H 7  589  ? 192.932 133.203 123.279 1.00 392.92 ? 589  THR I CA 1 
ATOM 3508 C CA . ILE H 7  590  ? 192.417 131.992 119.711 1.00 342.07 ? 590  ILE I CA 1 
ATOM 3509 C CA . LEU H 7  591  ? 189.899 129.250 118.809 1.00 500.00 ? 591  LEU I CA 1 
ATOM 3510 C CA . GLU H 7  592  ? 191.004 126.573 116.302 1.00 500.00 ? 592  GLU I CA 1 
ATOM 3511 C CA . ASP H 7  593  ? 189.285 123.317 117.298 1.00 500.00 ? 593  ASP I CA 1 
ATOM 3512 C CA . SER H 7  594  ? 186.353 125.136 118.945 1.00 341.72 ? 594  SER I CA 1 
ATOM 3513 C CA . LEU H 7  595  ? 188.505 125.087 122.065 1.00 277.25 ? 595  LEU I CA 1 
ATOM 3514 C CA . TYR H 7  596  ? 190.215 128.408 123.018 1.00 279.56 ? 596  TYR I CA 1 
ATOM 3515 C CA . LYS H 7  597  ? 194.022 128.033 122.901 1.00 336.70 ? 597  LYS I CA 1 
ATOM 3516 C CA . MET H 7  598  ? 195.975 130.415 125.127 1.00 369.33 ? 598  MET I CA 1 
ATOM 3517 C CA . CYS H 7  599  ? 198.744 132.597 123.648 1.00 335.95 ? 599  CYS I CA 1 
ATOM 3518 C CA . ILE H 7  600  ? 201.320 134.906 125.101 1.00 339.17 ? 600  ILE I CA 1 
ATOM 3519 C CA . LEU H 7  601  ? 202.673 137.701 122.984 1.00 362.79 ? 601  LEU I CA 1 
ATOM 3520 C CA . ARG H 7  602  ? 205.516 139.930 124.169 1.00 310.96 ? 602  ARG I CA 1 
ATOM 3521 C CA . ARG H 7  603  ? 207.433 142.932 122.814 1.00 252.19 ? 603  ARG I CA 1 
ATOM 3522 C CA . HIS H 7  604  ? 210.233 145.086 124.094 1.00 276.09 ? 604  HIS I CA 1 
ATOM 3523 C CA . THR H 7  605  ? 209.060 148.304 125.713 1.00 290.17 ? 605  THR I CA 1 
ATOM 3524 C CA . ASP H 7  606  ? 211.389 150.200 123.340 1.00 308.21 ? 606  ASP I CA 1 
ATOM 3525 C CA . ILE H 7  607  ? 209.800 149.959 119.907 1.00 324.05 ? 607  ILE I CA 1 
ATOM 3526 C CA . SER H 7  608  ? 212.931 149.690 117.794 1.00 339.83 ? 608  SER I CA 1 
ATOM 3527 C CA . GLN H 7  609  ? 214.157 146.552 119.548 1.00 333.19 ? 609  GLN I CA 1 
ATOM 3528 C CA . SER H 7  610  ? 213.067 142.907 119.434 1.00 351.60 ? 610  SER I CA 1 
ATOM 3529 C CA . VAL H 7  611  ? 212.875 140.145 122.022 1.00 316.44 ? 611  VAL I CA 1 
ATOM 3530 C CA . SER H 7  612  ? 213.111 136.343 122.432 1.00 326.74 ? 612  SER I CA 1 
ATOM 3531 C CA . ASN H 7  613  ? 209.991 134.257 121.816 1.00 298.47 ? 613  ASN I CA 1 
ATOM 3532 C CA . GLY H 7  614  ? 207.600 136.967 120.660 1.00 299.43 ? 614  GLY I CA 1 
ATOM 3533 C CA . LEU H 7  615  ? 204.819 134.464 120.350 1.00 315.59 ? 615  LEU I CA 1 
ATOM 3534 C CA . ILE H 7  616  ? 204.084 131.215 122.187 1.00 336.77 ? 616  ILE I CA 1 
ATOM 3535 C CA . ALA H 7  617  ? 200.951 129.204 122.877 1.00 304.68 ? 617  ALA I CA 1 
ATOM 3536 C CA . ILE H 7  618  ? 200.085 126.797 125.693 1.00 348.99 ? 618  ILE I CA 1 
ATOM 3537 C CA . LYS H 7  619  ? 198.525 123.344 125.716 1.00 370.80 ? 619  LYS I CA 1 
ATOM 3538 C CA . PHE H 7  620  ? 197.972 122.057 129.232 1.00 404.73 ? 620  PHE I CA 1 
ATOM 3539 C CA . GLY H 7  621  ? 199.060 118.422 129.292 1.00 424.52 ? 621  GLY I CA 1 
ATOM 3540 C CA . SER H 7  622  ? 198.691 116.929 132.713 1.00 379.38 ? 622  SER I CA 1 
ATOM 3541 C CA . PHE H 7  623  ? 197.526 117.949 136.151 1.00 390.81 ? 623  PHE I CA 1 
ATOM 3542 C CA . THR H 7  624  ? 198.641 115.999 139.175 1.00 417.19 ? 624  THR I CA 1 
ATOM 3543 C CA . TYR H 7  625  ? 199.953 116.389 142.690 1.00 358.39 ? 625  TYR I CA 1 
ATOM 3544 C CA . ALA H 7  626  ? 203.079 114.848 144.180 1.00 400.67 ? 626  ALA I CA 1 
ATOM 3545 C CA . THR H 7  627  ? 201.263 112.817 146.798 1.00 500.00 ? 627  THR I CA 1 
ATOM 3546 C CA . THR H 7  628  ? 198.072 111.726 144.873 1.00 500.00 ? 628  THR I CA 1 
ATOM 3547 C CA . GLU H 7  629  ? 199.417 109.304 142.212 1.00 500.00 ? 629  GLU I CA 1 
ATOM 3548 C CA . LYS H 7  630  ? 196.328 110.109 140.067 1.00 500.00 ? 630  LYS I CA 1 
ATOM 3549 C CA . VAL H 7  631  ? 197.091 112.258 136.970 1.00 344.20 ? 631  VAL I CA 1 
ATOM 3550 C CA . ARG H 7  632  ? 194.516 114.437 135.213 1.00 350.62 ? 632  ARG I CA 1 
ATOM 3551 C CA . ARG H 7  633  ? 195.136 114.280 131.456 1.00 335.67 ? 633  ARG I CA 1 
ATOM 3552 C CA . SER H 7  634  ? 192.314 115.690 129.424 1.00 322.95 ? 634  SER I CA 1 
ATOM 3553 C CA . ILE H 7  635  ? 191.291 118.228 126.857 1.00 346.80 ? 635  ILE I CA 1 
ATOM 3554 C CA . TYR H 7  636  ? 191.141 121.763 128.245 1.00 396.10 ? 636  TYR I CA 1 
ATOM 3555 C CA . SER H 7  637  ? 189.829 125.056 126.859 1.00 390.79 ? 637  SER I CA 1 
ATOM 3556 C CA . CYS H 7  638  ? 191.005 128.437 128.284 1.00 439.19 ? 638  CYS I CA 1 
ATOM 3557 C CA . LEU H 7  639  ? 188.208 130.463 129.933 1.00 420.57 ? 639  LEU I CA 1 
ATOM 3558 C CA . ASP H 7  640  ? 190.449 133.239 131.325 1.00 400.14 ? 640  ASP I CA 1 
ATOM 3559 C CA . ALA H 7  641  ? 193.949 134.533 132.301 1.00 337.98 ? 641  ALA I CA 1 
ATOM 3560 C CA . GLN H 7  642  ? 195.602 137.377 134.229 1.00 274.90 ? 642  GLN I CA 1 
ATOM 3561 C CA . PHE H 7  643  ? 199.147 138.275 135.273 1.00 258.91 ? 643  PHE I CA 1 
ATOM 3562 C CA . TYR H 7  644  ? 199.852 137.507 138.923 1.00 296.48 ? 644  TYR I CA 1 
ATOM 3563 C CA . ASP H 7  645  ? 203.358 138.892 139.138 1.00 308.22 ? 645  ASP I CA 1 
ATOM 3564 C CA . ASP H 7  646  ? 206.267 139.556 136.764 1.00 315.59 ? 646  ASP I CA 1 
ATOM 3565 C CA . GLU H 7  647  ? 207.085 135.829 136.526 1.00 278.53 ? 647  GLU I CA 1 
ATOM 3566 C CA . THR H 7  648  ? 203.642 134.132 136.873 1.00 279.53 ? 648  THR I CA 1 
ATOM 3567 C CA . VAL H 7  649  ? 200.168 134.091 135.142 1.00 288.12 ? 649  VAL I CA 1 
ATOM 3568 C CA . THR H 7  650  ? 196.886 132.891 136.716 1.00 320.19 ? 650  THR I CA 1 
ATOM 3569 C CA . VAL H 7  651  ? 194.685 130.827 134.375 1.00 301.32 ? 651  VAL I CA 1 
ATOM 3570 C CA . VAL H 7  652  ? 191.175 129.408 134.342 1.00 330.60 ? 652  VAL I CA 1 
ATOM 3571 C CA . LEU H 7  653  ? 190.485 126.251 132.311 1.00 282.50 ? 653  LEU I CA 1 
ATOM 3572 C CA . LYS H 7  654  ? 187.374 124.327 131.330 1.00 355.64 ? 654  LYS I CA 1 
ATOM 3573 C CA . ASP H 7  655  ? 187.695 120.596 131.184 1.00 353.93 ? 655  ASP I CA 1 
ATOM 3574 C CA . THR H 7  656  ? 185.728 119.880 128.027 1.00 369.25 ? 656  THR I CA 1 
ATOM 3575 C CA . VAL H 7  657  ? 184.512 116.501 129.385 1.00 407.95 ? 657  VAL I CA 1 
ATOM 3576 C CA . GLY H 7  658  ? 183.517 117.030 133.099 1.00 488.67 ? 658  GLY I CA 1 
ATOM 3577 C CA . ARG H 7  659  ? 180.162 118.791 132.807 1.00 500.00 ? 659  ARG I CA 1 
ATOM 3578 C CA . GLU H 7  660  ? 178.512 119.153 136.253 1.00 463.24 ? 660  GLU I CA 1 
ATOM 3579 C CA . GLY H 7  661  ? 180.468 121.219 138.768 1.00 406.98 ? 661  GLY I CA 1 
ATOM 3580 C CA . ARG H 7  662  ? 183.610 119.106 138.485 1.00 355.57 ? 662  ARG I CA 1 
ATOM 3581 C CA . ASP H 7  663  ? 184.682 120.718 135.171 1.00 500.00 ? 663  ASP I CA 1 
ATOM 3582 C CA . ARG H 7  664  ? 186.741 123.879 135.820 1.00 500.00 ? 664  ARG I CA 1 
ATOM 3583 C CA . LEU H 7  665  ? 190.339 124.413 137.003 1.00 394.68 ? 665  LEU I CA 1 
ATOM 3584 C CA . LEU H 7  666  ? 192.419 127.168 138.520 1.00 457.98 ? 666  LEU I CA 1 
ATOM 3585 C CA . VAL H 7  667  ? 196.085 127.101 137.419 1.00 378.55 ? 667  VAL I CA 1 
ATOM 3586 C CA . GLN H 7  668  ? 199.260 129.046 138.213 1.00 345.66 ? 668  GLN I CA 1 
ATOM 3587 C CA . LEU H 7  669  ? 201.510 129.248 135.138 1.00 286.15 ? 669  LEU I CA 1 
ATOM 3588 C CA . PRO H 7  670  ? 205.271 129.959 135.728 1.00 317.48 ? 670  PRO I CA 1 
ATOM 3589 C CA . LEU H 7  671  ? 206.903 131.901 132.941 1.00 326.99 ? 671  LEU I CA 1 
ATOM 3590 C CA . SER H 7  672  ? 210.333 130.548 133.848 1.00 323.36 ? 672  SER I CA 1 
ATOM 3591 C CA . LEU H 7  673  ? 209.201 127.266 132.267 1.00 317.40 ? 673  LEU I CA 1 
ATOM 3592 C CA . VAL H 7  674  ? 207.431 128.775 129.239 1.00 289.41 ? 674  VAL I CA 1 
ATOM 3593 C CA . TYR H 7  675  ? 210.503 130.756 128.320 1.00 308.43 ? 675  TYR I CA 1 
ATOM 3594 C CA . ASN H 7  676  ? 212.564 127.882 129.754 1.00 361.17 ? 676  ASN I CA 1 
ATOM 3595 C CA . SER H 7  677  ? 216.200 128.277 128.811 1.00 380.31 ? 677  SER I CA 1 
ATOM 3596 C CA . GLU H 7  678  ? 216.784 124.677 127.697 1.00 500.00 ? 678  GLU I CA 1 
ATOM 3597 C CA . ASP H 7  679  ? 214.138 124.136 124.872 1.00 500.00 ? 679  ASP I CA 1 
ATOM 3598 C CA . SER H 7  680  ? 213.018 127.723 124.265 1.00 500.00 ? 680  SER I CA 1 
ATOM 3599 C CA . ALA H 7  681  ? 215.004 127.614 121.062 1.00 500.00 ? 681  ALA I CA 1 
ATOM 3600 C CA . GLU H 7  682  ? 212.731 124.851 119.605 1.00 500.00 ? 682  GLU I CA 1 
ATOM 3601 C CA . TYR H 7  683  ? 209.554 126.875 120.187 1.00 472.70 ? 683  TYR I CA 1 
ATOM 3602 C CA . GLN H 7  684  ? 209.565 129.601 117.586 1.00 274.84 ? 684  GLN I CA 1 
ATOM 3603 C CA . PHE H 7  685  ? 206.930 131.374 115.452 1.00 336.29 ? 685  PHE I CA 1 
ATOM 3604 C CA . THR H 7  686  ? 207.080 129.993 111.830 1.00 399.37 ? 686  THR I CA 1 
ATOM 3605 C CA . GLY H 7  687  ? 204.772 132.723 110.400 1.00 456.75 ? 687  GLY I CA 1 
ATOM 3606 C CA . THR H 7  688  ? 204.548 136.508 109.979 1.00 500.00 ? 688  THR I CA 1 
ATOM 3607 C CA . TYR H 7  689  ? 203.125 139.396 111.970 1.00 500.00 ? 689  TYR I CA 1 
ATOM 3608 C CA . SER H 7  690  ? 202.318 141.000 108.602 1.00 500.00 ? 690  SER I CA 1 
ATOM 3609 C CA . THR H 7  691  ? 199.092 139.017 108.473 1.00 439.28 ? 691  THR I CA 1 
ATOM 3610 C CA . ARG H 7  692  ? 196.744 138.001 111.290 1.00 403.82 ? 692  ARG I CA 1 
ATOM 3611 C CA . LEU H 7  693  ? 197.924 135.545 113.918 1.00 457.73 ? 693  LEU I CA 1 
ATOM 3612 C CA . ASP H 7  694  ? 194.779 133.469 113.963 1.00 500.00 ? 694  ASP I CA 1 
ATOM 3613 C CA . GLU H 7  695  ? 195.005 132.821 110.215 1.00 500.00 ? 695  GLU I CA 1 
ATOM 3614 C CA . GLN H 7  696  ? 198.212 130.887 110.749 1.00 500.00 ? 696  GLN I CA 1 
ATOM 3615 C CA . CYS H 7  697  ? 197.842 128.362 113.568 1.00 438.04 ? 697  CYS I CA 1 
ATOM 3616 C CA . SER H 7  698  ? 200.333 125.686 112.468 1.00 404.66 ? 698  SER I CA 1 
ATOM 3617 C CA . ALA H 7  699  ? 202.936 128.460 112.538 1.00 389.38 ? 699  ALA I CA 1 
ATOM 3618 C CA . ILE H 7  700  ? 202.538 129.191 116.261 1.00 392.74 ? 700  ILE I CA 1 
ATOM 3619 C CA . PRO H 7  701  ? 204.763 127.146 118.577 1.00 412.76 ? 701  PRO I CA 1 
ATOM 3620 C CA . THR H 7  702  ? 202.886 125.333 121.321 1.00 330.56 ? 702  THR I CA 1 
ATOM 3621 C CA . ARG H 7  703  ? 204.478 124.271 124.573 1.00 338.31 ? 703  ARG I CA 1 
ATOM 3622 C CA . THR H 7  704  ? 202.890 121.278 126.197 1.00 361.33 ? 704  THR I CA 1 
ATOM 3623 C CA . MET H 7  705  ? 203.253 121.782 129.867 1.00 352.88 ? 705  MET I CA 1 
ATOM 3624 C CA . HIS H 7  706  ? 202.767 119.262 132.618 1.00 383.63 ? 706  HIS I CA 1 
ATOM 3625 C CA . PHE H 7  707  ? 201.652 120.616 135.992 1.00 399.33 ? 707  PHE I CA 1 
ATOM 3626 C CA . GLU H 7  708  ? 202.331 118.898 139.204 1.00 412.57 ? 708  GLU I CA 1 
ATOM 3627 C CA . LYS H 7  709  ? 202.125 121.962 141.517 1.00 389.65 ? 709  LYS I CA 1 
ATOM 3628 C CA . HIS H 7  710  ? 200.068 125.085 142.181 1.00 370.67 ? 710  HIS I CA 1 
ATOM 3629 C CA . TRP H 7  711  ? 196.621 124.369 140.756 1.00 355.18 ? 711  TRP I CA 1 
ATOM 3630 C CA . ARG H 7  712  ? 193.253 123.232 141.986 1.00 441.57 ? 712  ARG I CA 1 
ATOM 3631 C CA . LEU H 7  713  ? 190.090 121.712 140.695 1.00 475.14 ? 713  LEU I CA 1 
ATOM 3632 C CA . LEU H 7  714  ? 187.316 124.102 141.605 1.00 500.00 ? 714  LEU I CA 1 
ATOM 3633 C CA . GLU H 7  715  ? 184.637 122.131 143.455 1.00 500.00 ? 715  GLU I CA 1 
ATOM 3634 C CA . SER H 7  716  ? 181.079 122.727 142.245 1.00 500.00 ? 716  SER I CA 1 
ATOM 3635 C CA . MET H 7  717  ? 182.258 126.265 141.540 1.00 500.00 ? 717  MET I CA 1 
ATOM 3636 C CA . LYS H 7  718  ? 181.277 126.946 137.905 1.00 500.00 ? 718  LYS I CA 1 
ATOM 3637 C CA . ALA H 7  719  ? 184.003 129.630 137.637 1.00 500.00 ? 719  ALA I CA 1 
ATOM 3638 C CA . GLN H 7  720  ? 184.626 131.814 134.633 1.00 500.00 ? 720  GLN I CA 1 
ATOM 3639 C CA . TYR H 7  721  ? 187.026 134.713 135.543 1.00 500.00 ? 721  TYR I CA 1 
ATOM 3640 C CA . VAL H 7  722  ? 190.156 135.472 137.645 1.00 500.00 ? 722  VAL I CA 1 
ATOM 3641 C CA . ALA H 7  723  ? 191.428 138.422 139.744 1.00 500.00 ? 723  ALA I CA 1 
ATOM 3642 C CA . GLY H 7  724  ? 195.117 138.141 140.575 1.00 412.27 ? 724  GLY I CA 1 
ATOM 3643 C CA . ASN H 7  725  ? 196.963 139.918 143.371 1.00 500.00 ? 725  ASN I CA 1 
ATOM 3644 C CA . GLY H 7  726  ? 200.677 139.133 143.401 1.00 500.00 ? 726  GLY I CA 1 
ATOM 3645 C CA . PHE H 7  727  ? 201.780 141.513 146.103 1.00 500.00 ? 727  PHE I CA 1 
ATOM 3646 C CA . ARG H 7  728  ? 199.435 140.750 148.899 1.00 447.99 ? 728  ARG I CA 1 
ATOM 3647 C CA . LYS H 7  729  ? 199.556 137.135 147.736 1.00 246.99 ? 729  LYS I CA 1 
ATOM 3648 C CA . VAL H 7  730  ? 195.754 136.536 147.563 1.00 248.65 ? 730  VAL I CA 1 
ATOM 3649 C CA . SER H 7  731  ? 193.383 136.128 144.491 1.00 396.52 ? 731  SER I CA 1 
ATOM 3650 C CA . CYS H 7  732  ? 189.742 135.859 143.593 1.00 498.25 ? 732  CYS I CA 1 
ATOM 3651 C CA . VAL H 7  733  ? 187.492 133.883 141.282 1.00 500.00 ? 733  VAL I CA 1 
ATOM 3652 C CA . LEU H 7  734  ? 184.196 135.109 139.802 1.00 500.00 ? 734  LEU I CA 1 
ATOM 3653 C CA . SER H 7  735  ? 181.634 132.706 138.338 1.00 500.00 ? 735  SER I CA 1 
ATOM 3654 C CA . SER H 7  736  ? 180.149 132.813 134.901 1.00 500.00 ? 736  SER I CA 1 
ATOM 3655 C CA . ASN H 7  737  ? 176.762 133.837 136.492 1.00 500.00 ? 737  ASN I CA 1 
ATOM 3656 C CA . LEU H 7  738  ? 178.769 136.597 138.112 1.00 500.00 ? 738  LEU I CA 1 
ATOM 3657 C CA . ARG H 7  739  ? 176.836 136.404 141.403 1.00 498.41 ? 739  ARG I CA 1 
ATOM 3658 C CA . HIS H 7  740  ? 179.314 134.078 143.184 1.00 446.98 ? 740  HIS I CA 1 
ATOM 3659 C CA . VAL H 7  741  ? 182.877 134.846 144.280 1.00 472.23 ? 741  VAL I CA 1 
ATOM 3660 C CA . ARG H 7  742  ? 185.543 132.591 145.856 1.00 477.63 ? 742  ARG I CA 1 
ATOM 3661 C CA . VAL H 7  743  ? 188.612 134.181 147.432 1.00 462.48 ? 743  VAL I CA 1 
ATOM 3662 C CA . PHE H 7  744  ? 191.910 132.272 147.899 1.00 422.11 ? 744  PHE I CA 1 
ATOM 3663 C CA . GLU H 7  745  ? 195.101 132.849 149.839 1.00 253.73 ? 745  GLU I CA 1 
ATOM 3664 C CA . MET H 7  746  ? 197.433 131.637 147.097 1.00 276.31 ? 746  MET I CA 1 
ATOM 3665 C CA . ASP H 7  747  ? 200.559 131.205 149.220 1.00 310.10 ? 747  ASP I CA 1 
ATOM 3666 C CA . ILE H 7  748  ? 199.051 128.275 151.163 1.00 316.34 ? 748  ILE I CA 1 
ATOM 3667 C CA . ASP H 7  749  ? 197.685 124.700 150.697 1.00 327.61 ? 749  ASP I CA 1 
ATOM 3668 C CA . ASN I 8  2    ? 244.685 262.891 240.498 1.00 500.00 ? 2    ASN J CA 1 
ATOM 3669 C CA . LEU I 8  3    ? 241.295 261.976 241.914 1.00 500.00 ? 3    LEU J CA 1 
ATOM 3670 C CA . GLU I 8  4    ? 239.881 265.317 240.712 1.00 497.55 ? 4    GLU J CA 1 
ATOM 3671 C CA . ARG I 8  5    ? 241.098 264.652 237.157 1.00 386.56 ? 5    ARG J CA 1 
ATOM 3672 C CA . LEU I 8  6    ? 239.678 261.120 237.170 1.00 197.59 ? 6    LEU J CA 1 
ATOM 3673 C CA . ARG I 8  7    ? 236.304 262.351 238.426 1.00 196.33 ? 7    ARG J CA 1 
ATOM 3674 C CA . LYS I 8  8    ? 236.066 264.915 235.657 1.00 371.55 ? 8    LYS J CA 1 
ATOM 3675 C CA . ARG I 8  9    ? 236.941 262.045 233.282 1.00 319.29 ? 9    ARG J CA 1 
ATOM 3676 C CA . VAL I 8  10   ? 234.278 259.643 234.581 1.00 192.59 ? 10   VAL J CA 1 
ATOM 3677 C CA . ARG I 8  11   ? 231.618 262.423 234.528 1.00 322.98 ? 11   ARG J CA 1 
ATOM 3678 C CA . GLN I 8  12   ? 232.504 263.428 230.971 1.00 195.79 ? 12   GLN J CA 1 
ATOM 3679 C CA . TYR I 8  13   ? 232.265 259.741 229.941 1.00 275.73 ? 13   TYR J CA 1 
ATOM 3680 C CA . LEU I 8  14   ? 228.734 259.690 231.314 1.00 266.59 ? 14   LEU J CA 1 
ATOM 3681 C CA . ASP I 8  15   ? 227.806 262.926 229.457 1.00 342.31 ? 15   ASP J CA 1 
ATOM 3682 C CA . GLN I 8  16   ? 229.391 261.345 226.342 1.00 333.32 ? 16   GLN J CA 1 
ATOM 3683 C CA . GLN I 8  17   ? 227.393 258.196 227.069 1.00 273.24 ? 17   GLN J CA 1 
ATOM 3684 C CA . GLN I 8  18   ? 230.249 255.702 227.191 1.00 267.64 ? 18   GLN J CA 1 
ATOM 3685 C CA . TYR I 8  19   ? 228.631 253.841 230.119 1.00 214.38 ? 19   TYR J CA 1 
ATOM 3686 C CA . GLN I 8  20   ? 230.673 250.652 230.225 1.00 207.79 ? 20   GLN J CA 1 
ATOM 3687 C CA . SER I 8  21   ? 233.836 252.739 230.236 1.00 242.12 ? 21   SER J CA 1 
ATOM 3688 C CA . ALA I 8  22   ? 232.593 255.226 232.858 1.00 185.95 ? 22   ALA J CA 1 
ATOM 3689 C CA . LEU I 8  23   ? 231.486 252.260 235.062 1.00 207.59 ? 23   LEU J CA 1 
ATOM 3690 C CA . PHE I 8  24   ? 234.987 250.888 235.018 1.00 311.08 ? 24   PHE J CA 1 
ATOM 3691 C CA . TRP I 8  25   ? 236.637 254.212 235.943 1.00 168.72 ? 25   TRP J CA 1 
ATOM 3692 C CA . ALA I 8  26   ? 233.854 255.072 238.373 1.00 230.25 ? 26   ALA J CA 1 
ATOM 3693 C CA . ASP I 8  27   ? 234.541 251.882 240.348 1.00 226.21 ? 27   ASP J CA 1 
ATOM 3694 C CA . LYS I 8  28   ? 238.313 252.584 240.507 1.00 240.09 ? 28   LYS J CA 1 
ATOM 3695 C CA . VAL I 8  29   ? 237.665 256.235 241.544 1.00 385.12 ? 29   VAL J CA 1 
ATOM 3696 C CA . ALA I 8  30   ? 235.709 254.946 244.522 1.00 433.41 ? 30   ALA J CA 1 
ATOM 3697 C CA . SER I 8  31   ? 238.470 252.622 245.569 1.00 248.27 ? 31   SER J CA 1 
ATOM 3698 C CA . LEU I 8  32   ? 241.346 255.104 245.043 1.00 396.93 ? 32   LEU J CA 1 
ATOM 3699 C CA . SER I 8  33   ? 239.452 257.844 246.895 1.00 500.00 ? 33   SER J CA 1 
ATOM 3700 C CA . ARG I 8  34   ? 238.249 255.302 249.507 1.00 500.00 ? 34   ARG J CA 1 
ATOM 3701 C CA . GLU I 8  35   ? 234.470 254.920 249.839 1.00 500.00 ? 35   GLU J CA 1 
ATOM 3702 C CA . GLU I 8  36   ? 233.040 258.466 250.001 1.00 500.00 ? 36   GLU J CA 1 
ATOM 3703 C CA . PRO I 8  37   ? 229.448 259.778 249.826 1.00 500.00 ? 37   PRO J CA 1 
ATOM 3704 C CA . GLN I 8  38   ? 229.878 261.555 246.525 1.00 500.00 ? 38   GLN J CA 1 
ATOM 3705 C CA . ASP I 8  39   ? 232.207 259.010 244.923 1.00 482.89 ? 39   ASP J CA 1 
ATOM 3706 C CA . ILE I 8  40   ? 229.907 255.995 245.612 1.00 306.01 ? 40   ILE J CA 1 
ATOM 3707 C CA . TYR I 8  41   ? 227.051 258.075 244.148 1.00 167.73 ? 41   TYR J CA 1 
ATOM 3708 C CA . TRP I 8  42   ? 228.699 258.040 240.719 1.00 250.25 ? 42   TRP J CA 1 
ATOM 3709 C CA . LEU I 8  43   ? 229.426 254.320 240.915 1.00 236.20 ? 43   LEU J CA 1 
ATOM 3710 C CA . ALA I 8  44   ? 225.788 253.681 241.791 1.00 223.12 ? 44   ALA J CA 1 
ATOM 3711 C CA . GLN I 8  45   ? 224.688 256.045 239.032 1.00 199.01 ? 45   GLN J CA 1 
ATOM 3712 C CA . CYS I 8  46   ? 226.798 254.137 236.523 1.00 176.50 ? 46   CYS J CA 1 
ATOM 3713 C CA . LEU I 8  47   ? 225.316 250.860 237.478 1.00 189.98 ? 47   LEU J CA 1 
ATOM 3714 C CA . TYR I 8  48   ? 221.800 252.233 237.256 1.00 170.27 ? 48   TYR J CA 1 
ATOM 3715 C CA . LEU I 8  49   ? 222.160 253.587 233.803 1.00 211.87 ? 49   LEU J CA 1 
ATOM 3716 C CA . THR I 8  50   ? 224.059 250.406 232.870 1.00 198.06 ? 50   THR J CA 1 
ATOM 3717 C CA . ALA I 8  51   ? 220.860 248.424 233.662 1.00 160.63 ? 51   ALA J CA 1 
ATOM 3718 C CA . GLN I 8  52   ? 222.680 246.662 236.520 1.00 157.93 ? 52   GLN J CA 1 
ATOM 3719 C CA . TYR I 8  53   ? 220.056 247.538 239.013 1.00 163.51 ? 53   TYR J CA 1 
ATOM 3720 C CA . HIS I 8  54   ? 220.622 244.846 241.562 1.00 185.10 ? 54   HIS J CA 1 
ATOM 3721 C CA . ARG I 8  55   ? 224.290 245.947 241.777 1.00 197.99 ? 55   ARG J CA 1 
ATOM 3722 C CA . ALA I 8  56   ? 223.415 249.681 242.054 1.00 201.58 ? 56   ALA J CA 1 
ATOM 3723 C CA . ALA I 8  57   ? 220.950 249.011 244.861 1.00 281.61 ? 57   ALA J CA 1 
ATOM 3724 C CA . HIS I 8  58   ? 223.454 246.807 246.642 1.00 275.17 ? 58   HIS J CA 1 
ATOM 3725 C CA . ALA I 8  59   ? 226.192 249.474 246.471 1.00 318.74 ? 59   ALA J CA 1 
ATOM 3726 C CA . LEU I 8  60   ? 224.007 252.140 247.998 1.00 415.84 ? 60   LEU J CA 1 
ATOM 3727 C CA . ARG I 8  61   ? 222.154 250.042 250.588 1.00 422.65 ? 61   ARG J CA 1 
ATOM 3728 C CA . SER I 8  62   ? 225.189 248.118 251.903 1.00 446.65 ? 62   SER J CA 1 
ATOM 3729 C CA . ARG I 8  63   ? 227.180 251.172 252.833 1.00 461.75 ? 63   ARG J CA 1 
ATOM 3730 C CA . LYS I 8  64   ? 224.109 252.699 254.610 1.00 500.00 ? 64   LYS J CA 1 
ATOM 3731 C CA . LEU I 8  65   ? 224.890 255.737 252.413 1.00 500.00 ? 65   LEU J CA 1 
ATOM 3732 C CA . ASP I 8  66   ? 221.214 256.085 251.471 1.00 500.00 ? 66   ASP J CA 1 
ATOM 3733 C CA . LYS I 8  67   ? 220.031 256.768 255.026 1.00 500.00 ? 67   LYS J CA 1 
ATOM 3734 C CA . LEU I 8  68   ? 222.735 259.364 255.696 1.00 500.00 ? 68   LEU J CA 1 
ATOM 3735 C CA . TYR I 8  69   ? 221.971 261.738 252.779 1.00 500.00 ? 69   TYR J CA 1 
ATOM 3736 C CA . GLU I 8  70   ? 218.643 261.258 250.974 1.00 500.00 ? 70   GLU J CA 1 
ATOM 3737 C CA . ALA I 8  71   ? 220.008 262.073 247.499 1.00 493.81 ? 71   ALA J CA 1 
ATOM 3738 C CA . CYS I 8  72   ? 221.356 258.529 247.314 1.00 475.54 ? 72   CYS J CA 1 
ATOM 3739 C CA . ARG I 8  73   ? 218.057 257.173 248.842 1.00 488.08 ? 73   ARG J CA 1 
ATOM 3740 C CA . TYR I 8  74   ? 216.315 258.554 245.733 1.00 402.21 ? 74   TYR J CA 1 
ATOM 3741 C CA . LEU I 8  75   ? 218.672 256.595 243.465 1.00 271.31 ? 75   LEU J CA 1 
ATOM 3742 C CA . ALA I 8  76   ? 218.352 253.325 245.442 1.00 189.71 ? 76   ALA J CA 1 
ATOM 3743 C CA . ALA I 8  77   ? 214.547 253.695 245.293 1.00 160.63 ? 77   ALA J CA 1 
ATOM 3744 C CA . ARG I 8  78   ? 214.873 254.406 241.599 1.00 206.12 ? 78   ARG J CA 1 
ATOM 3745 C CA . CYS I 8  79   ? 216.883 251.273 241.119 1.00 199.23 ? 79   CYS J CA 1 
ATOM 3746 C CA . HIS I 8  80   ? 214.301 249.119 242.869 1.00 148.30 ? 80   HIS J CA 1 
ATOM 3747 C CA . TYR I 8  81   ? 211.589 250.576 240.751 1.00 155.73 ? 81   TYR J CA 1 
ATOM 3748 C CA . ALA I 8  82   ? 213.531 249.893 237.534 1.00 171.90 ? 82   ALA J CA 1 
ATOM 3749 C CA . ALA I 8  83   ? 213.989 246.354 238.881 1.00 203.14 ? 83   ALA J CA 1 
ATOM 3750 C CA . LYS I 8  84   ? 210.190 246.131 239.390 1.00 184.50 ? 84   LYS J CA 1 
ATOM 3751 C CA . GLU I 8  85   ? 210.759 245.535 243.115 1.00 264.98 ? 85   GLU J CA 1 
ATOM 3752 C CA . HIS I 8  86   ? 207.766 247.717 244.068 1.00 475.19 ? 86   HIS J CA 1 
ATOM 3753 C CA . GLN I 8  87   ? 206.936 247.939 247.754 1.00 500.00 ? 87   GLN J CA 1 
ATOM 3754 C CA . GLN I 8  88   ? 210.656 247.587 248.525 1.00 500.00 ? 88   GLN J CA 1 
ATOM 3755 C CA . ALA I 8  89   ? 211.234 250.785 246.591 1.00 500.00 ? 89   ALA J CA 1 
ATOM 3756 C CA . LEU I 8  90   ? 208.325 252.372 248.541 1.00 500.00 ? 90   LEU J CA 1 
ATOM 3757 C CA . ASP I 8  91   ? 209.865 251.074 251.780 1.00 500.00 ? 91   ASP J CA 1 
ATOM 3758 C CA . VAL I 8  92   ? 213.148 252.919 250.951 1.00 500.00 ? 92   VAL J CA 1 
ATOM 3759 C CA . LEU I 8  93   ? 211.166 256.198 250.806 1.00 500.00 ? 93   LEU J CA 1 
ATOM 3760 C CA . ASP I 8  94   ? 209.229 255.771 254.031 1.00 500.00 ? 94   ASP J CA 1 
ATOM 3761 C CA . MET I 8  95   ? 212.048 256.748 256.482 1.00 500.00 ? 95   MET J CA 1 
ATOM 3762 C CA . SER I 8  124  ? 219.484 271.307 243.982 1.00 500.00 ? 124  SER J CA 1 
ATOM 3763 C CA . GLN I 8  125  ? 217.585 270.690 247.286 1.00 500.00 ? 125  GLN J CA 1 
ATOM 3764 C CA . SER I 8  126  ? 214.095 271.620 246.067 1.00 500.00 ? 126  SER J CA 1 
ATOM 3765 C CA . SER I 8  127  ? 214.541 269.791 242.727 1.00 500.00 ? 127  SER J CA 1 
ATOM 3766 C CA . ILE I 8  128  ? 215.526 266.607 244.544 1.00 500.00 ? 128  ILE J CA 1 
ATOM 3767 C CA . LYS I 8  129  ? 212.707 266.744 247.110 1.00 500.00 ? 129  LYS J CA 1 
ATOM 3768 C CA . SER I 8  130  ? 210.085 267.106 244.339 1.00 500.00 ? 130  SER J CA 1 
ATOM 3769 C CA . SER I 8  131  ? 211.500 264.411 242.106 1.00 500.00 ? 131  SER J CA 1 
ATOM 3770 C CA . ILE I 8  132  ? 211.525 261.943 244.981 1.00 500.00 ? 132  ILE J CA 1 
ATOM 3771 C CA . CYS I 8  133  ? 207.870 262.756 245.662 1.00 500.00 ? 133  CYS J CA 1 
ATOM 3772 C CA . LEU I 8  134  ? 207.140 262.024 242.032 1.00 500.00 ? 134  LEU J CA 1 
ATOM 3773 C CA . LEU I 8  135  ? 208.864 258.686 242.182 1.00 500.00 ? 135  LEU J CA 1 
ATOM 3774 C CA . ARG I 8  136  ? 206.695 257.754 245.232 1.00 500.00 ? 136  ARG J CA 1 
ATOM 3775 C CA . GLY I 8  137  ? 203.700 258.444 242.931 1.00 500.00 ? 137  GLY J CA 1 
ATOM 3776 C CA . LYS I 8  138  ? 205.197 256.392 240.127 1.00 494.70 ? 138  LYS J CA 1 
ATOM 3777 C CA . ILE I 8  139  ? 205.448 253.402 242.438 1.00 500.00 ? 139  ILE J CA 1 
ATOM 3778 C CA . TYR I 8  140  ? 201.870 253.710 243.727 1.00 500.00 ? 140  TYR J CA 1 
ATOM 3779 C CA . ASP I 8  141  ? 200.728 253.531 240.120 1.00 500.00 ? 141  ASP J CA 1 
ATOM 3780 C CA . ALA I 8  142  ? 202.598 250.276 239.664 1.00 500.00 ? 142  ALA J CA 1 
ATOM 3781 C CA . LEU I 8  143  ? 201.121 248.996 242.947 1.00 500.00 ? 143  LEU J CA 1 
ATOM 3782 C CA . ASP I 8  144  ? 197.715 250.028 241.480 1.00 500.00 ? 144  ASP J CA 1 
ATOM 3783 C CA . ASN I 8  145  ? 196.990 252.435 244.381 1.00 500.00 ? 145  ASN J CA 1 
ATOM 3784 C CA . ARG I 8  146  ? 195.769 255.046 241.912 1.00 500.00 ? 146  ARG J CA 1 
ATOM 3785 C CA . THR I 8  147  ? 194.068 257.263 244.509 1.00 500.00 ? 147  THR J CA 1 
ATOM 3786 C CA . LEU I 8  148  ? 197.291 257.525 246.515 1.00 500.00 ? 148  LEU J CA 1 
ATOM 3787 C CA . ALA I 8  149  ? 199.462 258.071 243.414 1.00 500.00 ? 149  ALA J CA 1 
ATOM 3788 C CA . THR I 8  150  ? 197.440 260.969 242.134 1.00 500.00 ? 150  THR J CA 1 
ATOM 3789 C CA . TYR I 8  151  ? 197.921 262.634 245.565 1.00 500.00 ? 151  TYR J CA 1 
ATOM 3790 C CA . SER I 8  152  ? 201.697 261.987 245.365 1.00 500.00 ? 152  SER J CA 1 
ATOM 3791 C CA . TYR I 8  153  ? 201.950 263.503 241.831 1.00 500.00 ? 153  TYR J CA 1 
ATOM 3792 C CA . LYS I 8  154  ? 200.078 266.617 243.029 1.00 500.00 ? 154  LYS J CA 1 
ATOM 3793 C CA . GLU I 8  155  ? 202.619 267.020 245.816 1.00 500.00 ? 155  GLU J CA 1 
ATOM 3794 C CA . ALA I 8  156  ? 205.491 266.654 243.294 1.00 500.00 ? 156  ALA J CA 1 
ATOM 3795 C CA . LEU I 8  157  ? 203.910 269.358 241.130 1.00 500.00 ? 157  LEU J CA 1 
ATOM 3796 C CA . LYS I 8  158  ? 203.670 271.858 243.931 1.00 500.00 ? 158  LYS J CA 1 
ATOM 3797 C CA . LEU I 8  159  ? 207.371 271.627 244.831 1.00 500.00 ? 159  LEU J CA 1 
ATOM 3798 C CA . ASP I 8  160  ? 208.880 271.969 241.335 1.00 500.00 ? 160  ASP J CA 1 
ATOM 3799 C CA . VAL I 8  161  ? 206.193 273.304 238.948 1.00 500.00 ? 161  VAL J CA 1 
ATOM 3800 C CA . TYR I 8  162  ? 208.663 273.248 236.022 1.00 479.31 ? 162  TYR J CA 1 
ATOM 3801 C CA . CYS I 8  163  ? 208.703 269.419 235.834 1.00 268.96 ? 163  CYS J CA 1 
ATOM 3802 C CA . PHE I 8  164  ? 206.196 268.312 233.341 1.00 159.13 ? 164  PHE J CA 1 
ATOM 3803 C CA . GLU I 8  165  ? 206.716 264.598 233.864 1.00 177.63 ? 165  GLU J CA 1 
ATOM 3804 C CA . ALA I 8  166  ? 204.471 264.671 236.935 1.00 369.88 ? 166  ALA J CA 1 
ATOM 3805 C CA . PHE I 8  167  ? 201.897 266.789 235.125 1.00 466.85 ? 167  PHE J CA 1 
ATOM 3806 C CA . ASP I 8  168  ? 201.896 264.664 231.973 1.00 376.00 ? 168  ASP J CA 1 
ATOM 3807 C CA . LEU I 8  169  ? 201.419 261.567 234.086 1.00 184.12 ? 169  LEU J CA 1 
ATOM 3808 C CA . LEU I 8  170  ? 198.290 262.839 235.819 1.00 368.23 ? 170  LEU J CA 1 
ATOM 3809 C CA . THR I 8  171  ? 196.808 264.491 232.685 1.00 401.80 ? 171  THR J CA 1 
ATOM 3810 C CA . SER I 8  172  ? 197.420 261.682 230.149 1.00 249.19 ? 172  SER J CA 1 
ATOM 3811 C CA . HIS I 8  173  ? 196.250 258.969 232.515 1.00 282.69 ? 173  HIS J CA 1 
ATOM 3812 C CA . HIS I 8  174  ? 192.996 260.875 233.160 1.00 456.83 ? 174  HIS J CA 1 
ATOM 3813 C CA . MET I 8  175  ? 193.618 260.535 236.891 1.00 500.00 ? 175  MET J CA 1 
ATOM 3814 C CA . LEU I 8  176  ? 192.199 264.035 237.577 1.00 500.00 ? 176  LEU J CA 1 
ATOM 3815 C CA . THR I 8  177  ? 188.745 265.224 236.623 1.00 500.00 ? 177  THR J CA 1 
ATOM 3816 C CA . ALA I 8  178  ? 188.407 268.286 234.359 1.00 500.00 ? 178  ALA J CA 1 
ATOM 3817 C CA . GLN I 8  179  ? 187.446 270.615 237.227 1.00 500.00 ? 179  GLN J CA 1 
ATOM 3818 C CA . GLU I 8  180  ? 190.378 269.526 239.354 1.00 500.00 ? 180  GLU J CA 1 
ATOM 3819 C CA . GLU I 8  181  ? 192.923 270.054 236.600 1.00 500.00 ? 181  GLU J CA 1 
ATOM 3820 C CA . LYS I 8  182  ? 191.651 273.655 236.156 1.00 500.00 ? 182  LYS J CA 1 
ATOM 3821 C CA . GLU I 8  183  ? 191.592 274.030 239.926 1.00 500.00 ? 183  GLU J CA 1 
ATOM 3822 C CA . LEU I 8  184  ? 195.051 272.369 240.248 1.00 500.00 ? 184  LEU J CA 1 
ATOM 3823 C CA . LEU I 8  185  ? 196.744 274.791 237.845 1.00 500.00 ? 185  LEU J CA 1 
ATOM 3824 C CA . GLU I 8  186  ? 195.587 277.703 240.109 1.00 500.00 ? 186  GLU J CA 1 
ATOM 3825 C CA . SER I 8  187  ? 196.923 275.794 243.169 1.00 500.00 ? 187  SER J CA 1 
ATOM 3826 C CA . LEU I 8  188  ? 200.551 275.762 241.838 1.00 500.00 ? 188  LEU J CA 1 
ATOM 3827 C CA . PRO I 8  189  ? 202.527 278.633 243.352 1.00 500.00 ? 189  PRO J CA 1 
ATOM 3828 C CA . LEU I 8  190  ? 203.587 280.042 239.954 1.00 500.00 ? 190  LEU J CA 1 
ATOM 3829 C CA . SER I 8  191  ? 205.222 282.895 241.892 1.00 500.00 ? 191  SER J CA 1 
ATOM 3830 C CA . LYS I 8  192  ? 206.500 285.622 239.603 1.00 500.00 ? 192  LYS J CA 1 
ATOM 3831 C CA . LEU I 8  193  ? 209.631 284.397 237.752 1.00 500.00 ? 193  LEU J CA 1 
ATOM 3832 C CA . CYS I 8  194  ? 209.770 286.936 234.880 1.00 500.00 ? 194  CYS J CA 1 
ATOM 3833 C CA . ASN I 8  195  ? 206.706 288.379 233.126 1.00 500.00 ? 195  ASN J CA 1 
ATOM 3834 C CA . GLU I 8  196  ? 207.541 286.100 230.120 1.00 500.00 ? 196  GLU J CA 1 
ATOM 3835 C CA . GLU I 8  197  ? 207.989 282.892 232.077 1.00 500.00 ? 197  GLU J CA 1 
ATOM 3836 C CA . GLN I 8  198  ? 204.762 283.389 234.095 1.00 500.00 ? 198  GLN J CA 1 
ATOM 3837 C CA . GLU I 8  199  ? 202.773 283.483 230.849 1.00 500.00 ? 199  GLU J CA 1 
ATOM 3838 C CA . LEU I 8  200  ? 204.763 280.707 229.228 1.00 500.00 ? 200  LEU J CA 1 
ATOM 3839 C CA . LEU I 8  201  ? 204.088 278.095 231.922 1.00 500.00 ? 201  LEU J CA 1 
ATOM 3840 C CA . ARG I 8  202  ? 200.363 278.919 232.155 1.00 500.00 ? 202  ARG J CA 1 
ATOM 3841 C CA . PHE I 8  203  ? 200.050 278.750 228.359 1.00 500.00 ? 203  PHE J CA 1 
ATOM 3842 C CA . LEU I 8  204  ? 201.786 275.358 228.122 1.00 500.00 ? 204  LEU J CA 1 
ATOM 3843 C CA . PHE I 8  205  ? 199.762 273.804 230.917 1.00 500.00 ? 205  PHE J CA 1 
ATOM 3844 C CA . GLU I 8  206  ? 196.506 275.320 229.560 1.00 500.00 ? 206  GLU J CA 1 
ATOM 3845 C CA . ASN I 8  207  ? 197.042 273.598 226.228 1.00 500.00 ? 207  ASN J CA 1 
ATOM 3846 C CA . LYS I 8  208  ? 197.363 270.197 227.860 1.00 500.00 ? 208  LYS J CA 1 
ATOM 3847 C CA . LEU I 8  209  ? 194.478 270.571 230.350 1.00 500.00 ? 209  LEU J CA 1 
ATOM 3848 C CA . LYS I 8  210  ? 191.971 267.839 229.609 1.00 500.00 ? 210  LYS J CA 1 
ATOM 3849 C CA . LYS I 8  211  ? 189.712 268.493 226.645 1.00 500.00 ? 211  LYS J CA 1 
ATOM 3850 C CA . TYR I 8  212  ? 186.552 266.532 225.651 1.00 500.00 ? 212  TYR J CA 1 
ATOM 3851 C CA . ASN I 8  213  ? 185.097 267.640 229.036 1.00 500.00 ? 213  ASN J CA 1 
ATOM 3852 C CA . LYS I 8  214  ? 183.870 270.687 227.117 1.00 500.00 ? 214  LYS J CA 1 
ATOM 3853 C CA . PRO I 8  215  ? 184.331 271.154 223.355 1.00 500.00 ? 215  PRO J CA 1 
ATOM 3854 C CA . SER I 8  216  ? 183.364 274.856 223.460 1.00 500.00 ? 216  SER J CA 1 
ATOM 3855 C CA . GLU I 8  217  ? 186.857 276.328 223.146 1.00 500.00 ? 217  GLU J CA 1 
ATOM 3856 C CA . THR I 8  218  ? 188.169 276.939 219.566 1.00 500.00 ? 218  THR J CA 1 
ATOM 3857 C CA . VAL I 8  219  ? 191.417 278.290 218.093 1.00 500.00 ? 219  VAL J CA 1 
ATOM 3858 C CA . ILE I 8  220  ? 193.574 279.618 220.987 1.00 500.00 ? 220  ILE J CA 1 
ATOM 3859 C CA . PRO I 8  221  ? 195.364 282.741 219.678 1.00 500.00 ? 221  PRO J CA 1 
ATOM 3860 C CA . GLU I 8  222  ? 197.086 283.118 223.042 1.00 500.00 ? 222  GLU J CA 1 
ATOM 3861 C CA . SER I 8  223  ? 200.280 282.514 221.046 1.00 500.00 ? 223  SER J CA 1 
ATOM 3862 C CA . VAL I 8  224  ? 203.668 283.024 222.600 1.00 500.00 ? 224  VAL J CA 1 
ATOM 3863 C CA . ASP I 8  225  ? 206.117 285.652 221.178 1.00 500.00 ? 225  ASP J CA 1 
ATOM 3864 C CA . GLY I 8  226  ? 207.862 283.124 218.881 1.00 500.00 ? 226  GLY J CA 1 
ATOM 3865 C CA . LEU I 8  227  ? 206.750 279.641 219.981 1.00 500.00 ? 227  LEU J CA 1 
ATOM 3866 C CA . GLN I 8  228  ? 204.106 278.451 217.480 1.00 500.00 ? 228  GLN J CA 1 
ATOM 3867 C CA . GLU I 8  229  ? 205.844 276.545 214.677 1.00 500.00 ? 229  GLU J CA 1 
ATOM 3868 C CA . ASN I 8  230  ? 206.447 273.941 217.443 1.00 500.00 ? 230  ASN J CA 1 
ATOM 3869 C CA . LEU I 8  231  ? 204.879 270.559 216.839 1.00 500.00 ? 231  LEU J CA 1 
ATOM 3870 C CA . ASP I 8  232  ? 203.604 270.163 220.414 1.00 500.00 ? 232  ASP J CA 1 
ATOM 3871 C CA . VAL I 8  233  ? 201.574 273.349 220.080 1.00 500.00 ? 233  VAL J CA 1 
ATOM 3872 C CA . VAL I 8  234  ? 200.077 272.321 216.742 1.00 500.00 ? 234  VAL J CA 1 
ATOM 3873 C CA . VAL I 8  235  ? 199.278 268.826 218.019 1.00 449.78 ? 235  VAL J CA 1 
ATOM 3874 C CA . SER I 8  236  ? 197.492 270.377 220.973 1.00 500.00 ? 236  SER J CA 1 
ATOM 3875 C CA . LEU I 8  237  ? 195.385 272.336 218.482 1.00 500.00 ? 237  LEU J CA 1 
ATOM 3876 C CA . ALA I 8  238  ? 194.581 269.109 216.565 1.00 500.00 ? 238  ALA J CA 1 
ATOM 3877 C CA . GLU I 8  239  ? 193.548 267.379 219.819 1.00 500.00 ? 239  GLU J CA 1 
ATOM 3878 C CA . ARG I 8  240  ? 191.136 270.199 220.462 1.00 500.00 ? 240  ARG J CA 1 
ATOM 3879 C CA . HIS I 8  241  ? 189.677 270.034 216.941 1.00 379.39 ? 241  HIS J CA 1 
ATOM 3880 C CA . TYR I 8  242  ? 189.263 266.270 217.269 1.00 166.46 ? 242  TYR J CA 1 
ATOM 3881 C CA . TYR I 8  243  ? 187.360 266.508 220.485 1.00 133.05 ? 243  TYR J CA 1 
ATOM 3882 C CA . ASN I 8  244  ? 185.097 269.130 218.805 1.00 212.14 ? 244  ASN J CA 1 
ATOM 3883 C CA . CYS I 8  245  ? 184.471 266.468 216.132 1.00 148.92 ? 245  CYS J CA 1 
ATOM 3884 C CA . ASP I 8  246  ? 185.989 268.741 213.395 1.00 323.62 ? 246  ASP J CA 1 
ATOM 3885 C CA . PHE I 8  247  ? 187.774 265.733 211.917 1.00 200.22 ? 247  PHE J CA 1 
ATOM 3886 C CA . LYS I 8  248  ? 188.855 267.094 208.500 1.00 166.74 ? 248  LYS J CA 1 
ATOM 3887 C CA . MET I 8  249  ? 190.440 270.094 210.226 1.00 314.61 ? 249  MET J CA 1 
ATOM 3888 C CA . CYS I 8  250  ? 192.152 267.864 212.753 1.00 191.53 ? 250  CYS J CA 1 
ATOM 3889 C CA . TYR I 8  251  ? 193.347 265.600 209.963 1.00 160.18 ? 251  TYR J CA 1 
ATOM 3890 C CA . LYS I 8  252  ? 194.773 268.461 207.956 1.00 186.02 ? 252  LYS J CA 1 
ATOM 3891 C CA . LEU I 8  253  ? 196.862 269.534 210.994 1.00 164.97 ? 253  LEU J CA 1 
ATOM 3892 C CA . THR I 8  254  ? 197.850 266.055 212.185 1.00 161.42 ? 254  THR J CA 1 
ATOM 3893 C CA . SER I 8  255  ? 198.967 265.022 208.663 1.00 173.99 ? 255  SER J CA 1 
ATOM 3894 C CA . VAL I 8  256  ? 201.463 267.922 208.570 1.00 174.37 ? 256  VAL J CA 1 
ATOM 3895 C CA . VAL I 8  257  ? 202.630 266.901 212.054 1.00 153.40 ? 257  VAL J CA 1 
ATOM 3896 C CA . MET I 8  258  ? 203.331 263.371 210.833 1.00 184.18 ? 258  MET J CA 1 
ATOM 3897 C CA . GLU I 8  259  ? 205.411 264.615 207.898 1.00 190.30 ? 259  GLU J CA 1 
ATOM 3898 C CA . LYS I 8  260  ? 207.516 266.971 210.049 1.00 200.86 ? 260  LYS J CA 1 
ATOM 3899 C CA . ASP I 8  261  ? 208.131 264.152 212.691 1.00 209.30 ? 261  ASP J CA 1 
ATOM 3900 C CA . PRO I 8  262  ? 207.343 260.720 211.356 1.00 223.09 ? 262  PRO J CA 1 
ATOM 3901 C CA . PHE I 8  263  ? 206.399 259.062 214.633 1.00 196.88 ? 263  PHE J CA 1 
ATOM 3902 C CA . HIS I 8  264  ? 205.635 261.900 216.986 1.00 267.76 ? 264  HIS J CA 1 
ATOM 3903 C CA . ALA I 8  265  ? 204.403 259.976 220.053 1.00 231.30 ? 265  ALA J CA 1 
ATOM 3904 C CA . SER I 8  266  ? 201.850 262.477 221.393 1.00 193.78 ? 266  SER J CA 1 
ATOM 3905 C CA . CYS I 8  267  ? 200.314 262.849 217.928 1.00 178.13 ? 267  CYS J CA 1 
ATOM 3906 C CA . LEU I 8  268  ? 199.600 259.116 217.308 1.00 156.26 ? 268  LEU J CA 1 
ATOM 3907 C CA . PRO I 8  269  ? 196.532 258.590 219.525 1.00 190.75 ? 269  PRO J CA 1 
ATOM 3908 C CA . VAL I 8  270  ? 195.015 261.705 217.920 1.00 190.41 ? 270  VAL J CA 1 
ATOM 3909 C CA . HIS I 8  271  ? 196.128 260.719 214.445 1.00 157.50 ? 271  HIS J CA 1 
ATOM 3910 C CA . ILE I 8  272  ? 194.827 257.149 214.822 1.00 157.33 ? 272  ILE J CA 1 
ATOM 3911 C CA . GLY I 8  273  ? 191.522 258.352 216.332 1.00 174.27 ? 273  GLY J CA 1 
ATOM 3912 C CA . THR I 8  274  ? 191.001 260.846 213.460 1.00 122.06 ? 274  THR J CA 1 
ATOM 3913 C CA . LEU I 8  275  ? 191.740 258.156 210.861 1.00 142.15 ? 275  LEU J CA 1 
ATOM 3914 C CA . VAL I 8  276  ? 189.199 255.793 212.450 1.00 150.12 ? 276  VAL J CA 1 
ATOM 3915 C CA . GLU I 8  277  ? 186.488 258.432 212.191 1.00 178.60 ? 277  GLU J CA 1 
ATOM 3916 C CA . LEU I 8  278  ? 187.358 259.448 208.611 1.00 124.18 ? 278  LEU J CA 1 
ATOM 3917 C CA . ASN I 8  279  ? 187.477 255.727 207.774 1.00 176.07 ? 279  ASN J CA 1 
ATOM 3918 C CA . LYS I 8  280  ? 190.908 255.986 205.968 1.00 156.63 ? 280  LYS J CA 1 
ATOM 3919 C CA . ALA I 8  281  ? 191.754 252.357 206.306 1.00 145.22 ? 281  ALA J CA 1 
ATOM 3920 C CA . ASN I 8  282  ? 194.602 252.562 203.882 1.00 167.74 ? 282  ASN J CA 1 
ATOM 3921 C CA . GLU I 8  283  ? 196.382 255.261 205.867 1.00 154.31 ? 283  GLU J CA 1 
ATOM 3922 C CA . LEU I 8  284  ? 195.780 253.422 209.098 1.00 112.25 ? 284  LEU J CA 1 
ATOM 3923 C CA . PHE I 8  285  ? 197.061 250.139 207.763 1.00 142.10 ? 285  PHE J CA 1 
ATOM 3924 C CA . TYR I 8  286  ? 200.265 251.794 206.633 1.00 136.53 ? 286  TYR J CA 1 
ATOM 3925 C CA . LEU I 8  287  ? 200.625 253.468 210.020 1.00 146.12 ? 287  LEU J CA 1 
ATOM 3926 C CA . SER I 8  288  ? 199.972 250.343 212.110 1.00 158.96 ? 288  SER J CA 1 
ATOM 3927 C CA . HIS I 8  289  ? 202.306 248.183 210.089 1.00 156.70 ? 289  HIS J CA 1 
ATOM 3928 C CA . LYS I 8  290  ? 205.056 250.749 210.338 1.00 158.76 ? 290  LYS J CA 1 
ATOM 3929 C CA . LEU I 8  291  ? 204.486 251.062 214.085 1.00 133.84 ? 291  LEU J CA 1 
ATOM 3930 C CA . VAL I 8  292  ? 204.675 247.402 214.991 1.00 144.36 ? 292  VAL J CA 1 
ATOM 3931 C CA . ASP I 8  293  ? 207.825 246.902 213.111 1.00 176.57 ? 293  ASP J CA 1 
ATOM 3932 C CA . LEU I 8  294  ? 209.471 249.902 214.764 1.00 198.15 ? 294  LEU J CA 1 
ATOM 3933 C CA . TYR I 8  295  ? 207.975 250.070 218.259 1.00 183.45 ? 295  TYR J CA 1 
ATOM 3934 C CA . PRO I 8  296  ? 206.599 246.628 219.124 1.00 173.36 ? 296  PRO J CA 1 
ATOM 3935 C CA . SER I 8  297  ? 207.172 247.444 222.787 1.00 183.18 ? 297  SER J CA 1 
ATOM 3936 C CA . ASN I 8  298  ? 205.067 250.620 223.081 1.00 195.56 ? 298  ASN J CA 1 
ATOM 3937 C CA . PRO I 8  299  ? 201.344 250.287 223.885 1.00 169.43 ? 299  PRO J CA 1 
ATOM 3938 C CA . VAL I 8  300  ? 200.271 252.747 221.191 1.00 161.12 ? 300  VAL J CA 1 
ATOM 3939 C CA . SER I 8  301  ? 201.567 250.504 218.414 1.00 160.52 ? 301  SER J CA 1 
ATOM 3940 C CA . TRP I 8  302  ? 199.295 247.660 219.411 1.00 144.54 ? 302  TRP J CA 1 
ATOM 3941 C CA . PHE I 8  303  ? 196.455 250.103 219.887 1.00 154.02 ? 303  PHE J CA 1 
ATOM 3942 C CA . ALA I 8  304  ? 196.928 251.211 216.266 1.00 153.25 ? 304  ALA J CA 1 
ATOM 3943 C CA . VAL I 8  305  ? 196.850 247.621 215.096 1.00 156.72 ? 305  VAL J CA 1 
ATOM 3944 C CA . GLY I 8  306  ? 193.733 246.812 217.102 1.00 225.77 ? 306  GLY J CA 1 
ATOM 3945 C CA . CYS I 8  307  ? 191.978 249.898 215.778 1.00 150.67 ? 307  CYS J CA 1 
ATOM 3946 C CA . TYR I 8  308  ? 192.758 249.007 212.233 1.00 141.32 ? 308  TYR J CA 1 
ATOM 3947 C CA . TYR I 8  309  ? 191.029 245.704 212.550 1.00 130.43 ? 309  TYR J CA 1 
ATOM 3948 C CA . LEU I 8  310  ? 188.026 247.616 213.958 1.00 130.94 ? 310  LEU J CA 1 
ATOM 3949 C CA . MET I 8  311  ? 187.734 249.806 210.869 1.00 162.28 ? 311  MET J CA 1 
ATOM 3950 C CA . VAL I 8  312  ? 187.810 246.762 208.649 1.00 173.96 ? 312  VAL J CA 1 
ATOM 3951 C CA . GLY I 8  313  ? 184.861 245.108 210.488 1.00 176.71 ? 313  GLY J CA 1 
ATOM 3952 C CA . HIS I 8  314  ? 184.234 241.420 211.167 1.00 300.32 ? 314  HIS J CA 1 
ATOM 3953 C CA . LYS I 8  315  ? 187.882 241.128 212.419 1.00 246.28 ? 315  LYS J CA 1 
ATOM 3954 C CA . ASN I 8  316  ? 186.656 242.096 215.912 1.00 242.88 ? 316  ASN J CA 1 
ATOM 3955 C CA . GLU I 8  317  ? 187.933 238.806 217.344 1.00 149.25 ? 317  GLU J CA 1 
ATOM 3956 C CA . HIS I 8  318  ? 191.386 240.034 216.131 1.00 203.25 ? 318  HIS J CA 1 
ATOM 3957 C CA . ALA I 8  319  ? 190.998 243.664 217.201 1.00 138.64 ? 319  ALA J CA 1 
ATOM 3958 C CA . ARG I 8  320  ? 190.119 242.617 220.710 1.00 162.21 ? 320  ARG J CA 1 
ATOM 3959 C CA . ARG I 8  321  ? 193.217 240.371 220.604 1.00 156.38 ? 321  ARG J CA 1 
ATOM 3960 C CA . TYR I 8  322  ? 195.558 243.341 219.878 1.00 126.15 ? 322  TYR J CA 1 
ATOM 3961 C CA . LEU I 8  323  ? 193.656 245.679 222.205 1.00 137.94 ? 323  LEU J CA 1 
ATOM 3962 C CA . SER I 8  324  ? 194.333 243.075 224.867 1.00 163.10 ? 324  SER J CA 1 
ATOM 3963 C CA . LYS I 8  325  ? 197.963 243.106 224.007 1.00 167.61 ? 325  LYS J CA 1 
ATOM 3964 C CA . ALA I 8  326  ? 198.009 246.920 224.228 1.00 139.21 ? 326  ALA J CA 1 
ATOM 3965 C CA . THR I 8  327  ? 196.207 247.133 227.502 1.00 172.15 ? 327  THR J CA 1 
ATOM 3966 C CA . THR I 8  328  ? 198.223 244.370 229.077 1.00 174.75 ? 328  THR J CA 1 
ATOM 3967 C CA . LEU I 8  329  ? 201.453 245.947 227.781 1.00 181.04 ? 329  LEU J CA 1 
ATOM 3968 C CA . GLU I 8  330  ? 200.576 249.185 229.561 1.00 168.40 ? 330  GLU J CA 1 
ATOM 3969 C CA . LYS I 8  331  ? 197.743 248.588 232.106 1.00 345.60 ? 331  LYS J CA 1 
ATOM 3970 C CA . THR I 8  332  ? 196.395 252.198 232.775 1.00 279.88 ? 332  THR J CA 1 
ATOM 3971 C CA . TYR I 8  333  ? 196.227 252.912 229.042 1.00 224.02 ? 333  TYR J CA 1 
ATOM 3972 C CA . GLY I 8  334  ? 192.670 254.129 228.899 1.00 207.50 ? 334  GLY J CA 1 
ATOM 3973 C CA . PRO I 8  335  ? 192.084 254.530 225.188 1.00 219.57 ? 335  PRO J CA 1 
ATOM 3974 C CA . ALA I 8  336  ? 192.842 250.878 224.459 1.00 228.34 ? 336  ALA J CA 1 
ATOM 3975 C CA . TRP I 8  337  ? 190.272 249.867 227.056 1.00 158.89 ? 337  TRP J CA 1 
ATOM 3976 C CA . ILE I 8  338  ? 187.542 251.970 225.674 1.00 146.68 ? 338  ILE J CA 1 
ATOM 3977 C CA . ALA I 8  339  ? 188.205 250.623 222.231 1.00 127.74 ? 339  ALA J CA 1 
ATOM 3978 C CA . TYR I 8  340  ? 187.996 247.132 223.660 1.00 151.57 ? 340  TYR J CA 1 
ATOM 3979 C CA . GLY I 8  341  ? 184.492 247.847 224.947 1.00 183.05 ? 341  GLY J CA 1 
ATOM 3980 C CA . HIS I 8  342  ? 183.410 249.253 221.576 1.00 147.92 ? 342  HIS J CA 1 
ATOM 3981 C CA . SER I 8  343  ? 184.313 245.996 219.879 1.00 154.83 ? 343  SER J CA 1 
ATOM 3982 C CA . PHE I 8  344  ? 181.694 244.230 221.896 1.00 156.27 ? 344  PHE J CA 1 
ATOM 3983 C CA . ALA I 8  345  ? 179.117 246.996 221.574 1.00 183.51 ? 345  ALA J CA 1 
ATOM 3984 C CA . VAL I 8  346  ? 179.393 247.077 217.747 1.00 191.65 ? 346  VAL J CA 1 
ATOM 3985 C CA . GLU I 8  347  ? 178.988 243.259 217.813 1.00 161.12 ? 347  GLU J CA 1 
ATOM 3986 C CA . SER I 8  348  ? 176.163 244.037 220.319 1.00 179.60 ? 348  SER J CA 1 
ATOM 3987 C CA . GLU I 8  349  ? 177.374 241.768 223.160 1.00 243.22 ? 349  GLU J CA 1 
ATOM 3988 C CA . HIS I 8  350  ? 176.453 244.178 226.000 1.00 202.38 ? 350  HIS J CA 1 
ATOM 3989 C CA . ASP I 8  351  ? 177.466 241.886 228.832 1.00 258.95 ? 351  ASP J CA 1 
ATOM 3990 C CA . GLN I 8  352  ? 181.043 241.787 227.770 1.00 138.32 ? 352  GLN J CA 1 
ATOM 3991 C CA . ALA I 8  353  ? 181.110 245.450 226.800 1.00 122.31 ? 353  ALA J CA 1 
ATOM 3992 C CA . MET I 8  354  ? 179.949 246.225 230.346 1.00 204.47 ? 354  MET J CA 1 
ATOM 3993 C CA . ALA I 8  355  ? 183.000 244.347 231.631 1.00 201.35 ? 355  ALA J CA 1 
ATOM 3994 C CA . ALA I 8  356  ? 185.439 246.280 229.464 1.00 186.90 ? 356  ALA J CA 1 
ATOM 3995 C CA . TYR I 8  357  ? 183.788 249.586 230.234 1.00 181.75 ? 357  TYR J CA 1 
ATOM 3996 C CA . PHE I 8  358  ? 183.829 249.009 233.955 1.00 344.19 ? 358  PHE J CA 1 
ATOM 3997 C CA . THR I 8  359  ? 187.477 248.004 233.828 1.00 190.98 ? 359  THR J CA 1 
ATOM 3998 C CA . ALA I 8  360  ? 188.087 251.204 231.836 1.00 199.70 ? 360  ALA J CA 1 
ATOM 3999 C CA . ALA I 8  361  ? 186.077 253.192 234.345 1.00 375.10 ? 361  ALA J CA 1 
ATOM 4000 C CA . GLN I 8  362  ? 188.011 251.802 237.272 1.00 388.10 ? 362  GLN J CA 1 
ATOM 4001 C CA . LEU I 8  363  ? 191.290 252.677 235.745 1.00 341.61 ? 363  LEU J CA 1 
ATOM 4002 C CA . MET I 8  364  ? 190.317 256.191 234.530 1.00 451.93 ? 364  MET J CA 1 
ATOM 4003 C CA . LYS I 8  365  ? 188.761 257.850 237.581 1.00 500.00 ? 365  LYS J CA 1 
ATOM 4004 C CA . GLY I 8  366  ? 187.835 261.435 236.626 1.00 500.00 ? 366  GLY J CA 1 
ATOM 4005 C CA . CYS I 8  367  ? 187.122 260.777 232.978 1.00 500.00 ? 367  CYS J CA 1 
ATOM 4006 C CA . HIS I 8  368  ? 183.363 260.886 232.324 1.00 500.00 ? 368  HIS J CA 1 
ATOM 4007 C CA . LEU I 8  369  ? 183.562 258.780 229.137 1.00 482.18 ? 369  LEU J CA 1 
ATOM 4008 C CA . PRO I 8  370  ? 183.579 255.252 230.571 1.00 465.84 ? 370  PRO J CA 1 
ATOM 4009 C CA . MET I 8  371  ? 180.636 255.977 232.915 1.00 482.54 ? 371  MET J CA 1 
ATOM 4010 C CA . LEU I 8  372  ? 178.799 257.500 230.021 1.00 454.78 ? 372  LEU J CA 1 
ATOM 4011 C CA . TYR I 8  373  ? 179.288 254.355 227.875 1.00 367.72 ? 373  TYR J CA 1 
ATOM 4012 C CA . ILE I 8  374  ? 178.144 252.079 230.788 1.00 395.01 ? 374  ILE J CA 1 
ATOM 4013 C CA . GLY I 8  375  ? 175.044 254.287 230.795 1.00 359.11 ? 375  GLY J CA 1 
ATOM 4014 C CA . LEU I 8  376  ? 174.426 253.895 227.062 1.00 155.99 ? 376  LEU J CA 1 
ATOM 4015 C CA . GLU I 8  377  ? 174.813 250.135 227.435 1.00 181.72 ? 377  GLU J CA 1 
ATOM 4016 C CA . TYR I 8  378  ? 172.287 249.892 230.133 1.00 407.00 ? 378  TYR J CA 1 
ATOM 4017 C CA . GLY I 8  379  ? 169.825 251.843 228.057 1.00 461.39 ? 379  GLY J CA 1 
ATOM 4018 C CA . LEU I 8  380  ? 170.107 249.433 225.200 1.00 363.48 ? 380  LEU J CA 1 
ATOM 4019 C CA . THR I 8  381  ? 169.430 246.584 227.556 1.00 500.00 ? 381  THR J CA 1 
ATOM 4020 C CA . ASN I 8  382  ? 166.321 248.552 228.658 1.00 500.00 ? 382  ASN J CA 1 
ATOM 4021 C CA . ASN I 8  383  ? 167.311 249.246 232.290 1.00 500.00 ? 383  ASN J CA 1 
ATOM 4022 C CA . SER I 8  384  ? 166.510 252.925 232.431 1.00 500.00 ? 384  SER J CA 1 
ATOM 4023 C CA . LYS I 8  385  ? 167.061 253.513 236.177 1.00 500.00 ? 385  LYS J CA 1 
ATOM 4024 C CA . LEU I 8  386  ? 170.602 252.158 236.030 1.00 500.00 ? 386  LEU J CA 1 
ATOM 4025 C CA . ALA I 8  387  ? 171.338 253.966 232.808 1.00 500.00 ? 387  ALA J CA 1 
ATOM 4026 C CA . GLU I 8  388  ? 169.992 257.205 234.342 1.00 500.00 ? 388  GLU J CA 1 
ATOM 4027 C CA . ARG I 8  389  ? 172.117 256.707 237.495 1.00 500.00 ? 389  ARG J CA 1 
ATOM 4028 C CA . PHE I 8  390  ? 175.315 256.467 235.440 1.00 500.00 ? 390  PHE J CA 1 
ATOM 4029 C CA . PHE I 8  391  ? 174.507 259.482 233.252 1.00 500.00 ? 391  PHE J CA 1 
ATOM 4030 C CA . SER I 8  392  ? 173.862 261.500 236.456 1.00 500.00 ? 392  SER J CA 1 
ATOM 4031 C CA . GLN I 8  393  ? 177.269 260.342 237.745 1.00 500.00 ? 393  GLN J CA 1 
ATOM 4032 C CA . ALA I 8  394  ? 178.903 261.248 234.362 1.00 500.00 ? 394  ALA J CA 1 
ATOM 4033 C CA . LEU I 8  395  ? 177.112 264.668 234.610 1.00 500.00 ? 395  LEU J CA 1 
ATOM 4034 C CA . SER I 8  396  ? 178.441 265.077 238.189 1.00 500.00 ? 396  SER J CA 1 
ATOM 4035 C CA . ILE I 8  397  ? 181.923 265.037 236.529 1.00 500.00 ? 397  ILE J CA 1 
ATOM 4036 C CA . ALA I 8  398  ? 182.583 267.720 233.810 1.00 500.00 ? 398  ALA J CA 1 
ATOM 4037 C CA . PRO I 8  399  ? 179.026 269.134 233.558 1.00 500.00 ? 399  PRO J CA 1 
ATOM 4038 C CA . GLU I 8  400  ? 179.287 271.161 230.335 1.00 500.00 ? 400  GLU J CA 1 
ATOM 4039 C CA . ASP I 8  401  ? 179.508 268.215 227.967 1.00 500.00 ? 401  ASP J CA 1 
ATOM 4040 C CA . PRO I 8  402  ? 177.324 268.038 224.868 1.00 500.00 ? 402  PRO J CA 1 
ATOM 4041 C CA . PHE I 8  403  ? 177.569 264.236 224.834 1.00 432.77 ? 403  PHE J CA 1 
ATOM 4042 C CA . VAL I 8  404  ? 176.394 263.649 228.357 1.00 500.00 ? 404  VAL J CA 1 
ATOM 4043 C CA . MET I 8  405  ? 173.664 266.238 228.089 1.00 500.00 ? 405  MET J CA 1 
ATOM 4044 C CA . HIS I 8  406  ? 172.348 264.739 224.914 1.00 500.00 ? 406  HIS J CA 1 
ATOM 4045 C CA . GLU I 8  407  ? 172.235 261.283 226.506 1.00 500.00 ? 407  GLU J CA 1 
ATOM 4046 C CA . VAL I 8  408  ? 170.287 262.466 229.576 1.00 500.00 ? 408  VAL J CA 1 
ATOM 4047 C CA . GLY I 8  409  ? 167.902 264.060 227.084 1.00 500.00 ? 409  GLY J CA 1 
ATOM 4048 C CA . VAL I 8  410  ? 167.401 260.773 225.286 1.00 500.00 ? 410  VAL J CA 1 
ATOM 4049 C CA . VAL I 8  411  ? 166.619 258.940 228.494 1.00 500.00 ? 411  VAL J CA 1 
ATOM 4050 C CA . ALA I 8  412  ? 164.248 261.710 229.592 1.00 500.00 ? 412  ALA J CA 1 
ATOM 4051 C CA . PHE I 8  413  ? 162.663 261.329 226.205 1.00 500.00 ? 413  PHE J CA 1 
ATOM 4052 C CA . GLN I 8  414  ? 162.066 257.558 226.880 1.00 500.00 ? 414  GLN J CA 1 
ATOM 4053 C CA . ASN I 8  415  ? 160.321 258.516 230.163 1.00 500.00 ? 415  ASN J CA 1 
ATOM 4054 C CA . GLY I 8  416  ? 158.172 260.850 228.106 1.00 500.00 ? 416  GLY J CA 1 
ATOM 4055 C CA . GLU I 8  417  ? 158.904 263.954 230.178 1.00 500.00 ? 417  GLU J CA 1 
ATOM 4056 C CA . TRP I 8  418  ? 159.207 266.082 226.981 1.00 500.00 ? 418  TRP J CA 1 
ATOM 4057 C CA . LYS I 8  419  ? 159.864 269.347 228.810 1.00 500.00 ? 419  LYS J CA 1 
ATOM 4058 C CA . THR I 8  420  ? 162.953 268.026 230.523 1.00 500.00 ? 420  THR J CA 1 
ATOM 4059 C CA . ALA I 8  421  ? 164.193 266.389 227.306 1.00 500.00 ? 421  ALA J CA 1 
ATOM 4060 C CA . GLU I 8  422  ? 163.807 269.670 225.390 1.00 500.00 ? 422  GLU J CA 1 
ATOM 4061 C CA . LYS I 8  423  ? 165.683 271.467 228.172 1.00 500.00 ? 423  LYS J CA 1 
ATOM 4062 C CA . TRP I 8  424  ? 168.507 268.971 227.930 1.00 500.00 ? 424  TRP J CA 1 
ATOM 4063 C CA . PHE I 8  425  ? 168.771 269.116 224.153 1.00 500.00 ? 425  PHE J CA 1 
ATOM 4064 C CA . LEU I 8  426  ? 168.663 272.928 224.127 1.00 500.00 ? 426  LEU J CA 1 
ATOM 4065 C CA . ASP I 8  427  ? 171.377 272.982 226.779 1.00 500.00 ? 427  ASP J CA 1 
ATOM 4066 C CA . ALA I 8  428  ? 173.423 270.574 224.682 1.00 500.00 ? 428  ALA J CA 1 
ATOM 4067 C CA . LEU I 8  429  ? 172.996 272.824 221.577 1.00 500.00 ? 429  LEU J CA 1 
ATOM 4068 C CA . GLU I 8  430  ? 174.216 275.898 223.519 1.00 500.00 ? 430  GLU J CA 1 
ATOM 4069 C CA . LYS I 8  431  ? 177.395 274.076 224.598 1.00 500.00 ? 431  LYS J CA 1 
ATOM 4070 C CA . ILE I 8  432  ? 177.963 272.769 221.051 1.00 500.00 ? 432  ILE J CA 1 
ATOM 4071 C CA . LYS I 8  433  ? 177.158 276.168 219.531 1.00 500.00 ? 433  LYS J CA 1 
ATOM 4072 C CA . ALA I 8  434  ? 180.362 277.595 220.974 1.00 500.00 ? 434  ALA J CA 1 
ATOM 4073 C CA . ILE I 8  435  ? 182.454 275.724 218.282 1.00 500.00 ? 435  ILE J CA 1 
ATOM 4074 C CA . GLY I 8  436  ? 180.496 277.165 215.336 1.00 500.00 ? 436  GLY J CA 1 
ATOM 4075 C CA . ASN I 8  437  ? 177.564 279.563 214.922 1.00 500.00 ? 437  ASN J CA 1 
ATOM 4076 C CA . GLU I 8  438  ? 175.721 276.899 212.940 1.00 500.00 ? 438  GLU J CA 1 
ATOM 4077 C CA . VAL I 8  439  ? 176.574 273.268 213.761 1.00 500.00 ? 439  VAL J CA 1 
ATOM 4078 C CA . THR I 8  440  ? 178.806 271.778 211.005 1.00 500.00 ? 440  THR J CA 1 
ATOM 4079 C CA . VAL I 8  441  ? 180.403 268.840 212.792 1.00 393.41 ? 441  VAL J CA 1 
ATOM 4080 C CA . ASP I 8  442  ? 178.286 265.995 211.362 1.00 227.70 ? 442  ASP J CA 1 
ATOM 4081 C CA . LYS I 8  443  ? 178.571 263.846 214.460 1.00 177.46 ? 443  LYS J CA 1 
ATOM 4082 C CA . TRP I 8  444  ? 175.759 265.991 215.945 1.00 329.84 ? 444  TRP J CA 1 
ATOM 4083 C CA . GLU I 8  445  ? 173.349 265.266 213.192 1.00 218.25 ? 445  GLU J CA 1 
ATOM 4084 C CA . PRO I 8  446  ? 171.393 263.262 215.760 1.00 160.99 ? 446  PRO J CA 1 
ATOM 4085 C CA . LEU I 8  447  ? 171.167 266.169 218.183 1.00 351.24 ? 447  LEU J CA 1 
ATOM 4086 C CA . LEU I 8  448  ? 169.398 268.403 215.786 1.00 470.45 ? 448  LEU J CA 1 
ATOM 4087 C CA . ASN I 8  449  ? 167.054 265.537 214.761 1.00 487.07 ? 449  ASN J CA 1 
ATOM 4088 C CA . ASN I 8  450  ? 166.321 264.808 218.397 1.00 383.84 ? 450  ASN J CA 1 
ATOM 4089 C CA . LEU I 8  451  ? 165.439 268.286 219.179 1.00 488.11 ? 451  LEU J CA 1 
ATOM 4090 C CA . GLY I 8  452  ? 163.077 268.469 216.244 1.00 500.00 ? 452  GLY J CA 1 
ATOM 4091 C CA . HIS I 8  453  ? 161.315 265.330 217.502 1.00 500.00 ? 453  HIS J CA 1 
ATOM 4092 C CA . VAL I 8  454  ? 160.898 266.843 220.979 1.00 500.00 ? 454  VAL J CA 1 
ATOM 4093 C CA . CYS I 8  455  ? 159.485 270.017 219.410 1.00 500.00 ? 455  CYS J CA 1 
ATOM 4094 C CA . ARG I 8  456  ? 156.928 267.893 217.507 1.00 500.00 ? 456  ARG J CA 1 
ATOM 4095 C CA . LYS I 8  457  ? 155.772 266.350 220.818 1.00 500.00 ? 457  LYS J CA 1 
ATOM 4096 C CA . LEU I 8  458  ? 155.611 269.863 222.363 1.00 500.00 ? 458  LEU J CA 1 
ATOM 4097 C CA . LYS I 8  459  ? 153.277 270.823 219.477 1.00 500.00 ? 459  LYS J CA 1 
ATOM 4098 C CA . LYS I 8  460  ? 155.687 273.594 218.508 1.00 500.00 ? 460  LYS J CA 1 
ATOM 4099 C CA . TYR I 8  461  ? 155.596 272.647 214.813 1.00 500.00 ? 461  TYR J CA 1 
ATOM 4100 C CA . ALA I 8  462  ? 157.460 275.735 213.426 1.00 500.00 ? 462  ALA J CA 1 
ATOM 4101 C CA . GLU I 8  463  ? 160.506 275.018 215.535 1.00 500.00 ? 463  GLU J CA 1 
ATOM 4102 C CA . ALA I 8  464  ? 160.384 271.316 214.708 1.00 500.00 ? 464  ALA J CA 1 
ATOM 4103 C CA . LEU I 8  465  ? 160.345 271.955 210.920 1.00 500.00 ? 465  LEU J CA 1 
ATOM 4104 C CA . ASP I 8  466  ? 163.303 274.282 211.303 1.00 500.00 ? 466  ASP J CA 1 
ATOM 4105 C CA . TYR I 8  467  ? 165.481 271.840 213.225 1.00 500.00 ? 467  TYR J CA 1 
ATOM 4106 C CA . HIS I 8  468  ? 164.934 268.925 210.864 1.00 500.00 ? 468  HIS J CA 1 
ATOM 4107 C CA . ARG I 8  469  ? 165.992 271.223 208.001 1.00 500.00 ? 469  ARG J CA 1 
ATOM 4108 C CA . GLN I 8  470  ? 169.203 272.138 209.803 1.00 500.00 ? 470  GLN J CA 1 
ATOM 4109 C CA . ALA I 8  471  ? 169.696 268.377 210.437 1.00 449.25 ? 471  ALA J CA 1 
ATOM 4110 C CA . LEU I 8  472  ? 169.041 267.724 206.720 1.00 230.30 ? 472  LEU J CA 1 
ATOM 4111 C CA . VAL I 8  473  ? 171.549 270.408 205.849 1.00 346.35 ? 473  VAL J CA 1 
ATOM 4112 C CA . LEU I 8  474  ? 174.096 268.672 208.045 1.00 331.00 ? 474  LEU J CA 1 
ATOM 4113 C CA . ILE I 8  475  ? 173.594 265.235 206.511 1.00 135.14 ? 475  ILE J CA 1 
ATOM 4114 C CA . PRO I 8  476  ? 171.863 265.635 203.240 1.00 147.09 ? 476  PRO J CA 1 
ATOM 4115 C CA . GLN I 8  477  ? 170.525 262.246 202.327 1.00 165.69 ? 477  GLN J CA 1 
ATOM 4116 C CA . ASN I 8  478  ? 168.896 261.017 205.479 1.00 207.98 ? 478  ASN J CA 1 
ATOM 4117 C CA . ALA I 8  479  ? 165.712 258.999 204.850 1.00 221.63 ? 479  ALA J CA 1 
ATOM 4118 C CA . SER I 8  480  ? 164.404 259.438 208.414 1.00 187.74 ? 480  SER J CA 1 
ATOM 4119 C CA . THR I 8  481  ? 164.777 263.227 208.245 1.00 259.85 ? 481  THR J CA 1 
ATOM 4120 C CA . TYR I 8  482  ? 162.629 263.326 205.181 1.00 389.26 ? 482  TYR J CA 1 
ATOM 4121 C CA . SER I 8  483  ? 160.020 261.194 206.844 1.00 399.14 ? 483  SER J CA 1 
ATOM 4122 C CA . ALA I 8  484  ? 160.206 263.336 209.971 1.00 500.00 ? 484  ALA J CA 1 
ATOM 4123 C CA . ILE I 8  485  ? 159.872 266.552 207.932 1.00 500.00 ? 485  ILE J CA 1 
ATOM 4124 C CA . GLY I 8  486  ? 157.005 265.037 206.039 1.00 500.00 ? 486  GLY J CA 1 
ATOM 4125 C CA . TYR I 8  487  ? 155.342 264.068 209.254 1.00 500.00 ? 487  TYR J CA 1 
ATOM 4126 C CA . ILE I 8  488  ? 155.516 267.549 210.729 1.00 500.00 ? 488  ILE J CA 1 
ATOM 4127 C CA . HIS I 8  489  ? 153.836 268.792 207.537 1.00 500.00 ? 489  HIS J CA 1 
ATOM 4128 C CA . SER I 8  490  ? 150.979 266.312 207.796 1.00 500.00 ? 490  SER J CA 1 
ATOM 4129 C CA . LEU I 8  491  ? 150.293 267.353 211.389 1.00 500.00 ? 491  LEU J CA 1 
ATOM 4130 C CA . MET I 8  492  ? 150.233 271.018 210.442 1.00 500.00 ? 492  MET J CA 1 
ATOM 4131 C CA . GLY I 8  493  ? 147.521 270.457 207.872 1.00 500.00 ? 493  GLY J CA 1 
ATOM 4132 C CA . ASN I 8  494  ? 149.958 270.863 204.958 1.00 500.00 ? 494  ASN J CA 1 
ATOM 4133 C CA . PHE I 8  495  ? 149.153 267.487 203.324 1.00 500.00 ? 495  PHE J CA 1 
ATOM 4134 C CA . GLU I 8  496  ? 150.370 268.419 199.802 1.00 500.00 ? 496  GLU J CA 1 
ATOM 4135 C CA . ASN I 8  497  ? 153.849 269.385 201.084 1.00 500.00 ? 497  ASN J CA 1 
ATOM 4136 C CA . ALA I 8  498  ? 153.954 266.345 203.343 1.00 500.00 ? 498  ALA J CA 1 
ATOM 4137 C CA . VAL I 8  499  ? 153.153 263.852 200.575 1.00 500.00 ? 499  VAL J CA 1 
ATOM 4138 C CA . ASP I 8  500  ? 156.076 265.187 198.532 1.00 500.00 ? 500  ASP J CA 1 
ATOM 4139 C CA . TYR I 8  501  ? 158.436 264.478 201.431 1.00 500.00 ? 501  TYR J CA 1 
ATOM 4140 C CA . PHE I 8  502  ? 157.101 261.023 202.313 1.00 451.42 ? 502  PHE J CA 1 
ATOM 4141 C CA . HIS I 8  503  ? 157.642 260.101 198.661 1.00 292.38 ? 503  HIS J CA 1 
ATOM 4142 C CA . THR I 8  504  ? 161.284 261.203 198.828 1.00 176.74 ? 504  THR J CA 1 
ATOM 4143 C CA . ALA I 8  505  ? 161.918 259.293 202.033 1.00 173.95 ? 505  ALA J CA 1 
ATOM 4144 C CA . LEU I 8  506  ? 160.402 256.194 200.490 1.00 189.65 ? 506  LEU J CA 1 
ATOM 4145 C CA . GLY I 8  507  ? 162.744 256.499 197.532 1.00 227.28 ? 507  GLY J CA 1 
ATOM 4146 C CA . LEU I 8  508  ? 165.723 256.528 199.888 1.00 179.35 ? 508  LEU J CA 1 
ATOM 4147 C CA . ARG I 8  509  ? 164.455 253.648 202.026 1.00 202.36 ? 509  ARG J CA 1 
ATOM 4148 C CA . ARG I 8  510  ? 161.852 251.424 200.416 1.00 245.97 ? 510  ARG J CA 1 
ATOM 4149 C CA . ASP I 8  511  ? 162.100 249.348 203.605 1.00 265.64 ? 511  ASP J CA 1 
ATOM 4150 C CA . ASP I 8  512  ? 160.749 251.995 206.097 1.00 255.15 ? 512  ASP J CA 1 
ATOM 4151 C CA . THR I 8  513  ? 157.256 250.937 207.257 1.00 272.59 ? 513  THR J CA 1 
ATOM 4152 C CA . PHE I 8  514  ? 156.447 254.103 209.143 1.00 215.29 ? 514  PHE J CA 1 
ATOM 4153 C CA . SER I 8  515  ? 156.900 256.386 206.227 1.00 176.67 ? 515  SER J CA 1 
ATOM 4154 C CA . VAL I 8  516  ? 154.860 254.015 203.982 1.00 197.20 ? 516  VAL J CA 1 
ATOM 4155 C CA . THR I 8  517  ? 151.918 253.705 206.394 1.00 256.18 ? 517  THR J CA 1 
ATOM 4156 C CA . MET I 8  518  ? 152.041 257.403 207.262 1.00 169.20 ? 518  MET J CA 1 
ATOM 4157 C CA . LEU I 8  519  ? 151.957 258.121 203.525 1.00 201.67 ? 519  LEU J CA 1 
ATOM 4158 C CA . GLY I 8  520  ? 148.719 256.213 203.072 1.00 198.87 ? 520  GLY J CA 1 
ATOM 4159 C CA . HIS I 8  521  ? 146.899 258.307 205.642 1.00 404.33 ? 521  HIS J CA 1 
ATOM 4160 C CA . CYS I 8  522  ? 148.061 261.681 204.336 1.00 483.89 ? 522  CYS J CA 1 
ATOM 4161 C CA . ILE I 8  523  ? 146.945 260.716 200.854 1.00 500.00 ? 523  ILE J CA 1 
ATOM 4162 C CA . GLU I 8  524  ? 143.454 259.823 202.098 1.00 500.00 ? 524  GLU J CA 1 
ATOM 4163 C CA . MET I 8  525  ? 143.426 263.261 203.820 1.00 500.00 ? 525  MET J CA 1 
ATOM 4164 C CA . TYR I 8  526  ? 144.707 265.050 200.669 1.00 500.00 ? 526  TYR J CA 1 
ATOM 4165 C CA . ILE I 8  527  ? 141.780 263.618 198.661 1.00 500.00 ? 527  ILE J CA 1 
ATOM 4166 C CA . GLY I 8  528  ? 139.243 264.867 201.261 1.00 500.00 ? 528  GLY J CA 1 
ATOM 4167 C CA . ASP I 8  529  ? 140.330 268.526 200.954 1.00 500.00 ? 529  ASP J CA 1 
ATOM 4168 C CA . SER I 8  530  ? 141.018 268.332 197.171 1.00 500.00 ? 530  SER J CA 1 
ATOM 4169 C CA . GLU I 8  531  ? 139.458 270.431 194.389 1.00 500.00 ? 531  GLU J CA 1 
ATOM 4170 C CA . ALA I 8  532  ? 140.919 268.831 191.190 1.00 500.00 ? 532  ALA J CA 1 
ATOM 4171 C CA . TYR I 8  533  ? 139.426 271.307 188.623 1.00 500.00 ? 533  TYR J CA 1 
ATOM 4172 C CA . ASN J 8  2    ? 215.118 283.402 229.228 1.00 455.15 ? 2    ASN K CA 1 
ATOM 4173 C CA . LEU J 8  3    ? 216.515 280.841 226.818 1.00 385.80 ? 3    LEU K CA 1 
ATOM 4174 C CA . GLU J 8  4    ? 219.707 280.602 228.907 1.00 215.82 ? 4    GLU K CA 1 
ATOM 4175 C CA . ARG J 8  5    ? 217.691 279.867 232.062 1.00 264.32 ? 5    ARG K CA 1 
ATOM 4176 C CA . LEU J 8  6    ? 215.582 277.243 230.284 1.00 398.07 ? 6    LEU K CA 1 
ATOM 4177 C CA . ARG J 8  7    ? 218.683 275.520 228.903 1.00 236.88 ? 7    ARG K CA 1 
ATOM 4178 C CA . LYS J 8  8    ? 220.245 275.278 232.336 1.00 220.30 ? 8    LYS K CA 1 
ATOM 4179 C CA . ARG J 8  9    ? 216.880 273.848 233.474 1.00 314.86 ? 9    ARG K CA 1 
ATOM 4180 C CA . VAL J 8  10   ? 216.656 271.185 230.751 1.00 275.66 ? 10   VAL K CA 1 
ATOM 4181 C CA . ARG J 8  11   ? 220.310 270.145 231.337 1.00 286.13 ? 11   ARG K CA 1 
ATOM 4182 C CA . GLN J 8  12   ? 219.815 269.900 235.102 1.00 262.25 ? 12   GLN K CA 1 
ATOM 4183 C CA . TYR J 8  13   ? 216.711 267.751 234.490 1.00 237.45 ? 13   TYR K CA 1 
ATOM 4184 C CA . LEU J 8  14   ? 218.865 265.372 232.474 1.00 255.03 ? 14   LEU K CA 1 
ATOM 4185 C CA . ASP J 8  15   ? 221.543 265.279 235.234 1.00 238.37 ? 15   ASP K CA 1 
ATOM 4186 C CA . GLN J 8  16   ? 218.676 264.676 237.702 1.00 240.46 ? 16   GLN K CA 1 
ATOM 4187 C CA . GLN J 8  17   ? 217.383 261.953 235.373 1.00 294.94 ? 17   GLN K CA 1 
ATOM 4188 C CA . GLN J 8  18   ? 213.859 263.282 234.887 1.00 297.92 ? 18   GLN K CA 1 
ATOM 4189 C CA . TYR J 8  19   ? 213.877 262.338 231.194 1.00 248.98 ? 19   TYR K CA 1 
ATOM 4190 C CA . GLN J 8  20   ? 210.224 262.704 230.268 1.00 168.20 ? 20   GLN K CA 1 
ATOM 4191 C CA . SER J 8  21   ? 210.246 266.169 231.800 1.00 167.66 ? 21   SER K CA 1 
ATOM 4192 C CA . ALA J 8  22   ? 213.542 267.233 230.183 1.00 199.54 ? 22   ALA K CA 1 
ATOM 4193 C CA . LEU J 8  23   ? 212.225 265.956 226.793 1.00 161.82 ? 23   LEU K CA 1 
ATOM 4194 C CA . PHE J 8  24   ? 209.237 268.211 227.068 1.00 302.98 ? 24   PHE K CA 1 
ATOM 4195 C CA . TRP J 8  25   ? 211.290 271.328 227.952 1.00 161.85 ? 25   TRP K CA 1 
ATOM 4196 C CA . ALA J 8  26   ? 214.029 270.380 225.498 1.00 208.70 ? 26   ALA K CA 1 
ATOM 4197 C CA . ASP J 8  27   ? 211.498 270.407 222.633 1.00 333.13 ? 27   ASP K CA 1 
ATOM 4198 C CA . LYS J 8  28   ? 210.123 273.852 223.647 1.00 323.78 ? 28   LYS K CA 1 
ATOM 4199 C CA . VAL J 8  29   ? 213.693 275.249 224.027 1.00 227.34 ? 29   VAL K CA 1 
ATOM 4200 C CA . ALA J 8  30   ? 214.314 274.323 220.408 1.00 426.65 ? 30   ALA K CA 1 
ATOM 4201 C CA . SER J 8  31   ? 211.181 276.024 219.229 1.00 447.06 ? 31   SER K CA 1 
ATOM 4202 C CA . LEU J 8  32   ? 211.569 279.185 221.358 1.00 458.59 ? 32   LEU K CA 1 
ATOM 4203 C CA . SER J 8  33   ? 215.225 279.540 220.347 1.00 479.73 ? 33   SER K CA 1 
ATOM 4204 C CA . ARG J 8  34   ? 214.376 278.547 216.734 1.00 490.70 ? 34   ARG K CA 1 
ATOM 4205 C CA . GLU J 8  35   ? 216.176 275.442 215.417 1.00 385.04 ? 35   GLU K CA 1 
ATOM 4206 C CA . GLU J 8  36   ? 219.849 275.836 216.426 1.00 386.30 ? 36   GLU K CA 1 
ATOM 4207 C CA . PRO J 8  37   ? 222.801 273.404 216.268 1.00 277.26 ? 37   PRO K CA 1 
ATOM 4208 C CA . GLN J 8  38   ? 223.275 273.184 220.009 1.00 232.95 ? 38   GLN K CA 1 
ATOM 4209 C CA . ASP J 8  39   ? 219.593 273.363 220.958 1.00 254.11 ? 39   ASP K CA 1 
ATOM 4210 C CA . ILE J 8  40   ? 218.519 270.499 218.634 1.00 198.38 ? 40   ILE K CA 1 
ATOM 4211 C CA . TYR J 8  41   ? 221.427 268.468 220.081 1.00 184.31 ? 41   TYR K CA 1 
ATOM 4212 C CA . TRP J 8  42   ? 219.740 268.401 223.475 1.00 165.03 ? 42   TRP K CA 1 
ATOM 4213 C CA . LEU J 8  43   ? 216.371 267.509 221.977 1.00 168.40 ? 43   LEU K CA 1 
ATOM 4214 C CA . ALA J 8  44   ? 217.989 264.632 220.106 1.00 148.55 ? 44   ALA K CA 1 
ATOM 4215 C CA . GLN J 8  45   ? 219.867 263.613 223.253 1.00 156.62 ? 45   GLN K CA 1 
ATOM 4216 C CA . CYS J 8  46   ? 216.605 263.520 225.186 1.00 156.30 ? 46   CYS K CA 1 
ATOM 4217 C CA . LEU J 8  47   ? 214.942 261.354 222.656 1.00 161.89 ? 47   LEU K CA 1 
ATOM 4218 C CA . TYR J 8  48   ? 217.866 258.960 222.587 1.00 223.52 ? 48   TYR K CA 1 
ATOM 4219 C CA . LEU J 8  49   ? 217.976 258.401 226.258 1.00 169.96 ? 49   LEU K CA 1 
ATOM 4220 C CA . THR J 8  50   ? 214.152 258.269 226.244 1.00 192.77 ? 50   THR K CA 1 
ATOM 4221 C CA . ALA J 8  51   ? 214.406 255.167 223.983 1.00 184.61 ? 51   ALA K CA 1 
ATOM 4222 C CA . GLN J 8  52   ? 212.693 257.093 221.168 1.00 162.14 ? 52   GLN K CA 1 
ATOM 4223 C CA . TYR J 8  53   ? 215.391 256.322 218.715 1.00 162.51 ? 53   TYR K CA 1 
ATOM 4224 C CA . HIS J 8  54   ? 213.499 256.706 215.492 1.00 176.94 ? 54   HIS K CA 1 
ATOM 4225 C CA . ARG J 8  55   ? 212.502 260.232 216.596 1.00 209.03 ? 55   ARG K CA 1 
ATOM 4226 C CA . ALA J 8  56   ? 216.067 261.180 217.683 1.00 165.42 ? 56   ALA K CA 1 
ATOM 4227 C CA . ALA J 8  57   ? 217.506 260.023 214.366 1.00 164.51 ? 57   ALA K CA 1 
ATOM 4228 C CA . HIS J 8  58   ? 214.810 261.876 212.465 1.00 193.35 ? 58   HIS K CA 1 
ATOM 4229 C CA . ALA J 8  59   ? 215.496 265.143 214.320 1.00 223.39 ? 59   ALA K CA 1 
ATOM 4230 C CA . LEU J 8  60   ? 219.193 265.069 213.566 1.00 188.78 ? 60   LEU K CA 1 
ATOM 4231 C CA . ARG J 8  61   ? 219.100 263.704 210.015 1.00 209.13 ? 61   ARG K CA 1 
ATOM 4232 C CA . SER J 8  62   ? 216.335 266.078 208.866 1.00 170.82 ? 62   SER K CA 1 
ATOM 4233 C CA . ARG J 8  63   ? 218.018 269.424 208.568 1.00 191.26 ? 63   ARG K CA 1 
ATOM 4234 C CA . LYS J 8  64   ? 221.393 267.691 207.825 1.00 196.99 ? 64   LYS K CA 1 
ATOM 4235 C CA . LEU J 8  65   ? 222.722 268.481 211.315 1.00 198.86 ? 65   LEU K CA 1 
ATOM 4236 C CA . ASP J 8  66   ? 224.709 265.258 211.398 1.00 238.89 ? 66   ASP K CA 1 
ATOM 4237 C CA . LYS J 8  67   ? 227.005 266.246 208.530 1.00 234.99 ? 67   LYS K CA 1 
ATOM 4238 C CA . LEU J 8  68   ? 227.659 269.729 209.893 1.00 218.89 ? 68   LEU K CA 1 
ATOM 4239 C CA . TYR J 8  69   ? 228.850 268.580 213.395 1.00 231.82 ? 69   TYR K CA 1 
ATOM 4240 C CA . GLU J 8  70   ? 230.745 265.477 214.452 1.00 211.85 ? 70   GLU K CA 1 
ATOM 4241 C CA . ALA J 8  71   ? 228.880 265.345 217.792 1.00 212.87 ? 71   ALA K CA 1 
ATOM 4242 C CA . CYS J 8  72   ? 225.511 265.276 216.092 1.00 228.44 ? 72   CYS K CA 1 
ATOM 4243 C CA . ARG J 8  73   ? 226.708 262.663 213.554 1.00 171.29 ? 73   ARG K CA 1 
ATOM 4244 C CA . TYR J 8  74   ? 227.901 260.509 216.459 1.00 183.35 ? 74   TYR K CA 1 
ATOM 4245 C CA . LEU J 8  75   ? 224.510 260.740 218.138 1.00 164.37 ? 75   LEU K CA 1 
ATOM 4246 C CA . ALA J 8  76   ? 222.516 259.952 214.963 1.00 175.40 ? 76   ALA K CA 1 
ATOM 4247 C CA . ALA J 8  77   ? 224.772 256.924 214.377 1.00 127.05 ? 77   ALA K CA 1 
ATOM 4248 C CA . ARG J 8  78   ? 224.265 255.977 217.993 1.00 164.21 ? 78   ARG K CA 1 
ATOM 4249 C CA . CYS J 8  79   ? 220.516 256.079 217.576 1.00 198.67 ? 79   CYS K CA 1 
ATOM 4250 C CA . HIS J 8  80   ? 220.549 253.808 214.546 1.00 200.37 ? 80   HIS K CA 1 
ATOM 4251 C CA . TYR J 8  81   ? 222.706 251.362 216.391 1.00 332.62 ? 81   TYR K CA 1 
ATOM 4252 C CA . ALA J 8  82   ? 220.382 251.363 219.419 1.00 171.93 ? 82   ALA K CA 1 
ATOM 4253 C CA . ALA J 8  83   ? 217.562 250.787 216.904 1.00 274.44 ? 83   ALA K CA 1 
ATOM 4254 C CA . LYS J 8  84   ? 219.555 247.722 215.732 1.00 266.14 ? 84   LYS K CA 1 
ATOM 4255 C CA . GLU J 8  85   ? 219.328 249.013 212.175 1.00 309.41 ? 85   GLU K CA 1 
ATOM 4256 C CA . HIS J 8  86   ? 223.092 248.567 211.354 1.00 242.69 ? 86   HIS K CA 1 
ATOM 4257 C CA . GLN J 8  87   ? 224.630 249.456 208.006 1.00 228.68 ? 87   GLN K CA 1 
ATOM 4258 C CA . GLN J 8  88   ? 222.625 252.693 208.087 1.00 252.16 ? 88   GLN K CA 1 
ATOM 4259 C CA . ALA J 8  89   ? 224.486 253.656 211.241 1.00 220.73 ? 89   ALA K CA 1 
ATOM 4260 C CA . LEU J 8  90   ? 227.764 252.692 209.465 1.00 239.82 ? 90   LEU K CA 1 
ATOM 4261 C CA . ASP J 8  91   ? 226.675 254.786 206.467 1.00 286.20 ? 91   ASP K CA 1 
ATOM 4262 C CA . VAL J 8  92   ? 226.282 257.863 208.766 1.00 266.30 ? 92   VAL K CA 1 
ATOM 4263 C CA . LEU J 8  93   ? 229.977 257.402 209.738 1.00 194.32 ? 93   LEU K CA 1 
ATOM 4264 C CA . SER J 8  127  ? 236.797 264.568 222.643 1.00 293.71 ? 127  SER K CA 1 
ATOM 4265 C CA . ILE J 8  128  ? 234.424 262.533 220.465 1.00 221.47 ? 128  ILE K CA 1 
ATOM 4266 C CA . LYS J 8  129  ? 237.052 261.634 217.819 1.00 247.72 ? 129  LYS K CA 1 
ATOM 4267 C CA . SER J 8  130  ? 237.705 258.498 219.847 1.00 261.66 ? 130  SER K CA 1 
ATOM 4268 C CA . SER J 8  131  ? 234.264 257.526 221.030 1.00 217.16 ? 131  SER K CA 1 
ATOM 4269 C CA . ILE J 8  132  ? 232.904 257.749 217.492 1.00 213.81 ? 132  ILE K CA 1 
ATOM 4270 C CA . CYS J 8  133  ? 235.719 255.460 216.327 1.00 188.54 ? 133  CYS K CA 1 
ATOM 4271 C CA . LEU J 8  134  ? 234.668 253.003 218.996 1.00 177.74 ? 134  LEU K CA 1 
ATOM 4272 C CA . LEU J 8  135  ? 231.081 253.081 217.870 1.00 187.74 ? 135  LEU K CA 1 
ATOM 4273 C CA . ARG J 8  136  ? 232.240 252.251 214.287 1.00 187.25 ? 136  ARG K CA 1 
ATOM 4274 C CA . GLY J 8  137  ? 233.867 249.150 215.852 1.00 203.34 ? 137  GLY K CA 1 
ATOM 4275 C CA . LYS J 8  138  ? 230.726 248.306 217.794 1.00 194.93 ? 138  LYS K CA 1 
ATOM 4276 C CA . ILE J 8  139  ? 228.743 248.263 214.560 1.00 190.08 ? 139  ILE K CA 1 
ATOM 4277 C CA . TYR J 8  140  ? 231.239 246.051 212.718 1.00 193.94 ? 140  TYR K CA 1 
ATOM 4278 C CA . ASP J 8  141  ? 230.832 243.526 215.507 1.00 217.35 ? 141  ASP K CA 1 
ATOM 4279 C CA . ALA J 8  142  ? 227.083 243.506 214.957 1.00 240.74 ? 142  ALA K CA 1 
ATOM 4280 C CA . LEU J 8  143  ? 227.665 243.174 211.203 1.00 250.44 ? 143  LEU K CA 1 
ATOM 4281 C CA . ASP J 8  144  ? 229.971 240.231 212.104 1.00 292.79 ? 144  ASP K CA 1 
ATOM 4282 C CA . ASN J 8  145  ? 233.049 241.858 210.440 1.00 266.68 ? 145  ASN K CA 1 
ATOM 4283 C CA . ARG J 8  146  ? 235.179 240.919 213.402 1.00 241.51 ? 146  ARG K CA 1 
ATOM 4284 C CA . THR J 8  147  ? 238.484 241.612 211.607 1.00 289.13 ? 147  THR K CA 1 
ATOM 4285 C CA . LEU J 8  148  ? 237.380 245.171 210.761 1.00 258.28 ? 148  LEU K CA 1 
ATOM 4286 C CA . ALA J 8  149  ? 235.974 245.791 214.267 1.00 240.22 ? 149  ALA K CA 1 
ATOM 4287 C CA . THR J 8  150  ? 239.117 244.828 216.072 1.00 297.14 ? 150  THR K CA 1 
ATOM 4288 C CA . TYR J 8  151  ? 240.999 247.361 213.877 1.00 282.08 ? 151  TYR K CA 1 
ATOM 4289 C CA . SER J 8  152  ? 238.407 250.059 214.727 1.00 231.51 ? 152  SER K CA 1 
ATOM 4290 C CA . TYR J 8  153  ? 238.652 249.385 218.503 1.00 190.04 ? 153  TYR K CA 1 
ATOM 4291 C CA . LYS J 8  154  ? 242.461 249.696 218.303 1.00 201.93 ? 154  LYS K CA 1 
ATOM 4292 C CA . GLU J 8  155  ? 242.049 253.076 216.642 1.00 221.73 ? 155  GLU K CA 1 
ATOM 4293 C CA . ALA J 8  156  ? 239.606 254.162 219.391 1.00 227.33 ? 156  ALA K CA 1 
ATOM 4294 C CA . LEU J 8  157  ? 242.155 253.099 222.016 1.00 436.21 ? 157  LEU K CA 1 
ATOM 4295 C CA . LYS J 8  158  ? 244.940 255.165 220.551 1.00 247.21 ? 158  LYS K CA 1 
ATOM 4296 C CA . LEU J 8  159  ? 242.941 258.410 220.636 1.00 227.71 ? 159  LEU K CA 1 
ATOM 4297 C CA . ASP J 8  160  ? 241.573 258.207 224.199 1.00 278.65 ? 160  ASP K CA 1 
ATOM 4298 C CA . VAL J 8  161  ? 243.529 255.541 226.134 1.00 381.84 ? 161  VAL K CA 1 
ATOM 4299 C CA . TYR J 8  162  ? 241.413 256.164 229.259 1.00 210.09 ? 162  TYR K CA 1 
ATOM 4300 C CA . CYS J 8  163  ? 238.264 254.598 227.731 1.00 300.85 ? 163  CYS K CA 1 
ATOM 4301 C CA . PHE J 8  164  ? 238.072 251.060 228.800 1.00 222.65 ? 164  PHE K CA 1 
ATOM 4302 C CA . GLU J 8  165  ? 235.022 250.078 226.761 1.00 228.44 ? 165  GLU K CA 1 
ATOM 4303 C CA . ALA J 8  166  ? 237.225 249.697 223.709 1.00 237.12 ? 166  ALA K CA 1 
ATOM 4304 C CA . PHE J 8  167  ? 239.931 247.961 225.724 1.00 333.63 ? 167  PHE K CA 1 
ATOM 4305 C CA . ASP J 8  168  ? 237.547 245.535 227.438 1.00 302.27 ? 168  ASP K CA 1 
ATOM 4306 C CA . LEU J 8  169  ? 236.124 244.613 224.063 1.00 270.16 ? 169  LEU K CA 1 
ATOM 4307 C CA . LEU J 8  170  ? 239.562 243.772 222.574 1.00 269.64 ? 170  LEU K CA 1 
ATOM 4308 C CA . THR J 8  171  ? 240.797 241.788 225.629 1.00 269.22 ? 171  THR K CA 1 
ATOM 4309 C CA . SER J 8  172  ? 237.657 240.148 227.077 1.00 262.72 ? 172  SER K CA 1 
ATOM 4310 C CA . HIS J 8  173  ? 237.972 236.433 227.759 1.00 308.47 ? 173  HIS K CA 1 
ATOM 4311 C CA . HIS J 8  174  ? 241.621 235.973 226.705 1.00 282.22 ? 174  HIS K CA 1 
ATOM 4312 C CA . MET J 8  175  ? 241.609 237.410 223.192 1.00 253.83 ? 175  MET K CA 1 
ATOM 4313 C CA . LEU J 8  176  ? 244.872 238.650 221.602 1.00 233.44 ? 176  LEU K CA 1 
ATOM 4314 C CA . THR J 8  177  ? 247.337 235.753 222.088 1.00 221.27 ? 177  THR K CA 1 
ATOM 4315 C CA . ALA J 8  178  ? 249.194 237.286 225.104 1.00 275.88 ? 178  ALA K CA 1 
ATOM 4316 C CA . GLN J 8  179  ? 252.150 238.440 222.978 1.00 302.98 ? 179  GLN K CA 1 
ATOM 4317 C CA . GLU J 8  180  ? 250.104 241.105 221.227 1.00 237.07 ? 180  GLU K CA 1 
ATOM 4318 C CA . GLU J 8  181  ? 248.691 242.378 224.503 1.00 289.29 ? 181  GLU K CA 1 
ATOM 4319 C CA . LYS J 8  182  ? 252.263 243.286 225.550 1.00 291.97 ? 182  LYS K CA 1 
ATOM 4320 C CA . GLU J 8  183  ? 252.809 244.873 222.153 1.00 288.89 ? 183  GLU K CA 1 
ATOM 4321 C CA . LEU J 8  184  ? 249.347 246.527 222.275 1.00 259.94 ? 184  LEU K CA 1 
ATOM 4322 C CA . LEU J 8  185  ? 250.005 248.278 225.599 1.00 307.53 ? 185  LEU K CA 1 
ATOM 4323 C CA . GLU J 8  186  ? 253.437 249.443 224.252 1.00 352.69 ? 186  GLU K CA 1 
ATOM 4324 C CA . SER J 8  187  ? 251.733 250.525 220.974 1.00 336.76 ? 187  SER K CA 1 
ATOM 4325 C CA . LEU J 8  188  ? 249.327 252.993 222.703 1.00 276.87 ? 188  LEU K CA 1 
ATOM 4326 C CA . PRO J 8  189  ? 251.037 256.325 223.164 1.00 500.00 ? 189  PRO K CA 1 
ATOM 4327 C CA . LEU J 8  190  ? 250.303 256.534 226.920 1.00 500.00 ? 190  LEU K CA 1 
ATOM 4328 C CA . SER J 8  191  ? 252.442 259.690 226.938 1.00 500.00 ? 191  SER K CA 1 
ATOM 4329 C CA . LYS J 8  192  ? 253.209 261.110 230.363 1.00 500.00 ? 192  LYS K CA 1 
ATOM 4330 C CA . LEU J 8  193  ? 250.218 262.887 231.915 1.00 500.00 ? 193  LEU K CA 1 
ATOM 4331 C CA . CYS J 8  194  ? 251.862 263.228 235.342 1.00 500.00 ? 194  CYS K CA 1 
ATOM 4332 C CA . ASN J 8  195  ? 253.891 260.520 237.123 1.00 500.00 ? 195  ASN K CA 1 
ATOM 4333 C CA . GLU J 8  196  ? 250.784 259.184 238.981 1.00 500.00 ? 196  GLU K CA 1 
ATOM 4334 C CA . GLU J 8  197  ? 248.602 258.541 235.954 1.00 500.00 ? 197  GLU K CA 1 
ATOM 4335 C CA . GLN J 8  198  ? 251.371 256.733 234.003 1.00 500.00 ? 198  GLN K CA 1 
ATOM 4336 C CA . GLU J 8  199  ? 251.682 254.208 236.853 1.00 500.00 ? 199  GLU K CA 1 
ATOM 4337 C CA . LEU J 8  200  ? 247.923 253.977 237.363 1.00 480.00 ? 200  LEU K CA 1 
ATOM 4338 C CA . LEU J 8  201  ? 247.080 253.097 233.746 1.00 255.14 ? 201  LEU K CA 1 
ATOM 4339 C CA . ARG J 8  202  ? 249.956 250.584 233.428 1.00 221.61 ? 202  ARG K CA 1 
ATOM 4340 C CA . PHE J 8  203  ? 248.865 248.899 236.683 1.00 229.96 ? 203  PHE K CA 1 
ATOM 4341 C CA . LEU J 8  204  ? 245.232 248.579 235.569 1.00 188.42 ? 204  LEU K CA 1 
ATOM 4342 C CA . PHE J 8  205  ? 246.078 247.235 232.139 1.00 233.82 ? 205  PHE K CA 1 
ATOM 4343 C CA . GLU J 8  206  ? 248.747 244.881 233.597 1.00 288.52 ? 206  GLU K CA 1 
ATOM 4344 C CA . ASN J 8  207  ? 246.073 243.258 235.770 1.00 237.99 ? 207  ASN K CA 1 
ATOM 4345 C CA . LYS J 8  208  ? 243.898 242.213 232.883 1.00 211.74 ? 208  LYS K CA 1 
ATOM 4346 C CA . LEU J 8  209  ? 246.614 241.047 230.490 1.00 244.19 ? 209  LEU K CA 1 
ATOM 4347 C CA . LYS J 8  210  ? 248.962 239.287 232.868 1.00 295.54 ? 210  LYS K CA 1 
ATOM 4348 C CA . LYS J 8  211  ? 246.576 236.554 234.083 1.00 263.46 ? 211  LYS K CA 1 
ATOM 4349 C CA . TYR J 8  212  ? 249.494 234.068 234.173 1.00 232.98 ? 212  TYR K CA 1 
ATOM 4350 C CA . ASN J 8  213  ? 251.686 235.663 236.936 1.00 295.69 ? 213  ASN K CA 1 
ATOM 4351 C CA . LYS J 8  214  ? 251.447 233.884 240.315 1.00 242.87 ? 214  LYS K CA 1 
ATOM 4352 C CA . PRO J 8  215  ? 250.277 236.520 242.869 1.00 241.80 ? 215  PRO K CA 1 
ATOM 4353 C CA . SER J 8  216  ? 253.918 237.599 243.412 1.00 289.41 ? 216  SER K CA 1 
ATOM 4354 C CA . GLU J 8  217  ? 253.617 241.096 241.922 1.00 299.73 ? 217  GLU K CA 1 
ATOM 4355 C CA . THR J 8  218  ? 251.579 244.391 241.936 1.00 309.52 ? 218  THR K CA 1 
ATOM 4356 C CA . VAL J 8  219  ? 252.143 244.799 245.674 1.00 389.85 ? 219  VAL K CA 1 
ATOM 4357 C CA . ILE J 8  220  ? 254.181 247.969 244.811 1.00 428.12 ? 220  ILE K CA 1 
ATOM 4358 C CA . PRO J 8  221  ? 251.105 249.690 243.271 1.00 373.06 ? 221  PRO K CA 1 
ATOM 4359 C CA . GLU J 8  222  ? 249.148 248.900 246.433 1.00 500.00 ? 222  GLU K CA 1 
ATOM 4360 C CA . SER J 8  223  ? 251.769 250.603 248.656 1.00 500.00 ? 223  SER K CA 1 
ATOM 4361 C CA . VAL J 8  224  ? 251.065 253.633 246.554 1.00 500.00 ? 224  VAL K CA 1 
ATOM 4362 C CA . ASP J 8  225  ? 247.243 253.311 246.562 1.00 500.00 ? 225  ASP K CA 1 
ATOM 4363 C CA . GLY J 8  226  ? 244.071 251.831 248.163 1.00 281.53 ? 226  GLY K CA 1 
ATOM 4364 C CA . LEU J 8  227  ? 243.039 249.849 245.069 1.00 256.47 ? 227  LEU K CA 1 
ATOM 4365 C CA . GLN J 8  228  ? 243.993 246.733 247.073 1.00 323.93 ? 228  GLN K CA 1 
ATOM 4366 C CA . GLU J 8  229  ? 240.496 247.041 248.519 1.00 324.95 ? 229  GLU K CA 1 
ATOM 4367 C CA . ASN J 8  230  ? 238.871 247.384 245.065 1.00 257.25 ? 230  ASN K CA 1 
ATOM 4368 C CA . LEU J 8  231  ? 236.939 244.414 243.796 1.00 212.16 ? 231  LEU K CA 1 
ATOM 4369 C CA . ASP J 8  232  ? 238.418 244.537 240.286 1.00 240.07 ? 232  ASP K CA 1 
ATOM 4370 C CA . VAL J 8  233  ? 241.912 244.105 241.716 1.00 228.65 ? 233  VAL K CA 1 
ATOM 4371 C CA . VAL J 8  234  ? 240.868 241.196 243.945 1.00 201.64 ? 234  VAL K CA 1 
ATOM 4372 C CA . VAL J 8  235  ? 239.052 239.516 241.047 1.00 187.94 ? 235  VAL K CA 1 
ATOM 4373 C CA . SER J 8  236  ? 242.224 239.821 238.987 1.00 210.25 ? 236  SER K CA 1 
ATOM 4374 C CA . LEU J 8  237  ? 244.016 238.046 241.834 1.00 198.98 ? 237  LEU K CA 1 
ATOM 4375 C CA . ALA J 8  238  ? 241.389 235.248 241.793 1.00 213.53 ? 238  ALA K CA 1 
ATOM 4376 C CA . GLU J 8  239  ? 241.818 234.839 238.019 1.00 197.67 ? 239  GLU K CA 1 
ATOM 4377 C CA . ARG J 8  240  ? 245.507 234.338 238.628 1.00 237.88 ? 240  ARG K CA 1 
ATOM 4378 C CA . HIS J 8  241  ? 244.863 231.765 241.378 1.00 217.50 ? 241  HIS K CA 1 
ATOM 4379 C CA . TYR J 8  242  ? 242.430 229.930 239.060 1.00 223.53 ? 242  TYR K CA 1 
ATOM 4380 C CA . TYR J 8  243  ? 244.987 229.663 236.330 1.00 225.01 ? 243  TYR K CA 1 
ATOM 4381 C CA . ASN J 8  244  ? 247.470 228.240 238.903 1.00 188.96 ? 244  ASN K CA 1 
ATOM 4382 C CA . CYS J 8  245  ? 244.786 225.606 239.773 1.00 206.18 ? 245  CYS K CA 1 
ATOM 4383 C CA . ASP J 8  246  ? 244.649 226.908 243.425 1.00 280.75 ? 246  ASP K CA 1 
ATOM 4384 C CA . PHE J 8  247  ? 240.868 226.588 243.525 1.00 365.13 ? 247  PHE K CA 1 
ATOM 4385 C CA . LYS J 8  248  ? 240.199 226.855 247.298 1.00 186.44 ? 248  LYS K CA 1 
ATOM 4386 C CA . MET J 8  249  ? 242.220 230.076 247.395 1.00 369.87 ? 249  MET K CA 1 
ATOM 4387 C CA . CYS J 8  250  ? 240.402 231.432 244.370 1.00 358.06 ? 250  CYS K CA 1 
ATOM 4388 C CA . TYR J 8  251  ? 237.076 230.439 245.925 1.00 393.83 ? 251  TYR K CA 1 
ATOM 4389 C CA . LYS J 8  252  ? 237.886 232.154 249.218 1.00 382.69 ? 252  LYS K CA 1 
ATOM 4390 C CA . LEU J 8  253  ? 238.538 235.424 247.311 1.00 202.47 ? 253  LEU K CA 1 
ATOM 4391 C CA . THR J 8  254  ? 235.666 235.116 244.823 1.00 197.05 ? 254  THR K CA 1 
ATOM 4392 C CA . SER J 8  255  ? 233.142 234.296 247.598 1.00 245.31 ? 255  SER K CA 1 
ATOM 4393 C CA . VAL J 8  256  ? 234.084 237.525 249.450 1.00 336.30 ? 256  VAL K CA 1 
ATOM 4394 C CA . VAL J 8  257  ? 233.608 239.396 246.149 1.00 203.00 ? 257  VAL K CA 1 
ATOM 4395 C CA . MET J 8  258  ? 230.089 238.000 245.758 1.00 193.46 ? 258  MET K CA 1 
ATOM 4396 C CA . GLU J 8  259  ? 229.119 239.092 249.309 1.00 224.28 ? 259  GLU K CA 1 
ATOM 4397 C CA . LYS J 8  260  ? 230.490 242.656 248.962 1.00 206.53 ? 260  LYS K CA 1 
ATOM 4398 C CA . ASP J 8  261  ? 229.007 242.883 245.381 1.00 209.45 ? 261  ASP K CA 1 
ATOM 4399 C CA . PRO J 8  262  ? 226.137 240.558 244.630 1.00 204.44 ? 262  PRO K CA 1 
ATOM 4400 C CA . PHE J 8  263  ? 226.772 240.116 240.912 1.00 160.67 ? 263  PHE K CA 1 
ATOM 4401 C CA . HIS J 8  264  ? 230.060 241.652 239.865 1.00 188.44 ? 264  HIS K CA 1 
ATOM 4402 C CA . ALA J 8  265  ? 230.260 241.077 236.100 1.00 230.71 ? 265  ALA K CA 1 
ATOM 4403 C CA . SER J 8  266  ? 234.001 240.438 235.761 1.00 236.73 ? 266  SER K CA 1 
ATOM 4404 C CA . CYS J 8  267  ? 233.909 238.065 238.748 1.00 210.75 ? 267  CYS K CA 1 
ATOM 4405 C CA . LEU J 8  268  ? 231.184 235.701 237.385 1.00 172.01 ? 268  LEU K CA 1 
ATOM 4406 C CA . PRO J 8  269  ? 233.214 233.718 234.820 1.00 203.58 ? 269  PRO K CA 1 
ATOM 4407 C CA . VAL J 8  270  ? 235.850 233.201 237.530 1.00 157.86 ? 270  VAL K CA 1 
ATOM 4408 C CA . HIS J 8  271  ? 233.280 232.450 240.201 1.00 145.89 ? 271  HIS K CA 1 
ATOM 4409 C CA . ILE J 8  272  ? 231.387 229.995 237.964 1.00 154.38 ? 272  ILE K CA 1 
ATOM 4410 C CA . GLY J 8  273  ? 234.633 228.308 236.823 1.00 218.16 ? 273  GLY K CA 1 
ATOM 4411 C CA . THR J 8  274  ? 235.806 227.885 240.447 1.00 180.94 ? 274  THR K CA 1 
ATOM 4412 C CA . LEU J 8  275  ? 232.439 226.416 241.474 1.00 242.92 ? 275  LEU K CA 1 
ATOM 4413 C CA . VAL J 8  276  ? 232.579 223.887 238.613 1.00 262.42 ? 276  VAL K CA 1 
ATOM 4414 C CA . GLU J 8  277  ? 235.965 222.659 239.782 1.00 281.83 ? 277  GLU K CA 1 
ATOM 4415 C CA . LEU J 8  278  ? 234.985 222.473 243.475 1.00 212.11 ? 278  LEU K CA 1 
ATOM 4416 C CA . ASN J 8  279  ? 231.786 220.726 242.357 1.00 207.72 ? 279  ASN K CA 1 
ATOM 4417 C CA . LYS J 8  280  ? 229.490 223.026 244.493 1.00 204.27 ? 280  LYS K CA 1 
ATOM 4418 C CA . ALA J 8  281  ? 226.388 222.413 242.499 1.00 237.54 ? 281  ALA K CA 1 
ATOM 4419 C CA . ASN J 8  282  ? 224.145 223.886 245.128 1.00 202.95 ? 282  ASN K CA 1 
ATOM 4420 C CA . GLU J 8  283  ? 225.956 227.233 245.036 1.00 167.29 ? 283  GLU K CA 1 
ATOM 4421 C CA . LEU J 8  284  ? 225.930 227.210 241.268 1.00 258.81 ? 284  LEU K CA 1 
ATOM 4422 C CA . PHE J 8  285  ? 222.239 226.436 241.078 1.00 323.59 ? 285  PHE K CA 1 
ATOM 4423 C CA . TYR J 8  286  ? 221.464 229.328 243.389 1.00 176.35 ? 286  TYR K CA 1 
ATOM 4424 C CA . LEU J 8  287  ? 223.714 231.582 241.315 1.00 151.75 ? 287  LEU K CA 1 
ATOM 4425 C CA . SER J 8  288  ? 222.243 230.602 237.928 1.00 278.94 ? 288  SER K CA 1 
ATOM 4426 C CA . HIS J 8  289  ? 218.679 230.988 239.093 1.00 261.65 ? 289  HIS K CA 1 
ATOM 4427 C CA . LYS J 8  290  ? 219.467 234.372 240.572 1.00 120.87 ? 290  LYS K CA 1 
ATOM 4428 C CA . LEU J 8  291  ? 221.214 235.407 237.354 1.00 139.11 ? 291  LEU K CA 1 
ATOM 4429 C CA . VAL J 8  292  ? 218.387 234.635 235.017 1.00 143.52 ? 292  VAL K CA 1 
ATOM 4430 C CA . ASP J 8  293  ? 216.127 236.632 237.223 1.00 158.34 ? 293  ASP K CA 1 
ATOM 4431 C CA . LEU J 8  294  ? 218.432 239.650 237.274 1.00 145.93 ? 294  LEU K CA 1 
ATOM 4432 C CA . TYR J 8  295  ? 220.220 239.542 233.927 1.00 182.32 ? 295  TYR K CA 1 
ATOM 4433 C CA . PRO J 8  296  ? 218.059 237.589 231.475 1.00 160.37 ? 296  PRO K CA 1 
ATOM 4434 C CA . SER J 8  297  ? 219.574 239.698 228.688 1.00 344.39 ? 297  SER K CA 1 
ATOM 4435 C CA . ASN J 8  298  ? 223.248 238.932 229.389 1.00 248.06 ? 298  ASN K CA 1 
ATOM 4436 C CA . PRO J 8  299  ? 225.012 235.979 227.773 1.00 334.36 ? 299  PRO K CA 1 
ATOM 4437 C CA . VAL J 8  300  ? 226.757 235.159 231.036 1.00 172.33 ? 300  VAL K CA 1 
ATOM 4438 C CA . SER J 8  301  ? 223.501 234.284 232.760 1.00 227.75 ? 301  SER K CA 1 
ATOM 4439 C CA . TRP J 8  302  ? 222.753 231.545 230.281 1.00 130.90 ? 302  TRP K CA 1 
ATOM 4440 C CA . PHE J 8  303  ? 226.352 230.415 230.433 1.00 171.48 ? 303  PHE K CA 1 
ATOM 4441 C CA . ALA J 8  304  ? 225.885 229.921 234.186 1.00 127.71 ? 304  ALA K CA 1 
ATOM 4442 C CA . VAL J 8  305  ? 222.707 227.918 233.564 1.00 305.84 ? 305  VAL K CA 1 
ATOM 4443 C CA . GLY J 8  306  ? 224.347 225.759 230.910 1.00 360.82 ? 306  GLY K CA 1 
ATOM 4444 C CA . CYS J 8  307  ? 227.309 225.081 233.139 1.00 417.58 ? 307  CYS K CA 1 
ATOM 4445 C CA . TYR J 8  308  ? 225.112 224.028 235.996 1.00 444.40 ? 308  TYR K CA 1 
ATOM 4446 C CA . TYR J 8  309  ? 223.506 221.276 233.942 1.00 448.76 ? 309  TYR K CA 1 
ATOM 4447 C CA . LEU J 8  310  ? 227.079 220.187 233.097 1.00 437.25 ? 310  LEU K CA 1 
ATOM 4448 C CA . MET J 8  311  ? 228.130 219.810 236.722 1.00 334.49 ? 311  MET K CA 1 
ATOM 4449 C CA . VAL J 8  312  ? 225.122 217.696 237.578 1.00 156.23 ? 312  VAL K CA 1 
ATOM 4450 C CA . GLY J 8  313  ? 225.891 215.150 234.786 1.00 157.11 ? 313  GLY K CA 1 
ATOM 4451 C CA . HIS J 8  314  ? 223.413 213.282 232.568 1.00 296.52 ? 314  HIS K CA 1 
ATOM 4452 C CA . LYS J 8  315  ? 221.604 216.649 231.980 1.00 353.76 ? 315  LYS K CA 1 
ATOM 4453 C CA . ASN J 8  316  ? 223.925 217.503 229.045 1.00 189.11 ? 316  ASN K CA 1 
ATOM 4454 C CA . GLU J 8  317  ? 221.238 217.685 226.382 1.00 328.74 ? 317  GLU K CA 1 
ATOM 4455 C CA . HIS J 8  318  ? 219.879 220.640 228.480 1.00 464.70 ? 318  HIS K CA 1 
ATOM 4456 C CA . ALA J 8  319  ? 223.301 222.217 228.992 1.00 433.04 ? 319  ALA K CA 1 
ATOM 4457 C CA . ARG J 8  320  ? 223.953 222.305 225.332 1.00 298.07 ? 320  ARG K CA 1 
ATOM 4458 C CA . ARG J 8  321  ? 220.488 223.901 224.956 1.00 342.87 ? 321  ARG K CA 1 
ATOM 4459 C CA . TYR J 8  322  ? 221.368 226.839 227.260 1.00 363.32 ? 322  TYR K CA 1 
ATOM 4460 C CA . LEU J 8  323  ? 224.942 227.126 225.987 1.00 370.78 ? 323  LEU K CA 1 
ATOM 4461 C CA . SER J 8  324  ? 223.350 227.495 222.572 1.00 357.47 ? 324  SER K CA 1 
ATOM 4462 C CA . LYS J 8  325  ? 221.136 230.215 223.871 1.00 372.45 ? 325  LYS K CA 1 
ATOM 4463 C CA . ALA J 8  326  ? 224.126 231.997 225.408 1.00 414.37 ? 326  ALA K CA 1 
ATOM 4464 C CA . THR J 8  327  ? 226.310 231.775 222.363 1.00 456.58 ? 327  THR K CA 1 
ATOM 4465 C CA . THR J 8  328  ? 223.559 232.731 219.969 1.00 349.21 ? 328  THR K CA 1 
ATOM 4466 C CA . LEU J 8  329  ? 222.619 235.664 222.229 1.00 385.18 ? 329  LEU K CA 1 
ATOM 4467 C CA . GLU J 8  330  ? 226.196 236.976 222.018 1.00 420.31 ? 330  GLU K CA 1 
ATOM 4468 C CA . LYS J 8  331  ? 228.083 235.189 219.150 1.00 384.07 ? 331  LYS K CA 1 
ATOM 4469 C CA . THR J 8  332  ? 231.303 236.913 220.414 1.00 475.96 ? 332  THR K CA 1 
ATOM 4470 C CA . TYR J 8  333  ? 231.085 235.019 223.713 1.00 443.57 ? 333  TYR K CA 1 
ATOM 4471 C CA . GLY J 8  334  ? 233.812 232.410 224.314 1.00 466.13 ? 334  GLY K CA 1 
ATOM 4472 C CA . PRO J 8  335  ? 233.331 230.638 227.621 1.00 345.66 ? 335  PRO K CA 1 
ATOM 4473 C CA . ALA J 8  336  ? 229.880 229.508 226.327 1.00 372.83 ? 336  ALA K CA 1 
ATOM 4474 C CA . TRP J 8  337  ? 231.595 227.704 223.468 1.00 285.72 ? 337  TRP K CA 1 
ATOM 4475 C CA . ILE J 8  338  ? 234.084 225.893 225.661 1.00 132.26 ? 338  ILE K CA 1 
ATOM 4476 C CA . ALA J 8  339  ? 231.146 224.769 227.691 1.00 250.02 ? 339  ALA K CA 1 
ATOM 4477 C CA . TYR J 8  340  ? 229.377 223.845 224.490 1.00 235.05 ? 340  TYR K CA 1 
ATOM 4478 C CA . GLY J 8  341  ? 232.400 221.736 223.463 1.00 165.27 ? 341  GLY K CA 1 
ATOM 4479 C CA . HIS J 8  342  ? 232.429 220.004 226.841 1.00 144.65 ? 342  HIS K CA 1 
ATOM 4480 C CA . SER J 8  343  ? 228.864 218.773 226.361 1.00 145.74 ? 343  SER K CA 1 
ATOM 4481 C CA . PHE J 8  344  ? 229.887 216.811 223.326 1.00 210.56 ? 344  PHE K CA 1 
ATOM 4482 C CA . ALA J 8  345  ? 233.144 215.568 224.827 1.00 177.87 ? 345  ALA K CA 1 
ATOM 4483 C CA . VAL J 8  346  ? 231.395 214.186 227.960 1.00 185.37 ? 346  VAL K CA 1 
ATOM 4484 C CA . GLU J 8  347  ? 228.902 212.482 225.594 1.00 206.76 ? 347  GLU K CA 1 
ATOM 4485 C CA . SER J 8  348  ? 232.058 211.535 223.600 1.00 256.33 ? 348  SER K CA 1 
ATOM 4486 C CA . GLU J 8  349  ? 230.974 212.954 220.203 1.00 354.59 ? 349  GLU K CA 1 
ATOM 4487 C CA . HIS J 8  350  ? 234.431 214.180 219.089 1.00 297.71 ? 350  HIS K CA 1 
ATOM 4488 C CA . ASP J 8  351  ? 233.470 215.609 215.733 1.00 293.97 ? 351  ASP K CA 1 
ATOM 4489 C CA . GLN J 8  352  ? 231.069 218.040 217.187 1.00 193.45 ? 352  GLN K CA 1 
ATOM 4490 C CA . ALA J 8  353  ? 233.279 218.868 220.141 1.00 220.22 ? 353  ALA K CA 1 
ATOM 4491 C CA . MET J 8  354  ? 236.150 219.666 217.750 1.00 251.05 ? 354  MET K CA 1 
ATOM 4492 C CA . ALA J 8  355  ? 233.878 222.185 216.024 1.00 247.49 ? 355  ALA K CA 1 
ATOM 4493 C CA . ALA J 8  356  ? 232.902 223.868 219.249 1.00 180.75 ? 356  ALA K CA 1 
ATOM 4494 C CA . TYR J 8  357  ? 236.427 223.912 220.570 1.00 186.94 ? 357  TYR K CA 1 
ATOM 4495 C CA . PHE J 8  358  ? 237.849 225.389 217.399 1.00 206.58 ? 358  PHE K CA 1 
ATOM 4496 C CA . THR J 8  359  ? 235.214 228.084 217.343 1.00 256.62 ? 359  THR K CA 1 
ATOM 4497 C CA . ALA J 8  360  ? 236.098 228.752 221.001 1.00 134.21 ? 360  ALA K CA 1 
ATOM 4498 C CA . ALA J 8  361  ? 239.772 228.654 220.285 1.00 191.27 ? 361  ALA K CA 1 
ATOM 4499 C CA . GLN J 8  362  ? 239.628 231.136 217.447 1.00 328.94 ? 362  GLN K CA 1 
ATOM 4500 C CA . LEU J 8  363  ? 237.928 233.734 219.494 1.00 321.87 ? 363  LEU K CA 1 
ATOM 4501 C CA . MET J 8  364  ? 239.952 233.252 222.719 1.00 209.38 ? 364  MET K CA 1 
ATOM 4502 C CA . LYS J 8  365  ? 243.573 233.342 221.496 1.00 226.19 ? 365  LYS K CA 1 
ATOM 4503 C CA . GLY J 8  366  ? 245.352 233.931 224.841 1.00 237.59 ? 366  GLY K CA 1 
ATOM 4504 C CA . CYS J 8  367  ? 243.574 231.218 226.756 1.00 235.67 ? 367  CYS K CA 1 
ATOM 4505 C CA . HIS J 8  368  ? 245.343 227.833 226.726 1.00 255.44 ? 368  HIS K CA 1 
ATOM 4506 C CA . LEU J 8  369  ? 242.179 225.846 227.505 1.00 231.39 ? 369  LEU K CA 1 
ATOM 4507 C CA . PRO J 8  370  ? 240.512 225.567 224.096 1.00 182.94 ? 370  PRO K CA 1 
ATOM 4508 C CA . MET J 8  371  ? 243.793 224.595 222.361 1.00 238.80 ? 371  MET K CA 1 
ATOM 4509 C CA . LEU J 8  372  ? 244.405 222.076 225.057 1.00 213.84 ? 372  LEU K CA 1 
ATOM 4510 C CA . TYR J 8  373  ? 240.974 220.456 224.550 1.00 218.80 ? 373  TYR K CA 1 
ATOM 4511 C CA . ILE J 8  374  ? 241.438 220.380 220.708 1.00 262.49 ? 374  ILE K CA 1 
ATOM 4512 C CA . GLY J 8  375  ? 244.664 218.544 221.520 1.00 227.19 ? 375  GLY K CA 1 
ATOM 4513 C CA . LEU J 8  376  ? 242.965 215.981 223.764 1.00 244.94 ? 376  LEU K CA 1 
ATOM 4514 C CA . GLU J 8  377  ? 240.343 215.401 221.083 1.00 231.60 ? 377  GLU K CA 1 
ATOM 4515 C CA . TYR J 8  378  ? 242.828 214.726 218.395 1.00 268.98 ? 378  TYR K CA 1 
ATOM 4516 C CA . GLY J 8  379  ? 244.584 212.243 220.593 1.00 234.32 ? 379  GLY K CA 1 
ATOM 4517 C CA . LEU J 8  380  ? 241.444 210.256 221.152 1.00 252.45 ? 380  LEU K CA 1 
ATOM 4518 C CA . THR J 8  381  ? 240.809 210.157 217.461 1.00 238.70 ? 381  THR K CA 1 
ATOM 4519 C CA . ASN J 8  382  ? 244.411 208.895 217.087 1.00 279.17 ? 382  ASN K CA 1 
ATOM 4520 C CA . ASN J 8  383  ? 245.827 212.013 215.399 1.00 225.97 ? 383  ASN K CA 1 
ATOM 4521 C CA . SER J 8  384  ? 248.931 212.336 217.471 1.00 244.95 ? 384  SER K CA 1 
ATOM 4522 C CA . LYS J 8  385  ? 250.925 214.750 215.273 1.00 262.93 ? 385  LYS K CA 1 
ATOM 4523 C CA . LEU J 8  386  ? 248.123 217.305 215.262 1.00 276.71 ? 386  LEU K CA 1 
ATOM 4524 C CA . ALA J 8  387  ? 247.374 216.660 218.951 1.00 255.01 ? 387  ALA K CA 1 
ATOM 4525 C CA . GLU J 8  388  ? 251.094 217.204 219.752 1.00 255.88 ? 388  GLU K CA 1 
ATOM 4526 C CA . ARG J 8  389  ? 251.144 220.535 217.826 1.00 237.70 ? 389  ARG K CA 1 
ATOM 4527 C CA . PHE J 8  390  ? 248.240 221.890 219.853 1.00 201.86 ? 390  PHE K CA 1 
ATOM 4528 C CA . PHE J 8  391  ? 249.664 220.761 223.212 1.00 227.20 ? 391  PHE K CA 1 
ATOM 4529 C CA . SER J 8  392  ? 252.956 222.481 222.290 1.00 309.24 ? 392  SER K CA 1 
ATOM 4530 C CA . GLN J 8  393  ? 250.970 225.635 221.573 1.00 440.58 ? 393  GLN K CA 1 
ATOM 4531 C CA . ALA J 8  394  ? 249.046 225.291 224.871 1.00 273.12 ? 394  ALA K CA 1 
ATOM 4532 C CA . LEU J 8  395  ? 252.225 224.541 226.882 1.00 215.16 ? 395  LEU K CA 1 
ATOM 4533 C CA . SER J 8  396  ? 254.026 227.636 225.524 1.00 271.63 ? 396  SER K CA 1 
ATOM 4534 C CA . ILE J 8  397  ? 251.127 229.646 226.995 1.00 276.58 ? 397  ILE K CA 1 
ATOM 4535 C CA . ALA J 8  398  ? 251.081 228.014 230.510 1.00 254.41 ? 398  ALA K CA 1 
ATOM 4536 C CA . PRO J 8  399  ? 253.967 225.655 231.427 1.00 308.15 ? 399  PRO K CA 1 
ATOM 4537 C CA . GLU J 8  400  ? 253.176 224.611 235.011 1.00 283.12 ? 400  GLU K CA 1 
ATOM 4538 C CA . ASP J 8  401  ? 249.641 223.249 234.916 1.00 251.85 ? 401  ASP K CA 1 
ATOM 4539 C CA . PRO J 8  402  ? 248.770 219.816 236.318 1.00 214.29 ? 402  PRO K CA 1 
ATOM 4540 C CA . PHE J 8  403  ? 245.792 219.652 233.979 1.00 228.28 ? 403  PHE K CA 1 
ATOM 4541 C CA . VAL J 8  404  ? 247.708 220.312 230.804 1.00 263.15 ? 404  VAL K CA 1 
ATOM 4542 C CA . MET J 8  405  ? 250.509 217.983 231.775 1.00 257.92 ? 405  MET K CA 1 
ATOM 4543 C CA . HIS J 8  406  ? 248.114 215.198 232.546 1.00 212.79 ? 406  HIS K CA 1 
ATOM 4544 C CA . GLU J 8  407  ? 246.416 215.661 229.153 1.00 250.82 ? 407  GLU K CA 1 
ATOM 4545 C CA . VAL J 8  408  ? 249.702 215.489 227.203 1.00 247.43 ? 408  VAL K CA 1 
ATOM 4546 C CA . GLY J 8  409  ? 250.397 212.312 229.173 1.00 280.79 ? 409  GLY K CA 1 
ATOM 4547 C CA . VAL J 8  410  ? 247.106 210.791 228.114 1.00 234.62 ? 410  VAL K CA 1 
ATOM 4548 C CA . VAL J 8  411  ? 247.735 211.513 224.461 1.00 237.94 ? 411  VAL K CA 1 
ATOM 4549 C CA . ALA J 8  412  ? 251.280 210.167 224.733 1.00 221.34 ? 412  ALA K CA 1 
ATOM 4550 C CA . PHE J 8  413  ? 249.730 207.123 226.281 1.00 271.52 ? 413  PHE K CA 1 
ATOM 4551 C CA . GLN J 8  414  ? 247.425 206.664 223.186 1.00 248.16 ? 414  GLN K CA 1 
ATOM 4552 C CA . ASN J 8  415  ? 250.554 206.776 220.960 1.00 310.88 ? 415  ASN K CA 1 
ATOM 4553 C CA . GLY J 8  416  ? 252.095 204.143 223.201 1.00 249.61 ? 416  GLY K CA 1 
ATOM 4554 C CA . GLU J 8  417  ? 255.038 206.407 224.106 1.00 201.92 ? 417  GLU K CA 1 
ATOM 4555 C CA . TRP J 8  418  ? 255.103 204.831 227.596 1.00 193.66 ? 418  TRP K CA 1 
ATOM 4556 C CA . LYS J 8  419  ? 258.303 206.503 228.837 1.00 260.07 ? 419  LYS K CA 1 
ATOM 4557 C CA . THR J 8  420  ? 257.085 209.930 227.756 1.00 259.11 ? 420  THR K CA 1 
ATOM 4558 C CA . ALA J 8  421  ? 253.628 209.327 229.300 1.00 237.14 ? 421  ALA K CA 1 
ATOM 4559 C CA . GLU J 8  422  ? 255.217 208.299 232.621 1.00 235.69 ? 422  GLU K CA 1 
ATOM 4560 C CA . LYS J 8  423  ? 257.397 211.413 232.497 1.00 285.56 ? 423  LYS K CA 1 
ATOM 4561 C CA . TRP J 8  424  ? 254.348 213.577 231.966 1.00 252.93 ? 424  TRP K CA 1 
ATOM 4562 C CA . PHE J 8  425  ? 252.309 211.995 234.733 1.00 219.98 ? 425  PHE K CA 1 
ATOM 4563 C CA . LEU J 8  426  ? 255.223 212.157 237.197 1.00 279.20 ? 426  LEU K CA 1 
ATOM 4564 C CA . ASP J 8  427  ? 255.730 215.811 236.273 1.00 279.19 ? 427  ASP K CA 1 
ATOM 4565 C CA . ALA J 8  428  ? 252.030 216.419 236.823 1.00 242.57 ? 428  ALA K CA 1 
ATOM 4566 C CA . LEU J 8  429  ? 252.229 214.785 240.309 1.00 274.42 ? 429  LEU K CA 1 
ATOM 4567 C CA . GLU J 8  430  ? 255.225 216.997 241.271 1.00 316.47 ? 430  GLU K CA 1 
ATOM 4568 C CA . LYS J 8  431  ? 253.308 220.160 240.309 1.00 304.13 ? 431  LYS K CA 1 
ATOM 4569 C CA . ILE J 8  432  ? 250.204 218.957 242.184 1.00 202.03 ? 432  ILE K CA 1 
ATOM 4570 C CA . LYS J 8  433  ? 252.271 217.837 245.171 1.00 325.87 ? 433  LYS K CA 1 
ATOM 4571 C CA . ALA J 8  434  ? 253.494 221.332 245.899 1.00 352.52 ? 434  ALA K CA 1 
ATOM 4572 C CA . ILE J 8  435  ? 251.745 224.053 243.772 1.00 354.30 ? 435  ILE K CA 1 
ATOM 4573 C CA . GLY J 8  436  ? 248.275 222.977 244.921 1.00 284.27 ? 436  GLY K CA 1 
ATOM 4574 C CA . ASN J 8  437  ? 247.774 222.476 248.685 1.00 272.66 ? 437  ASN K CA 1 
ATOM 4575 C CA . GLU J 8  438  ? 244.074 222.206 247.820 1.00 399.79 ? 438  GLU K CA 1 
ATOM 4576 C CA . VAL J 8  439  ? 243.195 218.566 248.442 1.00 398.99 ? 439  VAL K CA 1 
ATOM 4577 C CA . THR J 8  440  ? 240.474 218.055 245.765 1.00 500.00 ? 440  THR K CA 1 
ATOM 4578 C CA . VAL J 8  441  ? 240.294 214.269 245.754 1.00 442.10 ? 441  VAL K CA 1 
ATOM 4579 C CA . ASP J 8  442  ? 238.018 213.269 242.913 1.00 299.16 ? 442  ASP K CA 1 
ATOM 4580 C CA . LYS J 8  443  ? 239.774 215.268 240.281 1.00 251.20 ? 443  LYS K CA 1 
ATOM 4581 C CA . TRP J 8  444  ? 243.132 213.699 240.647 1.00 214.26 ? 444  TRP K CA 1 
ATOM 4582 C CA . GLU J 8  445  ? 241.922 210.233 241.319 1.00 198.08 ? 445  GLU K CA 1 
ATOM 4583 C CA . PRO J 8  446  ? 242.334 209.662 237.569 1.00 220.61 ? 446  PRO K CA 1 
ATOM 4584 C CA . LEU J 8  447  ? 245.956 210.813 237.612 1.00 219.25 ? 447  LEU K CA 1 
ATOM 4585 C CA . LEU J 8  448  ? 246.997 208.192 240.050 1.00 196.04 ? 448  LEU K CA 1 
ATOM 4586 C CA . ASN J 8  449  ? 245.085 205.517 238.070 1.00 189.83 ? 449  ASN K CA 1 
ATOM 4587 C CA . ASN J 8  450  ? 246.719 206.701 234.869 1.00 242.74 ? 450  ASN K CA 1 
ATOM 4588 C CA . LEU J 8  451  ? 250.124 206.500 236.310 1.00 183.64 ? 451  LEU K CA 1 
ATOM 4589 C CA . GLY J 8  452  ? 249.528 202.972 237.461 1.00 179.69 ? 452  GLY K CA 1 
ATOM 4590 C CA . HIS J 8  453  ? 248.426 201.981 233.946 1.00 196.68 ? 453  HIS K CA 1 
ATOM 4591 C CA . VAL J 8  454  ? 251.595 203.455 232.432 1.00 200.85 ? 454  VAL K CA 1 
ATOM 4592 C CA . CYS J 8  455  ? 253.686 201.570 235.001 1.00 220.44 ? 455  CYS K CA 1 
ATOM 4593 C CA . ARG J 8  456  ? 251.957 198.317 233.963 1.00 222.92 ? 456  ARG K CA 1 
ATOM 4594 C CA . LYS J 8  457  ? 252.963 198.954 230.327 1.00 198.37 ? 457  LYS K CA 1 
ATOM 4595 C CA . LEU J 8  458  ? 256.546 199.735 231.484 1.00 246.71 ? 458  LEU K CA 1 
ATOM 4596 C CA . LYS J 8  459  ? 256.538 196.288 233.177 1.00 256.95 ? 459  LYS K CA 1 
ATOM 4597 C CA . LYS J 8  460  ? 257.285 197.966 236.502 1.00 212.73 ? 460  LYS K CA 1 
ATOM 4598 C CA . TYR J 8  461  ? 254.595 195.958 238.315 1.00 288.08 ? 461  TYR K CA 1 
ATOM 4599 C CA . ALA J 8  462  ? 255.542 196.949 241.928 1.00 466.58 ? 462  ALA K CA 1 
ATOM 4600 C CA . GLU J 8  463  ? 255.073 200.619 241.197 1.00 496.39 ? 463  GLU K CA 1 
ATOM 4601 C CA . ALA J 8  464  ? 251.837 199.973 239.319 1.00 500.00 ? 464  ALA K CA 1 
ATOM 4602 C CA . LEU J 8  465  ? 250.290 198.034 242.248 1.00 490.86 ? 465  LEU K CA 1 
ATOM 4603 C CA . ASP J 8  466  ? 251.251 200.842 244.594 1.00 447.05 ? 466  ASP K CA 1 
ATOM 4604 C CA . TYR J 8  467  ? 249.656 203.618 242.546 1.00 430.68 ? 467  TYR K CA 1 
ATOM 4605 C CA . HIS J 8  468  ? 246.334 201.843 242.074 1.00 417.02 ? 468  HIS K CA 1 
ATOM 4606 C CA . ARG J 8  469  ? 246.195 201.403 245.867 1.00 342.87 ? 469  ARG K CA 1 
ATOM 4607 C CA . GLN J 8  470  ? 246.780 205.124 246.399 1.00 258.59 ? 470  GLN K CA 1 
ATOM 4608 C CA . ALA J 8  471  ? 244.046 205.728 243.747 1.00 311.83 ? 471  ALA K CA 1 
ATOM 4609 C CA . LEU J 8  472  ? 241.759 203.461 245.869 1.00 186.29 ? 472  LEU K CA 1 
ATOM 4610 C CA . VAL J 8  473  ? 242.378 205.876 248.829 1.00 201.97 ? 473  VAL K CA 1 
ATOM 4611 C CA . LEU J 8  474  ? 240.735 208.656 246.823 1.00 201.62 ? 474  LEU K CA 1 
ATOM 4612 C CA . ILE J 8  475  ? 237.634 206.696 245.886 1.00 237.62 ? 475  ILE K CA 1 
ATOM 4613 C CA . PRO J 8  476  ? 236.946 203.790 248.136 1.00 259.32 ? 476  PRO K CA 1 
ATOM 4614 C CA . GLN J 8  477  ? 234.879 201.503 245.969 1.00 180.05 ? 477  GLN K CA 1 
ATOM 4615 C CA . ASN J 8  478  ? 236.037 201.549 242.383 1.00 212.44 ? 478  ASN K CA 1 
ATOM 4616 C CA . ALA J 8  479  ? 235.299 198.670 240.020 1.00 232.01 ? 479  ALA K CA 1 
ATOM 4617 C CA . SER J 8  480  ? 238.053 199.614 237.532 1.00 289.37 ? 480  SER K CA 1 
ATOM 4618 C CA . THR J 8  481  ? 240.753 199.954 240.257 1.00 196.84 ? 481  THR K CA 1 
ATOM 4619 C CA . TYR J 8  482  ? 240.051 196.508 241.555 1.00 361.15 ? 482  TYR K CA 1 
ATOM 4620 C CA . SER J 8  483  ? 240.107 195.056 238.066 1.00 459.91 ? 483  SER K CA 1 
ATOM 4621 C CA . ALA J 8  484  ? 243.347 196.931 237.387 1.00 453.02 ? 484  ALA K CA 1 
ATOM 4622 C CA . ILE J 8  485  ? 244.879 195.688 240.651 1.00 467.10 ? 485  ILE K CA 1 
ATOM 4623 C CA . GLY J 8  486  ? 243.740 192.209 239.777 1.00 484.84 ? 486  GLY K CA 1 
ATOM 4624 C CA . TYR J 8  487  ? 245.178 192.454 236.341 1.00 500.00 ? 487  TYR K CA 1 
ATOM 4625 C CA . ILE J 8  488  ? 248.637 193.511 237.534 1.00 483.42 ? 488  ILE K CA 1 
ATOM 4626 C CA . HIS J 8  489  ? 248.593 190.407 239.752 1.00 454.62 ? 489  HIS K CA 1 
ATOM 4627 C CA . SER J 8  490  ? 247.815 188.078 236.861 1.00 381.19 ? 490  SER K CA 1 
ATOM 4628 C CA . LEU J 8  491  ? 250.642 189.582 234.791 1.00 343.25 ? 491  LEU K CA 1 
ATOM 4629 C CA . MET J 8  492  ? 252.982 189.144 237.696 1.00 193.55 ? 492  MET K CA 1 
ATOM 4630 C CA . GLY J 8  493  ? 251.810 185.547 237.786 1.00 167.48 ? 493  GLY K CA 1 
ATOM 4631 C CA . ASN J 8  494  ? 249.959 185.361 241.079 1.00 254.69 ? 494  ASN K CA 1 
ATOM 4632 C CA . PHE J 8  495  ? 246.709 183.742 239.879 1.00 357.24 ? 495  PHE K CA 1 
ATOM 4633 C CA . GLU J 8  496  ? 245.198 183.017 243.331 1.00 293.33 ? 496  GLU K CA 1 
ATOM 4634 C CA . ASN J 8  497  ? 245.584 186.663 244.444 1.00 178.74 ? 497  ASN K CA 1 
ATOM 4635 C CA . ALA J 8  498  ? 244.332 187.904 241.096 1.00 248.00 ? 498  ALA K CA 1 
ATOM 4636 C CA . VAL J 8  499  ? 241.143 185.833 241.141 1.00 221.68 ? 499  VAL K CA 1 
ATOM 4637 C CA . ASP J 8  500  ? 240.230 187.282 244.539 1.00 193.44 ? 500  ASP K CA 1 
ATOM 4638 C CA . TYR J 8  501  ? 240.493 190.788 243.087 1.00 351.83 ? 501  TYR K CA 1 
ATOM 4639 C CA . PHE J 8  502  ? 238.569 190.145 239.891 1.00 405.30 ? 502  PHE K CA 1 
ATOM 4640 C CA . HIS J 8  503  ? 235.797 188.742 242.087 1.00 319.29 ? 503  HIS K CA 1 
ATOM 4641 C CA . THR J 8  504  ? 235.683 191.942 244.149 1.00 280.78 ? 504  THR K CA 1 
ATOM 4642 C CA . ALA J 8  505  ? 235.553 194.143 241.081 1.00 315.82 ? 505  ALA K CA 1 
ATOM 4643 C CA . LEU J 8  506  ? 232.695 192.082 239.728 1.00 345.76 ? 506  LEU K CA 1 
ATOM 4644 C CA . GLY J 8  507  ? 230.820 192.482 243.024 1.00 313.57 ? 507  GLY K CA 1 
ATOM 4645 C CA . LEU J 8  508  ? 231.105 196.265 242.694 1.00 210.71 ? 508  LEU K CA 1 
ATOM 4646 C CA . ARG J 8  509  ? 229.990 196.349 239.071 1.00 193.06 ? 509  ARG K CA 1 
ATOM 4647 C CA . ARG J 8  510  ? 228.432 193.248 237.565 1.00 163.42 ? 510  ARG K CA 1 
ATOM 4648 C CA . ASP J 8  511  ? 228.401 194.776 234.070 1.00 314.33 ? 511  ASP K CA 1 
ATOM 4649 C CA . ASP J 8  512  ? 232.235 194.779 233.454 1.00 407.37 ? 512  ASP K CA 1 
ATOM 4650 C CA . THR J 8  513  ? 233.192 192.557 230.602 1.00 500.00 ? 513  THR K CA 1 
ATOM 4651 C CA . PHE J 8  514  ? 236.933 193.136 230.729 1.00 500.00 ? 514  PHE K CA 1 
ATOM 4652 C CA . SER J 8  515  ? 237.018 192.045 234.313 1.00 500.00 ? 515  SER K CA 1 
ATOM 4653 C CA . VAL J 8  516  ? 234.638 189.130 233.517 1.00 500.00 ? 516  VAL K CA 1 
ATOM 4654 C CA . THR J 8  517  ? 236.616 187.889 230.500 1.00 500.00 ? 517  THR K CA 1 
ATOM 4655 C CA . MET J 8  518  ? 239.943 188.436 232.262 1.00 500.00 ? 518  MET K CA 1 
ATOM 4656 C CA . LEU J 8  519  ? 238.551 186.404 235.168 1.00 403.51 ? 519  LEU K CA 1 
ATOM 4657 C CA . GLY J 8  520  ? 237.831 183.412 232.951 1.00 202.27 ? 520  GLY K CA 1 
ATOM 4658 C CA . HIS J 8  521  ? 241.406 183.215 231.737 1.00 229.20 ? 521  HIS K CA 1 
ATOM 4659 C CA . CYS J 8  522  ? 243.027 183.469 235.163 1.00 207.43 ? 522  CYS K CA 1 
ATOM 4660 C CA . ILE J 8  523  ? 240.806 180.683 236.420 1.00 227.02 ? 523  ILE K CA 1 
ATOM 4661 C CA . GLU J 8  524  ? 241.835 178.398 233.546 1.00 231.42 ? 524  GLU K CA 1 
ATOM 4662 C CA . MET J 8  525  ? 245.471 179.237 234.477 1.00 219.40 ? 525  MET K CA 1 
ATOM 4663 C CA . TYR J 8  526  ? 244.834 178.620 238.217 1.00 238.29 ? 526  TYR K CA 1 
ATOM 4664 C CA . ILE J 8  527  ? 243.708 175.021 237.409 1.00 234.16 ? 527  ILE K CA 1 
ATOM 4665 C CA . ALA K 9  11   ? 192.695 175.331 247.001 1.00 500.00 ? 11   ALA L CA 1 
ATOM 4666 C CA . ASP K 9  12   ? 194.387 178.691 247.686 1.00 500.00 ? 12   ASP L CA 1 
ATOM 4667 C CA . PRO K 9  13   ? 197.735 178.796 245.786 1.00 500.00 ? 13   PRO L CA 1 
ATOM 4668 C CA . LYS K 9  14   ? 199.564 180.066 248.907 1.00 500.00 ? 14   LYS L CA 1 
ATOM 4669 C CA . GLN K 9  15   ? 198.676 176.844 250.802 1.00 500.00 ? 15   GLN L CA 1 
ATOM 4670 C CA . LEU K 9  16   ? 200.149 174.840 247.912 1.00 500.00 ? 16   LEU L CA 1 
ATOM 4671 C CA . GLU K 9  17   ? 203.247 177.094 247.976 1.00 500.00 ? 17   GLU L CA 1 
ATOM 4672 C CA . ARG K 9  18   ? 203.712 176.639 251.801 1.00 500.00 ? 18   ARG L CA 1 
ATOM 4673 C CA . THR K 9  19   ? 203.943 172.801 251.402 1.00 500.00 ? 19   THR L CA 1 
ATOM 4674 C CA . GLY K 9  20   ? 207.124 173.525 249.359 1.00 500.00 ? 20   GLY L CA 1 
ATOM 4675 C CA . THR K 9  21   ? 206.574 170.822 246.771 1.00 500.00 ? 21   THR L CA 1 
ATOM 4676 C CA . VAL K 9  22   ? 206.345 173.527 244.008 1.00 484.67 ? 22   VAL L CA 1 
ATOM 4677 C CA . ARG K 9  23   ? 207.347 177.221 243.639 1.00 347.39 ? 23   ARG L CA 1 
ATOM 4678 C CA . GLU K 9  24   ? 206.321 180.202 241.435 1.00 366.13 ? 24   GLU L CA 1 
ATOM 4679 C CA . ILE K 9  25   ? 208.285 181.047 238.244 1.00 461.74 ? 25   ILE L CA 1 
ATOM 4680 C CA . GLY K 9  26   ? 206.484 184.373 237.521 1.00 500.00 ? 26   GLY L CA 1 
ATOM 4681 C CA . SER K 9  27   ? 209.837 186.178 238.341 1.00 500.00 ? 27   SER L CA 1 
ATOM 4682 C CA . GLN K 9  28   ? 212.167 185.021 235.527 1.00 500.00 ? 28   GLN L CA 1 
ATOM 4683 C CA . ALA K 9  29   ? 209.854 184.670 232.513 1.00 458.54 ? 29   ALA L CA 1 
ATOM 4684 C CA . VAL K 9  30   ? 208.724 187.271 229.950 1.00 398.14 ? 30   VAL L CA 1 
ATOM 4685 C CA . TRP K 9  31   ? 204.931 187.856 230.095 1.00 378.22 ? 31   TRP L CA 1 
ATOM 4686 C CA . SER K 9  32   ? 203.145 188.935 226.969 1.00 251.25 ? 32   SER L CA 1 
ATOM 4687 C CA . LEU K 9  33   ? 199.522 189.693 226.554 1.00 163.04 ? 33   LEU L CA 1 
ATOM 4688 C CA . SER K 9  34   ? 198.175 189.335 222.975 1.00 209.39 ? 34   SER L CA 1 
ATOM 4689 C CA . SER K 9  35   ? 196.062 192.439 223.425 1.00 183.77 ? 35   SER L CA 1 
ATOM 4690 C CA . CYS K 9  36   ? 195.662 194.817 226.390 1.00 198.43 ? 36   CYS L CA 1 
ATOM 4691 C CA . LYS K 9  37   ? 193.939 197.961 227.527 1.00 250.94 ? 37   LYS L CA 1 
ATOM 4692 C CA . PRO K 9  38   ? 196.087 200.632 229.063 1.00 235.87 ? 38   PRO L CA 1 
ATOM 4693 C CA . GLY K 9  39   ? 195.405 200.426 232.799 1.00 238.74 ? 39   GLY L CA 1 
ATOM 4694 C CA . PHE K 9  40   ? 194.214 196.868 232.746 1.00 276.71 ? 40   PHE L CA 1 
ATOM 4695 C CA . GLY K 9  41   ? 197.863 195.932 232.332 1.00 379.82 ? 41   GLY L CA 1 
ATOM 4696 C CA . VAL K 9  42   ? 200.293 192.992 232.617 1.00 500.00 ? 42   VAL L CA 1 
ATOM 4697 C CA . ASP K 9  43   ? 201.427 194.721 235.812 1.00 500.00 ? 43   ASP L CA 1 
ATOM 4698 C CA . GLN K 9  44   ? 197.825 194.628 237.080 1.00 500.00 ? 44   GLN L CA 1 
ATOM 4699 C CA . LEU K 9  45   ? 197.277 190.920 236.260 1.00 385.71 ? 45   LEU L CA 1 
ATOM 4700 C CA . ARG K 9  46   ? 200.413 189.992 238.220 1.00 476.64 ? 46   ARG L CA 1 
ATOM 4701 C CA . ASP K 9  47   ? 199.602 192.332 241.228 1.00 500.00 ? 47   ASP L CA 1 
ATOM 4702 C CA . ASP K 9  48   ? 198.225 189.413 243.381 1.00 500.00 ? 48   ASP L CA 1 
ATOM 4703 C CA . ASN K 9  49   ? 195.063 191.465 244.027 1.00 492.72 ? 49   ASN L CA 1 
ATOM 4704 C CA . LEU K 9  50   ? 192.176 189.542 242.536 1.00 445.33 ? 50   LEU L CA 1 
ATOM 4705 C CA . GLU K 9  51   ? 190.565 193.024 242.473 1.00 476.33 ? 51   GLU L CA 1 
ATOM 4706 C CA . THR K 9  52   ? 192.884 194.108 239.649 1.00 500.00 ? 52   THR L CA 1 
ATOM 4707 C CA . TYR K 9  53   ? 192.509 192.259 236.326 1.00 377.43 ? 53   TYR L CA 1 
ATOM 4708 C CA . TRP K 9  54   ? 193.502 192.403 232.675 1.00 263.40 ? 54   TRP L CA 1 
ATOM 4709 C CA . GLN K 9  55   ? 190.871 193.064 229.987 1.00 232.69 ? 55   GLN L CA 1 
ATOM 4710 C CA . SER K 9  56   ? 191.603 191.813 226.466 1.00 243.35 ? 56   SER L CA 1 
ATOM 4711 C CA . ASP K 9  57   ? 190.602 193.990 223.460 1.00 235.22 ? 57   ASP L CA 1 
ATOM 4712 C CA . GLY K 9  58   ? 190.828 192.003 220.210 1.00 222.40 ? 58   GLY L CA 1 
ATOM 4713 C CA . SER K 9  59   ? 189.233 188.973 218.566 1.00 241.19 ? 59   SER L CA 1 
ATOM 4714 C CA . GLN K 9  60   ? 189.260 185.454 220.095 1.00 231.69 ? 60   GLN L CA 1 
ATOM 4715 C CA . PRO K 9  61   ? 191.450 183.801 221.102 1.00 215.24 ? 61   PRO L CA 1 
ATOM 4716 C CA . HIS K 9  62   ? 193.285 186.121 223.583 1.00 204.33 ? 62   HIS L CA 1 
ATOM 4717 C CA . LEU K 9  63   ? 196.734 184.971 224.786 1.00 169.27 ? 63   LEU L CA 1 
ATOM 4718 C CA . VAL K 9  64   ? 199.254 184.873 227.736 1.00 243.21 ? 64   VAL L CA 1 
ATOM 4719 C CA . ASN K 9  65   ? 202.670 184.017 226.176 1.00 242.33 ? 65   ASN L CA 1 
ATOM 4720 C CA . ILE K 9  66   ? 205.317 183.122 228.769 1.00 239.97 ? 66   ILE L CA 1 
ATOM 4721 C CA . GLN K 9  67   ? 208.979 182.471 227.784 1.00 158.56 ? 67   GLN L CA 1 
ATOM 4722 C CA . PHE K 9  68   ? 211.544 181.160 230.222 1.00 194.22 ? 68   PHE L CA 1 
ATOM 4723 C CA . ARG K 9  69   ? 215.210 182.021 229.725 1.00 284.56 ? 69   ARG L CA 1 
ATOM 4724 C CA . ARG K 9  70   ? 215.852 178.311 230.272 1.00 189.14 ? 70   ARG L CA 1 
ATOM 4725 C CA . LYS K 9  71   ? 213.631 175.248 229.470 1.00 145.67 ? 71   LYS L CA 1 
ATOM 4726 C CA . THR K 9  72   ? 211.868 175.234 232.884 1.00 229.70 ? 72   THR L CA 1 
ATOM 4727 C CA . THR K 9  73   ? 209.972 172.147 234.035 1.00 185.38 ? 73   THR L CA 1 
ATOM 4728 C CA . VAL K 9  74   ? 206.408 172.992 234.947 1.00 178.68 ? 74   VAL L CA 1 
ATOM 4729 C CA . LYS K 9  75   ? 204.358 170.900 237.354 1.00 341.20 ? 75   LYS L CA 1 
ATOM 4730 C CA . THR K 9  76   ? 201.318 173.180 237.589 1.00 473.99 ? 76   THR L CA 1 
ATOM 4731 C CA . LEU K 9  77   ? 199.651 176.288 236.326 1.00 471.60 ? 77   LEU L CA 1 
ATOM 4732 C CA . CYS K 9  78   ? 197.290 178.241 238.632 1.00 427.78 ? 78   CYS L CA 1 
ATOM 4733 C CA . ILE K 9  79   ? 194.715 180.657 237.104 1.00 390.19 ? 79   ILE L CA 1 
ATOM 4734 C CA . TYR K 9  80   ? 191.914 182.733 238.623 1.00 295.23 ? 80   TYR L CA 1 
ATOM 4735 C CA . ALA K 9  81   ? 188.322 183.279 237.380 1.00 310.22 ? 81   ALA L CA 1 
ATOM 4736 C CA . ASP K 9  82   ? 184.911 183.833 239.015 1.00 446.38 ? 82   ASP L CA 1 
ATOM 4737 C CA . TYR K 9  83   ? 181.420 183.575 237.460 1.00 309.01 ? 83   TYR L CA 1 
ATOM 4738 C CA . LYS K 9  84   ? 179.734 185.993 239.919 1.00 280.39 ? 84   LYS L CA 1 
ATOM 4739 C CA . SER K 9  85   ? 181.667 189.098 238.828 1.00 247.00 ? 85   SER L CA 1 
ATOM 4740 C CA . ASP K 9  86   ? 182.029 188.395 235.087 1.00 260.54 ? 86   ASP L CA 1 
ATOM 4741 C CA . GLU K 9  87   ? 178.781 188.180 233.028 1.00 312.36 ? 87   GLU L CA 1 
ATOM 4742 C CA . SER K 9  88   ? 180.523 187.249 229.791 1.00 321.37 ? 88   SER L CA 1 
ATOM 4743 C CA . TYR K 9  89   ? 184.083 187.995 230.885 1.00 207.85 ? 89   TYR L CA 1 
ATOM 4744 C CA . THR K 9  90   ? 184.695 184.659 232.580 1.00 278.58 ? 90   THR L CA 1 
ATOM 4745 C CA . PRO K 9  91   ? 187.109 182.395 230.578 1.00 236.26 ? 91   PRO L CA 1 
ATOM 4746 C CA . SER K 9  92   ? 185.106 179.406 229.284 1.00 216.09 ? 92   SER L CA 1 
ATOM 4747 C CA . LYS K 9  93   ? 187.237 177.270 226.891 1.00 217.07 ? 93   LYS L CA 1 
ATOM 4748 C CA . ILE K 9  94   ? 190.860 177.714 228.077 1.00 244.14 ? 94   ILE L CA 1 
ATOM 4749 C CA . SER K 9  95   ? 193.557 176.095 226.018 1.00 209.73 ? 95   SER L CA 1 
ATOM 4750 C CA . VAL K 9  96   ? 197.092 175.576 227.325 1.00 245.75 ? 96   VAL L CA 1 
ATOM 4751 C CA . ARG K 9  97   ? 199.756 175.350 224.701 1.00 112.21 ? 97   ARG L CA 1 
ATOM 4752 C CA . VAL K 9  98   ? 203.531 174.771 224.870 1.00 145.40 ? 98   VAL L CA 1 
ATOM 4753 C CA . GLY K 9  99   ? 206.600 174.674 222.606 1.00 199.28 ? 99   GLY L CA 1 
ATOM 4754 C CA . ASN K 9  100  ? 209.526 176.692 221.249 1.00 205.52 ? 100  ASN L CA 1 
ATOM 4755 C CA . ASN K 9  101  ? 208.405 179.343 218.760 1.00 182.91 ? 101  ASN L CA 1 
ATOM 4756 C CA . PHE K 9  102  ? 205.029 181.120 218.809 1.00 183.15 ? 102  PHE L CA 1 
ATOM 4757 C CA . HIS K 9  103  ? 204.346 179.199 215.555 1.00 235.90 ? 103  HIS L CA 1 
ATOM 4758 C CA . ASN K 9  104  ? 205.727 175.901 216.997 1.00 219.09 ? 104  ASN L CA 1 
ATOM 4759 C CA . LEU K 9  105  ? 203.092 175.879 219.712 1.00 186.07 ? 105  LEU L CA 1 
ATOM 4760 C CA . GLN K 9  106  ? 200.832 172.830 220.163 1.00 221.21 ? 106  GLN L CA 1 
ATOM 4761 C CA . GLU K 9  107  ? 197.839 172.423 222.490 1.00 232.22 ? 107  GLU L CA 1 
ATOM 4762 C CA . ILE K 9  108  ? 198.850 170.092 225.318 1.00 191.53 ? 108  ILE L CA 1 
ATOM 4763 C CA . ARG K 9  109  ? 195.799 170.085 227.586 1.00 173.72 ? 109  ARG L CA 1 
ATOM 4764 C CA . GLN K 9  110  ? 192.480 171.910 227.411 1.00 253.89 ? 110  GLN L CA 1 
ATOM 4765 C CA . LEU K 9  111  ? 189.862 172.946 229.997 1.00 247.86 ? 111  LEU L CA 1 
ATOM 4766 C CA . GLU K 9  112  ? 186.180 173.587 229.536 1.00 317.71 ? 112  GLU L CA 1 
ATOM 4767 C CA . LEU K 9  113  ? 184.985 175.484 232.665 1.00 474.85 ? 113  LEU L CA 1 
ATOM 4768 C CA . VAL K 9  114  ? 181.328 176.077 233.621 1.00 493.95 ? 114  VAL L CA 1 
ATOM 4769 C CA . GLU K 9  115  ? 180.433 178.842 236.153 1.00 500.00 ? 115  GLU L CA 1 
ATOM 4770 C CA . PRO K 9  116  ? 183.887 178.650 237.803 1.00 500.00 ? 116  PRO L CA 1 
ATOM 4771 C CA . SER K 9  117  ? 184.089 180.538 241.108 1.00 500.00 ? 117  SER L CA 1 
ATOM 4772 C CA . GLY K 9  118  ? 187.644 180.005 242.424 1.00 500.00 ? 118  GLY L CA 1 
ATOM 4773 C CA . TRP K 9  119  ? 191.267 179.278 241.527 1.00 500.00 ? 119  TRP L CA 1 
ATOM 4774 C CA . ILE K 9  120  ? 191.788 176.646 238.829 1.00 486.01 ? 120  ILE L CA 1 
ATOM 4775 C CA . HIS K 9  121  ? 194.771 174.269 239.008 1.00 457.93 ? 121  HIS L CA 1 
ATOM 4776 C CA . VAL K 9  122  ? 195.993 172.849 235.686 1.00 310.30 ? 122  VAL L CA 1 
ATOM 4777 C CA . PRO K 9  123  ? 198.270 169.762 235.857 1.00 260.57 ? 123  PRO L CA 1 
ATOM 4778 C CA . LEU K 9  124  ? 200.802 169.681 233.023 1.00 256.22 ? 124  LEU L CA 1 
ATOM 4779 C CA . THR K 9  125  ? 200.816 167.014 230.318 1.00 339.86 ? 125  THR L CA 1 
ATOM 4780 C CA . ASP K 9  126  ? 203.221 165.489 229.203 1.00 363.31 ? 126  ASP L CA 1 
ATOM 4781 C CA . ASN K 9  127  ? 201.539 162.114 228.602 1.00 310.17 ? 127  ASN L CA 1 
ATOM 4782 C CA . HIS K 9  128  ? 203.359 160.076 231.277 1.00 280.94 ? 128  HIS L CA 1 
ATOM 4783 C CA . LYS K 9  129  ? 203.100 161.401 234.856 1.00 281.98 ? 129  LYS L CA 1 
ATOM 4784 C CA . LYS K 9  130  ? 206.372 163.357 234.662 1.00 303.80 ? 130  LYS L CA 1 
ATOM 4785 C CA . PRO K 9  131  ? 206.151 167.081 233.961 1.00 263.11 ? 131  PRO L CA 1 
ATOM 4786 C CA . THR K 9  132  ? 206.557 169.035 230.661 1.00 219.14 ? 132  THR L CA 1 
ATOM 4787 C CA . ARG K 9  133  ? 209.938 170.663 230.185 1.00 208.54 ? 133  ARG L CA 1 
ATOM 4788 C CA . THR K 9  134  ? 209.264 173.547 227.864 1.00 224.78 ? 134  THR L CA 1 
ATOM 4789 C CA . PHE K 9  135  ? 210.621 176.934 226.742 1.00 196.88 ? 135  PHE L CA 1 
ATOM 4790 C CA . MET K 9  136  ? 207.314 178.737 226.220 1.00 148.58 ? 136  MET L CA 1 
ATOM 4791 C CA . ILE K 9  137  ? 203.794 178.472 227.656 1.00 155.43 ? 137  ILE L CA 1 
ATOM 4792 C CA . GLN K 9  138  ? 200.563 179.965 226.308 1.00 247.76 ? 138  GLN L CA 1 
ATOM 4793 C CA . ILE K 9  139  ? 197.199 180.477 227.796 1.00 180.13 ? 139  ILE L CA 1 
ATOM 4794 C CA . ALA K 9  140  ? 194.649 180.795 224.976 1.00 183.38 ? 140  ALA L CA 1 
ATOM 4795 C CA . VAL K 9  141  ? 191.075 181.872 225.748 1.00 193.43 ? 141  VAL L CA 1 
ATOM 4796 C CA . LEU K 9  142  ? 189.079 180.154 223.041 1.00 229.57 ? 142  LEU L CA 1 
ATOM 4797 C CA . ALA K 9  143  ? 185.643 181.091 224.498 1.00 261.55 ? 143  ALA L CA 1 
ATOM 4798 C CA . ASN K 9  144  ? 183.997 183.206 227.210 1.00 267.66 ? 144  ASN L CA 1 
ATOM 4799 C CA . HIS K 9  145  ? 180.683 182.616 229.043 1.00 314.83 ? 145  HIS L CA 1 
ATOM 4800 C CA . GLN K 9  146  ? 177.697 183.945 227.021 1.00 326.28 ? 146  GLN L CA 1 
ATOM 4801 C CA . ASN K 9  147  ? 180.126 184.157 224.042 1.00 282.33 ? 147  ASN L CA 1 
ATOM 4802 C CA . GLY K 9  148  ? 181.607 187.489 225.287 1.00 321.40 ? 148  GLY L CA 1 
ATOM 4803 C CA . ARG K 9  149  ? 184.191 189.459 223.309 1.00 282.89 ? 149  ARG L CA 1 
ATOM 4804 C CA . ASP K 9  150  ? 186.890 190.336 225.852 1.00 224.46 ? 150  ASP L CA 1 
ATOM 4805 C CA . THR K 9  151  ? 188.195 188.288 228.830 1.00 258.80 ? 151  THR L CA 1 
ATOM 4806 C CA . HIS K 9  152  ? 188.990 189.242 232.429 1.00 288.26 ? 152  HIS L CA 1 
ATOM 4807 C CA . MET K 9  153  ? 191.979 187.362 233.864 1.00 308.20 ? 153  MET L CA 1 
ATOM 4808 C CA . ARG K 9  154  ? 192.356 188.388 237.522 1.00 310.73 ? 154  ARG L CA 1 
ATOM 4809 C CA . GLN K 9  155  ? 195.558 186.463 238.320 1.00 424.21 ? 155  GLN L CA 1 
ATOM 4810 C CA . ILE K 9  156  ? 197.802 183.748 236.944 1.00 417.06 ? 156  ILE L CA 1 
ATOM 4811 C CA . LYS K 9  157  ? 200.577 181.936 238.753 1.00 409.74 ? 157  LYS L CA 1 
ATOM 4812 C CA . ILE K 9  158  ? 202.858 179.275 237.370 1.00 388.49 ? 158  ILE L CA 1 
ATOM 4813 C CA . TYR K 9  159  ? 204.709 176.620 239.372 1.00 220.58 ? 159  TYR L CA 1 
ATOM 4814 C CA . THR K 9  160  ? 207.837 174.517 238.832 1.00 221.28 ? 160  THR L CA 1 
ATOM 4815 C CA . PRO K 9  161  ? 208.502 171.306 240.739 1.00 292.35 ? 161  PRO L CA 1 
ATOM 4816 C CA . VAL K 9  162  ? 211.070 172.001 243.498 1.00 407.05 ? 162  VAL L CA 1 
ATOM 4817 C CA . GLU K 9  164  ? 214.490 170.255 243.062 1.00 323.96 ? 163  GLU L CA 1 
ATOM 4818 C CA . SER K 9  165  ? 214.223 168.013 246.173 1.00 366.93 ? 164  SER L CA 1 
ATOM 4819 C CA . SER K 9  166  ? 217.928 167.097 245.739 1.00 460.32 ? 165  SER L CA 1 
ATOM 4820 C CA . ILE K 9  167  ? 220.278 167.105 248.768 1.00 436.60 ? 166  ILE L CA 1 
ATOM 4821 C CA . GLY K 9  168  ? 223.266 165.952 246.718 1.00 318.65 ? 167  GLY L CA 1 
ATOM 4822 C CA . LYS K 9  169  ? 223.016 164.078 243.396 1.00 385.39 ? 168  LYS L CA 1 
ATOM 4823 C CA . PHE K 9  170  ? 220.316 161.692 244.704 1.00 375.23 ? 169  PHE L CA 1 
ATOM 4824 C CA . PRO K 9  171  ? 216.838 162.558 245.960 1.00 333.74 ? 170  PRO L CA 1 
ATOM 4825 C CA . ARG K 9  172  ? 215.870 162.880 248.795 1.00 271.97 ? 171  ARG L CA 1 
ATOM 4826 C CA . CYS K 9  173  ? 217.027 163.131 252.436 1.00 374.55 ? 172  CYS L CA 1 
ATOM 4827 C CA . THR K 9  174  ? 214.740 162.445 255.507 1.00 273.77 ? 173  THR L CA 1 
ATOM 4828 C CA . THR K 9  175  ? 215.005 163.090 259.309 1.00 206.38 ? 174  THR L CA 1 
ATOM 4829 C CA . ILE K 9  176  ? 217.145 165.863 260.890 1.00 209.24 ? 175  ILE L CA 1 
ATOM 4830 C CA . ASP K 9  177  ? 220.122 163.554 261.504 1.00 204.10 ? 176  ASP L CA 1 
ATOM 4831 C CA . PHE K 9  178  ? 221.378 163.608 257.897 1.00 228.14 ? 177  PHE L CA 1 
ATOM 4832 C CA . MET K 9  179  ? 219.807 166.911 256.824 1.00 184.18 ? 178  MET L CA 1 
ATOM 4833 C CA . MET K 9  180  ? 221.805 168.753 259.569 1.00 161.70 ? 179  MET L CA 1 
ATOM 4834 C CA . TYR K 9  181  ? 224.843 168.395 257.386 1.00 140.78 ? 180  TYR L CA 1 
ATOM 4835 C CA . ARG K 9  182  ? 223.472 168.673 253.848 1.00 156.68 ? 181  ARG L CA 1 
ATOM 4836 C CA . SER K 9  183  ? 225.022 172.145 253.240 1.00 160.58 ? 182  SER L CA 1 
ATOM 4837 C CA . ILE K 9  184  ? 227.466 174.335 255.188 1.00 178.26 ? 183  ILE L CA 1 
ATOM 4838 C CA . ARG K 9  185  ? 225.803 177.691 255.629 1.00 177.71 ? 184  ARG L CA 1 
ATOM 4839 C CA . MET L 10 1    ? 178.722 272.412 183.895 1.00 182.99 ? 1    MET M CA 1 
ATOM 4840 C CA . ASP L 10 2    ? 179.613 269.928 186.674 1.00 217.45 ? 2    ASP M CA 1 
ATOM 4841 C CA . SER L 10 3    ? 177.312 266.901 186.216 1.00 233.27 ? 3    SER M CA 1 
ATOM 4842 C CA . GLU L 10 4    ? 177.404 267.400 182.446 1.00 308.34 ? 4    GLU M CA 1 
ATOM 4843 C CA . VAL L 10 5    ? 180.907 265.966 182.237 1.00 255.66 ? 5    VAL M CA 1 
ATOM 4844 C CA . GLN L 10 6    ? 180.269 262.285 182.615 1.00 260.61 ? 6    GLN M CA 1 
ATOM 4845 C CA . ARG L 10 7    ? 182.137 258.989 182.234 1.00 293.87 ? 7    ARG M CA 1 
ATOM 4846 C CA . ASP L 10 8    ? 184.129 258.576 179.047 1.00 196.80 ? 8    ASP M CA 1 
ATOM 4847 C CA . GLY L 10 9    ? 181.831 256.269 177.135 1.00 211.60 ? 9    GLY M CA 1 
ATOM 4848 C CA . ARG L 10 10   ? 184.620 254.152 175.568 1.00 204.88 ? 10   ARG M CA 1 
ATOM 4849 C CA . ILE L 10 11   ? 185.992 253.440 179.071 1.00 196.02 ? 11   ILE M CA 1 
ATOM 4850 C CA . LEU L 10 12   ? 182.474 252.829 180.501 1.00 152.06 ? 12   LEU M CA 1 
ATOM 4851 C CA . ASP L 10 13   ? 181.912 250.506 177.454 1.00 193.26 ? 13   ASP M CA 1 
ATOM 4852 C CA . LEU L 10 14   ? 185.004 248.376 178.124 1.00 283.03 ? 14   LEU M CA 1 
ATOM 4853 C CA . ILE L 10 15   ? 184.073 247.569 181.804 1.00 328.30 ? 15   ILE M CA 1 
ATOM 4854 C CA . ASP L 10 16   ? 180.617 245.756 181.770 1.00 288.54 ? 16   ASP M CA 1 
ATOM 4855 C CA . ASP L 10 17   ? 179.877 247.111 185.352 1.00 287.91 ? 17   ASP M CA 1 
ATOM 4856 C CA . ALA L 10 18   ? 179.699 243.593 186.906 1.00 230.46 ? 18   ALA M CA 1 
ATOM 4857 C CA . TRP L 10 19   ? 183.535 243.914 187.111 1.00 255.65 ? 19   TRP M CA 1 
ATOM 4858 C CA . ARG L 10 20   ? 183.565 247.469 188.350 1.00 141.68 ? 20   ARG M CA 1 
ATOM 4859 C CA . GLU L 10 21   ? 181.308 246.571 191.271 1.00 231.72 ? 21   GLU M CA 1 
ATOM 4860 C CA . ASP L 10 22   ? 184.395 245.245 193.076 1.00 317.59 ? 22   ASP M CA 1 
ATOM 4861 C CA . LYS L 10 23   ? 186.557 246.303 196.059 1.00 369.56 ? 23   LYS M CA 1 
ATOM 4862 C CA . LEU L 10 24   ? 190.043 245.656 197.461 1.00 360.15 ? 24   LEU M CA 1 
ATOM 4863 C CA . PRO L 10 25   ? 190.003 243.050 200.297 1.00 385.22 ? 25   PRO M CA 1 
ATOM 4864 C CA . TYR L 10 26   ? 191.114 244.286 203.727 1.00 287.32 ? 26   TYR M CA 1 
ATOM 4865 C CA . GLU L 10 27   ? 194.680 243.346 204.653 1.00 264.47 ? 27   GLU M CA 1 
ATOM 4866 C CA . ASP L 10 28   ? 196.059 241.858 207.842 1.00 290.63 ? 28   ASP M CA 1 
ATOM 4867 C CA . VAL L 10 29   ? 199.018 243.768 209.369 1.00 128.16 ? 29   VAL M CA 1 
ATOM 4868 C CA . ALA L 10 30   ? 201.961 241.318 209.722 1.00 192.55 ? 30   ALA M CA 1 
ATOM 4869 C CA . ILE L 10 31   ? 202.489 241.045 213.431 1.00 173.66 ? 31   ILE M CA 1 
ATOM 4870 C CA . PRO L 10 32   ? 205.332 239.915 215.773 1.00 227.10 ? 32   PRO M CA 1 
ATOM 4871 C CA . LEU L 10 33   ? 203.249 237.143 217.476 1.00 214.37 ? 33   LEU M CA 1 
ATOM 4872 C CA . GLU L 10 54   ? 211.632 232.767 226.774 1.00 196.47 ? 54   GLU M CA 1 
ATOM 4873 C CA . MET L 10 55   ? 213.410 234.992 229.334 1.00 229.99 ? 55   MET M CA 1 
ATOM 4874 C CA . LYS L 10 56   ? 212.081 233.106 232.433 1.00 183.39 ? 56   LYS M CA 1 
ATOM 4875 C CA . TRP L 10 57   ? 214.216 230.055 233.426 1.00 195.74 ? 57   TRP M CA 1 
ATOM 4876 C CA . THR L 10 58   ? 212.524 227.656 235.746 1.00 208.20 ? 58   THR M CA 1 
ATOM 4877 C CA . ASP L 10 59   ? 213.668 224.303 237.212 1.00 348.93 ? 59   ASP M CA 1 
ATOM 4878 C CA . LEU L 10 60   ? 213.701 223.931 241.067 1.00 222.02 ? 60   LEU M CA 1 
ATOM 4879 C CA . ALA L 10 61   ? 215.278 220.490 240.512 1.00 321.09 ? 61   ALA M CA 1 
ATOM 4880 C CA . LEU L 10 62   ? 212.935 218.438 242.725 1.00 294.77 ? 62   LEU M CA 1 
ATOM 4881 C CA . GLN L 10 63   ? 214.933 215.514 241.430 1.00 364.80 ? 63   GLN M CA 1 
ATOM 4882 C CA . TYR L 10 64   ? 217.420 214.571 244.276 1.00 238.63 ? 64   TYR M CA 1 
ATOM 4883 C CA . LEU L 10 65   ? 214.161 214.746 246.287 1.00 154.48 ? 65   LEU M CA 1 
ATOM 4884 C CA . HIS L 10 66   ? 212.688 211.413 245.174 1.00 252.48 ? 66   HIS M CA 1 
ATOM 4885 C CA . GLU L 10 67   ? 212.609 212.035 241.380 1.00 392.66 ? 67   GLU M CA 1 
ATOM 4886 C CA . ARG M 11 15   ? 287.232 168.722 143.172 1.00 275.31 ? 15   ARG N CA 1 
ATOM 4887 C CA . PRO M 11 16   ? 287.068 167.690 139.485 1.00 296.73 ? 16   PRO N CA 1 
ATOM 4888 C CA . GLY M 11 17   ? 287.542 163.924 138.931 1.00 433.47 ? 17   GLY N CA 1 
ATOM 4889 C CA . GLN M 11 18   ? 287.208 162.801 142.553 1.00 490.67 ? 18   GLN N CA 1 
ATOM 4890 C CA . GLU M 11 19   ? 283.896 164.664 142.721 1.00 455.68 ? 19   GLU N CA 1 
ATOM 4891 C CA . LEU M 11 20   ? 282.794 163.122 139.441 1.00 419.33 ? 20   LEU N CA 1 
ATOM 4892 C CA . LEU M 11 21   ? 283.605 159.682 140.840 1.00 311.26 ? 21   LEU N CA 1 
ATOM 4893 C CA . VAL M 11 22   ? 281.605 160.455 143.969 1.00 245.37 ? 22   VAL N CA 1 
ATOM 4894 C CA . ALA M 11 23   ? 278.666 161.520 141.811 1.00 248.78 ? 23   ALA N CA 1 
ATOM 4895 C CA . TRP M 11 24   ? 278.945 158.281 139.851 1.00 352.96 ? 24   TRP N CA 1 
ATOM 4896 C CA . ASN M 11 25   ? 278.944 156.292 143.091 1.00 493.95 ? 25   ASN N CA 1 
ATOM 4897 C CA . THR M 11 26   ? 276.147 158.168 144.906 1.00 256.16 ? 26   THR N CA 1 
ATOM 4898 C CA . VAL M 11 27   ? 274.208 157.861 141.559 1.00 241.68 ? 27   VAL N CA 1 
ATOM 4899 C CA . SER M 11 28   ? 274.414 154.034 141.701 1.00 329.19 ? 28   SER N CA 1 
ATOM 4900 C CA . THR M 11 29   ? 272.267 154.300 144.846 1.00 343.00 ? 29   THR N CA 1 
ATOM 4901 C CA . GLU M 11 53   ? 282.442 153.890 152.546 1.00 281.88 ? 53   GLU N CA 1 
ATOM 4902 C CA . GLU M 11 54   ? 281.605 155.041 148.981 1.00 286.72 ? 54   GLU N CA 1 
ATOM 4903 C CA . LEU M 11 55   ? 278.837 157.145 150.521 1.00 303.66 ? 55   LEU N CA 1 
ATOM 4904 C CA . ARG M 11 56   ? 281.380 158.650 152.952 1.00 336.14 ? 56   ARG N CA 1 
ATOM 4905 C CA . ALA M 11 57   ? 283.840 159.289 150.042 1.00 273.13 ? 57   ALA N CA 1 
ATOM 4906 C CA . ALA M 11 58   ? 281.042 160.827 147.938 1.00 299.08 ? 58   ALA N CA 1 
ATOM 4907 C CA . VAL M 11 59   ? 279.999 163.218 150.794 1.00 351.15 ? 59   VAL N CA 1 
ATOM 4908 C CA . GLU M 11 60   ? 283.652 164.198 151.497 1.00 402.16 ? 60   GLU N CA 1 
ATOM 4909 C CA . VAL M 11 61   ? 283.766 165.342 147.868 1.00 236.00 ? 61   VAL N CA 1 
ATOM 4910 C CA . LEU M 11 62   ? 280.469 167.203 148.081 1.00 241.97 ? 62   LEU N CA 1 
ATOM 4911 C CA . ARG M 11 63   ? 281.726 168.845 151.289 1.00 315.29 ? 63   ARG N CA 1 
ATOM 4912 C CA . GLY M 11 64   ? 283.452 171.079 149.378 1.00 500.00 ? 64   GLY N CA 1 
ATOM 4913 C CA . HIS M 11 65   ? 281.122 173.097 147.051 1.00 463.46 ? 65   HIS N CA 1 
ATOM 4914 C CA . VAL M 11 70   ? 278.204 170.084 145.640 1.00 273.96 ? 70   VAL N CA 1 
ATOM 4915 C CA . LEU M 11 71   ? 277.673 170.741 149.388 1.00 284.25 ? 71   LEU N CA 1 
ATOM 4916 C CA . GLU M 11 72   ? 273.919 171.002 149.846 1.00 291.80 ? 72   GLU N CA 1 
ATOM 4917 C CA . GLU M 11 73   ? 272.335 170.087 146.400 1.00 267.72 ? 73   GLU N CA 1 
ATOM 4918 C CA . TRP M 11 74   ? 271.583 166.391 145.294 1.00 296.26 ? 74   TRP N CA 1 
ATOM 4919 C CA . PHE M 11 75   ? 268.875 164.980 143.000 1.00 269.23 ? 75   PHE N CA 1 
ATOM 4920 C CA . VAL M 11 76   ? 267.020 161.926 144.314 1.00 243.22 ? 76   VAL N CA 1 
ATOM 4921 C CA . GLU M 11 77   ? 263.655 163.780 144.520 1.00 314.01 ? 77   GLU N CA 1 
ATOM 4922 C CA . VAL M 11 78   ? 264.212 164.225 140.758 1.00 426.81 ? 78   VAL N CA 1 
ATOM 4923 C CA . LEU M 11 79   ? 266.279 161.289 139.343 1.00 374.22 ? 79   LEU N CA 1 
ATOM 4924 C CA . GLN M 11 80   ? 264.139 159.023 141.523 1.00 236.14 ? 80   GLN N CA 1 
ATOM 4925 C CA . ASN M 11 81   ? 260.985 160.771 140.202 1.00 275.00 ? 81   ASN N CA 1 
ATOM 4926 C CA . ASP M 11 82   ? 262.012 159.873 136.601 1.00 285.89 ? 82   ASP N CA 1 
ATOM 4927 C CA . LEU M 11 83   ? 262.524 156.236 137.714 1.00 308.51 ? 83   LEU N CA 1 
ATOM 4928 C CA . GLN M 11 84   ? 259.144 156.350 139.480 1.00 275.87 ? 84   GLN N CA 1 
ATOM 4929 C CA . ALA M 11 85   ? 257.382 157.496 136.282 1.00 242.03 ? 85   ALA N CA 1 
ATOM 4930 C CA . ASN M 11 86   ? 259.160 154.350 134.891 1.00 259.94 ? 86   ASN N CA 1 
ATOM 4931 C CA . ILE M 11 87   ? 258.425 152.022 137.874 1.00 204.90 ? 87   ILE N CA 1 
ATOM 4932 C CA . SER M 11 88   ? 254.637 152.646 137.818 1.00 245.18 ? 88   SER N CA 1 
ATOM 4933 C CA . PRO M 11 89   ? 253.972 151.944 134.069 1.00 276.09 ? 89   PRO N CA 1 
ATOM 4934 C CA . GLU M 11 90   ? 255.875 148.622 134.223 1.00 274.16 ? 90   GLU N CA 1 
ATOM 4935 C CA . PHE M 11 91   ? 253.866 148.093 137.428 1.00 248.20 ? 91   PHE N CA 1 
ATOM 4936 C CA . TRP M 11 92   ? 250.167 148.681 136.310 1.00 264.88 ? 92   TRP N CA 1 
ATOM 4937 C CA . ASN M 11 93   ? 251.363 143.899 135.370 1.00 253.76 ? 93   ASN N CA 1 
ATOM 4938 C CA . ALA M 11 94   ? 248.785 144.710 138.132 1.00 198.88 ? 94   ALA N CA 1 
ATOM 4939 C CA . ILE M 11 95   ? 245.794 144.732 135.731 1.00 231.72 ? 95   ILE N CA 1 
ATOM 4940 C CA . SER M 11 96   ? 247.625 142.276 133.432 1.00 273.92 ? 96   SER N CA 1 
ATOM 4941 C CA . GLN M 11 97   ? 247.808 139.642 136.165 1.00 226.27 ? 97   GLN N CA 1 
ATOM 4942 C CA . CYS M 11 98   ? 244.282 140.631 137.295 1.00 268.61 ? 98   CYS N CA 1 
ATOM 4943 C CA . GLU M 11 99   ? 243.257 139.320 133.842 1.00 397.86 ? 99   GLU N CA 1 
ATOM 4944 C CA . ASN M 11 100  ? 240.903 136.325 134.491 1.00 443.48 ? 100  ASN N CA 1 
ATOM 4945 C CA . SER M 11 101  ? 242.143 134.595 137.682 1.00 450.35 ? 101  SER N CA 1 
ATOM 4946 C CA . ALA M 11 102  ? 240.649 132.197 140.347 1.00 467.86 ? 102  ALA N CA 1 
ATOM 4947 C CA . CYS M 11 107  ? 243.042 128.766 141.380 1.00 301.62 ? 107  CYS N CA 1 
ATOM 4948 C CA . LEU M 11 108  ? 242.100 130.913 144.418 1.00 298.65 ? 108  LEU N CA 1 
ATOM 4949 C CA . LEU M 11 109  ? 245.698 130.515 145.637 1.00 347.23 ? 109  LEU N CA 1 
ATOM 4950 C CA . LEU M 11 110  ? 246.978 131.616 142.204 1.00 500.00 ? 110  LEU N CA 1 
ATOM 4951 C CA . LEU M 11 111  ? 244.849 134.834 142.314 1.00 500.00 ? 111  LEU N CA 1 
ATOM 4952 C CA . LEU M 11 112  ? 246.118 135.859 145.756 1.00 500.00 ? 112  LEU N CA 1 
ATOM 4953 C CA . ASP M 11 113  ? 249.683 134.846 144.763 1.00 500.00 ? 113  ASP N CA 1 
ATOM 4954 C CA . ALA M 11 114  ? 249.656 136.977 141.541 1.00 500.00 ? 114  ALA N CA 1 
ATOM 4955 C CA . PHE M 11 115  ? 248.317 140.043 143.406 1.00 500.00 ? 115  PHE N CA 1 
ATOM 4956 C CA . GLY M 11 116  ? 250.785 139.749 146.325 1.00 500.00 ? 116  GLY N CA 1 
ATOM 4957 C CA . LEU M 11 117  ? 253.703 138.974 143.943 1.00 451.61 ? 117  LEU N CA 1 
ATOM 4958 C CA . LEU M 11 118  ? 252.914 142.095 141.851 1.00 230.24 ? 118  LEU N CA 1 
ATOM 4959 C CA . GLU M 11 119  ? 252.869 144.500 144.782 1.00 233.16 ? 119  GLU N CA 1 
ATOM 4960 C CA . SER M 11 120  ? 255.874 142.640 146.311 1.00 311.92 ? 120  SER N CA 1 
ATOM 4961 C CA . ARG M 11 121  ? 258.026 142.752 143.129 1.00 209.87 ? 121  ARG N CA 1 
ATOM 4962 C CA . LEU M 11 122  ? 256.820 146.363 142.883 1.00 225.80 ? 122  LEU N CA 1 
ATOM 4963 C CA . ASP M 11 123  ? 258.145 146.988 146.426 1.00 406.25 ? 123  ASP N CA 1 
ATOM 4964 C CA . PRO M 11 124  ? 261.900 146.510 145.920 1.00 270.35 ? 124  PRO N CA 1 
ATOM 4965 C CA . TYR M 11 125  ? 261.793 148.356 142.631 1.00 235.70 ? 125  TYR N CA 1 
ATOM 4966 C CA . LEU M 11 126  ? 261.545 151.122 144.489 1.00 268.70 ? 126  LEU N CA 1 
ATOM 4967 C CA . ARG M 11 127  ? 263.002 149.957 147.829 1.00 385.30 ? 127  ARG N CA 1 
ATOM 4968 C CA . SER M 11 128  ? 266.377 150.623 146.108 1.00 310.39 ? 128  SER N CA 1 
ATOM 4969 C CA . LEU M 11 129  ? 265.539 154.328 146.504 1.00 230.17 ? 129  LEU N CA 1 
ATOM 4970 C CA . GLU M 11 130  ? 263.741 154.051 149.989 1.00 208.38 ? 130  GLU N CA 1 
ATOM 4971 C CA . LEU M 11 131  ? 267.035 152.829 151.493 1.00 359.26 ? 131  LEU N CA 1 
ATOM 4972 C CA . LEU M 11 132  ? 269.108 155.471 149.542 1.00 362.95 ? 132  LEU N CA 1 
ATOM 4973 C CA . GLU M 11 133  ? 267.067 158.499 150.635 1.00 287.25 ? 133  GLU N CA 1 
ATOM 4974 C CA . LYS M 11 134  ? 267.615 157.497 154.313 1.00 271.34 ? 134  LYS N CA 1 
ATOM 4975 C CA . TRP M 11 135  ? 271.365 157.301 153.486 1.00 246.49 ? 135  TRP N CA 1 
ATOM 4976 C CA . THR M 11 136  ? 271.284 161.058 152.826 1.00 267.20 ? 136  THR N CA 1 
ATOM 4977 C CA . ARG M 11 137  ? 269.400 161.673 156.168 1.00 239.42 ? 137  ARG N CA 1 
ATOM 4978 C CA . LEU M 11 138  ? 272.130 159.956 158.142 1.00 256.72 ? 138  LEU N CA 1 
ATOM 4979 C CA . GLY M 11 139  ? 274.771 161.314 155.678 1.00 379.92 ? 139  GLY N CA 1 
ATOM 4980 C CA . LEU M 11 140  ? 274.411 164.999 156.509 1.00 269.32 ? 140  LEU N CA 1 
ATOM 4981 C CA . LEU M 11 141  ? 278.199 165.421 156.190 1.00 251.25 ? 141  LEU N CA 1 
ATOM 4982 C CA . MET M 11 142  ? 278.945 169.221 156.129 1.00 265.54 ? 142  MET N CA 1 
ATOM 4983 C CA . GLY M 11 143  ? 275.540 169.566 154.371 1.00 261.40 ? 143  GLY N CA 1 
ATOM 4984 C CA . THR M 11 144  ? 272.121 171.108 153.865 1.00 282.41 ? 144  THR N CA 1 
ATOM 4985 C CA . GLY M 11 145  ? 268.522 171.259 155.146 1.00 276.80 ? 145  GLY N CA 1 
ATOM 4986 C CA . ALA M 11 146  ? 265.330 169.935 153.345 1.00 282.08 ? 146  ALA N CA 1 
ATOM 4987 C CA . GLN M 11 147  ? 262.044 171.699 154.493 1.00 342.28 ? 147  GLN N CA 1 
ATOM 4988 C CA . GLY M 11 148  ? 260.738 168.210 155.421 1.00 313.42 ? 148  GLY N CA 1 
ATOM 4989 C CA . LEU M 11 149  ? 262.143 164.668 155.405 1.00 299.16 ? 149  LEU N CA 1 
ATOM 4990 C CA . ARG M 11 150  ? 261.733 161.175 153.982 1.00 307.37 ? 150  ARG N CA 1 
ATOM 4991 C CA . GLU M 11 151  ? 257.999 161.452 154.403 1.00 327.75 ? 151  GLU N CA 1 
ATOM 4992 C CA . GLU M 11 152  ? 258.348 163.757 151.350 1.00 276.25 ? 152  GLU N CA 1 
ATOM 4993 C CA . VAL M 11 153  ? 260.052 161.005 149.383 1.00 268.95 ? 153  VAL N CA 1 
ATOM 4994 C CA . HIS M 11 154  ? 258.127 157.855 150.332 1.00 255.54 ? 154  HIS N CA 1 
ATOM 4995 C CA . THR M 11 155  ? 254.830 159.612 150.993 1.00 205.23 ? 155  THR N CA 1 
ATOM 4996 C CA . MET M 11 156  ? 254.941 161.302 147.607 1.00 322.72 ? 156  MET N CA 1 
ATOM 4997 C CA . LEU M 11 157  ? 255.697 158.008 145.915 1.00 262.69 ? 157  LEU N CA 1 
ATOM 4998 C CA . ARG M 11 158  ? 252.768 156.378 147.704 1.00 279.93 ? 158  ARG N CA 1 
ATOM 4999 C CA . GLY M 11 159  ? 250.406 159.167 146.712 1.00 260.41 ? 159  GLY N CA 1 
ATOM 5000 C CA . VAL M 11 160  ? 251.383 158.825 143.072 1.00 269.05 ? 160  VAL N CA 1 
ATOM 5001 C CA . LEU M 11 161  ? 250.614 155.082 143.175 1.00 315.73 ? 161  LEU N CA 1 
ATOM 5002 C CA . PHE M 11 162  ? 246.988 155.255 144.401 1.00 290.73 ? 162  PHE N CA 1 
ATOM 5003 C CA . PHE M 11 163  ? 245.837 157.388 141.445 1.00 239.53 ? 163  PHE N CA 1 
ATOM 5004 C CA . SER M 11 164  ? 247.169 154.822 138.942 1.00 30.00  ? 164  SER N CA 1 
ATOM 5005 C CA . THR M 11 165  ? 244.423 152.133 139.036 1.00 30.00  ? 165  THR N CA 1 
ATOM 5006 C CA . PRO M 11 166  ? 241.363 153.518 137.173 1.00 273.41 ? 166  PRO N CA 1 
ATOM 5007 C CA . ARG M 11 167  ? 239.049 152.446 140.040 1.00 453.72 ? 167  ARG N CA 1 
ATOM 5008 C CA . THR M 11 168  ? 238.667 148.895 138.697 1.00 477.59 ? 168  THR N CA 1 
ATOM 5009 C CA . PHE M 11 169  ? 242.068 148.199 140.263 1.00 500.00 ? 169  PHE N CA 1 
ATOM 5010 C CA . GLN M 11 170  ? 240.652 149.710 143.439 1.00 500.00 ? 170  GLN N CA 1 
ATOM 5011 C CA . GLU M 11 171  ? 237.723 147.254 143.584 1.00 500.00 ? 171  GLU N CA 1 
ATOM 5012 C CA . MET M 11 172  ? 240.244 144.349 143.608 1.00 500.00 ? 172  MET N CA 1 
ATOM 5013 C CA . ILE M 11 173  ? 241.717 145.585 146.955 1.00 500.00 ? 173  ILE N CA 1 
ATOM 5014 C CA . GLN M 11 174  ? 238.137 145.645 148.355 1.00 484.81 ? 174  GLN N CA 1 
ATOM 5015 C CA . ARG M 11 175  ? 237.693 141.997 147.236 1.00 500.00 ? 175  ARG N CA 1 
ATOM 5016 C CA . LEU M 11 176  ? 241.014 140.780 148.742 1.00 443.74 ? 176  LEU N CA 1 
ATOM 5017 C CA . TYR M 11 177  ? 240.744 142.470 152.182 1.00 303.10 ? 177  TYR N CA 1 
ATOM 5018 C CA . GLY M 11 178  ? 237.067 141.694 152.888 1.00 237.32 ? 178  GLY N CA 1 
ATOM 5019 C CA . CYS M 11 179  ? 237.669 138.050 152.025 1.00 231.55 ? 179  CYS N CA 1 
ATOM 5020 C CA . PHE M 11 180  ? 240.874 138.268 154.123 1.00 208.48 ? 180  PHE N CA 1 
ATOM 5021 C CA . LEU M 11 181  ? 238.486 139.293 156.972 1.00 212.98 ? 181  LEU N CA 1 
ATOM 5022 C CA . ARG M 11 182  ? 235.983 136.612 155.912 1.00 253.47 ? 182  ARG N CA 1 
ATOM 5023 C CA . VAL M 11 183  ? 238.942 134.181 156.315 1.00 250.80 ? 183  VAL N CA 1 
ATOM 5024 C CA . TYR M 11 184  ? 239.642 135.724 159.750 1.00 250.47 ? 184  TYR N CA 1 
ATOM 5025 C CA . MET M 11 185  ? 236.063 135.068 160.810 1.00 234.56 ? 185  MET N CA 1 
ATOM 5026 C CA . GLN M 11 186  ? 236.221 131.708 159.004 1.00 237.35 ? 186  GLN N CA 1 
ATOM 5027 C CA . SER M 11 187  ? 239.210 131.000 161.342 1.00 243.35 ? 187  SER N CA 1 
ATOM 5028 C CA . LYS M 11 188  ? 237.159 131.794 164.441 1.00 281.42 ? 188  LYS N CA 1 
ATOM 5029 C CA . ARG M 11 189  ? 234.301 129.761 162.856 1.00 329.06 ? 189  ARG N CA 1 
ATOM 5030 C CA . LYS M 11 190  ? 236.839 126.897 163.076 1.00 337.67 ? 190  LYS N CA 1 
ATOM 5031 C CA . GLY M 11 191  ? 237.586 127.913 166.700 1.00 244.63 ? 191  GLY N CA 1 
ATOM 5032 C CA . TRP M 11 232  ? 240.579 129.994 150.126 1.00 405.20 ? 232  TRP N CA 1 
ATOM 5033 C CA . CYS M 11 233  ? 241.607 129.153 153.739 1.00 327.11 ? 233  CYS N CA 1 
ATOM 5034 C CA . ARG M 11 234  ? 244.703 128.678 156.004 1.00 295.26 ? 234  ARG N CA 1 
ATOM 5035 C CA . GLN M 11 235  ? 247.095 129.318 153.091 1.00 289.09 ? 235  GLN N CA 1 
ATOM 5036 C CA . ALA M 11 236  ? 245.127 132.566 152.706 1.00 285.00 ? 236  ALA N CA 1 
ATOM 5037 C CA . LEU M 11 237  ? 246.365 133.823 156.161 1.00 245.50 ? 237  LEU N CA 1 
ATOM 5038 C CA . GLU M 11 238  ? 249.928 132.801 155.245 1.00 300.19 ? 238  GLU N CA 1 
ATOM 5039 C CA . GLN M 11 239  ? 249.645 134.745 151.975 1.00 273.76 ? 239  GLN N CA 1 
ATOM 5040 C CA . PHE M 11 240  ? 247.881 137.579 153.827 1.00 223.72 ? 240  PHE N CA 1 
ATOM 5041 C CA . HIS M 11 241  ? 250.618 138.046 156.389 1.00 180.51 ? 241  HIS N CA 1 
ATOM 5042 C CA . GLN M 11 242  ? 252.896 138.360 153.402 1.00 273.17 ? 242  GLN N CA 1 
ATOM 5043 C CA . LEU M 11 243  ? 250.535 141.168 152.114 1.00 361.09 ? 243  LEU N CA 1 
ATOM 5044 C CA . SER M 11 244  ? 250.266 143.196 155.366 1.00 317.79 ? 244  SER N CA 1 
ATOM 5045 C CA . GLN M 11 245  ? 254.063 142.935 155.849 1.00 404.53 ? 245  GLN N CA 1 
ATOM 5046 C CA . VAL M 11 246  ? 254.544 144.156 152.206 1.00 368.20 ? 246  VAL N CA 1 
ATOM 5047 C CA . LEU M 11 247  ? 252.326 147.237 152.866 1.00 283.00 ? 247  LEU N CA 1 
ATOM 5048 C CA . HIS M 11 248  ? 253.674 148.212 156.337 1.00 238.68 ? 248  HIS N CA 1 
ATOM 5049 C CA . ARG M 11 249  ? 257.200 148.106 154.783 1.00 238.98 ? 249  ARG N CA 1 
ATOM 5050 C CA . LEU M 11 250  ? 256.912 150.911 152.277 1.00 215.31 ? 250  LEU N CA 1 
ATOM 5051 C CA . SER M 11 251  ? 253.839 151.829 150.143 1.00 275.44 ? 251  SER N CA 1 
ATOM 5052 C CA . LEU M 11 252  ? 252.177 152.078 153.561 1.00 243.72 ? 252  LEU N CA 1 
ATOM 5053 C CA . LEU M 11 253  ? 249.022 150.201 154.435 1.00 271.07 ? 253  LEU N CA 1 
ATOM 5054 C CA . GLU M 11 254  ? 248.095 153.653 155.814 1.00 278.45 ? 254  GLU N CA 1 
ATOM 5055 C CA . ARG M 11 255  ? 247.422 155.061 152.298 1.00 258.63 ? 255  ARG N CA 1 
ATOM 5056 C CA . VAL M 11 256  ? 246.617 152.047 150.082 1.00 245.33 ? 256  VAL N CA 1 
ATOM 5057 C CA . SER M 11 257  ? 244.733 149.770 152.487 1.00 266.67 ? 257  SER N CA 1 
ATOM 5058 C CA . ALA M 11 258  ? 243.000 152.265 154.869 1.00 301.42 ? 258  ALA N CA 1 
ATOM 5059 C CA . GLU M 11 259  ? 240.642 153.503 152.133 1.00 383.38 ? 259  GLU N CA 1 
ATOM 5060 C CA . ALA M 11 260  ? 239.927 149.848 151.282 1.00 417.90 ? 260  ALA N CA 1 
ATOM 5061 C CA . VAL M 11 261  ? 239.733 148.482 154.862 1.00 352.52 ? 261  VAL N CA 1 
ATOM 5062 C CA . THR M 11 262  ? 237.276 151.146 156.137 1.00 500.00 ? 262  THR N CA 1 
ATOM 5063 C CA . THR M 11 263  ? 234.764 150.448 153.297 1.00 500.00 ? 263  THR N CA 1 
ATOM 5064 C CA . THR M 11 264  ? 235.192 146.646 153.628 1.00 500.00 ? 264  THR N CA 1 
ATOM 5065 C CA . LEU M 11 265  ? 234.704 146.713 157.432 1.00 482.18 ? 265  LEU N CA 1 
ATOM 5066 C CA . HIS M 11 266  ? 231.429 148.649 156.889 1.00 425.07 ? 266  HIS N CA 1 
ATOM 5067 C CA . GLN M 11 267  ? 230.029 146.295 154.130 1.00 218.79 ? 267  GLN N CA 1 
ATOM 5068 C CA . VAL M 11 268  ? 231.141 143.153 156.039 1.00 290.02 ? 268  VAL N CA 1 
ATOM 5069 C CA . THR M 11 269  ? 229.306 144.407 159.226 1.00 282.58 ? 269  THR N CA 1 
ATOM 5070 C CA . ARG M 11 270  ? 226.077 144.574 157.176 1.00 324.94 ? 270  ARG N CA 1 
ATOM 5071 C CA . GLU M 11 271  ? 226.387 141.091 155.514 1.00 187.87 ? 271  GLU N CA 1 
ATOM 5072 C CA . ARG M 11 272  ? 227.180 139.152 158.785 1.00 298.75 ? 272  ARG N CA 1 
ATOM 5073 C CA . MET M 11 273  ? 224.304 141.063 160.429 1.00 291.93 ? 273  MET N CA 1 
ATOM 5074 C CA . GLU M 11 274  ? 221.999 140.641 157.394 1.00 298.88 ? 274  GLU N CA 1 
ATOM 5075 C CA . ASP M 11 275  ? 221.822 136.838 156.969 1.00 335.12 ? 275  ASP N CA 1 
ATOM 5076 C CA . ARG M 11 276  ? 220.831 136.209 160.590 1.00 277.12 ? 276  ARG N CA 1 
ATOM 5077 C CA . CYS M 11 277  ? 219.479 139.504 162.006 1.00 303.62 ? 277  CYS N CA 1 
ATOM 5078 C CA . ARG M 11 278  ? 216.020 138.901 160.524 1.00 302.90 ? 278  ARG N CA 1 
ATOM 5079 C CA . GLY M 11 279  ? 215.452 136.792 163.696 1.00 356.10 ? 279  GLY N CA 1 
ATOM 5080 C CA . GLU M 11 280  ? 213.111 138.100 166.446 1.00 353.11 ? 280  GLU N CA 1 
ATOM 5081 C CA . TYR M 11 281  ? 213.905 135.986 168.511 1.00 281.71 ? 281  TYR N CA 1 
ATOM 5082 C CA . GLU M 11 282  ? 216.530 133.330 169.397 1.00 365.86 ? 282  GLU N CA 1 
ATOM 5083 C CA . ARG M 11 283  ? 219.898 134.615 170.678 1.00 326.78 ? 283  ARG N CA 1 
ATOM 5084 C CA . SER M 11 284  ? 219.255 138.042 169.066 1.00 294.88 ? 284  SER N CA 1 
ATOM 5085 C CA . PHE M 11 285  ? 221.794 139.685 168.552 1.00 334.39 ? 285  PHE N CA 1 
ATOM 5086 C CA . LEU M 11 286  ? 224.137 141.842 170.704 1.00 420.85 ? 286  LEU N CA 1 
ATOM 5087 C CA . ARG M 11 287  ? 226.287 139.203 172.555 1.00 411.52 ? 287  ARG N CA 1 
ATOM 5088 C CA . GLU M 11 288  ? 227.181 137.911 169.081 1.00 266.64 ? 288  GLU N CA 1 
ATOM 5089 C CA . PHE M 11 289  ? 228.866 141.253 168.174 1.00 210.43 ? 289  PHE N CA 1 
ATOM 5090 C CA . HIS M 11 290  ? 230.682 142.939 171.148 1.00 318.60 ? 290  HIS N CA 1 
ATOM 5091 C CA . LYS M 11 291  ? 232.507 139.588 170.999 1.00 409.74 ? 291  LYS N CA 1 
ATOM 5092 C CA . TRP M 11 292  ? 232.320 140.005 167.181 1.00 295.15 ? 292  TRP N CA 1 
ATOM 5093 C CA . ILE M 11 293  ? 233.381 143.730 167.692 1.00 344.34 ? 293  ILE N CA 1 
ATOM 5094 C CA . GLU M 11 294  ? 236.387 142.604 169.834 1.00 366.91 ? 294  GLU N CA 1 
ATOM 5095 C CA . ARG M 11 295  ? 237.392 140.026 167.192 1.00 379.12 ? 295  ARG N CA 1 
ATOM 5096 C CA . VAL M 11 296  ? 237.078 142.771 164.487 1.00 330.99 ? 296  VAL N CA 1 
ATOM 5097 C CA . VAL M 11 297  ? 239.176 145.232 166.616 1.00 238.00 ? 297  VAL N CA 1 
ATOM 5098 C CA . GLY M 11 298  ? 241.890 142.521 166.867 1.00 373.32 ? 298  GLY N CA 1 
ATOM 5099 C CA . TRP M 11 299  ? 241.771 142.162 163.065 1.00 441.26 ? 299  TRP N CA 1 
ATOM 5100 C CA . LEU M 11 300  ? 242.775 145.863 162.872 1.00 443.89 ? 300  LEU N CA 1 
ATOM 5101 C CA . GLY M 11 301  ? 245.714 145.195 165.241 1.00 432.51 ? 301  GLY N CA 1 
ATOM 5102 C CA . LYS M 11 302  ? 246.625 142.290 162.920 1.00 402.26 ? 302  LYS N CA 1 
ATOM 5103 C CA . VAL M 11 303  ? 246.838 144.646 159.859 1.00 288.37 ? 303  VAL N CA 1 
ATOM 5104 C CA . PHE M 11 304  ? 248.996 147.035 162.023 1.00 330.01 ? 304  PHE N CA 1 
ATOM 5105 C CA . THR M 11 320  ? 245.120 156.156 171.921 1.00 231.73 ? 320  THR N CA 1 
ATOM 5106 C CA . LEU M 11 321  ? 244.063 152.862 170.302 1.00 342.88 ? 321  LEU N CA 1 
ATOM 5107 C CA . ARG M 11 322  ? 240.725 152.211 172.094 1.00 314.30 ? 322  ARG N CA 1 
ATOM 5108 C CA . ARG M 11 323  ? 240.036 154.434 169.090 1.00 184.35 ? 323  ARG N CA 1 
ATOM 5109 C CA . TRP M 11 324  ? 239.134 151.369 166.949 1.00 215.73 ? 324  TRP N CA 1 
ATOM 5110 C CA . ARG M 11 325  ? 237.049 149.703 169.682 1.00 241.43 ? 325  ARG N CA 1 
ATOM 5111 C CA . CYS M 11 326  ? 234.911 152.831 170.226 1.00 239.14 ? 326  CYS N CA 1 
ATOM 5112 C CA . HIS M 11 327  ? 234.600 153.605 166.509 1.00 204.70 ? 327  HIS N CA 1 
ATOM 5113 C CA . VAL M 11 328  ? 233.179 150.193 165.474 1.00 182.36 ? 328  VAL N CA 1 
ATOM 5114 C CA . GLN M 11 329  ? 231.016 149.978 168.621 1.00 227.52 ? 329  GLN N CA 1 
ATOM 5115 C CA . ARG M 11 330  ? 229.034 153.126 167.729 1.00 224.62 ? 330  ARG N CA 1 
ATOM 5116 C CA . PHE M 11 331  ? 228.962 152.152 164.044 1.00 237.21 ? 331  PHE N CA 1 
ATOM 5117 C CA . PHE M 11 332  ? 227.593 148.765 164.978 1.00 199.33 ? 332  PHE N CA 1 
ATOM 5118 C CA . TYR M 11 333  ? 224.830 150.379 166.986 1.00 180.95 ? 333  TYR N CA 1 
ATOM 5119 C CA . ARG M 11 334  ? 223.628 152.555 164.069 1.00 314.49 ? 334  ARG N CA 1 
ATOM 5120 C CA . ILE M 11 335  ? 223.169 149.585 161.598 1.00 208.35 ? 335  ILE N CA 1 
ATOM 5121 C CA . TYR M 11 336  ? 221.481 147.066 163.894 1.00 175.79 ? 336  TYR N CA 1 
ATOM 5122 C CA . ALA M 11 337  ? 219.259 149.900 165.347 1.00 262.44 ? 337  ALA N CA 1 
ATOM 5123 C CA . SER M 11 338  ? 218.056 150.812 161.872 1.00 279.60 ? 338  SER N CA 1 
ATOM 5124 C CA . LEU M 11 339  ? 217.491 147.078 161.279 1.00 223.51 ? 339  LEU N CA 1 
ATOM 5125 C CA . ARG M 11 340  ? 215.292 146.937 164.357 1.00 320.56 ? 340  ARG N CA 1 
ATOM 5126 C CA . ILE M 11 341  ? 213.402 150.088 163.136 1.00 422.31 ? 341  ILE N CA 1 
ATOM 5127 C CA . GLU M 11 342  ? 212.314 148.487 159.801 1.00 463.74 ? 342  GLU N CA 1 
ATOM 5128 C CA . GLU M 11 343  ? 211.314 145.159 161.393 1.00 500.00 ? 343  GLU N CA 1 
ATOM 5129 C CA . LEU M 11 344  ? 209.726 147.083 164.343 1.00 500.00 ? 344  LEU N CA 1 
ATOM 5130 C CA . PHE M 11 345  ? 206.252 146.990 162.771 1.00 500.00 ? 345  PHE N CA 1 
ATOM 5131 C CA . SER M 11 346  ? 206.823 143.250 162.137 1.00 500.00 ? 346  SER N CA 1 
ATOM 5132 C CA . ILE M 11 347  ? 208.151 143.029 165.747 1.00 500.00 ? 347  ILE N CA 1 
ATOM 5133 C CA . VAL M 11 348  ? 204.876 144.577 167.058 1.00 480.00 ? 348  VAL N CA 1 
ATOM 5134 C CA . ARG M 11 349  ? 202.715 142.415 164.752 1.00 278.06 ? 349  ARG N CA 1 
ATOM 5135 C CA . ASP M 11 350  ? 202.592 139.538 167.319 1.00 265.87 ? 350  ASP N CA 1 
ATOM 5136 C CA . PHE M 11 351  ? 203.798 140.579 170.831 1.00 373.84 ? 351  PHE N CA 1 
ATOM 5137 C CA . PRO M 11 352  ? 203.816 137.214 172.706 1.00 327.64 ? 352  PRO N CA 1 
ATOM 5138 C CA . ASP M 11 353  ? 207.419 136.839 171.582 1.00 301.33 ? 353  ASP N CA 1 
ATOM 5139 C CA . SER M 11 354  ? 209.849 139.429 170.039 1.00 442.51 ? 354  SER N CA 1 
ATOM 5140 C CA . ARG M 11 355  ? 209.848 141.193 173.452 1.00 426.37 ? 355  ARG N CA 1 
ATOM 5141 C CA . PRO M 11 356  ? 213.650 140.899 173.740 1.00 329.76 ? 356  PRO N CA 1 
ATOM 5142 C CA . ALA M 11 357  ? 214.002 142.295 170.139 1.00 233.47 ? 357  ALA N CA 1 
ATOM 5143 C CA . ILE M 11 358  ? 212.579 145.737 171.203 1.00 346.14 ? 358  ILE N CA 1 
ATOM 5144 C CA . GLU M 11 359  ? 214.811 145.556 174.312 1.00 292.00 ? 359  GLU N CA 1 
ATOM 5145 C CA . ASP M 11 360  ? 217.878 145.220 171.983 1.00 287.95 ? 360  ASP N CA 1 
ATOM 5146 C CA . LEU M 11 361  ? 216.603 148.247 169.985 1.00 319.94 ? 361  LEU N CA 1 
ATOM 5147 C CA . LYS M 11 362  ? 216.076 150.044 173.341 1.00 244.18 ? 362  LYS N CA 1 
ATOM 5148 C CA . TYR M 11 363  ? 219.685 149.385 174.288 1.00 211.13 ? 363  TYR N CA 1 
ATOM 5149 C CA . CYS M 11 364  ? 220.552 150.532 170.827 1.00 224.70 ? 364  CYS N CA 1 
ATOM 5150 C CA . LEU M 11 365  ? 218.471 153.723 171.177 1.00 260.14 ? 365  LEU N CA 1 
ATOM 5151 C CA . GLU M 11 366  ? 220.177 155.007 174.313 1.00 264.50 ? 366  GLU N CA 1 
ATOM 5152 C CA . ARG M 11 367  ? 223.080 155.840 172.009 1.00 220.08 ? 367  ARG N CA 1 
ATOM 5153 C CA . THR M 11 368  ? 222.321 159.041 170.049 1.00 273.36 ? 368  THR N CA 1 
ATOM 5154 C CA . ASP M 11 369  ? 220.909 160.174 167.786 1.00 268.86 ? 369  ASP N CA 1 
ATOM 5155 C CA . GLN M 11 370  ? 218.362 158.078 165.846 1.00 403.95 ? 370  GLN N CA 1 
ATOM 5156 C CA . ARG M 11 371  ? 215.239 159.160 167.797 1.00 394.42 ? 371  ARG N CA 1 
ATOM 5157 C CA . GLN M 11 372  ? 214.108 161.336 164.819 1.00 500.00 ? 372  GLN N CA 1 
ATOM 5158 C CA . GLN M 11 373  ? 214.626 158.533 162.249 1.00 500.00 ? 373  GLN N CA 1 
ATOM 5159 C CA . LEU M 11 374  ? 212.636 156.130 164.469 1.00 500.00 ? 374  LEU N CA 1 
ATOM 5160 C CA . LEU M 11 375  ? 209.541 158.406 164.648 1.00 500.00 ? 375  LEU N CA 1 
ATOM 5161 C CA . VAL M 11 376  ? 209.519 159.295 160.903 1.00 500.00 ? 376  VAL N CA 1 
ATOM 5162 C CA . SER M 11 377  ? 209.925 155.651 159.743 1.00 500.00 ? 377  SER N CA 1 
ATOM 5163 C CA . LEU M 11 378  ? 207.349 154.372 162.305 1.00 500.00 ? 378  LEU N CA 1 
ATOM 5164 C CA . LYS M 11 379  ? 204.662 156.865 161.168 1.00 500.00 ? 379  LYS N CA 1 
ATOM 5165 C CA . ALA M 11 380  ? 205.356 155.892 157.527 1.00 500.00 ? 380  ALA N CA 1 
ATOM 5166 C CA . ALA M 11 381  ? 205.279 152.152 158.419 1.00 500.00 ? 381  ALA N CA 1 
ATOM 5167 C CA . LEU M 11 382  ? 201.974 152.381 160.361 1.00 500.00 ? 382  LEU N CA 1 
ATOM 5168 C CA . GLU M 11 383  ? 200.194 154.302 157.564 1.00 500.00 ? 383  GLU N CA 1 
ATOM 5169 C CA . THR M 11 384  ? 201.528 151.933 154.864 1.00 500.00 ? 384  THR N CA 1 
ATOM 5170 C CA . ARG M 11 385  ? 200.714 148.758 156.879 1.00 500.00 ? 385  ARG N CA 1 
ATOM 5171 C CA . LEU M 11 386  ? 197.614 149.263 159.167 1.00 500.00 ? 386  LEU N CA 1 
ATOM 5172 C CA . LEU M 11 387  ? 196.124 152.839 159.361 1.00 500.00 ? 387  LEU N CA 1 
ATOM 5173 C CA . HIS M 11 388  ? 195.143 151.624 156.026 1.00 500.00 ? 388  HIS N CA 1 
ATOM 5174 C CA . PRO M 11 389  ? 191.553 150.635 155.092 1.00 500.00 ? 389  PRO N CA 1 
ATOM 5175 C CA . GLY M 11 390  ? 191.048 146.995 154.273 1.00 500.00 ? 390  GLY N CA 1 
ATOM 5176 C CA . VAL M 11 391  ? 192.576 146.110 157.632 1.00 500.00 ? 391  VAL N CA 1 
ATOM 5177 C CA . ASN M 11 392  ? 189.850 144.592 159.801 1.00 500.00 ? 392  ASN N CA 1 
ATOM 5178 C CA . THR M 11 393  ? 187.896 146.147 162.688 1.00 500.00 ? 393  THR N CA 1 
ATOM 5179 C CA . CYS M 11 394  ? 188.797 142.732 164.249 1.00 500.00 ? 394  CYS N CA 1 
ATOM 5180 C CA . ASP M 11 395  ? 191.521 145.212 164.591 1.00 500.00 ? 395  ASP N CA 1 
ATOM 5181 C CA . ILE M 11 396  ? 194.335 147.677 164.272 1.00 500.00 ? 396  ILE N CA 1 
ATOM 5182 C CA . ILE M 11 397  ? 193.535 147.739 168.025 1.00 500.00 ? 397  ILE N CA 1 
ATOM 5183 C CA . THR M 11 398  ? 195.079 144.262 168.786 1.00 500.00 ? 398  THR N CA 1 
ATOM 5184 C CA . LEU M 11 399  ? 198.395 145.522 167.350 1.00 479.15 ? 399  LEU N CA 1 
ATOM 5185 C CA . TYR M 11 400  ? 197.781 148.917 169.050 1.00 393.42 ? 400  TYR N CA 1 
ATOM 5186 C CA . ILE M 11 401  ? 197.472 147.341 172.569 1.00 277.20 ? 401  ILE N CA 1 
ATOM 5187 C CA . SER M 11 402  ? 200.662 145.369 171.687 1.00 368.67 ? 402  SER N CA 1 
ATOM 5188 C CA . ALA M 11 403  ? 202.190 148.733 170.663 1.00 403.79 ? 403  ALA N CA 1 
ATOM 5189 C CA . ILE M 11 404  ? 201.085 150.125 174.052 1.00 226.52 ? 404  ILE N CA 1 
ATOM 5190 C CA . LYS M 11 405  ? 202.855 147.325 176.080 1.00 236.27 ? 405  LYS N CA 1 
ATOM 5191 C CA . ALA M 11 406  ? 206.027 147.385 173.900 1.00 331.95 ? 406  ALA N CA 1 
ATOM 5192 C CA . LEU M 11 407  ? 206.446 151.218 173.708 1.00 375.98 ? 407  LEU N CA 1 
ATOM 5193 C CA . ARG M 11 408  ? 205.798 151.335 177.472 1.00 315.61 ? 408  ARG N CA 1 
ATOM 5194 C CA . VAL M 11 409  ? 209.209 149.603 177.383 1.00 288.97 ? 409  VAL N CA 1 
ATOM 5195 C CA . LEU M 11 410  ? 211.689 152.490 176.575 1.00 314.38 ? 410  LEU N CA 1 
ATOM 5196 C CA . ASP M 11 411  ? 211.278 156.358 176.769 1.00 368.00 ? 411  ASP N CA 1 
ATOM 5197 C CA . PRO M 11 412  ? 210.962 157.115 180.538 1.00 355.14 ? 412  PRO N CA 1 
ATOM 5198 C CA . SER M 11 413  ? 207.696 155.149 180.231 1.00 361.91 ? 413  SER N CA 1 
ATOM 5199 C CA . MET M 11 414  ? 205.589 156.144 177.197 1.00 307.79 ? 414  MET N CA 1 
ATOM 5200 C CA . VAL M 11 415  ? 207.003 159.522 176.053 1.00 260.04 ? 415  VAL N CA 1 
ATOM 5201 C CA . ILE M 11 416  ? 207.618 158.304 172.499 1.00 346.34 ? 416  ILE N CA 1 
ATOM 5202 C CA . LEU M 11 417  ? 204.264 156.432 172.504 1.00 232.54 ? 417  LEU N CA 1 
ATOM 5203 C CA . GLU M 11 418  ? 202.188 159.540 173.394 1.00 305.75 ? 418  GLU N CA 1 
ATOM 5204 C CA . VAL M 11 419  ? 203.631 160.967 170.127 1.00 390.70 ? 419  VAL N CA 1 
ATOM 5205 C CA . ALA M 11 420  ? 203.884 157.776 167.949 1.00 500.00 ? 420  ALA N CA 1 
ATOM 5206 C CA . CYS M 11 421  ? 200.315 156.513 168.557 1.00 500.00 ? 421  CYS N CA 1 
ATOM 5207 C CA . GLU M 11 422  ? 198.746 159.953 167.818 1.00 500.00 ? 422  GLU N CA 1 
ATOM 5208 C CA . PRO M 11 423  ? 197.898 158.932 164.189 1.00 500.00 ? 423  PRO N CA 1 
ATOM 5209 C CA . ILE M 11 424  ? 196.403 155.589 165.431 1.00 500.00 ? 424  ILE N CA 1 
ATOM 5210 C CA . ARG M 11 425  ? 194.037 157.618 167.677 1.00 500.00 ? 425  ARG N CA 1 
ATOM 5211 C CA . ARG M 11 426  ? 192.864 159.898 164.821 1.00 500.00 ? 426  ARG N CA 1 
ATOM 5212 C CA . TYR M 11 427  ? 192.376 156.988 162.394 1.00 500.00 ? 427  TYR N CA 1 
ATOM 5213 C CA . LEU M 11 428  ? 190.333 154.849 164.831 1.00 500.00 ? 428  LEU N CA 1 
ATOM 5214 C CA . ARG M 11 429  ? 187.919 157.665 165.802 1.00 500.00 ? 429  ARG N CA 1 
ATOM 5215 C CA . THR M 11 430  ? 187.438 158.277 162.044 1.00 500.00 ? 430  THR N CA 1 
ATOM 5216 C CA . ARG M 11 431  ? 186.582 154.784 160.655 1.00 500.00 ? 431  ARG N CA 1 
ATOM 5217 C CA . GLU M 11 432  ? 183.982 154.011 163.410 1.00 500.00 ? 432  GLU N CA 1 
ATOM 5218 C CA . ASP M 11 433  ? 181.946 150.803 164.180 1.00 500.00 ? 433  ASP N CA 1 
ATOM 5219 C CA . THR M 11 434  ? 184.997 149.871 166.321 1.00 500.00 ? 434  THR N CA 1 
ATOM 5220 C CA . VAL M 11 435  ? 183.281 150.686 169.685 1.00 500.00 ? 435  VAL N CA 1 
ATOM 5221 C CA . ARG M 11 436  ? 181.296 147.419 169.339 1.00 500.00 ? 436  ARG N CA 1 
ATOM 5222 C CA . GLN M 11 437  ? 184.412 145.326 168.628 1.00 500.00 ? 437  GLN N CA 1 
ATOM 5223 C CA . ILE M 11 438  ? 186.500 146.866 171.473 1.00 500.00 ? 438  ILE N CA 1 
ATOM 5224 C CA . VAL M 11 439  ? 183.798 145.724 173.956 1.00 500.00 ? 439  VAL N CA 1 
ATOM 5225 C CA . ALA M 11 440  ? 183.612 142.385 172.052 1.00 500.00 ? 440  ALA N CA 1 
ATOM 5226 C CA . GLY M 11 441  ? 187.435 142.093 172.299 1.00 500.00 ? 441  GLY N CA 1 
ATOM 5227 C CA . LEU M 11 442  ? 187.107 142.126 176.090 1.00 500.00 ? 442  LEU N CA 1 
ATOM 5228 C CA . THR M 11 443  ? 185.783 138.717 177.219 1.00 500.00 ? 443  THR N CA 1 
ATOM 5229 C CA . ASP M 11 451  ? 194.649 139.230 175.284 1.00 500.00 ? 451  ASP N CA 1 
ATOM 5230 C CA . LEU M 11 452  ? 192.310 142.094 176.351 1.00 500.00 ? 452  LEU N CA 1 
ATOM 5231 C CA . ALA M 11 453  ? 190.505 139.928 178.957 1.00 500.00 ? 453  ALA N CA 1 
ATOM 5232 C CA . VAL M 11 454  ? 193.770 138.882 180.687 1.00 500.00 ? 454  VAL N CA 1 
ATOM 5233 C CA . GLU M 11 455  ? 194.994 142.524 180.816 1.00 500.00 ? 455  GLU N CA 1 
ATOM 5234 C CA . LEU M 11 456  ? 191.690 143.640 182.402 1.00 500.00 ? 456  LEU N CA 1 
ATOM 5235 C CA . SER M 11 457  ? 191.945 140.948 185.151 1.00 477.70 ? 457  SER N CA 1 
ATOM 5236 C CA . LYS M 11 458  ? 195.172 142.367 186.657 1.00 237.32 ? 458  LYS N CA 1 
ATOM 5237 C CA . LYS M 11 495  ? 202.711 162.824 179.866 1.00 416.16 ? 495  LYS N CA 1 
ATOM 5238 C CA . ARG M 11 496  ? 199.637 160.620 179.527 1.00 350.66 ? 496  ARG N CA 1 
ATOM 5239 C CA . ARG M 11 497  ? 199.037 157.502 181.605 1.00 329.51 ? 497  ARG N CA 1 
ATOM 5240 C CA . SER M 11 498  ? 200.134 154.132 180.249 1.00 324.17 ? 498  SER N CA 1 
ATOM 5241 C CA . SER M 11 499  ? 196.484 153.441 179.612 1.00 339.09 ? 499  SER N CA 1 
ATOM 5242 C CA . ASP M 11 500  ? 196.362 149.930 178.130 1.00 251.17 ? 500  ASP N CA 1 
ATOM 5243 C CA . ILE M 11 501  ? 192.624 149.288 178.247 1.00 354.47 ? 501  ILE N CA 1 
ATOM 5244 C CA . ILE M 11 502  ? 192.307 152.754 179.729 1.00 428.98 ? 502  ILE N CA 1 
ATOM 5245 C CA . SER M 11 503  ? 193.860 154.594 176.740 1.00 265.66 ? 503  SER N CA 1 
ATOM 5246 C CA . LEU M 11 504  ? 191.922 152.317 174.484 1.00 227.52 ? 504  LEU N CA 1 
ATOM 5247 C CA . LEU M 11 505  ? 188.732 153.743 175.981 1.00 444.02 ? 505  LEU N CA 1 
ATOM 5248 C CA . VAL M 11 506  ? 190.307 157.211 176.327 1.00 500.00 ? 506  VAL N CA 1 
ATOM 5249 C CA . SER M 11 507  ? 192.478 157.086 173.202 1.00 500.00 ? 507  SER N CA 1 
ATOM 5250 C CA . ILE M 11 508  ? 189.935 155.523 170.856 1.00 500.00 ? 508  ILE N CA 1 
ATOM 5251 C CA . TYR M 11 509  ? 186.979 157.973 171.245 1.00 500.00 ? 509  TYR N CA 1 
ATOM 5252 C CA . GLY M 11 510  ? 187.029 158.259 174.247 1.00 500.00 ? 510  GLY N CA 1 
ATOM 5253 C CA . SER M 11 511  ? 183.987 160.752 178.030 1.00 500.00 ? 511  SER N CA 1 
ATOM 5254 C CA . LYS M 11 512  ? 183.052 157.337 179.531 1.00 500.00 ? 512  LYS N CA 1 
ATOM 5255 C CA . ASP M 11 513  ? 179.390 157.431 178.406 1.00 500.00 ? 513  ASP N CA 1 
ATOM 5256 C CA . LEU M 11 514  ? 179.841 155.890 174.907 1.00 500.00 ? 514  LEU N CA 1 
ATOM 5257 C CA . PHE M 11 515  ? 181.578 152.705 176.159 1.00 500.00 ? 515  PHE N CA 1 
ATOM 5258 C CA . ILE M 11 516  ? 179.056 152.391 179.013 1.00 500.00 ? 516  ILE N CA 1 
ATOM 5259 C CA . ASN M 11 517  ? 176.291 152.548 176.324 1.00 500.00 ? 517  ASN N CA 1 
ATOM 5260 C CA . GLU M 11 518  ? 177.917 149.905 174.071 1.00 500.00 ? 518  GLU N CA 1 
ATOM 5261 C CA . TYR M 11 519  ? 178.608 147.405 176.902 1.00 500.00 ? 519  TYR N CA 1 
ATOM 5262 C CA . ARG M 11 520  ? 174.865 147.456 177.895 1.00 500.00 ? 520  ARG N CA 1 
ATOM 5263 C CA . SER M 11 521  ? 173.682 147.315 174.226 1.00 500.00 ? 521  SER N CA 1 
ATOM 5264 C CA . LEU M 11 522  ? 175.888 144.250 173.555 1.00 500.00 ? 522  LEU N CA 1 
ATOM 5265 C CA . LEU M 11 523  ? 174.507 142.491 176.689 1.00 500.00 ? 523  LEU N CA 1 
ATOM 5266 C CA . ALA M 11 524  ? 171.013 143.079 175.272 1.00 500.00 ? 524  ALA N CA 1 
ATOM 5267 C CA . ASP M 11 525  ? 171.764 140.777 172.283 1.00 500.00 ? 525  ASP N CA 1 
ATOM 5268 C CA . ARG M 11 526  ? 173.507 138.219 174.508 1.00 482.79 ? 526  ARG N CA 1 
ATOM 5269 C CA . LEU M 11 527  ? 170.166 137.961 176.304 1.00 394.37 ? 527  LEU N CA 1 
ATOM 5270 C CA . LEU M 11 528  ? 168.498 136.926 173.046 1.00 452.47 ? 528  LEU N CA 1 
ATOM 5271 C CA . HIS M 11 529  ? 171.156 134.226 172.850 1.00 410.09 ? 529  HIS N CA 1 
ATOM 5272 C CA . GLN M 11 530  ? 172.082 131.889 175.676 1.00 500.00 ? 530  GLN N CA 1 
ATOM 5273 C CA . PHE M 11 531  ? 175.715 132.012 174.577 1.00 500.00 ? 531  PHE N CA 1 
ATOM 5274 C CA . SER M 11 532  ? 176.427 129.187 177.005 1.00 500.00 ? 532  SER N CA 1 
ATOM 5275 C CA . PHE M 11 533  ? 177.882 129.560 179.409 1.00 463.99 ? 533  PHE N CA 1 
ATOM 5276 C CA . GLU M 11 534  ? 176.421 133.074 179.567 1.00 475.37 ? 534  GLU N CA 1 
ATOM 5277 C CA . PRO M 11 535  ? 176.240 132.977 183.341 1.00 483.46 ? 535  PRO N CA 1 
ATOM 5278 C CA . GLU M 11 536  ? 179.328 134.260 185.154 1.00 423.34 ? 536  GLU N CA 1 
ATOM 5279 C CA . ARG M 11 537  ? 180.570 136.638 182.454 1.00 490.54 ? 537  ARG N CA 1 
ATOM 5280 C CA . GLU M 11 538  ? 178.670 139.899 182.939 1.00 500.00 ? 538  GLU N CA 1 
ATOM 5281 C CA . ILE M 11 539  ? 179.534 140.099 186.642 1.00 500.00 ? 539  ILE N CA 1 
ATOM 5282 C CA . ARG M 11 540  ? 183.142 139.341 185.885 1.00 500.00 ? 540  ARG N CA 1 
ATOM 5283 C CA . ASN M 11 541  ? 183.230 142.137 183.294 1.00 500.00 ? 541  ASN N CA 1 
ATOM 5284 C CA . VAL M 11 542  ? 181.548 144.461 185.766 1.00 500.00 ? 542  VAL N CA 1 
ATOM 5285 C CA . GLU M 11 543  ? 184.183 144.150 188.537 1.00 500.00 ? 543  GLU N CA 1 
ATOM 5286 C CA . LEU M 11 544  ? 187.186 145.253 186.357 1.00 500.00 ? 544  LEU N CA 1 
ATOM 5287 C CA . LEU M 11 545  ? 185.572 148.565 185.332 1.00 500.00 ? 545  LEU N CA 1 
ATOM 5288 C CA . LYS M 11 546  ? 185.099 149.287 189.093 1.00 467.79 ? 546  LYS N CA 1 
ATOM 5289 C CA . LEU M 11 547  ? 188.910 149.224 189.390 1.00 304.57 ? 547  LEU N CA 1 
ATOM 5290 C CA . ARG M 11 548  ? 189.173 151.411 186.267 1.00 292.43 ? 548  ARG N CA 1 
ATOM 5291 C CA . PHE M 11 549  ? 186.280 153.883 185.942 1.00 420.10 ? 549  PHE N CA 1 
ATOM 5292 C CA . GLY M 11 550  ? 182.727 153.884 187.293 1.00 500.00 ? 550  GLY N CA 1 
ATOM 5293 C CA . GLU M 11 551  ? 181.090 151.986 188.654 1.00 500.00 ? 551  GLU N CA 1 
ATOM 5294 C CA . ALA M 11 552  ? 177.761 153.666 189.449 1.00 500.00 ? 552  ALA N CA 1 
ATOM 5295 C CA . PRO M 11 553  ? 176.761 153.934 185.786 1.00 500.00 ? 553  PRO N CA 1 
ATOM 5296 C CA . MET M 11 554  ? 177.879 150.309 185.338 1.00 500.00 ? 554  MET N CA 1 
ATOM 5297 C CA . HIS M 11 555  ? 175.162 149.355 187.836 1.00 500.00 ? 555  HIS N CA 1 
ATOM 5298 C CA . PHE M 11 556  ? 172.752 149.521 184.845 1.00 500.00 ? 556  PHE N CA 1 
ATOM 5299 C CA . CYS M 11 557  ? 174.893 146.741 183.216 1.00 500.00 ? 557  CYS N CA 1 
ATOM 5300 C CA . GLU M 11 558  ? 174.953 144.302 186.229 1.00 470.18 ? 558  GLU N CA 1 
ATOM 5301 C CA . VAL M 11 559  ? 171.187 144.238 186.858 1.00 316.38 ? 559  VAL N CA 1 
ATOM 5302 C CA . MET M 11 560  ? 170.537 143.459 183.162 1.00 345.96 ? 560  MET N CA 1 
ATOM 5303 C CA . LEU M 11 561  ? 172.120 139.988 183.505 1.00 442.60 ? 561  LEU N CA 1 
ATOM 5304 C CA . LYS M 11 562  ? 170.488 139.162 186.847 1.00 336.66 ? 562  LYS N CA 1 
ATOM 5305 C CA . ASP M 11 563  ? 167.024 139.700 185.177 1.00 303.36 ? 563  ASP N CA 1 
ATOM 5306 C CA . MET M 11 564  ? 168.743 136.269 182.926 1.00 447.26 ? 564  MET N CA 1 
ATOM 5307 C CA . ALA M 11 565  ? 169.156 134.641 186.400 1.00 371.50 ? 565  ALA N CA 1 
ATOM 5308 C CA . ASP M 11 566  ? 165.639 135.572 187.570 1.00 390.98 ? 566  ASP N CA 1 
ATOM 5309 C CA . SER M 11 567  ? 164.378 134.297 184.184 1.00 342.18 ? 567  SER N CA 1 
ATOM 5310 C CA . ARG M 11 568  ? 165.783 130.858 185.112 1.00 426.89 ? 568  ARG N CA 1 
ATOM 5311 C CA . ARG M 11 569  ? 163.860 131.009 188.423 1.00 500.00 ? 569  ARG N CA 1 
ATOM 5312 C CA . ILE M 11 570  ? 160.517 132.241 186.977 1.00 500.00 ? 570  ILE N CA 1 
ATOM 5313 C CA . ASN M 11 571  ? 160.602 129.748 184.069 1.00 500.00 ? 571  ASN N CA 1 
ATOM 5314 C CA . ALA M 11 572  ? 161.456 126.936 186.519 1.00 500.00 ? 572  ALA N CA 1 
ATOM 5315 C CA . ASN M 11 573  ? 158.343 127.630 188.642 1.00 500.00 ? 573  ASN N CA 1 
ATOM 5316 C CA . ILE M 11 574  ? 155.903 127.878 185.678 1.00 500.00 ? 574  ILE N CA 1 
ATOM 5317 C CA . ARG M 11 575  ? 157.241 124.654 184.042 1.00 500.00 ? 575  ARG N CA 1 
ATOM 5318 C CA . GLU M 11 576  ? 156.886 122.748 187.347 1.00 500.00 ? 576  GLU N CA 1 
ATOM 5319 C CA . GLU M 11 577  ? 153.331 124.016 188.004 1.00 500.00 ? 577  GLU N CA 1 
ATOM 5320 C CA . ASP M 11 578  ? 152.186 123.574 184.343 1.00 500.00 ? 578  ASP N CA 1 
ATOM 5321 C CA . GLU M 11 579  ? 153.264 119.900 184.513 1.00 500.00 ? 579  GLU N CA 1 
ATOM 5322 C CA . LYS M 11 580  ? 151.098 119.549 187.654 1.00 500.00 ? 580  LYS N CA 1 
ATOM 5323 C CA . ARG M 11 581  ? 147.291 120.030 187.676 1.00 500.00 ? 581  ARG N CA 1 
ATOM 5324 C CA . PRO M 11 582  ? 147.051 122.728 190.505 1.00 500.00 ? 582  PRO N CA 1 
ATOM 5325 C CA . ALA M 11 583  ? 147.910 125.412 187.867 1.00 500.00 ? 583  ALA N CA 1 
ATOM 5326 C CA . GLU M 11 584  ? 144.425 125.070 186.238 1.00 500.00 ? 584  GLU N CA 1 
ATOM 5327 C CA . GLU M 11 585  ? 146.237 125.421 182.860 1.00 500.00 ? 585  GLU N CA 1 
ATOM 5328 C CA . GLN M 11 586  ? 147.679 123.055 180.242 1.00 500.00 ? 586  GLN N CA 1 
ATOM 5329 C CA . PRO M 11 587  ? 150.133 124.440 177.620 1.00 500.00 ? 587  PRO N CA 1 
ATOM 5330 C CA . PRO M 11 588  ? 149.338 123.725 173.897 1.00 500.00 ? 588  PRO N CA 1 
ATOM 5331 C CA . PHE M 11 589  ? 153.133 123.527 173.298 1.00 500.00 ? 589  PHE N CA 1 
ATOM 5332 C CA . GLY M 11 590  ? 156.528 123.747 175.079 1.00 500.00 ? 590  GLY N CA 1 
ATOM 5333 C CA . VAL M 11 591  ? 156.478 127.228 176.652 1.00 500.00 ? 591  VAL N CA 1 
ATOM 5334 C CA . TYR M 11 592  ? 159.250 129.662 177.724 1.00 464.69 ? 592  TYR N CA 1 
ATOM 5335 C CA . ALA M 11 593  ? 159.227 133.400 178.548 1.00 500.00 ? 593  ALA N CA 1 
ATOM 5336 C CA . VAL M 11 594  ? 162.441 135.352 179.283 1.00 475.40 ? 594  VAL N CA 1 
ATOM 5337 C CA . ILE M 11 595  ? 161.017 138.115 181.602 1.00 500.00 ? 595  ILE N CA 1 
ATOM 5338 C CA . LEU M 11 596  ? 162.796 141.521 181.332 1.00 500.00 ? 596  LEU N CA 1 
ATOM 5339 C CA . SER M 11 597  ? 162.935 144.616 183.606 1.00 500.00 ? 597  SER N CA 1 
ATOM 5340 C CA . SER M 11 598  ? 161.609 147.220 181.054 1.00 500.00 ? 598  SER N CA 1 
ATOM 5341 C CA . GLU M 11 599  ? 163.544 150.174 182.578 1.00 500.00 ? 599  GLU N CA 1 
ATOM 5342 C CA . PHE M 11 600  ? 167.052 148.703 182.166 1.00 491.26 ? 600  PHE N CA 1 
ATOM 5343 C CA . TRP M 11 601  ? 166.638 147.695 178.466 1.00 500.00 ? 601  TRP N CA 1 
ATOM 5344 C CA . PRO M 11 602  ? 167.708 150.176 175.688 1.00 500.00 ? 602  PRO N CA 1 
ATOM 5345 C CA . PRO M 11 603  ? 165.045 149.014 173.098 1.00 500.00 ? 603  PRO N CA 1 
ATOM 5346 C CA . PHE M 11 604  ? 161.406 150.201 172.745 1.00 500.00 ? 604  PHE N CA 1 
ATOM 5347 C CA . LYS M 11 605  ? 157.885 148.888 173.572 1.00 500.00 ? 605  LYS N CA 1 
ATOM 5348 C CA . ASP M 11 606  ? 157.184 148.328 169.784 1.00 500.00 ? 606  ASP N CA 1 
ATOM 5349 C CA . GLU M 11 607  ? 154.480 149.072 167.179 1.00 500.00 ? 607  GLU N CA 1 
ATOM 5350 C CA . LYS M 11 608  ? 151.086 147.482 167.976 1.00 500.00 ? 608  LYS N CA 1 
ATOM 5351 C CA . LEU M 11 609  ? 150.672 143.875 166.781 1.00 500.00 ? 609  LEU N CA 1 
ATOM 5352 C CA . GLU M 11 610  ? 147.659 141.556 166.601 1.00 500.00 ? 610  GLU N CA 1 
ATOM 5353 C CA . VAL M 11 611  ? 149.046 138.307 168.047 1.00 500.00 ? 611  VAL N CA 1 
ATOM 5354 C CA . PRO M 11 612  ? 148.698 134.805 166.441 1.00 500.00 ? 612  PRO N CA 1 
ATOM 5355 C CA . GLU M 11 613  ? 145.887 132.526 167.713 1.00 500.00 ? 613  GLU N CA 1 
ATOM 5356 C CA . ASP M 11 614  ? 148.243 129.722 168.866 1.00 500.00 ? 614  ASP N CA 1 
ATOM 5357 C CA . ILE M 11 615  ? 150.383 131.860 171.242 1.00 500.00 ? 615  ILE N CA 1 
ATOM 5358 C CA . ARG M 11 616  ? 147.321 133.670 172.734 1.00 500.00 ? 616  ARG N CA 1 
ATOM 5359 C CA . ALA M 11 617  ? 146.441 130.706 175.011 1.00 500.00 ? 617  ALA N CA 1 
ATOM 5360 C CA . ALA M 11 618  ? 150.095 130.383 176.130 1.00 500.00 ? 618  ALA N CA 1 
ATOM 5361 C CA . LEU M 11 619  ? 150.334 134.096 177.069 1.00 500.00 ? 619  LEU N CA 1 
ATOM 5362 C CA . GLU M 11 620  ? 147.005 133.877 178.966 1.00 500.00 ? 620  GLU N CA 1 
ATOM 5363 C CA . ALA M 11 621  ? 148.366 130.817 180.836 1.00 500.00 ? 621  ALA N CA 1 
ATOM 5364 C CA . TYR M 11 622  ? 151.532 132.835 181.630 1.00 500.00 ? 622  TYR N CA 1 
ATOM 5365 C CA . CYS M 11 623  ? 149.398 135.865 182.658 1.00 500.00 ? 623  CYS N CA 1 
ATOM 5366 C CA . LYS M 11 624  ? 147.269 133.710 185.015 1.00 500.00 ? 624  LYS N CA 1 
ATOM 5367 C CA . LYS M 11 625  ? 150.475 132.251 186.552 1.00 500.00 ? 625  LYS N CA 1 
ATOM 5368 C CA . TYR M 11 626  ? 152.002 135.752 186.675 1.00 500.00 ? 626  TYR N CA 1 
ATOM 5369 C CA . GLU M 11 627  ? 149.142 137.142 188.830 1.00 500.00 ? 627  GLU N CA 1 
ATOM 5370 C CA . GLN M 11 628  ? 149.042 133.883 190.884 1.00 500.00 ? 628  GLN N CA 1 
ATOM 5371 C CA . LEU M 11 629  ? 152.704 134.400 191.846 1.00 500.00 ? 629  LEU N CA 1 
ATOM 5372 C CA . LYS M 11 630  ? 153.665 138.105 192.136 1.00 500.00 ? 630  LYS N CA 1 
ATOM 5373 C CA . ALA M 11 631  ? 150.908 140.650 192.923 1.00 500.00 ? 631  ALA N CA 1 
ATOM 5374 C CA . MET M 11 632  ? 149.264 143.033 190.373 1.00 481.12 ? 632  MET N CA 1 
ATOM 5375 C CA . ARG M 11 633  ? 151.395 142.084 187.340 1.00 478.96 ? 633  ARG N CA 1 
ATOM 5376 C CA . THR M 11 634  ? 149.671 142.766 183.938 1.00 500.00 ? 634  THR N CA 1 
ATOM 5377 C CA . LEU M 11 635  ? 151.855 141.867 180.913 1.00 500.00 ? 635  LEU N CA 1 
ATOM 5378 C CA . SER M 11 636  ? 153.395 143.850 177.980 1.00 500.00 ? 636  SER N CA 1 
ATOM 5379 C CA . TRP M 11 637  ? 154.511 142.066 174.779 1.00 500.00 ? 637  TRP N CA 1 
ATOM 5380 C CA . LYS M 11 638  ? 157.819 143.264 173.194 1.00 500.00 ? 638  LYS N CA 1 
ATOM 5381 C CA . HIS M 11 639  ? 156.699 141.470 170.015 1.00 500.00 ? 639  HIS N CA 1 
ATOM 5382 C CA . THR M 11 640  ? 159.228 142.757 167.411 1.00 500.00 ? 640  THR N CA 1 
ATOM 5383 C CA . LEU M 11 641  ? 162.136 141.320 169.463 1.00 500.00 ? 641  LEU N CA 1 
ATOM 5384 C CA . GLY M 11 642  ? 160.659 137.981 170.548 1.00 500.00 ? 642  GLY N CA 1 
ATOM 5385 C CA . LEU M 11 643  ? 161.725 134.499 169.412 1.00 500.00 ? 643  LEU N CA 1 
ATOM 5386 C CA . VAL M 11 644  ? 159.547 131.667 168.045 1.00 500.00 ? 644  VAL N CA 1 
ATOM 5387 C CA . THR M 11 645  ? 160.478 128.343 166.438 1.00 500.00 ? 645  THR N CA 1 
ATOM 5388 C CA . MET M 11 646  ? 157.846 126.640 164.289 1.00 500.00 ? 646  MET N CA 1 
ATOM 5389 C CA . ASP M 11 647  ? 157.469 123.465 162.205 1.00 500.00 ? 647  ASP N CA 1 
ATOM 5390 C CA . VAL M 11 648  ? 156.465 123.934 158.548 1.00 500.00 ? 648  VAL N CA 1 
ATOM 5391 C CA . GLU M 11 649  ? 154.611 120.858 157.241 1.00 500.00 ? 649  GLU N CA 1 
ATOM 5392 C CA . LEU M 11 650  ? 153.502 122.391 153.890 1.00 470.07 ? 650  LEU N CA 1 
ATOM 5393 C CA . ALA M 11 651  ? 157.126 122.119 152.668 1.00 422.71 ? 651  ALA N CA 1 
ATOM 5394 C CA . ASP M 11 652  ? 158.001 118.645 151.272 1.00 447.39 ? 652  ASP N CA 1 
ATOM 5395 C CA . ARG M 11 653  ? 160.854 118.237 153.780 1.00 486.06 ? 653  ARG N CA 1 
ATOM 5396 C CA . THR M 11 654  ? 160.328 118.801 157.533 1.00 500.00 ? 654  THR N CA 1 
ATOM 5397 C CA . LEU M 11 655  ? 161.467 122.330 158.401 1.00 500.00 ? 655  LEU N CA 1 
ATOM 5398 C CA . SER M 11 656  ? 162.140 124.108 161.709 1.00 500.00 ? 656  SER N CA 1 
ATOM 5399 C CA . VAL M 11 657  ? 161.905 127.844 160.939 1.00 500.00 ? 657  VAL N CA 1 
ATOM 5400 C CA . ALA M 11 658  ? 163.406 129.645 164.058 1.00 500.00 ? 658  ALA N CA 1 
ATOM 5401 C CA . VAL M 11 659  ? 161.803 133.018 163.229 1.00 500.00 ? 659  VAL N CA 1 
ATOM 5402 C CA . THR M 11 660  ? 160.539 136.432 164.502 1.00 500.00 ? 660  THR N CA 1 
ATOM 5403 C CA . PRO M 11 661  ? 156.877 136.311 165.866 1.00 500.00 ? 661  PRO N CA 1 
ATOM 5404 C CA . VAL M 11 662  ? 155.842 138.892 163.206 1.00 500.00 ? 662  VAL N CA 1 
ATOM 5405 C CA . GLN M 11 663  ? 156.953 136.541 160.376 1.00 500.00 ? 663  GLN N CA 1 
ATOM 5406 C CA . ALA M 11 664  ? 155.417 133.553 162.211 1.00 500.00 ? 664  ALA N CA 1 
ATOM 5407 C CA . VAL M 11 665  ? 151.991 135.278 162.219 1.00 500.00 ? 665  VAL N CA 1 
ATOM 5408 C CA . ILE M 11 666  ? 152.454 136.032 158.460 1.00 500.00 ? 666  ILE N CA 1 
ATOM 5409 C CA . LEU M 11 667  ? 152.902 132.255 157.782 1.00 500.00 ? 667  LEU N CA 1 
ATOM 5410 C CA . LEU M 11 668  ? 150.005 131.451 160.171 1.00 500.00 ? 668  LEU N CA 1 
ATOM 5411 C CA . TYR M 11 669  ? 147.713 133.900 158.353 1.00 500.00 ? 669  TYR N CA 1 
ATOM 5412 C CA . PHE M 11 670  ? 148.564 131.821 155.280 1.00 500.00 ? 670  PHE N CA 1 
ATOM 5413 C CA . GLN M 11 671  ? 147.097 128.848 157.139 1.00 500.00 ? 671  GLN N CA 1 
ATOM 5414 C CA . ASP M 11 672  ? 143.668 130.338 156.454 1.00 500.00 ? 672  ASP N CA 1 
ATOM 5415 C CA . GLN M 11 673  ? 143.251 132.521 153.355 1.00 500.00 ? 673  GLN N CA 1 
ATOM 5416 C CA . ALA M 11 674  ? 145.860 131.699 150.699 1.00 500.00 ? 674  ALA N CA 1 
ATOM 5417 C CA . SER M 11 675  ? 145.703 135.110 149.008 1.00 500.00 ? 675  SER N CA 1 
ATOM 5418 C CA . TRP M 11 676  ? 147.081 138.342 150.465 1.00 500.00 ? 676  TRP N CA 1 
ATOM 5419 C CA . THR M 11 677  ? 148.117 141.898 149.528 1.00 500.00 ? 677  THR N CA 1 
ATOM 5420 C CA . LEU M 11 678  ? 150.865 143.686 151.484 1.00 500.00 ? 678  LEU N CA 1 
ATOM 5421 C CA . GLU M 11 679  ? 148.070 146.112 152.543 1.00 500.00 ? 679  GLU N CA 1 
ATOM 5422 C CA . GLU M 11 680  ? 145.774 143.170 153.468 1.00 500.00 ? 680  GLU N CA 1 
ATOM 5423 C CA . LEU M 11 681  ? 148.525 141.637 155.648 1.00 500.00 ? 681  LEU N CA 1 
ATOM 5424 C CA . SER M 11 682  ? 149.220 145.151 157.057 1.00 500.00 ? 682  SER N CA 1 
ATOM 5425 C CA . LYS M 11 683  ? 145.559 145.139 158.185 1.00 500.00 ? 683  LYS N CA 1 
ATOM 5426 C CA . ALA M 11 684  ? 145.677 141.519 159.488 1.00 500.00 ? 684  ALA N CA 1 
ATOM 5427 C CA . VAL M 11 685  ? 149.001 141.780 161.399 1.00 500.00 ? 685  VAL N CA 1 
ATOM 5428 C CA . LYS M 11 686  ? 148.534 145.561 162.142 1.00 500.00 ? 686  LYS N CA 1 
ATOM 5429 C CA . MET M 11 687  ? 152.222 146.258 161.353 1.00 500.00 ? 687  MET N CA 1 
ATOM 5430 C CA . PRO M 11 688  ? 153.339 149.499 159.621 1.00 500.00 ? 688  PRO N CA 1 
ATOM 5431 C CA . VAL M 11 689  ? 154.249 149.104 155.901 1.00 500.00 ? 689  VAL N CA 1 
ATOM 5432 C CA . ALA M 11 690  ? 157.947 149.996 156.493 1.00 500.00 ? 690  ALA N CA 1 
ATOM 5433 C CA . LEU M 11 691  ? 158.470 147.139 159.008 1.00 500.00 ? 691  LEU N CA 1 
ATOM 5434 C CA . LEU M 11 692  ? 156.287 144.607 157.121 1.00 500.00 ? 692  LEU N CA 1 
ATOM 5435 C CA . ARG M 11 693  ? 158.276 145.186 153.885 1.00 500.00 ? 693  ARG N CA 1 
ATOM 5436 C CA . ARG M 11 694  ? 161.546 144.737 155.859 1.00 500.00 ? 694  ARG N CA 1 
ATOM 5437 C CA . ARG M 11 695  ? 160.283 141.300 156.981 1.00 500.00 ? 695  ARG N CA 1 
ATOM 5438 C CA . MET M 11 696  ? 158.764 140.655 153.500 1.00 500.00 ? 696  MET N CA 1 
ATOM 5439 C CA . SER M 11 697  ? 162.317 140.968 152.083 1.00 500.00 ? 697  SER N CA 1 
ATOM 5440 C CA . VAL M 11 698  ? 163.617 138.294 154.525 1.00 500.00 ? 698  VAL N CA 1 
ATOM 5441 C CA . TRP M 11 699  ? 160.820 135.808 153.605 1.00 500.00 ? 699  TRP N CA 1 
ATOM 5442 C CA . LEU M 11 700  ? 161.383 136.459 149.862 1.00 500.00 ? 700  LEU N CA 1 
ATOM 5443 C CA . GLN M 11 701  ? 165.136 135.745 150.184 1.00 500.00 ? 701  GLN N CA 1 
ATOM 5444 C CA . GLN M 11 702  ? 164.233 132.531 152.077 1.00 500.00 ? 702  GLN N CA 1 
ATOM 5445 C CA . GLY M 11 703  ? 161.893 131.432 149.246 1.00 500.00 ? 703  GLY N CA 1 
ATOM 5446 C CA . VAL M 11 704  ? 158.872 130.447 151.361 1.00 500.00 ? 704  VAL N CA 1 
ATOM 5447 C CA . LEU M 11 705  ? 157.197 133.348 149.505 1.00 500.00 ? 705  LEU N CA 1 
ATOM 5448 C CA . ARG M 11 706  ? 157.441 134.254 145.800 1.00 500.00 ? 706  ARG N CA 1 
ATOM 5449 C CA . GLU M 11 707  ? 156.454 137.718 144.473 1.00 500.00 ? 707  GLU N CA 1 
ATOM 5450 C CA . GLU M 11 708  ? 153.565 138.491 142.080 1.00 500.00 ? 708  GLU N CA 1 
ATOM 5451 C CA . PRO M 11 709  ? 152.521 142.151 141.240 1.00 500.00 ? 709  PRO N CA 1 
ATOM 5452 C CA . PRO M 11 710  ? 150.965 144.401 142.360 1.00 500.00 ? 710  PRO N CA 1 
ATOM 5453 C CA . GLY M 11 711  ? 150.504 143.007 145.912 1.00 500.00 ? 711  GLY N CA 1 
ATOM 5454 C CA . THR M 11 712  ? 153.188 140.362 146.384 1.00 500.00 ? 712  THR N CA 1 
ATOM 5455 C CA . PHE M 11 713  ? 152.516 137.099 148.292 1.00 500.00 ? 713  PHE N CA 1 
ATOM 5456 C CA . SER M 11 714  ? 152.479 133.501 146.964 1.00 500.00 ? 714  SER N CA 1 
ATOM 5457 C CA . VAL M 11 715  ? 152.926 130.267 149.005 1.00 500.00 ? 715  VAL N CA 1 
ATOM 5458 C CA . ILE M 11 716  ? 154.819 128.249 146.261 1.00 500.00 ? 716  ILE N CA 1 
ATOM 5459 C CA . GLU M 11 717  ? 154.730 124.618 147.480 1.00 500.00 ? 717  GLU N CA 1 
ATOM 5460 C CA . GLU M 11 718  ? 157.912 123.580 145.582 1.00 500.00 ? 718  GLU N CA 1 
ATOM 5461 C CA . GLU M 11 719  ? 159.827 124.723 148.737 1.00 500.00 ? 719  GLU N CA 1 
ATOM 5462 C CA . ARG M 11 720  ? 162.991 122.776 149.596 1.00 500.00 ? 720  ARG N CA 1 
ATOM 5463 C CA . LEU M 11 751  ? 170.028 170.141 166.905 1.00 46.19  ? 751  LEU N CA 1 
ATOM 5464 C CA . LEU M 11 752  ? 166.635 171.829 167.444 1.00 47.54  ? 752  LEU N CA 1 
ATOM 5465 C CA . LEU M 11 753  ? 166.766 170.588 171.026 1.00 34.40  ? 753  LEU N CA 1 
ATOM 5466 C CA . PHE M 11 754  ? 170.225 172.140 171.460 1.00 29.37  ? 754  PHE N CA 1 
ATOM 5467 C CA . TRP M 11 755  ? 168.794 175.466 170.208 1.00 31.65  ? 755  TRP N CA 1 
ATOM 5468 C CA . THR M 11 756  ? 166.003 175.383 172.786 1.00 27.03  ? 756  THR N CA 1 
ATOM 5469 C CA . TYR M 11 757  ? 168.553 174.829 175.612 1.00 25.35  ? 757  TYR N CA 1 
ATOM 5470 C CA . ILE M 11 758  ? 170.917 177.496 174.176 1.00 25.44  ? 758  ILE N CA 1 
ATOM 5471 C CA . GLN M 11 759  ? 168.103 180.061 174.167 1.00 24.40  ? 759  GLN N CA 1 
ATOM 5472 C CA . ALA M 11 760  ? 167.296 179.284 177.830 1.00 30.76  ? 760  ALA N CA 1 
ATOM 5473 C CA . MET M 11 761  ? 170.944 179.338 178.925 1.00 28.09  ? 761  MET N CA 1 
ATOM 5474 C CA . LEU M 11 762  ? 171.302 182.773 177.364 1.00 30.31  ? 762  LEU N CA 1 
ATOM 5475 C CA . THR M 11 763  ? 167.966 184.120 178.605 1.00 28.26  ? 763  THR N CA 1 
ATOM 5476 C CA . ASN M 11 764  ? 168.908 183.334 182.185 1.00 26.10  ? 764  ASN N CA 1 
ATOM 5477 C CA . LEU M 11 765  ? 172.720 183.778 182.217 1.00 27.39  ? 765  LEU N CA 1 
ATOM 5478 C CA . GLU M 11 766  ? 172.735 186.635 179.659 1.00 36.79  ? 766  GLU N CA 1 
ATOM 5479 C CA . SER M 11 767  ? 176.046 185.879 177.860 1.00 29.06  ? 767  SER N CA 1 
ATOM 5480 C CA . LEU M 11 768  ? 178.276 182.857 177.531 1.00 25.85  ? 768  LEU N CA 1 
ATOM 5481 C CA . SER M 11 769  ? 181.509 181.907 175.815 1.00 27.84  ? 769  SER N CA 1 
ATOM 5482 C CA . LEU M 11 770  ? 181.644 178.982 173.404 1.00 26.93  ? 770  LEU N CA 1 
ATOM 5483 C CA . ASP M 11 771  ? 183.354 176.910 176.155 1.00 27.40  ? 771  ASP N CA 1 
ATOM 5484 C CA . ARG M 11 772  ? 180.592 177.552 178.654 1.00 24.62  ? 772  ARG N CA 1 
ATOM 5485 C CA . ILE M 11 773  ? 177.811 176.721 176.107 1.00 22.41  ? 773  ILE N CA 1 
ATOM 5486 C CA . TYR M 11 774  ? 179.674 173.572 175.114 1.00 24.54  ? 774  TYR N CA 1 
ATOM 5487 C CA . ASN M 11 775  ? 180.091 172.428 178.727 1.00 28.32  ? 775  ASN N CA 1 
ATOM 5488 C CA . MET M 11 776  ? 176.448 173.116 179.635 1.00 26.85  ? 776  MET N CA 1 
ATOM 5489 C CA . LEU M 11 777  ? 175.197 171.122 176.607 1.00 26.06  ? 777  LEU N CA 1 
ATOM 5490 C CA . ARG M 11 778  ? 177.556 168.282 177.563 1.00 28.29  ? 778  ARG N CA 1 
ATOM 5491 C CA . MET M 11 779  ? 176.317 168.189 181.132 1.00 31.30  ? 779  MET N CA 1 
ATOM 5492 C CA . PHE M 11 780  ? 172.571 168.709 180.473 1.00 35.99  ? 780  PHE N CA 1 
ATOM 5493 C CA . VAL M 11 781  ? 172.018 167.297 176.989 1.00 37.02  ? 781  VAL N CA 1 
ATOM 5494 C CA . VAL M 11 782  ? 174.863 164.958 175.908 1.00 37.53  ? 782  VAL N CA 1 
ATOM 5495 C CA . THR M 11 783  ? 175.015 163.211 179.320 1.00 44.05  ? 783  THR N CA 1 
ATOM 5496 C CA . GLY M 11 784  ? 171.513 164.477 180.147 1.00 46.75  ? 784  GLY N CA 1 
ATOM 5497 C CA . PRO M 11 785  ? 168.255 162.543 179.643 1.00 38.62  ? 785  PRO N CA 1 
ATOM 5498 C CA . ALA M 11 786  ? 168.306 163.265 175.883 1.00 34.88  ? 786  ALA N CA 1 
ATOM 5499 C CA . LEU M 11 787  ? 171.574 161.356 175.388 1.00 45.25  ? 787  LEU N CA 1 
ATOM 5500 C CA . ALA M 11 788  ? 172.305 163.617 172.365 1.00 40.58  ? 788  ALA N CA 1 
ATOM 5501 C CA . GLU M 11 789  ? 175.815 163.862 170.877 1.00 39.25  ? 789  GLU N CA 1 
ATOM 5502 C CA . ILE M 11 790  ? 177.680 167.029 169.888 1.00 45.74  ? 790  ILE N CA 1 
ATOM 5503 C CA . ASP M 11 791  ? 181.317 167.965 169.441 1.00 35.67  ? 791  ASP N CA 1 
ATOM 5504 C CA . LEU M 11 792  ? 182.890 171.364 169.666 1.00 27.95  ? 792  LEU N CA 1 
ATOM 5505 C CA . GLN M 11 793  ? 183.480 172.071 165.975 1.00 42.82  ? 793  GLN N CA 1 
ATOM 5506 C CA . GLU M 11 794  ? 179.882 171.274 165.097 1.00 43.12  ? 794  GLU N CA 1 
ATOM 5507 C CA . LEU M 11 795  ? 178.654 173.460 167.926 1.00 27.59  ? 795  LEU N CA 1 
ATOM 5508 C CA . GLN M 11 796  ? 180.812 176.385 166.849 1.00 33.42  ? 796  GLN N CA 1 
ATOM 5509 C CA . GLY M 11 797  ? 179.608 176.069 163.251 1.00 42.21  ? 797  GLY N CA 1 
ATOM 5510 C CA . TYR M 11 798  ? 176.037 175.967 164.535 1.00 39.05  ? 798  TYR N CA 1 
ATOM 5511 C CA . LEU M 11 799  ? 176.336 179.097 166.719 1.00 36.32  ? 799  LEU N CA 1 
ATOM 5512 C CA . GLN M 11 800  ? 178.049 180.846 163.791 1.00 51.30  ? 800  GLN N CA 1 
ATOM 5513 C CA . LYS M 11 801  ? 175.144 180.029 161.490 1.00 51.43  ? 801  LYS N CA 1 
ATOM 5514 C CA . LYS M 11 802  ? 172.847 181.421 164.205 1.00 45.16  ? 802  LYS N CA 1 
ATOM 5515 C CA . VAL M 11 803  ? 174.888 184.649 164.309 1.00 43.35  ? 803  VAL N CA 1 
ATOM 5516 C CA . ARG M 11 804  ? 174.798 184.962 160.486 1.00 57.67  ? 804  ARG N CA 1 
ATOM 5517 C CA . ASP M 11 805  ? 171.007 184.666 160.592 1.00 58.13  ? 805  ASP N CA 1 
ATOM 5518 C CA . GLN M 11 806  ? 170.854 187.142 163.471 1.00 49.33  ? 806  GLN N CA 1 
ATOM 5519 C CA . GLN M 11 807  ? 169.282 184.665 165.876 1.00 52.24  ? 807  GLN N CA 1 
ATOM 5520 C CA . LEU M 11 808  ? 172.410 185.225 167.995 1.00 42.81  ? 808  LEU N CA 1 
ATOM 5521 C CA . VAL M 11 809  ? 174.892 188.065 168.603 1.00 38.11  ? 809  VAL N CA 1 
ATOM 5522 C CA . TYR M 11 810  ? 178.651 187.495 169.008 1.00 35.32  ? 810  TYR N CA 1 
ATOM 5523 C CA . GLU M 11 811  ? 180.570 190.333 170.622 1.00 36.83  ? 811  GLU N CA 1 
ATOM 5524 C CA . ALA M 11 812  ? 183.463 190.756 173.045 1.00 34.14  ? 812  ALA N CA 1 
ATOM 5525 C CA . GLY M 11 813  ? 184.313 187.058 172.642 1.00 28.56  ? 813  GLY N CA 1 
ATOM 5526 C CA . VAL M 11 814  ? 180.897 185.804 173.826 1.00 28.45  ? 814  VAL N CA 1 
ATOM 5527 C CA . TYR M 11 815  ? 177.365 184.929 172.625 1.00 27.63  ? 815  TYR N CA 1 
ATOM 5528 C CA . ARG M 11 816  ? 174.159 186.744 173.466 1.00 28.88  ? 816  ARG N CA 1 
ATOM 5529 C CA . LEU M 11 817  ? 170.542 186.850 172.377 1.00 36.29  ? 817  LEU N CA 1 
ATOM 5530 C CA . PRO M 11 818  ? 169.649 189.873 170.264 1.00 47.12  ? 818  PRO N CA 1 
ATOM 5531 C CA . LYS N 12 27   ? 180.849 232.338 163.429 1.00 283.65 ? 27   LYS O CA 1 
ATOM 5532 C CA . ASP N 12 28   ? 178.002 232.393 160.858 1.00 266.74 ? 28   ASP O CA 1 
ATOM 5533 C CA . TRP N 12 29   ? 176.566 235.715 159.705 1.00 263.11 ? 29   TRP O CA 1 
ATOM 5534 C CA . VAL N 12 30   ? 174.047 237.127 157.204 1.00 239.30 ? 30   VAL O CA 1 
ATOM 5535 C CA . THR N 12 31   ? 174.994 238.210 153.648 1.00 248.35 ? 31   THR O CA 1 
ATOM 5536 C CA . PRO N 12 32   ? 172.977 239.510 150.589 1.00 200.41 ? 32   PRO O CA 1 
ATOM 5537 C CA . TYR N 12 33   ? 173.304 236.077 148.839 1.00 198.34 ? 33   TYR O CA 1 
ATOM 5538 C CA . LYS N 12 34   ? 172.130 234.272 152.029 1.00 213.14 ? 34   LYS O CA 1 
ATOM 5539 C CA . ILE N 12 35   ? 169.188 236.762 152.301 1.00 231.85 ? 35   ILE O CA 1 
ATOM 5540 C CA . ALA N 12 36   ? 168.243 235.962 148.699 1.00 227.45 ? 36   ALA O CA 1 
ATOM 5541 C CA . VAL N 12 37   ? 168.432 232.167 149.177 1.00 249.36 ? 37   VAL O CA 1 
ATOM 5542 C CA . LEU N 12 38   ? 166.435 232.597 152.368 1.00 279.79 ? 38   LEU O CA 1 
ATOM 5543 C CA . VAL N 12 39   ? 163.666 234.501 150.582 1.00 500.00 ? 39   VAL O CA 1 
ATOM 5544 C CA . LEU N 12 40   ? 163.382 231.764 147.976 1.00 500.00 ? 40   LEU O CA 1 
ATOM 5545 C CA . LEU N 12 41   ? 163.080 229.113 150.729 1.00 500.00 ? 41   LEU O CA 1 
ATOM 5546 C CA . ASN N 12 42   ? 160.469 231.036 152.548 1.00 500.00 ? 42   ASN O CA 1 
ATOM 5547 C CA . GLU N 12 43   ? 158.391 231.891 149.490 1.00 500.00 ? 43   GLU O CA 1 
ATOM 5548 C CA . MET N 12 44   ? 158.548 228.274 148.292 1.00 500.00 ? 44   MET O CA 1 
ATOM 5549 C CA . SER N 12 45   ? 157.339 226.644 151.483 1.00 500.00 ? 45   SER O CA 1 
ATOM 5550 C CA . ARG N 12 46   ? 154.195 228.674 151.718 1.00 500.00 ? 46   ARG O CA 1 
ATOM 5551 C CA . THR N 12 47   ? 150.850 226.801 151.917 1.00 500.00 ? 47   THR O CA 1 
ATOM 5552 C CA . GLY N 12 48   ? 148.946 229.479 149.945 1.00 500.00 ? 48   GLY O CA 1 
ATOM 5553 C CA . GLU N 12 49   ? 151.661 229.900 147.304 1.00 500.00 ? 49   GLU O CA 1 
ATOM 5554 C CA . GLY N 12 50   ? 152.435 226.178 146.876 1.00 500.00 ? 50   GLY O CA 1 
ATOM 5555 C CA . ALA N 12 51   ? 154.333 225.722 143.605 1.00 500.00 ? 51   ALA O CA 1 
ATOM 5556 C CA . VAL N 12 52   ? 153.724 225.960 139.842 1.00 500.00 ? 52   VAL O CA 1 
ATOM 5557 C CA . SER N 12 53   ? 153.846 222.179 139.695 1.00 500.00 ? 53   SER O CA 1 
ATOM 5558 C CA . LEU N 12 54   ? 154.346 219.300 142.198 1.00 500.00 ? 54   LEU O CA 1 
ATOM 5559 C CA . MET N 12 55   ? 157.199 218.000 139.946 1.00 500.00 ? 55   MET O CA 1 
ATOM 5560 C CA . GLU N 12 56   ? 159.004 221.420 140.123 1.00 500.00 ? 56   GLU O CA 1 
ATOM 5561 C CA . ARG N 12 57   ? 159.092 221.167 143.893 1.00 500.00 ? 57   ARG O CA 1 
ATOM 5562 C CA . ARG N 12 58   ? 161.089 217.901 143.507 1.00 496.98 ? 58   ARG O CA 1 
ATOM 5563 C CA . ARG N 12 59   ? 163.511 219.569 141.063 1.00 455.23 ? 59   ARG O CA 1 
ATOM 5564 C CA . LEU N 12 60   ? 163.812 222.681 143.354 1.00 381.20 ? 60   LEU O CA 1 
ATOM 5565 C CA . ASN N 12 61   ? 164.645 220.436 146.395 1.00 221.67 ? 61   ASN O CA 1 
ATOM 5566 C CA . GLN N 12 62   ? 167.601 218.930 144.473 1.00 269.97 ? 62   GLN O CA 1 
ATOM 5567 C CA . LEU N 12 63   ? 168.827 222.363 143.357 1.00 253.93 ? 63   LEU O CA 1 
ATOM 5568 C CA . LEU N 12 64   ? 168.430 224.024 146.747 1.00 261.40 ? 64   LEU O CA 1 
ATOM 5569 C CA . LEU N 12 65   ? 170.610 221.522 148.699 1.00 229.01 ? 65   LEU O CA 1 
ATOM 5570 C CA . PRO N 12 66   ? 173.768 222.516 146.766 1.00 243.26 ? 66   PRO O CA 1 
ATOM 5571 C CA . LEU N 12 67   ? 172.824 226.262 147.182 1.00 227.80 ? 67   LEU O CA 1 
ATOM 5572 C CA . LEU N 12 68   ? 172.741 226.062 150.978 1.00 224.51 ? 68   LEU O CA 1 
ATOM 5573 C CA . GLN N 12 69   ? 176.133 224.462 151.117 1.00 291.44 ? 69   GLN O CA 1 
ATOM 5574 C CA . GLY N 12 70   ? 177.668 226.143 148.042 1.00 218.68 ? 70   GLY O CA 1 
ATOM 5575 C CA . PRO N 12 71   ? 179.383 229.532 147.748 1.00 268.92 ? 71   PRO O CA 1 
ATOM 5576 C CA . ASP N 12 72   ? 177.547 232.890 147.354 1.00 276.75 ? 72   ASP O CA 1 
ATOM 5577 C CA . ILE N 12 73   ? 176.966 234.186 143.843 1.00 239.57 ? 73   ILE O CA 1 
ATOM 5578 C CA . THR N 12 74   ? 175.380 237.148 142.093 1.00 259.63 ? 74   THR O CA 1 
ATOM 5579 C CA . LEU N 12 75   ? 171.564 237.291 142.159 1.00 245.27 ? 75   LEU O CA 1 
ATOM 5580 C CA . SER N 12 76   ? 171.606 237.423 138.294 1.00 243.98 ? 76   SER O CA 1 
ATOM 5581 C CA . LYS N 12 77   ? 173.295 233.977 138.196 1.00 224.06 ? 77   LYS O CA 1 
ATOM 5582 C CA . LEU N 12 78   ? 171.038 232.540 140.938 1.00 229.17 ? 78   LEU O CA 1 
ATOM 5583 C CA . TYR N 12 79   ? 167.920 233.800 138.981 1.00 241.05 ? 79   TYR O CA 1 
ATOM 5584 C CA . LYS N 12 80   ? 169.188 231.884 135.901 1.00 249.50 ? 80   LYS O CA 1 
ATOM 5585 C CA . LEU N 12 81   ? 169.700 228.736 138.033 1.00 438.58 ? 81   LEU O CA 1 
ATOM 5586 C CA . ILE N 12 82   ? 166.237 229.067 139.660 1.00 406.34 ? 82   ILE O CA 1 
ATOM 5587 C CA . GLU N 12 83   ? 164.660 229.998 136.250 1.00 497.71 ? 83   GLU O CA 1 
ATOM 5588 C CA . GLU N 12 84   ? 166.127 226.854 134.679 1.00 500.00 ? 84   GLU O CA 1 
ATOM 5589 C CA . SER N 12 85   ? 164.544 224.637 137.369 1.00 500.00 ? 85   SER O CA 1 
ATOM 5590 C CA . CYS N 12 86   ? 161.321 226.692 137.429 1.00 500.00 ? 86   CYS O CA 1 
ATOM 5591 C CA . PRO N 12 87   ? 160.427 229.698 135.173 1.00 500.00 ? 87   PRO O CA 1 
ATOM 5592 C CA . GLN N 12 88   ? 157.567 230.796 137.549 1.00 500.00 ? 88   GLN O CA 1 
ATOM 5593 C CA . LEU N 12 89   ? 159.393 231.011 140.891 1.00 500.00 ? 89   LEU O CA 1 
ATOM 5594 C CA . ALA N 12 90   ? 162.234 233.241 139.528 1.00 500.00 ? 90   ALA O CA 1 
ATOM 5595 C CA . ASN N 12 91   ? 159.509 235.929 138.956 1.00 500.00 ? 91   ASN O CA 1 
ATOM 5596 C CA . SER N 12 92   ? 158.055 235.417 142.493 1.00 500.00 ? 92   SER O CA 1 
ATOM 5597 C CA . VAL N 12 93   ? 161.529 235.632 144.145 1.00 500.00 ? 93   VAL O CA 1 
ATOM 5598 C CA . GLN N 12 94   ? 162.527 238.652 142.022 1.00 500.00 ? 94   GLN O CA 1 
ATOM 5599 C CA . ILE N 12 95   ? 159.244 240.561 142.904 1.00 500.00 ? 95   ILE O CA 1 
ATOM 5600 C CA . ARG N 12 96   ? 159.690 239.891 146.601 1.00 500.00 ? 96   ARG O CA 1 
ATOM 5601 C CA . ILE N 12 97   ? 163.409 240.910 146.592 1.00 319.90 ? 97   ILE O CA 1 
ATOM 5602 C CA . LYS N 12 98   ? 162.713 243.944 144.305 1.00 416.52 ? 98   LYS O CA 1 
ATOM 5603 C CA . LEU N 12 99   ? 160.075 245.284 146.724 1.00 366.11 ? 99   LEU O CA 1 
ATOM 5604 C CA . MET N 12 100  ? 162.346 244.651 149.750 1.00 264.16 ? 100  MET O CA 1 
ATOM 5605 C CA . ALA N 12 101  ? 165.344 246.331 148.025 1.00 329.89 ? 101  ALA O CA 1 
ATOM 5606 C CA . GLU N 12 102  ? 163.359 249.364 146.889 1.00 306.49 ? 102  GLU O CA 1 
ATOM 5607 C CA . GLY N 12 103  ? 161.572 249.533 150.290 1.00 249.86 ? 103  GLY O CA 1 
ATOM 5608 C CA . GLU N 12 104  ? 162.950 250.731 153.591 1.00 222.48 ? 104  GLU O CA 1 
ATOM 5609 C CA . LEU N 12 105  ? 165.159 248.916 156.100 1.00 268.41 ? 105  LEU O CA 1 
ATOM 5610 C CA . LYS N 12 106  ? 161.970 248.191 158.087 1.00 247.00 ? 106  LYS O CA 1 
ATOM 5611 C CA . ASP N 12 107  ? 160.802 245.939 155.186 1.00 219.10 ? 107  ASP O CA 1 
ATOM 5612 C CA . MET N 12 108  ? 163.951 243.759 155.492 1.00 270.35 ? 108  MET O CA 1 
ATOM 5613 C CA . GLU N 12 109  ? 163.577 243.678 159.362 1.00 366.41 ? 109  GLU O CA 1 
ATOM 5614 C CA . GLN N 12 110  ? 159.896 242.668 158.766 1.00 436.09 ? 110  GLN O CA 1 
ATOM 5615 C CA . PHE N 12 111  ? 161.046 239.903 156.342 1.00 481.34 ? 111  PHE O CA 1 
ATOM 5616 C CA . PHE N 12 112  ? 163.227 238.406 159.112 1.00 383.56 ? 112  PHE O CA 1 
ATOM 5617 C CA . ASP N 12 113  ? 160.464 238.648 161.722 1.00 497.24 ? 113  ASP O CA 1 
ATOM 5618 C CA . ASP N 12 114  ? 158.034 236.959 159.176 1.00 500.00 ? 114  ASP O CA 1 
ATOM 5619 C CA . LEU N 12 115  ? 160.631 234.135 158.757 1.00 500.00 ? 115  LEU O CA 1 
ATOM 5620 C CA . SER N 12 116  ? 160.765 233.560 162.563 1.00 500.00 ? 116  SER O CA 1 
ATOM 5621 C CA . ASP N 12 117  ? 156.984 233.234 162.776 1.00 500.00 ? 117  ASP O CA 1 
ATOM 5622 C CA . SER N 12 118  ? 157.113 230.294 160.311 1.00 500.00 ? 118  SER O CA 1 
ATOM 5623 C CA . PHE N 12 119  ? 158.316 228.109 163.198 1.00 500.00 ? 119  PHE O CA 1 
ATOM 5624 C CA . GLU N 12 125  ? 155.802 224.734 158.046 1.00 500.00 ? 125  GLU O CA 1 
ATOM 5625 C CA . VAL N 12 126  ? 159.608 224.241 158.136 1.00 500.00 ? 126  VAL O CA 1 
ATOM 5626 C CA . HIS N 12 127  ? 160.285 221.548 160.742 1.00 500.00 ? 127  HIS O CA 1 
ATOM 5627 C CA . LYS N 12 128  ? 162.981 223.368 162.877 1.00 500.00 ? 128  LYS O CA 1 
ATOM 5628 C CA . THR N 12 129  ? 165.284 220.496 162.131 1.00 500.00 ? 129  THR O CA 1 
ATOM 5629 C CA . SER N 12 130  ? 166.773 219.181 158.871 1.00 500.00 ? 130  SER O CA 1 
ATOM 5630 C CA . VAL N 12 131  ? 168.953 221.255 156.502 1.00 461.89 ? 131  VAL O CA 1 
ATOM 5631 C CA . VAL N 12 132  ? 166.330 223.823 155.842 1.00 441.69 ? 132  VAL O CA 1 
ATOM 5632 C CA . GLY N 12 133  ? 165.386 224.165 159.515 1.00 398.90 ? 133  GLY O CA 1 
ATOM 5633 C CA . LEU N 12 134  ? 168.895 224.675 160.927 1.00 390.21 ? 134  LEU O CA 1 
ATOM 5634 C CA . PHE N 12 135  ? 169.842 226.880 157.995 1.00 313.36 ? 135  PHE O CA 1 
ATOM 5635 C CA . LEU N 12 136  ? 167.098 229.305 158.599 1.00 263.78 ? 136  LEU O CA 1 
ATOM 5636 C CA . ARG N 12 137  ? 167.730 229.215 162.427 1.00 258.78 ? 137  ARG O CA 1 
ATOM 5637 C CA . HIS N 12 138  ? 171.388 230.213 161.992 1.00 215.77 ? 138  HIS O CA 1 
ATOM 5638 C CA . MET N 12 139  ? 170.322 233.161 159.754 1.00 234.74 ? 139  MET O CA 1 
ATOM 5639 C CA . ILE N 12 140  ? 167.475 234.131 162.189 1.00 214.31 ? 140  ILE O CA 1 
ATOM 5640 C CA . LEU N 12 141  ? 169.901 234.004 165.120 1.00 176.78 ? 141  LEU O CA 1 
ATOM 5641 C CA . ALA N 12 142  ? 172.667 235.833 163.217 1.00 201.78 ? 142  ALA O CA 1 
ATOM 5642 C CA . TYR N 12 143  ? 170.396 238.622 162.151 1.00 211.60 ? 143  TYR O CA 1 
ATOM 5643 C CA . SER N 12 144  ? 168.991 239.064 165.693 1.00 202.85 ? 144  SER O CA 1 
ATOM 5644 C CA . LYS N 12 145  ? 172.538 239.408 167.080 1.00 189.49 ? 145  LYS O CA 1 
ATOM 5645 C CA . LEU N 12 146  ? 173.503 242.286 164.602 1.00 158.57 ? 146  LEU O CA 1 
ATOM 5646 C CA . SER N 12 147  ? 173.440 245.915 165.750 1.00 162.67 ? 147  SER O CA 1 
ATOM 5647 C CA . PHE N 12 148  ? 171.163 248.250 163.785 1.00 189.94 ? 148  PHE O CA 1 
ATOM 5648 C CA . SER N 12 149  ? 174.456 249.456 162.396 1.00 179.08 ? 149  SER O CA 1 
ATOM 5649 C CA . GLN N 12 150  ? 175.474 245.945 161.087 1.00 168.28 ? 150  GLN O CA 1 
ATOM 5650 C CA . VAL N 12 151  ? 171.943 245.233 159.830 1.00 139.76 ? 151  VAL O CA 1 
ATOM 5651 C CA . PHE N 12 152  ? 171.891 248.687 158.156 1.00 169.40 ? 152  PHE O CA 1 
ATOM 5652 C CA . LYS N 12 153  ? 175.153 247.642 156.448 1.00 175.94 ? 153  LYS O CA 1 
ATOM 5653 C CA . LEU N 12 154  ? 173.399 244.412 155.454 1.00 167.25 ? 154  LEU O CA 1 
ATOM 5654 C CA . TYR N 12 155  ? 170.701 246.650 153.976 1.00 224.94 ? 155  TYR O CA 1 
ATOM 5655 C CA . THR N 12 156  ? 173.352 248.680 152.134 1.00 204.11 ? 156  THR O CA 1 
ATOM 5656 C CA . ALA N 12 157  ? 174.926 245.530 150.605 1.00 175.12 ? 157  ALA O CA 1 
ATOM 5657 C CA . LEU N 12 158  ? 171.517 244.058 149.887 1.00 152.82 ? 158  LEU O CA 1 
ATOM 5658 C CA . GLN N 12 159  ? 170.641 246.946 147.559 1.00 207.77 ? 159  GLN O CA 1 
ATOM 5659 C CA . GLN N 12 160  ? 174.000 246.636 145.678 1.00 201.25 ? 160  GLN O CA 1 
ATOM 5660 C CA . TYR N 12 161  ? 173.345 242.897 145.309 1.00 212.56 ? 161  TYR O CA 1 
ATOM 5661 C CA . PHE N 12 162  ? 169.847 243.392 143.821 1.00 231.04 ? 162  PHE O CA 1 
ATOM 5662 C CA . GLN N 12 163  ? 171.259 246.144 141.652 1.00 222.10 ? 163  GLN O CA 1 
ATOM 5663 C CA . ASN N 12 164  ? 173.802 243.807 139.929 1.00 215.61 ? 164  ASN O CA 1 
ATOM 5664 C CA . GLY N 12 165  ? 171.001 241.314 139.154 1.00 268.69 ? 165  GLY O CA 1 
ATOM 5665 C CA . GLU N 12 166  ? 168.682 243.976 137.657 1.00 406.91 ? 166  GLU O CA 1 
ATOM 5666 C CA . LYS N 12 167  ? 171.597 245.714 135.815 1.00 471.57 ? 167  LYS O CA 1 
ATOM 5667 C CA . LYS N 12 168  ? 172.600 242.489 134.013 1.00 479.79 ? 168  LYS O CA 1 
ATOM 5668 C CA . PRO N 12 206  ? 188.090 239.647 154.593 1.00 272.20 ? 206  PRO O CA 1 
ATOM 5669 C CA . LEU N 12 207  ? 186.887 236.184 155.658 1.00 221.46 ? 207  LEU O CA 1 
ATOM 5670 C CA . SER N 12 208  ? 184.686 234.190 158.081 1.00 230.96 ? 208  SER O CA 1 
ATOM 5671 C CA . GLN N 12 209  ? 185.275 231.801 161.023 1.00 206.67 ? 209  GLN O CA 1 
ATOM 5672 C CA . LYS N 12 210  ? 183.057 229.167 159.318 1.00 227.90 ? 210  LYS O CA 1 
ATOM 5673 C CA . GLN N 12 211  ? 184.576 229.647 155.858 1.00 225.70 ? 211  GLN O CA 1 
ATOM 5674 C CA . ALA N 12 212  ? 188.209 229.397 157.113 1.00 196.13 ? 212  ALA O CA 1 
ATOM 5675 C CA . GLU N 12 213  ? 187.431 226.097 158.839 1.00 240.13 ? 213  GLU O CA 1 
ATOM 5676 C CA . PHE N 12 214  ? 186.104 224.943 155.415 1.00 233.50 ? 214  PHE O CA 1 
ATOM 5677 C CA . PHE N 12 215  ? 189.042 226.463 153.540 1.00 206.70 ? 215  PHE O CA 1 
ATOM 5678 C CA . LEU N 12 216  ? 191.542 224.575 155.753 1.00 272.99 ? 216  LEU O CA 1 
ATOM 5679 C CA . SER N 12 217  ? 189.560 221.318 155.746 1.00 236.91 ? 217  SER O CA 1 
ATOM 5680 C CA . GLN N 12 218  ? 189.527 221.186 151.924 1.00 193.86 ? 218  GLN O CA 1 
ATOM 5681 C CA . GLN N 12 219  ? 193.109 222.457 151.520 1.00 128.29 ? 219  GLN O CA 1 
ATOM 5682 C CA . ALA N 12 220  ? 194.693 220.035 153.973 1.00 118.36 ? 220  ALA O CA 1 
ATOM 5683 C CA . GLU N 12 221  ? 192.847 217.122 152.515 1.00 184.14 ? 221  GLU O CA 1 
ATOM 5684 C CA . LEU N 12 222  ? 194.598 218.309 149.411 1.00 151.36 ? 222  LEU O CA 1 
ATOM 5685 C CA . LEU N 12 223  ? 197.969 218.882 151.075 1.00 149.03 ? 223  LEU O CA 1 
ATOM 5686 C CA . LYS N 12 224  ? 197.911 215.308 152.447 1.00 187.88 ? 224  LYS O CA 1 
ATOM 5687 C CA . ASN N 12 225  ? 196.860 213.683 149.110 1.00 178.91 ? 225  ASN O CA 1 
ATOM 5688 C CA . ASP N 12 226  ? 198.024 216.118 146.388 1.00 249.47 ? 226  ASP O CA 1 
ATOM 5689 C CA . GLU N 12 227  ? 200.180 219.178 145.809 1.00 263.08 ? 227  GLU O CA 1 
ATOM 5690 C CA . THR N 12 228  ? 199.048 219.967 142.255 1.00 240.66 ? 228  THR O CA 1 
ATOM 5691 C CA . LYS N 12 229  ? 195.268 220.300 142.801 1.00 233.33 ? 229  LYS O CA 1 
ATOM 5692 C CA . ALA N 12 230  ? 195.824 222.651 145.865 1.00 185.36 ? 230  ALA O CA 1 
ATOM 5693 C CA . LEU N 12 231  ? 197.870 225.923 146.153 1.00 166.44 ? 231  LEU O CA 1 
ATOM 5694 C CA . GLU N 12 232  ? 201.619 226.365 145.392 1.00 334.23 ? 232  GLU O CA 1 
ATOM 5695 C CA . PRO N 12 233  ? 203.621 227.374 148.514 1.00 150.39 ? 233  PRO O CA 1 
ATOM 5696 C CA . ALA N 12 234  ? 203.950 230.994 147.590 1.00 171.67 ? 234  ALA O CA 1 
ATOM 5697 C CA . SER N 12 235  ? 200.174 231.381 147.250 1.00 296.82 ? 235  SER O CA 1 
ATOM 5698 C CA . LEU N 12 236  ? 199.061 229.302 150.277 1.00 191.70 ? 236  LEU O CA 1 
ATOM 5699 C CA . GLN N 12 237  ? 201.319 231.062 152.664 1.00 120.13 ? 237  GLN O CA 1 
ATOM 5700 C CA . LYS N 12 238  ? 200.177 234.619 151.957 1.00 154.58 ? 238  LYS O CA 1 
ATOM 5701 C CA . GLU N 12 239  ? 196.585 233.258 152.054 1.00 187.18 ? 239  GLU O CA 1 
ATOM 5702 C CA . LEU N 12 240  ? 197.316 231.987 155.518 1.00 164.56 ? 240  LEU O CA 1 
ATOM 5703 C CA . ASN N 12 241  ? 198.877 235.362 156.472 1.00 168.38 ? 241  ASN O CA 1 
ATOM 5704 C CA . ASN N 12 242  ? 195.852 237.167 154.946 1.00 189.21 ? 242  ASN O CA 1 
ATOM 5705 C CA . LEU N 12 243  ? 193.667 234.853 156.946 1.00 146.60 ? 243  LEU O CA 1 
ATOM 5706 C CA . LEU N 12 244  ? 195.771 235.502 160.085 1.00 164.36 ? 244  LEU O CA 1 
ATOM 5707 C CA . LYS N 12 245  ? 195.819 239.274 159.795 1.00 233.43 ? 245  LYS O CA 1 
ATOM 5708 C CA . PHE N 12 246  ? 192.048 239.089 160.260 1.00 197.30 ? 246  PHE O CA 1 
ATOM 5709 C CA . ASN N 12 247  ? 192.309 236.728 163.223 1.00 189.13 ? 247  ASN O CA 1 
ATOM 5710 C CA . PRO N 12 248  ? 195.602 235.534 164.808 1.00 162.99 ? 248  PRO O CA 1 
ATOM 5711 C CA . ASP N 12 249  ? 193.565 233.445 167.264 1.00 381.97 ? 249  ASP O CA 1 
ATOM 5712 C CA . PHE N 12 250  ? 192.889 230.679 164.659 1.00 467.23 ? 250  PHE O CA 1 
ATOM 5713 C CA . ALA N 12 251  ? 195.488 228.046 165.625 1.00 493.04 ? 251  ALA O CA 1 
ATOM 5714 C CA . GLU N 12 252  ? 195.112 225.645 162.654 1.00 462.08 ? 252  GLU O CA 1 
ATOM 5715 C CA . ALA N 12 253  ? 196.271 228.396 160.223 1.00 406.24 ? 253  ALA O CA 1 
ATOM 5716 C CA . HIS N 12 254  ? 199.792 227.931 161.652 1.00 406.70 ? 254  HIS O CA 1 
ATOM 5717 C CA . TYR N 12 255  ? 199.496 224.165 160.989 1.00 353.08 ? 255  TYR O CA 1 
ATOM 5718 C CA . LEU N 12 256  ? 198.611 224.651 157.280 1.00 121.57 ? 256  LEU O CA 1 
ATOM 5719 C CA . SER N 12 257  ? 201.714 226.903 156.964 1.00 184.70 ? 257  SER O CA 1 
ATOM 5720 C CA . TYR N 12 258  ? 203.733 224.056 158.689 1.00 287.08 ? 258  TYR O CA 1 
ATOM 5721 C CA . LEU N 12 259  ? 202.374 221.414 156.228 1.00 313.71 ? 259  LEU O CA 1 
ATOM 5722 C CA . ASN N 12 260  ? 202.948 223.990 153.488 1.00 181.40 ? 260  ASN O CA 1 
ATOM 5723 C CA . ASN N 12 261  ? 206.531 224.760 154.717 1.00 117.00 ? 261  ASN O CA 1 
ATOM 5724 C CA . LEU N 12 262  ? 207.030 220.916 155.109 1.00 139.28 ? 262  LEU O CA 1 
ATOM 5725 C CA . ARG N 12 263  ? 205.846 220.282 151.494 1.00 142.75 ? 263  ARG O CA 1 
ATOM 5726 C CA . VAL N 12 264  ? 208.413 222.937 150.566 1.00 134.94 ? 264  VAL O CA 1 
ATOM 5727 C CA . GLN N 12 265  ? 211.236 221.265 152.604 1.00 172.70 ? 265  GLN O CA 1 
ATOM 5728 C CA . ASP N 12 266  ? 211.627 224.147 155.041 1.00 166.35 ? 266  ASP O CA 1 
ATOM 5729 C CA . VAL N 12 267  ? 213.873 222.995 157.804 1.00 140.87 ? 267  VAL O CA 1 
ATOM 5730 C CA . PHE N 12 268  ? 213.382 226.321 159.421 1.00 163.50 ? 268  PHE O CA 1 
ATOM 5731 C CA . SER N 12 269  ? 209.884 227.403 158.659 1.00 189.16 ? 269  SER O CA 1 
ATOM 5732 C CA . SER N 12 270  ? 208.360 224.070 159.566 1.00 251.31 ? 270  SER O CA 1 
ATOM 5733 C CA . THR N 12 271  ? 209.886 224.285 163.068 1.00 191.17 ? 271  THR O CA 1 
ATOM 5734 C CA . HIS N 12 272  ? 208.977 227.938 163.367 1.00 133.72 ? 272  HIS O CA 1 
ATOM 5735 C CA . SER N 12 273  ? 205.454 227.096 162.286 1.00 222.49 ? 273  SER O CA 1 
ATOM 5736 C CA . LEU N 12 274  ? 204.923 223.870 164.412 1.00 279.49 ? 274  LEU O CA 1 
ATOM 5737 C CA . LEU N 12 275  ? 206.127 225.250 167.805 1.00 116.92 ? 275  LEU O CA 1 
ATOM 5738 C CA . HIS N 12 276  ? 203.976 228.300 167.161 1.00 105.96 ? 276  HIS O CA 1 
ATOM 5739 C CA . TYR N 12 277  ? 200.969 226.059 166.450 1.00 290.22 ? 277  TYR O CA 1 
ATOM 5740 C CA . PHE N 12 278  ? 201.233 223.835 169.580 1.00 357.28 ? 278  PHE O CA 1 
ATOM 5741 C CA . ASP N 12 279  ? 201.587 227.009 171.676 1.00 267.74 ? 279  ASP O CA 1 
ATOM 5742 C CA . ARG N 12 280  ? 198.301 228.481 170.557 1.00 132.52 ? 280  ARG O CA 1 
ATOM 5743 C CA . LEU N 12 281  ? 196.285 225.269 170.048 1.00 327.69 ? 281  LEU O CA 1 
ATOM 5744 C CA . ILE N 12 282  ? 193.480 224.551 172.562 1.00 428.99 ? 282  ILE O CA 1 
ATOM 5745 C CA . LEU N 12 283  ? 192.792 220.874 171.895 1.00 500.00 ? 283  LEU O CA 1 
ATOM 5746 C CA . ARG N 12 298  ? 196.641 218.001 175.816 1.00 500.00 ? 298  ARG O CA 1 
ATOM 5747 C CA . SER N 12 299  ? 198.832 219.949 173.325 1.00 500.00 ? 299  SER O CA 1 
ATOM 5748 C CA . LEU N 12 300  ? 202.236 219.551 175.019 1.00 500.00 ? 300  LEU O CA 1 
ATOM 5749 C CA . ARG N 12 301  ? 202.470 215.728 174.719 1.00 500.00 ? 301  ARG O CA 1 
ATOM 5750 C CA . TYR N 12 302  ? 201.868 215.800 170.930 1.00 500.00 ? 302  TYR O CA 1 
ATOM 5751 C CA . ALA N 12 303  ? 204.061 218.941 170.544 1.00 500.00 ? 303  ALA O CA 1 
ATOM 5752 C CA . ALA N 12 304  ? 207.294 217.240 171.631 1.00 404.44 ? 304  ALA O CA 1 
ATOM 5753 C CA . LEU N 12 305  ? 206.123 214.127 169.698 1.00 463.62 ? 305  LEU O CA 1 
ATOM 5754 C CA . ASN N 12 306  ? 205.838 216.258 166.558 1.00 441.14 ? 306  ASN O CA 1 
ATOM 5755 C CA . LEU N 12 307  ? 209.128 218.178 167.226 1.00 306.47 ? 307  LEU O CA 1 
ATOM 5756 C CA . ALA N 12 308  ? 210.844 214.744 167.464 1.00 239.91 ? 308  ALA O CA 1 
ATOM 5757 C CA . ALA N 12 309  ? 209.131 213.448 164.357 1.00 148.54 ? 309  ALA O CA 1 
ATOM 5758 C CA . LEU N 12 310  ? 210.028 216.693 162.732 1.00 157.58 ? 310  LEU O CA 1 
ATOM 5759 C CA . HIS N 12 311  ? 213.656 215.767 162.988 1.00 181.26 ? 311  HIS O CA 1 
ATOM 5760 C CA . CYS N 12 312  ? 212.771 212.290 161.609 1.00 180.79 ? 312  CYS O CA 1 
ATOM 5761 C CA . ARG N 12 313  ? 211.253 213.823 158.454 1.00 185.84 ? 313  ARG O CA 1 
ATOM 5762 C CA . PHE N 12 314  ? 214.435 215.860 158.023 1.00 168.05 ? 314  PHE O CA 1 
ATOM 5763 C CA . GLY N 12 315  ? 216.615 212.795 158.858 1.00 167.63 ? 315  GLY O CA 1 
ATOM 5764 C CA . HIS N 12 316  ? 218.320 214.199 161.966 1.00 169.68 ? 316  HIS O CA 1 
ATOM 5765 C CA . TYR N 12 317  ? 217.840 210.924 163.681 1.00 174.76 ? 317  TYR O CA 1 
ATOM 5766 C CA . GLN N 12 318  ? 220.262 211.615 166.584 1.00 197.00 ? 318  GLN O CA 1 
ATOM 5767 C CA . GLN N 12 319  ? 218.374 214.842 167.251 1.00 136.99 ? 319  GLN O CA 1 
ATOM 5768 C CA . ALA N 12 320  ? 215.065 213.097 166.818 1.00 98.24  ? 320  ALA O CA 1 
ATOM 5769 C CA . GLU N 12 321  ? 215.903 210.312 169.330 1.00 134.35 ? 321  GLU O CA 1 
ATOM 5770 C CA . LEU N 12 322  ? 216.649 213.245 171.670 1.00 129.09 ? 322  LEU O CA 1 
ATOM 5771 C CA . ALA N 12 323  ? 213.335 214.900 171.097 1.00 108.12 ? 323  ALA O CA 1 
ATOM 5772 C CA . LEU N 12 324  ? 211.344 211.694 171.183 1.00 117.85 ? 324  LEU O CA 1 
ATOM 5773 C CA . GLN N 12 325  ? 212.650 211.403 174.747 1.00 120.83 ? 325  GLN O CA 1 
ATOM 5774 C CA . GLU N 12 326  ? 210.771 214.585 175.763 1.00 126.50 ? 326  GLU O CA 1 
ATOM 5775 C CA . ALA N 12 327  ? 207.702 213.248 173.970 1.00 253.26 ? 327  ALA O CA 1 
ATOM 5776 C CA . ILE N 12 328  ? 207.673 209.861 175.772 1.00 316.59 ? 328  ILE O CA 1 
ATOM 5777 C CA . ARG N 12 329  ? 208.339 211.604 179.199 1.00 217.32 ? 329  ARG O CA 1 
ATOM 5778 C CA . ILE N 12 330  ? 205.563 214.168 179.319 1.00 217.73 ? 330  ILE O CA 1 
ATOM 5779 C CA . ALA N 12 331  ? 203.092 211.593 177.764 1.00 390.41 ? 331  ALA O CA 1 
ATOM 5780 C CA . GLN N 12 332  ? 203.598 209.390 180.879 1.00 430.48 ? 332  GLN O CA 1 
ATOM 5781 C CA . GLU N 12 333  ? 203.108 212.389 183.205 1.00 466.68 ? 333  GLU O CA 1 
ATOM 5782 C CA . SER N 12 334  ? 199.581 212.642 181.667 1.00 489.00 ? 334  SER O CA 1 
ATOM 5783 C CA . ASN N 12 335  ? 199.491 208.767 181.597 1.00 500.00 ? 335  ASN O CA 1 
ATOM 5784 C CA . ASP N 12 336  ? 197.710 208.671 178.200 1.00 500.00 ? 336  ASP O CA 1 
ATOM 5785 C CA . HIS N 12 337  ? 198.083 205.482 176.120 1.00 500.00 ? 337  HIS O CA 1 
ATOM 5786 C CA . VAL N 12 338  ? 196.874 206.807 172.711 1.00 500.00 ? 338  VAL O CA 1 
ATOM 5787 C CA . CYS N 12 339  ? 199.748 209.374 172.523 1.00 500.00 ? 339  CYS O CA 1 
ATOM 5788 C CA . LEU N 12 340  ? 202.288 206.751 173.663 1.00 500.00 ? 340  LEU O CA 1 
ATOM 5789 C CA . GLN N 12 341  ? 201.361 204.376 170.799 1.00 486.12 ? 341  GLN O CA 1 
ATOM 5790 C CA . HIS N 12 342  ? 202.184 207.292 168.433 1.00 444.31 ? 342  HIS O CA 1 
ATOM 5791 C CA . CYS N 12 343  ? 205.557 207.504 170.208 1.00 259.28 ? 343  CYS O CA 1 
ATOM 5792 C CA . LEU N 12 344  ? 205.889 203.763 169.546 1.00 139.64 ? 344  LEU O CA 1 
ATOM 5793 C CA . SER N 12 345  ? 205.005 204.163 165.853 1.00 149.78 ? 345  SER O CA 1 
ATOM 5794 C CA . TRP N 12 346  ? 207.998 206.531 165.508 1.00 232.52 ? 346  TRP O CA 1 
ATOM 5795 C CA . LEU N 12 347  ? 210.008 204.895 168.281 1.00 139.02 ? 347  LEU O CA 1 
ATOM 5796 C CA . TYR N 12 348  ? 210.463 201.950 165.920 1.00 107.12 ? 348  TYR O CA 1 
ATOM 5797 C CA . VAL N 12 349  ? 211.327 204.121 162.940 1.00 106.75 ? 349  VAL O CA 1 
ATOM 5798 C CA . LEU N 12 350  ? 213.938 205.759 165.187 1.00 123.07 ? 350  LEU O CA 1 
ATOM 5799 C CA . GLY N 12 351  ? 215.399 202.330 165.778 1.00 216.12 ? 351  GLY O CA 1 
ATOM 5800 C CA . GLN N 12 352  ? 215.429 199.929 162.743 1.00 225.30 ? 352  GLN O CA 1 
ATOM 5801 C CA . LEU N 12 414  ? 191.488 204.259 155.746 1.00 232.09 ? 414  LEU O CA 1 
ATOM 5802 C CA . SER N 12 415  ? 192.672 205.143 152.214 1.00 188.42 ? 415  SER O CA 1 
ATOM 5803 C CA . GLU N 12 416  ? 196.263 205.733 152.906 1.00 187.45 ? 416  GLU O CA 1 
ATOM 5804 C CA . LEU N 12 417  ? 197.349 202.304 153.992 1.00 171.30 ? 417  LEU O CA 1 
ATOM 5805 C CA . ILE N 12 418  ? 195.530 200.794 150.965 1.00 156.64 ? 418  ILE O CA 1 
ATOM 5806 C CA . ASP N 12 419  ? 197.873 202.694 148.627 1.00 141.34 ? 419  ASP O CA 1 
ATOM 5807 C CA . ILE N 12 420  ? 200.891 201.965 150.784 1.00 130.31 ? 420  ILE O CA 1 
ATOM 5808 C CA . SER N 12 421  ? 200.216 198.181 151.005 1.00 287.21 ? 421  SER O CA 1 
ATOM 5809 C CA . ILE N 12 422  ? 199.811 197.897 147.217 1.00 301.19 ? 422  ILE O CA 1 
ATOM 5810 C CA . ALA N 12 423  ? 202.967 200.078 146.970 1.00 192.35 ? 423  ALA O CA 1 
ATOM 5811 C CA . GLN N 12 424  ? 204.580 198.009 149.771 1.00 111.16 ? 424  GLN O CA 1 
ATOM 5812 C CA . LYS N 12 425  ? 203.977 194.826 147.713 1.00 270.43 ? 425  LYS O CA 1 
ATOM 5813 C CA . THR N 12 426  ? 205.240 196.128 144.317 1.00 297.83 ? 426  THR O CA 1 
ATOM 5814 C CA . ALA N 12 427  ? 208.515 197.032 146.141 1.00 235.19 ? 427  ALA O CA 1 
ATOM 5815 C CA . ILE N 12 428  ? 208.531 193.614 148.000 1.00 161.57 ? 428  ILE O CA 1 
ATOM 5816 C CA . TRP N 12 429  ? 207.689 191.420 144.858 1.00 256.63 ? 429  TRP O CA 1 
ATOM 5817 C CA . ARG N 12 430  ? 210.276 193.638 143.084 1.00 171.09 ? 430  ARG O CA 1 
ATOM 5818 C CA . LEU N 12 431  ? 212.715 192.602 145.706 1.00 137.91 ? 431  LEU O CA 1 
ATOM 5819 C CA . TYR N 12 432  ? 211.842 188.944 145.434 1.00 154.68 ? 432  TYR O CA 1 
ATOM 5820 C CA . GLY N 12 433  ? 212.350 189.454 141.698 1.00 160.09 ? 433  GLY O CA 1 
ATOM 5821 C CA . ARG N 12 434  ? 208.872 188.343 140.843 1.00 178.11 ? 434  ARG O CA 1 
ATOM 5822 C CA . SER N 12 435  ? 208.761 190.890 138.115 1.00 145.78 ? 435  SER O CA 1 
ATOM 5823 C CA . THR N 12 436  ? 205.478 190.196 136.307 1.00 156.15 ? 436  THR O CA 1 
ATOM 5824 C CA . MET N 12 437  ? 203.863 190.059 139.763 1.00 242.58 ? 437  MET O CA 1 
ATOM 5825 C CA . ALA N 12 438  ? 205.147 193.614 140.586 1.00 271.60 ? 438  ALA O CA 1 
ATOM 5826 C CA . LEU N 12 439  ? 203.553 194.639 137.249 1.00 144.60 ? 439  LEU O CA 1 
ATOM 5827 C CA . GLN N 12 440  ? 200.173 193.384 138.479 1.00 242.51 ? 440  GLN O CA 1 
ATOM 5828 C CA . GLN N 12 441  ? 200.762 195.085 141.841 1.00 240.44 ? 441  GLN O CA 1 
ATOM 5829 C CA . ALA N 12 442  ? 201.692 198.482 140.440 1.00 154.15 ? 442  ALA O CA 1 
ATOM 5830 C CA . GLN N 12 443  ? 198.595 197.970 138.338 1.00 193.82 ? 443  GLN O CA 1 
ATOM 5831 C CA . MET N 12 444  ? 196.393 197.407 141.392 1.00 214.81 ? 444  MET O CA 1 
ATOM 5832 C CA . LEU N 12 445  ? 197.266 200.954 142.375 1.00 147.72 ? 445  LEU O CA 1 
ATOM 5833 C CA . LEU N 12 446  ? 196.883 202.672 139.001 1.00 184.11 ? 446  LEU O CA 1 
ATOM 5834 C CA . SER N 12 447  ? 193.521 200.994 138.541 1.00 164.16 ? 447  SER O CA 1 
ATOM 5835 C CA . MET N 12 448  ? 192.364 203.100 141.458 1.00 177.22 ? 448  MET O CA 1 
ATOM 5836 C CA . ASN N 12 449  ? 190.158 206.086 142.322 1.00 191.18 ? 449  ASN O CA 1 
ATOM 5837 C CA . SER N 12 450  ? 191.246 207.825 145.536 1.00 208.06 ? 450  SER O CA 1 
ATOM 5838 C CA . LEU N 12 451  ? 188.631 207.085 148.293 1.00 217.22 ? 451  LEU O CA 1 
ATOM 5839 C CA . GLN N 12 459  ? 190.938 210.716 140.968 1.00 205.67 ? 459  GLN O CA 1 
ATOM 5840 C CA . GLN N 12 460  ? 194.364 209.170 141.075 1.00 274.01 ? 460  GLN O CA 1 
ATOM 5841 C CA . ASN N 12 461  ? 195.751 210.349 144.478 1.00 271.28 ? 461  ASN O CA 1 
ATOM 5842 C CA . ASN N 12 462  ? 199.500 211.269 144.164 1.00 164.00 ? 462  ASN O CA 1 
ATOM 5843 C CA . THR N 12 463  ? 201.763 211.052 147.329 1.00 197.22 ? 463  THR O CA 1 
ATOM 5844 C CA . GLU N 12 464  ? 204.981 208.989 147.658 1.00 186.03 ? 464  GLU O CA 1 
ATOM 5845 C CA . SER N 12 465  ? 202.914 205.828 147.196 1.00 148.96 ? 465  SER O CA 1 
ATOM 5846 C CA . PHE N 12 466  ? 201.908 206.241 143.512 1.00 157.34 ? 466  PHE O CA 1 
ATOM 5847 C CA . ALA N 12 467  ? 205.396 207.536 142.791 1.00 159.95 ? 467  ALA O CA 1 
ATOM 5848 C CA . VAL N 12 468  ? 207.045 204.296 143.919 1.00 170.48 ? 468  VAL O CA 1 
ATOM 5849 C CA . ALA N 12 469  ? 204.317 202.589 141.872 1.00 244.09 ? 469  ALA O CA 1 
ATOM 5850 C CA . LEU N 12 470  ? 204.889 204.342 138.524 1.00 145.55 ? 470  LEU O CA 1 
ATOM 5851 C CA . CYS N 12 471  ? 208.563 204.070 139.174 1.00 148.01 ? 471  CYS O CA 1 
ATOM 5852 C CA . HIS N 12 472  ? 208.499 200.357 139.407 1.00 154.14 ? 472  HIS O CA 1 
ATOM 5853 C CA . LEU N 12 473  ? 206.171 200.542 136.441 1.00 219.85 ? 473  LEU O CA 1 
ATOM 5854 C CA . ALA N 12 474  ? 208.695 202.771 134.583 1.00 166.90 ? 474  ALA O CA 1 
ATOM 5855 C CA . GLU N 12 475  ? 211.607 200.559 135.587 1.00 140.28 ? 475  GLU O CA 1 
ATOM 5856 C CA . LEU N 12 476  ? 210.169 197.117 134.649 1.00 154.28 ? 476  LEU O CA 1 
ATOM 5857 C CA . HIS N 12 477  ? 209.486 198.611 131.176 1.00 232.41 ? 477  HIS O CA 1 
ATOM 5858 C CA . ALA N 12 478  ? 212.979 199.998 130.593 1.00 172.96 ? 478  ALA O CA 1 
ATOM 5859 C CA . GLU N 12 479  ? 214.278 196.629 131.753 1.00 203.83 ? 479  GLU O CA 1 
ATOM 5860 C CA . GLN N 12 480  ? 212.125 194.714 129.276 1.00 159.99 ? 480  GLN O CA 1 
ATOM 5861 C CA . GLY N 12 481  ? 213.063 196.919 126.317 1.00 201.57 ? 481  GLY O CA 1 
ATOM 5862 C CA . CYS N 12 482  ? 210.097 199.361 125.998 1.00 236.68 ? 482  CYS O CA 1 
ATOM 5863 C CA . PHE N 12 483  ? 212.209 202.457 126.960 1.00 170.87 ? 483  PHE O CA 1 
ATOM 5864 C CA . ALA N 12 484  ? 209.930 204.694 124.866 1.00 275.81 ? 484  ALA O CA 1 
ATOM 5865 C CA . ALA N 12 485  ? 207.009 203.127 126.824 1.00 241.29 ? 485  ALA O CA 1 
ATOM 5866 C CA . ALA N 12 486  ? 208.954 203.485 130.129 1.00 178.44 ? 486  ALA O CA 1 
ATOM 5867 C CA . SER N 12 487  ? 209.862 207.044 129.213 1.00 116.86 ? 487  SER O CA 1 
ATOM 5868 C CA . GLU N 12 488  ? 206.130 207.822 128.857 1.00 244.69 ? 488  GLU O CA 1 
ATOM 5869 C CA . VAL N 12 489  ? 205.854 206.729 132.501 1.00 153.35 ? 489  VAL O CA 1 
ATOM 5870 C CA . LEU N 12 490  ? 208.682 209.138 133.549 1.00 181.79 ? 490  LEU O CA 1 
ATOM 5871 C CA . LYS N 12 491  ? 206.644 211.686 131.564 1.00 303.49 ? 491  LYS O CA 1 
ATOM 5872 C CA . HIS N 12 492  ? 203.634 210.613 133.725 1.00 154.11 ? 492  HIS O CA 1 
ATOM 5873 C CA . LEU N 12 493  ? 205.810 210.859 136.875 1.00 148.06 ? 493  LEU O CA 1 
ATOM 5874 C CA . LYS N 12 494  ? 207.408 214.110 135.759 1.00 139.04 ? 494  LYS O CA 1 
ATOM 5875 C CA . GLU N 12 495  ? 203.856 215.550 135.541 1.00 256.57 ? 495  GLU O CA 1 
ATOM 5876 C CA . ARG N 12 496  ? 202.595 213.769 138.684 1.00 169.30 ? 496  ARG O CA 1 
ATOM 5877 C CA . PHE N 12 497  ? 205.416 215.095 140.828 1.00 158.12 ? 497  PHE O CA 1 
ATOM 5878 C CA . PRO N 12 498  ? 206.673 218.408 139.428 1.00 202.42 ? 498  PRO O CA 1 
ATOM 5879 C CA . PRO N 12 499  ? 210.496 218.922 139.409 1.00 194.26 ? 499  PRO O CA 1 
ATOM 5880 C CA . ASN N 12 500  ? 210.464 221.480 142.288 1.00 182.07 ? 500  ASN O CA 1 
ATOM 5881 C CA . SER N 12 501  ? 208.415 219.067 144.509 1.00 194.88 ? 501  SER O CA 1 
ATOM 5882 C CA . GLN N 12 502  ? 209.406 216.186 146.925 1.00 165.41 ? 502  GLN O CA 1 
ATOM 5883 C CA . HIS N 12 503  ? 209.401 212.718 145.380 1.00 152.38 ? 503  HIS O CA 1 
ATOM 5884 C CA . ALA N 12 504  ? 210.497 214.213 142.064 1.00 153.72 ? 504  ALA O CA 1 
ATOM 5885 C CA . GLN N 12 505  ? 213.684 212.942 143.754 1.00 177.07 ? 505  GLN O CA 1 
ATOM 5886 C CA . LEU N 12 506  ? 212.662 209.338 143.468 1.00 149.78 ? 506  LEU O CA 1 
ATOM 5887 C CA . TRP N 12 507  ? 211.480 209.450 139.855 1.00 113.87 ? 507  TRP O CA 1 
ATOM 5888 C CA . MET N 12 508  ? 214.593 211.528 138.973 1.00 122.14 ? 508  MET O CA 1 
ATOM 5889 C CA . LEU N 12 509  ? 216.649 208.815 140.564 1.00 135.88 ? 509  LEU O CA 1 
ATOM 5890 C CA . CYS N 12 510  ? 214.686 206.110 138.688 1.00 167.56 ? 510  CYS O CA 1 
ATOM 5891 C CA . ASP N 12 511  ? 215.010 207.948 135.317 1.00 181.19 ? 511  ASP O CA 1 
ATOM 5892 C CA . GLN N 12 512  ? 218.675 208.483 135.800 1.00 154.29 ? 512  GLN O CA 1 
ATOM 5893 C CA . LYS N 12 513  ? 219.193 204.697 136.302 1.00 150.10 ? 513  LYS O CA 1 
ATOM 5894 C CA . ILE N 12 514  ? 217.072 204.065 133.192 1.00 177.21 ? 514  ILE O CA 1 
ATOM 5895 C CA . GLN N 12 515  ? 219.114 206.544 131.195 1.00 209.46 ? 515  GLN O CA 1 
ATOM 5896 C CA . PHE N 12 516  ? 222.273 204.963 132.649 1.00 124.47 ? 516  PHE O CA 1 
ATOM 5897 C CA . ASP N 12 517  ? 221.405 201.546 131.403 1.00 189.86 ? 517  ASP O CA 1 
ATOM 5898 C CA . ARG N 12 518  ? 220.843 202.714 127.788 1.00 211.36 ? 518  ARG O CA 1 
ATOM 5899 C CA . ALA N 12 519  ? 224.176 204.564 127.923 1.00 215.04 ? 519  ALA O CA 1 
ATOM 5900 C CA . MET N 12 520  ? 225.951 201.382 129.196 1.00 182.83 ? 520  MET O CA 1 
ATOM 5901 C CA . ASN N 12 521  ? 224.577 199.212 126.418 1.00 210.86 ? 521  ASN O CA 1 
ATOM 5902 C CA . ASP N 12 522  ? 225.305 202.023 123.924 1.00 240.87 ? 522  ASP O CA 1 
ATOM 5903 C CA . GLY N 12 523  ? 228.839 201.974 125.346 1.00 223.52 ? 523  GLY O CA 1 
ATOM 5904 C CA . LYS N 12 524  ? 229.271 205.752 125.460 1.00 193.41 ? 524  LYS O CA 1 
ATOM 5905 C CA . TYR N 12 525  ? 231.332 205.789 128.628 1.00 190.65 ? 525  TYR O CA 1 
ATOM 5906 C CA . HIS N 12 526  ? 232.331 209.475 128.937 1.00 226.77 ? 526  HIS O CA 1 
ATOM 5907 C CA . LEU N 12 527  ? 228.585 210.337 128.702 1.00 208.42 ? 527  LEU O CA 1 
ATOM 5908 C CA . ALA N 12 528  ? 227.674 207.838 131.410 1.00 207.66 ? 528  ALA O CA 1 
ATOM 5909 C CA . ASP N 12 529  ? 230.306 209.162 133.818 1.00 181.65 ? 529  ASP O CA 1 
ATOM 5910 C CA . SER N 12 530  ? 228.582 212.520 133.442 1.00 169.99 ? 530  SER O CA 1 
ATOM 5911 C CA . LEU N 12 531  ? 225.324 210.719 134.356 1.00 153.02 ? 531  LEU O CA 1 
ATOM 5912 C CA . VAL N 12 532  ? 226.940 209.003 137.353 1.00 155.32 ? 532  VAL O CA 1 
ATOM 5913 C CA . THR N 12 533  ? 227.526 212.383 139.018 1.00 173.78 ? 533  THR O CA 1 
ATOM 5914 C CA . GLY N 12 534  ? 223.763 212.817 138.574 1.00 133.80 ? 534  GLY O CA 1 
ATOM 5915 C CA . ILE N 12 535  ? 222.881 209.460 140.135 1.00 124.66 ? 535  ILE O CA 1 
ATOM 5916 C CA . THR N 12 536  ? 225.342 209.702 143.022 1.00 149.09 ? 536  THR O CA 1 
ATOM 5917 C CA . ALA N 12 537  ? 223.733 212.980 144.202 1.00 154.13 ? 537  ALA O CA 1 
ATOM 5918 C CA . LEU N 12 538  ? 220.301 211.324 144.330 1.00 143.92 ? 538  LEU O CA 1 
ATOM 5919 C CA . ASN N 12 539  ? 221.042 207.891 145.866 1.00 155.19 ? 539  ASN O CA 1 
ATOM 5920 C CA . SER N 12 540  ? 224.678 208.266 146.893 1.00 160.14 ? 540  SER O CA 1 
ATOM 5921 C CA . ILE N 12 541  ? 225.037 204.547 147.820 1.00 170.89 ? 541  ILE O CA 1 
ATOM 5922 C CA . GLU N 12 542  ? 223.787 203.095 144.454 1.00 183.50 ? 542  GLU O CA 1 
ATOM 5923 C CA . GLY N 12 543  ? 225.226 206.151 142.699 1.00 136.06 ? 543  GLY O CA 1 
ATOM 5924 C CA . VAL N 12 544  ? 228.675 204.685 143.406 1.00 115.17 ? 544  VAL O CA 1 
ATOM 5925 C CA . TYR N 12 545  ? 227.799 201.033 143.014 1.00 182.72 ? 545  TYR O CA 1 
ATOM 5926 C CA . ARG N 12 546  ? 226.943 202.545 139.551 1.00 142.37 ? 546  ARG O CA 1 
ATOM 5927 C CA . LYS N 12 547  ? 230.100 204.729 139.577 1.00 101.23 ? 547  LYS O CA 1 
ATOM 5928 C CA . ALA N 12 548  ? 231.704 201.353 139.921 1.00 122.66 ? 548  ALA O CA 1 
ATOM 5929 C CA . VAL N 12 549  ? 230.121 199.861 136.819 1.00 167.08 ? 549  VAL O CA 1 
ATOM 5930 C CA . VAL N 12 550  ? 231.109 202.829 134.671 1.00 131.55 ? 550  VAL O CA 1 
ATOM 5931 C CA . LEU N 12 551  ? 234.556 202.820 136.300 1.00 126.28 ? 551  LEU O CA 1 
ATOM 5932 C CA . GLN N 12 552  ? 234.969 199.119 135.308 1.00 291.94 ? 552  GLN O CA 1 
ATOM 5933 C CA . ALA N 12 553  ? 233.801 199.256 131.723 1.00 141.20 ? 553  ALA O CA 1 
ATOM 5934 C CA . GLN N 12 554  ? 235.970 202.452 131.298 1.00 148.77 ? 554  GLN O CA 1 
ATOM 5935 C CA . ASN N 12 555  ? 239.027 200.279 132.079 1.00 169.21 ? 555  ASN O CA 1 
ATOM 5936 C CA . GLN N 12 556  ? 240.179 201.724 135.389 1.00 182.26 ? 556  GLN O CA 1 
ATOM 5937 C CA . MET N 12 557  ? 239.586 198.274 136.754 1.00 208.24 ? 557  MET O CA 1 
ATOM 5938 C CA . SER N 12 558  ? 241.467 198.351 140.065 1.00 234.04 ? 558  SER O CA 1 
ATOM 5939 C CA . GLU N 12 559  ? 240.282 201.784 141.059 1.00 174.51 ? 559  GLU O CA 1 
ATOM 5940 C CA . ALA N 12 560  ? 236.813 200.429 140.644 1.00 195.45 ? 560  ALA O CA 1 
ATOM 5941 C CA . HIS N 12 561  ? 237.781 197.430 142.786 1.00 324.95 ? 561  HIS O CA 1 
ATOM 5942 C CA . LYS N 12 562  ? 239.117 199.575 145.654 1.00 200.63 ? 562  LYS O CA 1 
ATOM 5943 C CA . LEU N 12 563  ? 235.982 201.645 145.424 1.00 154.43 ? 563  LEU O CA 1 
ATOM 5944 C CA . LEU N 12 564  ? 233.876 198.445 145.293 1.00 140.60 ? 564  LEU O CA 1 
ATOM 5945 C CA . GLN N 12 565  ? 235.505 197.033 148.415 1.00 183.47 ? 565  GLN O CA 1 
ATOM 5946 C CA . LYS N 12 566  ? 235.075 200.390 150.137 1.00 183.23 ? 566  LYS O CA 1 
ATOM 5947 C CA . LEU N 12 567  ? 231.451 200.116 149.079 1.00 141.16 ? 567  LEU O CA 1 
ATOM 5948 C CA . LEU N 12 568  ? 231.208 196.463 150.101 1.00 129.15 ? 568  LEU O CA 1 
ATOM 5949 C CA . VAL N 12 569  ? 232.425 197.346 153.641 1.00 154.81 ? 569  VAL O CA 1 
ATOM 5950 C CA . HIS N 12 570  ? 229.775 200.082 153.937 1.00 167.15 ? 570  HIS O CA 1 
ATOM 5951 C CA . CYS N 12 571  ? 226.874 198.002 152.668 1.00 135.05 ? 571  CYS O CA 1 
ATOM 5952 C CA . GLN N 12 572  ? 227.706 195.642 155.565 1.00 161.36 ? 572  GLN O CA 1 
ATOM 5953 C CA . LYS N 12 573  ? 227.508 198.645 157.885 1.00 150.26 ? 573  LYS O CA 1 
ATOM 5954 C CA . LEU N 12 574  ? 223.954 199.345 156.538 1.00 157.34 ? 574  LEU O CA 1 
ATOM 5955 C CA . LYS N 12 575  ? 223.344 195.517 156.447 1.00 191.41 ? 575  LYS O CA 1 
ATOM 5956 C CA . ASN N 12 576  ? 221.178 195.980 153.310 1.00 166.02 ? 576  ASN O CA 1 
ATOM 5957 C CA . THR N 12 577  ? 221.658 192.607 151.653 1.00 176.66 ? 577  THR O CA 1 
ATOM 5958 C CA . GLU N 12 578  ? 220.303 193.622 148.175 1.00 169.37 ? 578  GLU O CA 1 
ATOM 5959 C CA . MET N 12 579  ? 223.409 195.701 147.800 1.00 141.47 ? 579  MET O CA 1 
ATOM 5960 C CA . VAL N 12 580  ? 225.920 193.222 149.316 1.00 134.85 ? 580  VAL O CA 1 
ATOM 5961 C CA . ILE N 12 581  ? 224.972 190.409 146.960 1.00 132.55 ? 581  ILE O CA 1 
ATOM 5962 C CA . SER N 12 582  ? 224.746 192.883 144.068 1.00 136.35 ? 582  SER O CA 1 
ATOM 5963 C CA . VAL N 12 583  ? 228.147 194.309 145.023 1.00 127.64 ? 583  VAL O CA 1 
ATOM 5964 C CA . LEU N 12 584  ? 229.796 190.940 145.368 1.00 136.44 ? 584  LEU O CA 1 
ATOM 5965 C CA . LEU N 12 585  ? 228.472 190.476 141.845 1.00 149.00 ? 585  LEU O CA 1 
ATOM 5966 C CA . SER N 12 586  ? 230.153 193.633 140.582 1.00 299.77 ? 586  SER O CA 1 
ATOM 5967 C CA . VAL N 12 587  ? 233.388 192.340 142.260 1.00 313.77 ? 587  VAL O CA 1 
ATOM 5968 C CA . ALA N 12 588  ? 232.849 188.849 140.674 1.00 355.24 ? 588  ALA O CA 1 
ATOM 5969 C CA . GLU N 12 589  ? 232.365 190.487 137.239 1.00 340.28 ? 589  GLU O CA 1 
ATOM 5970 C CA . LEU N 12 590  ? 235.738 192.204 137.873 1.00 396.89 ? 590  LEU O CA 1 
ATOM 5971 C CA . TYR N 12 591  ? 237.395 188.839 138.568 1.00 432.54 ? 591  TYR O CA 1 
ATOM 5972 C CA . TRP N 12 592  ? 236.406 187.645 135.076 1.00 281.65 ? 592  TRP O CA 1 
ATOM 5973 C CA . ARG N 12 593  ? 238.771 190.297 133.818 1.00 180.26 ? 593  ARG O CA 1 
ATOM 5974 C CA . SER N 12 594  ? 241.448 188.957 136.241 1.00 185.54 ? 594  SER O CA 1 
ATOM 5975 C CA . SER N 12 595  ? 242.968 186.149 134.059 1.00 255.06 ? 595  SER O CA 1 
ATOM 5976 C CA . SER N 12 596  ? 243.019 183.991 137.221 1.00 221.37 ? 596  SER O CA 1 
ATOM 5977 C CA . PRO N 12 597  ? 239.365 182.872 136.792 1.00 238.28 ? 597  PRO O CA 1 
ATOM 5978 C CA . THR N 12 598  ? 239.561 180.827 139.983 1.00 186.38 ? 598  THR O CA 1 
ATOM 5979 C CA . ILE N 12 599  ? 239.890 184.019 142.069 1.00 224.43 ? 599  ILE O CA 1 
ATOM 5980 C CA . ALA N 12 600  ? 236.153 184.642 141.303 1.00 372.45 ? 600  ALA O CA 1 
ATOM 5981 C CA . LEU N 12 601  ? 234.718 181.500 142.951 1.00 333.51 ? 601  LEU O CA 1 
ATOM 5982 C CA . PRO N 12 602  ? 234.907 182.210 146.743 1.00 175.64 ? 602  PRO O CA 1 
ATOM 5983 C CA . MET N 12 603  ? 233.054 185.492 146.345 1.00 222.42 ? 603  MET O CA 1 
ATOM 5984 C CA . LEU N 12 604  ? 230.579 184.155 143.770 1.00 159.15 ? 604  LEU O CA 1 
ATOM 5985 C CA . LEU N 12 605  ? 229.565 181.294 145.994 1.00 163.95 ? 605  LEU O CA 1 
ATOM 5986 C CA . GLN N 12 606  ? 229.355 183.457 149.159 1.00 162.67 ? 606  GLN O CA 1 
ATOM 5987 C CA . ALA N 12 607  ? 226.783 185.448 147.188 1.00 146.22 ? 607  ALA O CA 1 
ATOM 5988 C CA . LEU N 12 608  ? 224.948 182.662 145.295 1.00 115.21 ? 608  LEU O CA 1 
ATOM 5989 C CA . ALA N 12 609  ? 224.138 180.823 148.524 1.00 161.61 ? 609  ALA O CA 1 
ATOM 5990 C CA . LEU N 12 610  ? 223.421 184.168 150.176 1.00 181.48 ? 610  LEU O CA 1 
ATOM 5991 C CA . SER N 12 611  ? 220.767 185.187 147.511 1.00 166.06 ? 611  SER O CA 1 
ATOM 5992 C CA . LYS N 12 612  ? 219.218 181.809 148.307 1.00 148.79 ? 612  LYS O CA 1 
ATOM 5993 C CA . GLU N 12 613  ? 219.296 182.791 152.005 1.00 210.90 ? 613  GLU O CA 1 
ATOM 5994 C CA . TYR N 12 614  ? 217.118 185.825 151.293 1.00 146.97 ? 614  TYR O CA 1 
ATOM 5995 C CA . ARG N 12 615  ? 215.459 184.781 148.004 1.00 152.71 ? 615  ARG O CA 1 
ATOM 5996 C CA . LEU N 12 616  ? 216.690 187.936 146.217 1.00 135.50 ? 616  LEU O CA 1 
ATOM 5997 C CA . GLN N 12 617  ? 215.881 186.141 143.018 1.00 167.06 ? 617  GLN O CA 1 
ATOM 5998 C CA . TYR N 12 618  ? 216.539 188.961 140.543 1.00 144.00 ? 618  TYR O CA 1 
ATOM 5999 C CA . LEU N 12 619  ? 220.088 188.831 141.883 1.00 174.42 ? 619  LEU O CA 1 
ATOM 6000 C CA . ALA N 12 620  ? 220.009 184.998 142.210 1.00 159.77 ? 620  ALA O CA 1 
ATOM 6001 C CA . SER N 12 621  ? 219.257 184.583 138.509 1.00 233.88 ? 621  SER O CA 1 
ATOM 6002 C CA . GLU N 12 622  ? 222.204 186.689 137.334 1.00 201.25 ? 622  GLU O CA 1 
ATOM 6003 C CA . THR N 12 623  ? 224.769 185.253 139.865 1.00 169.25 ? 623  THR O CA 1 
ATOM 6004 C CA . VAL N 12 624  ? 223.867 181.676 139.243 1.00 141.63 ? 624  VAL O CA 1 
ATOM 6005 C CA . LEU N 12 625  ? 223.967 181.897 135.453 1.00 154.62 ? 625  LEU O CA 1 
ATOM 6006 C CA . ASN N 12 626  ? 227.385 183.478 136.107 1.00 141.20 ? 626  ASN O CA 1 
ATOM 6007 C CA . LEU N 12 627  ? 228.465 180.359 138.085 1.00 140.02 ? 627  LEU O CA 1 
ATOM 6008 C CA . ALA N 12 628  ? 227.522 178.272 135.063 1.00 165.01 ? 628  ALA O CA 1 
ATOM 6009 C CA . PHE N 12 629  ? 229.862 180.415 133.020 1.00 129.18 ? 629  PHE O CA 1 
ATOM 6010 C CA . ALA N 12 630  ? 232.528 179.634 135.642 1.00 177.77 ? 630  ALA O CA 1 
ATOM 6011 C CA . GLN N 12 631  ? 231.826 175.946 135.333 1.00 167.73 ? 631  GLN O CA 1 
ATOM 6012 C CA . LEU N 12 632  ? 231.978 176.060 131.530 1.00 152.99 ? 632  LEU O CA 1 
ATOM 6013 C CA . ILE N 12 633  ? 235.377 177.691 131.762 1.00 171.26 ? 633  ILE O CA 1 
ATOM 6014 C CA . LEU N 12 634  ? 236.683 175.226 134.367 1.00 166.96 ? 634  LEU O CA 1 
ATOM 6015 C CA . GLY N 12 635  ? 236.024 172.744 131.575 1.00 200.35 ? 635  GLY O CA 1 
ATOM 6016 C CA . ILE N 12 636  ? 232.907 170.916 132.684 1.00 177.51 ? 636  ILE O CA 1 
ATOM 6017 C CA . PRO N 12 637  ? 230.325 172.446 130.343 1.00 207.33 ? 637  PRO O CA 1 
ATOM 6018 C CA . GLU N 12 638  ? 228.019 169.377 130.445 1.00 226.65 ? 638  GLU O CA 1 
ATOM 6019 C CA . GLN N 12 639  ? 227.783 169.700 134.257 1.00 200.97 ? 639  GLN O CA 1 
ATOM 6020 C CA . ALA N 12 640  ? 227.298 173.482 133.925 1.00 197.18 ? 640  ALA O CA 1 
ATOM 6021 C CA . LEU N 12 641  ? 224.615 173.062 131.253 1.00 180.51 ? 641  LEU O CA 1 
ATOM 6022 C CA . SER N 12 642  ? 222.787 170.638 133.539 1.00 245.17 ? 642  SER O CA 1 
ATOM 6023 C CA . LEU N 12 643  ? 223.092 173.266 136.305 1.00 187.81 ? 643  LEU O CA 1 
ATOM 6024 C CA . LEU N 12 644  ? 221.818 175.919 133.910 1.00 162.87 ? 644  LEU O CA 1 
ATOM 6025 C CA . HIS N 12 645  ? 218.644 173.972 132.929 1.00 238.07 ? 645  HIS O CA 1 
ATOM 6026 C CA . MET N 12 646  ? 217.193 174.570 136.386 1.00 256.32 ? 646  MET O CA 1 
ATOM 6027 C CA . ALA N 12 647  ? 218.183 178.224 136.932 1.00 195.57 ? 647  ALA O CA 1 
ATOM 6028 C CA . ILE N 12 648  ? 217.423 179.397 133.362 1.00 162.87 ? 648  ILE O CA 1 
ATOM 6029 C CA . GLU N 12 649  ? 213.671 178.903 133.495 1.00 193.33 ? 649  GLU O CA 1 
ATOM 6030 C CA . PRO N 12 650  ? 213.033 181.533 136.273 1.00 168.59 ? 650  PRO O CA 1 
ATOM 6031 C CA . ILE N 12 651  ? 215.505 183.931 134.551 1.00 175.64 ? 651  ILE O CA 1 
ATOM 6032 C CA . LEU N 12 652  ? 213.509 183.473 131.377 1.00 155.96 ? 652  LEU O CA 1 
ATOM 6033 C CA . ALA N 12 653  ? 210.276 184.187 133.207 1.00 184.37 ? 653  ALA O CA 1 
ATOM 6034 C CA . ASP N 12 654  ? 210.889 187.751 134.292 1.00 204.02 ? 654  ASP O CA 1 
ATOM 6035 C CA . GLY N 12 655  ? 214.323 189.033 133.363 1.00 219.65 ? 655  GLY O CA 1 
ATOM 6036 C CA . ALA N 12 656  ? 215.872 192.296 132.259 1.00 171.12 ? 656  ALA O CA 1 
ATOM 6037 C CA . ILE N 12 657  ? 215.987 190.698 128.710 1.00 158.56 ? 657  ILE O CA 1 
ATOM 6038 C CA . LEU N 12 658  ? 219.577 191.991 128.536 1.00 172.51 ? 658  LEU O CA 1 
ATOM 6039 C CA . ASP N 12 659  ? 219.605 189.197 131.150 1.00 163.14 ? 659  ASP O CA 1 
ATOM 6040 C CA . LYS N 12 660  ? 217.332 186.935 129.033 1.00 163.12 ? 660  LYS O CA 1 
ATOM 6041 C CA . GLY N 12 661  ? 219.698 187.530 126.122 1.00 145.18 ? 661  GLY O CA 1 
ATOM 6042 C CA . ARG N 12 662  ? 222.935 186.915 128.096 1.00 129.15 ? 662  ARG O CA 1 
ATOM 6043 C CA . ALA N 12 663  ? 221.293 183.764 129.422 1.00 141.52 ? 663  ALA O CA 1 
ATOM 6044 C CA . MET N 12 664  ? 220.162 182.160 126.118 1.00 155.62 ? 664  MET O CA 1 
ATOM 6045 C CA . PHE N 12 665  ? 223.526 183.160 124.613 1.00 170.50 ? 665  PHE O CA 1 
ATOM 6046 C CA . LEU N 12 666  ? 225.286 181.366 127.474 1.00 169.04 ? 666  LEU O CA 1 
ATOM 6047 C CA . VAL N 12 667  ? 223.088 178.281 126.977 1.00 181.81 ? 667  VAL O CA 1 
ATOM 6048 C CA . ALA N 12 668  ? 224.228 178.246 123.346 1.00 173.00 ? 668  ALA O CA 1 
ATOM 6049 C CA . LYS N 12 669  ? 227.827 178.855 124.421 1.00 159.12 ? 669  LYS O CA 1 
ATOM 6050 C CA . CYS N 12 670  ? 227.497 175.854 126.764 1.00 199.60 ? 670  CYS O CA 1 
ATOM 6051 C CA . GLN N 12 671  ? 225.846 173.443 124.326 1.00 200.24 ? 671  GLN O CA 1 
ATOM 6052 C CA . VAL N 12 672  ? 228.549 174.076 121.724 1.00 171.48 ? 672  VAL O CA 1 
ATOM 6053 C CA . ALA N 12 673  ? 231.458 173.862 124.211 1.00 206.58 ? 673  ALA O CA 1 
ATOM 6054 C CA . SER N 12 674  ? 230.132 170.553 125.531 1.00 201.72 ? 674  SER O CA 1 
ATOM 6055 C CA . ALA N 12 675  ? 229.338 169.506 121.915 1.00 251.34 ? 675  ALA O CA 1 
ATOM 6056 C CA . ALA N 12 676  ? 233.125 169.550 121.292 1.00 347.87 ? 676  ALA O CA 1 
ATOM 6057 C CA . SER N 12 677  ? 233.062 166.313 123.339 1.00 287.41 ? 677  SER O CA 1 
ATOM 6058 C CA . TYR N 12 678  ? 230.425 165.062 120.839 1.00 312.28 ? 678  TYR O CA 1 
ATOM 6059 C CA . ASP N 12 679  ? 233.052 164.008 118.243 1.00 367.29 ? 679  ASP O CA 1 
ATOM 6060 C CA . GLN N 12 680  ? 230.335 162.240 116.164 1.00 330.63 ? 680  GLN O CA 1 
ATOM 6061 C CA . PRO N 12 681  ? 228.503 163.504 113.123 1.00 299.49 ? 681  PRO O CA 1 
ATOM 6062 C CA . LYS N 12 682  ? 225.099 164.079 114.783 1.00 306.60 ? 682  LYS O CA 1 
ATOM 6063 C CA . LYS N 12 683  ? 227.066 166.722 116.734 1.00 272.86 ? 683  LYS O CA 1 
ATOM 6064 C CA . ALA N 12 684  ? 225.779 168.955 113.922 1.00 328.51 ? 684  ALA O CA 1 
ATOM 6065 C CA . GLU N 12 685  ? 222.199 167.925 114.813 1.00 312.75 ? 685  GLU O CA 1 
ATOM 6066 C CA . ALA N 12 686  ? 222.841 168.986 118.447 1.00 278.06 ? 686  ALA O CA 1 
ATOM 6067 C CA . LEU N 12 687  ? 224.707 172.082 117.245 1.00 274.78 ? 687  LEU O CA 1 
ATOM 6068 C CA . GLU N 12 688  ? 221.834 173.068 114.937 1.00 408.09 ? 688  GLU O CA 1 
ATOM 6069 C CA . ALA N 12 689  ? 219.604 173.138 118.074 1.00 250.00 ? 689  ALA O CA 1 
ATOM 6070 C CA . ALA N 12 690  ? 222.170 175.395 119.825 1.00 176.66 ? 690  ALA O CA 1 
ATOM 6071 C CA . ILE N 12 691  ? 222.206 177.780 116.836 1.00 176.67 ? 691  ILE O CA 1 
ATOM 6072 C CA . GLU N 12 692  ? 218.452 178.218 117.421 1.00 233.81 ? 692  GLU O CA 1 
ATOM 6073 C CA . ASN N 12 693  ? 219.354 179.155 121.036 1.00 180.17 ? 693  ASN O CA 1 
ATOM 6074 C CA . LEU N 12 694  ? 221.813 181.581 119.566 1.00 183.58 ? 694  LEU O CA 1 
ATOM 6075 C CA . ASN N 12 695  ? 219.045 182.805 117.228 1.00 204.73 ? 695  ASN O CA 1 
ATOM 6076 C CA . GLU N 12 696  ? 216.813 183.538 120.263 1.00 231.64 ? 696  GLU O CA 1 
ATOM 6077 C CA . ALA N 12 697  ? 219.590 185.602 121.888 1.00 205.37 ? 697  ALA O CA 1 
ATOM 6078 C CA . LYS N 12 698  ? 220.083 187.464 118.570 1.00 225.85 ? 698  LYS O CA 1 
ATOM 6079 C CA . ASN N 12 699  ? 216.444 188.600 119.001 1.00 231.58 ? 699  ASN O CA 1 
ATOM 6080 C CA . TYR N 12 700  ? 216.852 189.671 122.625 1.00 211.83 ? 700  TYR O CA 1 
ATOM 6081 C CA . PHE N 12 701  ? 219.831 191.947 121.948 1.00 201.07 ? 701  PHE O CA 1 
ATOM 6082 C CA . ALA N 12 702  ? 217.766 193.444 119.099 1.00 215.62 ? 702  ALA O CA 1 
ATOM 6083 C CA . LYS N 12 703  ? 215.105 194.574 121.636 1.00 218.91 ? 703  LYS O CA 1 
ATOM 6084 C CA . VAL N 12 704  ? 217.640 196.147 124.049 1.00 238.01 ? 704  VAL O CA 1 
ATOM 6085 C CA . ASP N 12 705  ? 219.564 197.493 120.969 1.00 273.46 ? 705  ASP O CA 1 
ATOM 6086 C CA . CYS N 12 706  ? 222.819 196.181 122.477 1.00 222.28 ? 706  CYS O CA 1 
ATOM 6087 C CA . LYS N 12 707  ? 224.619 196.156 119.092 1.00 245.11 ? 707  LYS O CA 1 
ATOM 6088 C CA . GLU N 12 708  ? 228.156 195.756 120.438 1.00 247.57 ? 708  GLU O CA 1 
ATOM 6089 C CA . ARG N 12 709  ? 226.731 192.783 122.309 1.00 202.62 ? 709  ARG O CA 1 
ATOM 6090 C CA . ILE N 12 710  ? 224.935 191.340 119.238 1.00 197.97 ? 710  ILE O CA 1 
ATOM 6091 C CA . ARG N 12 711  ? 228.026 191.602 116.956 1.00 209.49 ? 711  ARG O CA 1 
ATOM 6092 C CA . ASP N 12 712  ? 229.497 189.174 119.450 1.00 223.98 ? 712  ASP O CA 1 
ATOM 6093 C CA . VAL N 12 713  ? 226.534 186.763 119.218 1.00 173.85 ? 713  VAL O CA 1 
ATOM 6094 C CA . VAL N 12 714  ? 227.186 186.820 115.449 1.00 195.83 ? 714  VAL O CA 1 
ATOM 6095 C CA . TYR N 12 715  ? 231.015 186.169 115.714 1.00 189.64 ? 715  TYR O CA 1 
ATOM 6096 C CA . PHE N 12 716  ? 230.136 183.027 117.681 1.00 187.06 ? 716  PHE O CA 1 
ATOM 6097 C CA . GLN N 12 717  ? 227.265 182.114 115.301 1.00 149.36 ? 717  GLN O CA 1 
ATOM 6098 C CA . ALA N 12 718  ? 229.772 182.626 112.487 1.00 173.69 ? 718  ALA O CA 1 
ATOM 6099 C CA . ARG N 12 719  ? 232.502 180.343 113.755 1.00 171.88 ? 719  ARG O CA 1 
ATOM 6100 C CA . LEU N 12 720  ? 229.755 177.722 114.316 1.00 173.25 ? 720  LEU O CA 1 
ATOM 6101 C CA . TYR N 12 721  ? 228.597 177.569 110.674 1.00 199.60 ? 721  TYR O CA 1 
ATOM 6102 C CA . HIS N 12 722  ? 232.262 177.672 109.634 1.00 235.99 ? 722  HIS O CA 1 
ATOM 6103 C CA . THR N 12 723  ? 232.851 174.633 111.929 1.00 257.77 ? 723  THR O CA 1 
ATOM 6104 C CA . LEU N 12 724  ? 229.603 172.992 110.805 1.00 258.17 ? 724  LEU O CA 1 
ATOM 6105 C CA . GLY N 12 725  ? 231.279 173.250 107.363 1.00 266.92 ? 725  GLY O CA 1 
ATOM 6106 C CA . LYS N 12 726  ? 228.976 175.317 105.125 1.00 201.71 ? 726  LYS O CA 1 
ATOM 6107 C CA . THR N 12 727  ? 230.815 178.663 104.753 1.00 304.93 ? 727  THR O CA 1 
ATOM 6108 C CA . GLN N 12 728  ? 227.867 179.574 102.431 1.00 399.46 ? 728  GLN O CA 1 
ATOM 6109 C CA . GLU N 12 729  ? 225.856 180.414 105.598 1.00 371.32 ? 729  GLU O CA 1 
ATOM 6110 C CA . ARG N 12 730  ? 228.913 182.311 107.064 1.00 234.35 ? 730  ARG O CA 1 
ATOM 6111 C CA . ASN N 12 731  ? 228.103 185.111 104.452 1.00 311.74 ? 731  ASN O CA 1 
ATOM 6112 C CA . ARG N 12 732  ? 224.775 186.397 105.846 1.00 230.93 ? 732  ARG O CA 1 
ATOM 6113 C CA . CYS N 12 733  ? 226.309 186.003 109.289 1.00 196.82 ? 733  CYS O CA 1 
ATOM 6114 C CA . ALA N 12 734  ? 229.374 187.831 108.087 1.00 195.60 ? 734  ALA O CA 1 
ATOM 6115 C CA . MET N 12 735  ? 227.185 190.517 106.443 1.00 330.29 ? 735  MET O CA 1 
ATOM 6116 C CA . LEU N 12 736  ? 225.328 191.173 109.724 1.00 204.01 ? 736  LEU O CA 1 
ATOM 6117 C CA . PHE N 12 737  ? 228.660 191.140 111.604 1.00 186.91 ? 737  PHE O CA 1 
ATOM 6118 C CA . ARG N 12 738  ? 230.556 193.592 109.360 1.00 305.28 ? 738  ARG O CA 1 
ATOM 6119 C CA . GLN N 12 739  ? 227.626 196.067 109.332 1.00 377.90 ? 739  GLN O CA 1 
ATOM 6120 C CA . LEU N 12 740  ? 227.585 195.797 113.164 1.00 348.11 ? 740  LEU O CA 1 
ATOM 6121 C CA . HIS N 12 741  ? 231.414 196.352 113.236 1.00 358.67 ? 741  HIS O CA 1 
ATOM 6122 C CA . GLN N 12 742  ? 230.640 200.009 112.497 1.00 356.24 ? 742  GLN O CA 1 
ATOM 6123 C CA . GLU N 12 743  ? 230.181 199.997 116.324 1.00 221.31 ? 743  GLU O CA 1 
ATOM 6124 C CA . LEU N 12 744  ? 233.687 200.385 117.848 1.00 219.31 ? 744  LEU O CA 1 
ATOM 6125 C CA . PRO N 12 745  ? 235.494 197.716 120.016 1.00 276.12 ? 745  PRO O CA 1 
ATOM 6126 C CA . SER N 12 746  ? 237.143 198.382 123.400 1.00 316.85 ? 746  SER O CA 1 
ATOM 6127 C CA . VAL N 12 749  ? 237.152 193.662 123.732 1.00 276.41 ? 749  VAL O CA 1 
ATOM 6128 C CA . PRO N 12 750  ? 236.655 189.829 123.634 1.00 226.87 ? 750  PRO O CA 1 
ATOM 6129 C CA . LEU N 12 751  ? 233.575 187.698 124.336 1.00 217.79 ? 751  LEU O CA 1 
ATOM 6130 C CA . ILE N 12 752  ? 234.954 185.466 127.059 1.00 252.96 ? 752  ILE O CA 1 
ATOM 6131 C CA . ASN N 12 753  ? 236.353 187.974 129.626 1.00 292.89 ? 753  ASN O CA 1 
ATOM 6132 C CA . HIS N 12 754  ? 233.333 190.166 128.818 1.00 293.70 ? 754  HIS O CA 1 
ATOM 6133 C CA . LEU N 12 755  ? 231.167 187.127 129.820 1.00 245.44 ? 755  LEU O CA 1 
ATOM 6134 C CA . PHE O 3  26   ? 170.122 296.065 175.476 1.00 500.00 ? 26   PHE P CA 1 
ATOM 6135 C CA . SER O 3  27   ? 171.108 298.035 172.319 1.00 500.00 ? 27   SER P CA 1 
ATOM 6136 C CA . ASP O 3  28   ? 174.845 297.812 171.364 1.00 500.00 ? 28   ASP P CA 1 
ATOM 6137 C CA . LEU O 3  29   ? 175.564 294.362 169.960 1.00 500.00 ? 29   LEU P CA 1 
ATOM 6138 C CA . ARG O 3  30   ? 179.244 294.937 169.425 1.00 500.00 ? 30   ARG P CA 1 
ATOM 6139 C CA . GLU O 3  31   ? 179.345 295.774 173.121 1.00 500.00 ? 31   GLU P CA 1 
ATOM 6140 C CA . ILE O 3  32   ? 177.370 292.627 173.992 1.00 500.00 ? 32   ILE P CA 1 
ATOM 6141 C CA . LYS O 3  33   ? 179.418 290.376 171.754 1.00 500.00 ? 33   LYS P CA 1 
ATOM 6142 C CA . LYS O 3  34   ? 182.666 291.731 173.256 1.00 500.00 ? 34   LYS P CA 1 
ATOM 6143 C CA . GLN O 3  35   ? 181.388 291.328 176.774 1.00 402.98 ? 35   GLN P CA 1 
ATOM 6144 C CA . LEU O 3  36   ? 180.008 287.809 175.997 1.00 203.42 ? 36   LEU P CA 1 
ATOM 6145 C CA . LEU O 3  37   ? 183.369 286.835 174.499 1.00 212.37 ? 37   LEU P CA 1 
ATOM 6146 C CA . LEU O 3  38   ? 185.203 287.807 177.717 1.00 404.01 ? 38   LEU P CA 1 
ATOM 6147 C CA . ILE O 3  39   ? 182.901 285.541 179.778 1.00 392.63 ? 39   ILE P CA 1 
ATOM 6148 C CA . ALA O 3  40   ? 183.587 282.627 177.367 1.00 181.24 ? 40   ALA P CA 1 
ATOM 6149 C CA . GLY O 3  41   ? 187.367 283.286 177.994 1.00 260.12 ? 41   GLY P CA 1 
ATOM 6150 C CA . LEU O 3  42   ? 186.903 283.506 181.840 1.00 143.06 ? 42   LEU P CA 1 
ATOM 6151 C CA . THR O 3  43   ? 184.886 280.237 182.025 1.00 203.57 ? 43   THR P CA 1 
ATOM 6152 C CA . ARG O 3  44   ? 187.330 278.385 179.721 1.00 204.91 ? 44   ARG P CA 1 
ATOM 6153 C CA . GLU O 3  45   ? 190.160 279.404 182.036 1.00 196.76 ? 45   GLU P CA 1 
ATOM 6154 C CA . ARG O 3  46   ? 188.224 277.920 184.995 1.00 155.67 ? 46   ARG P CA 1 
ATOM 6155 C CA . GLY O 3  47   ? 187.355 274.801 182.912 1.00 163.20 ? 47   GLY P CA 1 
ATOM 6156 C CA . LEU O 3  48   ? 183.598 275.184 182.932 1.00 197.65 ? 48   LEU P CA 1 
ATOM 6157 C CA . LEU O 3  49   ? 183.396 273.824 179.409 1.00 190.06 ? 49   LEU P CA 1 
ATOM 6158 C CA . HIS O 3  50   ? 179.682 273.631 178.869 1.00 179.46 ? 50   HIS P CA 1 
ATOM 6159 C CA . SER O 3  51   ? 179.021 277.183 179.962 1.00 186.19 ? 51   SER P CA 1 
ATOM 6160 C CA . SER O 3  52   ? 181.946 278.302 177.711 1.00 192.31 ? 52   SER P CA 1 
ATOM 6161 C CA . LYS O 3  53   ? 180.458 276.426 174.697 1.00 162.71 ? 53   LYS P CA 1 
ATOM 6162 C CA . TRP O 3  54   ? 177.036 278.061 175.277 1.00 185.44 ? 54   TRP P CA 1 
ATOM 6163 C CA . SER O 3  55   ? 178.492 281.568 175.647 1.00 169.12 ? 55   SER P CA 1 
ATOM 6164 C CA . ALA O 3  56   ? 180.690 281.069 172.526 1.00 218.80 ? 56   ALA P CA 1 
ATOM 6165 C CA . GLU O 3  57   ? 177.640 279.978 170.528 1.00 420.88 ? 57   GLU P CA 1 
ATOM 6166 C CA . LEU O 3  58   ? 175.869 283.252 171.056 1.00 500.00 ? 58   LEU P CA 1 
ATOM 6167 C CA . ALA O 3  59   ? 179.075 285.246 170.351 1.00 481.13 ? 59   ALA P CA 1 
ATOM 6168 C CA . PHE O 3  60   ? 179.377 283.373 166.994 1.00 365.35 ? 60   PHE P CA 1 
ATOM 6169 C CA . SER O 3  61   ? 175.751 284.316 166.199 1.00 500.00 ? 61   SER P CA 1 
ATOM 6170 C CA . LEU O 3  62   ? 176.662 288.023 166.486 1.00 500.00 ? 62   LEU P CA 1 
ATOM 6171 C CA . PRO O 3  63   ? 178.407 289.951 163.654 1.00 500.00 ? 63   PRO P CA 1 
ATOM 6172 C CA . ALA O 3  64   ? 182.205 289.359 163.523 1.00 484.18 ? 64   ALA P CA 1 
ATOM 6173 C CA . LEU O 3  65   ? 184.509 292.045 164.952 1.00 500.00 ? 65   LEU P CA 1 
ATOM 6174 C CA . PRO O 3  66   ? 187.038 293.610 162.495 1.00 500.00 ? 66   PRO P CA 1 
ATOM 6175 C CA . LEU O 3  67   ? 189.873 294.271 165.066 1.00 500.00 ? 67   LEU P CA 1 
ATOM 6176 C CA . ALA O 3  68   ? 188.139 297.537 166.098 1.00 500.00 ? 68   ALA P CA 1 
ATOM 6177 C CA . GLU O 3  69   ? 186.364 297.121 169.482 1.00 500.00 ? 69   GLU P CA 1 
ATOM 6178 C CA . LEU O 3  70   ? 188.649 294.149 170.299 1.00 500.00 ? 70   LEU P CA 1 
ATOM 6179 C CA . GLN O 3  71   ? 190.208 294.381 173.773 1.00 500.00 ? 71   GLN P CA 1 
ATOM 6180 C CA . PRO O 3  72   ? 193.615 293.138 174.986 1.00 500.00 ? 72   PRO P CA 1 
ATOM 6181 C CA . PRO O 3  73   ? 193.396 290.572 177.873 1.00 500.00 ? 73   PRO P CA 1 
ATOM 6182 C CA . PRO O 3  74   ? 193.426 292.157 181.414 1.00 500.00 ? 74   PRO P CA 1 
ATOM 6183 C CA . PRO O 3  75   ? 196.883 293.117 182.727 1.00 500.00 ? 75   PRO P CA 1 
ATOM 6184 C CA . ILE O 3  76   ? 198.321 290.344 184.917 1.00 500.00 ? 76   ILE P CA 1 
ATOM 6185 C CA . THR O 3  77   ? 197.543 290.865 188.647 1.00 500.00 ? 77   THR P CA 1 
ATOM 6186 C CA . GLU O 3  78   ? 200.024 290.424 191.536 1.00 500.00 ? 78   GLU P CA 1 
ATOM 6187 C CA . GLU O 3  79   ? 198.390 287.263 192.877 1.00 500.00 ? 79   GLU P CA 1 
ATOM 6188 C CA . ASP O 3  80   ? 198.262 285.719 189.335 1.00 500.00 ? 80   ASP P CA 1 
ATOM 6189 C CA . ALA O 3  81   ? 202.051 285.997 189.055 1.00 500.00 ? 81   ALA P CA 1 
ATOM 6190 C CA . GLN O 3  82   ? 202.453 284.176 192.396 1.00 472.83 ? 82   GLN P CA 1 
ATOM 6191 C CA . ASP O 3  83   ? 200.167 281.304 191.301 1.00 434.21 ? 83   ASP P CA 1 
ATOM 6192 C CA . MET O 3  84   ? 201.072 281.286 187.571 1.00 463.38 ? 84   MET P CA 1 
ATOM 6193 C CA . ASP O 3  85   ? 203.323 278.233 187.803 1.00 248.61 ? 85   ASP P CA 1 
ATOM 6194 C CA . ALA O 3  86   ? 200.951 276.211 189.897 1.00 219.58 ? 86   ALA P CA 1 
ATOM 6195 C CA . TYR O 3  87   ? 197.881 277.214 187.917 1.00 184.82 ? 87   TYR P CA 1 
ATOM 6196 C CA . THR O 3  88   ? 199.178 276.493 184.466 1.00 201.09 ? 88   THR P CA 1 
ATOM 6197 C CA . LEU O 3  89   ? 200.523 273.114 185.569 1.00 195.60 ? 89   LEU P CA 1 
ATOM 6198 C CA . ALA O 3  90   ? 197.325 272.303 187.473 1.00 183.59 ? 90   ALA P CA 1 
ATOM 6199 C CA . LYS O 3  91   ? 195.132 273.335 184.536 1.00 170.47 ? 91   LYS P CA 1 
ATOM 6200 C CA . ALA O 3  92   ? 196.975 271.084 182.193 1.00 194.18 ? 92   ALA P CA 1 
ATOM 6201 C CA . TYR O 3  93   ? 196.505 268.121 184.473 1.00 175.83 ? 93   TYR P CA 1 
ATOM 6202 C CA . PHE O 3  94   ? 192.914 269.133 184.854 1.00 161.09 ? 94   PHE P CA 1 
ATOM 6203 C CA . ASP O 3  95   ? 192.518 268.893 181.069 1.00 171.43 ? 95   ASP P CA 1 
ATOM 6204 C CA . VAL O 3  96   ? 194.116 265.443 180.784 1.00 164.59 ? 96   VAL P CA 1 
ATOM 6205 C CA . LYS O 3  97   ? 191.980 264.921 182.959 1.00 151.08 ? 97   LYS P CA 1 
ATOM 6206 C CA . GLU O 3  98   ? 193.303 263.670 186.309 1.00 189.29 ? 98   GLU P CA 1 
ATOM 6207 C CA . TYR O 3  99   ? 191.376 265.813 188.690 1.00 155.73 ? 99   TYR P CA 1 
ATOM 6208 C CA . ASP O 3  100  ? 192.863 264.523 191.934 1.00 158.18 ? 100  ASP P CA 1 
ATOM 6209 C CA . ARG O 3  101  ? 196.345 265.368 190.742 1.00 147.06 ? 101  ARG P CA 1 
ATOM 6210 C CA . ALA O 3  102  ? 195.311 268.861 189.653 1.00 156.79 ? 102  ALA P CA 1 
ATOM 6211 C CA . ALA O 3  103  ? 193.757 269.450 193.077 1.00 131.86 ? 103  ALA P CA 1 
ATOM 6212 C CA . HIS O 3  104  ? 196.973 268.521 194.816 1.00 184.86 ? 104  HIS P CA 1 
ATOM 6213 C CA . PHE O 3  105  ? 198.992 271.201 193.024 1.00 147.78 ? 105  PHE P CA 1 
ATOM 6214 C CA . LEU O 3  106  ? 196.637 274.041 193.729 1.00 209.07 ? 106  LEU P CA 1 
ATOM 6215 C CA . HIS O 3  107  ? 196.275 273.099 197.431 1.00 180.84 ? 107  HIS P CA 1 
ATOM 6216 C CA . GLY O 3  108  ? 198.503 275.954 198.576 1.00 294.21 ? 108  GLY P CA 1 
ATOM 6217 C CA . CYS O 3  109  ? 197.350 278.690 196.210 1.00 359.61 ? 109  CYS P CA 1 
ATOM 6218 C CA . ASN O 3  110  ? 195.347 281.700 197.414 1.00 424.72 ? 110  ASN P CA 1 
ATOM 6219 C CA . SER O 3  111  ? 194.319 283.395 194.094 1.00 315.74 ? 111  SER P CA 1 
ATOM 6220 C CA . LYS O 3  112  ? 190.576 283.487 193.487 1.00 423.95 ? 112  LYS P CA 1 
ATOM 6221 C CA . LYS O 3  113  ? 191.071 281.812 190.113 1.00 380.86 ? 113  LYS P CA 1 
ATOM 6222 C CA . ALA O 3  114  ? 193.275 279.145 191.628 1.00 173.63 ? 114  ALA P CA 1 
ATOM 6223 C CA . TYR O 3  115  ? 190.990 278.446 194.510 1.00 257.08 ? 115  TYR P CA 1 
ATOM 6224 C CA . PHE O 3  116  ? 188.019 277.959 192.193 1.00 358.88 ? 116  PHE P CA 1 
ATOM 6225 C CA . LEU O 3  117  ? 189.814 275.475 189.961 1.00 179.04 ? 117  LEU P CA 1 
ATOM 6226 C CA . TYR O 3  118  ? 191.118 273.618 193.040 1.00 166.07 ? 118  TYR P CA 1 
ATOM 6227 C CA . MET O 3  119  ? 187.654 273.237 194.503 1.00 279.76 ? 119  MET P CA 1 
ATOM 6228 C CA . TYR O 3  120  ? 186.005 272.483 191.178 1.00 293.19 ? 120  TYR P CA 1 
ATOM 6229 C CA . SER O 3  121  ? 188.677 269.831 190.576 1.00 151.21 ? 121  SER P CA 1 
ATOM 6230 C CA . ARG O 3  122  ? 188.013 268.307 193.996 1.00 198.90 ? 122  ARG P CA 1 
ATOM 6231 C CA . TYR O 3  123  ? 184.279 268.360 193.218 1.00 123.84 ? 123  TYR P CA 1 
ATOM 6232 C CA . LEU O 3  124  ? 184.710 266.553 189.888 1.00 167.89 ? 124  LEU P CA 1 
ATOM 6233 C CA . SER O 3  125  ? 187.153 264.063 191.430 1.00 153.73 ? 125  SER P CA 1 
ATOM 6234 C CA . GLY O 3  126  ? 184.265 263.218 193.822 1.00 153.90 ? 126  GLY P CA 1 
ATOM 6235 C CA . GLU O 3  127  ? 181.971 262.622 190.827 1.00 187.46 ? 127  GLU P CA 1 
ATOM 6236 C CA . LYS O 3  128  ? 184.414 260.297 189.028 1.00 159.86 ? 128  LYS P CA 1 
ATOM 6237 C CA . LYS O 3  129  ? 184.578 258.225 192.152 1.00 149.64 ? 129  LYS P CA 1 
ATOM 6238 C CA . LYS O 3  130  ? 180.759 258.287 192.569 1.00 202.23 ? 130  LYS P CA 1 
ATOM 6239 C CA . ASP O 3  131  ? 180.511 256.867 189.067 1.00 200.36 ? 131  ASP P CA 1 
ATOM 6240 C CA . ASP O 3  132  ? 183.325 254.354 189.647 1.00 276.67 ? 132  ASP P CA 1 
ATOM 6241 C CA . GLU O 3  133  ? 182.007 253.027 192.976 1.00 282.98 ? 133  GLU P CA 1 
ATOM 6242 C CA . THR O 3  134  ? 178.532 252.770 191.321 1.00 236.24 ? 134  THR P CA 1 
ATOM 6243 C CA . LYS O 3  147  ? 176.523 257.253 200.477 1.00 255.06 ? 147  LYS P CA 1 
ATOM 6244 C CA . ASN O 3  148  ? 177.462 260.880 200.415 1.00 194.80 ? 148  ASN P CA 1 
ATOM 6245 C CA . GLU O 3  149  ? 180.568 261.755 202.444 1.00 207.33 ? 149  GLU P CA 1 
ATOM 6246 C CA . ALA O 3  150  ? 182.704 263.184 199.632 1.00 262.26 ? 150  ALA P CA 1 
ATOM 6247 C CA . LEU O 3  151  ? 180.277 265.986 198.732 1.00 245.67 ? 151  LEU P CA 1 
ATOM 6248 C CA . ARG O 3  152  ? 179.595 266.893 202.357 1.00 136.05 ? 152  ARG P CA 1 
ATOM 6249 C CA . GLU O 3  153  ? 183.263 267.811 202.933 1.00 278.42 ? 153  GLU P CA 1 
ATOM 6250 C CA . LEU O 3  154  ? 183.076 270.363 200.111 1.00 410.26 ? 154  LEU P CA 1 
ATOM 6251 C CA . ARG O 3  155  ? 179.768 271.773 201.485 1.00 500.00 ? 155  ARG P CA 1 
ATOM 6252 C CA . VAL O 3  156  ? 181.347 272.340 204.920 1.00 500.00 ? 156  VAL P CA 1 
ATOM 6253 C CA . GLU O 3  157  ? 184.446 274.064 203.556 1.00 500.00 ? 157  GLU P CA 1 
ATOM 6254 C CA . LEU O 3  158  ? 182.482 276.162 201.042 1.00 500.00 ? 158  LEU P CA 1 
ATOM 6255 C CA . SER O 3  159  ? 179.896 277.214 203.626 1.00 500.00 ? 159  SER P CA 1 
ATOM 6256 C CA . LYS O 3  160  ? 182.595 278.550 205.898 1.00 500.00 ? 160  LYS P CA 1 
ATOM 6257 C CA . LYS O 3  161  ? 184.030 280.643 203.095 1.00 500.00 ? 161  LYS P CA 1 
ATOM 6258 C CA . HIS O 3  162  ? 180.582 281.822 201.943 1.00 500.00 ? 162  HIS P CA 1 
ATOM 6259 C CA . GLN O 3  163  ? 179.689 283.042 205.446 1.00 500.00 ? 163  GLN P CA 1 
ATOM 6260 C CA . ALA O 3  164  ? 182.961 284.865 205.597 1.00 500.00 ? 164  ALA P CA 1 
ATOM 6261 C CA . ARG O 3  165  ? 182.157 286.300 202.137 1.00 500.00 ? 165  ARG P CA 1 
ATOM 6262 C CA . GLU O 3  166  ? 185.624 285.502 200.807 1.00 500.00 ? 166  GLU P CA 1 
ATOM 6263 C CA . LEU O 3  167  ? 184.093 283.301 198.097 1.00 500.00 ? 167  LEU P CA 1 
ATOM 6264 C CA . ASP O 3  168  ? 183.115 285.255 194.981 1.00 500.00 ? 168  ASP P CA 1 
ATOM 6265 C CA . GLY O 3  169  ? 181.647 284.905 191.478 1.00 500.00 ? 169  GLY P CA 1 
ATOM 6266 C CA . PHE O 3  170  ? 181.987 281.359 190.261 1.00 500.00 ? 170  PHE P CA 1 
ATOM 6267 C CA . GLY O 3  171  ? 182.866 279.964 193.672 1.00 500.00 ? 171  GLY P CA 1 
ATOM 6268 C CA . LEU O 3  172  ? 179.285 280.804 194.665 1.00 500.00 ? 172  LEU P CA 1 
ATOM 6269 C CA . TYR O 3  173  ? 178.212 278.803 191.574 1.00 500.00 ? 173  TYR P CA 1 
ATOM 6270 C CA . LEU O 3  174  ? 180.348 275.865 192.656 1.00 500.00 ? 174  LEU P CA 1 
ATOM 6271 C CA . TYR O 3  175  ? 178.768 276.029 196.140 1.00 500.00 ? 175  TYR P CA 1 
ATOM 6272 C CA . GLY O 3  176  ? 175.374 276.132 194.532 1.00 500.00 ? 176  GLY P CA 1 
ATOM 6273 C CA . VAL O 3  177  ? 176.135 273.005 192.465 1.00 500.00 ? 177  VAL P CA 1 
ATOM 6274 C CA . VAL O 3  178  ? 177.232 271.122 195.604 1.00 500.00 ? 178  VAL P CA 1 
ATOM 6275 C CA . LEU O 3  179  ? 174.112 271.983 197.631 1.00 500.00 ? 179  LEU P CA 1 
ATOM 6276 C CA . ARG O 3  180  ? 171.899 271.105 194.630 1.00 500.00 ? 180  ARG P CA 1 
ATOM 6277 C CA . LYS O 3  181  ? 173.574 267.690 194.505 1.00 389.21 ? 181  LYS P CA 1 
ATOM 6278 C CA . LEU O 3  182  ? 172.810 267.254 198.220 1.00 473.98 ? 182  LEU P CA 1 
ATOM 6279 C CA . ASP O 3  183  ? 169.136 268.089 197.344 1.00 500.00 ? 183  ASP P CA 1 
ATOM 6280 C CA . LEU O 3  184  ? 169.215 271.220 199.412 1.00 500.00 ? 184  LEU P CA 1 
ATOM 6281 C CA . VAL O 3  185  ? 167.040 272.944 196.829 1.00 500.00 ? 185  VAL P CA 1 
ATOM 6282 C CA . LYS O 3  186  ? 165.617 275.694 198.955 1.00 500.00 ? 186  LYS P CA 1 
ATOM 6283 C CA . GLU O 3  187  ? 169.064 276.717 200.077 1.00 500.00 ? 187  GLU P CA 1 
ATOM 6284 C CA . ALA O 3  188  ? 170.551 276.325 196.566 1.00 500.00 ? 188  ALA P CA 1 
ATOM 6285 C CA . ILE O 3  189  ? 168.148 278.775 194.991 1.00 500.00 ? 189  ILE P CA 1 
ATOM 6286 C CA . ASP O 3  190  ? 169.208 281.393 197.559 1.00 500.00 ? 190  ASP P CA 1 
ATOM 6287 C CA . VAL O 3  191  ? 172.874 280.824 196.693 1.00 500.00 ? 191  VAL P CA 1 
ATOM 6288 C CA . PHE O 3  192  ? 172.344 280.747 192.932 1.00 500.00 ? 192  PHE P CA 1 
ATOM 6289 C CA . VAL O 3  193  ? 170.301 283.930 193.032 1.00 500.00 ? 193  VAL P CA 1 
ATOM 6290 C CA . GLU O 3  194  ? 173.208 285.563 194.908 1.00 500.00 ? 194  GLU P CA 1 
ATOM 6291 C CA . ALA O 3  195  ? 175.728 284.133 192.293 1.00 500.00 ? 195  ALA P CA 1 
ATOM 6292 C CA . THR O 3  196  ? 173.950 285.749 189.385 1.00 500.00 ? 196  THR P CA 1 
ATOM 6293 C CA . HIS O 3  197  ? 173.575 289.031 191.277 1.00 500.00 ? 197  HIS P CA 1 
ATOM 6294 C CA . VAL O 3  198  ? 177.366 289.064 191.952 1.00 500.00 ? 198  VAL P CA 1 
ATOM 6295 C CA . LEU O 3  199  ? 178.490 287.798 188.533 1.00 500.00 ? 199  LEU P CA 1 
ATOM 6296 C CA . PRO O 3  200  ? 176.208 287.731 185.501 1.00 500.00 ? 200  PRO P CA 1 
ATOM 6297 C CA . LEU O 3  201  ? 176.881 286.401 181.966 1.00 456.35 ? 201  LEU P CA 1 
ATOM 6298 C CA . HIS O 3  202  ? 177.915 282.947 183.243 1.00 270.50 ? 202  HIS P CA 1 
ATOM 6299 C CA . TRP O 3  203  ? 175.231 280.743 181.813 1.00 286.30 ? 203  TRP P CA 1 
ATOM 6300 C CA . GLY O 3  204  ? 175.893 277.790 184.045 1.00 235.32 ? 204  GLY P CA 1 
ATOM 6301 C CA . ALA O 3  205  ? 174.711 279.725 187.172 1.00 368.87 ? 205  ALA P CA 1 
ATOM 6302 C CA . TRP O 3  206  ? 171.520 280.829 185.481 1.00 398.70 ? 206  TRP P CA 1 
ATOM 6303 C CA . LEU O 3  207  ? 170.952 277.411 184.025 1.00 221.61 ? 207  LEU P CA 1 
ATOM 6304 C CA . GLU O 3  208  ? 171.162 275.589 187.407 1.00 232.70 ? 208  GLU P CA 1 
ATOM 6305 C CA . LEU O 3  209  ? 168.411 278.004 188.488 1.00 312.70 ? 209  LEU P CA 1 
ATOM 6306 C CA . CYS O 3  210  ? 166.208 276.752 185.606 1.00 339.53 ? 210  CYS P CA 1 
ATOM 6307 C CA . ASN O 3  211  ? 166.310 273.167 186.988 1.00 248.67 ? 211  ASN P CA 1 
ATOM 6308 C CA . LEU O 3  212  ? 165.487 274.248 190.567 1.00 471.49 ? 212  LEU P CA 1 
ATOM 6309 C CA . ILE O 3  213  ? 162.470 276.578 190.007 1.00 500.00 ? 213  ILE P CA 1 
ATOM 6310 C CA . THR O 3  214  ? 159.281 274.547 189.968 1.00 500.00 ? 214  THR P CA 1 
ATOM 6311 C CA . ASP O 3  215  ? 156.594 277.318 189.580 1.00 500.00 ? 215  ASP P CA 1 
ATOM 6312 C CA . LYS O 3  216  ? 156.116 280.823 188.025 1.00 500.00 ? 216  LYS P CA 1 
ATOM 6313 C CA . GLU O 3  217  ? 155.171 282.132 191.514 1.00 500.00 ? 217  GLU P CA 1 
ATOM 6314 C CA . MET O 3  218  ? 158.587 281.039 192.904 1.00 500.00 ? 218  MET P CA 1 
ATOM 6315 C CA . LEU O 3  219  ? 160.179 282.990 190.024 1.00 500.00 ? 219  LEU P CA 1 
ATOM 6316 C CA . LYS O 3  220  ? 158.205 286.193 190.803 1.00 500.00 ? 220  LYS P CA 1 
ATOM 6317 C CA . PHE O 3  221  ? 159.326 285.939 194.474 1.00 500.00 ? 221  PHE P CA 1 
ATOM 6318 C CA . LEU O 3  222  ? 163.078 286.075 193.627 1.00 500.00 ? 222  LEU P CA 1 
ATOM 6319 C CA . SER O 3  223  ? 164.986 289.198 192.607 1.00 500.00 ? 223  SER P CA 1 
ATOM 6320 C CA . LEU O 3  224  ? 167.555 288.984 189.768 1.00 500.00 ? 224  LEU P CA 1 
ATOM 6321 C CA . PRO O 3  225  ? 170.078 291.410 188.116 1.00 500.00 ? 225  PRO P CA 1 
ATOM 6322 C CA . ASP O 3  226  ? 169.050 293.838 185.324 1.00 500.00 ? 226  ASP P CA 1 
ATOM 6323 C CA . THR O 3  227  ? 171.740 292.520 182.912 1.00 500.00 ? 227  THR P CA 1 
ATOM 6324 C CA . TRP O 3  228  ? 170.352 291.263 179.585 1.00 500.00 ? 228  TRP P CA 1 
ATOM 6325 C CA . MET O 3  229  ? 170.978 287.601 180.485 1.00 500.00 ? 229  MET P CA 1 
ATOM 6326 C CA . LYS O 3  230  ? 167.795 287.783 182.613 1.00 500.00 ? 230  LYS P CA 1 
ATOM 6327 C CA . GLU O 3  231  ? 165.902 287.900 179.290 1.00 500.00 ? 231  GLU P CA 1 
ATOM 6328 C CA . PHE O 3  232  ? 167.436 284.639 177.970 1.00 500.00 ? 232  PHE P CA 1 
ATOM 6329 C CA . PHE O 3  233  ? 166.741 283.125 181.416 1.00 500.00 ? 233  PHE P CA 1 
ATOM 6330 C CA . LEU O 3  234  ? 163.079 284.059 181.910 1.00 500.00 ? 234  LEU P CA 1 
ATOM 6331 C CA . ALA O 3  235  ? 162.459 282.847 178.351 1.00 500.00 ? 235  ALA P CA 1 
ATOM 6332 C CA . HIS O 3  236  ? 164.215 279.491 179.025 1.00 493.05 ? 236  HIS P CA 1 
ATOM 6333 C CA . ILE O 3  237  ? 162.248 279.095 182.286 1.00 500.00 ? 237  ILE P CA 1 
ATOM 6334 C CA . TYR O 3  238  ? 159.013 279.625 180.349 1.00 500.00 ? 238  TYR P CA 1 
ATOM 6335 C CA . THR O 3  239  ? 160.025 276.663 178.109 1.00 500.00 ? 239  THR P CA 1 
ATOM 6336 C CA . GLU O 3  240  ? 160.727 274.509 181.222 1.00 500.00 ? 240  GLU P CA 1 
ATOM 6337 C CA . LEU O 3  241  ? 157.358 275.611 182.641 1.00 500.00 ? 241  LEU P CA 1 
ATOM 6338 C CA . GLN O 3  242  ? 154.067 276.479 180.861 1.00 500.00 ? 242  GLN P CA 1 
ATOM 6339 C CA . LEU O 3  243  ? 153.495 279.984 179.326 1.00 500.00 ? 243  LEU P CA 1 
ATOM 6340 C CA . ILE O 3  244  ? 155.173 279.045 176.022 1.00 500.00 ? 244  ILE P CA 1 
ATOM 6341 C CA . GLU O 3  245  ? 153.133 281.656 174.109 1.00 500.00 ? 245  GLU P CA 1 
ATOM 6342 C CA . GLU O 3  246  ? 154.949 284.330 176.147 1.00 500.00 ? 246  GLU P CA 1 
ATOM 6343 C CA . ALA O 3  247  ? 158.271 282.435 175.816 1.00 500.00 ? 247  ALA P CA 1 
ATOM 6344 C CA . LEU O 3  248  ? 157.800 282.344 171.996 1.00 500.00 ? 248  LEU P CA 1 
ATOM 6345 C CA . GLN O 3  249  ? 157.304 286.156 172.006 1.00 500.00 ? 249  GLN P CA 1 
ATOM 6346 C CA . LYS O 3  250  ? 160.338 286.582 174.276 1.00 500.00 ? 250  LYS P CA 1 
ATOM 6347 C CA . TYR O 3  251  ? 162.413 284.512 171.879 1.00 500.00 ? 251  TYR P CA 1 
ATOM 6348 C CA . GLN O 3  252  ? 160.947 286.446 168.939 1.00 500.00 ? 252  GLN P CA 1 
ATOM 6349 C CA . ASN O 3  253  ? 162.588 289.599 170.352 1.00 500.00 ? 253  ASN P CA 1 
ATOM 6350 C CA . LEU O 3  254  ? 166.036 287.842 170.360 1.00 500.00 ? 254  LEU P CA 1 
ATOM 6351 C CA . ILE O 3  255  ? 165.730 286.671 166.712 1.00 500.00 ? 255  ILE P CA 1 
ATOM 6352 C CA . ASP O 3  256  ? 164.898 290.324 165.843 1.00 500.00 ? 256  ASP P CA 1 
ATOM 6353 C CA . VAL O 3  257  ? 167.918 291.715 167.811 1.00 500.00 ? 257  VAL P CA 1 
ATOM 6354 C CA . GLY O 3  258  ? 170.428 289.811 165.646 1.00 500.00 ? 258  GLY P CA 1 
ATOM 6355 C CA . PHE O 3  259  ? 170.826 286.563 167.566 1.00 500.00 ? 259  PHE P CA 1 
ATOM 6356 C CA . SER O 3  260  ? 169.031 284.865 164.609 1.00 500.00 ? 260  SER P CA 1 
ATOM 6357 C CA . LYS O 3  261  ? 172.195 283.169 163.423 1.00 500.00 ? 261  LYS P CA 1 
ATOM 6358 C CA . SER O 3  262  ? 172.711 281.332 166.760 1.00 432.59 ? 262  SER P CA 1 
ATOM 6359 C CA . SER O 3  263  ? 171.845 277.648 166.723 1.00 253.11 ? 263  SER P CA 1 
ATOM 6360 C CA . TYR O 3  264  ? 170.793 277.587 170.359 1.00 266.89 ? 264  TYR P CA 1 
ATOM 6361 C CA . ILE O 3  265  ? 167.802 279.905 169.930 1.00 290.17 ? 265  ILE P CA 1 
ATOM 6362 C CA . VAL O 3  266  ? 166.533 277.851 166.969 1.00 157.26 ? 266  VAL P CA 1 
ATOM 6363 C CA . SER O 3  267  ? 166.949 274.643 168.910 1.00 233.72 ? 267  SER P CA 1 
ATOM 6364 C CA . GLN O 3  268  ? 165.174 276.127 171.911 1.00 457.51 ? 268  GLN P CA 1 
ATOM 6365 C CA . ILE O 3  269  ? 162.289 277.250 169.724 1.00 500.00 ? 269  ILE P CA 1 
ATOM 6366 C CA . ALA O 3  270  ? 161.834 273.665 168.448 1.00 500.00 ? 270  ALA P CA 1 
ATOM 6367 C CA . VAL O 3  271  ? 161.942 272.308 172.023 1.00 500.00 ? 271  VAL P CA 1 
ATOM 6368 C CA . ALA O 3  272  ? 159.466 275.090 172.993 1.00 500.00 ? 272  ALA P CA 1 
ATOM 6369 C CA . TYR O 3  273  ? 157.013 274.099 170.251 1.00 500.00 ? 273  TYR P CA 1 
ATOM 6370 C CA . HIS O 3  274  ? 157.377 270.433 171.232 1.00 500.00 ? 274  HIS P CA 1 
ATOM 6371 C CA . ASN O 3  275  ? 156.301 271.382 174.768 1.00 500.00 ? 275  ASN P CA 1 
ATOM 6372 C CA . ILE O 3  276  ? 153.050 272.449 173.063 1.00 500.00 ? 276  ILE P CA 1 
ATOM 6373 C CA . ARG O 3  277  ? 151.799 269.649 170.795 1.00 500.00 ? 277  ARG P CA 1 
ATOM 6374 C CA . ASP O 3  278  ? 151.963 271.398 167.380 1.00 500.00 ? 278  ASP P CA 1 
ATOM 6375 C CA . ILE O 3  279  ? 154.219 268.728 165.808 1.00 500.00 ? 279  ILE P CA 1 
ATOM 6376 C CA . ASP O 3  280  ? 153.982 269.934 162.169 1.00 500.00 ? 280  ASP P CA 1 
ATOM 6377 C CA . LYS O 3  281  ? 155.174 273.505 162.970 1.00 500.00 ? 281  LYS P CA 1 
ATOM 6378 C CA . ALA O 3  282  ? 157.795 272.247 165.532 1.00 500.00 ? 282  ALA P CA 1 
ATOM 6379 C CA . LEU O 3  283  ? 159.188 269.558 163.222 1.00 494.85 ? 283  LEU P CA 1 
ATOM 6380 C CA . SER O 3  284  ? 159.910 271.945 160.325 1.00 487.17 ? 284  SER P CA 1 
ATOM 6381 C CA . ILE O 3  285  ? 162.071 274.000 162.790 1.00 353.33 ? 285  ILE P CA 1 
ATOM 6382 C CA . PHE O 3  286  ? 163.891 270.848 163.870 1.00 248.78 ? 286  PHE P CA 1 
ATOM 6383 C CA . ASN O 3  287  ? 164.682 270.198 160.223 1.00 259.58 ? 287  ASN P CA 1 
ATOM 6384 C CA . GLU O 3  288  ? 166.276 273.605 159.668 1.00 265.81 ? 288  GLU P CA 1 
ATOM 6385 C CA . LEU O 3  289  ? 168.017 273.140 163.017 1.00 280.83 ? 289  LEU P CA 1 
ATOM 6386 C CA . ARG O 3  290  ? 170.001 270.297 161.478 1.00 273.19 ? 290  ARG P CA 1 
ATOM 6387 C CA . LYS O 3  291  ? 170.686 272.558 158.501 1.00 231.58 ? 291  LYS P CA 1 
ATOM 6388 C CA . GLN O 3  292  ? 171.889 275.160 161.042 1.00 276.94 ? 292  GLN P CA 1 
ATOM 6389 C CA . ASP O 3  293  ? 174.253 272.674 162.768 1.00 271.62 ? 293  ASP P CA 1 
ATOM 6390 C CA . PRO O 3  294  ? 175.085 269.197 161.397 1.00 209.26 ? 294  PRO P CA 1 
ATOM 6391 C CA . TYR O 3  295  ? 177.078 267.929 164.367 1.00 201.56 ? 295  TYR P CA 1 
ATOM 6392 C CA . ARG O 3  296  ? 174.793 269.472 166.901 1.00 206.46 ? 296  ARG P CA 1 
ATOM 6393 C CA . ILE O 3  297  ? 173.574 266.504 168.874 1.00 218.80 ? 297  ILE P CA 1 
ATOM 6394 C CA . GLU O 3  298  ? 172.705 268.366 172.090 1.00 250.90 ? 298  GLU P CA 1 
ATOM 6395 C CA . ASN O 3  299  ? 168.915 268.559 171.722 1.00 249.76 ? 299  ASN P CA 1 
ATOM 6396 C CA . MET O 3  300  ? 168.217 265.565 169.500 1.00 203.39 ? 300  MET P CA 1 
ATOM 6397 C CA . ASP O 3  301  ? 166.718 263.891 172.561 1.00 231.25 ? 301  ASP P CA 1 
ATOM 6398 C CA . THR O 3  302  ? 163.622 266.079 172.245 1.00 200.47 ? 302  THR P CA 1 
ATOM 6399 C CA . PHE O 3  303  ? 163.771 265.789 168.384 1.00 198.92 ? 303  PHE P CA 1 
ATOM 6400 C CA . SER O 3  304  ? 163.510 262.040 168.577 1.00 180.26 ? 304  SER P CA 1 
ATOM 6401 C CA . ASN O 3  305  ? 160.605 262.273 171.085 1.00 170.65 ? 305  ASN P CA 1 
ATOM 6402 C CA . LEU O 3  306  ? 158.366 264.211 168.680 1.00 156.62 ? 306  LEU P CA 1 
ATOM 6403 C CA . LEU O 3  307  ? 159.416 262.182 165.679 1.00 175.22 ? 307  LEU P CA 1 
ATOM 6404 C CA . TYR O 3  308  ? 158.386 259.047 167.712 1.00 198.15 ? 308  TYR P CA 1 
ATOM 6405 C CA . VAL O 3  309  ? 154.886 260.406 168.527 1.00 222.56 ? 309  VAL P CA 1 
ATOM 6406 C CA . ARG O 3  310  ? 153.964 260.928 164.910 1.00 225.87 ? 310  ARG P CA 1 
ATOM 6407 C CA . SER O 3  311  ? 155.405 257.440 164.381 1.00 288.20 ? 311  SER P CA 1 
ATOM 6408 C CA . MET O 3  312  ? 157.747 258.083 161.413 1.00 429.79 ? 312  MET P CA 1 
ATOM 6409 C CA . LYS O 3  313  ? 160.107 255.080 161.596 1.00 301.32 ? 313  LYS P CA 1 
ATOM 6410 C CA . SER O 3  314  ? 161.876 256.218 158.417 1.00 208.84 ? 314  SER P CA 1 
ATOM 6411 C CA . GLU O 3  315  ? 162.640 259.744 159.592 1.00 178.25 ? 315  GLU P CA 1 
ATOM 6412 C CA . LEU O 3  316  ? 163.783 258.497 162.983 1.00 197.11 ? 316  LEU P CA 1 
ATOM 6413 C CA . SER O 3  317  ? 165.996 255.902 161.319 1.00 172.90 ? 317  SER P CA 1 
ATOM 6414 C CA . TYR O 3  318  ? 167.625 258.617 159.231 1.00 219.98 ? 318  TYR P CA 1 
ATOM 6415 C CA . LEU O 3  319  ? 168.254 260.596 162.491 1.00 209.66 ? 319  LEU P CA 1 
ATOM 6416 C CA . ALA O 3  320  ? 169.382 257.523 164.530 1.00 223.40 ? 320  ALA P CA 1 
ATOM 6417 C CA . HIS O 3  321  ? 171.920 256.016 162.064 1.00 170.67 ? 321  HIS P CA 1 
ATOM 6418 C CA . ASN O 3  322  ? 173.249 259.533 161.495 1.00 195.27 ? 322  ASN P CA 1 
ATOM 6419 C CA . LEU O 3  323  ? 173.777 260.253 165.170 1.00 237.28 ? 323  LEU P CA 1 
ATOM 6420 C CA . CYS O 3  324  ? 175.599 257.008 165.842 1.00 344.33 ? 324  CYS P CA 1 
ATOM 6421 C CA . GLU O 3  325  ? 178.119 258.140 163.175 1.00 262.52 ? 325  GLU P CA 1 
ATOM 6422 C CA . ILE O 3  326  ? 178.535 261.573 164.864 1.00 276.20 ? 326  ILE P CA 1 
ATOM 6423 C CA . ASP O 3  327  ? 178.881 260.619 168.613 1.00 219.40 ? 327  ASP P CA 1 
ATOM 6424 C CA . LYS O 3  328  ? 178.179 257.012 169.744 1.00 181.04 ? 328  LYS P CA 1 
ATOM 6425 C CA . TYR O 3  329  ? 178.676 258.026 173.375 1.00 253.71 ? 329  TYR P CA 1 
ATOM 6426 C CA . ARG O 3  330  ? 176.299 260.746 174.351 1.00 219.25 ? 330  ARG P CA 1 
ATOM 6427 C CA . VAL O 3  331  ? 173.036 260.402 176.381 1.00 256.16 ? 331  VAL P CA 1 
ATOM 6428 C CA . GLU O 3  332  ? 171.158 262.102 173.519 1.00 215.21 ? 332  GLU P CA 1 
ATOM 6429 C CA . THR O 3  333  ? 172.252 259.676 170.836 1.00 197.75 ? 333  THR P CA 1 
ATOM 6430 C CA . CYS O 3  334  ? 171.743 256.681 173.165 1.00 159.42 ? 334  CYS P CA 1 
ATOM 6431 C CA . CYS O 3  335  ? 168.145 257.760 173.765 1.00 209.43 ? 335  CYS P CA 1 
ATOM 6432 C CA . VAL O 3  336  ? 167.501 258.539 170.072 1.00 143.65 ? 336  VAL P CA 1 
ATOM 6433 C CA . ILE O 3  337  ? 168.653 254.976 169.242 1.00 147.83 ? 337  ILE P CA 1 
ATOM 6434 C CA . GLY O 3  338  ? 166.272 254.025 172.125 1.00 155.41 ? 338  GLY P CA 1 
ATOM 6435 C CA . ASN O 3  339  ? 163.272 255.850 170.609 1.00 151.63 ? 339  ASN P CA 1 
ATOM 6436 C CA . TYR O 3  340  ? 164.007 254.251 167.240 1.00 161.83 ? 340  TYR P CA 1 
ATOM 6437 C CA . TYR O 3  341  ? 164.098 250.817 168.910 1.00 175.01 ? 341  TYR P CA 1 
ATOM 6438 C CA . SER O 3  342  ? 160.844 251.460 170.765 1.00 169.02 ? 342  SER P CA 1 
ATOM 6439 C CA . LEU O 3  343  ? 159.024 252.425 167.558 1.00 180.92 ? 343  LEU P CA 1 
ATOM 6440 C CA . ARG O 3  344  ? 160.698 249.445 165.935 1.00 209.99 ? 344  ARG P CA 1 
ATOM 6441 C CA . SER O 3  345  ? 158.647 247.659 168.668 1.00 214.97 ? 345  SER P CA 1 
ATOM 6442 C CA . GLN O 3  346  ? 161.760 245.778 169.845 1.00 253.91 ? 346  GLN P CA 1 
ATOM 6443 C CA . HIS O 3  347  ? 161.208 246.731 173.516 1.00 224.18 ? 347  HIS P CA 1 
ATOM 6444 C CA . GLU O 3  348  ? 163.763 244.514 175.267 1.00 209.72 ? 348  GLU P CA 1 
ATOM 6445 C CA . LYS O 3  349  ? 166.479 246.297 173.243 1.00 196.43 ? 349  LYS P CA 1 
ATOM 6446 C CA . ALA O 3  350  ? 164.686 249.666 173.588 1.00 178.30 ? 350  ALA P CA 1 
ATOM 6447 C CA . ALA O 3  351  ? 164.691 249.612 177.421 1.00 214.04 ? 351  ALA P CA 1 
ATOM 6448 C CA . LEU O 3  352  ? 168.332 248.580 177.313 1.00 171.19 ? 352  LEU P CA 1 
ATOM 6449 C CA . TYR O 3  353  ? 169.506 251.562 175.269 1.00 155.39 ? 353  TYR P CA 1 
ATOM 6450 C CA . PHE O 3  354  ? 167.614 253.747 177.712 1.00 146.61 ? 354  PHE P CA 1 
ATOM 6451 C CA . GLN O 3  355  ? 169.327 251.803 180.466 1.00 151.49 ? 355  GLN P CA 1 
ATOM 6452 C CA . ARG O 3  356  ? 172.647 252.628 178.805 1.00 191.48 ? 356  ARG P CA 1 
ATOM 6453 C CA . ALA O 3  357  ? 171.753 256.292 178.247 1.00 168.26 ? 357  ALA P CA 1 
ATOM 6454 C CA . LEU O 3  358  ? 171.140 256.671 181.947 1.00 148.06 ? 358  LEU P CA 1 
ATOM 6455 C CA . LYS O 3  359  ? 174.359 254.779 182.567 1.00 169.12 ? 359  LYS P CA 1 
ATOM 6456 C CA . LEU O 3  360  ? 175.647 257.684 180.501 1.00 227.44 ? 360  LEU P CA 1 
ATOM 6457 C CA . ASN O 3  361  ? 173.960 260.311 182.690 1.00 180.07 ? 361  ASN P CA 1 
ATOM 6458 C CA . PRO O 3  362  ? 172.176 259.575 185.109 1.00 384.56 ? 362  PRO P CA 1 
ATOM 6459 C CA . ARG O 3  363  ? 170.601 263.052 185.672 1.00 360.35 ? 363  ARG P CA 1 
ATOM 6460 C CA . TYR O 3  364  ? 169.169 263.191 182.093 1.00 205.80 ? 364  TYR P CA 1 
ATOM 6461 C CA . LEU O 3  365  ? 165.374 263.442 182.444 1.00 243.73 ? 365  LEU P CA 1 
ATOM 6462 C CA . GLY O 3  366  ? 163.857 261.863 179.316 1.00 221.70 ? 366  GLY P CA 1 
ATOM 6463 C CA . ALA O 3  367  ? 165.386 258.450 179.810 1.00 174.83 ? 367  ALA P CA 1 
ATOM 6464 C CA . TRP O 3  368  ? 163.952 257.481 183.170 1.00 169.03 ? 368  TRP P CA 1 
ATOM 6465 C CA . THR O 3  369  ? 160.364 258.147 181.991 1.00 215.23 ? 369  THR P CA 1 
ATOM 6466 C CA . LEU O 3  370  ? 161.037 256.672 178.587 1.00 176.53 ? 370  LEU P CA 1 
ATOM 6467 C CA . MET O 3  371  ? 162.423 253.618 180.411 1.00 143.81 ? 371  MET P CA 1 
ATOM 6468 C CA . GLY O 3  372  ? 159.140 253.348 182.273 1.00 151.79 ? 372  GLY P CA 1 
ATOM 6469 C CA . HIS O 3  373  ? 157.060 253.029 179.133 1.00 168.31 ? 373  HIS P CA 1 
ATOM 6470 C CA . GLU O 3  374  ? 159.353 250.332 177.844 1.00 180.41 ? 374  GLU P CA 1 
ATOM 6471 C CA . TYR O 3  375  ? 159.093 248.417 181.132 1.00 161.14 ? 375  TYR P CA 1 
ATOM 6472 C CA . MET O 3  376  ? 155.390 249.063 180.865 1.00 184.13 ? 376  MET P CA 1 
ATOM 6473 C CA . GLU O 3  377  ? 155.236 247.418 177.421 1.00 187.94 ? 377  GLU P CA 1 
ATOM 6474 C CA . MET O 3  378  ? 156.940 244.150 178.465 1.00 224.52 ? 378  MET P CA 1 
ATOM 6475 C CA . LYS O 3  379  ? 154.444 244.294 181.418 1.00 243.03 ? 379  LYS P CA 1 
ATOM 6476 C CA . ASN O 3  380  ? 157.075 244.275 184.187 1.00 290.88 ? 380  ASN P CA 1 
ATOM 6477 C CA . THR O 3  381  ? 155.145 246.911 186.079 1.00 204.14 ? 381  THR P CA 1 
ATOM 6478 C CA . SER O 3  382  ? 157.130 247.106 189.402 1.00 182.79 ? 382  SER P CA 1 
ATOM 6479 C CA . ALA O 3  383  ? 160.101 247.946 187.230 1.00 172.44 ? 383  ALA P CA 1 
ATOM 6480 C CA . ALA O 3  384  ? 157.918 250.552 185.579 1.00 143.53 ? 384  ALA P CA 1 
ATOM 6481 C CA . ILE O 3  385  ? 156.917 252.133 188.925 1.00 149.96 ? 385  ILE P CA 1 
ATOM 6482 C CA . GLN O 3  386  ? 160.549 252.295 190.075 1.00 152.07 ? 386  GLN P CA 1 
ATOM 6483 C CA . ALA O 3  387  ? 161.431 253.597 186.647 1.00 168.11 ? 387  ALA P CA 1 
ATOM 6484 C CA . TYR O 3  388  ? 158.979 256.500 186.607 1.00 142.12 ? 388  TYR P CA 1 
ATOM 6485 C CA . ARG O 3  389  ? 159.737 257.072 190.257 1.00 153.09 ? 389  ARG P CA 1 
ATOM 6486 C CA . HIS O 3  390  ? 163.314 257.827 189.340 1.00 165.85 ? 390  HIS P CA 1 
ATOM 6487 C CA . ALA O 3  391  ? 162.195 260.379 186.785 1.00 166.88 ? 391  ALA P CA 1 
ATOM 6488 C CA . ILE O 3  392  ? 160.229 262.012 189.642 1.00 307.11 ? 392  ILE P CA 1 
ATOM 6489 C CA . GLU O 3  393  ? 163.269 261.839 192.024 1.00 257.01 ? 393  GLU P CA 1 
ATOM 6490 C CA . VAL O 3  394  ? 165.255 263.763 189.378 1.00 366.08 ? 394  VAL P CA 1 
ATOM 6491 C CA . ASN O 3  395  ? 162.333 266.019 188.288 1.00 500.00 ? 395  ASN P CA 1 
ATOM 6492 C CA . LYS O 3  396  ? 159.108 266.823 190.159 1.00 500.00 ? 396  LYS P CA 1 
ATOM 6493 C CA . ARG O 3  397  ? 158.765 268.844 186.891 1.00 500.00 ? 397  ARG P CA 1 
ATOM 6494 C CA . ASP O 3  398  ? 158.500 265.728 184.673 1.00 473.69 ? 398  ASP P CA 1 
ATOM 6495 C CA . TYR O 3  399  ? 154.801 265.398 183.894 1.00 403.67 ? 399  TYR P CA 1 
ATOM 6496 C CA . ARG O 3  400  ? 155.009 262.276 181.726 1.00 310.37 ? 400  ARG P CA 1 
ATOM 6497 C CA . ALA O 3  401  ? 156.578 260.351 184.654 1.00 358.24 ? 401  ALA P CA 1 
ATOM 6498 C CA . TRP O 3  402  ? 153.898 261.644 186.979 1.00 360.53 ? 402  TRP P CA 1 
ATOM 6499 C CA . TYR O 3  403  ? 151.265 260.479 184.506 1.00 200.53 ? 403  TYR P CA 1 
ATOM 6500 C CA . GLY O 3  404  ? 153.261 257.309 184.085 1.00 222.41 ? 404  GLY P CA 1 
ATOM 6501 C CA . LEU O 3  405  ? 153.084 256.642 187.807 1.00 191.72 ? 405  LEU P CA 1 
ATOM 6502 C CA . GLY O 3  406  ? 149.347 257.099 187.837 1.00 274.81 ? 406  GLY P CA 1 
ATOM 6503 C CA . GLN O 3  407  ? 149.006 254.932 184.737 1.00 269.39 ? 407  GLN P CA 1 
ATOM 6504 C CA . THR O 3  408  ? 151.172 252.187 186.247 1.00 254.43 ? 408  THR P CA 1 
ATOM 6505 C CA . TYR O 3  409  ? 149.357 252.251 189.601 1.00 220.35 ? 409  TYR P CA 1 
ATOM 6506 C CA . GLU O 3  410  ? 146.032 252.300 187.687 1.00 233.20 ? 410  GLU P CA 1 
ATOM 6507 C CA . ILE O 3  411  ? 147.094 249.133 185.830 1.00 213.92 ? 411  ILE P CA 1 
ATOM 6508 C CA . LEU O 3  412  ? 147.778 247.751 189.283 1.00 152.55 ? 412  LEU P CA 1 
ATOM 6509 C CA . LYS O 3  413  ? 144.757 246.912 191.515 1.00 369.43 ? 413  LYS P CA 1 
ATOM 6510 C CA . MET O 3  414  ? 145.367 250.024 193.660 1.00 445.27 ? 414  MET P CA 1 
ATOM 6511 C CA . PRO O 3  415  ? 142.974 253.053 193.241 1.00 500.00 ? 415  PRO P CA 1 
ATOM 6512 C CA . PHE O 3  416  ? 143.878 255.689 195.878 1.00 500.00 ? 416  PHE P CA 1 
ATOM 6513 C CA . TYR O 3  417  ? 147.558 256.040 194.943 1.00 500.00 ? 417  TYR P CA 1 
ATOM 6514 C CA . CYS O 3  418  ? 146.961 256.281 191.155 1.00 500.00 ? 418  CYS P CA 1 
ATOM 6515 C CA . LEU O 3  419  ? 144.435 259.041 191.801 1.00 500.00 ? 419  LEU P CA 1 
ATOM 6516 C CA . TYR O 3  420  ? 147.155 261.086 193.587 1.00 500.00 ? 420  TYR P CA 1 
ATOM 6517 C CA . TYR O 3  421  ? 149.713 261.021 190.767 1.00 432.79 ? 421  TYR P CA 1 
ATOM 6518 C CA . TYR O 3  422  ? 147.070 261.843 188.144 1.00 500.00 ? 422  TYR P CA 1 
ATOM 6519 C CA . ARG O 3  423  ? 145.994 265.033 189.961 1.00 500.00 ? 423  ARG P CA 1 
ATOM 6520 C CA . ARG O 3  424  ? 149.695 265.895 190.404 1.00 500.00 ? 424  ARG P CA 1 
ATOM 6521 C CA . ALA O 3  425  ? 150.167 265.377 186.645 1.00 500.00 ? 425  ALA P CA 1 
ATOM 6522 C CA . HIS O 3  426  ? 147.094 267.413 185.695 1.00 500.00 ? 426  HIS P CA 1 
ATOM 6523 C CA . GLN O 3  427  ? 148.514 270.224 187.884 1.00 500.00 ? 427  GLN P CA 1 
ATOM 6524 C CA . LEU O 3  428  ? 151.581 270.107 185.585 1.00 500.00 ? 428  LEU P CA 1 
ATOM 6525 C CA . ARG O 3  429  ? 149.564 270.251 182.333 1.00 500.00 ? 429  ARG P CA 1 
ATOM 6526 C CA . PRO O 3  430  ? 146.164 271.956 182.692 1.00 500.00 ? 430  PRO P CA 1 
ATOM 6527 C CA . ASN O 3  431  ? 145.187 272.092 179.005 1.00 500.00 ? 431  ASN P CA 1 
ATOM 6528 C CA . ASP O 3  432  ? 145.734 268.345 178.547 1.00 500.00 ? 432  ASP P CA 1 
ATOM 6529 C CA . SER O 3  433  ? 142.526 266.401 177.862 1.00 500.00 ? 433  SER P CA 1 
ATOM 6530 C CA . ARG O 3  434  ? 144.094 262.983 178.678 1.00 500.00 ? 434  ARG P CA 1 
ATOM 6531 C CA . MET O 3  435  ? 144.823 263.891 182.335 1.00 500.00 ? 435  MET P CA 1 
ATOM 6532 C CA . LEU O 3  436  ? 141.285 265.015 183.089 1.00 500.00 ? 436  LEU P CA 1 
ATOM 6533 C CA . VAL O 3  437  ? 139.898 261.871 181.434 1.00 482.26 ? 437  VAL P CA 1 
ATOM 6534 C CA . ALA O 3  438  ? 142.253 259.749 183.576 1.00 408.75 ? 438  ALA P CA 1 
ATOM 6535 C CA . LEU O 3  439  ? 141.113 261.584 186.716 1.00 500.00 ? 439  LEU P CA 1 
ATOM 6536 C CA . GLY O 3  440  ? 137.499 260.746 185.860 1.00 500.00 ? 440  GLY P CA 1 
ATOM 6537 C CA . GLU O 3  441  ? 138.319 257.001 185.663 1.00 493.20 ? 441  GLU P CA 1 
ATOM 6538 C CA . CYS O 3  442  ? 139.924 257.100 189.125 1.00 500.00 ? 442  CYS P CA 1 
ATOM 6539 C CA . TYR O 3  443  ? 137.073 259.054 190.669 1.00 500.00 ? 443  TYR P CA 1 
ATOM 6540 C CA . GLU O 3  444  ? 134.445 256.692 189.106 1.00 500.00 ? 444  GLU P CA 1 
ATOM 6541 C CA . LYS O 3  445  ? 136.093 253.505 190.530 1.00 500.00 ? 445  LYS P CA 1 
ATOM 6542 C CA . LEU O 3  446  ? 136.387 255.542 193.758 1.00 500.00 ? 446  LEU P CA 1 
ATOM 6543 C CA . ASN O 3  447  ? 132.560 255.908 193.492 1.00 500.00 ? 447  ASN P CA 1 
ATOM 6544 C CA . GLN O 3  448  ? 132.806 259.702 193.959 1.00 500.00 ? 448  GLN P CA 1 
ATOM 6545 C CA . LEU O 3  449  ? 130.767 260.346 190.824 1.00 500.00 ? 449  LEU P CA 1 
ATOM 6546 C CA . VAL O 3  450  ? 129.874 264.083 191.121 1.00 500.00 ? 450  VAL P CA 1 
ATOM 6547 C CA . GLU O 3  451  ? 133.671 264.849 191.074 1.00 500.00 ? 451  GLU P CA 1 
ATOM 6548 C CA . ALA O 3  452  ? 134.236 262.572 188.044 1.00 500.00 ? 452  ALA P CA 1 
ATOM 6549 C CA . LYS O 3  453  ? 131.332 264.034 186.086 1.00 500.00 ? 453  LYS P CA 1 
ATOM 6550 C CA . LYS O 3  454  ? 132.650 267.597 186.501 1.00 500.00 ? 454  LYS P CA 1 
ATOM 6551 C CA . CYS O 3  455  ? 136.139 266.408 185.456 1.00 500.00 ? 455  CYS P CA 1 
ATOM 6552 C CA . TYR O 3  456  ? 134.903 264.670 182.280 1.00 500.00 ? 456  TYR P CA 1 
ATOM 6553 C CA . TRP O 3  457  ? 132.800 267.783 181.540 1.00 500.00 ? 457  TRP P CA 1 
ATOM 6554 C CA . ARG O 3  458  ? 135.912 270.004 181.902 1.00 500.00 ? 458  ARG P CA 1 
ATOM 6555 C CA . ALA O 3  459  ? 137.741 267.467 179.626 1.00 500.00 ? 459  ALA P CA 1 
ATOM 6556 C CA . TYR O 3  460  ? 135.160 268.161 176.899 1.00 500.00 ? 460  TYR P CA 1 
ATOM 6557 C CA . ALA O 3  461  ? 135.493 271.919 177.528 1.00 500.00 ? 461  ALA P CA 1 
ATOM 6558 C CA . VAL O 3  462  ? 139.325 271.800 177.426 1.00 500.00 ? 462  VAL P CA 1 
ATOM 6559 C CA . GLY O 3  463  ? 140.121 269.358 174.588 1.00 500.00 ? 463  GLY P CA 1 
ATOM 6560 C CA . ASP O 3  464  ? 138.875 265.789 174.050 1.00 500.00 ? 464  ASP P CA 1 
ATOM 6561 C CA . VAL O 3  465  ? 141.095 265.112 170.998 1.00 408.35 ? 465  VAL P CA 1 
ATOM 6562 C CA . GLU O 3  466  ? 140.746 261.290 170.910 1.00 223.60 ? 466  GLU P CA 1 
ATOM 6563 C CA . LYS O 3  467  ? 137.145 262.297 171.567 1.00 428.87 ? 467  LYS P CA 1 
ATOM 6564 C CA . MET O 3  468  ? 136.332 259.700 174.294 1.00 500.00 ? 468  MET P CA 1 
ATOM 6565 C CA . ALA O 3  469  ? 135.496 261.948 177.353 1.00 500.00 ? 469  ALA P CA 1 
ATOM 6566 C CA . LEU O 3  470  ? 131.806 262.460 176.477 1.00 500.00 ? 470  LEU P CA 1 
ATOM 6567 C CA . VAL O 3  471  ? 130.941 258.738 176.278 1.00 500.00 ? 471  VAL P CA 1 
ATOM 6568 C CA . LYS O 3  472  ? 132.417 258.311 179.732 1.00 500.00 ? 472  LYS P CA 1 
ATOM 6569 C CA . LEU O 3  473  ? 130.552 261.311 181.211 1.00 500.00 ? 473  LEU P CA 1 
ATOM 6570 C CA . ALA O 3  474  ? 127.392 259.868 179.655 1.00 500.00 ? 474  ALA P CA 1 
ATOM 6571 C CA . LYS O 3  475  ? 127.929 256.391 181.058 1.00 500.00 ? 475  LYS P CA 1 
ATOM 6572 C CA . LEU O 3  476  ? 128.050 257.968 184.565 1.00 500.00 ? 476  LEU P CA 1 
ATOM 6573 C CA . HIS O 3  477  ? 124.748 259.718 183.843 1.00 500.00 ? 477  HIS P CA 1 
ATOM 6574 C CA . GLU O 3  478  ? 123.457 256.229 182.983 1.00 500.00 ? 478  GLU P CA 1 
ATOM 6575 C CA . GLY P 13 29   ? 172.995 161.002 191.705 1.00 56.96  ? 29   GLY Q CA 1 
ATOM 6576 C CA . PRO P 13 30   ? 169.176 160.465 191.881 1.00 59.25  ? 30   PRO Q CA 1 
ATOM 6577 C CA . VAL P 13 31   ? 168.454 164.061 192.803 1.00 54.84  ? 31   VAL Q CA 1 
ATOM 6578 C CA . GLY P 13 32   ? 170.711 165.290 190.023 1.00 49.84  ? 32   GLY Q CA 1 
ATOM 6579 C CA . LYS P 13 33   ? 168.914 162.881 187.652 1.00 44.45  ? 33   LYS Q CA 1 
ATOM 6580 C CA . ARG P 13 34   ? 165.595 164.313 188.774 1.00 33.01  ? 34   ARG Q CA 1 
ATOM 6581 C CA . LEU P 13 35   ? 166.822 167.897 188.199 1.00 33.80  ? 35   LEU Q CA 1 
ATOM 6582 C CA . GLN P 13 36   ? 168.122 166.978 184.742 1.00 29.06  ? 36   GLN Q CA 1 
ATOM 6583 C CA . GLN P 13 37   ? 164.644 165.680 183.954 1.00 25.52  ? 37   GLN Q CA 1 
ATOM 6584 C CA . GLU P 13 38   ? 162.954 168.819 185.396 1.00 29.07  ? 38   GLU Q CA 1 
ATOM 6585 C CA . LEU P 13 39   ? 165.237 170.903 183.157 1.00 28.77  ? 39   LEU Q CA 1 
ATOM 6586 C CA . MET P 13 40   ? 164.331 168.915 180.046 1.00 28.87  ? 40   MET Q CA 1 
ATOM 6587 C CA . THR P 13 41   ? 160.615 169.080 180.882 1.00 30.48  ? 41   THR Q CA 1 
ATOM 6588 C CA . LEU P 13 42   ? 160.846 172.861 181.233 1.00 28.22  ? 42   LEU Q CA 1 
ATOM 6589 C CA . MET P 13 43   ? 162.824 173.139 177.949 1.00 28.64  ? 43   MET Q CA 1 
ATOM 6590 C CA . MET P 13 44   ? 160.216 171.084 176.095 1.00 36.19  ? 44   MET Q CA 1 
ATOM 6591 C CA . SER P 13 45   ? 157.179 172.781 177.647 1.00 37.74  ? 45   SER Q CA 1 
ATOM 6592 C CA . GLY P 13 46   ? 157.288 176.185 175.911 1.00 53.17  ? 46   GLY Q CA 1 
ATOM 6593 C CA . ASP P 13 47   ? 155.486 178.084 178.713 1.00 55.20  ? 47   ASP Q CA 1 
ATOM 6594 C CA . LYS P 13 48   ? 155.311 181.823 177.997 1.00 47.41  ? 48   LYS Q CA 1 
ATOM 6595 C CA . GLY P 13 49   ? 157.312 184.302 180.055 1.00 38.70  ? 49   GLY Q CA 1 
ATOM 6596 C CA . ILE P 13 50   ? 159.026 181.816 182.310 1.00 26.20  ? 50   ILE Q CA 1 
ATOM 6597 C CA . SER P 13 51   ? 162.473 180.268 182.006 1.00 21.54  ? 51   SER Q CA 1 
ATOM 6598 C CA . ALA P 13 52   ? 165.226 178.868 184.206 1.00 24.60  ? 52   ALA Q CA 1 
ATOM 6599 C CA . PHE P 13 53   ? 168.634 177.217 183.925 1.00 24.49  ? 53   PHE Q CA 1 
ATOM 6600 C CA . PRO P 13 54   ? 171.356 175.823 186.185 1.00 24.34  ? 54   PRO Q CA 1 
ATOM 6601 C CA . GLU P 13 55   ? 173.738 178.568 187.087 1.00 48.04  ? 55   GLU Q CA 1 
ATOM 6602 C CA . SER P 13 56   ? 177.128 177.546 185.794 1.00 72.05  ? 56   SER Q CA 1 
ATOM 6603 C CA . ASP P 13 57   ? 178.466 174.332 187.319 1.00 70.55  ? 57   ASP Q CA 1 
ATOM 6604 C CA . ASN P 13 58   ? 175.830 172.887 189.625 1.00 56.99  ? 58   ASN Q CA 1 
ATOM 6605 C CA . LEU P 13 59   ? 172.525 171.288 188.918 1.00 43.60  ? 59   LEU Q CA 1 
ATOM 6606 C CA . PHE P 13 60   ? 171.814 172.502 192.476 1.00 37.26  ? 60   PHE Q CA 1 
ATOM 6607 C CA . LYS P 13 61   ? 171.621 176.246 191.886 1.00 36.80  ? 61   LYS Q CA 1 
ATOM 6608 C CA . TRP P 13 62   ? 169.648 177.757 189.046 1.00 28.44  ? 62   TRP Q CA 1 
ATOM 6609 C CA . VAL P 13 63   ? 168.647 181.201 187.802 1.00 21.69  ? 63   VAL Q CA 1 
ATOM 6610 C CA . GLY P 13 64   ? 165.051 181.733 186.737 1.00 26.93  ? 64   GLY Q CA 1 
ATOM 6611 C CA . THR P 13 65   ? 163.346 184.498 184.799 1.00 23.42  ? 65   THR Q CA 1 
ATOM 6612 C CA . ILE P 13 66   ? 159.719 185.436 185.057 1.00 26.73  ? 66   ILE Q CA 1 
ATOM 6613 C CA . HIS P 13 67   ? 157.886 188.057 182.978 1.00 32.43  ? 67   HIS Q CA 1 
ATOM 6614 C CA . GLY P 13 68   ? 154.709 189.641 184.292 1.00 34.43  ? 68   GLY Q CA 1 
ATOM 6615 C CA . ALA P 13 69   ? 151.584 188.406 182.505 1.00 50.32  ? 69   ALA Q CA 1 
ATOM 6616 C CA . ALA P 13 70   ? 149.767 190.621 179.997 1.00 54.61  ? 70   ALA Q CA 1 
ATOM 6617 C CA . GLY P 13 71   ? 146.868 192.464 181.586 1.00 49.89  ? 71   GLY Q CA 1 
ATOM 6618 C CA . THR P 13 72   ? 148.561 192.643 184.971 1.00 40.27  ? 72   THR Q CA 1 
ATOM 6619 C CA . VAL P 13 73   ? 150.417 195.639 186.454 1.00 35.72  ? 73   VAL Q CA 1 
ATOM 6620 C CA . TYR P 13 74   ? 153.657 193.622 186.010 1.00 26.50  ? 74   TYR Q CA 1 
ATOM 6621 C CA . GLU P 13 75   ? 153.331 193.410 182.246 1.00 45.46  ? 75   GLU Q CA 1 
ATOM 6622 C CA . ASP P 13 76   ? 156.555 194.535 180.586 1.00 42.83  ? 76   ASP Q CA 1 
ATOM 6623 C CA . LEU P 13 77   ? 158.585 193.813 183.745 1.00 26.37  ? 77   LEU Q CA 1 
ATOM 6624 C CA . ARG P 13 78   ? 160.959 190.927 184.152 1.00 30.40  ? 78   ARG Q CA 1 
ATOM 6625 C CA . TYR P 13 79   ? 162.519 189.456 187.281 1.00 24.85  ? 79   TYR Q CA 1 
ATOM 6626 C CA . LYS P 13 80   ? 165.458 187.104 187.889 1.00 22.09  ? 80   LYS Q CA 1 
ATOM 6627 C CA . LEU P 13 81   ? 165.181 184.590 190.728 1.00 29.04  ? 81   LEU Q CA 1 
ATOM 6628 C CA . SER P 13 82   ? 167.608 182.167 192.368 1.00 26.80  ? 82   SER Q CA 1 
ATOM 6629 C CA . LEU P 13 83   ? 166.565 178.579 193.019 1.00 29.08  ? 83   LEU Q CA 1 
ATOM 6630 C CA . GLU P 13 84   ? 168.729 176.490 195.363 1.00 38.07  ? 84   GLU Q CA 1 
ATOM 6631 C CA . PHE P 13 85   ? 168.111 172.752 195.844 1.00 38.49  ? 85   PHE Q CA 1 
ATOM 6632 C CA . PRO P 13 86   ? 168.995 171.488 199.349 1.00 49.73  ? 86   PRO Q CA 1 
ATOM 6633 C CA . SER P 13 87   ? 170.218 168.093 200.492 1.00 53.95  ? 87   SER Q CA 1 
ATOM 6634 C CA . GLY P 13 88   ? 166.940 166.221 200.775 1.00 51.07  ? 88   GLY Q CA 1 
ATOM 6635 C CA . TYR P 13 89   ? 165.315 167.660 197.660 1.00 47.62  ? 89   TYR Q CA 1 
ATOM 6636 C CA . PRO P 13 90   ? 162.627 166.717 196.251 1.00 39.03  ? 90   PRO Q CA 1 
ATOM 6637 C CA . TYR P 13 91   ? 161.270 166.181 199.812 1.00 40.10  ? 91   TYR Q CA 1 
ATOM 6638 C CA . ASN P 13 92   ? 162.768 169.399 201.128 1.00 43.52  ? 92   ASN Q CA 1 
ATOM 6639 C CA . ALA P 13 93   ? 161.464 172.427 199.240 1.00 40.51  ? 93   ALA Q CA 1 
ATOM 6640 C CA . PRO P 13 94   ? 163.924 174.423 197.133 1.00 41.93  ? 94   PRO Q CA 1 
ATOM 6641 C CA . THR P 13 95   ? 164.872 177.908 198.389 1.00 40.51  ? 95   THR Q CA 1 
ATOM 6642 C CA . VAL P 13 96   ? 163.562 180.427 195.840 1.00 34.78  ? 96   VAL Q CA 1 
ATOM 6643 C CA . LYS P 13 97   ? 164.191 184.164 196.115 1.00 35.99  ? 97   LYS Q CA 1 
ATOM 6644 C CA . PHE P 13 98   ? 163.876 187.178 193.857 1.00 23.03  ? 98   PHE Q CA 1 
ATOM 6645 C CA . LEU P 13 99   ? 167.274 188.452 192.760 1.00 38.06  ? 99   LEU Q CA 1 
ATOM 6646 C CA . THR P 13 100  ? 165.615 191.419 190.999 1.00 31.60  ? 100  THR Q CA 1 
ATOM 6647 C CA . PRO P 13 101  ? 164.033 193.588 193.758 1.00 37.30  ? 101  PRO Q CA 1 
ATOM 6648 C CA . CYS P 13 102  ? 160.336 192.933 193.429 1.00 29.28  ? 102  CYS Q CA 1 
ATOM 6649 C CA . TYR P 13 103  ? 157.703 195.305 194.844 1.00 26.46  ? 103  TYR Q CA 1 
ATOM 6650 C CA . HIS P 13 104  ? 154.806 192.926 195.646 1.00 26.95  ? 104  HIS Q CA 1 
ATOM 6651 C CA . PRO P 13 105  ? 152.509 192.237 198.658 1.00 39.00  ? 105  PRO Q CA 1 
ATOM 6652 C CA . ASN P 13 106  ? 153.973 188.716 199.103 1.00 33.06  ? 106  ASN Q CA 1 
ATOM 6653 C CA . VAL P 13 107  ? 157.645 189.505 198.647 1.00 33.23  ? 107  VAL Q CA 1 
ATOM 6654 C CA . ASP P 13 108  ? 159.991 190.872 201.293 1.00 36.62  ? 108  ASP Q CA 1 
ATOM 6655 C CA . THR P 13 109  ? 162.970 193.200 200.882 1.00 37.75  ? 109  THR Q CA 1 
ATOM 6656 C CA . GLN P 13 110  ? 165.427 190.296 200.888 1.00 51.15  ? 110  GLN Q CA 1 
ATOM 6657 C CA . GLY P 13 111  ? 163.635 188.646 197.949 1.00 37.45  ? 111  GLY Q CA 1 
ATOM 6658 C CA . ASN P 13 112  ? 161.799 186.059 200.082 1.00 36.29  ? 112  ASN Q CA 1 
ATOM 6659 C CA . ILE P 13 113  ? 158.417 184.919 198.784 1.00 33.03  ? 113  ILE Q CA 1 
ATOM 6660 C CA . CYS P 13 114  ? 155.438 183.939 200.880 1.00 39.13  ? 114  CYS Q CA 1 
ATOM 6661 C CA . LEU P 13 115  ? 153.945 181.242 198.659 1.00 29.03  ? 115  LEU Q CA 1 
ATOM 6662 C CA . ASP P 13 116  ? 152.128 178.216 200.162 1.00 38.91  ? 116  ASP Q CA 1 
ATOM 6663 C CA . ILE P 13 117  ? 153.687 175.629 197.832 1.00 41.77  ? 117  ILE Q CA 1 
ATOM 6664 C CA . LEU P 13 118  ? 157.181 176.668 198.904 1.00 42.69  ? 118  LEU Q CA 1 
ATOM 6665 C CA . LYS P 13 119  ? 156.566 175.865 202.553 1.00 49.74  ? 119  LYS Q CA 1 
ATOM 6666 C CA . GLU P 13 120  ? 153.678 173.850 203.985 1.00 60.24  ? 120  GLU Q CA 1 
ATOM 6667 C CA . LYS P 13 121  ? 152.044 172.835 200.732 1.00 45.15  ? 121  LYS Q CA 1 
ATOM 6668 C CA . TRP P 13 122  ? 155.326 171.678 199.079 1.00 33.87  ? 122  TRP Q CA 1 
ATOM 6669 C CA . SER P 13 123  ? 154.774 168.363 197.286 1.00 38.77  ? 123  SER Q CA 1 
ATOM 6670 C CA . ALA P 13 124  ? 157.626 166.111 196.162 1.00 37.09  ? 124  ALA Q CA 1 
ATOM 6671 C CA . LEU P 13 125  ? 155.888 165.932 192.735 1.00 31.12  ? 125  LEU Q CA 1 
ATOM 6672 C CA . TYR P 13 126  ? 156.374 169.684 192.142 1.00 38.74  ? 126  TYR Q CA 1 
ATOM 6673 C CA . ASP P 13 127  ? 159.006 170.649 189.646 1.00 38.91  ? 127  ASP Q CA 1 
ATOM 6674 C CA . VAL P 13 128  ? 160.771 173.844 188.586 1.00 33.33  ? 128  VAL Q CA 1 
ATOM 6675 C CA . ARG P 13 129  ? 158.192 174.586 185.922 1.00 26.01  ? 129  ARG Q CA 1 
ATOM 6676 C CA . THR P 13 130  ? 155.422 174.377 188.542 1.00 36.04  ? 130  THR Q CA 1 
ATOM 6677 C CA . ILE P 13 131  ? 157.240 176.710 190.860 1.00 29.89  ? 131  ILE Q CA 1 
ATOM 6678 C CA . LEU P 13 132  ? 157.832 179.332 188.125 1.00 27.65  ? 132  LEU Q CA 1 
ATOM 6679 C CA . LEU P 13 133  ? 154.235 179.212 186.913 1.00 27.98  ? 133  LEU Q CA 1 
ATOM 6680 C CA . SER P 13 134  ? 153.015 179.586 190.505 1.00 31.16  ? 134  SER Q CA 1 
ATOM 6681 C CA . ILE P 13 135  ? 155.215 182.625 191.159 1.00 27.77  ? 135  ILE Q CA 1 
ATOM 6682 C CA . GLN P 13 136  ? 154.180 184.189 187.855 1.00 32.51  ? 136  GLN Q CA 1 
ATOM 6683 C CA . SER P 13 137  ? 150.582 183.664 188.900 1.00 31.23  ? 137  SER Q CA 1 
ATOM 6684 C CA . LEU P 13 138  ? 151.280 185.169 192.348 1.00 34.51  ? 138  LEU Q CA 1 
ATOM 6685 C CA . LEU P 13 139  ? 152.385 188.423 190.593 1.00 30.39  ? 139  LEU Q CA 1 
ATOM 6686 C CA . GLY P 13 140  ? 148.901 189.106 189.225 1.00 37.95  ? 140  GLY Q CA 1 
ATOM 6687 C CA . GLU P 13 141  ? 146.976 187.609 192.184 1.00 32.11  ? 141  GLU Q CA 1 
ATOM 6688 C CA . PRO P 13 142  ? 148.701 188.367 195.471 1.00 36.10  ? 142  PRO Q CA 1 
ATOM 6689 C CA . ASN P 13 143  ? 147.369 187.116 198.800 1.00 50.77  ? 143  ASN Q CA 1 
ATOM 6690 C CA . ILE P 13 144  ? 146.595 190.307 200.695 1.00 59.70  ? 144  ILE Q CA 1 
ATOM 6691 C CA . ASP P 13 145  ? 145.788 188.474 203.936 1.00 66.58  ? 145  ASP Q CA 1 
ATOM 6692 C CA . SER P 13 146  ? 149.411 187.235 204.127 1.00 57.73  ? 146  SER Q CA 1 
ATOM 6693 C CA . PRO P 13 147  ? 151.566 190.332 203.285 1.00 55.28  ? 147  PRO Q CA 1 
ATOM 6694 C CA . LEU P 13 148  ? 155.354 190.492 203.507 1.00 37.80  ? 148  LEU Q CA 1 
ATOM 6695 C CA . ASN P 13 149  ? 155.159 194.057 202.185 1.00 40.01  ? 149  ASN Q CA 1 
ATOM 6696 C CA . THR P 13 150  ? 152.362 196.040 203.808 1.00 43.39  ? 150  THR Q CA 1 
ATOM 6697 C CA A HIS P 13 151  ? 152.892 199.159 201.703 0.56 32.40  ? 151  HIS Q CA 1 
ATOM 6698 C CA B HIS P 13 151  ? 152.847 199.149 201.729 0.44 32.45  ? 151  HIS Q CA 1 
ATOM 6699 C CA . ALA P 13 152  ? 152.345 197.100 198.563 1.00 25.42  ? 152  ALA Q CA 1 
ATOM 6700 C CA . ALA P 13 153  ? 149.425 195.230 200.083 1.00 34.16  ? 153  ALA Q CA 1 
ATOM 6701 C CA . GLU P 13 154  ? 147.655 198.519 200.911 1.00 38.11  ? 154  GLU Q CA 1 
ATOM 6702 C CA . LEU P 13 155  ? 148.465 200.091 197.558 1.00 24.82  ? 155  LEU Q CA 1 
ATOM 6703 C CA . TRP P 13 156  ? 147.300 197.044 195.611 1.00 29.42  ? 156  TRP Q CA 1 
ATOM 6704 C CA . LYS P 13 157  ? 143.634 198.109 195.657 1.00 38.61  ? 157  LYS Q CA 1 
ATOM 6705 C CA . ASN P 13 158  ? 144.540 201.132 193.544 1.00 31.68  ? 158  ASN Q CA 1 
ATOM 6706 C CA . PRO P 13 159  ? 145.988 199.605 190.361 1.00 26.78  ? 159  PRO Q CA 1 
ATOM 6707 C CA . THR P 13 160  ? 146.890 202.821 188.442 1.00 25.76  ? 160  THR Q CA 1 
ATOM 6708 C CA . ALA P 13 161  ? 148.787 204.150 191.519 1.00 30.93  ? 161  ALA Q CA 1 
ATOM 6709 C CA . PHE P 13 162  ? 150.283 200.719 192.195 1.00 22.32  ? 162  PHE Q CA 1 
ATOM 6710 C CA . LYS P 13 163  ? 151.440 200.376 188.601 1.00 27.52  ? 163  LYS Q CA 1 
ATOM 6711 C CA . LYS P 13 164  ? 152.953 203.872 188.480 1.00 24.65  ? 164  LYS Q CA 1 
ATOM 6712 C CA . TYR P 13 165  ? 154.831 203.339 191.739 1.00 25.76  ? 165  TYR Q CA 1 
ATOM 6713 C CA . LEU P 13 166  ? 155.946 199.777 190.697 1.00 21.71  ? 166  LEU Q CA 1 
ATOM 6714 C CA . GLN P 13 167  ? 157.231 200.953 187.272 1.00 29.04  ? 167  GLN Q CA 1 
ATOM 6715 C CA . GLU P 13 168  ? 158.929 204.065 188.541 1.00 37.44  ? 168  GLU Q CA 1 
ATOM 6716 C CA . THR P 13 169  ? 160.728 202.201 191.404 1.00 31.50  ? 169  THR Q CA 1 
ATOM 6717 C CA . TYR P 13 170  ? 161.670 199.145 189.270 1.00 30.55  ? 170  TYR Q CA 1 
ATOM 6718 C CA . SER P 13 171  ? 163.685 201.739 187.349 1.00 53.91  ? 171  SER Q CA 1 
ATOM 6719 C CA . LYS P 13 172  ? 165.166 203.199 190.588 1.00 59.24  ? 172  LYS Q CA 1 
ATOM 6720 C CA . GLN P 13 173  ? 166.224 199.804 191.924 1.00 55.14  ? 173  GLN Q CA 1 
ATOM 6721 C CA . LYS Q 14 73   ? 223.726 241.303 195.240 1.00 276.47 ? 73   LYS R CA 1 
ATOM 6722 C CA . PRO Q 14 74   ? 222.531 241.790 191.598 1.00 312.02 ? 74   PRO R CA 1 
ATOM 6723 C CA . GLY Q 14 75   ? 219.677 241.801 190.748 1.00 235.04 ? 75   GLY R CA 1 
ATOM 6724 C CA . GLY Q 14 76   ? 216.700 239.484 191.471 1.00 250.45 ? 76   GLY R CA 1 
ATOM 6725 C CA . ASP Q 14 77   ? 214.412 241.466 189.129 1.00 228.84 ? 77   ASP R CA 1 
ATOM 6726 C CA . ARG Q 14 78   ? 210.756 240.665 187.884 1.00 167.44 ? 78   ARG R CA 1 
ATOM 6727 C CA . TYR Q 14 79   ? 209.710 238.869 184.679 1.00 150.14 ? 79   TYR R CA 1 
ATOM 6728 C CA . ILE Q 14 80   ? 212.894 236.497 184.691 1.00 127.35 ? 80   ILE R CA 1 
ATOM 6729 C CA . PRO Q 14 81   ? 213.128 234.078 187.674 1.00 154.48 ? 81   PRO R CA 1 
ATOM 6730 C CA . HIS Q 14 82   ? 216.487 233.310 189.209 1.00 173.23 ? 82   HIS R CA 1 
ATOM 6731 C CA . ARG Q 14 83   ? 218.317 230.034 188.297 1.00 223.89 ? 83   ARG R CA 1 
ATOM 6732 C CA . SER Q 14 84   ? 218.304 228.296 191.740 1.00 188.84 ? 84   SER R CA 1 
ATOM 6733 C CA . ALA Q 14 85   ? 218.274 224.539 190.971 1.00 191.12 ? 85   ALA R CA 1 
ATOM 6734 C CA . ALA Q 14 86   ? 216.485 223.797 194.258 1.00 249.06 ? 86   ALA R CA 1 
ATOM 6735 C CA . GLN Q 14 87   ? 213.239 225.716 193.513 1.00 195.36 ? 87   GLN R CA 1 
ATOM 6736 C CA . MET Q 14 88   ? 212.465 224.609 189.958 1.00 178.97 ? 88   MET R CA 1 
ATOM 6737 C CA . GLU Q 14 89   ? 212.717 220.960 190.910 1.00 297.03 ? 89   GLU R CA 1 
ATOM 6738 C CA . VAL Q 14 90   ? 210.523 221.509 193.933 1.00 318.46 ? 90   VAL R CA 1 
ATOM 6739 C CA . ALA Q 14 91   ? 207.884 223.223 191.791 1.00 127.92 ? 91   ALA R CA 1 
ATOM 6740 C CA . SER Q 14 92   ? 207.883 220.488 189.169 1.00 144.96 ? 92   SER R CA 1 
ATOM 6741 C CA . PHE Q 14 93   ? 207.428 217.836 191.812 1.00 340.42 ? 93   PHE R CA 1 
ATOM 6742 C CA . LEU Q 14 94   ? 204.530 219.758 193.286 1.00 396.31 ? 94   LEU R CA 1 
ATOM 6743 C CA . LEU Q 14 95   ? 202.767 220.118 189.928 1.00 413.03 ? 95   LEU R CA 1 
ATOM 6744 C CA . SER Q 14 96   ? 203.123 216.435 189.190 1.00 440.55 ? 96   SER R CA 1 
ATOM 6745 C CA . LYS Q 14 97   ? 201.762 215.466 192.599 1.00 488.21 ? 97   LYS R CA 1 
ATOM 6746 C CA . GLU Q 14 98   ? 198.986 217.913 191.884 1.00 500.00 ? 98   GLU R CA 1 
ATOM 6747 C CA . ASN Q 14 99   ? 197.456 216.537 188.613 1.00 500.00 ? 99   ASN R CA 1 
ATOM 6748 C CA . PRO Q 14 107  ? 191.290 215.312 206.040 1.00 239.48 ? 107  PRO R CA 1 
ATOM 6749 C CA . THR Q 14 108  ? 192.956 213.471 208.955 1.00 251.04 ? 108  THR R CA 1 
ATOM 6750 C CA . LYS Q 14 109  ? 194.261 211.289 206.068 1.00 230.61 ? 109  LYS R CA 1 
ATOM 6751 C CA . LYS Q 14 110  ? 195.484 214.598 204.577 1.00 202.31 ? 110  LYS R CA 1 
ATOM 6752 C CA . GLU Q 14 111  ? 197.275 215.414 207.906 1.00 243.67 ? 111  GLU R CA 1 
ATOM 6753 C CA . HIS Q 14 112  ? 199.102 212.052 207.894 1.00 248.56 ? 112  HIS R CA 1 
ATOM 6754 C CA . GLN Q 14 113  ? 200.301 213.043 204.369 1.00 206.97 ? 113  GLN R CA 1 
ATOM 6755 C CA . LYS Q 14 114  ? 201.389 216.569 205.361 1.00 262.92 ? 114  LYS R CA 1 
ATOM 6756 C CA . ALA Q 14 115  ? 202.953 215.375 208.553 1.00 144.25 ? 115  ALA R CA 1 
ATOM 6757 C CA . TRP Q 14 116  ? 205.266 213.234 206.420 1.00 200.41 ? 116  TRP R CA 1 
ATOM 6758 C CA . ALA Q 14 117  ? 205.496 215.735 203.508 1.00 359.65 ? 117  ALA R CA 1 
ATOM 6759 C CA . LEU Q 14 118  ? 206.586 218.611 205.813 1.00 254.08 ? 118  LEU R CA 1 
ATOM 6760 C CA . ASN Q 14 119  ? 208.771 216.019 207.680 1.00 402.63 ? 119  ASN R CA 1 
ATOM 6761 C CA . LEU Q 14 120  ? 210.674 214.653 204.632 1.00 394.11 ? 120  LEU R CA 1 
ATOM 6762 C CA . ASN Q 14 121  ? 211.462 217.971 202.962 1.00 385.28 ? 121  ASN R CA 1 
ATOM 6763 C CA . GLY Q 14 122  ? 211.462 221.004 205.294 1.00 222.91 ? 122  GLY R CA 1 
ATOM 6764 C CA . PHE Q 14 123  ? 209.872 223.031 202.482 1.00 241.52 ? 123  PHE R CA 1 
ATOM 6765 C CA . ASP Q 14 124  ? 206.154 222.503 203.019 1.00 221.28 ? 124  ASP R CA 1 
ATOM 6766 C CA . VAL Q 14 125  ? 206.011 222.147 199.220 1.00 288.88 ? 125  VAL R CA 1 
ATOM 6767 C CA . GLU Q 14 126  ? 202.352 223.229 199.074 1.00 307.56 ? 126  GLU R CA 1 
ATOM 6768 C CA . GLU Q 14 127  ? 203.737 226.547 200.425 1.00 208.14 ? 127  GLU R CA 1 
ATOM 6769 C CA . ALA Q 14 128  ? 205.178 227.259 196.909 1.00 253.99 ? 128  ALA R CA 1 
ATOM 6770 C CA . LYS Q 14 129  ? 205.846 229.083 194.399 1.00 159.93 ? 129  LYS R CA 1 
ATOM 6771 C CA . ILE Q 14 130  ? 206.410 227.410 190.997 1.00 145.42 ? 130  ILE R CA 1 
ATOM 6772 C CA . LEU Q 14 131  ? 208.218 230.423 189.741 1.00 177.68 ? 131  LEU R CA 1 
ATOM 6773 C CA . ARG Q 14 132  ? 209.674 232.147 192.727 1.00 180.55 ? 132  ARG R CA 1 
ATOM 6774 C CA . LEU Q 14 133  ? 209.909 235.947 192.501 1.00 191.16 ? 133  LEU R CA 1 
ATOM 6775 C CA . SER Q 14 134  ? 209.885 236.878 196.278 1.00 225.69 ? 134  SER R CA 1 
ATOM 6776 C CA . GLY Q 14 135  ? 211.496 235.944 199.723 1.00 214.28 ? 135  GLY R CA 1 
ATOM 6777 C CA . ILE Q 14 168  ? 188.698 210.100 226.221 1.00 444.05 ? 168  ILE R CA 1 
ATOM 6778 C CA . PRO Q 14 169  ? 188.182 206.318 225.508 1.00 437.92 ? 169  PRO R CA 1 
ATOM 6779 C CA . SER Q 14 170  ? 187.312 205.001 222.010 1.00 413.25 ? 170  SER R CA 1 
ATOM 6780 C CA . LEU Q 14 171  ? 185.277 202.021 223.363 1.00 301.17 ? 171  LEU R CA 1 
ATOM 6781 C CA . PRO Q 14 172  ? 182.145 202.628 225.524 1.00 283.17 ? 172  PRO R CA 1 
ATOM 6782 C CA . ASP Q 14 173  ? 182.083 202.538 229.348 1.00 313.15 ? 173  ASP R CA 1 
ATOM 6783 C CA . ARG Q 14 174  ? 178.919 200.458 228.935 1.00 305.54 ? 174  ARG R CA 1 
ATOM 6784 C CA . ILE Q 14 175  ? 176.347 199.264 226.405 1.00 325.99 ? 175  ILE R CA 1 
ATOM 6785 C CA . LEU Q 14 176  ? 172.825 199.229 227.889 1.00 374.74 ? 176  LEU R CA 1 
ATOM 6786 C CA . ASP Q 14 177  ? 169.800 197.390 226.448 1.00 435.11 ? 177  ASP R CA 1 
ATOM 6787 C CA . ALA Q 14 178  ? 167.117 199.649 224.995 1.00 481.04 ? 178  ALA R CA 1 
ATOM 6788 C CA . PRO Q 14 179  ? 164.651 196.966 223.817 1.00 460.10 ? 179  PRO R CA 1 
ATOM 6789 C CA . GLU Q 14 180  ? 161.202 198.028 222.471 1.00 449.62 ? 180  GLU R CA 1 
ATOM 6790 C CA . ILE Q 14 181  ? 162.591 201.552 221.643 1.00 500.00 ? 181  ILE R CA 1 
ATOM 6791 C CA . ARG Q 14 182  ? 160.440 203.552 219.185 1.00 482.88 ? 182  ARG R CA 1 
ATOM 6792 C CA . ASN Q 14 183  ? 162.388 204.370 216.006 1.00 500.00 ? 183  ASN R CA 1 
ATOM 6793 C CA . ASP Q 14 184  ? 161.021 207.880 215.433 1.00 500.00 ? 184  ASP R CA 1 
ATOM 6794 C CA . TYR Q 14 185  ? 163.473 210.726 214.627 1.00 500.00 ? 185  TYR R CA 1 
ATOM 6795 C CA . TYR Q 14 186  ? 161.265 213.450 216.186 1.00 500.00 ? 186  TYR R CA 1 
ATOM 6796 C CA . LEU Q 14 187  ? 160.907 211.964 219.723 1.00 453.45 ? 187  LEU R CA 1 
ATOM 6797 C CA . ASN Q 14 188  ? 163.071 212.731 222.779 1.00 441.47 ? 188  ASN R CA 1 
ATOM 6798 C CA . LEU Q 14 189  ? 163.342 209.378 224.576 1.00 449.16 ? 189  LEU R CA 1 
ATOM 6799 C CA . VAL Q 14 190  ? 166.270 209.723 227.067 1.00 392.32 ? 190  VAL R CA 1 
ATOM 6800 C CA . ASP Q 14 191  ? 167.165 212.060 229.955 1.00 366.81 ? 191  ASP R CA 1 
ATOM 6801 C CA . TRP Q 14 192  ? 169.822 211.767 232.663 1.00 291.79 ? 192  TRP R CA 1 
ATOM 6802 C CA . SER Q 14 193  ? 168.966 213.187 236.115 1.00 330.39 ? 193  SER R CA 1 
ATOM 6803 C CA . SER Q 14 194  ? 171.186 215.492 238.181 1.00 374.25 ? 194  SER R CA 1 
ATOM 6804 C CA . GLY Q 14 195  ? 170.839 212.654 240.751 1.00 414.47 ? 195  GLY R CA 1 
ATOM 6805 C CA . ASN Q 14 196  ? 172.583 210.151 238.401 1.00 402.63 ? 196  ASN R CA 1 
ATOM 6806 C CA . VAL Q 14 197  ? 169.506 208.172 237.249 1.00 396.23 ? 197  VAL R CA 1 
ATOM 6807 C CA . LEU Q 14 198  ? 168.886 207.514 233.546 1.00 404.46 ? 198  LEU R CA 1 
ATOM 6808 C CA . ALA Q 14 199  ? 165.250 207.616 232.387 1.00 478.53 ? 199  ALA R CA 1 
ATOM 6809 C CA . VAL Q 14 200  ? 164.713 205.662 229.152 1.00 500.00 ? 200  VAL R CA 1 
ATOM 6810 C CA . ALA Q 14 201  ? 161.352 205.614 227.347 1.00 500.00 ? 201  ALA R CA 1 
ATOM 6811 C CA . LEU Q 14 202  ? 160.729 202.237 225.699 1.00 462.85 ? 202  LEU R CA 1 
ATOM 6812 C CA . ASP Q 14 203  ? 157.417 202.157 223.779 1.00 455.30 ? 203  ASP R CA 1 
ATOM 6813 C CA . ASN Q 14 204  ? 154.707 202.166 226.518 1.00 500.00 ? 204  ASN R CA 1 
ATOM 6814 C CA . SER Q 14 205  ? 157.113 201.957 229.512 1.00 500.00 ? 205  SER R CA 1 
ATOM 6815 C CA . VAL Q 14 206  ? 159.695 204.134 231.311 1.00 500.00 ? 206  VAL R CA 1 
ATOM 6816 C CA . TYR Q 14 207  ? 162.767 202.367 232.720 1.00 493.72 ? 207  TYR R CA 1 
ATOM 6817 C CA . LEU Q 14 208  ? 165.078 203.922 235.301 1.00 438.65 ? 208  LEU R CA 1 
ATOM 6818 C CA . TRP Q 14 209  ? 168.737 202.938 235.484 1.00 364.62 ? 209  TRP R CA 1 
ATOM 6819 C CA . SER Q 14 210  ? 170.975 203.768 238.439 1.00 342.86 ? 210  SER R CA 1 
ATOM 6820 C CA . ALA Q 14 211  ? 174.474 204.570 237.096 1.00 350.96 ? 211  ALA R CA 1 
ATOM 6821 C CA . SER Q 14 212  ? 176.038 203.713 240.479 1.00 407.00 ? 212  SER R CA 1 
ATOM 6822 C CA . SER Q 14 213  ? 174.508 200.255 241.156 1.00 448.40 ? 213  SER R CA 1 
ATOM 6823 C CA . GLY Q 14 214  ? 173.412 199.096 237.673 1.00 409.55 ? 214  GLY R CA 1 
ATOM 6824 C CA . ASP Q 14 215  ? 169.872 198.430 238.945 1.00 454.87 ? 215  ASP R CA 1 
ATOM 6825 C CA . ILE Q 14 216  ? 166.909 198.724 236.554 1.00 433.14 ? 216  ILE R CA 1 
ATOM 6826 C CA . LEU Q 14 217  ? 163.438 199.853 237.718 1.00 435.41 ? 217  LEU R CA 1 
ATOM 6827 C CA . GLN Q 14 218  ? 160.170 200.108 235.759 1.00 500.00 ? 218  GLN R CA 1 
ATOM 6828 C CA . LEU Q 14 219  ? 158.531 203.392 236.844 1.00 500.00 ? 219  LEU R CA 1 
ATOM 6829 C CA . LEU Q 14 220  ? 155.393 203.215 234.658 1.00 493.55 ? 220  LEU R CA 1 
ATOM 6830 C CA . GLN Q 14 221  ? 153.496 201.230 232.021 1.00 497.49 ? 221  GLN R CA 1 
ATOM 6831 C CA . MET Q 14 222  ? 150.706 202.814 229.934 1.00 500.00 ? 222  MET R CA 1 
ATOM 6832 C CA . GLU Q 14 223  ? 147.264 201.208 230.338 1.00 500.00 ? 223  GLU R CA 1 
ATOM 6833 C CA . GLN Q 14 224  ? 145.786 201.996 226.883 1.00 500.00 ? 224  GLN R CA 1 
ATOM 6834 C CA . PRO Q 14 225  ? 146.784 199.562 224.059 1.00 500.00 ? 225  PRO R CA 1 
ATOM 6835 C CA . GLY Q 14 226  ? 148.584 201.076 221.037 1.00 500.00 ? 226  GLY R CA 1 
ATOM 6836 C CA . GLU Q 14 227  ? 149.565 204.199 223.017 1.00 500.00 ? 227  GLU R CA 1 
ATOM 6837 C CA . TYR Q 14 228  ? 153.220 205.189 223.556 1.00 500.00 ? 228  TYR R CA 1 
ATOM 6838 C CA . ILE Q 14 229  ? 155.517 207.585 225.462 1.00 500.00 ? 229  ILE R CA 1 
ATOM 6839 C CA . SER Q 14 230  ? 156.820 210.408 223.233 1.00 500.00 ? 230  SER R CA 1 
ATOM 6840 C CA . SER Q 14 231  ? 159.078 212.451 225.621 1.00 500.00 ? 231  SER R CA 1 
ATOM 6841 C CA . VAL Q 14 232  ? 160.880 212.302 228.999 1.00 500.00 ? 232  VAL R CA 1 
ATOM 6842 C CA . ALA Q 14 233  ? 162.492 215.072 231.121 1.00 494.97 ? 233  ALA R CA 1 
ATOM 6843 C CA . TRP Q 14 234  ? 163.805 215.190 234.709 1.00 493.10 ? 234  TRP R CA 1 
ATOM 6844 C CA . ILE Q 14 235  ? 163.175 218.218 236.948 1.00 500.00 ? 235  ILE R CA 1 
ATOM 6845 C CA . LYS Q 14 236  ? 166.278 220.338 237.842 1.00 500.00 ? 236  LYS R CA 1 
ATOM 6846 C CA . GLU Q 14 237  ? 166.726 218.670 241.279 1.00 500.00 ? 237  GLU R CA 1 
ATOM 6847 C CA . GLY Q 14 238  ? 166.079 215.178 239.796 1.00 500.00 ? 238  GLY R CA 1 
ATOM 6848 C CA . ASN Q 14 239  ? 163.302 213.838 242.075 1.00 500.00 ? 239  ASN R CA 1 
ATOM 6849 C CA . TYR Q 14 240  ? 160.425 214.159 239.541 1.00 500.00 ? 240  TYR R CA 1 
ATOM 6850 C CA . LEU Q 14 241  ? 160.094 212.925 235.938 1.00 500.00 ? 241  LEU R CA 1 
ATOM 6851 C CA . ALA Q 14 242  ? 157.938 214.556 233.245 1.00 500.00 ? 242  ALA R CA 1 
ATOM 6852 C CA . VAL Q 14 243  ? 156.421 212.142 230.702 1.00 500.00 ? 243  VAL R CA 1 
ATOM 6853 C CA . GLY Q 14 244  ? 154.765 213.162 227.409 1.00 500.00 ? 244  GLY R CA 1 
ATOM 6854 C CA . THR Q 14 245  ? 152.372 210.673 225.758 1.00 500.00 ? 245  THR R CA 1 
ATOM 6855 C CA . SER Q 14 246  ? 150.829 209.911 222.327 1.00 500.00 ? 246  SER R CA 1 
ATOM 6856 C CA . SER Q 14 247  ? 147.408 210.492 223.982 1.00 500.00 ? 247  SER R CA 1 
ATOM 6857 C CA . ALA Q 14 248  ? 148.414 214.207 224.374 1.00 500.00 ? 248  ALA R CA 1 
ATOM 6858 C CA . GLU Q 14 249  ? 149.073 214.003 228.155 1.00 500.00 ? 249  GLU R CA 1 
ATOM 6859 C CA . VAL Q 14 250  ? 151.863 215.617 230.187 1.00 500.00 ? 250  VAL R CA 1 
ATOM 6860 C CA . GLN Q 14 251  ? 152.374 213.482 233.331 1.00 500.00 ? 251  GLN R CA 1 
ATOM 6861 C CA . LEU Q 14 252  ? 154.646 214.156 236.333 1.00 500.00 ? 252  LEU R CA 1 
ATOM 6862 C CA . TRP Q 14 253  ? 155.971 211.193 238.361 1.00 500.00 ? 253  TRP R CA 1 
ATOM 6863 C CA . ASP Q 14 254  ? 157.443 211.127 241.880 1.00 500.00 ? 254  ASP R CA 1 
ATOM 6864 C CA . VAL Q 14 255  ? 160.253 208.514 241.701 1.00 500.00 ? 255  VAL R CA 1 
ATOM 6865 C CA . GLN Q 14 256  ? 160.820 208.398 245.512 1.00 500.00 ? 256  GLN R CA 1 
ATOM 6866 C CA . GLN Q 14 257  ? 157.288 207.085 246.263 1.00 500.00 ? 257  GLN R CA 1 
ATOM 6867 C CA . GLN Q 14 258  ? 156.917 205.582 242.715 1.00 500.00 ? 258  GLN R CA 1 
ATOM 6868 C CA . LYS Q 14 259  ? 153.574 207.310 241.911 1.00 500.00 ? 259  LYS R CA 1 
ATOM 6869 C CA . ARG Q 14 260  ? 151.997 209.807 239.470 1.00 500.00 ? 260  ARG R CA 1 
ATOM 6870 C CA . LEU Q 14 261  ? 151.357 213.229 241.044 1.00 500.00 ? 261  LEU R CA 1 
ATOM 6871 C CA . ARG Q 14 262  ? 149.665 215.039 238.108 1.00 500.00 ? 262  ARG R CA 1 
ATOM 6872 C CA . ASN Q 14 263  ? 148.019 214.278 234.735 1.00 500.00 ? 263  ASN R CA 1 
ATOM 6873 C CA . MET Q 14 264  ? 147.980 217.489 232.648 1.00 500.00 ? 264  MET R CA 1 
ATOM 6874 C CA . THR Q 14 265  ? 145.779 217.454 229.510 1.00 500.00 ? 265  THR R CA 1 
ATOM 6875 C CA . SER Q 14 266  ? 146.136 220.625 227.388 1.00 500.00 ? 266  SER R CA 1 
ATOM 6876 C CA . HIS Q 14 267  ? 147.499 219.388 224.012 1.00 500.00 ? 267  HIS R CA 1 
ATOM 6877 C CA . SER Q 14 268  ? 145.606 218.048 220.952 1.00 500.00 ? 268  SER R CA 1 
ATOM 6878 C CA . ALA Q 14 269  ? 148.424 215.826 219.561 1.00 500.00 ? 269  ALA R CA 1 
ATOM 6879 C CA . ARG Q 14 270  ? 151.454 213.761 220.763 1.00 500.00 ? 270  ARG R CA 1 
ATOM 6880 C CA . VAL Q 14 271  ? 153.936 215.534 223.079 1.00 500.00 ? 271  VAL R CA 1 
ATOM 6881 C CA . GLY Q 14 272  ? 157.370 214.928 221.490 1.00 500.00 ? 272  GLY R CA 1 
ATOM 6882 C CA . SER Q 14 273  ? 159.471 217.420 223.504 1.00 500.00 ? 273  SER R CA 1 
ATOM 6883 C CA . LEU Q 14 274  ? 159.786 218.574 227.147 1.00 500.00 ? 274  LEU R CA 1 
ATOM 6884 C CA . SER Q 14 275  ? 161.956 221.215 228.917 1.00 500.00 ? 275  SER R CA 1 
ATOM 6885 C CA . TRP Q 14 276  ? 162.089 222.403 232.560 1.00 500.00 ? 276  TRP R CA 1 
ATOM 6886 C CA . ASN Q 14 277  ? 162.684 225.921 233.930 1.00 500.00 ? 277  ASN R CA 1 
ATOM 6887 C CA . SER Q 14 278  ? 162.438 225.701 237.755 1.00 500.00 ? 278  SER R CA 1 
ATOM 6888 C CA . TYR Q 14 279  ? 158.688 225.156 238.458 1.00 500.00 ? 279  TYR R CA 1 
ATOM 6889 C CA . ILE Q 14 280  ? 157.728 225.837 234.793 1.00 500.00 ? 280  ILE R CA 1 
ATOM 6890 C CA . LEU Q 14 281  ? 157.483 222.823 232.444 1.00 500.00 ? 281  LEU R CA 1 
ATOM 6891 C CA . SER Q 14 282  ? 157.362 223.493 228.680 1.00 500.00 ? 282  SER R CA 1 
ATOM 6892 C CA . SER Q 14 283  ? 155.885 220.952 226.239 1.00 500.00 ? 283  SER R CA 1 
ATOM 6893 C CA . GLY Q 14 284  ? 156.058 220.763 222.413 1.00 500.00 ? 284  GLY R CA 1 
ATOM 6894 C CA . SER Q 14 285  ? 153.540 218.993 220.156 1.00 500.00 ? 285  SER R CA 1 
ATOM 6895 C CA . ARG Q 14 286  ? 153.054 217.479 216.648 1.00 500.00 ? 286  ARG R CA 1 
ATOM 6896 C CA . SER Q 14 287  ? 150.422 220.218 216.033 1.00 500.00 ? 287  SER R CA 1 
ATOM 6897 C CA . GLY Q 14 288  ? 153.273 222.780 216.287 1.00 500.00 ? 288  GLY R CA 1 
ATOM 6898 C CA . HIS Q 14 289  ? 152.074 224.359 219.553 1.00 500.00 ? 289  HIS R CA 1 
ATOM 6899 C CA . ILE Q 14 290  ? 154.144 224.876 222.730 1.00 500.00 ? 290  ILE R CA 1 
ATOM 6900 C CA . HIS Q 14 291  ? 152.481 224.993 226.192 1.00 500.00 ? 291  HIS R CA 1 
ATOM 6901 C CA . HIS Q 14 292  ? 153.835 226.335 229.515 1.00 500.00 ? 292  HIS R CA 1 
ATOM 6902 C CA . HIS Q 14 293  ? 152.800 224.395 232.663 1.00 500.00 ? 293  HIS R CA 1 
ATOM 6903 C CA . ASP Q 14 294  ? 152.946 225.833 236.207 1.00 500.00 ? 294  ASP R CA 1 
ATOM 6904 C CA . VAL Q 14 295  ? 153.103 222.574 238.235 1.00 500.00 ? 295  VAL R CA 1 
ATOM 6905 C CA . ARG Q 14 296  ? 152.451 224.313 241.613 1.00 500.00 ? 296  ARG R CA 1 
ATOM 6906 C CA . VAL Q 14 297  ? 148.931 225.602 240.782 1.00 500.00 ? 297  VAL R CA 1 
ATOM 6907 C CA . ALA Q 14 298  ? 145.513 223.988 240.082 1.00 500.00 ? 298  ALA R CA 1 
ATOM 6908 C CA . GLU Q 14 299  ? 145.208 225.474 236.563 1.00 500.00 ? 299  GLU R CA 1 
ATOM 6909 C CA . HIS Q 14 300  ? 148.542 224.323 235.078 1.00 500.00 ? 300  HIS R CA 1 
ATOM 6910 C CA . HIS Q 14 301  ? 148.257 225.725 231.524 1.00 500.00 ? 301  HIS R CA 1 
ATOM 6911 C CA . VAL Q 14 302  ? 149.444 229.361 231.672 1.00 500.00 ? 302  VAL R CA 1 
ATOM 6912 C CA . ALA Q 14 303  ? 150.659 230.028 228.084 1.00 500.00 ? 303  ALA R CA 1 
ATOM 6913 C CA . THR Q 14 304  ? 150.391 228.956 224.412 1.00 500.00 ? 304  THR R CA 1 
ATOM 6914 C CA . LEU Q 14 305  ? 153.306 229.568 221.999 1.00 500.00 ? 305  LEU R CA 1 
ATOM 6915 C CA . SER Q 14 306  ? 152.531 229.194 218.273 1.00 500.00 ? 306  SER R CA 1 
ATOM 6916 C CA . GLY Q 14 307  ? 155.549 229.522 215.949 1.00 500.00 ? 307  GLY R CA 1 
ATOM 6917 C CA . HIS Q 14 308  ? 155.768 226.171 214.114 1.00 500.00 ? 308  HIS R CA 1 
ATOM 6918 C CA . SER Q 14 309  ? 153.680 224.746 211.243 1.00 500.00 ? 309  SER R CA 1 
ATOM 6919 C CA . GLN Q 14 310  ? 154.944 221.157 211.770 1.00 500.00 ? 310  GLN R CA 1 
ATOM 6920 C CA . GLU Q 14 311  ? 156.106 218.976 214.736 1.00 500.00 ? 311  GLU R CA 1 
ATOM 6921 C CA . VAL Q 14 312  ? 158.182 220.614 217.505 1.00 500.00 ? 312  VAL R CA 1 
ATOM 6922 C CA . CYS Q 14 313  ? 161.049 218.079 217.857 1.00 500.00 ? 313  CYS R CA 1 
ATOM 6923 C CA . GLY Q 14 314  ? 163.468 220.347 219.764 1.00 500.00 ? 314  GLY R CA 1 
ATOM 6924 C CA . LEU Q 14 315  ? 162.677 222.307 222.945 1.00 500.00 ? 315  LEU R CA 1 
ATOM 6925 C CA . ARG Q 14 316  ? 165.307 223.676 225.362 1.00 500.00 ? 316  ARG R CA 1 
ATOM 6926 C CA . TRP Q 14 317  ? 165.372 226.345 228.085 1.00 500.00 ? 317  TRP R CA 1 
ATOM 6927 C CA . ALA Q 14 318  ? 168.614 228.300 228.585 1.00 500.00 ? 318  ALA R CA 1 
ATOM 6928 C CA . PRO Q 14 319  ? 170.404 227.634 231.973 1.00 500.00 ? 319  PRO R CA 1 
ATOM 6929 C CA . ASP Q 14 320  ? 169.626 231.198 233.194 1.00 500.00 ? 320  ASP R CA 1 
ATOM 6930 C CA . GLY Q 14 321  ? 165.958 230.788 232.130 1.00 500.00 ? 321  GLY R CA 1 
ATOM 6931 C CA . ARG Q 14 322  ? 166.048 233.957 229.986 1.00 500.00 ? 322  ARG R CA 1 
ATOM 6932 C CA . HIS Q 14 323  ? 165.336 232.189 226.659 1.00 500.00 ? 323  HIS R CA 1 
ATOM 6933 C CA . LEU Q 14 324  ? 163.462 229.124 225.397 1.00 500.00 ? 324  LEU R CA 1 
ATOM 6934 C CA . ALA Q 14 325  ? 164.624 227.695 222.064 1.00 500.00 ? 325  ALA R CA 1 
ATOM 6935 C CA . SER Q 14 326  ? 162.450 225.527 219.809 1.00 500.00 ? 326  SER R CA 1 
ATOM 6936 C CA . GLY Q 14 327  ? 163.173 223.517 216.657 1.00 500.00 ? 327  GLY R CA 1 
ATOM 6937 C CA . GLY Q 14 328  ? 160.705 222.082 214.149 1.00 500.00 ? 328  GLY R CA 1 
ATOM 6938 C CA . ASN Q 14 329  ? 160.153 219.697 211.235 1.00 500.00 ? 329  ASN R CA 1 
ATOM 6939 C CA . ASP Q 14 330  ? 159.307 222.905 209.287 1.00 500.00 ? 330  ASP R CA 1 
ATOM 6940 C CA . ASN Q 14 331  ? 163.087 223.734 209.071 1.00 500.00 ? 331  ASN R CA 1 
ATOM 6941 C CA . LEU Q 14 332  ? 162.715 226.562 211.625 1.00 500.00 ? 332  LEU R CA 1 
ATOM 6942 C CA . VAL Q 14 333  ? 164.516 227.647 214.823 1.00 500.00 ? 333  VAL R CA 1 
ATOM 6943 C CA . ASN Q 14 334  ? 162.592 229.952 217.202 1.00 500.00 ? 334  ASN R CA 1 
ATOM 6944 C CA . VAL Q 14 335  ? 163.921 231.762 220.290 1.00 500.00 ? 335  VAL R CA 1 
ATOM 6945 C CA . TRP Q 14 336  ? 161.153 232.703 222.774 1.00 500.00 ? 336  TRP R CA 1 
ATOM 6946 C CA . PRO Q 14 337  ? 161.106 235.115 225.772 1.00 500.00 ? 337  PRO R CA 1 
ATOM 6947 C CA . SER Q 14 338  ? 160.509 234.001 229.404 1.00 500.00 ? 338  SER R CA 1 
ATOM 6948 C CA . ALA Q 14 339  ? 157.566 236.441 229.733 1.00 500.00 ? 339  ALA R CA 1 
ATOM 6949 C CA . PRO Q 14 340  ? 155.273 237.747 226.911 1.00 500.00 ? 340  PRO R CA 1 
ATOM 6950 C CA . GLY Q 14 341  ? 156.423 240.858 224.994 1.00 500.00 ? 341  GLY R CA 1 
ATOM 6951 C CA . GLU Q 14 342  ? 153.210 242.960 225.301 1.00 500.00 ? 342  GLU R CA 1 
ATOM 6952 C CA . GLY Q 14 343  ? 151.728 241.708 221.975 1.00 500.00 ? 343  GLY R CA 1 
ATOM 6953 C CA . GLY Q 14 344  ? 151.299 238.034 222.905 1.00 500.00 ? 344  GLY R CA 1 
ATOM 6954 C CA . TRP Q 14 345  ? 153.798 235.177 222.649 1.00 500.00 ? 345  TRP R CA 1 
ATOM 6955 C CA . VAL Q 14 346  ? 156.020 236.193 219.703 1.00 500.00 ? 346  VAL R CA 1 
ATOM 6956 C CA . PRO Q 14 347  ? 159.547 234.804 218.932 1.00 500.00 ? 347  PRO R CA 1 
ATOM 6957 C CA . LEU Q 14 348  ? 162.440 237.201 219.680 1.00 500.00 ? 348  LEU R CA 1 
ATOM 6958 C CA . GLN Q 14 349  ? 164.479 235.338 217.024 1.00 500.00 ? 349  GLN R CA 1 
ATOM 6959 C CA . THR Q 14 350  ? 163.670 233.165 213.999 1.00 500.00 ? 350  THR R CA 1 
ATOM 6960 C CA . PHE Q 14 351  ? 166.452 231.317 212.112 1.00 500.00 ? 351  PHE R CA 1 
ATOM 6961 C CA . THR Q 14 352  ? 165.790 230.041 208.558 1.00 500.00 ? 352  THR R CA 1 
ATOM 6962 C CA . GLN Q 14 353  ? 169.379 228.970 207.647 1.00 500.00 ? 353  GLN R CA 1 
ATOM 6963 C CA . HIS Q 14 354  ? 168.733 225.249 208.332 1.00 500.00 ? 354  HIS R CA 1 
ATOM 6964 C CA . GLN Q 14 355  ? 167.587 223.280 205.254 1.00 500.00 ? 355  GLN R CA 1 
ATOM 6965 C CA . GLY Q 14 356  ? 166.257 220.352 207.349 1.00 500.00 ? 356  GLY R CA 1 
ATOM 6966 C CA . ALA Q 14 357  ? 164.465 219.351 210.573 1.00 500.00 ? 357  ALA R CA 1 
ATOM 6967 C CA . VAL Q 14 358  ? 166.006 220.953 213.690 1.00 500.00 ? 358  VAL R CA 1 
ATOM 6968 C CA . LYS Q 14 359  ? 165.866 218.431 216.535 1.00 449.17 ? 359  LYS R CA 1 
ATOM 6969 C CA . ALA Q 14 360  ? 169.262 219.401 217.991 1.00 416.38 ? 360  ALA R CA 1 
ATOM 6970 C CA . VAL Q 14 361  ? 169.083 222.401 220.376 1.00 393.94 ? 361  VAL R CA 1 
ATOM 6971 C CA . ALA Q 14 362  ? 171.615 223.160 223.188 1.00 459.63 ? 362  ALA R CA 1 
ATOM 6972 C CA . TRP Q 14 363  ? 172.744 226.238 225.156 1.00 399.32 ? 363  TRP R CA 1 
ATOM 6973 C CA . CYS Q 14 364  ? 176.287 227.191 226.235 1.00 500.00 ? 364  CYS R CA 1 
ATOM 6974 C CA . PRO Q 14 365  ? 176.601 226.982 230.092 1.00 500.00 ? 365  PRO R CA 1 
ATOM 6975 C CA . TRP Q 14 366  ? 179.399 229.622 230.300 1.00 454.22 ? 366  TRP R CA 1 
ATOM 6976 C CA . GLN Q 14 367  ? 178.137 232.162 227.692 1.00 330.82 ? 367  GLN R CA 1 
ATOM 6977 C CA . SER Q 14 368  ? 174.521 233.298 228.223 1.00 412.06 ? 368  SER R CA 1 
ATOM 6978 C CA . ASN Q 14 369  ? 173.553 234.215 224.622 1.00 423.63 ? 369  ASN R CA 1 
ATOM 6979 C CA . VAL Q 14 370  ? 175.365 231.380 222.761 1.00 457.76 ? 370  VAL R CA 1 
ATOM 6980 C CA . LEU Q 14 371  ? 173.094 228.650 221.270 1.00 392.66 ? 371  LEU R CA 1 
ATOM 6981 C CA . ALA Q 14 372  ? 174.015 225.485 219.306 1.00 380.50 ? 372  ALA R CA 1 
ATOM 6982 C CA . THR Q 14 373  ? 171.566 223.967 216.765 1.00 409.93 ? 373  THR R CA 1 
ATOM 6983 C CA . GLY Q 14 374  ? 171.639 221.116 214.217 1.00 363.04 ? 374  GLY R CA 1 
ATOM 6984 C CA . GLY Q 14 375  ? 169.698 220.192 211.055 1.00 322.05 ? 375  GLY R CA 1 
ATOM 6985 C CA . GLY Q 14 376  ? 168.609 216.756 209.774 1.00 356.70 ? 376  GLY R CA 1 
ATOM 6986 C CA . THR Q 14 377  ? 169.539 214.573 206.751 1.00 454.15 ? 377  THR R CA 1 
ATOM 6987 C CA . SER Q 14 378  ? 168.731 217.478 204.364 1.00 500.00 ? 378  SER R CA 1 
ATOM 6988 C CA . ASP Q 14 379  ? 170.926 219.993 206.288 1.00 500.00 ? 379  ASP R CA 1 
ATOM 6989 C CA . ARG Q 14 380  ? 173.823 218.198 208.154 1.00 433.38 ? 380  ARG R CA 1 
ATOM 6990 C CA . HIS Q 14 381  ? 175.140 221.443 209.742 1.00 393.53 ? 381  HIS R CA 1 
ATOM 6991 C CA . ILE Q 14 382  ? 176.059 222.426 213.310 1.00 402.35 ? 382  ILE R CA 1 
ATOM 6992 C CA . ARG Q 14 383  ? 175.499 226.144 213.861 1.00 355.29 ? 383  ARG R CA 1 
ATOM 6993 C CA . ILE Q 14 384  ? 176.474 228.533 216.693 1.00 339.11 ? 384  ILE R CA 1 
ATOM 6994 C CA . TRP Q 14 385  ? 174.165 231.558 217.329 1.00 345.51 ? 385  TRP R CA 1 
ATOM 6995 C CA . ASN Q 14 386  ? 174.097 234.854 219.186 1.00 331.05 ? 386  ASN R CA 1 
ATOM 6996 C CA . VAL Q 14 387  ? 170.459 235.114 220.334 1.00 405.78 ? 387  VAL R CA 1 
ATOM 6997 C CA A CYS Q 14 388  ? 170.154 238.631 221.852 0.50 500.00 ? 388  CYS R CA 1 
ATOM 6998 C CA B CYS Q 14 388  ? 170.068 238.623 221.872 0.50 482.21 ? 388  CYS R CA 1 
ATOM 6999 C CA . SER Q 14 389  ? 171.763 239.786 217.281 1.00 500.00 ? 389  SER R CA 1 
ATOM 7000 C CA . GLY Q 14 390  ? 170.512 236.870 215.157 1.00 442.86 ? 390  GLY R CA 1 
ATOM 7001 C CA . ALA Q 14 391  ? 174.031 236.560 213.725 1.00 375.66 ? 391  ALA R CA 1 
ATOM 7002 C CA . CYS Q 14 392  ? 175.713 233.180 213.176 1.00 379.21 ? 392  CYS R CA 1 
ATOM 7003 C CA . LEU Q 14 393  ? 179.124 232.954 214.949 1.00 348.43 ? 393  LEU R CA 1 
ATOM 7004 C CA . SER Q 14 394  ? 180.153 229.493 213.562 1.00 403.52 ? 394  SER R CA 1 
ATOM 7005 C CA . ALA Q 14 395  ? 178.981 226.790 211.113 1.00 360.02 ? 395  ALA R CA 1 
ATOM 7006 C CA . VAL Q 14 396  ? 180.444 223.339 210.334 1.00 380.17 ? 396  VAL R CA 1 
ATOM 7007 C CA . ASP Q 14 397  ? 179.546 220.430 208.017 1.00 408.87 ? 397  ASP R CA 1 
ATOM 7008 C CA . ALA Q 14 398  ? 178.776 217.263 210.018 1.00 453.49 ? 398  ALA R CA 1 
ATOM 7009 C CA . HIS Q 14 399  ? 178.338 215.077 206.856 1.00 473.17 ? 399  HIS R CA 1 
ATOM 7010 C CA . SER Q 14 400  ? 175.303 213.338 208.475 1.00 459.06 ? 400  SER R CA 1 
ATOM 7011 C CA . GLN Q 14 401  ? 171.972 214.145 210.208 1.00 429.24 ? 401  GLN R CA 1 
ATOM 7012 C CA . VAL Q 14 402  ? 172.376 215.982 213.529 1.00 381.90 ? 402  VAL R CA 1 
ATOM 7013 C CA . CYS Q 14 403  ? 169.944 214.450 216.037 1.00 410.16 ? 403  CYS R CA 1 
ATOM 7014 C CA . SER Q 14 404  ? 171.366 215.905 219.290 1.00 383.38 ? 404  SER R CA 1 
ATOM 7015 C CA . ILE Q 14 405  ? 173.952 218.344 220.759 1.00 392.20 ? 405  ILE R CA 1 
ATOM 7016 C CA . LEU Q 14 406  ? 175.532 218.737 224.236 1.00 351.59 ? 406  LEU R CA 1 
ATOM 7017 C CA . TRP Q 14 407  ? 178.080 221.159 225.707 1.00 317.98 ? 407  TRP R CA 1 
ATOM 7018 C CA . SER Q 14 408  ? 180.963 219.810 227.817 1.00 392.32 ? 408  SER R CA 1 
ATOM 7019 C CA . PRO Q 14 409  ? 182.463 222.220 230.412 1.00 458.42 ? 409  PRO R CA 1 
ATOM 7020 C CA . HIS Q 14 410  ? 185.135 219.581 231.140 1.00 409.05 ? 410  HIS R CA 1 
ATOM 7021 C CA . TYR Q 14 411  ? 187.317 220.465 228.112 1.00 346.57 ? 411  TYR R CA 1 
ATOM 7022 C CA . LYS Q 14 412  ? 185.262 223.448 226.726 1.00 408.77 ? 412  LYS R CA 1 
ATOM 7023 C CA . GLU Q 14 413  ? 183.891 221.332 223.880 1.00 436.29 ? 413  GLU R CA 1 
ATOM 7024 C CA . LEU Q 14 414  ? 180.762 220.257 221.978 1.00 388.18 ? 414  LEU R CA 1 
ATOM 7025 C CA . ILE Q 14 415  ? 179.415 216.728 221.337 1.00 359.73 ? 415  ILE R CA 1 
ATOM 7026 C CA . SER Q 14 416  ? 177.013 215.771 218.509 1.00 375.15 ? 416  SER R CA 1 
ATOM 7027 C CA . GLY Q 14 417  ? 175.181 212.537 217.531 1.00 461.81 ? 417  GLY R CA 1 
ATOM 7028 C CA . HIS Q 14 418  ? 174.655 211.251 213.976 1.00 488.95 ? 418  HIS R CA 1 
ATOM 7029 C CA . GLY Q 14 419  ? 172.960 208.734 211.633 1.00 486.69 ? 419  GLY R CA 1 
ATOM 7030 C CA . PHE Q 14 420  ? 173.488 207.497 208.036 1.00 479.76 ? 420  PHE R CA 1 
ATOM 7031 C CA . ALA Q 14 421  ? 175.830 205.898 207.346 1.00 425.27 ? 421  ALA R CA 1 
ATOM 7032 C CA . GLN Q 14 422  ? 178.509 206.110 210.105 1.00 427.34 ? 422  GLN R CA 1 
ATOM 7033 C CA . ASN Q 14 423  ? 176.181 206.353 213.184 1.00 391.56 ? 423  ASN R CA 1 
ATOM 7034 C CA . GLN Q 14 424  ? 179.026 208.124 215.025 1.00 379.84 ? 424  GLN R CA 1 
ATOM 7035 C CA . LEU Q 14 425  ? 179.504 210.743 217.749 1.00 384.51 ? 425  LEU R CA 1 
ATOM 7036 C CA . VAL Q 14 426  ? 181.891 213.714 217.254 1.00 404.22 ? 426  VAL R CA 1 
ATOM 7037 C CA . ILE Q 14 427  ? 183.634 215.973 219.799 1.00 431.15 ? 427  ILE R CA 1 
ATOM 7038 C CA . TRP Q 14 428  ? 184.392 219.532 218.556 1.00 476.81 ? 428  TRP R CA 1 
ATOM 7039 C CA . LYS Q 14 429  ? 186.741 222.080 220.220 1.00 395.48 ? 429  LYS R CA 1 
ATOM 7040 C CA . TYR Q 14 430  ? 185.408 225.558 221.112 1.00 387.83 ? 430  TYR R CA 1 
ATOM 7041 C CA . PRO Q 14 431  ? 185.883 227.912 219.448 1.00 400.23 ? 431  PRO R CA 1 
ATOM 7042 C CA . THR Q 14 432  ? 188.404 226.457 216.933 1.00 418.71 ? 432  THR R CA 1 
ATOM 7043 C CA . MET Q 14 433  ? 185.756 223.924 215.727 1.00 474.96 ? 433  MET R CA 1 
ATOM 7044 C CA . ALA Q 14 434  ? 188.537 221.379 215.104 1.00 412.63 ? 434  ALA R CA 1 
ATOM 7045 C CA . LYS Q 14 435  ? 187.529 217.734 215.681 1.00 436.20 ? 435  LYS R CA 1 
ATOM 7046 C CA . VAL Q 14 436  ? 188.895 216.226 218.906 1.00 424.03 ? 436  VAL R CA 1 
ATOM 7047 C CA . ALA Q 14 437  ? 187.283 212.756 219.005 1.00 400.49 ? 437  ALA R CA 1 
ATOM 7048 C CA . GLU Q 14 438  ? 185.103 210.516 216.849 1.00 419.88 ? 438  GLU R CA 1 
ATOM 7049 C CA . LEU Q 14 439  ? 183.273 207.814 218.809 1.00 398.11 ? 439  LEU R CA 1 
ATOM 7050 C CA . LYS Q 14 440  ? 182.158 204.749 216.839 1.00 366.36 ? 440  LYS R CA 1 
ATOM 7051 C CA . GLY Q 14 441  ? 180.197 201.723 218.063 1.00 371.06 ? 441  GLY R CA 1 
ATOM 7052 C CA . HIS Q 14 442  ? 176.574 202.291 217.038 1.00 323.13 ? 442  HIS R CA 1 
ATOM 7053 C CA . THR Q 14 443  ? 175.103 200.184 214.201 1.00 411.88 ? 443  THR R CA 1 
ATOM 7054 C CA . SER Q 14 444  ? 171.821 202.114 213.557 1.00 339.51 ? 444  SER R CA 1 
ATOM 7055 C CA . ARG Q 14 445  ? 170.956 205.860 213.493 1.00 388.99 ? 445  ARG R CA 1 
ATOM 7056 C CA . VAL Q 14 446  ? 171.504 207.758 216.776 1.00 437.67 ? 446  VAL R CA 1 
ATOM 7057 C CA . LEU Q 14 447  ? 168.305 209.307 218.201 1.00 444.97 ? 447  LEU R CA 1 
ATOM 7058 C CA . SER Q 14 448  ? 169.250 211.242 221.378 1.00 387.79 ? 448  SER R CA 1 
ATOM 7059 C CA . LEU Q 14 449  ? 172.221 212.329 223.510 1.00 327.53 ? 449  LEU R CA 1 
ATOM 7060 C CA . THR Q 14 450  ? 172.350 213.012 227.263 1.00 374.74 ? 450  THR R CA 1 
ATOM 7061 C CA A MET Q 14 451  ? 175.091 213.880 229.795 0.50 359.95 ? 451  MET R CA 1 
ATOM 7062 C CA B MET Q 14 451  ? 175.109 213.846 229.783 0.50 358.08 ? 451  MET R CA 1 
ATOM 7063 C CA . SER Q 14 452  ? 175.711 212.668 233.386 1.00 333.46 ? 452  SER R CA 1 
ATOM 7064 C CA . PRO Q 14 453  ? 175.361 215.163 236.346 1.00 333.82 ? 453  PRO R CA 1 
ATOM 7065 C CA . ASP Q 14 454  ? 179.145 215.260 236.830 1.00 342.51 ? 454  ASP R CA 1 
ATOM 7066 C CA . GLY Q 14 455  ? 179.513 215.515 233.027 1.00 278.10 ? 455  GLY R CA 1 
ATOM 7067 C CA . ALA Q 14 456  ? 181.957 212.563 232.917 1.00 255.05 ? 456  ALA R CA 1 
ATOM 7068 C CA . THR Q 14 457  ? 179.715 210.384 230.684 1.00 300.54 ? 457  THR R CA 1 
ATOM 7069 C CA . VAL Q 14 458  ? 177.823 211.156 227.437 1.00 295.91 ? 458  VAL R CA 1 
ATOM 7070 C CA . ALA Q 14 459  ? 175.096 208.565 226.764 1.00 299.07 ? 459  ALA R CA 1 
ATOM 7071 C CA . SER Q 14 460  ? 173.747 207.946 223.260 1.00 383.27 ? 460  SER R CA 1 
ATOM 7072 C CA . ALA Q 14 461  ? 170.419 206.254 222.417 1.00 406.78 ? 461  ALA R CA 1 
ATOM 7073 C CA . ALA Q 14 462  ? 170.030 204.639 218.985 1.00 365.43 ? 462  ALA R CA 1 
ATOM 7074 C CA . ALA Q 14 463  ? 167.697 202.640 216.687 1.00 407.17 ? 463  ALA R CA 1 
ATOM 7075 C CA . ASP Q 14 464  ? 169.964 199.569 217.239 1.00 390.18 ? 464  ASP R CA 1 
ATOM 7076 C CA . GLU Q 14 465  ? 168.154 199.226 220.622 1.00 410.62 ? 465  GLU R CA 1 
ATOM 7077 C CA . THR Q 14 466  ? 171.209 200.228 222.756 1.00 375.71 ? 466  THR R CA 1 
ATOM 7078 C CA . LEU Q 14 467  ? 172.519 203.130 224.903 1.00 332.62 ? 467  LEU R CA 1 
ATOM 7079 C CA . ARG Q 14 468  ? 176.331 203.588 224.825 1.00 226.68 ? 468  ARG R CA 1 
ATOM 7080 C CA . LEU Q 14 469  ? 178.177 205.450 227.556 1.00 238.08 ? 469  LEU R CA 1 
ATOM 7081 C CA . TRP Q 14 470  ? 181.103 207.665 226.450 1.00 311.26 ? 470  TRP R CA 1 
ATOM 7082 C CA . ARG Q 14 471  ? 183.340 208.856 229.336 1.00 390.03 ? 471  ARG R CA 1 
ATOM 7083 C CA . SER Q 14 492  ? 197.582 237.591 249.613 1.00 301.26 ? 492  SER R CA 1 
ATOM 7084 C CA . LEU Q 14 493  ? 194.953 237.600 252.401 1.00 275.73 ? 493  LEU R CA 1 
ATOM 7085 C CA . ILE Q 14 494  ? 192.075 235.059 252.851 1.00 280.68 ? 494  ILE R CA 1 
ATOM 7086 C CA . HIS Q 14 495  ? 194.734 232.357 252.975 1.00 335.88 ? 495  HIS R CA 1 
ATOM 7087 C CA . GLN Q 14 496  ? 197.531 234.094 254.889 1.00 257.46 ? 496  GLN R CA 1 
ATOM 7088 C CA . GLY Q 14 497  ? 199.634 233.384 257.955 1.00 236.82 ? 497  GLY R CA 1 
ATOM 7089 C CA . ILE Q 14 498  ? 200.546 230.664 260.469 1.00 229.98 ? 498  ILE R CA 1 
ATOM 7090 C CA . ARG Q 14 499  ? 201.208 228.190 257.619 1.00 224.18 ? 499  ARG R CA 1 
ATOM 7091 C CA . ARG R 15 24   ? 165.234 190.915 226.472 1.00 479.19 ? 828  ARG S CA 1 
ATOM 7092 C CA . ALA R 15 25   ? 165.831 192.623 229.831 1.00 481.51 ? 829  ALA S CA 1 
ATOM 7093 C CA . ALA R 15 26   ? 165.902 196.460 229.690 1.00 467.49 ? 830  ALA S CA 1 
ATOM 7094 C CA . LEU R 15 27   ? 169.442 197.829 230.301 1.00 408.79 ? 831  LEU S CA 1 
ATOM 7095 C CA . SER R 15 28   ? 171.013 194.438 231.220 1.00 419.39 ? 832  SER S CA 1 
ATOM 7096 C CA . ASP R 15 29   ? 174.799 194.687 230.708 1.00 429.97 ? 833  ASP S CA 1 
ATOM 7097 C CA . ILE R 15 30   ? 175.631 193.402 227.117 1.00 429.59 ? 834  ILE S CA 1 
ATOM 7098 C CA . THR R 15 31   ? 178.746 193.434 224.866 1.00 336.15 ? 835  THR S CA 1 
ATOM 7099 C CA . ASN R 15 32   ? 179.560 192.398 221.241 1.00 357.28 ? 836  ASN S CA 1 
ATOM 7100 C CA . SER R 15 33   ? 178.366 188.952 220.022 1.00 403.34 ? 837  SER S CA 1 
ATOM 7101 C CA . MET S 6  1    ? 237.447 229.218 232.038 1.00 217.05 ? 1    MET W CA 1 
ATOM 7102 C CA . LEU S 6  2    ? 235.729 225.890 232.252 1.00 218.47 ? 2    LEU W CA 1 
ATOM 7103 C CA . ARG S 6  3    ? 237.827 222.761 232.746 1.00 185.26 ? 3    ARG W CA 1 
ATOM 7104 C CA . ARG S 6  4    ? 236.578 219.238 232.228 1.00 212.75 ? 4    ARG W CA 1 
ATOM 7105 C CA . LYS S 6  5    ? 237.689 216.778 234.915 1.00 253.59 ? 5    LYS W CA 1 
ATOM 7106 C CA . PRO S 6  6    ? 240.800 214.934 233.760 1.00 197.53 ? 6    PRO W CA 1 
ATOM 7107 C CA . THR S 6  7    ? 240.264 211.864 231.603 1.00 206.63 ? 7    THR W CA 1 
ATOM 7108 C CA . ARG S 6  8    ? 240.859 208.463 233.106 1.00 210.11 ? 8    ARG W CA 1 
ATOM 7109 C CA . LEU S 6  9    ? 242.579 205.695 231.061 1.00 234.40 ? 9    LEU W CA 1 
ATOM 7110 C CA . GLU S 6  10   ? 240.782 202.351 231.240 1.00 239.73 ? 10   GLU W CA 1 
ATOM 7111 C CA . LEU S 6  11   ? 241.479 198.752 230.384 1.00 251.05 ? 11   LEU W CA 1 
ATOM 7112 C CA . LYS S 6  12   ? 240.655 197.528 226.905 1.00 256.56 ? 12   LYS W CA 1 
ATOM 7113 C CA . LEU S 6  13   ? 240.299 194.215 225.067 1.00 265.20 ? 13   LEU W CA 1 
ATOM 7114 C CA . ASP S 6  14   ? 243.547 195.191 223.298 1.00 309.42 ? 14   ASP W CA 1 
ATOM 7115 C CA . ASP S 6  15   ? 245.048 195.175 226.833 1.00 191.03 ? 15   ASP W CA 1 
ATOM 7116 C CA . ILE S 6  16   ? 243.814 191.512 227.170 1.00 238.38 ? 16   ILE W CA 1 
ATOM 7117 C CA . GLU S 6  17   ? 246.196 190.867 224.282 1.00 364.80 ? 17   GLU W CA 1 
ATOM 7118 C CA . GLU S 6  18   ? 249.059 191.632 226.666 1.00 393.65 ? 18   GLU W CA 1 
ATOM 7119 C CA . PHE S 6  19   ? 247.968 188.794 228.843 1.00 364.68 ? 19   PHE W CA 1 
ATOM 7120 C CA . GLU S 6  20   ? 247.925 186.316 225.951 1.00 395.50 ? 20   GLU W CA 1 
ATOM 7121 C CA . ASN S 6  21   ? 251.643 187.080 225.333 1.00 458.47 ? 21   ASN W CA 1 
ATOM 7122 C CA . ILE S 6  22   ? 252.637 186.013 228.829 1.00 457.97 ? 22   ILE W CA 1 
ATOM 7123 C CA . ARG S 6  23   ? 250.434 182.851 228.435 1.00 248.91 ? 23   ARG W CA 1 
ATOM 7124 C CA . LYS S 6  24   ? 252.737 181.760 225.567 1.00 213.76 ? 24   LYS W CA 1 
ATOM 7125 C CA . ASP S 6  25   ? 255.726 181.709 228.036 1.00 259.00 ? 25   ASP W CA 1 
ATOM 7126 C CA . ASN T 16 2    ? 235.709 175.674 306.154 1.00 233.81 ? 36   ASN X CA 1 
ATOM 7127 C CA . VAL T 16 3    ? 232.260 176.972 305.066 1.00 238.66 ? 37   VAL X CA 1 
ATOM 7128 C CA . ILE T 16 4    ? 232.421 174.713 301.980 1.00 242.56 ? 38   ILE X CA 1 
ATOM 7129 C CA . ASP T 16 5    ? 233.509 171.781 304.134 1.00 290.20 ? 39   ASP X CA 1 
ATOM 7130 C CA . HIS T 16 6    ? 230.353 172.348 306.156 1.00 259.49 ? 40   HIS X CA 1 
ATOM 7131 C CA . VAL T 16 7    ? 228.261 172.420 302.980 1.00 242.15 ? 41   VAL X CA 1 
ATOM 7132 C CA . ARG T 16 8    ? 229.883 169.099 301.897 1.00 219.60 ? 42   ARG X CA 1 
ATOM 7133 C CA . ASP T 16 9    ? 228.758 167.743 305.313 1.00 216.87 ? 43   ASP X CA 1 
ATOM 7134 C CA . MET T 16 10   ? 225.249 168.990 304.699 1.00 233.50 ? 44   MET X CA 1 
ATOM 7135 C CA . ALA T 16 11   ? 225.395 167.194 301.373 1.00 241.22 ? 45   ALA X CA 1 
ATOM 7136 C CA . ALA T 16 12   ? 226.418 163.996 303.215 1.00 196.42 ? 46   ALA X CA 1 
ATOM 7137 C CA . ALA T 16 13   ? 223.215 164.612 305.274 1.00 208.83 ? 47   ALA X CA 1 
ATOM 7138 C CA . GLY T 16 14   ? 221.441 164.782 301.930 1.00 374.36 ? 48   GLY X CA 1 
ATOM 7139 C CA . LEU T 16 15   ? 219.130 167.739 302.750 1.00 357.11 ? 49   LEU X CA 1 
ATOM 7140 C CA . HIS T 16 16   ? 218.740 169.253 299.337 1.00 205.70 ? 50   HIS X CA 1 
ATOM 7141 C CA . SER T 16 17   ? 216.449 172.131 300.238 1.00 314.34 ? 51   SER X CA 1 
ATOM 7142 C CA . ASN T 16 18   ? 218.982 173.313 302.834 1.00 366.46 ? 52   ASN X CA 1 
ATOM 7143 C CA . VAL T 16 19   ? 222.039 172.949 300.688 1.00 271.16 ? 53   VAL X CA 1 
ATOM 7144 C CA . ARG T 16 20   ? 220.304 174.807 297.885 1.00 227.25 ? 54   ARG X CA 1 
ATOM 7145 C CA . LEU T 16 21   ? 219.576 178.045 299.765 1.00 198.43 ? 55   LEU X CA 1 
ATOM 7146 C CA . LEU T 16 22   ? 223.018 178.069 301.351 1.00 188.25 ? 56   LEU X CA 1 
ATOM 7147 C CA . SER T 16 23   ? 224.840 177.248 298.096 1.00 264.18 ? 57   SER X CA 1 
ATOM 7148 C CA . SER T 16 24   ? 222.790 179.792 296.140 1.00 219.32 ? 58   SER X CA 1 
ATOM 7149 C CA . LEU T 16 25   ? 223.838 182.549 298.515 1.00 291.08 ? 59   LEU X CA 1 
ATOM 7150 C CA . LEU T 16 26   ? 227.389 181.216 298.500 1.00 157.00 ? 60   LEU X CA 1 
ATOM 7151 C CA . LEU T 16 27   ? 227.385 181.312 294.691 1.00 155.06 ? 61   LEU X CA 1 
ATOM 7152 C CA . THR T 16 28   ? 226.133 184.891 294.690 1.00 206.35 ? 62   THR X CA 1 
ATOM 7153 C CA . MET T 16 29   ? 228.894 185.769 297.148 1.00 281.48 ? 63   MET X CA 1 
ATOM 7154 C CA . SER T 16 30   ? 231.431 183.956 294.956 1.00 324.77 ? 64   SER X CA 1 
ATOM 7155 C CA . ASN T 16 31   ? 230.187 185.746 291.764 1.00 317.97 ? 65   ASN X CA 1 
ATOM 7156 C CA . ASN T 16 32   ? 230.262 189.135 293.442 1.00 202.13 ? 66   ASN X CA 1 
ATOM 7157 C CA . ASN T 16 33   ? 233.788 188.740 294.813 1.00 277.04 ? 67   ASN X CA 1 
ATOM 7158 C CA . PRO T 16 34   ? 236.083 186.660 292.662 1.00 179.67 ? 68   PRO X CA 1 
ATOM 7159 C CA . GLU T 16 35   ? 238.763 184.913 294.691 1.00 186.20 ? 69   GLU X CA 1 
ATOM 7160 C CA . LEU T 16 36   ? 236.528 184.764 297.727 1.00 155.91 ? 70   LEU X CA 1 
ATOM 7161 C CA . PHE T 16 37   ? 236.620 180.985 297.210 1.00 195.68 ? 71   PHE X CA 1 
ATOM 7162 C CA . SER T 16 38   ? 239.366 178.867 295.743 1.00 258.44 ? 72   SER X CA 1 
ATOM 7163 C CA . PRO T 16 39   ? 238.700 177.413 292.237 1.00 245.80 ? 73   PRO X CA 1 
ATOM 7164 C CA . PRO T 16 40   ? 238.556 173.893 293.682 1.00 225.60 ? 74   PRO X CA 1 
ATOM 7165 C CA . GLN T 16 41   ? 236.092 175.220 296.239 1.00 234.21 ? 75   GLN X CA 1 
ATOM 7166 C CA . LYS T 16 42   ? 233.918 176.812 293.570 1.00 217.31 ? 76   LYS X CA 1 
ATOM 7167 C CA . TYR T 16 43   ? 233.735 173.491 291.717 1.00 186.69 ? 77   TYR X CA 1 
ATOM 7168 C CA . GLN T 16 44   ? 232.609 171.762 294.888 1.00 190.71 ? 78   GLN X CA 1 
ATOM 7169 C CA . LEU T 16 45   ? 229.994 174.450 295.512 1.00 200.08 ? 79   LEU X CA 1 
ATOM 7170 C CA . LEU T 16 46   ? 228.598 174.113 292.002 1.00 178.83 ? 80   LEU X CA 1 
ATOM 7171 C CA . VAL T 16 47   ? 228.355 170.346 292.229 1.00 166.62 ? 81   VAL X CA 1 
ATOM 7172 C CA . TYR T 16 48   ? 226.553 170.475 295.585 1.00 187.57 ? 82   TYR X CA 1 
ATOM 7173 C CA . HIS T 16 49   ? 224.248 173.164 294.259 1.00 161.34 ? 83   HIS X CA 1 
ATOM 7174 C CA . ALA T 16 50   ? 223.488 171.218 291.087 1.00 220.48 ? 84   ALA X CA 1 
ATOM 7175 C CA . ASP T 16 51   ? 222.681 168.086 293.142 1.00 187.83 ? 85   ASP X CA 1 
ATOM 7176 C CA . SER T 16 52   ? 220.231 170.248 295.034 1.00 169.18 ? 86   SER X CA 1 
ATOM 7177 C CA . LEU T 16 53   ? 218.516 171.395 291.807 1.00 192.27 ? 87   LEU X CA 1 
ATOM 7178 C CA . PHE T 16 54   ? 218.316 167.826 290.505 1.00 189.29 ? 88   PHE X CA 1 
ATOM 7179 C CA . HIS T 16 55   ? 216.715 166.548 293.692 1.00 204.42 ? 89   HIS X CA 1 
ATOM 7180 C CA . ASP T 16 56   ? 214.260 169.481 293.464 1.00 246.96 ? 90   ASP X CA 1 
ATOM 7181 C CA . LYS T 16 57   ? 213.516 168.076 289.951 1.00 227.38 ? 91   LYS X CA 1 
ATOM 7182 C CA . GLU T 16 58   ? 214.345 171.349 288.127 1.00 253.63 ? 92   GLU X CA 1 
ATOM 7183 C CA . TYR T 16 59   ? 216.256 169.617 285.371 1.00 163.51 ? 93   TYR X CA 1 
ATOM 7184 C CA . ARG T 16 60   ? 216.962 172.473 282.955 1.00 162.51 ? 94   ARG X CA 1 
ATOM 7185 C CA . ASN T 16 61   ? 218.545 174.487 285.739 1.00 172.75 ? 95   ASN X CA 1 
ATOM 7186 C CA . ALA T 16 62   ? 220.499 171.487 286.967 1.00 154.59 ? 96   ALA X CA 1 
ATOM 7187 C CA . VAL T 16 63   ? 221.948 170.867 283.538 1.00 157.28 ? 97   VAL X CA 1 
ATOM 7188 C CA . SER T 16 64   ? 223.225 174.426 283.274 1.00 190.93 ? 98   SER X CA 1 
ATOM 7189 C CA . LYS T 16 65   ? 224.859 174.303 286.698 1.00 179.27 ? 99   LYS X CA 1 
ATOM 7190 C CA . TYR T 16 66   ? 226.456 170.958 285.952 1.00 160.85 ? 100  TYR X CA 1 
ATOM 7191 C CA . THR T 16 67   ? 227.900 172.259 282.645 1.00 189.25 ? 101  THR X CA 1 
ATOM 7192 C CA . MET T 16 68   ? 229.226 175.254 284.540 1.00 213.67 ? 102  MET X CA 1 
ATOM 7193 C CA . ALA T 16 69   ? 230.778 172.889 287.048 1.00 137.21 ? 103  ALA X CA 1 
ATOM 7194 C CA . LEU T 16 70   ? 232.512 170.882 284.319 1.00 122.90 ? 104  LEU X CA 1 
ATOM 7195 C CA . GLN T 16 71   ? 233.954 174.084 282.893 1.00 182.78 ? 105  GLN X CA 1 
ATOM 7196 C CA . GLN T 16 72   ? 235.420 174.823 286.306 1.00 169.03 ? 106  GLN X CA 1 
ATOM 7197 C CA . LYS T 16 73   ? 236.793 171.277 286.471 1.00 182.79 ? 107  LYS X CA 1 
ATOM 7198 C CA . LYS T 16 74   ? 238.750 171.914 283.273 1.00 228.94 ? 108  LYS X CA 1 
ATOM 7199 C CA . ALA T 16 75   ? 240.043 175.160 284.745 1.00 224.00 ? 109  ALA X CA 1 
ATOM 7200 C CA . LEU T 16 76   ? 241.440 172.935 287.556 1.00 172.71 ? 110  LEU X CA 1 
ATOM 7201 C CA . LEU T 16 98   ? 236.270 166.276 294.966 1.00 273.15 ? 132  LEU X CA 1 
ATOM 7202 C CA . PRO T 16 99   ? 233.224 164.932 293.110 1.00 241.33 ? 133  PRO X CA 1 
ATOM 7203 C CA . SER T 16 100  ? 234.453 162.872 290.178 1.00 267.63 ? 134  SER X CA 1 
ATOM 7204 C CA . GLU T 16 101  ? 234.042 164.433 286.763 1.00 203.81 ? 135  GLU X CA 1 
ATOM 7205 C CA . ILE T 16 102  ? 232.534 161.187 285.547 1.00 204.85 ? 136  ILE X CA 1 
ATOM 7206 C CA . GLU T 16 103  ? 229.917 161.197 288.314 1.00 208.04 ? 137  GLU X CA 1 
ATOM 7207 C CA . VAL T 16 104  ? 228.896 164.717 287.352 1.00 207.54 ? 138  VAL X CA 1 
ATOM 7208 C CA . LYS T 16 105  ? 228.626 163.909 283.623 1.00 212.88 ? 139  LYS X CA 1 
ATOM 7209 C CA . TYR T 16 106  ? 226.476 160.905 284.570 1.00 208.44 ? 140  TYR X CA 1 
ATOM 7210 C CA . LYS T 16 107  ? 224.193 163.181 286.537 1.00 162.76 ? 141  LYS X CA 1 
ATOM 7211 C CA . MET T 16 108  ? 223.843 165.476 283.563 1.00 171.41 ? 142  MET X CA 1 
ATOM 7212 C CA . ALA T 16 109  ? 222.907 162.549 281.459 1.00 182.61 ? 143  ALA X CA 1 
ATOM 7213 C CA . GLU T 16 110  ? 220.167 161.623 283.870 1.00 195.44 ? 144  GLU X CA 1 
ATOM 7214 C CA . CYS T 16 111  ? 218.717 165.131 283.652 1.00 181.95 ? 145  CYS X CA 1 
ATOM 7215 C CA . TYR T 16 112  ? 218.772 164.985 279.850 1.00 191.75 ? 146  TYR X CA 1 
ATOM 7216 C CA . THR T 16 113  ? 216.955 161.675 280.041 1.00 197.55 ? 147  THR X CA 1 
ATOM 7217 C CA . MET T 16 114  ? 214.183 163.072 282.251 1.00 205.98 ? 148  MET X CA 1 
ATOM 7218 C CA . LEU T 16 115  ? 213.955 165.954 279.798 1.00 202.78 ? 149  LEU X CA 1 
ATOM 7219 C CA . LYS T 16 116  ? 213.512 163.415 277.034 1.00 259.40 ? 150  LYS X CA 1 
ATOM 7220 C CA . GLN T 16 117  ? 216.358 164.738 274.873 1.00 218.18 ? 151  GLN X CA 1 
ATOM 7221 C CA . ASP T 16 118  ? 218.217 161.503 274.123 1.00 254.68 ? 152  ASP X CA 1 
ATOM 7222 C CA . LYS T 16 119  ? 220.892 162.830 271.783 1.00 203.53 ? 153  LYS X CA 1 
ATOM 7223 C CA . ASP T 16 120  ? 222.220 165.183 274.450 1.00 217.29 ? 154  ASP X CA 1 
ATOM 7224 C CA . ALA T 16 121  ? 222.665 162.380 276.986 1.00 204.62 ? 155  ALA X CA 1 
ATOM 7225 C CA . ILE T 16 122  ? 224.478 160.266 274.387 1.00 207.11 ? 156  ILE X CA 1 
ATOM 7226 C CA . ALA T 16 123  ? 226.818 163.118 273.562 1.00 214.69 ? 157  ALA X CA 1 
ATOM 7227 C CA . ILE T 16 124  ? 228.092 163.704 277.110 1.00 189.47 ? 158  ILE X CA 1 
ATOM 7228 C CA . LEU T 16 125  ? 228.707 160.009 277.735 1.00 182.48 ? 159  LEU X CA 1 
ATOM 7229 C CA . ASP T 16 126  ? 230.312 159.377 274.372 1.00 240.42 ? 160  ASP X CA 1 
ATOM 7230 C CA . GLY T 16 127  ? 232.792 162.077 275.234 1.00 316.64 ? 161  GLY X CA 1 
ATOM 7231 C CA . ILE T 16 128  ? 234.022 160.038 278.142 1.00 201.82 ? 162  ILE X CA 1 
ATOM 7232 C CA . PRO T 16 129  ? 236.692 157.426 277.388 1.00 246.37 ? 163  PRO X CA 1 
ATOM 7233 C CA . SER T 16 130  ? 235.460 153.804 277.557 1.00 257.26 ? 164  SER X CA 1 
ATOM 7234 C CA . ARG T 16 131  ? 238.093 152.853 280.148 1.00 253.56 ? 165  ARG X CA 1 
ATOM 7235 C CA . GLN T 16 132  ? 237.195 155.798 282.351 1.00 240.67 ? 166  GLN X CA 1 
ATOM 7236 C CA . ARG T 16 133  ? 233.488 154.979 282.068 1.00 251.02 ? 167  ARG X CA 1 
ATOM 7237 C CA . THR T 16 134  ? 231.931 152.981 284.907 1.00 237.89 ? 168  THR X CA 1 
ATOM 7238 C CA . PRO T 16 135  ? 229.512 150.076 284.629 1.00 226.33 ? 169  PRO X CA 1 
ATOM 7239 C CA . LYS T 16 136  ? 226.616 152.301 285.527 1.00 219.12 ? 170  LYS X CA 1 
ATOM 7240 C CA . ILE T 16 137  ? 227.488 154.819 282.826 1.00 195.12 ? 171  ILE X CA 1 
ATOM 7241 C CA . ASN T 16 138  ? 227.860 152.069 280.309 1.00 205.24 ? 172  ASN X CA 1 
ATOM 7242 C CA . MET T 16 139  ? 224.533 150.470 281.286 1.00 190.41 ? 173  MET X CA 1 
ATOM 7243 C CA . MET T 16 140  ? 222.634 153.695 280.896 1.00 220.61 ? 174  MET X CA 1 
ATOM 7244 C CA . LEU T 16 141  ? 224.502 154.328 277.682 1.00 170.40 ? 175  LEU X CA 1 
ATOM 7245 C CA . ALA T 16 142  ? 223.528 150.893 276.351 1.00 157.23 ? 176  ALA X CA 1 
ATOM 7246 C CA . ASN T 16 143  ? 219.882 151.663 277.073 1.00 181.06 ? 177  ASN X CA 1 
ATOM 7247 C CA . LEU T 16 144  ? 220.086 154.995 275.259 1.00 196.72 ? 178  LEU X CA 1 
ATOM 7248 C CA . TYR T 16 145  ? 221.575 153.413 272.192 1.00 152.26 ? 179  TYR X CA 1 
ATOM 7249 C CA . LYS T 16 146  ? 218.734 150.762 272.187 1.00 207.40 ? 180  LYS X CA 1 
ATOM 7250 C CA . LYS T 16 147  ? 216.183 153.530 272.269 1.00 191.13 ? 181  LYS X CA 1 
ATOM 7251 C CA . ALA T 16 148  ? 218.213 155.177 269.509 1.00 184.38 ? 182  ALA X CA 1 
ATOM 7252 C CA . GLY T 16 149  ? 218.085 151.915 267.530 1.00 318.29 ? 183  GLY X CA 1 
ATOM 7253 C CA . GLN T 16 150  ? 221.874 151.556 267.138 1.00 398.07 ? 184  GLN X CA 1 
ATOM 7254 C CA . GLU T 16 151  ? 222.417 147.835 267.880 1.00 417.83 ? 185  GLU X CA 1 
ATOM 7255 C CA . ARG T 16 152  ? 226.243 147.727 267.543 1.00 439.18 ? 186  ARG X CA 1 
ATOM 7256 C CA . PRO T 16 153  ? 226.859 150.545 270.093 1.00 384.01 ? 187  PRO X CA 1 
ATOM 7257 C CA . SER T 16 154  ? 224.339 148.837 272.475 1.00 315.33 ? 188  SER X CA 1 
ATOM 7258 C CA . VAL T 16 155  ? 226.163 145.452 272.141 1.00 213.51 ? 189  VAL X CA 1 
ATOM 7259 C CA . THR T 16 156  ? 229.634 146.811 272.984 1.00 155.55 ? 190  THR X CA 1 
ATOM 7260 C CA . SER T 16 157  ? 228.294 148.719 276.017 1.00 282.98 ? 191  SER X CA 1 
ATOM 7261 C CA . TYR T 16 158  ? 226.665 145.500 277.309 1.00 196.44 ? 192  TYR X CA 1 
ATOM 7262 C CA . LYS T 16 159  ? 229.926 143.641 276.730 1.00 219.58 ? 193  LYS X CA 1 
ATOM 7263 C CA . GLU T 16 160  ? 231.588 146.445 278.754 1.00 237.61 ? 194  GLU X CA 1 
ATOM 7264 C CA . VAL T 16 161  ? 229.117 146.138 281.668 1.00 187.34 ? 195  VAL X CA 1 
ATOM 7265 C CA . LEU T 16 162  ? 229.466 142.341 281.587 1.00 222.96 ? 196  LEU X CA 1 
ATOM 7266 C CA . ARG T 16 163  ? 233.282 142.476 281.763 1.00 191.62 ? 197  ARG X CA 1 
ATOM 7267 C CA . GLN T 16 164  ? 232.847 144.739 284.841 1.00 223.79 ? 198  GLN X CA 1 
ATOM 7268 C CA . CYS T 16 165  ? 229.866 142.994 286.504 1.00 226.04 ? 199  CYS X CA 1 
ATOM 7269 C CA . PRO T 16 166  ? 229.411 139.406 285.011 1.00 211.36 ? 200  PRO X CA 1 
ATOM 7270 C CA . LEU T 16 167  ? 226.107 138.223 286.626 1.00 213.48 ? 201  LEU X CA 1 
ATOM 7271 C CA . ALA T 16 168  ? 224.207 141.361 285.470 1.00 351.90 ? 202  ALA X CA 1 
ATOM 7272 C CA . LEU T 16 169  ? 221.006 139.779 284.316 1.00 175.02 ? 203  LEU X CA 1 
ATOM 7273 C CA . ASP T 16 170  ? 219.613 142.878 282.573 1.00 229.61 ? 204  ASP X CA 1 
ATOM 7274 C CA . ALA T 16 171  ? 222.833 143.302 280.638 1.00 261.51 ? 205  ALA X CA 1 
ATOM 7275 C CA . ILE T 16 172  ? 222.443 139.676 279.499 1.00 199.00 ? 206  ILE X CA 1 
ATOM 7276 C CA . LEU T 16 173  ? 218.713 140.309 278.935 1.00 185.50 ? 207  LEU X CA 1 
ATOM 7277 C CA . GLY T 16 174  ? 219.621 143.329 276.809 1.00 186.21 ? 208  GLY X CA 1 
ATOM 7278 C CA . LEU T 16 175  ? 222.124 141.332 274.752 1.00 202.90 ? 209  LEU X CA 1 
ATOM 7279 C CA . LEU T 16 176  ? 219.591 138.546 274.248 1.00 284.11 ? 210  LEU X CA 1 
ATOM 7280 C CA . SER T 16 177  ? 217.025 141.049 272.954 1.00 279.45 ? 211  SER X CA 1 
ATOM 7281 C CA . LEU T 16 178  ? 219.814 142.338 270.685 1.00 268.65 ? 212  LEU X CA 1 
ATOM 7282 C CA . SER T 16 179  ? 220.632 138.684 269.726 1.00 238.94 ? 213  SER X CA 1 
ATOM 7283 C CA . VAL T 16 180  ? 223.941 136.773 269.091 1.00 322.06 ? 214  VAL X CA 1 
ATOM 7284 C CA . LYS T 16 181  ? 222.712 134.592 271.973 1.00 302.42 ? 215  LYS X CA 1 
ATOM 7285 C CA . GLY T 16 182  ? 225.183 131.688 271.618 1.00 303.35 ? 216  GLY X CA 1 
ATOM 7286 C CA . ALA T 16 183  ? 228.094 134.101 272.110 1.00 241.45 ? 217  ALA X CA 1 
ATOM 7287 C CA . GLU T 16 184  ? 226.380 135.494 275.277 1.00 209.58 ? 218  GLU X CA 1 
ATOM 7288 C CA . VAL T 16 185  ? 225.805 131.951 276.605 1.00 222.72 ? 219  VAL X CA 1 
ATOM 7289 C CA . ALA T 16 186  ? 229.533 131.163 276.081 1.00 381.16 ? 220  ALA X CA 1 
ATOM 7290 C CA . SER T 16 187  ? 230.904 134.199 278.012 1.00 500.00 ? 221  SER X CA 1 
ATOM 7291 C CA . MET T 16 188  ? 228.393 133.690 280.820 1.00 500.00 ? 222  MET X CA 1 
ATOM 7292 C CA . THR T 16 189  ? 229.220 129.952 281.211 1.00 500.00 ? 223  THR X CA 1 
ATOM 7293 C CA . MET T 16 190  ? 232.888 130.799 282.052 1.00 429.01 ? 224  MET X CA 1 
ATOM 7294 C CA . ASN T 16 191  ? 231.561 133.254 284.645 1.00 242.86 ? 225  ASN X CA 1 
ATOM 7295 C CA . VAL T 16 192  ? 229.108 130.567 285.994 1.00 270.32 ? 226  VAL X CA 1 
ATOM 7296 C CA . ILE T 16 193  ? 231.988 128.151 286.856 1.00 325.58 ? 227  ILE X CA 1 
ATOM 7297 C CA . GLN T 16 194  ? 233.469 131.101 288.783 1.00 339.70 ? 228  GLN X CA 1 
ATOM 7298 C CA . THR T 16 195  ? 229.932 131.891 290.089 1.00 354.94 ? 229  THR X CA 1 
ATOM 7299 C CA . VAL T 16 196  ? 228.628 130.347 293.369 1.00 295.81 ? 230  VAL X CA 1 
ATOM 7300 C CA . PRO T 16 197  ? 226.484 127.113 293.456 1.00 335.01 ? 231  PRO X CA 1 
ATOM 7301 C CA . ASN T 16 198  ? 223.392 129.274 294.219 1.00 279.64 ? 232  ASN X CA 1 
ATOM 7302 C CA . LEU T 16 199  ? 223.227 130.235 290.517 1.00 308.16 ? 233  LEU X CA 1 
ATOM 7303 C CA . ASP T 16 200  ? 222.897 126.647 289.168 1.00 387.49 ? 234  ASP X CA 1 
ATOM 7304 C CA . TRP T 16 201  ? 219.947 127.660 286.960 1.00 378.07 ? 235  TRP X CA 1 
ATOM 7305 C CA . LEU T 16 202  ? 221.830 130.363 285.016 1.00 326.68 ? 236  LEU X CA 1 
ATOM 7306 C CA . SER T 16 203  ? 222.644 128.285 281.906 1.00 325.28 ? 237  SER X CA 1 
ATOM 7307 C CA . VAL T 16 204  ? 219.018 127.270 281.143 1.00 311.64 ? 238  VAL X CA 1 
ATOM 7308 C CA . TRP T 16 205  ? 217.770 130.822 281.926 1.00 271.61 ? 239  TRP X CA 1 
ATOM 7309 C CA . ILE T 16 206  ? 220.009 132.307 279.193 1.00 243.73 ? 240  ILE X CA 1 
ATOM 7310 C CA . LYS T 16 207  ? 218.970 129.610 276.679 1.00 244.48 ? 241  LYS X CA 1 
ATOM 7311 C CA . ALA T 16 208  ? 215.280 130.258 277.513 1.00 270.69 ? 242  ALA X CA 1 
ATOM 7312 C CA . TYR T 16 209  ? 215.398 134.015 276.903 1.00 233.39 ? 243  TYR X CA 1 
ATOM 7313 C CA . ALA T 16 210  ? 217.641 133.528 273.860 1.00 236.33 ? 244  ALA X CA 1 
ATOM 7314 C CA . PHE T 16 211  ? 214.802 131.519 272.327 1.00 277.70 ? 245  PHE X CA 1 
ATOM 7315 C CA . VAL T 16 212  ? 212.325 134.209 273.532 1.00 246.71 ? 246  VAL X CA 1 
ATOM 7316 C CA . HIS T 16 213  ? 214.124 136.711 271.285 1.00 263.69 ? 247  HIS X CA 1 
ATOM 7317 C CA . THR T 16 214  ? 214.725 134.207 268.442 1.00 289.28 ? 248  THR X CA 1 
ATOM 7318 C CA . GLY T 16 215  ? 210.994 134.706 267.807 1.00 369.95 ? 249  GLY X CA 1 
ATOM 7319 C CA . ASP T 16 216  ? 210.213 130.987 267.929 1.00 344.93 ? 250  ASP X CA 1 
ATOM 7320 C CA . ASN T 16 217  ? 207.516 130.859 270.615 1.00 398.60 ? 251  ASN X CA 1 
ATOM 7321 C CA . SER T 16 218  ? 207.451 127.031 270.632 1.00 352.20 ? 252  SER X CA 1 
ATOM 7322 C CA . ARG T 16 219  ? 211.090 126.470 271.612 1.00 295.03 ? 253  ARG X CA 1 
ATOM 7323 C CA . ALA T 16 220  ? 211.029 129.282 274.225 1.00 296.89 ? 254  ALA X CA 1 
ATOM 7324 C CA . ILE T 16 221  ? 207.712 128.385 275.926 1.00 287.11 ? 255  ILE X CA 1 
ATOM 7325 C CA . SER T 16 222  ? 208.730 124.742 276.559 1.00 267.81 ? 256  SER X CA 1 
ATOM 7326 C CA . THR T 16 223  ? 212.136 125.535 278.093 1.00 220.96 ? 257  THR X CA 1 
ATOM 7327 C CA . ILE T 16 224  ? 210.598 128.330 280.264 1.00 311.37 ? 258  ILE X CA 1 
ATOM 7328 C CA . CYS T 16 225  ? 208.101 125.696 281.467 1.00 289.35 ? 259  CYS X CA 1 
ATOM 7329 C CA . SER T 16 226  ? 211.136 123.531 282.392 1.00 272.64 ? 260  SER X CA 1 
ATOM 7330 C CA . LEU T 16 227  ? 212.215 126.367 284.773 1.00 274.54 ? 261  LEU X CA 1 
ATOM 7331 C CA . GLU T 16 228  ? 208.690 126.322 286.305 1.00 235.40 ? 262  GLU X CA 1 
ATOM 7332 C CA . LYS T 16 229  ? 209.264 122.568 286.970 1.00 307.46 ? 263  LYS X CA 1 
ATOM 7333 C CA . LYS T 16 230  ? 212.353 123.441 289.089 1.00 434.92 ? 264  LYS X CA 1 
ATOM 7334 C CA . SER T 16 231  ? 211.432 123.492 292.787 1.00 498.56 ? 265  SER X CA 1 
ATOM 7335 C CA . LEU T 16 232  ? 213.535 126.651 293.348 1.00 334.64 ? 266  LEU X CA 1 
ATOM 7336 C CA . LEU T 16 233  ? 212.398 128.473 290.221 1.00 303.49 ? 267  LEU X CA 1 
ATOM 7337 C CA . ARG T 16 234  ? 208.729 127.365 290.346 1.00 350.30 ? 268  ARG X CA 1 
ATOM 7338 C CA . ASP T 16 235  ? 206.897 130.631 290.935 1.00 245.37 ? 269  ASP X CA 1 
ATOM 7339 C CA . ASN T 16 236  ? 208.603 133.729 289.645 1.00 260.16 ? 270  ASN X CA 1 
ATOM 7340 C CA . VAL T 16 237  ? 206.498 136.825 289.404 1.00 234.07 ? 271  VAL X CA 1 
ATOM 7341 C CA . ASP T 16 238  ? 208.829 137.813 286.514 1.00 360.72 ? 272  ASP X CA 1 
ATOM 7342 C CA . LEU T 16 239  ? 209.259 134.387 284.876 1.00 254.84 ? 273  LEU X CA 1 
ATOM 7343 C CA . LEU T 16 240  ? 205.481 133.815 284.785 1.00 260.76 ? 274  LEU X CA 1 
ATOM 7344 C CA . GLY T 16 241  ? 205.210 137.338 283.299 1.00 193.76 ? 275  GLY X CA 1 
ATOM 7345 C CA . SER T 16 242  ? 207.809 136.249 280.641 1.00 272.45 ? 276  SER X CA 1 
ATOM 7346 C CA . LEU T 16 243  ? 205.855 133.079 279.942 1.00 301.46 ? 277  LEU X CA 1 
ATOM 7347 C CA . ALA T 16 244  ? 202.599 135.100 279.679 1.00 120.94 ? 278  ALA X CA 1 
ATOM 7348 C CA . ASP T 16 245  ? 204.182 137.245 276.942 1.00 265.98 ? 279  ASP X CA 1 
ATOM 7349 C CA . LEU T 16 246  ? 205.157 134.140 274.862 1.00 283.42 ? 280  LEU X CA 1 
ATOM 7350 C CA . TYR T 16 247  ? 201.682 132.630 275.046 1.00 343.83 ? 281  TYR X CA 1 
ATOM 7351 C CA . PHE T 16 248  ? 200.167 135.970 273.913 1.00 254.21 ? 282  PHE X CA 1 
ATOM 7352 C CA . ARG T 16 249  ? 202.555 135.978 270.944 1.00 295.09 ? 283  ARG X CA 1 
ATOM 7353 C CA . ALA T 16 250  ? 202.123 132.259 270.109 1.00 303.86 ? 284  ALA X CA 1 
ATOM 7354 C CA . GLY T 16 251  ? 198.380 132.904 269.785 1.00 276.65 ? 285  GLY X CA 1 
ATOM 7355 C CA . ASP T 16 252  ? 197.559 130.286 272.418 1.00 433.93 ? 286  ASP X CA 1 
ATOM 7356 C CA . ASN T 16 253  ? 195.037 132.786 273.741 1.00 500.00 ? 287  ASN X CA 1 
ATOM 7357 C CA . LYS T 16 254  ? 193.172 130.852 276.469 1.00 460.11 ? 288  LYS X CA 1 
ATOM 7358 C CA . ASN T 16 255  ? 196.357 129.395 278.053 1.00 328.04 ? 289  ASN X CA 1 
ATOM 7359 C CA . SER T 16 256  ? 197.944 132.870 278.222 1.00 443.60 ? 290  SER X CA 1 
ATOM 7360 C CA . VAL T 16 257  ? 195.241 134.266 280.534 1.00 500.00 ? 291  VAL X CA 1 
ATOM 7361 C CA . LEU T 16 258  ? 195.401 131.202 282.840 1.00 500.00 ? 292  LEU X CA 1 
ATOM 7362 C CA . LYS T 16 259  ? 199.164 131.601 283.463 1.00 500.00 ? 293  LYS X CA 1 
ATOM 7363 C CA . PHE T 16 260  ? 198.842 135.390 283.553 1.00 422.24 ? 294  PHE X CA 1 
ATOM 7364 C CA . GLU T 16 261  ? 195.919 135.268 286.039 1.00 500.00 ? 295  GLU X CA 1 
ATOM 7365 C CA . GLN T 16 262  ? 198.368 133.224 288.170 1.00 500.00 ? 296  GLN X CA 1 
ATOM 7366 C CA . ALA T 16 263  ? 201.090 135.899 287.819 1.00 500.00 ? 297  ALA X CA 1 
ATOM 7367 C CA . GLN T 16 264  ? 198.749 138.672 289.016 1.00 465.12 ? 298  GLN X CA 1 
ATOM 7368 C CA . MET T 16 265  ? 197.449 136.361 291.780 1.00 500.00 ? 299  MET X CA 1 
ATOM 7369 C CA . LEU T 16 266  ? 201.036 136.025 293.045 1.00 500.00 ? 300  LEU X CA 1 
ATOM 7370 C CA . ASP T 16 267  ? 201.757 139.770 293.274 1.00 500.00 ? 301  ASP X CA 1 
ATOM 7371 C CA . PRO T 16 268  ? 199.118 142.561 293.544 1.00 500.00 ? 302  PRO X CA 1 
ATOM 7372 C CA . TYR T 16 269  ? 201.284 145.008 291.485 1.00 500.00 ? 303  TYR X CA 1 
ATOM 7373 C CA . LEU T 16 270  ? 202.518 143.818 288.078 1.00 500.00 ? 304  LEU X CA 1 
ATOM 7374 C CA . ILE T 16 271  ? 203.258 146.728 285.725 1.00 500.00 ? 305  ILE X CA 1 
ATOM 7375 C CA . LYS T 16 272  ? 205.352 144.292 283.555 1.00 305.33 ? 306  LYS X CA 1 
ATOM 7376 C CA . GLY T 16 273  ? 202.656 141.859 282.475 1.00 244.69 ? 307  GLY X CA 1 
ATOM 7377 C CA . MET T 16 274  ? 199.633 144.158 282.305 1.00 371.84 ? 308  MET X CA 1 
ATOM 7378 C CA . ASP T 16 275  ? 200.609 145.674 278.931 1.00 500.00 ? 309  ASP X CA 1 
ATOM 7379 C CA . VAL T 16 276  ? 200.088 142.325 277.186 1.00 500.00 ? 310  VAL X CA 1 
ATOM 7380 C CA . TYR T 16 277  ? 197.165 141.216 279.403 1.00 500.00 ? 311  TYR X CA 1 
ATOM 7381 C CA . GLY T 16 278  ? 194.792 144.153 278.800 1.00 500.00 ? 312  GLY X CA 1 
ATOM 7382 C CA . TYR T 16 279  ? 194.761 143.230 275.093 1.00 500.00 ? 313  TYR X CA 1 
ATOM 7383 C CA . LEU T 16 280  ? 194.062 139.563 275.975 1.00 500.00 ? 314  LEU X CA 1 
ATOM 7384 C CA . LEU T 16 281  ? 190.791 140.441 277.751 1.00 500.00 ? 315  LEU X CA 1 
ATOM 7385 C CA . ALA T 16 282  ? 189.637 142.430 274.654 1.00 500.00 ? 316  ALA X CA 1 
ATOM 7386 C CA . ARG T 16 283  ? 190.262 139.443 272.339 1.00 500.00 ? 317  ARG X CA 1 
ATOM 7387 C CA . GLU T 16 284  ? 188.456 137.381 275.041 1.00 500.00 ? 318  GLU X CA 1 
ATOM 7388 C CA . GLY T 16 285  ? 185.607 139.960 274.911 1.00 500.00 ? 319  GLY X CA 1 
ATOM 7389 C CA . ARG T 16 286  ? 185.583 140.886 278.618 1.00 500.00 ? 320  ARG X CA 1 
ATOM 7390 C CA . LEU T 16 287  ? 185.355 144.695 278.735 1.00 500.00 ? 321  LEU X CA 1 
ATOM 7391 C CA . GLU T 16 288  ? 184.482 144.846 282.470 1.00 500.00 ? 322  GLU X CA 1 
ATOM 7392 C CA . ASP T 16 289  ? 187.815 143.166 283.378 1.00 500.00 ? 323  ASP X CA 1 
ATOM 7393 C CA . VAL T 16 290  ? 189.698 145.860 281.408 1.00 500.00 ? 324  VAL X CA 1 
ATOM 7394 C CA . GLU T 16 291  ? 187.951 148.754 283.217 1.00 500.00 ? 325  GLU X CA 1 
ATOM 7395 C CA . ASN T 16 292  ? 188.697 147.178 286.608 1.00 500.00 ? 326  ASN X CA 1 
ATOM 7396 C CA . LEU T 16 293  ? 192.316 146.442 285.554 1.00 500.00 ? 327  LEU X CA 1 
ATOM 7397 C CA . GLY T 16 294  ? 192.547 150.118 284.484 1.00 500.00 ? 328  GLY X CA 1 
ATOM 7398 C CA . CYS T 16 295  ? 191.370 151.312 287.928 1.00 500.00 ? 329  CYS X CA 1 
ATOM 7399 C CA . ARG T 16 296  ? 193.833 148.927 289.672 1.00 500.00 ? 330  ARG X CA 1 
ATOM 7400 C CA . LEU T 16 297  ? 196.761 150.176 287.551 1.00 500.00 ? 331  LEU X CA 1 
ATOM 7401 C CA . PHE T 16 298  ? 196.253 153.934 288.073 1.00 355.87 ? 332  PHE X CA 1 
ATOM 7402 C CA . ASN T 16 299  ? 195.773 153.453 291.831 1.00 339.62 ? 333  ASN X CA 1 
ATOM 7403 C CA . ILE T 16 300  ? 198.910 151.339 292.239 1.00 368.84 ? 334  ILE X CA 1 
ATOM 7404 C CA . SER T 16 301  ? 201.085 153.850 290.348 1.00 322.97 ? 335  SER X CA 1 
ATOM 7405 C CA . ASP T 16 302  ? 201.293 156.681 287.917 1.00 236.84 ? 336  ASP X CA 1 
ATOM 7406 C CA . GLN T 16 303  ? 204.217 157.513 285.582 1.00 329.26 ? 337  GLN X CA 1 
ATOM 7407 C CA . HIS T 16 304  ? 204.060 154.082 283.830 1.00 261.21 ? 338  HIS X CA 1 
ATOM 7408 C CA . ALA T 16 305  ? 203.080 153.338 280.254 1.00 495.12 ? 339  ALA X CA 1 
ATOM 7409 C CA . GLU T 16 306  ? 200.975 150.283 281.108 1.00 500.00 ? 340  GLU X CA 1 
ATOM 7410 C CA . PRO T 16 307  ? 198.089 151.980 283.068 1.00 500.00 ? 341  PRO X CA 1 
ATOM 7411 C CA . TRP T 16 308  ? 197.662 154.365 280.089 1.00 500.00 ? 342  TRP X CA 1 
ATOM 7412 C CA . VAL T 16 309  ? 197.943 151.448 277.574 1.00 498.98 ? 343  VAL X CA 1 
ATOM 7413 C CA . VAL T 16 310  ? 195.180 149.376 279.284 1.00 500.00 ? 344  VAL X CA 1 
ATOM 7414 C CA . SER T 16 311  ? 192.732 152.347 279.141 1.00 500.00 ? 345  SER X CA 1 
ATOM 7415 C CA . GLY T 16 312  ? 193.658 152.672 275.441 1.00 500.00 ? 346  GLY X CA 1 
ATOM 7416 C CA . CYS T 16 313  ? 192.979 148.906 275.016 1.00 500.00 ? 347  CYS X CA 1 
ATOM 7417 C CA . HIS T 16 314  ? 189.470 149.447 276.442 1.00 500.00 ? 348  HIS X CA 1 
ATOM 7418 C CA . SER T 16 315  ? 188.812 152.344 274.064 1.00 500.00 ? 349  SER X CA 1 
ATOM 7419 C CA . PHE T 16 316  ? 188.815 150.554 270.629 1.00 500.00 ? 350  PHE X CA 1 
ATOM 7420 C CA . TYR T 16 317  ? 186.187 148.118 271.876 1.00 500.00 ? 351  TYR X CA 1 
ATOM 7421 C CA . SER T 16 318  ? 184.204 150.859 273.678 1.00 500.00 ? 352  SER X CA 1 
ATOM 7422 C CA . LYS T 16 319  ? 184.344 152.677 270.244 1.00 500.00 ? 353  LYS X CA 1 
ATOM 7423 C CA . ARG T 16 320  ? 185.694 156.052 271.522 1.00 500.00 ? 354  ARG X CA 1 
ATOM 7424 C CA . TYR T 16 321  ? 188.804 156.355 269.305 1.00 500.00 ? 355  TYR X CA 1 
ATOM 7425 C CA . SER T 16 322  ? 189.717 159.997 270.100 1.00 500.00 ? 356  SER X CA 1 
ATOM 7426 C CA . ARG T 16 323  ? 190.200 159.087 273.791 1.00 500.00 ? 357  ARG X CA 1 
ATOM 7427 C CA . ALA T 16 324  ? 192.439 156.068 272.961 1.00 500.00 ? 358  ALA X CA 1 
ATOM 7428 C CA . LEU T 16 325  ? 194.617 158.269 270.696 1.00 500.00 ? 359  LEU X CA 1 
ATOM 7429 C CA . TYR T 16 326  ? 195.537 160.778 273.445 1.00 463.87 ? 360  TYR X CA 1 
ATOM 7430 C CA . LEU T 16 327  ? 195.907 158.385 276.431 1.00 214.30 ? 361  LEU X CA 1 
ATOM 7431 C CA . GLY T 16 328  ? 198.080 156.142 274.189 1.00 320.60 ? 362  GLY X CA 1 
ATOM 7432 C CA . ALA T 16 329  ? 200.289 159.045 273.132 1.00 179.57 ? 363  ALA X CA 1 
ATOM 7433 C CA . LYS T 16 330  ? 201.149 159.526 276.855 1.00 312.62 ? 364  LYS X CA 1 
ATOM 7434 C CA . ALA T 16 331  ? 201.859 155.816 277.052 1.00 330.67 ? 365  ALA X CA 1 
ATOM 7435 C CA . ILE T 16 332  ? 204.560 156.271 274.337 1.00 246.39 ? 366  ILE X CA 1 
ATOM 7436 C CA . GLN T 16 333  ? 205.876 159.319 276.198 1.00 264.86 ? 367  GLN X CA 1 
ATOM 7437 C CA . LEU T 16 334  ? 206.280 157.488 279.546 1.00 253.24 ? 368  LEU X CA 1 
ATOM 7438 C CA . ASN T 16 335  ? 207.860 154.332 278.091 1.00 246.19 ? 369  ASN X CA 1 
ATOM 7439 C CA . SER T 16 336  ? 209.342 154.839 274.642 1.00 241.61 ? 370  SER X CA 1 
ATOM 7440 C CA . ASN T 16 337  ? 210.646 151.270 274.618 1.00 286.56 ? 371  ASN X CA 1 
ATOM 7441 C CA . SER T 16 338  ? 207.243 149.586 275.206 1.00 375.54 ? 372  SER X CA 1 
ATOM 7442 C CA . VAL T 16 339  ? 205.982 148.513 271.797 1.00 371.06 ? 373  VAL X CA 1 
ATOM 7443 C CA . GLN T 16 340  ? 202.374 147.829 272.593 1.00 349.61 ? 374  GLN X CA 1 
ATOM 7444 C CA . ALA T 16 341  ? 201.837 151.539 273.279 1.00 324.98 ? 375  ALA X CA 1 
ATOM 7445 C CA . LEU T 16 342  ? 202.757 152.690 269.748 1.00 426.55 ? 376  LEU X CA 1 
ATOM 7446 C CA . LEU T 16 343  ? 200.716 150.020 267.899 1.00 500.00 ? 377  LEU X CA 1 
ATOM 7447 C CA . LEU T 16 344  ? 197.798 150.779 270.319 1.00 500.00 ? 378  LEU X CA 1 
ATOM 7448 C CA . LYS T 16 345  ? 197.665 154.394 269.062 1.00 500.00 ? 379  LYS X CA 1 
ATOM 7449 C CA . GLY T 16 346  ? 197.795 153.083 265.462 1.00 500.00 ? 380  GLY X CA 1 
ATOM 7450 C CA . ALA T 16 347  ? 194.734 150.809 265.818 1.00 500.00 ? 381  ALA X CA 1 
ATOM 7451 C CA . ALA T 16 348  ? 192.635 153.680 267.302 1.00 500.00 ? 382  ALA X CA 1 
ATOM 7452 C CA . LEU T 16 349  ? 193.449 155.767 264.224 1.00 500.00 ? 383  LEU X CA 1 
ATOM 7453 C CA . ARG T 16 350  ? 192.586 152.828 261.900 1.00 500.00 ? 384  ARG X CA 1 
ATOM 7454 C CA . ASN T 16 351  ? 189.016 152.380 263.205 1.00 500.00 ? 385  ASN X CA 1 
ATOM 7455 C CA . MET T 16 352  ? 188.269 156.140 263.515 1.00 500.00 ? 386  MET X CA 1 
ATOM 7456 C CA . GLY T 16 353  ? 189.018 157.647 258.856 1.00 500.00 ? 387  GLY X CA 1 
ATOM 7457 C CA . ARG T 16 354  ? 192.671 158.786 258.997 1.00 500.00 ? 388  ARG X CA 1 
ATOM 7458 C CA . VAL T 16 355  ? 194.238 155.708 257.293 1.00 500.00 ? 389  VAL X CA 1 
ATOM 7459 C CA . GLN T 16 356  ? 197.397 157.434 255.908 1.00 500.00 ? 390  GLN X CA 1 
ATOM 7460 C CA . GLU T 16 357  ? 198.032 158.993 259.357 1.00 500.00 ? 391  GLU X CA 1 
ATOM 7461 C CA . ALA T 16 358  ? 197.435 155.568 261.002 1.00 500.00 ? 392  ALA X CA 1 
ATOM 7462 C CA . ILE T 16 359  ? 199.916 153.928 258.586 1.00 500.00 ? 393  ILE X CA 1 
ATOM 7463 C CA . ILE T 16 360  ? 202.966 155.982 259.793 1.00 500.00 ? 394  ILE X CA 1 
ATOM 7464 C CA . HIS T 16 361  ? 202.586 154.890 263.471 1.00 500.00 ? 395  HIS X CA 1 
ATOM 7465 C CA . PHE T 16 362  ? 202.677 151.181 262.561 1.00 487.34 ? 396  PHE X CA 1 
ATOM 7466 C CA . ARG T 16 363  ? 205.847 151.832 260.531 1.00 414.69 ? 397  ARG X CA 1 
ATOM 7467 C CA . GLU T 16 364  ? 207.756 153.244 263.541 1.00 232.28 ? 398  GLU X CA 1 
ATOM 7468 C CA . ALA T 16 365  ? 206.142 150.494 265.707 1.00 344.33 ? 399  ALA X CA 1 
ATOM 7469 C CA . ILE T 16 366  ? 207.494 147.584 263.589 1.00 287.05 ? 400  ILE X CA 1 
ATOM 7470 C CA . ARG T 16 367  ? 211.167 148.540 264.292 1.00 276.91 ? 401  ARG X CA 1 
ATOM 7471 C CA . LEU T 16 368  ? 210.471 148.776 268.050 1.00 296.51 ? 402  LEU X CA 1 
ATOM 7472 C CA . ALA T 16 369  ? 208.917 145.298 267.960 1.00 295.81 ? 403  ALA X CA 1 
ATOM 7473 C CA . PRO T 16 370  ? 210.974 142.645 266.248 1.00 293.78 ? 404  PRO X CA 1 
ATOM 7474 C CA . CYS T 16 371  ? 209.674 139.015 266.187 1.00 278.22 ? 405  CYS X CA 1 
ATOM 7475 C CA . ARG T 16 372  ? 206.103 139.680 267.460 1.00 269.79 ? 406  ARG X CA 1 
ATOM 7476 C CA . LEU T 16 373  ? 203.494 138.044 265.160 1.00 308.49 ? 407  LEU X CA 1 
ATOM 7477 C CA . ASP T 16 374  ? 200.834 140.607 266.126 1.00 419.09 ? 408  ASP X CA 1 
ATOM 7478 C CA . CYS T 16 375  ? 203.054 143.536 265.093 1.00 280.79 ? 409  CYS X CA 1 
ATOM 7479 C CA . TYR T 16 376  ? 203.696 142.071 261.642 1.00 246.59 ? 410  TYR X CA 1 
ATOM 7480 C CA . GLU T 16 377  ? 199.983 141.472 261.012 1.00 493.19 ? 411  GLU X CA 1 
ATOM 7481 C CA . GLY T 16 378  ? 199.156 145.178 261.596 1.00 500.00 ? 412  GLY X CA 1 
ATOM 7482 C CA . LEU T 16 379  ? 201.810 146.348 259.127 1.00 500.00 ? 413  LEU X CA 1 
ATOM 7483 C CA . ILE T 16 380  ? 200.662 143.962 256.350 1.00 500.00 ? 414  ILE X CA 1 
ATOM 7484 C CA . GLU T 16 381  ? 196.920 144.650 257.016 1.00 500.00 ? 415  GLU X CA 1 
ATOM 7485 C CA . CYS T 16 382  ? 197.427 148.454 256.805 1.00 500.00 ? 416  CYS X CA 1 
ATOM 7486 C CA . TYR T 16 383  ? 199.146 148.126 253.404 1.00 500.00 ? 417  TYR X CA 1 
ATOM 7487 C CA . LEU T 16 384  ? 196.204 145.984 252.146 1.00 500.00 ? 418  LEU X CA 1 
ATOM 7488 C CA . ALA T 16 385  ? 193.935 148.981 252.918 1.00 500.00 ? 419  ALA X CA 1 
ATOM 7489 C CA . SER T 16 386  ? 196.492 151.250 251.170 1.00 500.00 ? 420  SER X CA 1 
ATOM 7490 C CA . ASN T 16 387  ? 196.415 148.779 248.176 1.00 500.00 ? 421  ASN X CA 1 
ATOM 7491 C CA . SER T 16 388  ? 200.230 148.341 248.017 1.00 500.00 ? 422  SER X CA 1 
ATOM 7492 C CA . ILE T 16 389  ? 200.040 144.684 246.911 1.00 500.00 ? 423  ILE X CA 1 
ATOM 7493 C CA . ARG T 16 390  ? 203.661 143.798 245.993 1.00 500.00 ? 424  ARG X CA 1 
ATOM 7494 C CA . GLU T 16 391  ? 204.960 145.781 248.995 1.00 500.00 ? 425  GLU X CA 1 
ATOM 7495 C CA . ALA T 16 392  ? 202.754 143.664 251.322 1.00 500.00 ? 426  ALA X CA 1 
ATOM 7496 C CA . MET T 16 393  ? 203.999 140.417 249.683 1.00 500.00 ? 427  MET X CA 1 
ATOM 7497 C CA . VAL T 16 394  ? 207.706 141.369 250.118 1.00 477.93 ? 428  VAL X CA 1 
ATOM 7498 C CA . MET T 16 395  ? 207.175 142.336 253.793 1.00 285.05 ? 429  MET X CA 1 
ATOM 7499 C CA . ALA T 16 396  ? 205.340 139.030 254.356 1.00 324.86 ? 430  ALA X CA 1 
ATOM 7500 C CA . ASN T 16 397  ? 208.373 137.172 252.962 1.00 349.99 ? 431  ASN X CA 1 
ATOM 7501 C CA . ASN T 16 398  ? 210.590 138.994 255.501 1.00 349.11 ? 432  ASN X CA 1 
ATOM 7502 C CA . VAL T 16 399  ? 208.395 137.975 258.455 1.00 303.36 ? 433  VAL X CA 1 
ATOM 7503 C CA . TYR T 16 400  ? 208.297 134.468 256.870 1.00 285.30 ? 434  TYR X CA 1 
ATOM 7504 C CA . LYS T 16 401  ? 212.127 134.340 256.746 1.00 283.18 ? 435  LYS X CA 1 
ATOM 7505 C CA . THR T 16 402  ? 212.608 135.279 260.442 1.00 321.41 ? 436  THR X CA 1 
ATOM 7506 C CA . LEU T 16 403  ? 210.038 132.856 261.941 1.00 296.88 ? 437  LEU X CA 1 
ATOM 7507 C CA . GLY T 16 404  ? 210.816 130.082 259.402 1.00 343.90 ? 438  GLY X CA 1 
ATOM 7508 C CA . ALA T 16 405  ? 209.148 126.647 259.244 1.00 439.22 ? 439  ALA X CA 1 
ATOM 7509 C CA . ASN T 16 406  ? 206.204 125.372 261.401 1.00 475.98 ? 440  ASN X CA 1 
ATOM 7510 C CA . ALA T 16 407  ? 204.659 128.829 261.955 1.00 365.54 ? 441  ALA X CA 1 
ATOM 7511 C CA . GLN T 16 408  ? 200.879 128.951 261.463 1.00 386.73 ? 442  GLN X CA 1 
ATOM 7512 C CA . THR T 16 409  ? 200.571 132.746 261.346 1.00 307.02 ? 443  THR X CA 1 
ATOM 7513 C CA . LEU T 16 410  ? 203.118 133.094 258.487 1.00 323.01 ? 444  LEU X CA 1 
ATOM 7514 C CA . THR T 16 411  ? 201.194 130.657 256.269 1.00 421.97 ? 445  THR X CA 1 
ATOM 7515 C CA . LEU T 16 412  ? 197.968 132.485 257.276 1.00 500.00 ? 446  LEU X CA 1 
ATOM 7516 C CA . LEU T 16 413  ? 199.562 135.888 256.413 1.00 500.00 ? 447  LEU X CA 1 
ATOM 7517 C CA . ALA T 16 414  ? 200.903 134.565 253.068 1.00 500.00 ? 448  ALA X CA 1 
ATOM 7518 C CA . THR T 16 415  ? 197.383 133.377 252.072 1.00 500.00 ? 449  THR X CA 1 
ATOM 7519 C CA . VAL T 16 416  ? 196.049 136.938 252.582 1.00 500.00 ? 450  VAL X CA 1 
ATOM 7520 C CA . CYS T 16 417  ? 199.087 138.182 250.579 1.00 500.00 ? 451  CYS X CA 1 
ATOM 7521 C CA . LEU T 16 418  ? 198.187 135.782 247.757 1.00 500.00 ? 452  LEU X CA 1 
ATOM 7522 C CA . ASN U 16 2    ? 228.999 135.135 297.590 1.00 252.67 ? 36   ASN Y CA 1 
ATOM 7523 C CA . VAL U 16 3    ? 226.042 135.688 295.193 1.00 284.36 ? 37   VAL Y CA 1 
ATOM 7524 C CA . ILE U 16 4    ? 224.606 138.312 297.588 1.00 310.82 ? 38   ILE Y CA 1 
ATOM 7525 C CA . ASP U 16 5    ? 228.015 139.946 297.909 1.00 343.85 ? 39   ASP Y CA 1 
ATOM 7526 C CA . HIS U 16 6    ? 227.973 140.308 294.128 1.00 344.88 ? 40   HIS Y CA 1 
ATOM 7527 C CA . VAL U 16 7    ? 224.489 141.833 294.274 1.00 240.58 ? 41   VAL Y CA 1 
ATOM 7528 C CA . ARG U 16 8    ? 225.762 144.319 296.933 1.00 313.61 ? 42   ARG Y CA 1 
ATOM 7529 C CA . ASP U 16 9    ? 228.519 145.220 294.411 1.00 351.40 ? 43   ASP Y CA 1 
ATOM 7530 C CA . MET U 16 10   ? 225.947 145.751 291.693 1.00 215.66 ? 44   MET Y CA 1 
ATOM 7531 C CA . ALA U 16 11   ? 224.113 148.002 294.127 1.00 413.75 ? 45   ALA Y CA 1 
ATOM 7532 C CA . ALA U 16 12   ? 227.363 149.968 294.646 1.00 497.95 ? 46   ALA Y CA 1 
ATOM 7533 C CA . ALA U 16 13   ? 227.298 150.323 290.803 1.00 487.79 ? 47   ALA Y CA 1 
ATOM 7534 C CA . GLY U 16 14   ? 223.788 151.672 291.289 1.00 366.51 ? 48   GLY Y CA 1 
ATOM 7535 C CA . LEU U 16 15   ? 222.138 149.861 288.351 1.00 341.98 ? 49   LEU Y CA 1 
ATOM 7536 C CA . HIS U 16 16   ? 218.607 149.436 289.541 1.00 182.23 ? 50   HIS Y CA 1 
ATOM 7537 C CA . SER U 16 17   ? 217.216 147.666 286.512 1.00 298.75 ? 51   SER Y CA 1 
ATOM 7538 C CA . ASN U 16 18   ? 219.892 144.982 286.816 1.00 354.74 ? 52   ASN Y CA 1 
ATOM 7539 C CA . VAL U 16 19   ? 219.673 144.499 290.520 1.00 274.03 ? 53   VAL Y CA 1 
ATOM 7540 C CA . ARG U 16 20   ? 215.907 144.215 290.289 1.00 173.50 ? 54   ARG Y CA 1 
ATOM 7541 C CA . LEU U 16 21   ? 215.750 141.253 287.876 1.00 288.85 ? 55   LEU Y CA 1 
ATOM 7542 C CA . LEU U 16 22   ? 218.521 139.435 289.709 1.00 287.09 ? 56   LEU Y CA 1 
ATOM 7543 C CA . SER U 16 23   ? 217.089 140.123 293.175 1.00 244.29 ? 57   SER Y CA 1 
ATOM 7544 C CA . SER U 16 24   ? 213.579 139.184 292.061 1.00 333.17 ? 58   SER Y CA 1 
ATOM 7545 C CA . LEU U 16 25   ? 214.784 135.773 290.922 1.00 361.99 ? 59   LEU Y CA 1 
ATOM 7546 C CA . LEU U 16 26   ? 216.898 135.473 294.054 1.00 234.77 ? 60   LEU Y CA 1 
ATOM 7547 C CA . LEU U 16 27   ? 213.827 136.261 296.173 1.00 228.30 ? 61   LEU Y CA 1 
ATOM 7548 C CA . THR U 16 28   ? 211.790 133.628 294.359 1.00 323.29 ? 62   THR Y CA 1 
ATOM 7549 C CA . MET U 16 29   ? 214.577 131.145 294.984 1.00 201.01 ? 63   MET Y CA 1 
ATOM 7550 C CA . SER U 16 30   ? 214.726 132.198 298.642 1.00 211.48 ? 64   SER Y CA 1 
ATOM 7551 C CA . ASN U 16 31   ? 210.894 131.911 299.040 1.00 442.69 ? 65   ASN Y CA 1 
ATOM 7552 C CA . ASN U 16 32   ? 210.859 128.502 297.418 1.00 484.53 ? 66   ASN Y CA 1 
ATOM 7553 C CA . ASN U 16 33   ? 213.710 127.039 299.486 1.00 498.85 ? 67   ASN Y CA 1 
ATOM 7554 C CA . PRO U 16 34   ? 213.893 127.895 303.161 1.00 453.69 ? 68   PRO Y CA 1 
ATOM 7555 C CA . GLU U 16 35   ? 217.413 128.319 304.457 1.00 412.97 ? 69   GLU Y CA 1 
ATOM 7556 C CA . LEU U 16 36   ? 218.787 128.658 300.943 1.00 304.63 ? 70   LEU Y CA 1 
ATOM 7557 C CA . PHE U 16 37   ? 219.961 132.096 302.134 1.00 278.51 ? 71   PHE Y CA 1 
ATOM 7558 C CA . SER U 16 38   ? 220.935 133.123 305.637 1.00 315.51 ? 72   SER Y CA 1 
ATOM 7559 C CA . PRO U 16 39   ? 218.475 135.471 307.435 1.00 318.51 ? 73   PRO Y CA 1 
ATOM 7560 C CA . PRO U 16 40   ? 221.019 138.303 307.320 1.00 312.83 ? 74   PRO Y CA 1 
ATOM 7561 C CA . GLN U 16 41   ? 221.394 137.595 303.613 1.00 279.60 ? 75   GLN Y CA 1 
ATOM 7562 C CA . LYS U 16 42   ? 217.640 137.705 303.043 1.00 281.47 ? 76   LYS Y CA 1 
ATOM 7563 C CA . TYR U 16 43   ? 217.477 141.124 304.708 1.00 276.18 ? 77   TYR Y CA 1 
ATOM 7564 C CA . GLN U 16 44   ? 220.228 142.369 302.421 1.00 361.03 ? 78   GLN Y CA 1 
ATOM 7565 C CA . LEU U 16 45   ? 218.435 140.971 299.382 1.00 288.47 ? 79   LEU Y CA 1 
ATOM 7566 C CA . LEU U 16 46   ? 215.181 142.677 300.325 1.00 258.54 ? 80   LEU Y CA 1 
ATOM 7567 C CA . VAL U 16 47   ? 216.869 146.030 300.866 1.00 225.60 ? 81   VAL Y CA 1 
ATOM 7568 C CA . TYR U 16 48   ? 218.675 145.871 297.526 1.00 381.73 ? 82   TYR Y CA 1 
ATOM 7569 C CA . HIS U 16 49   ? 215.461 144.828 295.830 1.00 306.85 ? 83   HIS Y CA 1 
ATOM 7570 C CA . ALA U 16 50   ? 213.459 147.610 297.474 1.00 293.45 ? 84   ALA Y CA 1 
ATOM 7571 C CA . ASP U 16 51   ? 216.093 150.189 296.382 1.00 196.25 ? 85   ASP Y CA 1 
ATOM 7572 C CA . SER U 16 52   ? 215.485 148.910 292.887 1.00 244.00 ? 86   SER Y CA 1 
ATOM 7573 C CA . LEU U 16 53   ? 211.695 149.354 293.240 1.00 254.86 ? 87   LEU Y CA 1 
ATOM 7574 C CA . PHE U 16 54   ? 212.153 152.900 294.482 1.00 216.74 ? 88   PHE Y CA 1 
ATOM 7575 C CA . HIS U 16 55   ? 214.142 153.882 291.399 1.00 233.57 ? 89   HIS Y CA 1 
ATOM 7576 C CA . ASP U 16 56   ? 211.528 152.117 289.253 1.00 238.49 ? 90   ASP Y CA 1 
ATOM 7577 C CA . LYS U 16 57   ? 209.042 154.476 290.976 1.00 247.78 ? 91   LYS Y CA 1 
ATOM 7578 C CA . GLU U 16 58   ? 206.552 151.665 291.970 1.00 402.42 ? 92   GLU Y CA 1 
ATOM 7579 C CA . TYR U 16 59   ? 205.811 153.013 295.442 1.00 351.68 ? 93   TYR Y CA 1 
ATOM 7580 C CA . ARG U 16 60   ? 203.107 150.547 296.580 1.00 468.40 ? 94   ARG Y CA 1 
ATOM 7581 C CA . ASN U 16 61   ? 205.460 147.655 295.899 1.00 485.71 ? 95   ASN Y CA 1 
ATOM 7582 C CA . ALA U 16 62   ? 208.387 149.412 297.515 1.00 404.35 ? 96   ALA Y CA 1 
ATOM 7583 C CA . VAL U 16 63   ? 206.466 149.992 300.702 1.00 395.03 ? 97   VAL Y CA 1 
ATOM 7584 C CA . SER U 16 64   ? 205.591 146.321 301.002 1.00 430.86 ? 98   SER Y CA 1 
ATOM 7585 C CA . LYS U 16 65   ? 209.154 145.111 300.377 1.00 390.81 ? 99   LYS Y CA 1 
ATOM 7586 C CA . TYR U 16 66   ? 210.556 147.615 302.832 1.00 426.02 ? 100  TYR Y CA 1 
ATOM 7587 C CA . THR U 16 67   ? 208.090 146.504 305.552 1.00 399.61 ? 101  THR Y CA 1 
ATOM 7588 C CA . MET U 16 68   ? 209.039 142.924 304.781 1.00 284.15 ? 102  MET Y CA 1 
ATOM 7589 C CA . ALA U 16 69   ? 212.678 143.890 305.121 1.00 285.17 ? 103  ALA Y CA 1 
ATOM 7590 C CA . LEU U 16 70   ? 212.099 145.482 308.527 1.00 351.13 ? 104  LEU Y CA 1 
ATOM 7591 C CA . GLN U 16 71   ? 210.380 142.319 309.708 1.00 264.23 ? 105  GLN Y CA 1 
ATOM 7592 C CA . GLN U 16 72   ? 213.477 140.380 308.710 1.00 221.20 ? 106  GLN Y CA 1 
ATOM 7593 C CA . LYS U 16 73   ? 215.646 142.924 310.534 1.00 400.13 ? 107  LYS Y CA 1 
ATOM 7594 C CA . LYS U 16 74   ? 213.767 142.168 313.756 1.00 500.00 ? 108  LYS Y CA 1 
ATOM 7595 C CA . ALA U 16 75   ? 214.271 138.468 313.164 1.00 500.00 ? 109  ALA Y CA 1 
ATOM 7596 C CA . LEU U 16 76   ? 218.017 139.207 312.729 1.00 500.00 ? 110  LEU Y CA 1 
ATOM 7597 C CA . LEU U 16 98   ? 224.599 146.077 306.323 1.00 297.55 ? 132  LEU Y CA 1 
ATOM 7598 C CA . PRO U 16 99   ? 221.910 148.616 305.499 1.00 275.04 ? 133  PRO Y CA 1 
ATOM 7599 C CA . SER U 16 100  ? 220.924 150.565 308.591 1.00 266.84 ? 134  SER Y CA 1 
ATOM 7600 C CA . GLU U 16 101  ? 217.392 150.053 309.834 1.00 326.12 ? 135  GLU Y CA 1 
ATOM 7601 C CA . ILE U 16 102  ? 217.024 153.804 310.061 1.00 299.66 ? 136  ILE Y CA 1 
ATOM 7602 C CA . GLU U 16 103  ? 218.028 154.269 306.415 1.00 254.78 ? 137  GLU Y CA 1 
ATOM 7603 C CA . VAL U 16 104  ? 215.398 151.758 305.358 1.00 258.89 ? 138  VAL Y CA 1 
ATOM 7604 C CA . LYS U 16 105  ? 212.628 153.379 307.443 1.00 431.37 ? 139  LYS Y CA 1 
ATOM 7605 C CA . TYR U 16 106  ? 213.587 156.722 305.863 1.00 337.69 ? 140  TYR Y CA 1 
ATOM 7606 C CA . LYS U 16 107  ? 213.170 155.198 302.433 1.00 209.81 ? 141  LYS Y CA 1 
ATOM 7607 C CA . MET U 16 108  ? 209.754 153.885 303.372 1.00 269.11 ? 142  MET Y CA 1 
ATOM 7608 C CA . ALA U 16 109  ? 208.833 157.379 304.470 1.00 237.64 ? 143  ALA Y CA 1 
ATOM 7609 C CA . GLU U 16 110  ? 209.831 158.757 301.118 1.00 274.21 ? 144  GLU Y CA 1 
ATOM 7610 C CA . CYS U 16 111  ? 207.533 156.292 299.349 1.00 291.48 ? 145  CYS Y CA 1 
ATOM 7611 C CA . TYR U 16 112  ? 204.631 157.288 301.597 1.00 262.65 ? 146  TYR Y CA 1 
ATOM 7612 C CA . THR U 16 113  ? 205.335 160.915 300.787 1.00 231.20 ? 147  THR Y CA 1 
ATOM 7613 C CA . MET U 16 114  ? 205.215 160.330 297.025 1.00 267.71 ? 148  MET Y CA 1 
ATOM 7614 C CA . LEU U 16 115  ? 201.977 158.451 297.627 1.00 256.04 ? 149  LEU Y CA 1 
ATOM 7615 C CA . LYS U 16 116  ? 200.673 161.519 299.414 1.00 280.56 ? 150  LYS Y CA 1 
ATOM 7616 C CA . GLN U 16 117  ? 199.731 159.669 302.636 1.00 462.73 ? 151  GLN Y CA 1 
ATOM 7617 C CA . ASP U 16 118  ? 201.338 161.903 305.305 1.00 500.00 ? 152  ASP Y CA 1 
ATOM 7618 C CA . LYS U 16 119  ? 200.180 160.116 308.453 1.00 500.00 ? 153  LYS Y CA 1 
ATOM 7619 C CA . ASP U 16 120  ? 201.893 156.906 307.383 1.00 500.00 ? 154  ASP Y CA 1 
ATOM 7620 C CA . ALA U 16 121  ? 205.257 158.624 306.899 1.00 500.00 ? 155  ALA Y CA 1 
ATOM 7621 C CA . ILE U 16 122  ? 204.897 160.317 310.292 1.00 500.00 ? 156  ILE Y CA 1 
ATOM 7622 C CA . ALA U 16 123  ? 204.171 157.011 311.971 1.00 500.00 ? 157  ALA Y CA 1 
ATOM 7623 C CA . ILE U 16 124  ? 207.325 155.207 310.803 1.00 500.00 ? 158  ILE Y CA 1 
ATOM 7624 C CA . LEU U 16 125  ? 209.597 158.097 311.754 1.00 500.00 ? 159  LEU Y CA 1 
ATOM 7625 C CA . ASP U 16 126  ? 207.932 158.729 315.091 1.00 500.00 ? 160  ASP Y CA 1 
ATOM 7626 C CA . GLY U 16 127  ? 208.662 155.135 315.944 1.00 500.00 ? 161  GLY Y CA 1 
ATOM 7627 C CA . ILE U 16 128  ? 212.355 155.815 315.703 1.00 500.00 ? 162  ILE Y CA 1 
ATOM 7628 C CA . PRO U 16 129  ? 214.053 157.213 318.819 1.00 500.00 ? 163  PRO Y CA 1 
ATOM 7629 C CA . SER U 16 130  ? 215.100 160.885 318.545 1.00 500.00 ? 164  SER Y CA 1 
ATOM 7630 C CA . ARG U 16 131  ? 218.743 160.082 319.347 1.00 466.91 ? 165  ARG Y CA 1 
ATOM 7631 C CA . GLN U 16 132  ? 218.864 157.346 316.729 1.00 309.29 ? 166  GLN Y CA 1 
ATOM 7632 C CA . ARG U 16 133  ? 217.266 159.639 314.136 1.00 249.51 ? 167  ARG Y CA 1 
ATOM 7633 C CA . THR U 16 134  ? 219.609 161.435 311.736 1.00 289.19 ? 168  THR Y CA 1 
ATOM 7634 C CA . PRO U 16 135  ? 219.464 165.066 310.661 1.00 471.94 ? 169  PRO Y CA 1 
ATOM 7635 C CA . LYS U 16 136  ? 217.947 164.098 307.363 1.00 500.00 ? 170  LYS Y CA 1 
ATOM 7636 C CA . ILE U 16 137  ? 215.181 162.095 309.019 1.00 500.00 ? 171  ILE Y CA 1 
ATOM 7637 C CA . ASN U 16 138  ? 214.483 164.922 311.380 1.00 498.63 ? 172  ASN Y CA 1 
ATOM 7638 C CA . MET U 16 139  ? 214.371 167.496 308.574 1.00 439.60 ? 173  MET Y CA 1 
ATOM 7639 C CA . MET U 16 140  ? 211.878 165.503 306.568 1.00 412.34 ? 174  MET Y CA 1 
ATOM 7640 C CA . LEU U 16 141  ? 209.930 164.869 309.741 1.00 500.00 ? 175  LEU Y CA 1 
ATOM 7641 C CA . ALA U 16 142  ? 209.838 168.597 310.523 1.00 462.91 ? 176  ALA Y CA 1 
ATOM 7642 C CA . ASN U 16 143  ? 208.441 169.274 307.055 1.00 420.48 ? 177  ASN Y CA 1 
ATOM 7643 C CA . LEU U 16 144  ? 205.730 166.650 307.493 1.00 500.00 ? 178  LEU Y CA 1 
ATOM 7644 C CA . TYR U 16 145  ? 204.638 168.104 310.784 1.00 500.00 ? 179  TYR Y CA 1 
ATOM 7645 C CA . LYS U 16 146  ? 204.421 171.624 309.155 1.00 304.33 ? 180  LYS Y CA 1 
ATOM 7646 C CA . LYS U 16 147  ? 202.203 170.214 306.456 1.00 199.92 ? 181  LYS Y CA 1 
ATOM 7647 C CA . ALA U 16 148  ? 200.264 168.530 309.251 1.00 223.48 ? 182  ALA Y CA 1 
ATOM 7648 C CA . GLY U 16 149  ? 199.973 171.902 311.024 1.00 369.85 ? 183  GLY Y CA 1 
ATOM 7649 C CA . GLN U 16 150  ? 201.521 170.721 314.323 1.00 468.58 ? 184  GLN Y CA 1 
ATOM 7650 C CA . GLU U 16 151  ? 203.890 173.616 315.150 1.00 348.55 ? 185  GLU Y CA 1 
ATOM 7651 C CA . ARG U 16 152  ? 205.396 172.219 318.400 1.00 500.00 ? 186  ARG Y CA 1 
ATOM 7652 C CA . PRO U 16 153  ? 206.551 168.901 316.814 1.00 500.00 ? 187  PRO Y CA 1 
ATOM 7653 C CA . SER U 16 154  ? 207.980 170.910 313.843 1.00 500.00 ? 188  SER Y CA 1 
ATOM 7654 C CA . VAL U 16 155  ? 209.923 173.240 316.218 1.00 500.00 ? 189  VAL Y CA 1 
ATOM 7655 C CA . THR U 16 156  ? 211.637 170.438 318.176 1.00 500.00 ? 190  THR Y CA 1 
ATOM 7656 C CA . SER U 16 157  ? 212.646 168.636 314.953 1.00 500.00 ? 191  SER Y CA 1 
ATOM 7657 C CA . TYR U 16 158  ? 214.206 171.882 313.639 1.00 469.68 ? 192  TYR Y CA 1 
ATOM 7658 C CA . LYS U 16 159  ? 216.003 172.336 316.967 1.00 500.00 ? 193  LYS Y CA 1 
ATOM 7659 C CA . GLU U 16 160  ? 217.266 168.746 316.480 1.00 500.00 ? 194  GLU Y CA 1 
ATOM 7660 C CA . VAL U 16 161  ? 218.551 169.416 312.934 1.00 469.09 ? 195  VAL Y CA 1 
ATOM 7661 C CA . LEU U 16 162  ? 220.150 172.679 314.113 1.00 500.00 ? 196  LEU Y CA 1 
ATOM 7662 C CA . ARG U 16 163  ? 221.986 170.999 317.024 1.00 500.00 ? 197  ARG Y CA 1 
ATOM 7663 C CA . GLN U 16 164  ? 223.431 168.655 314.348 1.00 500.00 ? 198  GLN Y CA 1 
ATOM 7664 C CA . CYS U 16 165  ? 224.968 171.300 311.996 1.00 263.91 ? 199  CYS Y CA 1 
ATOM 7665 C CA . PRO U 16 166  ? 223.463 173.949 312.470 1.00 331.94 ? 200  PRO Y CA 1 
ATOM 7666 C CA . LEU U 16 167  ? 224.173 176.039 309.270 1.00 249.97 ? 201  LEU Y CA 1 
ATOM 7667 C CA . ALA U 16 168  ? 220.988 174.639 307.674 1.00 261.24 ? 202  ALA Y CA 1 
ATOM 7668 C CA . LEU U 16 169  ? 219.370 177.746 306.397 1.00 319.37 ? 203  LEU Y CA 1 
ATOM 7669 C CA . ASP U 16 170  ? 216.095 175.953 305.591 1.00 500.00 ? 204  ASP Y CA 1 
ATOM 7670 C CA . ALA U 16 171  ? 215.901 174.681 309.153 1.00 500.00 ? 205  ALA Y CA 1 
ATOM 7671 C CA . ILE U 16 172  ? 216.287 178.299 310.294 1.00 432.43 ? 206  ILE Y CA 1 
ATOM 7672 C CA . LEU U 16 173  ? 213.834 179.355 307.537 1.00 232.83 ? 207  LEU Y CA 1 
ATOM 7673 C CA . GLY U 16 174  ? 211.401 176.739 308.813 1.00 213.43 ? 208  GLY Y CA 1 
ATOM 7674 C CA . LEU U 16 175  ? 211.669 177.988 312.388 1.00 365.61 ? 209  LEU Y CA 1 
ATOM 7675 C CA . LEU U 16 176  ? 211.155 181.562 311.196 1.00 234.03 ? 210  LEU Y CA 1 
ATOM 7676 C CA . SER U 16 177  ? 207.985 180.554 309.334 1.00 261.63 ? 211  SER Y CA 1 
ATOM 7677 C CA . LEU U 16 178  ? 206.948 178.848 312.595 1.00 466.77 ? 212  LEU Y CA 1 
ATOM 7678 C CA . SER U 16 179  ? 207.956 182.039 314.522 1.00 500.00 ? 213  SER Y CA 1 
ATOM 7679 C CA . VAL U 16 180  ? 209.616 182.578 317.989 1.00 500.00 ? 214  VAL Y CA 1 
ATOM 7680 C CA . LYS U 16 181  ? 212.282 184.353 315.900 1.00 500.00 ? 215  LYS Y CA 1 
ATOM 7681 C CA . GLY U 16 182  ? 214.269 186.060 318.699 1.00 500.00 ? 216  GLY Y CA 1 
ATOM 7682 C CA . ALA U 16 183  ? 214.938 182.668 320.305 1.00 500.00 ? 217  ALA Y CA 1 
ATOM 7683 C CA . GLU U 16 184  ? 216.149 181.312 316.901 1.00 500.00 ? 218  GLU Y CA 1 
ATOM 7684 C CA . VAL U 16 185  ? 218.419 184.361 316.419 1.00 500.00 ? 219  VAL Y CA 1 
ATOM 7685 C CA . ALA U 16 186  ? 219.956 183.744 319.889 1.00 500.00 ? 220  ALA Y CA 1 
ATOM 7686 C CA . SER U 16 187  ? 220.856 180.046 319.325 1.00 500.00 ? 221  SER Y CA 1 
ATOM 7687 C CA . MET U 16 188  ? 222.201 180.782 315.842 1.00 500.00 ? 222  MET Y CA 1 
ATOM 7688 C CA . THR U 16 189  ? 224.413 183.701 317.066 1.00 500.00 ? 223  THR Y CA 1 
ATOM 7689 C CA . MET U 16 190  ? 226.354 181.322 319.395 1.00 500.00 ? 224  MET Y CA 1 
ATOM 7690 C CA . ASN U 16 191  ? 226.787 179.009 316.402 1.00 500.00 ? 225  ASN Y CA 1 
ATOM 7691 C CA . VAL U 16 192  ? 227.896 181.998 314.183 1.00 500.00 ? 226  VAL Y CA 1 
ATOM 7692 C CA . ILE U 16 193  ? 230.897 182.775 316.467 1.00 500.00 ? 227  ILE Y CA 1 
ATOM 7693 C CA . GLN U 16 194  ? 231.799 179.088 316.023 1.00 500.00 ? 228  GLN Y CA 1 
ATOM 7694 C CA . THR U 16 195  ? 230.879 179.409 312.291 1.00 287.10 ? 229  THR Y CA 1 
ATOM 7695 C CA . VAL U 16 196  ? 233.536 180.327 309.672 1.00 378.23 ? 230  VAL Y CA 1 
ATOM 7696 C CA . PRO U 16 197  ? 234.130 183.967 308.463 1.00 424.87 ? 231  PRO Y CA 1 
ATOM 7697 C CA . ASN U 16 198  ? 232.358 183.110 305.157 1.00 206.48 ? 232  ASN Y CA 1 
ATOM 7698 C CA . LEU U 16 199  ? 228.987 183.336 306.950 1.00 272.43 ? 233  LEU Y CA 1 
ATOM 7699 C CA . ASP U 16 200  ? 229.388 186.959 308.187 1.00 435.97 ? 234  ASP Y CA 1 
ATOM 7700 C CA . TRP U 16 201  ? 225.906 187.875 306.904 1.00 443.62 ? 235  TRP Y CA 1 
ATOM 7701 C CA . LEU U 16 202  ? 224.025 185.245 308.951 1.00 500.00 ? 236  LEU Y CA 1 
ATOM 7702 C CA . SER U 16 203  ? 222.730 187.498 311.755 1.00 500.00 ? 237  SER Y CA 1 
ATOM 7703 C CA . VAL U 16 204  ? 220.982 190.038 309.471 1.00 500.00 ? 238  VAL Y CA 1 
ATOM 7704 C CA . TRP U 16 205  ? 219.598 187.221 307.253 1.00 500.00 ? 239  TRP Y CA 1 
ATOM 7705 C CA . ILE U 16 206  ? 217.760 185.637 310.215 1.00 500.00 ? 240  ILE Y CA 1 
ATOM 7706 C CA . LYS U 16 207  ? 216.385 189.028 311.361 1.00 500.00 ? 241  LYS Y CA 1 
ATOM 7707 C CA . ALA U 16 208  ? 215.202 189.752 307.786 1.00 446.70 ? 242  ALA Y CA 1 
ATOM 7708 C CA . TYR U 16 209  ? 213.232 186.532 307.349 1.00 247.94 ? 243  TYR Y CA 1 
ATOM 7709 C CA . ALA U 16 210  ? 211.939 186.721 310.930 1.00 372.11 ? 244  ALA Y CA 1 
ATOM 7710 C CA . PHE U 16 211  ? 210.283 190.003 309.949 1.00 365.90 ? 245  PHE Y CA 1 
ATOM 7711 C CA . VAL U 16 212  ? 209.112 188.376 306.660 1.00 214.47 ? 246  VAL Y CA 1 
ATOM 7712 C CA . HIS U 16 213  ? 207.053 185.926 308.745 1.00 385.33 ? 247  HIS Y CA 1 
ATOM 7713 C CA . THR U 16 214  ? 206.014 188.543 311.349 1.00 367.50 ? 248  THR Y CA 1 
ATOM 7714 C CA . GLY U 16 215  ? 203.707 189.751 308.559 1.00 250.38 ? 249  GLY Y CA 1 
ATOM 7715 C CA . ASP U 16 216  ? 204.968 193.334 308.737 1.00 326.77 ? 250  ASP Y CA 1 
ATOM 7716 C CA . ASN U 16 217  ? 206.070 193.977 305.151 1.00 281.81 ? 251  ASN Y CA 1 
ATOM 7717 C CA . SER U 16 218  ? 207.621 197.371 306.024 1.00 421.96 ? 252  SER Y CA 1 
ATOM 7718 C CA . ARG U 16 219  ? 210.184 196.144 308.565 1.00 433.16 ? 253  ARG Y CA 1 
ATOM 7719 C CA . ALA U 16 220  ? 211.123 193.094 306.426 1.00 316.78 ? 254  ALA Y CA 1 
ATOM 7720 C CA . ILE U 16 221  ? 211.468 194.877 303.054 1.00 175.38 ? 255  ILE Y CA 1 
ATOM 7721 C CA . SER U 16 222  ? 213.911 197.507 304.410 1.00 336.66 ? 256  SER Y CA 1 
ATOM 7722 C CA . THR U 16 223  ? 216.264 195.024 306.117 1.00 389.42 ? 257  THR Y CA 1 
ATOM 7723 C CA . ILE U 16 224  ? 216.208 192.720 303.020 1.00 291.91 ? 258  ILE Y CA 1 
ATOM 7724 C CA . CYS U 16 225  ? 217.205 195.811 301.005 1.00 366.59 ? 259  CYS Y CA 1 
ATOM 7725 C CA . SER U 16 226  ? 220.137 196.228 303.453 1.00 397.65 ? 260  SER Y CA 1 
ATOM 7726 C CA . LEU U 16 227  ? 221.369 192.759 302.308 1.00 300.05 ? 261  LEU Y CA 1 
ATOM 7727 C CA . GLU U 16 228  ? 221.088 193.933 298.666 1.00 283.93 ? 262  GLU Y CA 1 
ATOM 7728 C CA . LYS U 16 229  ? 223.401 196.855 299.669 1.00 374.07 ? 263  LYS Y CA 1 
ATOM 7729 C CA . LYS U 16 230  ? 226.092 194.319 300.734 1.00 284.15 ? 264  LYS Y CA 1 
ATOM 7730 C CA . SER U 16 231  ? 228.620 193.900 297.900 1.00 407.68 ? 265  SER Y CA 1 
ATOM 7731 C CA . LEU U 16 232  ? 228.744 190.101 298.417 1.00 317.44 ? 266  LEU Y CA 1 
ATOM 7732 C CA . LEU U 16 233  ? 225.003 189.630 298.889 1.00 244.03 ? 267  LEU Y CA 1 
ATOM 7733 C CA . ARG U 16 234  ? 223.918 192.128 296.188 1.00 225.40 ? 268  ARG Y CA 1 
ATOM 7734 C CA . ASP U 16 235  ? 222.268 189.883 293.621 1.00 256.86 ? 269  ASP Y CA 1 
ATOM 7735 C CA . ASN U 16 236  ? 220.689 186.731 294.984 1.00 241.12 ? 270  ASN Y CA 1 
ATOM 7736 C CA . VAL U 16 237  ? 218.330 184.876 292.743 1.00 258.04 ? 271  VAL Y CA 1 
ATOM 7737 C CA . ASP U 16 238  ? 216.577 183.753 295.963 1.00 293.00 ? 272  ASP Y CA 1 
ATOM 7738 C CA . LEU U 16 239  ? 216.870 186.967 298.001 1.00 203.26 ? 273  LEU Y CA 1 
ATOM 7739 C CA . LEU U 16 240  ? 215.444 189.078 295.162 1.00 255.66 ? 274  LEU Y CA 1 
ATOM 7740 C CA . GLY U 16 241  ? 212.665 186.449 294.893 1.00 207.04 ? 275  GLY Y CA 1 
ATOM 7741 C CA . SER U 16 242  ? 212.063 186.944 298.684 1.00 211.98 ? 276  SER Y CA 1 
ATOM 7742 C CA . LEU U 16 243  ? 211.990 190.702 298.238 1.00 181.14 ? 277  LEU Y CA 1 
ATOM 7743 C CA . ALA U 16 244  ? 209.589 190.375 295.260 1.00 254.54 ? 278  ALA Y CA 1 
ATOM 7744 C CA . ASP U 16 245  ? 207.126 188.466 297.470 1.00 274.22 ? 279  ASP Y CA 1 
ATOM 7745 C CA . LEU U 16 246  ? 207.147 191.225 300.162 1.00 220.16 ? 280  LEU Y CA 1 
ATOM 7746 C CA . TYR U 16 247  ? 206.478 193.997 297.654 1.00 201.58 ? 281  TYR Y CA 1 
ATOM 7747 C CA . PHE U 16 248  ? 203.552 192.009 296.192 1.00 200.13 ? 282  PHE Y CA 1 
ATOM 7748 C CA . ARG U 16 249  ? 202.104 191.625 299.701 1.00 247.67 ? 283  ARG Y CA 1 
ATOM 7749 C CA . ALA U 16 250  ? 202.799 195.240 300.785 1.00 243.54 ? 284  ALA Y CA 1 
ATOM 7750 C CA . GLY U 16 251  ? 200.719 196.390 297.803 1.00 269.27 ? 285  GLY Y CA 1 
ATOM 7751 C CA . ASP U 16 252  ? 203.597 198.441 296.390 1.00 224.63 ? 286  ASP Y CA 1 
ATOM 7752 C CA . ASN U 16 253  ? 202.599 197.067 292.997 1.00 219.51 ? 287  ASN Y CA 1 
ATOM 7753 C CA . LYS U 16 254  ? 204.851 198.986 290.555 1.00 243.59 ? 288  LYS Y CA 1 
ATOM 7754 C CA . ASN U 16 255  ? 208.034 198.536 292.646 1.00 183.35 ? 289  ASN Y CA 1 
ATOM 7755 C CA . SER U 16 256  ? 207.414 194.766 292.889 1.00 198.62 ? 290  SER Y CA 1 
ATOM 7756 C CA . VAL U 16 257  ? 207.662 194.231 289.123 1.00 185.81 ? 291  VAL Y CA 1 
ATOM 7757 C CA . LEU U 16 258  ? 210.853 196.350 288.853 1.00 203.42 ? 292  LEU Y CA 1 
ATOM 7758 C CA . LYS U 16 259  ? 212.730 194.233 291.442 1.00 185.42 ? 293  LYS Y CA 1 
ATOM 7759 C CA . PHE U 16 260  ? 211.151 191.046 290.123 1.00 201.77 ? 294  PHE Y CA 1 
ATOM 7760 C CA . GLU U 16 261  ? 212.039 191.895 286.468 1.00 191.69 ? 295  GLU Y CA 1 
ATOM 7761 C CA . GLN U 16 262  ? 215.609 192.116 287.857 1.00 221.37 ? 296  GLN Y CA 1 
ATOM 7762 C CA . ALA U 16 263  ? 215.291 188.674 289.524 1.00 257.42 ? 297  ALA Y CA 1 
ATOM 7763 C CA . GLN U 16 264  ? 214.188 187.019 286.262 1.00 206.83 ? 298  GLN Y CA 1 
ATOM 7764 C CA . MET U 16 265  ? 216.910 188.945 284.388 1.00 174.71 ? 299  MET Y CA 1 
ATOM 7765 C CA . LEU U 16 266  ? 219.467 187.335 286.713 1.00 156.00 ? 300  LEU Y CA 1 
ATOM 7766 C CA . ASP U 16 267  ? 218.338 183.732 286.182 1.00 187.75 ? 301  ASP Y CA 1 
ATOM 7767 C CA . PRO U 16 268  ? 216.413 182.053 283.335 1.00 340.52 ? 302  PRO Y CA 1 
ATOM 7768 C CA . TYR U 16 269  ? 214.802 179.614 285.882 1.00 236.29 ? 303  TYR Y CA 1 
ATOM 7769 C CA . LEU U 16 270  ? 212.682 181.076 288.714 1.00 318.46 ? 304  LEU Y CA 1 
ATOM 7770 C CA . ILE U 16 271  ? 209.640 178.853 289.342 1.00 237.19 ? 305  ILE Y CA 1 
ATOM 7771 C CA . LYS U 16 272  ? 209.233 180.459 292.843 1.00 254.82 ? 306  LYS Y CA 1 
ATOM 7772 C CA . GLY U 16 273  ? 208.505 184.033 291.854 1.00 235.16 ? 307  GLY Y CA 1 
ATOM 7773 C CA . MET U 16 274  ? 206.689 183.545 288.549 1.00 199.92 ? 308  MET Y CA 1 
ATOM 7774 C CA . ASP U 16 275  ? 203.349 182.668 290.174 1.00 267.73 ? 309  ASP Y CA 1 
ATOM 7775 C CA . VAL U 16 276  ? 203.036 186.159 291.653 1.00 194.04 ? 310  VAL Y CA 1 
ATOM 7776 C CA . TYR U 16 277  ? 204.692 187.953 288.701 1.00 172.16 ? 311  TYR Y CA 1 
ATOM 7777 C CA . GLY U 16 278  ? 202.361 186.800 285.905 1.00 225.96 ? 312  GLY Y CA 1 
ATOM 7778 C CA . TYR U 16 279  ? 199.477 188.495 287.731 1.00 229.79 ? 313  TYR Y CA 1 
ATOM 7779 C CA . LEU U 16 280  ? 201.570 191.678 288.184 1.00 180.28 ? 314  LEU Y CA 1 
ATOM 7780 C CA . LEU U 16 281  ? 201.922 192.161 284.395 1.00 184.54 ? 315  LEU Y CA 1 
ATOM 7781 C CA . ALA U 16 282  ? 198.098 191.807 283.972 1.00 298.31 ? 316  ALA Y CA 1 
ATOM 7782 C CA . ARG U 16 283  ? 197.426 194.528 286.582 1.00 212.40 ? 317  ARG Y CA 1 
ATOM 7783 C CA . GLU U 16 284  ? 200.168 196.511 284.746 1.00 211.68 ? 318  GLU Y CA 1 
ATOM 7784 C CA . GLY U 16 285  ? 198.313 195.811 281.454 1.00 206.50 ? 319  GLY Y CA 1 
ATOM 7785 C CA . ARG U 16 286  ? 201.256 194.221 279.593 1.00 188.96 ? 320  ARG Y CA 1 
ATOM 7786 C CA . LEU U 16 287  ? 199.836 191.160 277.821 1.00 203.86 ? 321  LEU Y CA 1 
ATOM 7787 C CA . GLU U 16 288  ? 202.875 190.616 275.549 1.00 201.78 ? 322  GLU Y CA 1 
ATOM 7788 C CA . ASP U 16 289  ? 205.144 190.117 278.599 1.00 207.19 ? 323  ASP Y CA 1 
ATOM 7789 C CA . VAL U 16 290  ? 202.794 187.387 279.894 1.00 219.58 ? 324  VAL Y CA 1 
ATOM 7790 C CA . GLU U 16 291  ? 202.815 185.423 276.608 1.00 213.01 ? 325  GLU Y CA 1 
ATOM 7791 C CA . ASN U 16 292  ? 206.614 185.550 276.468 1.00 262.90 ? 326  ASN Y CA 1 
ATOM 7792 C CA . LEU U 16 293  ? 206.869 184.627 280.187 1.00 400.27 ? 327  LEU Y CA 1 
ATOM 7793 C CA . GLY U 16 294  ? 204.518 181.688 279.417 1.00 422.75 ? 328  GLY Y CA 1 
ATOM 7794 C CA . CYS U 16 295  ? 206.836 180.448 276.631 1.00 405.66 ? 329  CYS Y CA 1 
ATOM 7795 C CA . ARG U 16 296  ? 209.906 180.842 278.924 1.00 399.16 ? 330  ARG Y CA 1 
ATOM 7796 C CA . LEU U 16 297  ? 208.225 178.854 281.737 1.00 399.89 ? 331  LEU Y CA 1 
ATOM 7797 C CA . PHE U 16 298  ? 207.126 175.819 279.685 1.00 297.38 ? 332  PHE Y CA 1 
ATOM 7798 C CA . ASN U 16 299  ? 210.558 175.586 278.038 1.00 210.16 ? 333  ASN Y CA 1 
ATOM 7799 C CA . ILE U 16 300  ? 212.440 175.733 281.341 1.00 179.37 ? 334  ILE Y CA 1 
ATOM 7800 C CA . SER U 16 301  ? 210.284 172.994 282.920 1.00 196.51 ? 335  SER Y CA 1 
ATOM 7801 C CA . ASP U 16 302  ? 207.065 171.090 282.948 1.00 293.76 ? 336  ASP Y CA 1 
ATOM 7802 C CA . GLN U 16 303  ? 205.329 169.531 285.995 1.00 336.22 ? 337  GLN Y CA 1 
ATOM 7803 C CA . HIS U 16 304  ? 205.144 172.893 287.895 1.00 309.49 ? 338  HIS Y CA 1 
ATOM 7804 C CA . ALA U 16 305  ? 202.053 174.895 288.749 1.00 252.97 ? 339  ALA Y CA 1 
ATOM 7805 C CA . GLU U 16 306  ? 203.539 178.257 287.785 1.00 372.39 ? 340  GLU Y CA 1 
ATOM 7806 C CA . PRO U 16 307  ? 203.893 177.758 283.952 1.00 495.46 ? 341  PRO Y CA 1 
ATOM 7807 C CA . TRP U 16 308  ? 200.215 176.682 283.853 1.00 490.86 ? 342  TRP Y CA 1 
ATOM 7808 C CA . VAL U 16 309  ? 199.190 179.599 286.162 1.00 491.20 ? 343  VAL Y CA 1 
ATOM 7809 C CA . VAL U 16 310  ? 200.852 182.275 283.954 1.00 455.16 ? 344  VAL Y CA 1 
ATOM 7810 C CA . SER U 16 311  ? 198.992 181.013 280.830 1.00 500.00 ? 345  SER Y CA 1 
ATOM 7811 C CA . GLY U 16 312  ? 195.783 181.146 282.912 1.00 500.00 ? 346  GLY Y CA 1 
ATOM 7812 C CA . CYS U 16 313  ? 196.688 184.737 283.954 1.00 500.00 ? 347  CYS Y CA 1 
ATOM 7813 C CA . HIS U 16 314  ? 196.929 185.696 280.264 1.00 500.00 ? 348  HIS Y CA 1 
ATOM 7814 C CA . SER U 16 315  ? 193.547 184.153 279.480 1.00 500.00 ? 349  SER Y CA 1 
ATOM 7815 C CA . PHE U 16 316  ? 191.140 186.399 281.524 1.00 500.00 ? 350  PHE Y CA 1 
ATOM 7816 C CA . TYR U 16 317  ? 192.597 189.488 279.876 1.00 500.00 ? 351  TYR Y CA 1 
ATOM 7817 C CA . SER U 16 318  ? 192.709 187.840 276.415 1.00 500.00 ? 352  SER Y CA 1 
ATOM 7818 C CA . LYS U 16 319  ? 188.978 186.972 277.087 1.00 500.00 ? 353  LYS Y CA 1 
ATOM 7819 C CA . ARG U 16 320  ? 189.235 183.192 276.311 1.00 500.00 ? 354  ARG Y CA 1 
ATOM 7820 C CA . TYR U 16 321  ? 187.792 181.962 279.641 1.00 500.00 ? 355  TYR Y CA 1 
ATOM 7821 C CA . SER U 16 322  ? 187.281 178.253 278.780 1.00 500.00 ? 356  SER Y CA 1 
ATOM 7822 C CA . ARG U 16 323  ? 191.042 177.879 278.152 1.00 500.00 ? 357  ARG Y CA 1 
ATOM 7823 C CA . ALA U 16 324  ? 191.957 179.561 281.497 1.00 500.00 ? 358  ALA Y CA 1 
ATOM 7824 C CA . LEU U 16 325  ? 189.583 177.217 283.368 1.00 500.00 ? 359  LEU Y CA 1 
ATOM 7825 C CA . TYR U 16 326  ? 191.300 173.995 282.184 1.00 500.00 ? 360  TYR Y CA 1 
ATOM 7826 C CA . LEU U 16 327  ? 194.973 175.122 282.272 1.00 500.00 ? 361  LEU Y CA 1 
ATOM 7827 C CA . GLY U 16 328  ? 194.342 176.519 285.793 1.00 355.23 ? 362  GLY Y CA 1 
ATOM 7828 C CA . ALA U 16 329  ? 192.790 173.268 286.990 1.00 221.09 ? 363  ALA Y CA 1 
ATOM 7829 C CA . LYS U 16 330  ? 196.113 171.532 286.134 1.00 208.41 ? 364  LYS Y CA 1 
ATOM 7830 C CA . ALA U 16 331  ? 197.904 174.262 288.025 1.00 234.18 ? 365  ALA Y CA 1 
ATOM 7831 C CA . ILE U 16 332  ? 195.936 173.297 291.191 1.00 249.59 ? 366  ILE Y CA 1 
ATOM 7832 C CA . GLN U 16 333  ? 196.662 169.626 290.504 1.00 228.94 ? 367  GLN Y CA 1 
ATOM 7833 C CA . LEU U 16 334  ? 200.456 170.099 290.249 1.00 206.62 ? 368  LEU Y CA 1 
ATOM 7834 C CA . ASN U 16 335  ? 200.791 172.390 293.292 1.00 250.66 ? 369  ASN Y CA 1 
ATOM 7835 C CA . SER U 16 336  ? 197.843 172.264 295.674 1.00 247.29 ? 370  SER Y CA 1 
ATOM 7836 C CA . ASN U 16 337  ? 199.622 174.608 298.082 1.00 271.78 ? 371  ASN Y CA 1 
ATOM 7837 C CA . SER U 16 338  ? 200.140 177.458 295.564 1.00 301.96 ? 372  SER Y CA 1 
ATOM 7838 C CA . VAL U 16 339  ? 197.302 179.892 296.187 1.00 233.90 ? 373  VAL Y CA 1 
ATOM 7839 C CA . GLN U 16 340  ? 197.281 181.902 293.014 1.00 186.50 ? 374  GLN Y CA 1 
ATOM 7840 C CA . ALA U 16 341  ? 196.309 178.773 291.063 1.00 200.88 ? 375  ALA Y CA 1 
ATOM 7841 C CA . LEU U 16 342  ? 193.002 178.204 292.885 1.00 225.25 ? 376  LEU Y CA 1 
ATOM 7842 C CA . LEU U 16 343  ? 191.823 181.843 292.763 1.00 317.51 ? 377  LEU Y CA 1 
ATOM 7843 C CA . LEU U 16 344  ? 192.907 181.916 289.066 1.00 475.49 ? 378  LEU Y CA 1 
ATOM 7844 C CA . LYS U 16 345  ? 190.445 179.119 288.208 1.00 500.00 ? 379  LYS Y CA 1 
ATOM 7845 C CA . GLY U 16 346  ? 187.733 181.007 290.157 1.00 500.00 ? 380  GLY Y CA 1 
ATOM 7846 C CA . ALA U 16 347  ? 188.048 184.247 288.152 1.00 500.00 ? 381  ALA Y CA 1 
ATOM 7847 C CA . ALA U 16 348  ? 187.832 182.359 284.807 1.00 500.00 ? 382  ALA Y CA 1 
ATOM 7848 C CA . LEU U 16 349  ? 184.552 180.784 285.998 1.00 500.00 ? 383  LEU Y CA 1 
ATOM 7849 C CA . ARG U 16 350  ? 183.226 184.197 287.146 1.00 500.00 ? 384  ARG Y CA 1 
ATOM 7850 C CA . ASN U 16 351  ? 183.549 185.861 283.719 1.00 500.00 ? 385  ASN Y CA 1 
ATOM 7851 C CA . MET U 16 352  ? 182.338 182.805 281.728 1.00 500.00 ? 386  MET Y CA 1 
ATOM 7852 C CA . GLY U 16 353  ? 178.937 182.707 283.560 1.00 500.00 ? 387  GLY Y CA 1 
ATOM 7853 C CA . ARG U 16 354  ? 178.787 180.040 286.305 1.00 500.00 ? 388  ARG Y CA 1 
ATOM 7854 C CA . VAL U 16 355  ? 178.816 182.439 289.316 1.00 500.00 ? 389  VAL Y CA 1 
ATOM 7855 C CA . GLN U 16 356  ? 177.615 179.966 292.023 1.00 500.00 ? 390  GLN Y CA 1 
ATOM 7856 C CA . GLU U 16 357  ? 180.205 177.406 290.820 1.00 500.00 ? 391  GLU Y CA 1 
ATOM 7857 C CA . ALA U 16 358  ? 182.891 180.160 290.769 1.00 500.00 ? 392  ALA Y CA 1 
ATOM 7858 C CA . ILE U 16 359  ? 181.984 181.173 294.351 1.00 500.00 ? 393  ILE Y CA 1 
ATOM 7859 C CA . ILE U 16 360  ? 183.005 177.778 295.901 1.00 492.25 ? 394  ILE Y CA 1 
ATOM 7860 C CA . HIS U 16 361  ? 186.591 177.911 294.486 1.00 264.63 ? 395  HIS Y CA 1 
ATOM 7861 C CA . PHE U 16 362  ? 187.256 181.328 296.052 1.00 201.92 ? 396  PHE Y CA 1 
ATOM 7862 C CA . ARG U 16 363  ? 186.030 179.943 299.389 1.00 219.16 ? 397  ARG Y CA 1 
ATOM 7863 C CA . GLU U 16 364  ? 188.629 177.134 299.433 1.00 255.21 ? 398  GLU Y CA 1 
ATOM 7864 C CA . ALA U 16 365  ? 191.196 179.642 298.033 1.00 247.51 ? 399  ALA Y CA 1 
ATOM 7865 C CA . ILE U 16 366  ? 190.805 182.136 300.931 1.00 197.52 ? 400  ILE Y CA 1 
ATOM 7866 C CA . ARG U 16 367  ? 192.004 179.547 303.530 1.00 222.77 ? 401  ARG Y CA 1 
ATOM 7867 C CA . LEU U 16 368  ? 195.056 178.693 301.387 1.00 235.59 ? 402  LEU Y CA 1 
ATOM 7868 C CA . ALA U 16 369  ? 195.895 182.410 301.159 1.00 247.87 ? 403  ALA Y CA 1 
ATOM 7869 C CA . PRO U 16 370  ? 195.317 184.126 304.444 1.00 233.39 ? 404  PRO Y CA 1 
ATOM 7870 C CA . CYS U 16 371  ? 196.172 187.879 304.417 1.00 277.93 ? 405  CYS Y CA 1 
ATOM 7871 C CA . ARG U 16 372  ? 196.386 188.387 300.605 1.00 322.46 ? 406  ARG Y CA 1 
ATOM 7872 C CA . LEU U 16 373  ? 194.419 191.487 299.533 1.00 289.39 ? 407  LEU Y CA 1 
ATOM 7873 C CA . ASP U 16 374  ? 193.838 190.200 295.994 1.00 306.26 ? 408  ASP Y CA 1 
ATOM 7874 C CA . CYS U 16 375  ? 192.231 186.967 297.210 1.00 295.16 ? 409  CYS Y CA 1 
ATOM 7875 C CA . TYR U 16 376  ? 189.758 188.788 299.440 1.00 238.75 ? 410  TYR Y CA 1 
ATOM 7876 C CA . GLU U 16 377  ? 188.732 191.212 296.679 1.00 229.33 ? 411  GLU Y CA 1 
ATOM 7877 C CA . GLY U 16 378  ? 187.649 188.385 294.333 1.00 243.27 ? 412  GLY Y CA 1 
ATOM 7878 C CA . LEU U 16 379  ? 185.434 186.788 296.978 1.00 300.02 ? 413  LEU Y CA 1 
ATOM 7879 C CA . ILE U 16 380  ? 183.691 190.075 297.920 1.00 500.00 ? 414  ILE Y CA 1 
ATOM 7880 C CA . GLU U 16 381  ? 183.342 191.200 294.243 1.00 500.00 ? 415  GLU Y CA 1 
ATOM 7881 C CA . CYS U 16 382  ? 181.717 187.882 293.206 1.00 500.00 ? 416  CYS Y CA 1 
ATOM 7882 C CA . TYR U 16 383  ? 179.087 188.211 295.963 1.00 500.00 ? 417  TYR Y CA 1 
ATOM 7883 C CA . LEU U 16 384  ? 178.314 191.790 294.767 1.00 500.00 ? 418  LEU Y CA 1 
ATOM 7884 C CA . ALA U 16 385  ? 177.413 190.252 291.364 1.00 500.00 ? 419  ALA Y CA 1 
ATOM 7885 C CA . SER U 16 386  ? 175.365 187.587 293.214 1.00 500.00 ? 420  SER Y CA 1 
ATOM 7886 C CA . ASN U 16 387  ? 173.654 190.478 295.159 1.00 500.00 ? 421  ASN Y CA 1 
ATOM 7887 C CA . SER U 16 388  ? 174.355 189.015 298.643 1.00 500.00 ? 422  SER Y CA 1 
ATOM 7888 C CA . ILE U 16 389  ? 174.789 192.437 300.304 1.00 500.00 ? 423  ILE Y CA 1 
ATOM 7889 C CA . ARG U 16 390  ? 174.940 191.592 304.055 1.00 500.00 ? 424  ARG Y CA 1 
ATOM 7890 C CA . GLU U 16 391  ? 177.113 188.529 303.330 1.00 500.00 ? 425  GLU Y CA 1 
ATOM 7891 C CA . ALA U 16 392  ? 179.639 190.777 301.508 1.00 500.00 ? 426  ALA Y CA 1 
ATOM 7892 C CA . MET U 16 393  ? 179.650 193.265 304.451 1.00 500.00 ? 427  MET Y CA 1 
ATOM 7893 C CA . VAL U 16 394  ? 180.357 190.496 307.036 1.00 500.00 ? 428  VAL Y CA 1 
ATOM 7894 C CA . MET U 16 395  ? 183.193 189.037 304.896 1.00 500.00 ? 429  MET Y CA 1 
ATOM 7895 C CA . ALA U 16 396  ? 184.647 192.555 304.505 1.00 500.00 ? 430  ALA Y CA 1 
ATOM 7896 C CA . ASN U 16 397  ? 184.696 192.881 308.314 1.00 488.88 ? 431  ASN Y CA 1 
ATOM 7897 C CA . ASN U 16 398  ? 186.684 189.599 308.494 1.00 287.71 ? 432  ASN Y CA 1 
ATOM 7898 C CA . VAL U 16 399  ? 189.325 190.831 306.027 1.00 304.53 ? 433  VAL Y CA 1 
ATOM 7899 C CA . TYR U 16 400  ? 189.274 194.144 307.976 1.00 500.00 ? 434  TYR Y CA 1 
ATOM 7900 C CA . LYS U 16 401  ? 189.929 192.284 311.268 1.00 500.00 ? 435  LYS Y CA 1 
ATOM 7901 C CA . THR U 16 402  ? 192.971 190.335 309.954 1.00 500.00 ? 436  THR Y CA 1 
ATOM 7902 C CA . LEU U 16 403  ? 194.798 193.272 308.293 1.00 500.00 ? 437  LEU Y CA 1 
ATOM 7903 C CA . GLY U 16 404  ? 193.763 195.760 311.027 1.00 500.00 ? 438  GLY Y CA 1 
ATOM 7904 C CA . ALA U 16 405  ? 194.661 199.465 311.176 1.00 500.00 ? 439  ALA Y CA 1 
ATOM 7905 C CA . ASN U 16 406  ? 196.523 201.520 308.489 1.00 500.00 ? 440  ASN Y CA 1 
ATOM 7906 C CA . ALA U 16 407  ? 195.396 199.359 305.528 1.00 500.00 ? 441  ALA Y CA 1 
ATOM 7907 C CA . GLN U 16 408  ? 194.179 201.366 302.517 1.00 500.00 ? 442  GLN Y CA 1 
ATOM 7908 C CA . THR U 16 409  ? 192.555 198.485 300.632 1.00 500.00 ? 443  THR Y CA 1 
ATOM 7909 C CA . LEU U 16 410  ? 190.329 197.496 303.606 1.00 413.37 ? 444  LEU Y CA 1 
ATOM 7910 C CA . THR U 16 411  ? 188.893 201.013 303.899 1.00 500.00 ? 445  THR Y CA 1 
ATOM 7911 C CA . LEU U 16 412  ? 188.493 201.053 300.075 1.00 500.00 ? 446  LEU Y CA 1 
ATOM 7912 C CA . LEU U 16 413  ? 186.711 197.632 300.175 1.00 500.00 ? 447  LEU Y CA 1 
ATOM 7913 C CA . ALA U 16 414  ? 184.451 198.731 303.076 1.00 500.00 ? 448  ALA Y CA 1 
ATOM 7914 C CA . THR U 16 415  ? 183.329 201.829 301.095 1.00 500.00 ? 449  THR Y CA 1 
ATOM 7915 C CA . VAL U 16 416  ? 182.167 199.568 298.225 1.00 500.00 ? 450  VAL Y CA 1 
ATOM 7916 C CA . CYS U 16 417  ? 180.479 197.347 300.879 1.00 500.00 ? 451  CYS Y CA 1 
ATOM 7917 C CA . LEU U 16 418  ? 178.672 200.410 302.256 1.00 500.00 ? 452  LEU Y CA 1 
ATOM 7918 C CA . GLU U 16 419  ? 177.593 201.449 298.719 1.00 500.00 ? 453  GLU Y CA 1 
ATOM 7919 C CA . ASP U 16 420  ? 175.629 198.153 298.587 1.00 500.00 ? 454  ASP Y CA 1 
ATOM 7920 C CA . PRO U 16 421  ? 172.963 199.165 301.193 1.00 500.00 ? 455  PRO Y CA 1 
ATOM 7921 C CA . VAL U 16 422  ? 173.183 202.685 299.558 1.00 500.00 ? 456  VAL Y CA 1 
ATOM 7922 C CA . THR U 16 423  ? 174.304 204.304 302.884 1.00 500.00 ? 457  THR Y CA 1 
ATOM 7923 C CA . GLN U 16 424  ? 176.428 206.896 301.043 1.00 500.00 ? 458  GLN Y CA 1 
ATOM 7924 C CA . GLU U 16 425  ? 177.268 209.035 304.116 1.00 500.00 ? 459  GLU Y CA 1 
ATOM 7925 C CA . LYS U 16 426  ? 178.991 206.229 306.094 1.00 500.00 ? 460  LYS Y CA 1 
ATOM 7926 C CA . ALA U 16 427  ? 180.844 205.017 302.958 1.00 500.00 ? 461  ALA Y CA 1 
ATOM 7927 C CA . LYS U 16 428  ? 182.163 208.523 302.020 1.00 500.00 ? 462  LYS Y CA 1 
ATOM 7928 C CA . THR U 16 429  ? 183.934 209.271 305.351 1.00 500.00 ? 463  THR Y CA 1 
ATOM 7929 C CA . LEU U 16 430  ? 185.816 205.947 305.057 1.00 500.00 ? 464  LEU Y CA 1 
ATOM 7930 C CA . LEU U 16 431  ? 186.848 206.760 301.442 1.00 500.00 ? 465  LEU Y CA 1 
ATOM 7931 C CA . ASP U 16 432  ? 188.097 210.221 302.523 1.00 500.00 ? 466  ASP Y CA 1 
ATOM 7932 C CA . LYS U 16 433  ? 190.067 208.470 305.320 1.00 500.00 ? 467  LYS Y CA 1 
ATOM 7933 C CA . ALA U 16 434  ? 191.633 205.970 302.852 1.00 500.00 ? 468  ALA Y CA 1 
ATOM 7934 C CA . LEU U 16 435  ? 193.088 208.814 300.760 1.00 500.00 ? 469  LEU Y CA 1 
ATOM 7935 C CA . THR U 16 436  ? 194.570 210.572 303.839 1.00 500.00 ? 470  THR Y CA 1 
ATOM 7936 C CA . GLN U 16 437  ? 196.557 207.403 304.713 1.00 500.00 ? 471  GLN Y CA 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1  1    MET 1    1    ?    ?   ?   A . n 
A 1  2    SER 2    2    ?    ?   ?   A . n 
A 1  3    ASN 3    3    ?    ?   ?   A . n 
A 1  4    PHE 4    4    ?    ?   ?   A . n 
A 1  5    TYR 5    5    ?    ?   ?   A . n 
A 1  6    GLU 6    6    ?    ?   ?   A . n 
A 1  7    GLU 7    7    ?    ?   ?   A . n 
A 1  8    ARG 8    8    ?    ?   ?   A . n 
A 1  9    THR 9    9    ?    ?   ?   A . n 
A 1  10   THR 10   10   ?    ?   ?   A . n 
A 1  11   MET 11   11   11   MET MET A . n 
A 1  12   ILE 12   12   12   ILE ILE A . n 
A 1  13   ALA 13   13   13   ALA ALA A . n 
A 1  14   ALA 14   14   14   ALA ALA A . n 
A 1  15   ARG 15   15   15   ARG ARG A . n 
A 1  16   ASP 16   16   16   ASP ASP A . n 
A 1  17   LEU 17   17   17   LEU LEU A . n 
A 1  18   GLN 18   18   18   GLN GLN A . n 
A 1  19   GLU 19   19   19   GLU GLU A . n 
A 1  20   PHE 20   20   20   PHE PHE A . n 
A 1  21   VAL 21   21   21   VAL VAL A . n 
A 1  22   PRO 22   22   22   PRO PRO A . n 
A 1  23   PHE 23   23   23   PHE PHE A . n 
A 1  24   GLY 24   24   24   GLY GLY A . n 
A 1  25   ARG 25   25   25   ARG ARG A . n 
A 1  26   ASP 26   26   26   ASP ASP A . n 
A 1  27   HIS 27   27   27   HIS HIS A . n 
A 1  28   CYS 28   28   28   CYS CYS A . n 
A 1  29   LYS 29   29   29   LYS LYS A . n 
A 1  30   HIS 30   30   30   HIS HIS A . n 
A 1  31   HIS 31   31   31   HIS HIS A . n 
A 1  32   PRO 32   32   32   PRO PRO A . n 
A 1  33   ASN 33   33   ?    ?   ?   A . n 
A 1  34   ALA 34   34   ?    ?   ?   A . n 
A 1  35   LEU 35   35   ?    ?   ?   A . n 
A 1  36   ASN 36   36   ?    ?   ?   A . n 
A 1  37   LEU 37   37   ?    ?   ?   A . n 
A 1  38   GLN 38   38   ?    ?   ?   A . n 
A 1  39   LEU 39   39   ?    ?   ?   A . n 
A 1  40   ARG 40   40   ?    ?   ?   A . n 
A 1  41   GLN 41   41   ?    ?   ?   A . n 
A 1  42   LEU 42   42   ?    ?   ?   A . n 
A 1  43   GLN 43   43   ?    ?   ?   A . n 
A 1  44   PRO 44   44   ?    ?   ?   A . n 
A 1  45   ALA 45   45   ?    ?   ?   A . n 
A 1  46   SER 46   46   ?    ?   ?   A . n 
A 1  47   GLU 47   47   ?    ?   ?   A . n 
A 1  48   LEU 48   48   ?    ?   ?   A . n 
A 1  49   TRP 49   49   ?    ?   ?   A . n 
A 1  50   SER 50   50   ?    ?   ?   A . n 
A 1  51   SER 51   51   ?    ?   ?   A . n 
A 1  52   ASP 52   52   ?    ?   ?   A . n 
A 1  53   GLY 53   53   ?    ?   ?   A . n 
A 1  54   ALA 54   54   ?    ?   ?   A . n 
A 1  55   ALA 55   55   ?    ?   ?   A . n 
A 1  56   GLY 56   56   ?    ?   ?   A . n 
A 1  57   LEU 57   57   ?    ?   ?   A . n 
A 1  58   VAL 58   58   ?    ?   ?   A . n 
A 1  59   GLY 59   59   ?    ?   ?   A . n 
A 1  60   SER 60   60   ?    ?   ?   A . n 
A 1  61   LEU 61   61   ?    ?   ?   A . n 
A 1  62   GLN 62   62   ?    ?   ?   A . n 
A 1  63   GLU 63   63   ?    ?   ?   A . n 
A 1  64   VAL 64   64   ?    ?   ?   A . n 
A 1  65   THR 65   65   ?    ?   ?   A . n 
A 1  66   ILE 66   66   ?    ?   ?   A . n 
A 1  67   HIS 67   67   ?    ?   ?   A . n 
A 1  68   GLU 68   68   ?    ?   ?   A . n 
A 1  69   LYS 69   69   ?    ?   ?   A . n 
A 1  70   GLN 70   70   ?    ?   ?   A . n 
A 1  71   LYS 71   71   71   LYS LYS A . n 
A 1  72   GLU 72   72   72   GLU GLU A . n 
A 1  73   SER 73   73   73   SER SER A . n 
A 1  74   TRP 74   74   74   TRP TRP A . n 
A 1  75   GLN 75   75   75   GLN GLN A . n 
A 1  76   LEU 76   76   76   LEU LEU A . n 
A 1  77   ARG 77   77   77   ARG ARG A . n 
A 1  78   LYS 78   78   78   LYS LYS A . n 
A 1  79   GLY 79   79   79   GLY ALA A . n 
A 1  80   VAL 80   80   80   VAL VAL A . n 
A 1  81   SER 81   81   81   SER SER A . n 
A 1  82   GLU 82   82   82   GLU GLU A . n 
A 1  83   ILE 83   83   83   ILE ILE A . n 
A 1  84   GLY 84   84   84   GLY GLY A . n 
A 1  85   GLU 85   85   85   GLU GLU A . n 
A 1  86   ASP 86   86   86   ASP ASP A . n 
A 1  87   VAL 87   87   87   VAL VAL A . n 
A 1  88   ASP 88   88   88   ASP ASP A . n 
A 1  89   TYR 89   89   89   TYR TYR A . n 
A 1  90   ASP 90   90   90   ASP ASP A . n 
A 1  91   GLU 91   91   91   GLU GLU A . n 
A 1  92   GLU 92   92   92   GLU GLU A . n 
A 1  93   LEU 93   93   93   LEU LEU A . n 
A 1  94   TYR 94   94   94   TYR TYR A . n 
A 1  95   VAL 95   95   95   VAL VAL A . n 
A 1  96   ALA 96   96   96   ALA ALA A . n 
A 1  97   GLY 97   97   97   GLY GLY A . n 
A 1  98   ASN 98   98   98   ASN ASN A . n 
A 1  99   MET 99   99   99   MET MET A . n 
A 1  100  VAL 100  100  100  VAL VAL A . n 
A 1  101  ILE 101  101  101  ILE ILE A . n 
A 1  102  TRP 102  102  102  TRP TRP A . n 
A 1  103  SER 103  103  103  SER SER A . n 
A 1  104  LYS 104  104  104  LYS LYS A . n 
A 1  105  GLY 105  105  105  GLY GLY A . n 
A 1  106  SER 106  106  106  SER SER A . n 
A 1  107  LYS 107  107  107  LYS LYS A . n 
A 1  108  SER 108  108  108  SER SER A . n 
A 1  109  GLN 109  109  109  GLN GLN A . n 
A 1  110  ALA 110  110  110  ALA ALA A . n 
A 1  111  LEU 111  111  111  LEU LEU A . n 
A 1  112  ALA 112  112  112  ALA ALA A . n 
A 1  113  VAL 113  113  113  VAL VAL A . n 
A 1  114  TYR 114  114  114  TYR TYR A . n 
A 1  115  LYS 115  115  115  LYS LYS A . n 
A 1  116  ALA 116  116  116  ALA ALA A . n 
A 1  117  PHE 117  117  117  PHE PHE A . n 
A 1  118  THR 118  118  118  THR THR A . n 
A 1  119  VAL 119  119  119  VAL VAL A . n 
A 1  120  ASP 120  120  120  ASP ASP A . n 
A 1  121  SER 121  121  121  SER SER A . n 
A 1  122  PRO 122  122  122  PRO PRO A . n 
A 1  123  VAL 123  123  123  VAL VAL A . n 
A 1  124  GLN 124  124  124  GLN GLN A . n 
A 1  125  GLN 125  125  125  GLN GLN A . n 
A 1  126  ALA 126  126  126  ALA ALA A . n 
A 1  127  LEU 127  127  127  LEU LEU A . n 
A 1  128  TRP 128  128  128  TRP TRP A . n 
A 1  129  CYS 129  129  129  CYS CYS A . n 
A 1  130  ASP 130  130  130  ASP ASP A . n 
A 1  131  PHE 131  131  131  PHE PHE A . n 
A 1  132  ILE 132  132  132  ILE ILE A . n 
A 1  133  ILE 133  133  133  ILE ILE A . n 
A 1  134  SER 134  134  134  SER SER A . n 
A 1  135  GLN 135  135  ?    ?   ?   A . n 
A 1  136  ASP 136  136  ?    ?   ?   A . n 
A 1  137  LYS 137  137  ?    ?   ?   A . n 
A 1  138  SER 138  138  ?    ?   ?   A . n 
A 1  139  GLU 139  139  ?    ?   ?   A . n 
A 1  140  LYS 140  140  ?    ?   ?   A . n 
A 1  141  ALA 141  141  ?    ?   ?   A . n 
A 1  142  TYR 142  142  ?    ?   ?   A . n 
A 1  143  SER 143  143  ?    ?   ?   A . n 
A 1  144  SER 144  144  ?    ?   ?   A . n 
A 1  145  ASN 145  145  ?    ?   ?   A . n 
A 1  146  GLU 146  146  146  GLU GLU A . n 
A 1  147  VAL 147  147  147  VAL VAL A . n 
A 1  148  GLU 148  148  148  GLU GLU A . n 
A 1  149  LYS 149  149  149  LYS LYS A . n 
A 1  150  CYS 150  150  150  CYS CYS A . n 
A 1  151  ILE 151  151  151  ILE ILE A . n 
A 1  152  CYS 152  152  152  CYS CYS A . n 
A 1  153  ILE 153  153  153  ILE ILE A . n 
A 1  154  LEU 154  154  154  LEU LEU A . n 
A 1  155  GLN 155  155  155  GLN GLN A . n 
A 1  156  SER 156  156  156  SER SER A . n 
A 1  157  SER 157  157  157  SER SER A . n 
A 1  158  CYS 158  158  158  CYS CYS A . n 
A 1  159  ILE 159  159  159  ILE ILE A . n 
A 1  160  ASN 160  160  160  ASN ASN A . n 
A 1  161  MET 161  161  161  MET MET A . n 
A 1  162  HIS 162  162  162  HIS HIS A . n 
A 1  163  SER 163  163  163  SER SER A . n 
A 1  164  ILE 164  164  164  ILE ILE A . n 
A 1  165  GLU 165  165  165  GLU GLU A . n 
A 1  166  GLY 166  166  166  GLY GLY A . n 
A 1  167  LYS 167  167  167  LYS LYS A . n 
A 1  168  ASP 168  168  168  ASP ASP A . n 
A 1  169  TYR 169  169  169  TYR TYR A . n 
A 1  170  ILE 170  170  170  ILE ILE A . n 
A 1  171  ALA 171  171  171  ALA ALA A . n 
A 1  172  SER 172  172  172  SER SER A . n 
A 1  173  LEU 173  173  173  LEU LEU A . n 
A 1  174  PRO 174  174  174  PRO PRO A . n 
A 1  175  PHE 175  175  175  PHE PHE A . n 
A 1  176  GLN 176  176  176  GLN GLN A . n 
A 1  177  VAL 177  177  177  VAL VAL A . n 
A 1  178  ALA 178  178  178  ALA ALA A . n 
A 1  179  ASN 179  179  179  ASN ASN A . n 
A 1  180  VAL 180  180  180  VAL VAL A . n 
A 1  181  TRP 181  181  181  TRP TRP A . n 
A 1  182  PRO 182  182  182  PRO PRO A . n 
A 1  183  THR 183  183  183  THR THR A . n 
A 1  184  LYS 184  184  184  LYS LYS A . n 
A 1  185  TYR 185  185  185  TYR TYR A . n 
A 1  186  GLY 186  186  186  GLY GLY A . n 
A 1  187  LEU 187  187  187  LEU LEU A . n 
A 1  188  LEU 188  188  188  LEU LEU A . n 
A 1  189  PHE 189  189  189  PHE PHE A . n 
A 1  190  GLU 190  190  190  GLU GLU A . n 
A 1  191  ARG 191  191  191  ARG ARG A . n 
A 1  192  SER 192  192  192  SER SER A . n 
A 1  193  ALA 193  193  ?    ?   ?   A . n 
A 1  194  SER 194  194  ?    ?   ?   A . n 
A 1  195  SER 195  195  ?    ?   ?   A . n 
A 1  196  HIS 196  196  ?    ?   ?   A . n 
A 1  197  GLU 197  197  ?    ?   ?   A . n 
A 1  198  VAL 198  198  ?    ?   ?   A . n 
A 1  199  PRO 199  199  ?    ?   ?   A . n 
A 1  200  PRO 200  200  ?    ?   ?   A . n 
A 1  201  GLY 201  201  ?    ?   ?   A . n 
A 1  202  SER 202  202  ?    ?   ?   A . n 
A 1  203  PRO 203  203  ?    ?   ?   A . n 
A 1  204  ARG 204  204  ?    ?   ?   A . n 
A 1  205  GLU 205  205  ?    ?   ?   A . n 
A 1  206  PRO 206  206  206  PRO PRO A . n 
A 1  207  LEU 207  207  207  LEU LEU A . n 
A 1  208  PRO 208  208  208  PRO PRO A . n 
A 1  209  THR 209  209  209  THR THR A . n 
A 1  210  MET 210  210  210  MET MET A . n 
A 1  211  PHE 211  211  211  PHE PHE A . n 
A 1  212  SER 212  212  212  SER SER A . n 
A 1  213  MET 213  213  213  MET MET A . n 
A 1  214  LEU 214  214  214  LEU LEU A . n 
A 1  215  HIS 215  215  215  HIS HIS A . n 
A 1  216  PRO 216  216  216  PRO PRO A . n 
A 1  217  LEU 217  217  217  LEU LEU A . n 
A 1  218  ASP 218  218  218  ASP ASP A . n 
A 1  219  GLU 219  219  219  GLU GLU A . n 
A 1  220  ILE 220  220  220  ILE ILE A . n 
A 1  221  THR 221  221  221  THR THR A . n 
A 1  222  PRO 222  222  222  PRO PRO A . n 
A 1  223  LEU 223  223  223  LEU LEU A . n 
A 1  224  VAL 224  224  224  VAL VAL A . n 
A 1  225  CYS 225  225  225  CYS CYS A . n 
A 1  226  LYS 226  226  226  LYS LYS A . n 
A 1  227  SER 227  227  ?    ?   ?   A . n 
A 1  228  GLY 228  228  ?    ?   ?   A . n 
A 1  229  SER 229  229  ?    ?   ?   A . n 
A 1  230  LEU 230  230  ?    ?   ?   A . n 
A 1  231  PHE 231  231  ?    ?   ?   A . n 
A 1  232  GLY 232  232  ?    ?   ?   A . n 
A 1  233  SER 233  233  ?    ?   ?   A . n 
A 1  234  SER 234  234  ?    ?   ?   A . n 
A 1  235  ARG 235  235  ?    ?   ?   A . n 
A 1  236  VAL 236  236  ?    ?   ?   A . n 
A 1  237  GLN 237  237  237  GLN GLN A . n 
A 1  238  TYR 238  238  238  TYR TYR A . n 
A 1  239  VAL 239  239  239  VAL VAL A . n 
A 1  240  VAL 240  240  240  VAL VAL A . n 
A 1  241  ASP 241  241  241  ASP ASP A . n 
A 1  242  HIS 242  242  242  HIS HIS A . n 
A 1  243  ALA 243  243  243  ALA ALA A . n 
A 1  244  MET 244  244  244  MET MET A . n 
A 1  245  LYS 245  245  245  LYS LYS A . n 
A 1  246  ILE 246  246  246  ILE ILE A . n 
A 1  247  VAL 247  247  247  VAL VAL A . n 
A 1  248  PHE 248  248  248  PHE PHE A . n 
A 1  249  LEU 249  249  249  LEU LEU A . n 
A 1  250  ASN 250  250  250  ASN ASN A . n 
A 1  251  THR 251  251  251  THR THR A . n 
A 1  252  ASP 252  252  252  ASP ASP A . n 
A 1  253  PRO 253  253  253  PRO PRO A . n 
A 1  254  SER 254  254  254  SER SER A . n 
A 1  255  ILE 255  255  255  ILE ILE A . n 
A 1  256  VAL 256  256  256  VAL VAL A . n 
A 1  257  MET 257  257  257  MET MET A . n 
A 1  258  THR 258  258  258  THR THR A . n 
A 1  259  TYR 259  259  259  TYR TYR A . n 
A 1  260  ASP 260  260  260  ASP ASP A . n 
A 1  261  ALA 261  261  261  ALA ALA A . n 
A 1  262  VAL 262  262  262  VAL VAL A . n 
A 1  263  GLN 263  263  263  GLN GLN A . n 
A 1  264  ASN 264  264  264  ASN ASN A . n 
A 1  265  VAL 265  265  265  VAL VAL A . n 
A 1  266  HIS 266  266  266  HIS HIS A . n 
A 1  267  SER 267  267  267  SER SER A . n 
A 1  268  VAL 268  268  268  VAL VAL A . n 
A 1  269  TRP 269  269  269  TRP TRP A . n 
A 1  270  THR 270  270  270  THR THR A . n 
A 1  271  LEU 271  271  271  LEU LEU A . n 
A 1  272  ARG 272  272  272  ARG ARG A . n 
A 1  273  ARG 273  273  273  ARG ARG A . n 
A 1  274  VAL 274  274  274  VAL VAL A . n 
A 1  275  LYS 275  275  275  LYS LYS A . n 
A 1  276  SER 276  276  276  SER ALA A . n 
A 1  277  GLU 277  277  277  GLU GLU A . n 
A 1  278  GLU 278  278  278  GLU ALA A . n 
A 1  279  GLU 279  279  279  GLU ALA A . n 
A 1  280  ASN 280  280  280  ASN ALA A . n 
A 1  281  VAL 281  281  281  VAL ALA A . n 
A 1  282  VAL 282  282  ?    ?   ?   A . n 
A 1  283  LEU 283  283  ?    ?   ?   A . n 
A 1  284  LYS 284  284  ?    ?   ?   A . n 
A 1  285  PHE 285  285  ?    ?   ?   A . n 
A 1  286  SER 286  286  ?    ?   ?   A . n 
A 1  287  GLU 287  287  ?    ?   ?   A . n 
A 1  288  GLN 288  288  ?    ?   ?   A . n 
A 1  289  GLY 289  289  ?    ?   ?   A . n 
A 1  290  GLY 290  290  ?    ?   ?   A . n 
A 1  291  THR 291  291  ?    ?   ?   A . n 
A 1  292  PRO 292  292  ?    ?   ?   A . n 
A 1  293  GLN 293  293  ?    ?   ?   A . n 
A 1  294  ASN 294  294  ?    ?   ?   A . n 
A 1  295  VAL 295  295  ?    ?   ?   A . n 
A 1  296  ALA 296  296  ?    ?   ?   A . n 
A 1  297  THR 297  297  ?    ?   ?   A . n 
A 1  298  SER 298  298  ?    ?   ?   A . n 
A 1  299  SER 299  299  ?    ?   ?   A . n 
A 1  300  SER 300  300  ?    ?   ?   A . n 
A 1  301  LEU 301  301  ?    ?   ?   A . n 
A 1  302  THR 302  302  ?    ?   ?   A . n 
A 1  303  ALA 303  303  ?    ?   ?   A . n 
A 1  304  HIS 304  304  ?    ?   ?   A . n 
A 1  305  LEU 305  305  ?    ?   ?   A . n 
A 1  306  ARG 306  306  ?    ?   ?   A . n 
A 1  307  SER 307  307  ?    ?   ?   A . n 
A 1  308  LEU 308  308  ?    ?   ?   A . n 
A 1  309  SER 309  309  ?    ?   ?   A . n 
A 1  310  LYS 310  310  ?    ?   ?   A . n 
A 1  311  GLY 311  311  ?    ?   ?   A . n 
A 1  312  ASP 312  312  ?    ?   ?   A . n 
A 1  313  SER 313  313  ?    ?   ?   A . n 
A 1  314  PRO 314  314  ?    ?   ?   A . n 
A 1  315  VAL 315  315  ?    ?   ?   A . n 
A 1  316  THR 316  316  ?    ?   ?   A . n 
A 1  317  SER 317  317  ?    ?   ?   A . n 
A 1  318  PRO 318  318  ?    ?   ?   A . n 
A 1  319  PHE 319  319  ?    ?   ?   A . n 
A 1  320  GLN 320  320  ?    ?   ?   A . n 
A 1  321  ASN 321  321  ?    ?   ?   A . n 
A 1  322  TYR 322  322  ?    ?   ?   A . n 
A 1  323  SER 323  323  ?    ?   ?   A . n 
A 1  324  SER 324  324  ?    ?   ?   A . n 
A 1  325  ILE 325  325  ?    ?   ?   A . n 
A 1  326  HIS 326  326  ?    ?   ?   A . n 
A 1  327  SER 327  327  ?    ?   ?   A . n 
A 1  328  GLN 328  328  ?    ?   ?   A . n 
A 1  329  SER 329  329  ?    ?   ?   A . n 
A 1  330  ARG 330  330  ?    ?   ?   A . n 
A 1  331  SER 331  331  ?    ?   ?   A . n 
A 1  332  THR 332  332  ?    ?   ?   A . n 
A 1  333  SER 333  333  ?    ?   ?   A . n 
A 1  334  SER 334  334  ?    ?   ?   A . n 
A 1  335  PRO 335  335  ?    ?   ?   A . n 
A 1  336  SER 336  336  ?    ?   ?   A . n 
A 1  337  LEU 337  337  ?    ?   ?   A . n 
A 1  338  HIS 338  338  ?    ?   ?   A . n 
A 1  339  SER 339  339  ?    ?   ?   A . n 
A 1  340  ARG 340  340  ?    ?   ?   A . n 
A 1  341  SER 341  341  ?    ?   ?   A . n 
A 1  342  PRO 342  342  ?    ?   ?   A . n 
A 1  343  SER 343  343  ?    ?   ?   A . n 
A 1  344  ILE 344  344  ?    ?   ?   A . n 
A 1  345  SER 345  345  ?    ?   ?   A . n 
A 1  346  ASN 346  346  ?    ?   ?   A . n 
A 1  347  MET 347  347  ?    ?   ?   A . n 
A 1  348  ALA 348  348  ?    ?   ?   A . n 
A 1  349  ALA 349  349  ?    ?   ?   A . n 
A 1  350  LEU 350  350  ?    ?   ?   A . n 
A 1  351  SER 351  351  ?    ?   ?   A . n 
A 1  352  ARG 352  352  ?    ?   ?   A . n 
A 1  353  ALA 353  353  ?    ?   ?   A . n 
A 1  354  HIS 354  354  ?    ?   ?   A . n 
A 1  355  SER 355  355  ?    ?   ?   A . n 
A 1  356  PRO 356  356  ?    ?   ?   A . n 
A 1  357  ALA 357  357  ?    ?   ?   A . n 
A 1  358  LEU 358  358  ?    ?   ?   A . n 
A 1  359  GLY 359  359  ?    ?   ?   A . n 
A 1  360  VAL 360  360  ?    ?   ?   A . n 
A 1  361  HIS 361  361  ?    ?   ?   A . n 
A 1  362  SER 362  362  ?    ?   ?   A . n 
A 1  363  PHE 363  363  ?    ?   ?   A . n 
A 1  364  SER 364  364  ?    ?   ?   A . n 
A 1  365  GLY 365  365  ?    ?   ?   A . n 
A 1  366  VAL 366  366  ?    ?   ?   A . n 
A 1  367  GLN 367  367  ?    ?   ?   A . n 
A 1  368  ARG 368  368  ?    ?   ?   A . n 
A 1  369  PHE 369  369  ?    ?   ?   A . n 
A 1  370  ASN 370  370  ?    ?   ?   A . n 
A 1  371  ILE 371  371  ?    ?   ?   A . n 
A 1  372  SER 372  372  ?    ?   ?   A . n 
A 1  373  SER 373  373  ?    ?   ?   A . n 
A 1  374  HIS 374  374  ?    ?   ?   A . n 
A 1  375  ASN 375  375  ?    ?   ?   A . n 
A 1  376  GLN 376  376  ?    ?   ?   A . n 
A 1  377  SER 377  377  ?    ?   ?   A . n 
A 1  378  PRO 378  378  ?    ?   ?   A . n 
A 1  379  LYS 379  379  ?    ?   ?   A . n 
A 1  380  ARG 380  380  ?    ?   ?   A . n 
A 1  381  HIS 381  381  ?    ?   ?   A . n 
A 1  382  SER 382  382  ?    ?   ?   A . n 
A 1  383  ILE 383  383  ?    ?   ?   A . n 
A 1  384  SER 384  384  ?    ?   ?   A . n 
A 1  385  HIS 385  385  ?    ?   ?   A . n 
A 1  386  SER 386  386  ?    ?   ?   A . n 
A 1  387  PRO 387  387  ?    ?   ?   A . n 
A 1  388  ASN 388  388  ?    ?   ?   A . n 
A 1  389  SER 389  389  ?    ?   ?   A . n 
A 1  390  ASN 390  390  ?    ?   ?   A . n 
A 1  391  SER 391  391  ?    ?   ?   A . n 
A 1  392  ASN 392  392  ?    ?   ?   A . n 
A 1  393  GLY 393  393  ?    ?   ?   A . n 
A 1  394  SER 394  394  ?    ?   ?   A . n 
A 1  395  PHE 395  395  ?    ?   ?   A . n 
A 1  396  LEU 396  396  ?    ?   ?   A . n 
A 1  397  ALA 397  397  ?    ?   ?   A . n 
A 1  398  PRO 398  398  ?    ?   ?   A . n 
A 1  399  GLU 399  399  ?    ?   ?   A . n 
A 1  400  THR 400  400  ?    ?   ?   A . n 
A 1  401  GLU 401  401  ?    ?   ?   A . n 
A 1  402  PRO 402  402  402  PRO PRO A . n 
A 1  403  ILE 403  403  403  ILE ILE A . n 
A 1  404  VAL 404  404  404  VAL VAL A . n 
A 1  405  PRO 405  405  405  PRO PRO A . n 
A 1  406  GLU 406  406  406  GLU GLU A . n 
A 1  407  LEU 407  407  407  LEU LEU A . n 
A 1  408  CYS 408  408  408  CYS CYS A . n 
A 1  409  ILE 409  409  409  ILE ILE A . n 
A 1  410  ASP 410  410  410  ASP ASP A . n 
A 1  411  HIS 411  411  411  HIS HIS A . n 
A 1  412  LEU 412  412  412  LEU LEU A . n 
A 1  413  TRP 413  413  413  TRP TRP A . n 
A 1  414  THR 414  414  414  THR ALA A . n 
A 1  415  GLU 415  415  ?    ?   ?   A . n 
A 1  416  THR 416  416  ?    ?   ?   A . n 
A 1  417  ILE 417  417  ?    ?   ?   A . n 
A 1  418  THR 418  418  ?    ?   ?   A . n 
A 1  419  ASN 419  419  ?    ?   ?   A . n 
A 1  420  ILE 420  420  ?    ?   ?   A . n 
A 1  421  ARG 421  421  ?    ?   ?   A . n 
A 1  422  GLU 422  422  ?    ?   ?   A . n 
A 1  423  LYS 423  423  ?    ?   ?   A . n 
A 1  424  ASN 424  424  ?    ?   ?   A . n 
A 1  425  SER 425  425  425  SER ALA A . n 
A 1  426  GLN 426  426  426  GLN GLN A . n 
A 1  427  ALA 427  427  427  ALA ALA A . n 
A 1  428  SER 428  428  428  SER SER A . n 
A 1  429  LYS 429  429  429  LYS LYS A . n 
A 1  430  VAL 430  430  430  VAL VAL A . n 
A 1  431  PHE 431  431  431  PHE PHE A . n 
A 1  432  ILE 432  432  432  ILE ILE A . n 
A 1  433  THR 433  433  433  THR THR A . n 
A 1  434  SER 434  434  434  SER SER A . n 
A 1  435  ASP 435  435  435  ASP ASP A . n 
A 1  436  LEU 436  436  436  LEU LEU A . n 
A 1  437  CYS 437  437  437  CYS CYS A . n 
A 1  438  GLY 438  438  438  GLY GLY A . n 
A 1  439  GLN 439  439  439  GLN GLN A . n 
A 1  440  LYS 440  440  440  LYS LYS A . n 
A 1  441  PHE 441  441  441  PHE PHE A . n 
A 1  442  LEU 442  442  442  LEU LEU A . n 
A 1  443  CYS 443  443  443  CYS CYS A . n 
A 1  444  PHE 444  444  444  PHE PHE A . n 
A 1  445  LEU 445  445  445  LEU LEU A . n 
A 1  446  VAL 446  446  446  VAL VAL A . n 
A 1  447  GLU 447  447  447  GLU GLU A . n 
A 1  448  SER 448  448  448  SER SER A . n 
A 1  449  GLN 449  449  449  GLN GLN A . n 
A 1  450  LEU 450  450  450  LEU LEU A . n 
A 1  451  GLN 451  451  451  GLN GLN A . n 
A 1  452  LEU 452  452  452  LEU LEU A . n 
A 1  453  ARG 453  453  453  ARG ARG A . n 
A 1  454  CYS 454  454  454  CYS CYS A . n 
A 1  455  VAL 455  455  455  VAL VAL A . n 
A 1  456  LYS 456  456  456  LYS LYS A . n 
A 1  457  PHE 457  457  457  PHE PHE A . n 
A 1  458  GLN 458  458  458  GLN GLN A . n 
A 1  459  GLU 459  459  459  GLU GLU A . n 
A 1  460  SER 460  460  460  SER SER A . n 
A 1  461  ASN 461  461  ?    ?   ?   A . n 
A 1  462  ASP 462  462  ?    ?   ?   A . n 
A 1  463  LYS 463  463  ?    ?   ?   A . n 
A 1  464  THR 464  464  464  THR THR A . n 
A 1  465  GLN 465  465  465  GLN ALA A . n 
A 1  466  LEU 466  466  466  LEU LEU A . n 
A 1  467  ILE 467  467  467  ILE ILE A . n 
A 1  468  PHE 468  468  468  PHE PHE A . n 
A 1  469  GLY 469  469  469  GLY GLY A . n 
A 1  470  SER 470  470  470  SER SER A . n 
A 1  471  VAL 471  471  471  VAL VAL A . n 
A 1  472  THR 472  472  472  THR THR A . n 
A 1  473  ASN 473  473  473  ASN ASN A . n 
A 1  474  ILE 474  474  474  ILE ILE A . n 
A 1  475  PRO 475  475  475  PRO PRO A . n 
A 1  476  ALA 476  476  476  ALA ALA A . n 
A 1  477  LYS 477  477  477  LYS LYS A . n 
A 1  478  ASP 478  478  478  ASP ASP A . n 
A 1  479  ALA 479  479  479  ALA ALA A . n 
A 1  480  ALA 480  480  480  ALA ALA A . n 
A 1  481  PRO 481  481  481  PRO PRO A . n 
A 1  482  VAL 482  482  482  VAL VAL A . n 
A 1  483  GLU 483  483  483  GLU GLU A . n 
A 1  484  LYS 484  484  484  LYS LYS A . n 
A 1  485  ILE 485  485  485  ILE ILE A . n 
A 1  486  ASP 486  486  486  ASP ASP A . n 
A 1  487  THR 487  487  487  THR THR A . n 
A 1  488  MET 488  488  488  MET MET A . n 
A 1  489  LEU 489  489  489  LEU LEU A . n 
A 1  490  VAL 490  490  490  VAL VAL A . n 
A 1  491  LEU 491  491  491  LEU LEU A . n 
A 1  492  GLU 492  492  492  GLU GLU A . n 
A 1  493  GLY 493  493  493  GLY GLY A . n 
A 1  494  SER 494  494  494  SER SER A . n 
A 1  495  GLY 495  495  495  GLY GLY A . n 
A 1  496  ASN 496  496  496  ASN ASN A . n 
A 1  497  LEU 497  497  497  LEU LEU A . n 
A 1  498  VAL 498  498  498  VAL VAL A . n 
A 1  499  LEU 499  499  499  LEU LEU A . n 
A 1  500  TYR 500  500  500  TYR TYR A . n 
A 1  501  THR 501  501  501  THR THR A . n 
A 1  502  GLY 502  502  502  GLY GLY A . n 
A 1  503  VAL 503  503  503  VAL VAL A . n 
A 1  504  VAL 504  504  504  VAL VAL A . n 
A 1  505  ARG 505  505  505  ARG ARG A . n 
A 1  506  VAL 506  506  506  VAL VAL A . n 
A 1  507  GLY 507  507  507  GLY GLY A . n 
A 1  508  LYS 508  508  508  LYS LYS A . n 
A 1  509  VAL 509  509  509  VAL VAL A . n 
A 1  510  PHE 510  510  510  PHE PHE A . n 
A 1  511  ILE 511  511  511  ILE ILE A . n 
A 1  512  PRO 512  512  512  PRO PRO A . n 
A 1  513  GLY 513  513  ?    ?   ?   A . n 
A 1  514  LEU 514  514  ?    ?   ?   A . n 
A 1  515  PRO 515  515  ?    ?   ?   A . n 
A 1  516  ALA 516  516  ?    ?   ?   A . n 
A 1  517  PRO 517  517  ?    ?   ?   A . n 
A 1  518  SER 518  518  ?    ?   ?   A . n 
A 1  519  LEU 519  519  ?    ?   ?   A . n 
A 1  520  THR 520  520  ?    ?   ?   A . n 
A 1  521  MET 521  521  ?    ?   ?   A . n 
A 1  522  SER 522  522  ?    ?   ?   A . n 
A 1  523  ASN 523  523  ?    ?   ?   A . n 
A 1  524  THR 524  524  ?    ?   ?   A . n 
A 1  525  MET 525  525  ?    ?   ?   A . n 
A 1  526  PRO 526  526  ?    ?   ?   A . n 
A 1  527  ARG 527  527  ?    ?   ?   A . n 
A 1  528  PRO 528  528  ?    ?   ?   A . n 
A 1  529  SER 529  529  ?    ?   ?   A . n 
A 1  530  THR 530  530  ?    ?   ?   A . n 
A 1  531  PRO 531  531  ?    ?   ?   A . n 
A 1  532  LEU 532  532  ?    ?   ?   A . n 
A 1  533  ASP 533  533  ?    ?   ?   A . n 
A 1  534  GLY 534  534  ?    ?   ?   A . n 
A 1  535  VAL 535  535  ?    ?   ?   A . n 
A 1  536  SER 536  536  ?    ?   ?   A . n 
A 1  537  THR 537  537  ?    ?   ?   A . n 
A 1  538  PRO 538  538  ?    ?   ?   A . n 
A 1  539  LYS 539  539  ?    ?   ?   A . n 
A 1  540  PRO 540  540  ?    ?   ?   A . n 
A 1  541  LEU 541  541  ?    ?   ?   A . n 
A 1  542  SER 542  542  ?    ?   ?   A . n 
A 1  543  LYS 543  543  ?    ?   ?   A . n 
A 1  544  LEU 544  544  ?    ?   ?   A . n 
A 1  545  LEU 545  545  ?    ?   ?   A . n 
A 1  546  GLY 546  546  ?    ?   ?   A . n 
A 1  547  SER 547  547  ?    ?   ?   A . n 
A 1  548  LEU 548  548  ?    ?   ?   A . n 
A 1  549  ASP 549  549  ?    ?   ?   A . n 
A 1  550  GLU 550  550  ?    ?   ?   A . n 
A 1  551  VAL 551  551  ?    ?   ?   A . n 
A 1  552  VAL 552  552  ?    ?   ?   A . n 
A 1  553  LEU 553  553  ?    ?   ?   A . n 
A 1  554  LEU 554  554  ?    ?   ?   A . n 
A 1  555  SER 555  555  ?    ?   ?   A . n 
A 1  556  PRO 556  556  ?    ?   ?   A . n 
A 1  557  VAL 557  557  ?    ?   ?   A . n 
A 1  558  PRO 558  558  ?    ?   ?   A . n 
A 1  559  GLU 559  559  ?    ?   ?   A . n 
A 1  560  LEU 560  560  ?    ?   ?   A . n 
A 1  561  ARG 561  561  ?    ?   ?   A . n 
A 1  562  ASP 562  562  ?    ?   ?   A . n 
A 1  563  SER 563  563  ?    ?   ?   A . n 
A 1  564  SER 564  564  ?    ?   ?   A . n 
A 1  565  LYS 565  565  ?    ?   ?   A . n 
A 1  566  LEU 566  566  ?    ?   ?   A . n 
A 1  567  HIS 567  567  ?    ?   ?   A . n 
A 1  568  ASP 568  568  ?    ?   ?   A . n 
A 1  569  SER 569  569  ?    ?   ?   A . n 
A 1  570  LEU 570  570  ?    ?   ?   A . n 
A 1  571  TYR 571  571  ?    ?   ?   A . n 
A 1  572  ASN 572  572  ?    ?   ?   A . n 
A 1  573  GLU 573  573  ?    ?   ?   A . n 
A 1  574  ASP 574  574  ?    ?   ?   A . n 
A 1  575  CYS 575  575  ?    ?   ?   A . n 
A 1  576  THR 576  576  ?    ?   ?   A . n 
A 1  577  PHE 577  577  ?    ?   ?   A . n 
A 1  578  GLN 578  578  ?    ?   ?   A . n 
A 1  579  GLN 579  579  ?    ?   ?   A . n 
A 1  580  LEU 580  580  ?    ?   ?   A . n 
A 1  581  GLY 581  581  513  GLY ALA A . n 
A 1  582  THR 582  582  582  THR THR A . n 
A 1  583  TYR 583  583  583  TYR TYR A . n 
A 1  584  ILE 584  584  584  ILE ILE A . n 
A 1  585  HIS 585  585  585  HIS HIS A . n 
A 1  586  SER 586  586  586  SER SER A . n 
A 1  587  ILE 587  587  587  ILE ILE A . n 
A 1  588  ARG 588  588  588  ARG ARG A . n 
A 1  589  ASP 589  589  589  ASP ASP A . n 
A 1  590  PRO 590  590  590  PRO PRO A . n 
A 1  591  VAL 591  591  591  VAL VAL A . n 
A 1  592  HIS 592  592  592  HIS HIS A . n 
A 1  593  ASN 593  593  593  ASN ASN A . n 
A 1  594  ARG 594  594  594  ARG ARG A . n 
A 1  595  VAL 595  595  595  VAL VAL A . n 
A 1  596  THR 596  596  596  THR THR A . n 
A 1  597  LEU 597  597  597  LEU LEU A . n 
A 1  598  GLU 598  598  598  GLU GLU A . n 
A 1  599  LEU 599  599  599  LEU LEU A . n 
A 1  600  SER 600  600  600  SER SER A . n 
A 1  601  ASN 601  601  601  ASN ASN A . n 
A 1  602  GLY 602  602  602  GLY GLY A . n 
A 1  603  SER 603  603  603  SER SER A . n 
A 1  604  MET 604  604  604  MET MET A . n 
A 1  605  VAL 605  605  605  VAL VAL A . n 
A 1  606  ARG 606  606  606  ARG ARG A . n 
A 1  607  ILE 607  607  607  ILE ILE A . n 
A 1  608  THR 608  608  608  THR THR A . n 
A 1  609  ILE 609  609  609  ILE ILE A . n 
A 1  610  PRO 610  610  610  PRO PRO A . n 
A 1  611  GLU 611  611  611  GLU GLU A . n 
A 1  612  ILE 612  612  612  ILE ILE A . n 
A 1  613  ALA 613  613  613  ALA ALA A . n 
A 1  614  THR 614  614  614  THR THR A . n 
A 1  615  SER 615  615  615  SER SER A . n 
A 1  616  GLU 616  616  616  GLU GLU A . n 
A 1  617  LEU 617  617  617  LEU LEU A . n 
A 1  618  VAL 618  618  618  VAL VAL A . n 
A 1  619  GLN 619  619  619  GLN GLN A . n 
A 1  620  THR 620  620  620  THR THR A . n 
A 1  621  CYS 621  621  621  CYS CYS A . n 
A 1  622  LEU 622  622  622  LEU LEU A . n 
A 1  623  GLN 623  623  623  GLN GLN A . n 
A 1  624  ALA 624  624  624  ALA ALA A . n 
A 1  625  ILE 625  625  625  ILE ILE A . n 
A 1  626  LYS 626  626  626  LYS LYS A . n 
A 1  627  PHE 627  627  627  PHE PHE A . n 
A 1  628  ILE 628  628  628  ILE ILE A . n 
A 1  629  LEU 629  629  629  LEU LEU A . n 
A 1  630  PRO 630  630  630  PRO PRO A . n 
A 1  631  LYS 631  631  631  LYS LYS A . n 
A 1  632  GLU 632  632  632  GLU GLU A . n 
A 1  633  ILE 633  633  633  ILE ILE A . n 
A 1  634  ALA 634  634  634  ALA ALA A . n 
A 1  635  VAL 635  635  635  VAL VAL A . n 
A 1  636  GLN 636  636  636  GLN GLN A . n 
A 1  637  MET 637  637  637  MET MET A . n 
A 1  638  LEU 638  638  638  LEU LEU A . n 
A 1  639  VAL 639  639  639  VAL VAL A . n 
A 1  640  LYS 640  640  640  LYS LYS A . n 
A 1  641  TRP 641  641  641  TRP TRP A . n 
A 1  642  TYR 642  642  642  TYR TYR A . n 
A 1  643  ASN 643  643  643  ASN ASN A . n 
A 1  644  VAL 644  644  644  VAL VAL A . n 
A 1  645  HIS 645  645  645  HIS HIS A . n 
A 1  646  SER 646  646  646  SER SER A . n 
A 1  647  ALA 647  647  647  ALA ALA A . n 
A 1  648  PRO 648  648  648  PRO PRO A . n 
A 1  649  GLY 649  649  649  GLY GLY A . n 
A 1  650  GLY 650  650  650  GLY GLY A . n 
A 1  651  PRO 651  651  651  PRO ALA A . n 
A 1  652  SER 652  652  652  SER SER A . n 
A 1  653  TYR 653  653  653  TYR TYR A . n 
A 1  654  HIS 654  654  654  HIS HIS A . n 
A 1  655  SER 655  655  655  SER SER A . n 
A 1  656  GLU 656  656  656  GLU ALA A . n 
A 1  657  TRP 657  657  657  TRP TRP A . n 
A 1  658  ASN 658  658  658  ASN ASN A . n 
A 1  659  LEU 659  659  659  LEU LEU A . n 
A 1  660  PHE 660  660  660  PHE PHE A . n 
A 1  661  VAL 661  661  661  VAL VAL A . n 
A 1  662  THR 662  662  662  THR THR A . n 
A 1  663  CYS 663  663  663  CYS CYS A . n 
A 1  664  LEU 664  664  664  LEU LEU A . n 
A 1  665  MET 665  665  665  MET MET A . n 
A 1  666  ASN 666  666  666  ASN ASN A . n 
A 1  667  MET 667  667  667  MET MET A . n 
A 1  668  MET 668  668  668  MET MET A . n 
A 1  669  GLY 669  669  669  GLY GLY A . n 
A 1  670  TYR 670  670  670  TYR TYR A . n 
A 1  671  ASN 671  671  671  ASN ALA A . n 
A 1  672  THR 672  672  ?    ?   ?   A . n 
A 1  673  ASP 673  673  ?    ?   ?   A . n 
A 1  674  ARG 674  674  ?    ?   ?   A . n 
A 1  675  LEU 675  675  ?    ?   ?   A . n 
A 1  676  ALA 676  676  ?    ?   ?   A . n 
A 1  677  TRP 677  677  ?    ?   ?   A . n 
A 1  678  THR 678  678  ?    ?   ?   A . n 
A 1  679  ARG 679  679  ?    ?   ?   A . n 
A 1  680  ASN 680  680  ?    ?   ?   A . n 
A 1  681  PHE 681  681  ?    ?   ?   A . n 
A 1  682  ASP 682  682  ?    ?   ?   A . n 
A 1  683  PHE 683  683  ?    ?   ?   A . n 
A 1  684  GLU 684  684  ?    ?   ?   A . n 
A 1  685  GLY 685  685  ?    ?   ?   A . n 
A 1  686  SER 686  686  ?    ?   ?   A . n 
A 1  687  LEU 687  687  ?    ?   ?   A . n 
A 1  688  SER 688  688  ?    ?   ?   A . n 
A 1  689  PRO 689  689  ?    ?   ?   A . n 
A 1  690  VAL 690  690  ?    ?   ?   A . n 
A 1  691  ILE 691  691  ?    ?   ?   A . n 
A 1  692  ALA 692  692  ?    ?   ?   A . n 
A 1  693  PRO 693  693  ?    ?   ?   A . n 
A 1  694  LYS 694  694  ?    ?   ?   A . n 
A 1  695  LYS 695  695  ?    ?   ?   A . n 
A 1  696  ALA 696  696  ?    ?   ?   A . n 
A 1  697  ARG 697  697  ?    ?   ?   A . n 
A 1  698  PRO 698  698  ?    ?   ?   A . n 
A 1  699  SER 699  699  ?    ?   ?   A . n 
A 1  700  GLU 700  700  ?    ?   ?   A . n 
A 1  701  THR 701  701  ?    ?   ?   A . n 
A 1  702  GLY 702  702  ?    ?   ?   A . n 
A 1  703  SER 703  703  ?    ?   ?   A . n 
A 1  704  ASP 704  704  ?    ?   ?   A . n 
A 1  705  ASP 705  705  ?    ?   ?   A . n 
A 1  706  ASP 706  706  ?    ?   ?   A . n 
A 1  707  TRP 707  707  ?    ?   ?   A . n 
A 1  708  GLU 708  708  ?    ?   ?   A . n 
A 1  709  TYR 709  709  ?    ?   ?   A . n 
A 1  710  LEU 710  710  ?    ?   ?   A . n 
A 1  711  LEU 711  711  ?    ?   ?   A . n 
A 1  712  ASN 712  712  ?    ?   ?   A . n 
A 1  713  SER 713  713  ?    ?   ?   A . n 
A 1  714  ASP 714  714  ?    ?   ?   A . n 
A 1  715  TYR 715  715  ?    ?   ?   A . n 
A 1  716  HIS 716  716  ?    ?   ?   A . n 
A 1  717  GLN 717  717  ?    ?   ?   A . n 
A 1  718  ASN 718  718  ?    ?   ?   A . n 
A 1  719  VAL 719  719  ?    ?   ?   A . n 
A 1  720  GLU 720  720  ?    ?   ?   A . n 
A 1  721  SER 721  721  ?    ?   ?   A . n 
A 1  722  HIS 722  722  ?    ?   ?   A . n 
A 1  723  LEU 723  723  ?    ?   ?   A . n 
A 1  724  LEU 724  724  ?    ?   ?   A . n 
A 1  725  ASN 725  725  ?    ?   ?   A . n 
A 1  726  ARG 726  726  ?    ?   ?   A . n 
A 1  727  SER 727  727  ?    ?   ?   A . n 
A 1  728  LEU 728  728  ?    ?   ?   A . n 
A 1  729  CYS 729  729  ?    ?   ?   A . n 
A 1  730  LEU 730  730  ?    ?   ?   A . n 
A 1  731  SER 731  731  ?    ?   ?   A . n 
A 1  732  PRO 732  732  ?    ?   ?   A . n 
A 1  733  SER 733  733  ?    ?   ?   A . n 
A 1  734  GLU 734  734  ?    ?   ?   A . n 
A 1  735  ALA 735  735  ?    ?   ?   A . n 
A 1  736  SER 736  736  ?    ?   ?   A . n 
A 1  737  GLN 737  737  ?    ?   ?   A . n 
A 1  738  MET 738  738  ?    ?   ?   A . n 
A 1  739  LYS 739  739  ?    ?   ?   A . n 
A 1  740  ASP 740  740  ?    ?   ?   A . n 
A 1  741  GLU 741  741  ?    ?   ?   A . n 
A 1  742  ASP 742  742  ?    ?   ?   A . n 
A 1  743  PHE 743  743  ?    ?   ?   A . n 
A 1  744  SER 744  744  ?    ?   ?   A . n 
A 1  745  GLN 745  745  ?    ?   ?   A . n 
A 1  746  ASN 746  746  ?    ?   ?   A . n 
A 1  747  LEU 747  747  ?    ?   ?   A . n 
A 1  748  SER 748  748  ?    ?   ?   A . n 
A 1  749  LEU 749  749  ?    ?   ?   A . n 
A 1  750  ASP 750  750  ?    ?   ?   A . n 
A 1  751  SER 751  751  ?    ?   ?   A . n 
A 1  752  SER 752  752  ?    ?   ?   A . n 
A 1  753  THR 753  753  ?    ?   ?   A . n 
A 1  754  LEU 754  754  ?    ?   ?   A . n 
A 1  755  LEU 755  755  ?    ?   ?   A . n 
A 1  756  PHE 756  756  ?    ?   ?   A . n 
A 1  757  THR 757  757  757  THR THR A . n 
A 1  758  HIS 758  758  758  HIS HIS A . n 
A 1  759  ILE 759  759  759  ILE ILE A . n 
A 1  760  PRO 760  760  760  PRO PRO A . n 
A 1  761  ALA 761  761  761  ALA ALA A . n 
A 1  762  ILE 762  762  762  ILE ILE A . n 
A 1  763  PHE 763  763  763  PHE PHE A . n 
A 1  764  PHE 764  764  764  PHE PHE A . n 
A 1  765  VAL 765  765  765  VAL VAL A . n 
A 1  766  LEU 766  766  766  LEU LEU A . n 
A 1  767  HIS 767  767  767  HIS HIS A . n 
A 1  768  LEU 768  768  768  LEU LEU A . n 
A 1  769  VAL 769  769  769  VAL VAL A . n 
A 1  770  TYR 770  770  770  TYR TYR A . n 
A 1  771  GLU 771  771  771  GLU GLU A . n 
A 1  772  GLU 772  772  772  GLU GLU A . n 
A 1  773  LEU 773  773  773  LEU LEU A . n 
A 1  774  LYS 774  774  774  LYS LYS A . n 
A 1  775  LEU 775  775  775  LEU LEU A . n 
A 1  776  ASN 776  776  776  ASN ASN A . n 
A 1  777  THR 777  777  777  THR THR A . n 
A 1  778  LEU 778  778  778  LEU LEU A . n 
A 1  779  MET 779  779  779  MET MET A . n 
A 1  780  GLY 780  780  780  GLY GLY A . n 
A 1  781  GLU 781  781  781  GLU GLU A . n 
A 1  782  GLY 782  782  782  GLY GLY A . n 
A 1  783  ILE 783  783  783  ILE ILE A . n 
A 1  784  CYS 784  784  784  CYS CYS A . n 
A 1  785  SER 785  785  785  SER SER A . n 
A 1  786  LEU 786  786  786  LEU LEU A . n 
A 1  787  VAL 787  787  787  VAL VAL A . n 
A 1  788  GLU 788  788  788  GLU GLU A . n 
A 1  789  LEU 789  789  789  LEU LEU A . n 
A 1  790  LEU 790  790  790  LEU LEU A . n 
A 1  791  VAL 791  791  791  VAL VAL A . n 
A 1  792  GLN 792  792  792  GLN GLN A . n 
A 1  793  LEU 793  793  793  LEU LEU A . n 
A 1  794  ALA 794  794  794  ALA ALA A . n 
A 1  795  ARG 795  795  795  ARG ARG A . n 
A 1  796  ASP 796  796  796  ASP ASP A . n 
A 1  797  LEU 797  797  797  LEU LEU A . n 
A 1  798  LYS 798  798  798  LYS LYS A . n 
A 1  799  LEU 799  799  799  LEU LEU A . n 
A 1  800  GLY 800  800  800  GLY GLY A . n 
A 1  801  PRO 801  801  801  PRO PRO A . n 
A 1  802  TYR 802  802  802  TYR TYR A . n 
A 1  803  VAL 803  803  803  VAL VAL A . n 
A 1  804  ASP 804  804  804  ASP ASP A . n 
A 1  805  HIS 805  805  805  HIS HIS A . n 
A 1  806  TYR 806  806  806  TYR TYR A . n 
A 1  807  TYR 807  807  807  TYR TYR A . n 
A 1  808  ARG 808  808  808  ARG ARG A . n 
A 1  809  ASP 809  809  809  ASP ASP A . n 
A 1  810  TYR 810  810  810  TYR TYR A . n 
A 1  811  PRO 811  811  811  PRO PRO A . n 
A 1  812  THR 812  812  812  THR THR A . n 
A 1  813  LEU 813  813  813  LEU LEU A . n 
A 1  814  VAL 814  814  814  VAL ALA A . n 
A 1  815  ARG 815  815  ?    ?   ?   A . n 
A 1  816  THR 816  816  ?    ?   ?   A . n 
A 1  817  THR 817  817  ?    ?   ?   A . n 
A 1  818  GLY 818  818  ?    ?   ?   A . n 
A 1  819  GLN 819  819  ?    ?   ?   A . n 
A 1  820  VAL 820  820  ?    ?   ?   A . n 
A 1  821  CYS 821  821  ?    ?   ?   A . n 
A 1  822  THR 822  822  ?    ?   ?   A . n 
A 1  823  ILE 823  823  ?    ?   ?   A . n 
A 1  824  ASP 824  824  ?    ?   ?   A . n 
A 1  825  PRO 825  825  ?    ?   ?   A . n 
A 1  826  GLY 826  826  ?    ?   ?   A . n 
A 1  827  GLN 827  827  ?    ?   ?   A . n 
A 1  828  THR 828  828  ?    ?   ?   A . n 
A 1  829  GLY 829  829  ?    ?   ?   A . n 
A 1  830  PHE 830  830  ?    ?   ?   A . n 
A 1  831  MET 831  831  ?    ?   ?   A . n 
A 1  832  HIS 832  832  ?    ?   ?   A . n 
A 1  833  HIS 833  833  ?    ?   ?   A . n 
A 1  834  PRO 834  834  ?    ?   ?   A . n 
A 1  835  SER 835  835  ?    ?   ?   A . n 
A 1  836  PHE 836  836  ?    ?   ?   A . n 
A 1  837  PHE 837  837  837  PHE ALA A . n 
A 1  838  THR 838  838  838  THR ALA A . n 
A 1  839  SER 839  839  839  SER SER A . n 
A 1  840  GLU 840  840  840  GLU GLU A . n 
A 1  841  PRO 841  841  841  PRO PRO A . n 
A 1  842  PRO 842  842  842  PRO PRO A . n 
A 1  843  SER 843  843  843  SER SER A . n 
A 1  844  ILE 844  844  844  ILE ILE A . n 
A 1  845  TYR 845  845  845  TYR TYR A . n 
A 1  846  GLN 846  846  846  GLN GLN A . n 
A 1  847  TRP 847  847  847  TRP TRP A . n 
A 1  848  VAL 848  848  848  VAL VAL A . n 
A 1  849  SER 849  849  849  SER SER A . n 
A 1  850  SER 850  850  850  SER SER A . n 
A 1  851  CYS 851  851  851  CYS CYS A . n 
A 1  852  LEU 852  852  852  LEU LEU A . n 
A 1  853  LYS 853  853  853  LYS LYS A . n 
A 1  854  GLY 854  854  854  GLY GLY A . n 
A 1  855  GLU 855  855  855  GLU GLU A . n 
A 1  856  GLY 856  856  856  GLY GLY A . n 
A 1  857  MET 857  857  857  MET ALA A . n 
A 1  858  PRO 858  858  858  PRO PRO A . n 
A 1  859  PRO 859  859  859  PRO PRO A . n 
A 1  860  TYR 860  860  860  TYR TYR A . n 
A 1  861  PRO 861  861  861  PRO PRO A . n 
A 1  862  TYR 862  862  862  TYR TYR A . n 
A 1  863  LEU 863  863  863  LEU LEU A . n 
A 1  864  PRO 864  864  864  PRO PRO A . n 
A 1  865  GLY 865  865  865  GLY GLY A . n 
A 1  866  ILE 866  866  866  ILE ILE A . n 
A 1  867  CYS 867  867  867  CYS CYS A . n 
A 1  868  GLU 868  868  868  GLU GLU A . n 
A 1  869  ARG 869  869  869  ARG ARG A . n 
A 1  870  SER 870  870  870  SER SER A . n 
A 1  871  ARG 871  871  871  ARG ARG A . n 
A 1  872  LEU 872  872  872  LEU LEU A . n 
A 1  873  VAL 873  873  873  VAL VAL A . n 
A 1  874  VAL 874  874  874  VAL VAL A . n 
A 1  875  LEU 875  875  875  LEU LEU A . n 
A 1  876  SER 876  876  876  SER SER A . n 
A 1  877  ILE 877  877  877  ILE ILE A . n 
A 1  878  ALA 878  878  878  ALA ALA A . n 
A 1  879  LEU 879  879  879  LEU LEU A . n 
A 1  880  TYR 880  880  880  TYR TYR A . n 
A 1  881  ILE 881  881  881  ILE ILE A . n 
A 1  882  LEU 882  882  882  LEU LEU A . n 
A 1  883  GLY 883  883  ?    ?   ?   A . n 
A 1  884  ASP 884  884  ?    ?   ?   A . n 
A 1  885  GLU 885  885  ?    ?   ?   A . n 
A 1  886  SER 886  886  ?    ?   ?   A . n 
A 1  887  LEU 887  887  ?    ?   ?   A . n 
A 1  888  VAL 888  888  ?    ?   ?   A . n 
A 1  889  SER 889  889  ?    ?   ?   A . n 
A 1  890  ASP 890  890  ?    ?   ?   A . n 
A 1  891  GLU 891  891  ?    ?   ?   A . n 
A 1  892  SER 892  892  ?    ?   ?   A . n 
A 1  893  SER 893  893  ?    ?   ?   A . n 
A 1  894  GLN 894  894  ?    ?   ?   A . n 
A 1  895  TYR 895  895  ?    ?   ?   A . n 
A 1  896  LEU 896  896  ?    ?   ?   A . n 
A 1  897  THR 897  897  ?    ?   ?   A . n 
A 1  898  ARG 898  898  ?    ?   ?   A . n 
A 1  899  ILE 899  899  ?    ?   ?   A . n 
A 1  900  THR 900  900  ?    ?   ?   A . n 
A 1  901  ILE 901  901  ?    ?   ?   A . n 
A 1  902  ALA 902  902  ?    ?   ?   A . n 
A 1  903  PRO 903  903  ?    ?   ?   A . n 
A 1  904  GLN 904  904  ?    ?   ?   A . n 
A 1  905  LYS 905  905  ?    ?   ?   A . n 
A 1  906  LEU 906  906  ?    ?   ?   A . n 
A 1  907  GLN 907  907  ?    ?   ?   A . n 
A 1  908  VAL 908  908  ?    ?   ?   A . n 
A 1  909  GLU 909  909  ?    ?   ?   A . n 
A 1  910  GLN 910  910  ?    ?   ?   A . n 
A 1  911  GLU 911  911  ?    ?   ?   A . n 
A 1  912  GLU 912  912  ?    ?   ?   A . n 
A 1  913  ASN 913  913  ?    ?   ?   A . n 
A 1  914  ARG 914  914  ?    ?   ?   A . n 
A 1  915  PHE 915  915  ?    ?   ?   A . n 
A 1  916  SER 916  916  ?    ?   ?   A . n 
A 1  917  PHE 917  917  ?    ?   ?   A . n 
A 1  918  ARG 918  918  ?    ?   ?   A . n 
A 1  919  HIS 919  919  ?    ?   ?   A . n 
A 1  920  SER 920  920  ?    ?   ?   A . n 
A 1  921  THR 921  921  ?    ?   ?   A . n 
A 1  922  SER 922  922  ?    ?   ?   A . n 
A 1  923  VAL 923  923  ?    ?   ?   A . n 
A 1  924  SER 924  924  924  SER SER A . n 
A 1  925  SER 925  925  925  SER SER A . n 
A 1  926  LEU 926  926  926  LEU LEU A . n 
A 1  927  ALA 927  927  927  ALA ALA A . n 
A 1  928  GLU 928  928  928  GLU GLU A . n 
A 1  929  ARG 929  929  929  ARG ARG A . n 
A 1  930  LEU 930  930  930  LEU LEU A . n 
A 1  931  VAL 931  931  931  VAL VAL A . n 
A 1  932  VAL 932  932  932  VAL VAL A . n 
A 1  933  TRP 933  933  933  TRP TRP A . n 
A 1  934  MET 934  934  934  MET MET A . n 
A 1  935  THR 935  935  935  THR THR A . n 
A 1  936  ASN 936  936  936  ASN ASN A . n 
A 1  937  VAL 937  937  937  VAL VAL A . n 
A 1  938  GLY 938  938  938  GLY GLY A . n 
A 1  939  PHE 939  939  939  PHE PHE A . n 
A 1  940  THR 940  940  940  THR THR A . n 
A 1  941  LEU 941  941  941  LEU LEU A . n 
A 1  942  ARG 942  942  942  ARG ARG A . n 
A 1  943  ASP 943  943  943  ASP ASP A . n 
A 1  944  LEU 944  944  944  LEU LEU A . n 
A 1  945  GLU 945  945  945  GLU GLU A . n 
A 1  946  THR 946  946  946  THR THR A . n 
A 1  947  LEU 947  947  947  LEU LEU A . n 
A 1  948  PRO 948  948  948  PRO PRO A . n 
A 1  949  PHE 949  949  949  PHE PHE A . n 
A 1  950  GLY 950  950  950  GLY GLY A . n 
A 1  951  ILE 951  951  951  ILE ILE A . n 
A 1  952  ALA 952  952  952  ALA ALA A . n 
A 1  953  LEU 953  953  953  LEU LEU A . n 
A 1  954  PRO 954  954  954  PRO PRO A . n 
A 1  955  ILE 955  955  955  ILE ILE A . n 
A 1  956  ARG 956  956  956  ARG ARG A . n 
A 1  957  ASP 957  957  957  ASP ASP A . n 
A 1  958  ALA 958  958  958  ALA ALA A . n 
A 1  959  ILE 959  959  959  ILE ILE A . n 
A 1  960  TYR 960  960  960  TYR TYR A . n 
A 1  961  HIS 961  961  961  HIS HIS A . n 
A 1  962  CYS 962  962  962  CYS CYS A . n 
A 1  963  ARG 963  963  963  ARG ARG A . n 
A 1  964  GLU 964  964  964  GLU GLU A . n 
A 1  965  GLN 965  965  965  GLN GLN A . n 
A 1  966  PRO 966  966  966  PRO PRO A . n 
A 1  967  ALA 967  967  967  ALA ALA A . n 
A 1  968  SER 968  968  968  SER SER A . n 
A 1  969  ASP 969  969  969  ASP ASP A . n 
A 1  970  TRP 970  970  970  TRP TRP A . n 
A 1  971  PRO 971  971  971  PRO PRO A . n 
A 1  972  GLU 972  972  972  GLU GLU A . n 
A 1  973  ALA 973  973  973  ALA ALA A . n 
A 1  974  VAL 974  974  974  VAL VAL A . n 
A 1  975  CYS 975  975  975  CYS CYS A . n 
A 1  976  LEU 976  976  976  LEU LEU A . n 
A 1  977  LEU 977  977  977  LEU LEU A . n 
A 1  978  ILE 978  978  978  ILE ILE A . n 
A 1  979  GLY 979  979  979  GLY GLY A . n 
A 1  980  ARG 980  980  980  ARG ARG A . n 
A 1  981  GLN 981  981  981  GLN GLN A . n 
A 1  982  ASP 982  982  982  ASP ASP A . n 
A 1  983  LEU 983  983  983  LEU LEU A . n 
A 1  984  SER 984  984  984  SER SER A . n 
A 1  985  LYS 985  985  985  LYS ALA A . n 
A 1  986  GLN 986  986  986  GLN ALA A . n 
A 1  987  ALA 987  987  ?    ?   ?   A . n 
A 1  988  CYS 988  988  ?    ?   ?   A . n 
A 1  989  GLU 989  989  ?    ?   ?   A . n 
A 1  990  GLY 990  990  ?    ?   ?   A . n 
A 1  991  ASN 991  991  ?    ?   ?   A . n 
A 1  992  LEU 992  992  ?    ?   ?   A . n 
A 1  993  PRO 993  993  ?    ?   ?   A . n 
A 1  994  LYS 994  994  ?    ?   ?   A . n 
A 1  995  GLY 995  995  ?    ?   ?   A . n 
A 1  996  LYS 996  996  ?    ?   ?   A . n 
A 1  997  SER 997  997  ?    ?   ?   A . n 
A 1  998  VAL 998  998  ?    ?   ?   A . n 
A 1  999  LEU 999  999  ?    ?   ?   A . n 
A 1  1000 SER 1000 1000 ?    ?   ?   A . n 
A 1  1001 SER 1001 1001 ?    ?   ?   A . n 
A 1  1002 ASP 1002 1002 ?    ?   ?   A . n 
A 1  1003 VAL 1003 1003 ?    ?   ?   A . n 
A 1  1004 PRO 1004 1004 ?    ?   ?   A . n 
A 1  1005 SER 1005 1005 ?    ?   ?   A . n 
A 1  1006 GLY 1006 1006 ?    ?   ?   A . n 
A 1  1007 THR 1007 1007 ?    ?   ?   A . n 
A 1  1008 GLU 1008 1008 ?    ?   ?   A . n 
A 1  1009 THR 1009 1009 ?    ?   ?   A . n 
A 1  1010 GLU 1010 1010 ?    ?   ?   A . n 
A 1  1011 GLU 1011 1011 ?    ?   ?   A . n 
A 1  1012 GLU 1012 1012 ?    ?   ?   A . n 
A 1  1013 ASP 1013 1013 1013 ASP ASP A . n 
A 1  1014 ASP 1014 1014 1014 ASP ASP A . n 
A 1  1015 GLY 1015 1015 1015 GLY GLY A . n 
A 1  1016 MET 1016 1016 1016 MET MET A . n 
A 1  1017 ASN 1017 1017 1017 ASN ASN A . n 
A 1  1018 ASP 1018 1018 1018 ASP ASP A . n 
A 1  1019 MET 1019 1019 1019 MET MET A . n 
A 1  1020 ASN 1020 1020 1020 ASN ASN A . n 
A 1  1021 HIS 1021 1021 1021 HIS HIS A . n 
A 1  1022 GLU 1022 1022 1022 GLU GLU A . n 
A 1  1023 VAL 1023 1023 1023 VAL VAL A . n 
A 1  1024 MET 1024 1024 1024 MET MET A . n 
A 1  1025 SER 1025 1025 1025 SER SER A . n 
A 1  1026 LEU 1026 1026 1026 LEU LEU A . n 
A 1  1027 ILE 1027 1027 1027 ILE ILE A . n 
A 1  1028 TRP 1028 1028 1028 TRP TRP A . n 
A 1  1029 SER 1029 1029 1029 SER SER A . n 
A 1  1030 GLU 1030 1030 1030 GLU GLU A . n 
A 1  1031 ASP 1031 1031 1031 ASP ASP A . n 
A 1  1032 LEU 1032 1032 1032 LEU LEU A . n 
A 1  1033 ARG 1033 1033 1033 ARG ARG A . n 
A 1  1034 VAL 1034 1034 1034 VAL VAL A . n 
A 1  1035 GLN 1035 1035 1035 GLN GLN A . n 
A 1  1036 ASP 1036 1036 1036 ASP ASP A . n 
A 1  1037 VAL 1037 1037 1037 VAL VAL A . n 
A 1  1038 ARG 1038 1038 1038 ARG ARG A . n 
A 1  1039 ARG 1039 1039 1039 ARG ARG A . n 
A 1  1040 LEU 1040 1040 1040 LEU LEU A . n 
A 1  1041 LEU 1041 1041 1041 LEU LEU A . n 
A 1  1042 GLN 1042 1042 1042 GLN GLN A . n 
A 1  1043 SER 1043 1043 1043 SER SER A . n 
A 1  1044 ALA 1044 1044 1044 ALA ALA A . n 
A 1  1045 HIS 1045 1045 1045 HIS HIS A . n 
A 1  1046 PRO 1046 1046 1046 PRO PRO A . n 
A 1  1047 VAL 1047 1047 1047 VAL VAL A . n 
A 1  1048 ARG 1048 1048 1048 ARG ARG A . n 
A 1  1049 VAL 1049 1049 1049 VAL VAL A . n 
A 1  1050 ASN 1050 1050 1050 ASN ASN A . n 
A 1  1051 VAL 1051 1051 1051 VAL VAL A . n 
A 1  1052 VAL 1052 1052 1052 VAL VAL A . n 
A 1  1053 GLN 1053 1053 1053 GLN GLN A . n 
A 1  1054 TYR 1054 1054 1054 TYR TYR A . n 
A 1  1055 PRO 1055 1055 1055 PRO PRO A . n 
A 1  1056 GLU 1056 1056 1056 GLU GLU A . n 
A 1  1057 LEU 1057 1057 1057 LEU LEU A . n 
A 1  1058 SER 1058 1058 1058 SER SER A . n 
A 1  1059 ASP 1059 1059 1059 ASP ASP A . n 
A 1  1060 HIS 1060 1060 1060 HIS HIS A . n 
A 1  1061 GLU 1061 1061 1061 GLU GLU A . n 
A 1  1062 PHE 1062 1062 1062 PHE PHE A . n 
A 1  1063 ILE 1063 1063 1063 ILE ILE A . n 
A 1  1064 GLU 1064 1064 1064 GLU GLU A . n 
A 1  1065 GLU 1065 1065 1065 GLU GLU A . n 
A 1  1066 LYS 1066 1066 1066 LYS LYS A . n 
A 1  1067 GLU 1067 1067 1067 GLU GLU A . n 
A 1  1068 ASN 1068 1068 1068 ASN ASN A . n 
A 1  1069 ARG 1069 1069 1069 ARG ARG A . n 
A 1  1070 LEU 1070 1070 1070 LEU LEU A . n 
A 1  1071 LEU 1071 1071 1071 LEU LEU A . n 
A 1  1072 GLN 1072 1072 1072 GLN GLN A . n 
A 1  1073 LEU 1073 1073 1073 LEU LEU A . n 
A 1  1074 CYS 1074 1074 1074 CYS CYS A . n 
A 1  1075 GLN 1075 1075 1075 GLN GLN A . n 
A 1  1076 ARG 1076 1076 1076 ARG ARG A . n 
A 1  1077 THR 1077 1077 1077 THR THR A . n 
A 1  1078 MET 1078 1078 1078 MET MET A . n 
A 1  1079 ALA 1079 1079 1079 ALA ALA A . n 
A 1  1080 LEU 1080 1080 1080 LEU LEU A . n 
A 1  1081 PRO 1081 1081 1081 PRO PRO A . n 
A 1  1082 VAL 1082 1082 1082 VAL VAL A . n 
A 1  1083 GLY 1083 1083 1083 GLY GLY A . n 
A 1  1084 ARG 1084 1084 1084 ARG ARG A . n 
A 1  1085 GLY 1085 1085 1085 GLY GLY A . n 
A 1  1086 MET 1086 1086 1086 MET MET A . n 
A 1  1087 PHE 1087 1087 1087 PHE PHE A . n 
A 1  1088 THR 1088 1088 1088 THR THR A . n 
A 1  1089 LEU 1089 1089 1089 LEU LEU A . n 
A 1  1090 PHE 1090 1090 1090 PHE PHE A . n 
A 1  1091 SER 1091 1091 1091 SER SER A . n 
A 1  1092 TYR 1092 1092 1092 TYR TYR A . n 
A 1  1093 HIS 1093 1093 1093 HIS HIS A . n 
A 1  1094 PRO 1094 1094 1094 PRO PRO A . n 
A 1  1095 VAL 1095 1095 1095 VAL VAL A . n 
A 1  1096 PRO 1096 1096 1096 PRO PRO A . n 
A 1  1097 THR 1097 1097 1097 THR THR A . n 
A 1  1098 GLU 1098 1098 1098 GLU GLU A . n 
A 1  1099 PRO 1099 1099 1099 PRO PRO A . n 
A 1  1100 LEU 1100 1100 1100 LEU LEU A . n 
A 1  1101 PRO 1101 1101 1101 PRO PRO A . n 
A 1  1102 ILE 1102 1102 1102 ILE ILE A . n 
A 1  1103 PRO 1103 1103 1103 PRO PRO A . n 
A 1  1104 LYS 1104 1104 1104 LYS LYS A . n 
A 1  1105 LEU 1105 1105 1105 LEU LEU A . n 
A 1  1106 ASN 1106 1106 1106 ASN ASN A . n 
A 1  1107 LEU 1107 1107 1107 LEU LEU A . n 
A 1  1108 THR 1108 1108 1108 THR THR A . n 
A 1  1109 GLY 1109 1109 1109 GLY GLY A . n 
A 1  1110 ARG 1110 1110 1110 ARG ARG A . n 
A 1  1111 ALA 1111 1111 1111 ALA ALA A . n 
A 1  1112 PRO 1112 1112 1112 PRO PRO A . n 
A 1  1113 PRO 1113 1113 1113 PRO PRO A . n 
A 1  1114 ARG 1114 1114 1114 ARG ARG A . n 
A 1  1115 ASN 1115 1115 1115 ASN ASN A . n 
A 1  1116 THR 1116 1116 1116 THR THR A . n 
A 1  1117 THR 1117 1117 1117 THR THR A . n 
A 1  1118 VAL 1118 1118 1118 VAL VAL A . n 
A 1  1119 ASP 1119 1119 1119 ASP ASP A . n 
A 1  1120 LEU 1120 1120 1120 LEU LEU A . n 
A 1  1121 ASN 1121 1121 1121 ASN ASN A . n 
A 1  1122 SER 1122 1122 1122 SER SER A . n 
A 1  1123 GLY 1123 1123 1123 GLY GLY A . n 
A 1  1124 ASN 1124 1124 1124 ASN ASN A . n 
A 1  1125 ILE 1125 1125 1125 ILE ILE A . n 
A 1  1126 ASP 1126 1126 1126 ASP ASP A . n 
A 1  1127 VAL 1127 1127 1127 VAL VAL A . n 
A 1  1128 PRO 1128 1128 1128 PRO PRO A . n 
A 1  1129 PRO 1129 1129 1129 PRO PRO A . n 
A 1  1130 ASN 1130 1130 1130 ASN ASN A . n 
A 1  1131 MET 1131 1131 1131 MET MET A . n 
A 1  1132 THR 1132 1132 1132 THR THR A . n 
A 1  1133 SER 1133 1133 1133 SER SER A . n 
A 1  1134 TRP 1134 1134 1134 TRP TRP A . n 
A 1  1135 ALA 1135 1135 1135 ALA ALA A . n 
A 1  1136 SER 1136 1136 1136 SER SER A . n 
A 1  1137 PHE 1137 1137 1137 PHE PHE A . n 
A 1  1138 HIS 1138 1138 1138 HIS HIS A . n 
A 1  1139 ASN 1139 1139 1139 ASN ASN A . n 
A 1  1140 GLY 1140 1140 1140 GLY GLY A . n 
A 1  1141 VAL 1141 1141 1141 VAL VAL A . n 
A 1  1142 ALA 1142 1142 1142 ALA ALA A . n 
A 1  1143 ALA 1143 1143 1143 ALA ALA A . n 
A 1  1144 GLY 1144 1144 1144 GLY GLY A . n 
A 1  1145 LEU 1145 1145 1145 LEU LEU A . n 
A 1  1146 LYS 1146 1146 1146 LYS LYS A . n 
A 1  1147 ILE 1147 1147 1147 ILE ILE A . n 
A 1  1148 ALA 1148 1148 1148 ALA ALA A . n 
A 1  1149 PRO 1149 1149 1149 PRO PRO A . n 
A 1  1150 ALA 1150 1150 1150 ALA ALA A . n 
A 1  1151 SER 1151 1151 1151 SER SER A . n 
A 1  1152 GLN 1152 1152 1152 GLN GLN A . n 
A 1  1153 ILE 1153 1153 1153 ILE ILE A . n 
A 1  1154 ASP 1154 1154 1154 ASP ASP A . n 
A 1  1155 SER 1155 1155 1155 SER SER A . n 
A 1  1156 ALA 1156 1156 1156 ALA ALA A . n 
A 1  1157 TRP 1157 1157 1157 TRP TRP A . n 
A 1  1158 ILE 1158 1158 1158 ILE ILE A . n 
A 1  1159 VAL 1159 1159 1159 VAL VAL A . n 
A 1  1160 TYR 1160 1160 1160 TYR TYR A . n 
A 1  1161 ASN 1161 1161 1161 ASN ASN A . n 
A 1  1162 LYS 1162 1162 1162 LYS LYS A . n 
A 1  1163 PRO 1163 1163 1163 PRO PRO A . n 
A 1  1164 LYS 1164 1164 1164 LYS LYS A . n 
A 1  1165 HIS 1165 1165 1165 HIS HIS A . n 
A 1  1166 ALA 1166 1166 1166 ALA ALA A . n 
A 1  1167 GLU 1167 1167 1167 GLU GLU A . n 
A 1  1168 LEU 1168 1168 1168 LEU LEU A . n 
A 1  1169 ALA 1169 1169 1169 ALA ALA A . n 
A 1  1170 ASN 1170 1170 1170 ASN ASN A . n 
A 1  1171 GLU 1171 1171 1171 GLU GLU A . n 
A 1  1172 TYR 1172 1172 1172 TYR TYR A . n 
A 1  1173 ALA 1173 1173 1173 ALA ALA A . n 
A 1  1174 GLY 1174 1174 1174 GLY GLY A . n 
A 1  1175 PHE 1175 1175 1175 PHE PHE A . n 
A 1  1176 LEU 1176 1176 1176 LEU LEU A . n 
A 1  1177 MET 1177 1177 1177 MET MET A . n 
A 1  1178 ALA 1178 1178 1178 ALA ALA A . n 
A 1  1179 LEU 1179 1179 1179 LEU LEU A . n 
A 1  1180 GLY 1180 1180 1180 GLY GLY A . n 
A 1  1181 LEU 1181 1181 1181 LEU LEU A . n 
A 1  1182 ASN 1182 1182 1182 ASN ASN A . n 
A 1  1183 GLY 1183 1183 1183 GLY GLY A . n 
A 1  1184 HIS 1184 1184 1184 HIS HIS A . n 
A 1  1185 LEU 1185 1185 1185 LEU LEU A . n 
A 1  1186 THR 1186 1186 1186 THR THR A . n 
A 1  1187 LYS 1187 1187 1187 LYS LYS A . n 
A 1  1188 LEU 1188 1188 1188 LEU LEU A . n 
A 1  1189 ALA 1189 1189 1189 ALA ALA A . n 
A 1  1190 THR 1190 1190 1190 THR THR A . n 
A 1  1191 LEU 1191 1191 1191 LEU LEU A . n 
A 1  1192 ASN 1192 1192 1192 ASN ASN A . n 
A 1  1193 ILE 1193 1193 1193 ILE ILE A . n 
A 1  1194 HIS 1194 1194 1194 HIS HIS A . n 
A 1  1195 ASP 1195 1195 1195 ASP ASP A . n 
A 1  1196 TYR 1196 1196 1196 TYR TYR A . n 
A 1  1197 LEU 1197 1197 1197 LEU LEU A . n 
A 1  1198 THR 1198 1198 1198 THR THR A . n 
A 1  1199 LYS 1199 1199 1199 LYS LYS A . n 
A 1  1200 GLY 1200 1200 1200 GLY GLY A . n 
A 1  1201 HIS 1201 1201 1201 HIS HIS A . n 
A 1  1202 GLU 1202 1202 1202 GLU GLU A . n 
A 1  1203 MET 1203 1203 1203 MET MET A . n 
A 1  1204 THR 1204 1204 1204 THR THR A . n 
A 1  1205 SER 1205 1205 1205 SER SER A . n 
A 1  1206 ILE 1206 1206 1206 ILE ILE A . n 
A 1  1207 GLY 1207 1207 1207 GLY GLY A . n 
A 1  1208 LEU 1208 1208 1208 LEU LEU A . n 
A 1  1209 LEU 1209 1209 1209 LEU LEU A . n 
A 1  1210 LEU 1210 1210 1210 LEU LEU A . n 
A 1  1211 GLY 1211 1211 1211 GLY GLY A . n 
A 1  1212 VAL 1212 1212 1212 VAL VAL A . n 
A 1  1213 SER 1213 1213 1213 SER SER A . n 
A 1  1214 ALA 1214 1214 1214 ALA ALA A . n 
A 1  1215 ALA 1215 1215 1215 ALA ALA A . n 
A 1  1216 LYS 1216 1216 1216 LYS LYS A . n 
A 1  1217 LEU 1217 1217 1217 LEU LEU A . n 
A 1  1218 GLY 1218 1218 1218 GLY GLY A . n 
A 1  1219 THR 1219 1219 1219 THR THR A . n 
A 1  1220 MET 1220 1220 1220 MET MET A . n 
A 1  1221 ASP 1221 1221 1221 ASP ASP A . n 
A 1  1222 MET 1222 1222 1222 MET MET A . n 
A 1  1223 SER 1223 1223 1223 SER SER A . n 
A 1  1224 ILE 1224 1224 1224 ILE ILE A . n 
A 1  1225 THR 1225 1225 1225 THR THR A . n 
A 1  1226 ARG 1226 1226 1226 ARG ARG A . n 
A 1  1227 LEU 1227 1227 1227 LEU LEU A . n 
A 1  1228 LEU 1228 1228 1228 LEU LEU A . n 
A 1  1229 SER 1229 1229 1229 SER SER A . n 
A 1  1230 ILE 1230 1230 1230 ILE ILE A . n 
A 1  1231 HIS 1231 1231 1231 HIS HIS A . n 
A 1  1232 ILE 1232 1232 1232 ILE ILE A . n 
A 1  1233 PRO 1233 1233 1233 PRO PRO A . n 
A 1  1234 ALA 1234 1234 1234 ALA ALA A . n 
A 1  1235 LEU 1235 1235 1235 LEU LEU A . n 
A 1  1236 LEU 1236 1236 1236 LEU LEU A . n 
A 1  1237 PRO 1237 1237 1237 PRO PRO A . n 
A 1  1238 PRO 1238 1238 1238 PRO PRO A . n 
A 1  1239 THR 1239 1239 1239 THR THR A . n 
A 1  1240 SER 1240 1240 1240 SER SER A . n 
A 1  1241 THR 1241 1241 1241 THR THR A . n 
A 1  1242 GLU 1242 1242 1242 GLU GLU A . n 
A 1  1243 LEU 1243 1243 1243 LEU LEU A . n 
A 1  1244 ASP 1244 1244 1244 ASP ASP A . n 
A 1  1245 VAL 1245 1245 1245 VAL VAL A . n 
A 1  1246 PRO 1246 1246 1246 PRO PRO A . n 
A 1  1247 HIS 1247 1247 1247 HIS HIS A . n 
A 1  1248 ASN 1248 1248 1248 ASN ASN A . n 
A 1  1249 VAL 1249 1249 1249 VAL VAL A . n 
A 1  1250 GLN 1250 1250 1250 GLN GLN A . n 
A 1  1251 VAL 1251 1251 1251 VAL VAL A . n 
A 1  1252 ALA 1252 1252 1252 ALA ALA A . n 
A 1  1253 ALA 1253 1253 1253 ALA ALA A . n 
A 1  1254 VAL 1254 1254 1254 VAL VAL A . n 
A 1  1255 VAL 1255 1255 1255 VAL VAL A . n 
A 1  1256 GLY 1256 1256 1256 GLY GLY A . n 
A 1  1257 ILE 1257 1257 1257 ILE ILE A . n 
A 1  1258 GLY 1258 1258 1258 GLY GLY A . n 
A 1  1259 LEU 1259 1259 1259 LEU LEU A . n 
A 1  1260 VAL 1260 1260 1260 VAL VAL A . n 
A 1  1261 TYR 1261 1261 1261 TYR TYR A . n 
A 1  1262 GLN 1262 1262 1262 GLN GLN A . n 
A 1  1263 GLY 1263 1263 1263 GLY GLY A . n 
A 1  1264 THR 1264 1264 1264 THR THR A . n 
A 1  1265 ALA 1265 1265 1265 ALA ALA A . n 
A 1  1266 HIS 1266 1266 1266 HIS HIS A . n 
A 1  1267 ARG 1267 1267 1267 ARG ARG A . n 
A 1  1268 HIS 1268 1268 1268 HIS HIS A . n 
A 1  1269 THR 1269 1269 1269 THR THR A . n 
A 1  1270 ALA 1270 1270 1270 ALA ALA A . n 
A 1  1271 GLU 1271 1271 1271 GLU GLU A . n 
A 1  1272 VAL 1272 1272 1272 VAL VAL A . n 
A 1  1273 LEU 1273 1273 1273 LEU LEU A . n 
A 1  1274 LEU 1274 1274 1274 LEU LEU A . n 
A 1  1275 ALA 1275 1275 1275 ALA ALA A . n 
A 1  1276 GLU 1276 1276 1276 GLU GLU A . n 
A 1  1277 ILE 1277 1277 1277 ILE ILE A . n 
A 1  1278 GLY 1278 1278 1278 GLY GLY A . n 
A 1  1279 ARG 1279 1279 1279 ARG ARG A . n 
A 1  1280 PRO 1280 1280 1280 PRO PRO A . n 
A 1  1281 PRO 1281 1281 1281 PRO PRO A . n 
A 1  1282 GLY 1282 1282 1282 GLY GLY A . n 
A 1  1283 PRO 1283 1283 1283 PRO PRO A . n 
A 1  1284 GLU 1284 1284 1284 GLU GLU A . n 
A 1  1285 MET 1285 1285 1285 MET MET A . n 
A 1  1286 GLU 1286 1286 1286 GLU GLU A . n 
A 1  1287 TYR 1287 1287 1287 TYR TYR A . n 
A 1  1288 CYS 1288 1288 1288 CYS ALA A . n 
A 1  1289 THR 1289 1289 1289 THR THR A . n 
A 1  1290 ASP 1290 1290 1290 ASP ASP A . n 
A 1  1291 ARG 1291 1291 1291 ARG ARG A . n 
A 1  1292 GLU 1292 1292 1292 GLU GLU A . n 
A 1  1293 SER 1293 1293 1293 SER SER A . n 
A 1  1294 TYR 1294 1294 1294 TYR TYR A . n 
A 1  1295 SER 1295 1295 1295 SER SER A . n 
A 1  1296 LEU 1296 1296 1296 LEU LEU A . n 
A 1  1297 ALA 1297 1297 1297 ALA ALA A . n 
A 1  1298 ALA 1298 1298 1298 ALA ALA A . n 
A 1  1299 GLY 1299 1299 1299 GLY GLY A . n 
A 1  1300 LEU 1300 1300 1300 LEU LEU A . n 
A 1  1301 ALA 1301 1301 1301 ALA ALA A . n 
A 1  1302 LEU 1302 1302 1302 LEU LEU A . n 
A 1  1303 GLY 1303 1303 1303 GLY GLY A . n 
A 1  1304 MET 1304 1304 1304 MET MET A . n 
A 1  1305 VAL 1305 1305 1305 VAL VAL A . n 
A 1  1306 CYS 1306 1306 1306 CYS CYS A . n 
A 1  1307 LEU 1307 1307 1307 LEU LEU A . n 
A 1  1308 GLY 1308 1308 1308 GLY GLY A . n 
A 1  1309 HIS 1309 1309 1309 HIS HIS A . n 
A 1  1310 GLY 1310 1310 1310 GLY GLY A . n 
A 1  1311 SER 1311 1311 1311 SER SER A . n 
A 1  1312 ASN 1312 1312 1312 ASN ASN A . n 
A 1  1313 LEU 1313 1313 1313 LEU LEU A . n 
A 1  1314 ILE 1314 1314 1314 ILE ILE A . n 
A 1  1315 GLY 1315 1315 1315 GLY GLY A . n 
A 1  1316 MET 1316 1316 1316 MET MET A . n 
A 1  1317 SER 1317 1317 1317 SER SER A . n 
A 1  1318 ASP 1318 1318 1318 ASP ALA A . n 
A 1  1319 LEU 1319 1319 1319 LEU LEU A . n 
A 1  1320 ASN 1320 1320 1320 ASN ASN A . n 
A 1  1321 VAL 1321 1321 1321 VAL VAL A . n 
A 1  1322 PRO 1322 1322 1322 PRO PRO A . n 
A 1  1323 GLU 1323 1323 1323 GLU GLU A . n 
A 1  1324 GLN 1324 1324 1324 GLN GLN A . n 
A 1  1325 LEU 1325 1325 1325 LEU LEU A . n 
A 1  1326 TYR 1326 1326 1326 TYR TYR A . n 
A 1  1327 GLN 1327 1327 1327 GLN GLN A . n 
A 1  1328 TYR 1328 1328 1328 TYR TYR A . n 
A 1  1329 MET 1329 1329 1329 MET MET A . n 
A 1  1330 VAL 1330 1330 1330 VAL VAL A . n 
A 1  1331 GLY 1331 1331 1331 GLY GLY A . n 
A 1  1332 GLY 1332 1332 1332 GLY GLY A . n 
A 1  1333 HIS 1333 1333 1333 HIS HIS A . n 
A 1  1334 ARG 1334 1334 ?    ?   ?   A . n 
A 1  1335 ARG 1335 1335 ?    ?   ?   A . n 
A 1  1336 PHE 1336 1336 ?    ?   ?   A . n 
A 1  1337 GLN 1337 1337 ?    ?   ?   A . n 
A 1  1338 THR 1338 1338 ?    ?   ?   A . n 
A 1  1339 GLY 1339 1339 ?    ?   ?   A . n 
A 1  1340 MET 1340 1340 ?    ?   ?   A . n 
A 1  1341 HIS 1341 1341 ?    ?   ?   A . n 
A 1  1342 ARG 1342 1342 ?    ?   ?   A . n 
A 1  1343 GLU 1343 1343 ?    ?   ?   A . n 
A 1  1344 LYS 1344 1344 ?    ?   ?   A . n 
A 1  1345 HIS 1345 1345 ?    ?   ?   A . n 
A 1  1346 LYS 1346 1346 ?    ?   ?   A . n 
A 1  1347 SER 1347 1347 ?    ?   ?   A . n 
A 1  1348 PRO 1348 1348 ?    ?   ?   A . n 
A 1  1349 SER 1349 1349 ?    ?   ?   A . n 
A 1  1350 TYR 1350 1350 ?    ?   ?   A . n 
A 1  1351 GLN 1351 1351 ?    ?   ?   A . n 
A 1  1352 ILE 1352 1352 ?    ?   ?   A . n 
A 1  1353 LYS 1353 1353 ?    ?   ?   A . n 
A 1  1354 GLU 1354 1354 1354 GLU GLU A . n 
A 1  1355 GLY 1355 1355 1355 GLY GLY A . n 
A 1  1356 ASP 1356 1356 1356 ASP ASP A . n 
A 1  1357 THR 1357 1357 1357 THR THR A . n 
A 1  1358 ILE 1358 1358 1358 ILE ILE A . n 
A 1  1359 ASN 1359 1359 1359 ASN ASN A . n 
A 1  1360 VAL 1360 1360 1360 VAL VAL A . n 
A 1  1361 ASP 1361 1361 1361 ASP ASP A . n 
A 1  1362 VAL 1362 1362 1362 VAL VAL A . n 
A 1  1363 THR 1363 1363 1363 THR THR A . n 
A 1  1364 CYS 1364 1364 1364 CYS CYS A . n 
A 1  1365 PRO 1365 1365 1365 PRO PRO A . n 
A 1  1366 GLY 1366 1366 1366 GLY GLY A . n 
A 1  1367 ALA 1367 1367 1367 ALA ALA A . n 
A 1  1368 THR 1368 1368 1368 THR THR A . n 
A 1  1369 LEU 1369 1369 1369 LEU LEU A . n 
A 1  1370 ALA 1370 1370 1370 ALA ALA A . n 
A 1  1371 LEU 1371 1371 1371 LEU LEU A . n 
A 1  1372 ALA 1372 1372 1372 ALA ALA A . n 
A 1  1373 MET 1373 1373 1373 MET MET A . n 
A 1  1374 ILE 1374 1374 1374 ILE ILE A . n 
A 1  1375 TYR 1375 1375 1375 TYR TYR A . n 
A 1  1376 LEU 1376 1376 1376 LEU LEU A . n 
A 1  1377 LYS 1377 1377 1377 LYS LYS A . n 
A 1  1378 THR 1378 1378 1378 THR THR A . n 
A 1  1379 ASN 1379 1379 1379 ASN ASN A . n 
A 1  1380 ASN 1380 1380 1380 ASN ASN A . n 
A 1  1381 ARG 1381 1381 1381 ARG ARG A . n 
A 1  1382 SER 1382 1382 1382 SER SER A . n 
A 1  1383 ILE 1383 1383 1383 ILE ILE A . n 
A 1  1384 ALA 1384 1384 1384 ALA ALA A . n 
A 1  1385 ASP 1385 1385 1385 ASP ASP A . n 
A 1  1386 TRP 1386 1386 1386 TRP TRP A . n 
A 1  1387 LEU 1387 1387 1387 LEU LEU A . n 
A 1  1388 ARG 1388 1388 1388 ARG ARG A . n 
A 1  1389 ALA 1389 1389 1389 ALA ALA A . n 
A 1  1390 PRO 1390 1390 1390 PRO PRO A . n 
A 1  1391 ASP 1391 1391 1391 ASP ASP A . n 
A 1  1392 THR 1392 1392 1392 THR THR A . n 
A 1  1393 MET 1393 1393 1393 MET MET A . n 
A 1  1394 TYR 1394 1394 1394 TYR TYR A . n 
A 1  1395 LEU 1395 1395 1395 LEU LEU A . n 
A 1  1396 LEU 1396 1396 1396 LEU LEU A . n 
A 1  1397 ASP 1397 1397 1397 ASP ASP A . n 
A 1  1398 PHE 1398 1398 1398 PHE PHE A . n 
A 1  1399 VAL 1399 1399 1399 VAL VAL A . n 
A 1  1400 LYS 1400 1400 1400 LYS LYS A . n 
A 1  1401 PRO 1401 1401 1401 PRO PRO A . n 
A 1  1402 GLU 1402 1402 1402 GLU GLU A . n 
A 1  1403 PHE 1403 1403 1403 PHE PHE A . n 
A 1  1404 LEU 1404 1404 1404 LEU LEU A . n 
A 1  1405 LEU 1405 1405 1405 LEU LEU A . n 
A 1  1406 LEU 1406 1406 1406 LEU LEU A . n 
A 1  1407 ARG 1407 1407 1407 ARG ARG A . n 
A 1  1408 THR 1408 1408 1408 THR THR A . n 
A 1  1409 LEU 1409 1409 1409 LEU LEU A . n 
A 1  1410 ALA 1410 1410 1410 ALA ALA A . n 
A 1  1411 ARG 1411 1411 1411 ARG ARG A . n 
A 1  1412 CYS 1412 1412 1412 CYS CYS A . n 
A 1  1413 LEU 1413 1413 1413 LEU LEU A . n 
A 1  1414 ILE 1414 1414 1414 ILE ILE A . n 
A 1  1415 LEU 1415 1415 1415 LEU LEU A . n 
A 1  1416 TRP 1416 1416 1416 TRP TRP A . n 
A 1  1417 ASP 1417 1417 1417 ASP ASP A . n 
A 1  1418 ASP 1418 1418 1418 ASP ASP A . n 
A 1  1419 ILE 1419 1419 1419 ILE ILE A . n 
A 1  1420 LEU 1420 1420 1420 LEU LEU A . n 
A 1  1421 PRO 1421 1421 1421 PRO PRO A . n 
A 1  1422 ASN 1422 1422 1422 ASN ASN A . n 
A 1  1423 SER 1423 1423 1423 SER SER A . n 
A 1  1424 LYS 1424 1424 1424 LYS LYS A . n 
A 1  1425 TRP 1425 1425 1425 TRP TRP A . n 
A 1  1426 VAL 1426 1426 1426 VAL VAL A . n 
A 1  1427 ASP 1427 1427 1427 ASP ASP A . n 
A 1  1428 SER 1428 1428 1428 SER SER A . n 
A 1  1429 ASN 1429 1429 1429 ASN ASN A . n 
A 1  1430 VAL 1430 1430 1430 VAL VAL A . n 
A 1  1431 PRO 1431 1431 1431 PRO PRO A . n 
A 1  1432 GLN 1432 1432 1432 GLN GLN A . n 
A 1  1433 ILE 1433 1433 1433 ILE ILE A . n 
A 1  1434 ILE 1434 1434 1434 ILE ILE A . n 
A 1  1435 ARG 1435 1435 1435 ARG ARG A . n 
A 1  1436 GLU 1436 1436 1436 GLU GLU A . n 
A 1  1437 ASN 1437 1437 1437 ASN ASN A . n 
A 1  1438 SER 1438 1438 ?    ?   ?   A . n 
A 1  1439 ILE 1439 1439 ?    ?   ?   A . n 
A 1  1440 SER 1440 1440 ?    ?   ?   A . n 
A 1  1441 LEU 1441 1441 ?    ?   ?   A . n 
A 1  1442 SER 1442 1442 ?    ?   ?   A . n 
A 1  1443 GLU 1443 1443 ?    ?   ?   A . n 
A 1  1444 ILE 1444 1444 ?    ?   ?   A . n 
A 1  1445 GLU 1445 1445 ?    ?   ?   A . n 
A 1  1446 LEU 1446 1446 ?    ?   ?   A . n 
A 1  1447 PRO 1447 1447 ?    ?   ?   A . n 
A 1  1448 CYS 1448 1448 ?    ?   ?   A . n 
A 1  1449 SER 1449 1449 ?    ?   ?   A . n 
A 1  1450 GLU 1450 1450 ?    ?   ?   A . n 
A 1  1451 ASP 1451 1451 ?    ?   ?   A . n 
A 1  1452 LEU 1452 1452 1452 LEU LEU A . n 
A 1  1453 ASN 1453 1453 1453 ASN ASN A . n 
A 1  1454 LEU 1454 1454 1454 LEU LEU A . n 
A 1  1455 GLU 1455 1455 1455 GLU GLU A . n 
A 1  1456 THR 1456 1456 1456 THR THR A . n 
A 1  1457 LEU 1457 1457 1457 LEU LEU A . n 
A 1  1458 SER 1458 1458 1458 SER SER A . n 
A 1  1459 GLN 1459 1459 1459 GLN GLN A . n 
A 1  1460 ALA 1460 1460 1460 ALA ALA A . n 
A 1  1461 HIS 1461 1461 1461 HIS HIS A . n 
A 1  1462 VAL 1462 1462 1462 VAL VAL A . n 
A 1  1463 TYR 1463 1463 1463 TYR TYR A . n 
A 1  1464 ILE 1464 1464 1464 ILE ILE A . n 
A 1  1465 ILE 1465 1465 1465 ILE ILE A . n 
A 1  1466 ALA 1466 1466 1466 ALA ALA A . n 
A 1  1467 GLY 1467 1467 1467 GLY GLY A . n 
A 1  1468 ALA 1468 1468 1468 ALA ALA A . n 
A 1  1469 CYS 1469 1469 1469 CYS CYS A . n 
A 1  1470 LEU 1470 1470 1470 LEU LEU A . n 
A 1  1471 SER 1471 1471 1471 SER SER A . n 
A 1  1472 LEU 1472 1472 1472 LEU LEU A . n 
A 1  1473 GLY 1473 1473 1473 GLY GLY A . n 
A 1  1474 PHE 1474 1474 1474 PHE PHE A . n 
A 1  1475 ARG 1475 1475 1475 ARG ARG A . n 
A 1  1476 PHE 1476 1476 1476 PHE PHE A . n 
A 1  1477 ALA 1477 1477 1477 ALA ALA A . n 
A 1  1478 GLY 1478 1478 1478 GLY GLY A . n 
A 1  1479 SER 1479 1479 1479 SER SER A . n 
A 1  1480 GLU 1480 1480 1480 GLU GLU A . n 
A 1  1481 ASN 1481 1481 1481 ASN ASN A . n 
A 1  1482 LEU 1482 1482 1482 LEU LEU A . n 
A 1  1483 SER 1483 1483 1483 SER SER A . n 
A 1  1484 ALA 1484 1484 1484 ALA ALA A . n 
A 1  1485 PHE 1485 1485 1485 PHE PHE A . n 
A 1  1486 ASN 1486 1486 1486 ASN ASN A . n 
A 1  1487 CYS 1487 1487 1487 CYS CYS A . n 
A 1  1488 LEU 1488 1488 1488 LEU LEU A . n 
A 1  1489 HIS 1489 1489 1489 HIS HIS A . n 
A 1  1490 LYS 1490 1490 1490 LYS LYS A . n 
A 1  1491 PHE 1491 1491 1491 PHE PHE A . n 
A 1  1492 ALA 1492 1492 1492 ALA ALA A . n 
A 1  1493 LYS 1493 1493 1493 LYS LYS A . n 
A 1  1494 ASP 1494 1494 1494 ASP ASP A . n 
A 1  1495 PHE 1495 1495 1495 PHE PHE A . n 
A 1  1496 MET 1496 1496 1496 MET MET A . n 
A 1  1497 THR 1497 1497 1497 THR THR A . n 
A 1  1498 TYR 1498 1498 1498 TYR TYR A . n 
A 1  1499 LEU 1499 1499 1499 LEU LEU A . n 
A 1  1500 SER 1500 1500 1500 SER SER A . n 
A 1  1501 ALA 1501 1501 1501 ALA ALA A . n 
A 1  1502 PRO 1502 1502 1502 PRO PRO A . n 
A 1  1503 ASN 1503 1503 1503 ASN ASN A . n 
A 1  1504 ALA 1504 1504 1504 ALA ALA A . n 
A 1  1505 SER 1505 1505 1505 SER SER A . n 
A 1  1506 VAL 1506 1506 1506 VAL VAL A . n 
A 1  1507 THR 1507 1507 1507 THR THR A . n 
A 1  1508 GLY 1508 1508 1508 GLY GLY A . n 
A 1  1509 PRO 1509 1509 1509 PRO PRO A . n 
A 1  1510 HIS 1510 1510 1510 HIS HIS A . n 
A 1  1511 ASN 1511 1511 1511 ASN ASN A . n 
A 1  1512 LEU 1512 1512 1512 LEU LEU A . n 
A 1  1513 GLU 1513 1513 1513 GLU GLU A . n 
A 1  1514 THR 1514 1514 1514 THR THR A . n 
A 1  1515 CYS 1515 1515 1515 CYS CYS A . n 
A 1  1516 LEU 1516 1516 1516 LEU LEU A . n 
A 1  1517 SER 1517 1517 1517 SER SER A . n 
A 1  1518 VAL 1518 1518 1518 VAL VAL A . n 
A 1  1519 VAL 1519 1519 1519 VAL VAL A . n 
A 1  1520 LEU 1520 1520 1520 LEU LEU A . n 
A 1  1521 LEU 1521 1521 1521 LEU LEU A . n 
A 1  1522 SER 1522 1522 1522 SER SER A . n 
A 1  1523 LEU 1523 1523 1523 LEU LEU A . n 
A 1  1524 ALA 1524 1524 1524 ALA ALA A . n 
A 1  1525 MET 1525 1525 1525 MET MET A . n 
A 1  1526 VAL 1526 1526 1526 VAL VAL A . n 
A 1  1527 MET 1527 1527 1527 MET MET A . n 
A 1  1528 ALA 1528 1528 1528 ALA ALA A . n 
A 1  1529 GLY 1529 1529 1529 GLY GLY A . n 
A 1  1530 SER 1530 1530 1530 SER SER A . n 
A 1  1531 GLY 1531 1531 1531 GLY GLY A . n 
A 1  1532 ASN 1532 1532 1532 ASN ASN A . n 
A 1  1533 LEU 1533 1533 1533 LEU LEU A . n 
A 1  1534 LYS 1534 1534 1534 LYS LYS A . n 
A 1  1535 VAL 1535 1535 1535 VAL VAL A . n 
A 1  1536 LEU 1536 1536 1536 LEU LEU A . n 
A 1  1537 GLN 1537 1537 1537 GLN GLN A . n 
A 1  1538 LEU 1538 1538 1538 LEU LEU A . n 
A 1  1539 CYS 1539 1539 1539 CYS CYS A . n 
A 1  1540 ARG 1540 1540 1540 ARG ARG A . n 
A 1  1541 PHE 1541 1541 1541 PHE PHE A . n 
A 1  1542 LEU 1542 1542 1542 LEU LEU A . n 
A 1  1543 HIS 1543 1543 1543 HIS HIS A . n 
A 1  1544 MET 1544 1544 1544 MET MET A . n 
A 1  1545 LYS 1545 1545 1545 LYS LYS A . n 
A 1  1546 THR 1546 1546 1546 THR THR A . n 
A 1  1547 GLY 1547 1547 1547 GLY GLY A . n 
A 1  1548 GLY 1548 1548 1548 GLY GLY A . n 
A 1  1549 GLU 1549 1549 1549 GLU GLU A . n 
A 1  1550 MET 1550 1550 1550 MET MET A . n 
A 1  1551 ASN 1551 1551 1551 ASN ASN A . n 
A 1  1552 TYR 1552 1552 1552 TYR TYR A . n 
A 1  1553 GLY 1553 1553 1553 GLY GLY A . n 
A 1  1554 PHE 1554 1554 1554 PHE PHE A . n 
A 1  1555 HIS 1555 1555 1555 HIS HIS A . n 
A 1  1556 LEU 1556 1556 1556 LEU LEU A . n 
A 1  1557 ALA 1557 1557 1557 ALA ALA A . n 
A 1  1558 HIS 1558 1558 1558 HIS HIS A . n 
A 1  1559 HIS 1559 1559 1559 HIS HIS A . n 
A 1  1560 MET 1560 1560 1560 MET MET A . n 
A 1  1561 ALA 1561 1561 1561 ALA ALA A . n 
A 1  1562 LEU 1562 1562 1562 LEU LEU A . n 
A 1  1563 GLY 1563 1563 1563 GLY GLY A . n 
A 1  1564 LEU 1564 1564 1564 LEU LEU A . n 
A 1  1565 LEU 1565 1565 1565 LEU LEU A . n 
A 1  1566 PHE 1566 1566 1566 PHE PHE A . n 
A 1  1567 LEU 1567 1567 1567 LEU LEU A . n 
A 1  1568 GLY 1568 1568 1568 GLY GLY A . n 
A 1  1569 GLY 1569 1569 1569 GLY GLY A . n 
A 1  1570 GLY 1570 1570 1570 GLY GLY A . n 
A 1  1571 ARG 1571 1571 1571 ARG ARG A . n 
A 1  1572 TYR 1572 1572 1572 TYR TYR A . n 
A 1  1573 SER 1573 1573 1573 SER SER A . n 
A 1  1574 LEU 1574 1574 1574 LEU LEU A . n 
A 1  1575 SER 1575 1575 1575 SER SER A . n 
A 1  1576 THR 1576 1576 1576 THR THR A . n 
A 1  1577 SER 1577 1577 1577 SER SER A . n 
A 1  1578 ASN 1578 1578 1578 ASN ASN A . n 
A 1  1579 SER 1579 1579 1579 SER SER A . n 
A 1  1580 SER 1580 1580 1580 SER SER A . n 
A 1  1581 ILE 1581 1581 1581 ILE ILE A . n 
A 1  1582 ALA 1582 1582 1582 ALA ALA A . n 
A 1  1583 ALA 1583 1583 1583 ALA ALA A . n 
A 1  1584 LEU 1584 1584 1584 LEU LEU A . n 
A 1  1585 LEU 1585 1585 1585 LEU LEU A . n 
A 1  1586 CYS 1586 1586 1586 CYS CYS A . n 
A 1  1587 ALA 1587 1587 1587 ALA ALA A . n 
A 1  1588 LEU 1588 1588 1588 LEU LEU A . n 
A 1  1589 TYR 1589 1589 1589 TYR TYR A . n 
A 1  1590 PRO 1590 1590 1590 PRO PRO A . n 
A 1  1591 HIS 1591 1591 1591 HIS HIS A . n 
A 1  1592 PHE 1592 1592 1592 PHE PHE A . n 
A 1  1593 PRO 1593 1593 1593 PRO PRO A . n 
A 1  1594 ALA 1594 1594 1594 ALA ALA A . n 
A 1  1595 HIS 1595 1595 1595 HIS HIS A . n 
A 1  1596 SER 1596 1596 1596 SER SER A . n 
A 1  1597 THR 1597 1597 1597 THR THR A . n 
A 1  1598 ASP 1598 1598 1598 ASP ASP A . n 
A 1  1599 ASN 1599 1599 1599 ASN ASN A . n 
A 1  1600 ARG 1600 1600 1600 ARG ARG A . n 
A 1  1601 TYR 1601 1601 1601 TYR TYR A . n 
A 1  1602 HIS 1602 1602 1602 HIS HIS A . n 
A 1  1603 LEU 1603 1603 1603 LEU LEU A . n 
A 1  1604 GLN 1604 1604 1604 GLN GLN A . n 
A 1  1605 ALA 1605 1605 1605 ALA ALA A . n 
A 1  1606 LEU 1606 1606 1606 LEU LEU A . n 
A 1  1607 ARG 1607 1607 1607 ARG ARG A . n 
A 1  1608 HIS 1608 1608 1608 HIS HIS A . n 
A 1  1609 LEU 1609 1609 1609 LEU LEU A . n 
A 1  1610 TYR 1610 1610 1610 TYR TYR A . n 
A 1  1611 VAL 1611 1611 1611 VAL VAL A . n 
A 1  1612 LEU 1612 1612 1612 LEU LEU A . n 
A 1  1613 ALA 1613 1613 1613 ALA ALA A . n 
A 1  1614 ALA 1614 1614 1614 ALA ALA A . n 
A 1  1615 GLU 1615 1615 1615 GLU GLU A . n 
A 1  1616 PRO 1616 1616 1616 PRO PRO A . n 
A 1  1617 ARG 1617 1617 1617 ARG ARG A . n 
A 1  1618 LEU 1618 1618 1618 LEU LEU A . n 
A 1  1619 LEU 1619 1619 1619 LEU LEU A . n 
A 1  1620 VAL 1620 1620 1620 VAL VAL A . n 
A 1  1621 PRO 1621 1621 1621 PRO PRO A . n 
A 1  1622 VAL 1622 1622 1622 VAL VAL A . n 
A 1  1623 ASP 1623 1623 1623 ASP ASP A . n 
A 1  1624 VAL 1624 1624 1624 VAL VAL A . n 
A 1  1625 ASP 1625 1625 1625 ASP ASP A . n 
A 1  1626 THR 1626 1626 1626 THR THR A . n 
A 1  1627 ASN 1627 1627 1627 ASN ASN A . n 
A 1  1628 THR 1628 1628 1628 THR THR A . n 
A 1  1629 PRO 1629 1629 1629 PRO PRO A . n 
A 1  1630 CYS 1630 1630 1630 CYS CYS A . n 
A 1  1631 TYR 1631 1631 1631 TYR TYR A . n 
A 1  1632 ALA 1632 1632 1632 ALA ALA A . n 
A 1  1633 LEU 1633 1633 1633 LEU LEU A . n 
A 1  1634 LEU 1634 1634 1634 LEU LEU A . n 
A 1  1635 GLU 1635 1635 1635 GLU GLU A . n 
A 1  1636 VAL 1636 1636 1636 VAL VAL A . n 
A 1  1637 THR 1637 1637 1637 THR THR A . n 
A 1  1638 TYR 1638 1638 1638 TYR TYR A . n 
A 1  1639 LYS 1639 1639 1639 LYS LYS A . n 
A 1  1640 GLY 1640 1640 1640 GLY GLY A . n 
A 1  1641 THR 1641 1641 1641 THR THR A . n 
A 1  1642 GLN 1642 1642 1642 GLN GLN A . n 
A 1  1643 TRP 1643 1643 1643 TRP TRP A . n 
A 1  1644 TYR 1644 1644 1644 TYR TYR A . n 
A 1  1645 GLU 1645 1645 1645 GLU GLU A . n 
A 1  1646 GLN 1646 1646 1646 GLN GLN A . n 
A 1  1647 THR 1647 1647 1647 THR THR A . n 
A 1  1648 LYS 1648 1648 1648 LYS LYS A . n 
A 1  1649 GLU 1649 1649 1649 GLU GLU A . n 
A 1  1650 GLU 1650 1650 1650 GLU GLU A . n 
A 1  1651 LEU 1651 1651 1651 LEU LEU A . n 
A 1  1652 MET 1652 1652 1652 MET MET A . n 
A 1  1653 ALA 1653 1653 1653 ALA ALA A . n 
A 1  1654 PRO 1654 1654 1654 PRO PRO A . n 
A 1  1655 THR 1655 1655 1655 THR THR A . n 
A 1  1656 LEU 1656 1656 1656 LEU LEU A . n 
A 1  1657 LEU 1657 1657 1657 LEU LEU A . n 
A 1  1658 PRO 1658 1658 1658 PRO PRO A . n 
A 1  1659 GLU 1659 1659 1659 GLU GLU A . n 
A 1  1660 LEU 1660 1660 1660 LEU LEU A . n 
A 1  1661 HIS 1661 1661 1661 HIS HIS A . n 
A 1  1662 LEU 1662 1662 1662 LEU LEU A . n 
A 1  1663 LEU 1663 1663 1663 LEU LEU A . n 
A 1  1664 LYS 1664 1664 1664 LYS LYS A . n 
A 1  1665 GLN 1665 1665 1665 GLN GLN A . n 
A 1  1666 ILE 1666 1666 1666 ILE ILE A . n 
A 1  1667 LYS 1667 1667 1667 LYS LYS A . n 
A 1  1668 VAL 1668 1668 1668 VAL VAL A . n 
A 1  1669 LYS 1669 1669 1669 LYS LYS A . n 
A 1  1670 GLY 1670 1670 1670 GLY GLY A . n 
A 1  1671 PRO 1671 1671 1671 PRO PRO A . n 
A 1  1672 ARG 1672 1672 1672 ARG ARG A . n 
A 1  1673 TYR 1673 1673 1673 TYR TYR A . n 
A 1  1674 TRP 1674 1674 1674 TRP TRP A . n 
A 1  1675 GLU 1675 1675 1675 GLU GLU A . n 
A 1  1676 LEU 1676 1676 1676 LEU LEU A . n 
A 1  1677 LEU 1677 1677 1677 LEU LEU A . n 
A 1  1678 ILE 1678 1678 1678 ILE ILE A . n 
A 1  1679 ASP 1679 1679 1679 ASP ASP A . n 
A 1  1680 LEU 1680 1680 1680 LEU LEU A . n 
A 1  1681 SER 1681 1681 ?    ?   ?   A . n 
A 1  1682 LYS 1682 1682 ?    ?   ?   A . n 
A 1  1683 GLY 1683 1683 ?    ?   ?   A . n 
A 1  1684 THR 1684 1684 1684 THR THR A . n 
A 1  1685 GLN 1685 1685 1685 GLN GLN A . n 
A 1  1686 HIS 1686 1686 1686 HIS HIS A . n 
A 1  1687 LEU 1687 1687 1687 LEU LEU A . n 
A 1  1688 LYS 1688 1688 1688 LYS LYS A . n 
A 1  1689 SER 1689 1689 1689 SER SER A . n 
A 1  1690 ILE 1690 1690 1690 ILE ILE A . n 
A 1  1691 LEU 1691 1691 1691 LEU LEU A . n 
A 1  1692 SER 1692 1692 1692 SER SER A . n 
A 1  1693 LYS 1693 1693 1693 LYS LYS A . n 
A 1  1694 ASP 1694 1694 1694 ASP ASP A . n 
A 1  1695 GLY 1695 1695 1695 GLY GLY A . n 
A 1  1696 VAL 1696 1696 1696 VAL VAL A . n 
A 1  1697 LEU 1697 1697 1697 LEU LEU A . n 
A 1  1698 TYR 1698 1698 1698 TYR TYR A . n 
A 1  1699 VAL 1699 1699 1699 VAL VAL A . n 
A 1  1700 LYS 1700 1700 1700 LYS LYS A . n 
A 1  1701 LEU 1701 1701 1701 LEU LEU A . n 
A 1  1702 ARG 1702 1702 1702 ARG ARG A . n 
A 1  1703 ALA 1703 1703 1703 ALA ALA A . n 
A 1  1704 GLY 1704 1704 1704 GLY GLY A . n 
A 1  1705 GLN 1705 1705 1705 GLN GLN A . n 
A 1  1706 LEU 1706 1706 1706 LEU LEU A . n 
A 1  1707 SER 1707 1707 1707 SER SER A . n 
A 1  1708 TYR 1708 1708 ?    ?   ?   A . n 
A 1  1709 LYS 1709 1709 ?    ?   ?   A . n 
A 1  1710 GLU 1710 1710 ?    ?   ?   A . n 
A 1  1711 ASP 1711 1711 ?    ?   ?   A . n 
A 1  1712 PRO 1712 1712 ?    ?   ?   A . n 
A 1  1713 MET 1713 1713 ?    ?   ?   A . n 
A 1  1714 GLY 1714 1714 ?    ?   ?   A . n 
A 1  1715 TRP 1715 1715 ?    ?   ?   A . n 
A 1  1716 GLN 1716 1716 ?    ?   ?   A . n 
A 1  1717 SER 1717 1717 ?    ?   ?   A . n 
A 1  1718 LEU 1718 1718 ?    ?   ?   A . n 
A 1  1719 LEU 1719 1719 ?    ?   ?   A . n 
A 1  1720 ALA 1720 1720 ?    ?   ?   A . n 
A 1  1721 GLN 1721 1721 ?    ?   ?   A . n 
A 1  1722 THR 1722 1722 ?    ?   ?   A . n 
A 1  1723 VAL 1723 1723 ?    ?   ?   A . n 
A 1  1724 ALA 1724 1724 ?    ?   ?   A . n 
A 1  1725 ASN 1725 1725 ?    ?   ?   A . n 
A 1  1726 ARG 1726 1726 ?    ?   ?   A . n 
A 1  1727 ASN 1727 1727 1727 ASN ALA A . n 
A 1  1728 SER 1728 1728 1728 SER SER A . n 
A 1  1729 GLU 1729 1729 1729 GLU GLU A . n 
A 1  1730 ALA 1730 1730 1730 ALA ALA A . n 
A 1  1731 ARG 1731 1731 1731 ARG ARG A . n 
A 1  1732 ALA 1732 1732 1732 ALA ALA A . n 
A 1  1733 PHE 1733 1733 1733 PHE PHE A . n 
A 1  1734 LYS 1734 1734 1734 LYS LYS A . n 
A 1  1735 PRO 1735 1735 ?    ?   ?   A . n 
A 1  1736 GLU 1736 1736 ?    ?   ?   A . n 
A 1  1737 THR 1737 1737 ?    ?   ?   A . n 
A 1  1738 ILE 1738 1738 ?    ?   ?   A . n 
A 1  1739 SER 1739 1739 1739 SER SER A . n 
A 1  1740 ALA 1740 1740 1740 ALA ALA A . n 
A 1  1741 PHE 1741 1741 1741 PHE PHE A . n 
A 1  1742 THR 1742 1742 1742 THR THR A . n 
A 1  1743 SER 1743 1743 1743 SER SER A . n 
A 1  1744 ASP 1744 1744 1744 ASP ASP A . n 
A 1  1745 PRO 1745 1745 1745 PRO PRO A . n 
A 1  1746 ALA 1746 1746 1746 ALA ALA A . n 
A 1  1747 LEU 1747 1747 1747 LEU LEU A . n 
A 1  1748 LEU 1748 1748 1748 LEU LEU A . n 
A 1  1749 SER 1749 1749 1749 SER SER A . n 
A 1  1750 PHE 1750 1750 1750 PHE PHE A . n 
A 1  1751 ALA 1751 1751 1751 ALA ALA A . n 
A 1  1752 GLU 1752 1752 1752 GLU GLU A . n 
A 1  1753 TYR 1753 1753 1753 TYR TYR A . n 
A 1  1754 PHE 1754 1754 1754 PHE PHE A . n 
A 1  1755 CYS 1755 1755 1755 CYS CYS A . n 
A 1  1756 LYS 1756 1756 1756 LYS LYS A . n 
A 1  1757 PRO 1757 1757 1757 PRO PRO A . n 
A 1  1758 THR 1758 1758 1758 THR THR A . n 
A 1  1759 VAL 1759 1759 1759 VAL VAL A . n 
A 1  1760 ASN 1760 1760 1760 ASN ASN A . n 
A 1  1761 MET 1761 1761 1761 MET MET A . n 
A 1  1762 GLY 1762 1762 1762 GLY GLY A . n 
A 1  1763 GLN 1763 1763 1763 GLN GLN A . n 
A 1  1764 LYS 1764 1764 1764 LYS LYS A . n 
A 1  1765 GLN 1765 1765 1765 GLN GLN A . n 
A 1  1766 GLU 1766 1766 1766 GLU GLU A . n 
A 1  1767 ILE 1767 1767 1767 ILE ILE A . n 
A 1  1768 LEU 1768 1768 1768 LEU LEU A . n 
A 1  1769 ASP 1769 1769 1769 ASP ASP A . n 
A 1  1770 LEU 1770 1770 1770 LEU LEU A . n 
A 1  1771 PHE 1771 1771 1771 PHE PHE A . n 
A 1  1772 SER 1772 1772 1772 SER SER A . n 
A 1  1773 SER 1773 1773 1773 SER SER A . n 
A 1  1774 VAL 1774 1774 1774 VAL VAL A . n 
A 1  1775 LEU 1775 1775 1775 LEU LEU A . n 
A 1  1776 TYR 1776 1776 1776 TYR TYR A . n 
A 1  1777 GLU 1777 1777 1777 GLU GLU A . n 
A 1  1778 CYS 1778 1778 1778 CYS CYS A . n 
A 1  1779 VAL 1779 1779 1779 VAL VAL A . n 
A 1  1780 THR 1780 1780 1780 THR THR A . n 
A 1  1781 GLN 1781 1781 1781 GLN GLN A . n 
A 1  1782 GLU 1782 1782 1782 GLU GLU A . n 
A 1  1783 THR 1783 1783 1783 THR THR A . n 
A 1  1784 PRO 1784 1784 1784 PRO PRO A . n 
A 1  1785 GLU 1785 1785 1785 GLU GLU A . n 
A 1  1786 MET 1786 1786 1786 MET MET A . n 
A 1  1787 LEU 1787 1787 1787 LEU LEU A . n 
A 1  1788 PRO 1788 1788 1788 PRO PRO A . n 
A 1  1789 ALA 1789 1789 1789 ALA ALA A . n 
A 1  1790 TYR 1790 1790 1790 TYR TYR A . n 
A 1  1791 ILE 1791 1791 1791 ILE ILE A . n 
A 1  1792 ALA 1792 1792 1792 ALA ALA A . n 
A 1  1793 MET 1793 1793 1793 MET MET A . n 
A 1  1794 ASP 1794 1794 1794 ASP ASP A . n 
A 1  1795 GLN 1795 1795 1795 GLN GLN A . n 
A 1  1796 ALA 1796 1796 1796 ALA ALA A . n 
A 1  1797 ILE 1797 1797 1797 ILE ILE A . n 
A 1  1798 ARG 1798 1798 1798 ARG ARG A . n 
A 1  1799 ARG 1799 1799 1799 ARG ARG A . n 
A 1  1800 LEU 1800 1800 1800 LEU LEU A . n 
A 1  1801 GLY 1801 1801 1801 GLY GLY A . n 
A 1  1802 ARG 1802 1802 1802 ARG ARG A . n 
A 1  1803 ARG 1803 1803 1803 ARG ARG A . n 
A 1  1804 GLU 1804 1804 1804 GLU GLU A . n 
A 1  1805 MET 1805 1805 1805 MET MET A . n 
A 1  1806 SER 1806 1806 1806 SER SER A . n 
A 1  1807 GLU 1807 1807 1807 GLU GLU A . n 
A 1  1808 THR 1808 1808 1808 THR THR A . n 
A 1  1809 SER 1809 1809 1809 SER SER A . n 
A 1  1810 GLU 1810 1810 1810 GLU GLU A . n 
A 1  1811 LEU 1811 1811 1811 LEU LEU A . n 
A 1  1812 TRP 1812 1812 1812 TRP TRP A . n 
A 1  1813 GLN 1813 1813 1813 GLN GLN A . n 
A 1  1814 ILE 1814 1814 1814 ILE ILE A . n 
A 1  1815 LYS 1815 1815 1815 LYS LYS A . n 
A 1  1816 LEU 1816 1816 1816 LEU LEU A . n 
A 1  1817 VAL 1817 1817 1817 VAL VAL A . n 
A 1  1818 LEU 1818 1818 1818 LEU LEU A . n 
A 1  1819 GLU 1819 1819 1819 GLU GLU A . n 
A 1  1820 PHE 1820 1820 1820 PHE PHE A . n 
A 1  1821 PHE 1821 1821 1821 PHE PHE A . n 
A 1  1822 SER 1822 1822 1822 SER SER A . n 
A 1  1823 SER 1823 1823 1823 SER SER A . n 
A 1  1824 ARG 1824 1824 1824 ARG ARG A . n 
A 1  1825 SER 1825 1825 1825 SER SER A . n 
A 1  1826 HIS 1826 1826 1826 HIS HIS A . n 
A 1  1827 GLN 1827 1827 1827 GLN GLN A . n 
A 1  1828 GLU 1828 1828 ?    ?   ?   A . n 
A 1  1829 ARG 1829 1829 ?    ?   ?   A . n 
A 1  1830 LEU 1830 1830 ?    ?   ?   A . n 
A 1  1831 GLN 1831 1831 ?    ?   ?   A . n 
A 1  1832 ASN 1832 1832 ?    ?   ?   A . n 
A 1  1833 HIS 1833 1833 ?    ?   ?   A . n 
A 1  1834 PRO 1834 1834 ?    ?   ?   A . n 
A 1  1835 LYS 1835 1835 ?    ?   ?   A . n 
A 1  1836 ARG 1836 1836 ?    ?   ?   A . n 
A 1  1837 GLY 1837 1837 ?    ?   ?   A . n 
A 1  1838 LEU 1838 1838 ?    ?   ?   A . n 
A 1  1839 PHE 1839 1839 1839 PHE PHE A . n 
A 1  1840 MET 1840 1840 1840 MET MET A . n 
A 1  1841 ASN 1841 1841 1841 ASN ASN A . n 
A 1  1842 SER 1842 1842 1842 SER SER A . n 
A 1  1843 GLU 1843 1843 1843 GLU GLU A . n 
A 1  1844 PHE 1844 1844 1844 PHE PHE A . n 
A 1  1845 LEU 1845 1845 1845 LEU LEU A . n 
A 1  1846 PRO 1846 1846 1846 PRO PRO A . n 
A 1  1847 VAL 1847 1847 1847 VAL VAL A . n 
A 1  1848 VAL 1848 1848 1848 VAL VAL A . n 
A 1  1849 LYS 1849 1849 1849 LYS LYS A . n 
A 1  1850 CYS 1850 1850 1850 CYS CYS A . n 
A 1  1851 THR 1851 1851 1851 THR THR A . n 
A 1  1852 ILE 1852 1852 1852 ILE ILE A . n 
A 1  1853 ASP 1853 1853 1853 ASP ASP A . n 
A 1  1854 ASN 1854 1854 1854 ASN ASN A . n 
A 1  1855 THR 1855 1855 1855 THR THR A . n 
A 1  1856 LEU 1856 1856 1856 LEU LEU A . n 
A 1  1857 ASP 1857 1857 1857 ASP ASP A . n 
A 1  1858 GLN 1858 1858 1858 GLN GLN A . n 
A 1  1859 TRP 1859 1859 1859 TRP TRP A . n 
A 1  1860 LEU 1860 1860 1860 LEU LEU A . n 
A 1  1861 GLN 1861 1861 1861 GLN GLN A . n 
A 1  1862 VAL 1862 1862 1862 VAL VAL A . n 
A 1  1863 GLY 1863 1863 1863 GLY GLY A . n 
A 1  1864 GLY 1864 1864 1864 GLY GLY A . n 
A 1  1865 ASP 1865 1865 1865 ASP ASP A . n 
A 1  1866 MET 1866 1866 1866 MET MET A . n 
A 1  1867 CYS 1867 1867 1867 CYS CYS A . n 
A 1  1868 VAL 1868 1868 1868 VAL VAL A . n 
A 1  1869 HIS 1869 1869 1869 HIS HIS A . n 
A 1  1870 ALA 1870 1870 1870 ALA ALA A . n 
A 1  1871 TYR 1871 1871 1871 TYR TYR A . n 
A 1  1872 LEU 1872 1872 1872 LEU LEU A . n 
A 1  1873 SER 1873 1873 1873 SER SER A . n 
A 1  1874 GLY 1874 1874 ?    ?   ?   A . n 
A 1  1875 GLN 1875 1875 ?    ?   ?   A . n 
A 1  1876 PRO 1876 1876 ?    ?   ?   A . n 
A 1  1877 LEU 1877 1877 1877 LEU LEU A . n 
A 1  1878 GLU 1878 1878 1878 GLU GLU A . n 
A 1  1879 GLU 1879 1879 1879 GLU GLU A . n 
A 1  1880 SER 1880 1880 1880 SER SER A . n 
A 1  1881 GLN 1881 1881 1881 GLN GLN A . n 
A 1  1882 LEU 1882 1882 1882 LEU LEU A . n 
A 1  1883 SER 1883 1883 1883 SER SER A . n 
A 1  1884 MET 1884 1884 1884 MET MET A . n 
A 1  1885 LEU 1885 1885 1885 LEU LEU A . n 
A 1  1886 ALA 1886 1886 1886 ALA ALA A . n 
A 1  1887 CYS 1887 1887 1887 CYS CYS A . n 
A 1  1888 PHE 1888 1888 1888 PHE PHE A . n 
A 1  1889 LEU 1889 1889 1889 LEU ALA A . n 
A 1  1890 VAL 1890 1890 1890 VAL VAL A . n 
A 1  1891 TYR 1891 1891 1891 TYR TYR A . n 
A 1  1892 HIS 1892 1892 1892 HIS HIS A . n 
A 1  1893 SER 1893 1893 1893 SER SER A . n 
A 1  1894 VAL 1894 1894 1894 VAL VAL A . n 
A 1  1895 PRO 1895 1895 1895 PRO PRO A . n 
A 1  1896 ALA 1896 1896 1896 ALA ALA A . n 
A 1  1897 PRO 1897 1897 1897 PRO PRO A . n 
A 1  1898 GLN 1898 1898 ?    ?   ?   A . n 
A 1  1899 HIS 1899 1899 ?    ?   ?   A . n 
A 1  1900 LEU 1900 1900 ?    ?   ?   A . n 
A 1  1901 PRO 1901 1901 ?    ?   ?   A . n 
A 1  1902 PRO 1902 1902 ?    ?   ?   A . n 
A 1  1903 ILE 1903 1903 ?    ?   ?   A . n 
A 1  1904 GLY 1904 1904 ?    ?   ?   A . n 
A 1  1905 LEU 1905 1905 ?    ?   ?   A . n 
A 1  1906 GLU 1906 1906 ?    ?   ?   A . n 
A 1  1907 GLY 1907 1907 ?    ?   ?   A . n 
A 1  1908 SER 1908 1908 ?    ?   ?   A . n 
A 1  1909 THR 1909 1909 ?    ?   ?   A . n 
A 1  1910 SER 1910 1910 1910 SER ALA A . n 
A 1  1911 PHE 1911 1911 1911 PHE ALA A . n 
A 1  1912 ALA 1912 1912 1912 ALA ALA A . n 
A 1  1913 GLU 1913 1913 1913 GLU ALA A . n 
A 1  1914 LEU 1914 1914 1914 LEU ALA A . n 
A 1  1915 LEU 1915 1915 1915 LEU ALA A . n 
A 1  1916 PHE 1916 1916 1916 PHE ALA A . n 
A 1  1917 LYS 1917 1917 1917 LYS ALA A . n 
A 1  1918 PHE 1918 1918 1918 PHE ALA A . n 
A 1  1919 LYS 1919 1919 1919 LYS ALA A . n 
A 1  1920 GLN 1920 1920 1920 GLN ALA A . n 
A 1  1921 LEU 1921 1921 1921 LEU ALA A . n 
A 1  1922 LYS 1922 1922 1922 LYS ALA A . n 
A 1  1923 MET 1923 1923 1923 MET ALA A . n 
A 1  1924 PRO 1924 1924 1924 PRO ALA A . n 
A 1  1925 VAL 1925 1925 1925 VAL ALA A . n 
A 1  1926 ARG 1926 1926 1926 ARG ALA A . n 
A 1  1927 ALA 1927 1927 1927 ALA ALA A . n 
A 1  1928 LEU 1928 1928 1928 LEU ALA A . n 
A 1  1929 LEU 1929 1929 1929 LEU ALA A . n 
A 1  1930 ARG 1930 1930 1930 ARG ALA A . n 
A 1  1931 LEU 1931 1931 1931 LEU ALA A . n 
A 1  1932 ALA 1932 1932 1932 ALA ALA A . n 
A 1  1933 PRO 1933 1933 1933 PRO ALA A . n 
A 1  1934 LEU 1934 1934 1934 LEU ALA A . n 
A 1  1935 LEU 1935 1935 ?    ?   ?   A . n 
A 1  1936 LEU 1936 1936 ?    ?   ?   A . n 
A 1  1937 GLY 1937 1937 ?    ?   ?   A . n 
A 1  1938 ASN 1938 1938 ?    ?   ?   A . n 
A 1  1939 PRO 1939 1939 ?    ?   ?   A . n 
A 1  1940 GLN 1940 1940 ?    ?   ?   A . n 
A 1  1941 PRO 1941 1941 ?    ?   ?   A . n 
A 1  1942 MET 1942 1942 ?    ?   ?   A . n 
A 1  1943 VAL 1943 1943 ?    ?   ?   A . n 
A 1  1944 MET 1944 1944 ?    ?   ?   A . n 
B 2  1    MET 1    1    1    MET MET B . n 
B 2  2    LYS 2    2    2    LYS LYS B . n 
B 2  3    VAL 3    3    3    VAL VAL B . n 
B 2  4    LYS 4    4    4    LYS LYS B . n 
B 2  5    ILE 5    5    5    ILE ILE B . n 
B 2  6    LYS 6    6    6    LYS LYS B . n 
B 2  7    CYS 7    7    7    CYS CYS B . n 
B 2  8    TRP 8    8    8    TRP TRP B . n 
B 2  9    ASN 9    9    9    ASN ASN B . n 
B 2  10   GLY 10   10   10   GLY GLY B . n 
B 2  11   VAL 11   11   11   VAL VAL B . n 
B 2  12   ALA 12   12   12   ALA ALA B . n 
B 2  13   THR 13   13   13   THR THR B . n 
B 2  14   TRP 14   14   14   TRP TRP B . n 
B 2  15   LEU 15   15   15   LEU LEU B . n 
B 2  16   TRP 16   16   16   TRP TRP B . n 
B 2  17   VAL 17   17   ?    ?   ?   B . n 
B 2  18   ALA 18   18   ?    ?   ?   B . n 
B 2  19   ASN 19   19   ?    ?   ?   B . n 
B 2  20   ASP 20   20   ?    ?   ?   B . n 
B 2  21   GLU 21   21   ?    ?   ?   B . n 
B 2  22   ASN 22   22   22   ASN ASN B . n 
B 2  23   CYS 23   23   23   CYS CYS B . n 
B 2  24   GLY 24   24   24   GLY GLY B . n 
B 2  25   ILE 25   25   25   ILE ILE B . n 
B 2  26   CYS 26   26   26   CYS CYS B . n 
B 2  27   ARG 27   27   27   ARG ARG B . n 
B 2  28   MET 28   28   28   MET MET B . n 
B 2  29   ALA 29   29   29   ALA ALA B . n 
B 2  30   PHE 30   30   ?    ?   ?   B . n 
B 2  31   ASN 31   31   ?    ?   ?   B . n 
B 2  32   GLY 32   32   ?    ?   ?   B . n 
B 2  33   CYS 33   33   33   CYS CYS B . n 
B 2  34   CYS 34   34   34   CYS CYS B . n 
B 2  35   PRO 35   35   35   PRO PRO B . n 
B 2  36   ASP 36   36   36   ASP ASP B . n 
B 2  37   CYS 37   37   37   CYS CYS B . n 
B 2  38   LYS 38   38   ?    ?   ?   B . n 
B 2  39   VAL 39   39   ?    ?   ?   B . n 
B 2  40   PRO 40   40   ?    ?   ?   B . n 
B 2  41   GLY 41   41   ?    ?   ?   B . n 
B 2  42   ASP 42   42   ?    ?   ?   B . n 
B 2  43   ASP 43   43   ?    ?   ?   B . n 
B 2  44   CYS 44   44   44   CYS CYS B . n 
B 2  45   PRO 45   45   45   PRO PRO B . n 
B 2  46   LEU 46   46   46   LEU LEU B . n 
B 2  47   VAL 47   47   47   VAL VAL B . n 
B 2  48   TRP 48   48   48   TRP TRP B . n 
B 2  49   GLY 49   49   49   GLY GLY B . n 
B 2  50   GLN 50   50   50   GLN GLN B . n 
B 2  51   CYS 51   51   51   CYS CYS B . n 
B 2  52   SER 52   52   52   SER SER B . n 
B 2  53   HIS 53   53   53   HIS HIS B . n 
B 2  54   CYS 54   54   54   CYS CYS B . n 
B 2  55   PHE 55   55   55   PHE PHE B . n 
B 2  56   HIS 56   56   56   HIS HIS B . n 
B 2  57   MET 57   57   57   MET MET B . n 
B 2  58   HIS 58   58   58   HIS HIS B . n 
B 2  59   CYS 59   59   59   CYS CYS B . n 
B 2  60   ILE 60   60   60   ILE ILE B . n 
B 2  61   LEU 61   61   61   LEU LEU B . n 
B 2  62   LYS 62   62   62   LYS LYS B . n 
B 2  63   TRP 63   63   63   TRP TRP B . n 
B 2  64   LEU 64   64   64   LEU LEU B . n 
B 2  65   HIS 65   65   65   HIS HIS B . n 
B 2  66   ALA 66   66   66   ALA ALA B . n 
B 2  67   GLN 67   67   67   GLN GLN B . n 
B 2  68   GLN 68   68   68   GLN GLN B . n 
B 2  69   VAL 69   69   69   VAL VAL B . n 
B 2  70   GLN 70   70   70   GLN GLN B . n 
B 2  71   GLN 71   71   71   GLN GLN B . n 
B 2  72   HIS 72   72   72   HIS HIS B . n 
B 2  73   CYS 73   73   73   CYS CYS B . n 
B 2  74   PRO 74   74   74   PRO PRO B . n 
B 2  75   MET 75   75   75   MET MET B . n 
B 2  76   CYS 76   76   76   CYS CYS B . n 
B 2  77   ARG 77   77   77   ARG ARG B . n 
B 2  78   GLN 78   78   78   GLN GLN B . n 
B 2  79   GLU 79   79   79   GLU GLU B . n 
B 2  80   TRP 80   80   80   TRP TRP B . n 
B 2  81   LYS 81   81   81   LYS LYS B . n 
B 2  82   PHE 82   82   82   PHE PHE B . n 
B 2  83   LYS 83   83   83   LYS LYS B . n 
B 2  84   GLU 84   84   ?    ?   ?   B . n 
C 3  1    MET 1    1    ?    ?   ?   C . n 
C 3  2    ALA 2    2    ?    ?   ?   C . n 
C 3  3    ALA 3    3    ?    ?   ?   C . n 
C 3  4    SER 4    4    ?    ?   ?   C . n 
C 3  5    THR 5    5    ?    ?   ?   C . n 
C 3  6    SER 6    6    ?    ?   ?   C . n 
C 3  7    MET 7    7    ?    ?   ?   C . n 
C 3  8    VAL 8    8    ?    ?   ?   C . n 
C 3  9    PRO 9    9    ?    ?   ?   C . n 
C 3  10   VAL 10   10   ?    ?   ?   C . n 
C 3  11   ALA 11   11   ?    ?   ?   C . n 
C 3  12   VAL 12   12   ?    ?   ?   C . n 
C 3  13   THR 13   13   ?    ?   ?   C . n 
C 3  14   ALA 14   14   ?    ?   ?   C . n 
C 3  15   ALA 15   15   ?    ?   ?   C . n 
C 3  16   VAL 16   16   ?    ?   ?   C . n 
C 3  17   ALA 17   17   ?    ?   ?   C . n 
C 3  18   PRO 18   18   ?    ?   ?   C . n 
C 3  19   VAL 19   19   ?    ?   ?   C . n 
C 3  20   LEU 20   20   ?    ?   ?   C . n 
C 3  21   SER 21   21   ?    ?   ?   C . n 
C 3  22   ILE 22   22   ?    ?   ?   C . n 
C 3  23   ASN 23   23   ?    ?   ?   C . n 
C 3  24   SER 24   24   ?    ?   ?   C . n 
C 3  25   ASP 25   25   ?    ?   ?   C . n 
C 3  26   PHE 26   26   26   PHE PHE C . n 
C 3  27   SER 27   27   27   SER SER C . n 
C 3  28   ASP 28   28   28   ASP ASP C . n 
C 3  29   LEU 29   29   29   LEU LEU C . n 
C 3  30   ARG 30   30   30   ARG ARG C . n 
C 3  31   GLU 31   31   31   GLU GLU C . n 
C 3  32   ILE 32   32   32   ILE ILE C . n 
C 3  33   LYS 33   33   33   LYS LYS C . n 
C 3  34   LYS 34   34   34   LYS LYS C . n 
C 3  35   GLN 35   35   35   GLN GLN C . n 
C 3  36   LEU 36   36   36   LEU LEU C . n 
C 3  37   LEU 37   37   37   LEU LEU C . n 
C 3  38   LEU 38   38   38   LEU LEU C . n 
C 3  39   ILE 39   39   39   ILE ILE C . n 
C 3  40   ALA 40   40   40   ALA ALA C . n 
C 3  41   GLY 41   41   41   GLY GLY C . n 
C 3  42   LEU 42   42   42   LEU LEU C . n 
C 3  43   THR 43   43   43   THR THR C . n 
C 3  44   ARG 44   44   44   ARG ARG C . n 
C 3  45   GLU 45   45   45   GLU GLU C . n 
C 3  46   ARG 46   46   46   ARG ARG C . n 
C 3  47   GLY 47   47   47   GLY GLY C . n 
C 3  48   LEU 48   48   48   LEU LEU C . n 
C 3  49   LEU 49   49   49   LEU LEU C . n 
C 3  50   HIS 50   50   50   HIS HIS C . n 
C 3  51   SER 51   51   51   SER SER C . n 
C 3  52   SER 52   52   52   SER SER C . n 
C 3  53   LYS 53   53   53   LYS LYS C . n 
C 3  54   TRP 54   54   54   TRP TRP C . n 
C 3  55   SER 55   55   55   SER SER C . n 
C 3  56   ALA 56   56   56   ALA ALA C . n 
C 3  57   GLU 57   57   57   GLU GLU C . n 
C 3  58   LEU 58   58   58   LEU LEU C . n 
C 3  59   ALA 59   59   59   ALA ALA C . n 
C 3  60   PHE 60   60   60   PHE PHE C . n 
C 3  61   SER 61   61   61   SER SER C . n 
C 3  62   LEU 62   62   62   LEU LEU C . n 
C 3  63   PRO 63   63   63   PRO PRO C . n 
C 3  64   ALA 64   64   64   ALA ALA C . n 
C 3  65   LEU 65   65   65   LEU LEU C . n 
C 3  66   PRO 66   66   66   PRO PRO C . n 
C 3  67   LEU 67   67   67   LEU LEU C . n 
C 3  68   ALA 68   68   68   ALA ALA C . n 
C 3  69   GLU 69   69   69   GLU GLU C . n 
C 3  70   LEU 70   70   70   LEU LEU C . n 
C 3  71   GLN 71   71   71   GLN GLN C . n 
C 3  72   PRO 72   72   72   PRO PRO C . n 
C 3  73   PRO 73   73   73   PRO PRO C . n 
C 3  74   PRO 74   74   74   PRO PRO C . n 
C 3  75   PRO 75   75   75   PRO PRO C . n 
C 3  76   ILE 76   76   76   ILE ILE C . n 
C 3  77   THR 77   77   77   THR THR C . n 
C 3  78   GLU 78   78   78   GLU GLU C . n 
C 3  79   GLU 79   79   79   GLU GLU C . n 
C 3  80   ASP 80   80   80   ASP ASP C . n 
C 3  81   ALA 81   81   81   ALA ALA C . n 
C 3  82   GLN 82   82   82   GLN GLN C . n 
C 3  83   ASP 83   83   83   ASP ASP C . n 
C 3  84   MET 84   84   84   MET MET C . n 
C 3  85   ASP 85   85   85   ASP ASP C . n 
C 3  86   ALA 86   86   86   ALA ALA C . n 
C 3  87   TYR 87   87   87   TYR TYR C . n 
C 3  88   THR 88   88   88   THR THR C . n 
C 3  89   LEU 89   89   89   LEU LEU C . n 
C 3  90   ALA 90   90   90   ALA ALA C . n 
C 3  91   LYS 91   91   91   LYS LYS C . n 
C 3  92   ALA 92   92   92   ALA ALA C . n 
C 3  93   TYR 93   93   93   TYR TYR C . n 
C 3  94   PHE 94   94   94   PHE PHE C . n 
C 3  95   ASP 95   95   95   ASP ASP C . n 
C 3  96   VAL 96   96   96   VAL VAL C . n 
C 3  97   LYS 97   97   97   LYS LYS C . n 
C 3  98   GLU 98   98   98   GLU GLU C . n 
C 3  99   TYR 99   99   99   TYR TYR C . n 
C 3  100  ASP 100  100  100  ASP ASP C . n 
C 3  101  ARG 101  101  101  ARG ARG C . n 
C 3  102  ALA 102  102  102  ALA ALA C . n 
C 3  103  ALA 103  103  103  ALA ALA C . n 
C 3  104  HIS 104  104  104  HIS HIS C . n 
C 3  105  PHE 105  105  105  PHE PHE C . n 
C 3  106  LEU 106  106  106  LEU LEU C . n 
C 3  107  HIS 107  107  107  HIS HIS C . n 
C 3  108  GLY 108  108  108  GLY GLY C . n 
C 3  109  CYS 109  109  109  CYS CYS C . n 
C 3  110  ASN 110  110  110  ASN ASN C . n 
C 3  111  SER 111  111  111  SER SER C . n 
C 3  112  LYS 112  112  112  LYS LYS C . n 
C 3  113  LYS 113  113  113  LYS LYS C . n 
C 3  114  ALA 114  114  114  ALA ALA C . n 
C 3  115  TYR 115  115  115  TYR TYR C . n 
C 3  116  PHE 116  116  116  PHE PHE C . n 
C 3  117  LEU 117  117  117  LEU LEU C . n 
C 3  118  TYR 118  118  118  TYR TYR C . n 
C 3  119  MET 119  119  119  MET MET C . n 
C 3  120  TYR 120  120  120  TYR TYR C . n 
C 3  121  SER 121  121  121  SER SER C . n 
C 3  122  ARG 122  122  122  ARG ARG C . n 
C 3  123  TYR 123  123  123  TYR TYR C . n 
C 3  124  LEU 124  124  124  LEU LEU C . n 
C 3  125  SER 125  125  125  SER SER C . n 
C 3  126  GLY 126  126  126  GLY GLY C . n 
C 3  127  GLU 127  127  127  GLU GLU C . n 
C 3  128  LYS 128  128  128  LYS LYS C . n 
C 3  129  LYS 129  129  129  LYS LYS C . n 
C 3  130  LYS 130  130  130  LYS LYS C . n 
C 3  131  ASP 131  131  131  ASP ASP C . n 
C 3  132  ASP 132  132  132  ASP ASP C . n 
C 3  133  GLU 133  133  133  GLU GLU C . n 
C 3  134  THR 134  134  134  THR THR C . n 
C 3  135  VAL 135  135  135  VAL VAL C . n 
C 3  136  ASP 136  136  136  ASP ASP C . n 
C 3  137  SER 137  137  137  SER SER C . n 
C 3  138  LEU 138  138  ?    ?   ?   C . n 
C 3  139  GLY 139  139  ?    ?   ?   C . n 
C 3  140  PRO 140  140  ?    ?   ?   C . n 
C 3  141  LEU 141  141  ?    ?   ?   C . n 
C 3  142  GLU 142  142  ?    ?   ?   C . n 
C 3  143  LYS 143  143  ?    ?   ?   C . n 
C 3  144  GLY 144  144  ?    ?   ?   C . n 
C 3  145  GLN 145  145  145  GLN GLN C . n 
C 3  146  VAL 146  146  146  VAL VAL C . n 
C 3  147  LYS 147  147  147  LYS LYS C . n 
C 3  148  ASN 148  148  148  ASN ASN C . n 
C 3  149  GLU 149  149  149  GLU GLU C . n 
C 3  150  ALA 150  150  150  ALA ALA C . n 
C 3  151  LEU 151  151  151  LEU LEU C . n 
C 3  152  ARG 152  152  152  ARG ARG C . n 
C 3  153  GLU 153  153  153  GLU GLU C . n 
C 3  154  LEU 154  154  154  LEU LEU C . n 
C 3  155  ARG 155  155  155  ARG ARG C . n 
C 3  156  VAL 156  156  156  VAL VAL C . n 
C 3  157  GLU 157  157  157  GLU GLU C . n 
C 3  158  LEU 158  158  158  LEU LEU C . n 
C 3  159  SER 159  159  159  SER SER C . n 
C 3  160  LYS 160  160  160  LYS LYS C . n 
C 3  161  LYS 161  161  161  LYS LYS C . n 
C 3  162  HIS 162  162  162  HIS HIS C . n 
C 3  163  GLN 163  163  163  GLN GLN C . n 
C 3  164  ALA 164  164  164  ALA ALA C . n 
C 3  165  ARG 165  165  165  ARG ARG C . n 
C 3  166  GLU 166  166  166  GLU GLU C . n 
C 3  167  LEU 167  167  167  LEU LEU C . n 
C 3  168  ASP 168  168  168  ASP ASP C . n 
C 3  169  GLY 169  169  169  GLY GLY C . n 
C 3  170  PHE 170  170  170  PHE PHE C . n 
C 3  171  GLY 171  171  171  GLY GLY C . n 
C 3  172  LEU 172  172  172  LEU LEU C . n 
C 3  173  TYR 173  173  173  TYR TYR C . n 
C 3  174  LEU 174  174  174  LEU LEU C . n 
C 3  175  TYR 175  175  175  TYR TYR C . n 
C 3  176  GLY 176  176  176  GLY GLY C . n 
C 3  177  VAL 177  177  177  VAL VAL C . n 
C 3  178  VAL 178  178  178  VAL VAL C . n 
C 3  179  LEU 179  179  179  LEU LEU C . n 
C 3  180  ARG 180  180  180  ARG ARG C . n 
C 3  181  LYS 181  181  181  LYS LYS C . n 
C 3  182  LEU 182  182  182  LEU LEU C . n 
C 3  183  ASP 183  183  183  ASP ASP C . n 
C 3  184  LEU 184  184  184  LEU LEU C . n 
C 3  185  VAL 185  185  185  VAL VAL C . n 
C 3  186  LYS 186  186  186  LYS LYS C . n 
C 3  187  GLU 187  187  187  GLU GLU C . n 
C 3  188  ALA 188  188  188  ALA ALA C . n 
C 3  189  ILE 189  189  189  ILE ILE C . n 
C 3  190  ASP 190  190  190  ASP ASP C . n 
C 3  191  VAL 191  191  191  VAL VAL C . n 
C 3  192  PHE 192  192  192  PHE PHE C . n 
C 3  193  VAL 193  193  193  VAL VAL C . n 
C 3  194  GLU 194  194  194  GLU GLU C . n 
C 3  195  ALA 195  195  195  ALA ALA C . n 
C 3  196  THR 196  196  196  THR THR C . n 
C 3  197  HIS 197  197  197  HIS HIS C . n 
C 3  198  VAL 198  198  198  VAL VAL C . n 
C 3  199  LEU 199  199  199  LEU LEU C . n 
C 3  200  PRO 200  200  200  PRO PRO C . n 
C 3  201  LEU 201  201  201  LEU LEU C . n 
C 3  202  HIS 202  202  202  HIS HIS C . n 
C 3  203  TRP 203  203  203  TRP TRP C . n 
C 3  204  GLY 204  204  204  GLY GLY C . n 
C 3  205  ALA 205  205  205  ALA ALA C . n 
C 3  206  TRP 206  206  206  TRP TRP C . n 
C 3  207  LEU 207  207  207  LEU LEU C . n 
C 3  208  GLU 208  208  208  GLU GLU C . n 
C 3  209  LEU 209  209  209  LEU LEU C . n 
C 3  210  CYS 210  210  210  CYS CYS C . n 
C 3  211  ASN 211  211  211  ASN ASN C . n 
C 3  212  LEU 212  212  212  LEU LEU C . n 
C 3  213  ILE 213  213  213  ILE ILE C . n 
C 3  214  THR 214  214  214  THR THR C . n 
C 3  215  ASP 215  215  215  ASP ASP C . n 
C 3  216  LYS 216  216  216  LYS LYS C . n 
C 3  217  GLU 217  217  217  GLU GLU C . n 
C 3  218  MET 218  218  218  MET MET C . n 
C 3  219  LEU 219  219  219  LEU LEU C . n 
C 3  220  LYS 220  220  220  LYS LYS C . n 
C 3  221  PHE 221  221  221  PHE PHE C . n 
C 3  222  LEU 222  222  222  LEU LEU C . n 
C 3  223  SER 223  223  223  SER SER C . n 
C 3  224  LEU 224  224  224  LEU LEU C . n 
C 3  225  PRO 225  225  225  PRO PRO C . n 
C 3  226  ASP 226  226  226  ASP ASP C . n 
C 3  227  THR 227  227  227  THR THR C . n 
C 3  228  TRP 228  228  228  TRP TRP C . n 
C 3  229  MET 229  229  229  MET MET C . n 
C 3  230  LYS 230  230  230  LYS LYS C . n 
C 3  231  GLU 231  231  231  GLU GLU C . n 
C 3  232  PHE 232  232  232  PHE PHE C . n 
C 3  233  PHE 233  233  233  PHE PHE C . n 
C 3  234  LEU 234  234  234  LEU LEU C . n 
C 3  235  ALA 235  235  235  ALA ALA C . n 
C 3  236  HIS 236  236  236  HIS HIS C . n 
C 3  237  ILE 237  237  237  ILE ILE C . n 
C 3  238  TYR 238  238  238  TYR TYR C . n 
C 3  239  THR 239  239  239  THR THR C . n 
C 3  240  GLU 240  240  240  GLU GLU C . n 
C 3  241  LEU 241  241  241  LEU LEU C . n 
C 3  242  GLN 242  242  242  GLN GLN C . n 
C 3  243  LEU 243  243  243  LEU LEU C . n 
C 3  244  ILE 244  244  244  ILE ILE C . n 
C 3  245  GLU 245  245  245  GLU GLU C . n 
C 3  246  GLU 246  246  246  GLU GLU C . n 
C 3  247  ALA 247  247  247  ALA ALA C . n 
C 3  248  LEU 248  248  248  LEU LEU C . n 
C 3  249  GLN 249  249  249  GLN GLN C . n 
C 3  250  LYS 250  250  250  LYS LYS C . n 
C 3  251  TYR 251  251  251  TYR TYR C . n 
C 3  252  GLN 252  252  252  GLN GLN C . n 
C 3  253  ASN 253  253  253  ASN ASN C . n 
C 3  254  LEU 254  254  254  LEU LEU C . n 
C 3  255  ILE 255  255  255  ILE ILE C . n 
C 3  256  ASP 256  256  256  ASP ASP C . n 
C 3  257  VAL 257  257  257  VAL VAL C . n 
C 3  258  GLY 258  258  258  GLY GLY C . n 
C 3  259  PHE 259  259  259  PHE PHE C . n 
C 3  260  SER 260  260  260  SER SER C . n 
C 3  261  LYS 261  261  261  LYS LYS C . n 
C 3  262  SER 262  262  262  SER SER C . n 
C 3  263  SER 263  263  263  SER SER C . n 
C 3  264  TYR 264  264  264  TYR TYR C . n 
C 3  265  ILE 265  265  265  ILE ILE C . n 
C 3  266  VAL 266  266  266  VAL VAL C . n 
C 3  267  SER 267  267  267  SER SER C . n 
C 3  268  GLN 268  268  268  GLN GLN C . n 
C 3  269  ILE 269  269  269  ILE ILE C . n 
C 3  270  ALA 270  270  270  ALA ALA C . n 
C 3  271  VAL 271  271  271  VAL VAL C . n 
C 3  272  ALA 272  272  272  ALA ALA C . n 
C 3  273  TYR 273  273  273  TYR TYR C . n 
C 3  274  HIS 274  274  274  HIS HIS C . n 
C 3  275  ASN 275  275  275  ASN ASN C . n 
C 3  276  ILE 276  276  276  ILE ILE C . n 
C 3  277  ARG 277  277  277  ARG ARG C . n 
C 3  278  ASP 278  278  278  ASP ASP C . n 
C 3  279  ILE 279  279  279  ILE ILE C . n 
C 3  280  ASP 280  280  280  ASP ASP C . n 
C 3  281  LYS 281  281  281  LYS LYS C . n 
C 3  282  ALA 282  282  282  ALA ALA C . n 
C 3  283  LEU 283  283  283  LEU LEU C . n 
C 3  284  SER 284  284  284  SER SER C . n 
C 3  285  ILE 285  285  285  ILE ILE C . n 
C 3  286  PHE 286  286  286  PHE PHE C . n 
C 3  287  ASN 287  287  287  ASN ASN C . n 
C 3  288  GLU 288  288  288  GLU GLU C . n 
C 3  289  LEU 289  289  289  LEU LEU C . n 
C 3  290  ARG 290  290  290  ARG ARG C . n 
C 3  291  LYS 291  291  291  LYS LYS C . n 
C 3  292  GLN 292  292  292  GLN GLN C . n 
C 3  293  ASP 293  293  293  ASP ASP C . n 
C 3  294  PRO 294  294  294  PRO PRO C . n 
C 3  295  TYR 295  295  295  TYR TYR C . n 
C 3  296  ARG 296  296  296  ARG ARG C . n 
C 3  297  ILE 297  297  297  ILE ILE C . n 
C 3  298  GLU 298  298  298  GLU GLU C . n 
C 3  299  ASN 299  299  299  ASN ASN C . n 
C 3  300  MET 300  300  300  MET MET C . n 
C 3  301  ASP 301  301  301  ASP ASP C . n 
C 3  302  THR 302  302  302  THR THR C . n 
C 3  303  PHE 303  303  303  PHE PHE C . n 
C 3  304  SER 304  304  304  SER SER C . n 
C 3  305  ASN 305  305  305  ASN ASN C . n 
C 3  306  LEU 306  306  306  LEU LEU C . n 
C 3  307  LEU 307  307  307  LEU LEU C . n 
C 3  308  TYR 308  308  308  TYR TYR C . n 
C 3  309  VAL 309  309  309  VAL VAL C . n 
C 3  310  ARG 310  310  310  ARG ARG C . n 
C 3  311  SER 311  311  311  SER SER C . n 
C 3  312  MET 312  312  312  MET MET C . n 
C 3  313  LYS 313  313  313  LYS LYS C . n 
C 3  314  SER 314  314  314  SER SER C . n 
C 3  315  GLU 315  315  315  GLU GLU C . n 
C 3  316  LEU 316  316  316  LEU LEU C . n 
C 3  317  SER 317  317  317  SER SER C . n 
C 3  318  TYR 318  318  318  TYR TYR C . n 
C 3  319  LEU 319  319  319  LEU LEU C . n 
C 3  320  ALA 320  320  320  ALA ALA C . n 
C 3  321  HIS 321  321  321  HIS HIS C . n 
C 3  322  ASN 322  322  322  ASN ASN C . n 
C 3  323  LEU 323  323  323  LEU LEU C . n 
C 3  324  CYS 324  324  324  CYS CYS C . n 
C 3  325  GLU 325  325  325  GLU GLU C . n 
C 3  326  ILE 326  326  326  ILE ILE C . n 
C 3  327  ASP 327  327  327  ASP ASP C . n 
C 3  328  LYS 328  328  328  LYS LYS C . n 
C 3  329  TYR 329  329  329  TYR TYR C . n 
C 3  330  ARG 330  330  330  ARG ARG C . n 
C 3  331  VAL 331  331  331  VAL VAL C . n 
C 3  332  GLU 332  332  332  GLU GLU C . n 
C 3  333  THR 333  333  333  THR THR C . n 
C 3  334  CYS 334  334  334  CYS CYS C . n 
C 3  335  CYS 335  335  335  CYS CYS C . n 
C 3  336  VAL 336  336  336  VAL VAL C . n 
C 3  337  ILE 337  337  337  ILE ILE C . n 
C 3  338  GLY 338  338  338  GLY GLY C . n 
C 3  339  ASN 339  339  339  ASN ASN C . n 
C 3  340  TYR 340  340  340  TYR TYR C . n 
C 3  341  TYR 341  341  341  TYR TYR C . n 
C 3  342  SER 342  342  342  SER SER C . n 
C 3  343  LEU 343  343  343  LEU LEU C . n 
C 3  344  ARG 344  344  344  ARG ARG C . n 
C 3  345  SER 345  345  345  SER SER C . n 
C 3  346  GLN 346  346  346  GLN GLN C . n 
C 3  347  HIS 347  347  347  HIS HIS C . n 
C 3  348  GLU 348  348  348  GLU GLU C . n 
C 3  349  LYS 349  349  349  LYS LYS C . n 
C 3  350  ALA 350  350  350  ALA ALA C . n 
C 3  351  ALA 351  351  351  ALA ALA C . n 
C 3  352  LEU 352  352  352  LEU LEU C . n 
C 3  353  TYR 353  353  353  TYR TYR C . n 
C 3  354  PHE 354  354  354  PHE PHE C . n 
C 3  355  GLN 355  355  355  GLN GLN C . n 
C 3  356  ARG 356  356  356  ARG ARG C . n 
C 3  357  ALA 357  357  357  ALA ALA C . n 
C 3  358  LEU 358  358  358  LEU LEU C . n 
C 3  359  LYS 359  359  359  LYS LYS C . n 
C 3  360  LEU 360  360  360  LEU LEU C . n 
C 3  361  ASN 361  361  361  ASN ASN C . n 
C 3  362  PRO 362  362  362  PRO PRO C . n 
C 3  363  ARG 363  363  363  ARG ARG C . n 
C 3  364  TYR 364  364  364  TYR TYR C . n 
C 3  365  LEU 365  365  365  LEU LEU C . n 
C 3  366  GLY 366  366  366  GLY GLY C . n 
C 3  367  ALA 367  367  367  ALA ALA C . n 
C 3  368  TRP 368  368  368  TRP TRP C . n 
C 3  369  THR 369  369  369  THR THR C . n 
C 3  370  LEU 370  370  370  LEU LEU C . n 
C 3  371  MET 371  371  371  MET MET C . n 
C 3  372  GLY 372  372  372  GLY GLY C . n 
C 3  373  HIS 373  373  373  HIS HIS C . n 
C 3  374  GLU 374  374  374  GLU GLU C . n 
C 3  375  TYR 375  375  375  TYR TYR C . n 
C 3  376  MET 376  376  376  MET MET C . n 
C 3  377  GLU 377  377  377  GLU GLU C . n 
C 3  378  MET 378  378  378  MET MET C . n 
C 3  379  LYS 379  379  379  LYS LYS C . n 
C 3  380  ASN 380  380  380  ASN ASN C . n 
C 3  381  THR 381  381  381  THR THR C . n 
C 3  382  SER 382  382  382  SER SER C . n 
C 3  383  ALA 383  383  383  ALA ALA C . n 
C 3  384  ALA 384  384  384  ALA ALA C . n 
C 3  385  ILE 385  385  385  ILE ILE C . n 
C 3  386  GLN 386  386  386  GLN GLN C . n 
C 3  387  ALA 387  387  387  ALA ALA C . n 
C 3  388  TYR 388  388  388  TYR TYR C . n 
C 3  389  ARG 389  389  389  ARG ARG C . n 
C 3  390  HIS 390  390  390  HIS HIS C . n 
C 3  391  ALA 391  391  391  ALA ALA C . n 
C 3  392  ILE 392  392  392  ILE ILE C . n 
C 3  393  GLU 393  393  393  GLU GLU C . n 
C 3  394  VAL 394  394  394  VAL VAL C . n 
C 3  395  ASN 395  395  395  ASN ASN C . n 
C 3  396  LYS 396  396  396  LYS LYS C . n 
C 3  397  ARG 397  397  397  ARG ARG C . n 
C 3  398  ASP 398  398  398  ASP ASP C . n 
C 3  399  TYR 399  399  399  TYR TYR C . n 
C 3  400  ARG 400  400  400  ARG ARG C . n 
C 3  401  ALA 401  401  401  ALA ALA C . n 
C 3  402  TRP 402  402  402  TRP TRP C . n 
C 3  403  TYR 403  403  403  TYR TYR C . n 
C 3  404  GLY 404  404  404  GLY GLY C . n 
C 3  405  LEU 405  405  405  LEU LEU C . n 
C 3  406  GLY 406  406  406  GLY GLY C . n 
C 3  407  GLN 407  407  407  GLN GLN C . n 
C 3  408  THR 408  408  408  THR THR C . n 
C 3  409  TYR 409  409  409  TYR TYR C . n 
C 3  410  GLU 410  410  410  GLU GLU C . n 
C 3  411  ILE 411  411  411  ILE ILE C . n 
C 3  412  LEU 412  412  412  LEU LEU C . n 
C 3  413  LYS 413  413  413  LYS LYS C . n 
C 3  414  MET 414  414  414  MET MET C . n 
C 3  415  PRO 415  415  415  PRO PRO C . n 
C 3  416  PHE 416  416  416  PHE PHE C . n 
C 3  417  TYR 417  417  417  TYR TYR C . n 
C 3  418  CYS 418  418  418  CYS CYS C . n 
C 3  419  LEU 419  419  419  LEU LEU C . n 
C 3  420  TYR 420  420  420  TYR TYR C . n 
C 3  421  TYR 421  421  421  TYR TYR C . n 
C 3  422  TYR 422  422  422  TYR TYR C . n 
C 3  423  ARG 423  423  423  ARG ARG C . n 
C 3  424  ARG 424  424  424  ARG ARG C . n 
C 3  425  ALA 425  425  425  ALA ALA C . n 
C 3  426  HIS 426  426  426  HIS HIS C . n 
C 3  427  GLN 427  427  427  GLN GLN C . n 
C 3  428  LEU 428  428  428  LEU LEU C . n 
C 3  429  ARG 429  429  429  ARG ARG C . n 
C 3  430  PRO 430  430  430  PRO PRO C . n 
C 3  431  ASN 431  431  431  ASN ASN C . n 
C 3  432  ASP 432  432  432  ASP ASP C . n 
C 3  433  SER 433  433  433  SER SER C . n 
C 3  434  ARG 434  434  434  ARG ARG C . n 
C 3  435  MET 435  435  435  MET MET C . n 
C 3  436  LEU 436  436  436  LEU LEU C . n 
C 3  437  VAL 437  437  437  VAL VAL C . n 
C 3  438  ALA 438  438  438  ALA ALA C . n 
C 3  439  LEU 439  439  439  LEU LEU C . n 
C 3  440  GLY 440  440  440  GLY GLY C . n 
C 3  441  GLU 441  441  441  GLU GLU C . n 
C 3  442  CYS 442  442  442  CYS CYS C . n 
C 3  443  TYR 443  443  443  TYR TYR C . n 
C 3  444  GLU 444  444  444  GLU GLU C . n 
C 3  445  LYS 445  445  445  LYS LYS C . n 
C 3  446  LEU 446  446  446  LEU LEU C . n 
C 3  447  ASN 447  447  447  ASN ASN C . n 
C 3  448  GLN 448  448  448  GLN GLN C . n 
C 3  449  LEU 449  449  449  LEU LEU C . n 
C 3  450  VAL 450  450  450  VAL VAL C . n 
C 3  451  GLU 451  451  451  GLU GLU C . n 
C 3  452  ALA 452  452  452  ALA ALA C . n 
C 3  453  LYS 453  453  453  LYS LYS C . n 
C 3  454  LYS 454  454  454  LYS LYS C . n 
C 3  455  CYS 455  455  455  CYS CYS C . n 
C 3  456  TYR 456  456  456  TYR TYR C . n 
C 3  457  TRP 457  457  457  TRP TRP C . n 
C 3  458  ARG 458  458  458  ARG ARG C . n 
C 3  459  ALA 459  459  459  ALA ALA C . n 
C 3  460  TYR 460  460  460  TYR TYR C . n 
C 3  461  ALA 461  461  461  ALA ALA C . n 
C 3  462  VAL 462  462  462  VAL VAL C . n 
C 3  463  GLY 463  463  463  GLY GLY C . n 
C 3  464  ASP 464  464  464  ASP ASP C . n 
C 3  465  VAL 465  465  465  VAL VAL C . n 
C 3  466  GLU 466  466  466  GLU GLU C . n 
C 3  467  LYS 467  467  467  LYS LYS C . n 
C 3  468  MET 468  468  468  MET MET C . n 
C 3  469  ALA 469  469  469  ALA ALA C . n 
C 3  470  LEU 470  470  470  LEU LEU C . n 
C 3  471  VAL 471  471  471  VAL VAL C . n 
C 3  472  LYS 472  472  472  LYS LYS C . n 
C 3  473  LEU 473  473  473  LEU LEU C . n 
C 3  474  ALA 474  474  474  ALA ALA C . n 
C 3  475  LYS 475  475  475  LYS LYS C . n 
C 3  476  LEU 476  476  476  LEU LEU C . n 
C 3  477  HIS 477  477  477  HIS HIS C . n 
C 3  478  GLU 478  478  478  GLU GLU C . n 
C 3  479  GLN 479  479  479  GLN GLN C . n 
C 3  480  LEU 480  480  480  LEU LEU C . n 
C 3  481  THR 481  481  481  THR THR C . n 
C 3  482  GLU 482  482  482  GLU GLU C . n 
C 3  483  SER 483  483  483  SER SER C . n 
C 3  484  GLU 484  484  484  GLU GLU C . n 
C 3  485  GLN 485  485  485  GLN GLN C . n 
C 3  486  ALA 486  486  486  ALA ALA C . n 
C 3  487  ALA 487  487  487  ALA ALA C . n 
C 3  488  GLN 488  488  488  GLN GLN C . n 
C 3  489  CYS 489  489  489  CYS CYS C . n 
C 3  490  TYR 490  490  490  TYR TYR C . n 
C 3  491  ILE 491  491  491  ILE ILE C . n 
C 3  492  LYS 492  492  492  LYS LYS C . n 
C 3  493  TYR 493  493  493  TYR TYR C . n 
C 3  494  ILE 494  494  494  ILE ILE C . n 
C 3  495  GLN 495  495  495  GLN GLN C . n 
C 3  496  ASP 496  496  496  ASP ASP C . n 
C 3  497  ILE 497  497  497  ILE ILE C . n 
C 3  498  TYR 498  498  498  TYR TYR C . n 
C 3  499  SER 499  499  499  SER SER C . n 
C 3  500  CYS 500  500  500  CYS CYS C . n 
C 3  501  GLY 501  501  ?    ?   ?   C . n 
C 3  502  GLU 502  502  ?    ?   ?   C . n 
C 3  503  ILE 503  503  ?    ?   ?   C . n 
C 3  504  VAL 504  504  ?    ?   ?   C . n 
C 3  505  GLU 505  505  ?    ?   ?   C . n 
C 3  506  HIS 506  506  ?    ?   ?   C . n 
C 3  507  LEU 507  507  ?    ?   ?   C . n 
C 3  508  GLU 508  508  ?    ?   ?   C . n 
C 3  509  GLU 509  509  ?    ?   ?   C . n 
C 3  510  SER 510  510  ?    ?   ?   C . n 
C 3  511  THR 511  511  ?    ?   ?   C . n 
C 3  512  ALA 512  512  ?    ?   ?   C . n 
C 3  513  PHE 513  513  ?    ?   ?   C . n 
C 3  514  ARG 514  514  ?    ?   ?   C . n 
C 3  515  TYR 515  515  ?    ?   ?   C . n 
C 3  516  LEU 516  516  ?    ?   ?   C . n 
C 3  517  ALA 517  517  ?    ?   ?   C . n 
C 3  518  GLN 518  518  ?    ?   ?   C . n 
C 3  519  TYR 519  519  ?    ?   ?   C . n 
C 3  520  TYR 520  520  ?    ?   ?   C . n 
C 3  521  PHE 521  521  ?    ?   ?   C . n 
C 3  522  LYS 522  522  ?    ?   ?   C . n 
C 3  523  CYS 523  523  ?    ?   ?   C . n 
C 3  524  LYS 524  524  ?    ?   ?   C . n 
C 3  525  LEU 525  525  ?    ?   ?   C . n 
C 3  526  TRP 526  526  ?    ?   ?   C . n 
C 3  527  ASP 527  527  ?    ?   ?   C . n 
C 3  528  GLU 528  528  ?    ?   ?   C . n 
C 3  529  ALA 529  529  ?    ?   ?   C . n 
C 3  530  SER 530  530  ?    ?   ?   C . n 
C 3  531  THR 531  531  ?    ?   ?   C . n 
C 3  532  CYS 532  532  ?    ?   ?   C . n 
C 3  533  ALA 533  533  ?    ?   ?   C . n 
C 3  534  GLN 534  534  ?    ?   ?   C . n 
C 3  535  LYS 535  535  ?    ?   ?   C . n 
C 3  536  CYS 536  536  ?    ?   ?   C . n 
C 3  537  CYS 537  537  ?    ?   ?   C . n 
C 3  538  ALA 538  538  ?    ?   ?   C . n 
C 3  539  PHE 539  539  ?    ?   ?   C . n 
C 3  540  ASN 540  540  ?    ?   ?   C . n 
C 3  541  ASP 541  541  ?    ?   ?   C . n 
C 3  542  THR 542  542  ?    ?   ?   C . n 
C 3  543  ARG 543  543  ?    ?   ?   C . n 
C 3  544  GLU 544  544  ?    ?   ?   C . n 
C 3  545  GLU 545  545  ?    ?   ?   C . n 
C 3  546  GLY 546  546  ?    ?   ?   C . n 
C 3  547  LYS 547  547  ?    ?   ?   C . n 
C 3  548  ALA 548  548  ?    ?   ?   C . n 
C 3  549  LEU 549  549  ?    ?   ?   C . n 
C 3  550  LEU 550  550  ?    ?   ?   C . n 
C 3  551  ARG 551  551  ?    ?   ?   C . n 
C 3  552  GLN 552  552  ?    ?   ?   C . n 
C 3  553  ILE 553  553  ?    ?   ?   C . n 
C 3  554  LEU 554  554  ?    ?   ?   C . n 
C 3  555  GLN 555  555  ?    ?   ?   C . n 
C 3  556  LEU 556  556  ?    ?   ?   C . n 
C 3  557  ARG 557  557  ?    ?   ?   C . n 
C 3  558  ASN 558  558  ?    ?   ?   C . n 
C 3  559  GLN 559  559  ?    ?   ?   C . n 
C 3  560  GLY 560  560  ?    ?   ?   C . n 
C 3  561  GLU 561  561  ?    ?   ?   C . n 
C 3  562  THR 562  562  ?    ?   ?   C . n 
C 3  563  PRO 563  563  ?    ?   ?   C . n 
C 3  564  THR 564  564  ?    ?   ?   C . n 
C 3  565  THR 565  565  ?    ?   ?   C . n 
C 3  566  GLU 566  566  ?    ?   ?   C . n 
C 3  567  VAL 567  567  ?    ?   ?   C . n 
C 3  568  PRO 568  568  ?    ?   ?   C . n 
C 3  569  ALA 569  569  ?    ?   ?   C . n 
C 3  570  PRO 570  570  ?    ?   ?   C . n 
C 3  571  PHE 571  571  ?    ?   ?   C . n 
C 3  572  PHE 572  572  ?    ?   ?   C . n 
C 3  573  LEU 573  573  ?    ?   ?   C . n 
C 3  574  PRO 574  574  ?    ?   ?   C . n 
C 3  575  ALA 575  575  ?    ?   ?   C . n 
C 3  576  SER 576  576  ?    ?   ?   C . n 
C 3  577  LEU 577  577  ?    ?   ?   C . n 
C 3  578  SER 578  578  ?    ?   ?   C . n 
C 3  579  ALA 579  579  ?    ?   ?   C . n 
C 3  580  ASN 580  580  ?    ?   ?   C . n 
C 3  581  ASN 581  581  ?    ?   ?   C . n 
C 3  582  THR 582  582  ?    ?   ?   C . n 
C 3  583  PRO 583  583  ?    ?   ?   C . n 
C 3  584  THR 584  584  ?    ?   ?   C . n 
C 3  585  ARG 585  585  ?    ?   ?   C . n 
C 3  586  ARG 586  586  ?    ?   ?   C . n 
C 3  587  VAL 587  587  ?    ?   ?   C . n 
C 3  588  SER 588  588  ?    ?   ?   C . n 
C 3  589  PRO 589  589  ?    ?   ?   C . n 
C 3  590  LEU 590  590  ?    ?   ?   C . n 
C 3  591  ASN 591  591  ?    ?   ?   C . n 
C 3  592  LEU 592  592  ?    ?   ?   C . n 
C 3  593  SER 593  593  ?    ?   ?   C . n 
C 3  594  SER 594  594  ?    ?   ?   C . n 
C 3  595  VAL 595  595  ?    ?   ?   C . n 
C 3  596  THR 596  596  ?    ?   ?   C . n 
C 3  597  PRO 597  597  ?    ?   ?   C . n 
D 4  1    MET 1    1    ?    ?   ?   E . n 
D 4  2    ALA 2    2    ?    ?   ?   E . n 
D 4  3    ALA 3    3    ?    ?   ?   E . n 
D 4  4    SER 4    4    ?    ?   ?   E . n 
D 4  5    SER 5    5    ?    ?   ?   E . n 
D 4  6    SER 6    6    ?    ?   ?   E . n 
D 4  7    SER 7    7    ?    ?   ?   E . n 
D 4  8    SER 8    8    ?    ?   ?   E . n 
D 4  9    SER 9    9    ?    ?   ?   E . n 
D 4  10   ALA 10   10   ?    ?   ?   E . n 
D 4  11   GLY 11   11   ?    ?   ?   E . n 
D 4  12   GLY 12   12   ?    ?   ?   E . n 
D 4  13   VAL 13   13   ?    ?   ?   E . n 
D 4  14   SER 14   14   ?    ?   ?   E . n 
D 4  15   GLY 15   15   ?    ?   ?   E . n 
D 4  16   SER 16   16   ?    ?   ?   E . n 
D 4  17   SER 17   17   ?    ?   ?   E . n 
D 4  18   VAL 18   18   ?    ?   ?   E . n 
D 4  19   THR 19   19   ?    ?   ?   E . n 
D 4  20   GLY 20   20   ?    ?   ?   E . n 
D 4  21   SER 21   21   ?    ?   ?   E . n 
D 4  22   GLY 22   22   ?    ?   ?   E . n 
D 4  23   PHE 23   23   ?    ?   ?   E . n 
D 4  24   SER 24   24   ?    ?   ?   E . n 
D 4  25   VAL 25   25   ?    ?   ?   E . n 
D 4  26   SER 26   26   ?    ?   ?   E . n 
D 4  27   ASP 27   27   ?    ?   ?   E . n 
D 4  28   LEU 28   28   ?    ?   ?   E . n 
D 4  29   ALA 29   29   ?    ?   ?   E . n 
D 4  30   PRO 30   30   ?    ?   ?   E . n 
D 4  31   PRO 31   31   ?    ?   ?   E . n 
D 4  32   ARG 32   32   ?    ?   ?   E . n 
D 4  33   LYS 33   33   ?    ?   ?   E . n 
D 4  34   ALA 34   34   ?    ?   ?   E . n 
D 4  35   LEU 35   35   ?    ?   ?   E . n 
D 4  36   PHE 36   36   ?    ?   ?   E . n 
D 4  37   THR 37   37   ?    ?   ?   E . n 
D 4  38   TYR 38   38   ?    ?   ?   E . n 
D 4  39   PRO 39   39   ?    ?   ?   E . n 
D 4  40   LYS 40   40   ?    ?   ?   E . n 
D 4  41   GLY 41   41   ?    ?   ?   E . n 
D 4  42   ALA 42   42   ?    ?   ?   E . n 
D 4  43   GLY 43   43   ?    ?   ?   E . n 
D 4  44   GLU 44   44   ?    ?   ?   E . n 
D 4  45   MET 45   45   ?    ?   ?   E . n 
D 4  46   LEU 46   46   ?    ?   ?   E . n 
D 4  47   GLU 47   47   ?    ?   ?   E . n 
D 4  48   ASP 48   48   ?    ?   ?   E . n 
D 4  49   GLY 49   49   ?    ?   ?   E . n 
D 4  50   SER 50   50   ?    ?   ?   E . n 
D 4  51   GLU 51   51   ?    ?   ?   E . n 
D 4  52   ARG 52   52   52   ARG ARG E . n 
D 4  53   PHE 53   53   53   PHE PHE E . n 
D 4  54   LEU 54   54   54   LEU LEU E . n 
D 4  55   CYS 55   55   55   CYS CYS E . n 
D 4  56   GLU 56   56   56   GLU GLU E . n 
D 4  57   SER 57   57   57   SER SER E . n 
D 4  58   VAL 58   58   58   VAL VAL E . n 
D 4  59   PHE 59   59   59   PHE PHE E . n 
D 4  60   SER 60   60   60   SER SER E . n 
D 4  61   TYR 61   61   61   TYR TYR E . n 
D 4  62   GLN 62   62   62   GLN GLN E . n 
D 4  63   VAL 63   63   63   VAL VAL E . n 
D 4  64   ALA 64   64   64   ALA ALA E . n 
D 4  65   SER 65   65   65   SER SER E . n 
D 4  66   THR 66   66   66   THR THR E . n 
D 4  67   LEU 67   67   67   LEU LEU E . n 
D 4  68   LYS 68   68   68   LYS LYS E . n 
D 4  69   GLN 69   69   69   GLN GLN E . n 
D 4  70   VAL 70   70   70   VAL VAL E . n 
D 4  71   LYS 71   71   71   LYS LYS E . n 
D 4  72   HIS 72   72   72   HIS HIS E . n 
D 4  73   ASP 73   73   73   ASP ASP E . n 
D 4  74   GLN 74   74   74   GLN GLN E . n 
D 4  75   GLN 75   75   75   GLN GLN E . n 
D 4  76   VAL 76   76   76   VAL VAL E . n 
D 4  77   ALA 77   77   77   ALA ALA E . n 
D 4  78   ARG 78   78   78   ARG ARG E . n 
D 4  79   MET 79   79   79   MET MET E . n 
D 4  80   GLU 80   80   80   GLU GLU E . n 
D 4  81   LYS 81   81   81   LYS LYS E . n 
D 4  82   LEU 82   82   82   LEU LEU E . n 
D 4  83   ALA 83   83   83   ALA ALA E . n 
D 4  84   GLY 84   84   84   GLY GLY E . n 
D 4  85   LEU 85   85   85   LEU LEU E . n 
D 4  86   VAL 86   86   86   VAL VAL E . n 
D 4  87   GLU 87   87   87   GLU GLU E . n 
D 4  88   GLU 88   88   88   GLU GLU E . n 
D 4  89   LEU 89   89   89   LEU LEU E . n 
D 4  90   GLU 90   90   90   GLU GLU E . n 
D 4  91   ALA 91   91   91   ALA ALA E . n 
D 4  92   ASP 92   92   92   ASP ASP E . n 
D 4  93   GLU 93   93   93   GLU GLU E . n 
D 4  94   TRP 94   94   94   TRP TRP E . n 
D 4  95   ARG 95   95   95   ARG ARG E . n 
D 4  96   PHE 96   96   96   PHE PHE E . n 
D 4  97   LYS 97   97   97   LYS LYS E . n 
D 4  98   PRO 98   98   98   PRO PRO E . n 
D 4  99   ILE 99   99   99   ILE ILE E . n 
D 4  100  GLU 100  100  100  GLU GLU E . n 
D 4  101  GLN 101  101  101  GLN GLN E . n 
D 4  102  LEU 102  102  102  LEU LEU E . n 
D 4  103  LEU 103  103  103  LEU LEU E . n 
D 4  104  GLY 104  104  104  GLY GLY E . n 
D 4  105  PHE 105  105  105  PHE PHE E . n 
D 4  106  THR 106  106  106  THR THR E . n 
D 4  107  PRO 107  107  107  PRO PRO E . n 
D 4  108  SER 108  108  ?    ?   ?   E . n 
D 4  109  SER 109  109  ?    ?   ?   E . n 
D 4  110  GLY 110  110  ?    ?   ?   E . n 
E 5  1    MET 1    1    ?    ?   ?   F . n 
E 5  2    THR 2    2    ?    ?   ?   F . n 
E 5  3    VAL 3    3    ?    ?   ?   F . n 
E 5  4    LEU 4    4    ?    ?   ?   F . n 
E 5  5    GLN 5    5    5    GLN GLN F . n 
E 5  6    GLU 6    6    6    GLU GLU F . n 
E 5  7    PRO 7    7    7    PRO PRO F . n 
E 5  8    VAL 8    8    8    VAL VAL F . n 
E 5  9    GLN 9    9    9    GLN GLN F . n 
E 5  10   ALA 10   10   10   ALA ALA F . n 
E 5  11   ALA 11   11   11   ALA ALA F . n 
E 5  12   ILE 12   12   12   ILE ILE F . n 
E 5  13   TRP 13   13   13   TRP TRP F . n 
E 5  14   GLN 14   14   14   GLN GLN F . n 
E 5  15   ALA 15   15   15   ALA ALA F . n 
E 5  16   LEU 16   16   16   LEU LEU F . n 
E 5  17   ASN 17   17   17   ASN ASN F . n 
E 5  18   HIS 18   18   18   HIS HIS F . n 
E 5  19   TYR 19   19   19   TYR TYR F . n 
E 5  20   ALA 20   20   20   ALA ALA F . n 
E 5  21   TYR 21   21   21   TYR TYR F . n 
E 5  22   ARG 22   22   22   ARG ARG F . n 
E 5  23   ASP 23   23   23   ASP ASP F . n 
E 5  24   ALA 24   24   24   ALA ALA F . n 
E 5  25   VAL 25   25   25   VAL VAL F . n 
E 5  26   PHE 26   26   26   PHE PHE F . n 
E 5  27   LEU 27   27   27   LEU LEU F . n 
E 5  28   ALA 28   28   28   ALA ALA F . n 
E 5  29   GLU 29   29   29   GLU GLU F . n 
E 5  30   ARG 30   30   30   ARG ARG F . n 
E 5  31   LEU 31   31   31   LEU LEU F . n 
E 5  32   TYR 32   32   32   TYR TYR F . n 
E 5  33   ALA 33   33   33   ALA ALA F . n 
E 5  34   GLU 34   34   34   GLU GLU F . n 
E 5  35   VAL 35   35   35   VAL VAL F . n 
E 5  36   HIS 36   36   36   HIS HIS F . n 
E 5  37   SER 37   37   37   SER SER F . n 
E 5  38   GLU 38   38   38   GLU GLU F . n 
E 5  39   GLU 39   39   39   GLU GLU F . n 
E 5  40   ALA 40   40   40   ALA ALA F . n 
E 5  41   LEU 41   41   41   LEU LEU F . n 
E 5  42   PHE 42   42   42   PHE PHE F . n 
E 5  43   LEU 43   43   43   LEU LEU F . n 
E 5  44   LEU 44   44   44   LEU LEU F . n 
E 5  45   ALA 45   45   45   ALA ALA F . n 
E 5  46   THR 46   46   46   THR THR F . n 
E 5  47   CYS 47   47   47   CYS CYS F . n 
E 5  48   TYR 48   48   48   TYR TYR F . n 
E 5  49   TYR 49   49   49   TYR TYR F . n 
E 5  50   ARG 50   50   50   ARG ARG F . n 
E 5  51   SER 51   51   51   SER SER F . n 
E 5  52   GLY 52   52   52   GLY GLY F . n 
E 5  53   LYS 53   53   53   LYS LYS F . n 
E 5  54   ALA 54   54   54   ALA ALA F . n 
E 5  55   TYR 55   55   55   TYR TYR F . n 
E 5  56   LYS 56   56   56   LYS LYS F . n 
E 5  57   ALA 57   57   57   ALA ALA F . n 
E 5  58   TYR 58   58   58   TYR TYR F . n 
E 5  59   ARG 59   59   59   ARG ARG F . n 
E 5  60   LEU 60   60   60   LEU LEU F . n 
E 5  61   LEU 61   61   61   LEU LEU F . n 
E 5  62   LYS 62   62   62   LYS LYS F . n 
E 5  63   GLY 63   63   63   GLY GLY F . n 
E 5  64   HIS 64   64   64   HIS HIS F . n 
E 5  65   SER 65   65   65   SER SER F . n 
E 5  66   CYS 66   66   66   CYS CYS F . n 
E 5  67   THR 67   67   67   THR THR F . n 
E 5  68   THR 68   68   68   THR THR F . n 
E 5  69   PRO 69   69   69   PRO PRO F . n 
E 5  70   GLN 70   70   70   GLN GLN F . n 
E 5  71   CYS 71   71   71   CYS CYS F . n 
E 5  72   LYS 72   72   72   LYS LYS F . n 
E 5  73   TYR 73   73   73   TYR TYR F . n 
E 5  74   LEU 74   74   74   LEU LEU F . n 
E 5  75   LEU 75   75   75   LEU LEU F . n 
E 5  76   ALA 76   76   76   ALA ALA F . n 
E 5  77   LYS 77   77   77   LYS LYS F . n 
E 5  78   CYS 78   78   78   CYS CYS F . n 
E 5  79   CYS 79   79   79   CYS CYS F . n 
E 5  80   VAL 80   80   80   VAL VAL F . n 
E 5  81   ASP 81   81   81   ASP ASP F . n 
E 5  82   LEU 82   82   82   LEU LEU F . n 
E 5  83   SER 83   83   83   SER SER F . n 
E 5  84   LYS 84   84   84   LYS LYS F . n 
E 5  85   LEU 85   85   85   LEU LEU F . n 
E 5  86   ALA 86   86   86   ALA ALA F . n 
E 5  87   GLU 87   87   87   GLU GLU F . n 
E 5  88   GLY 88   88   88   GLY GLY F . n 
E 5  89   GLU 89   89   89   GLU GLU F . n 
E 5  90   GLN 90   90   90   GLN GLN F . n 
E 5  91   ILE 91   91   91   ILE ILE F . n 
E 5  92   LEU 92   92   92   LEU LEU F . n 
E 5  93   SER 93   93   93   SER SER F . n 
E 5  94   GLY 94   94   94   GLY GLY F . n 
E 5  95   GLY 95   95   95   GLY GLY F . n 
E 5  96   VAL 96   96   96   VAL VAL F . n 
E 5  97   PHE 97   97   97   PHE PHE F . n 
E 5  98   ASN 98   98   98   ASN ASN F . n 
E 5  99   LYS 99   99   99   LYS LYS F . n 
E 5  100  GLN 100  100  100  GLN GLN F . n 
E 5  101  LYS 101  101  101  LYS LYS F . n 
E 5  102  SER 102  102  102  SER SER F . n 
E 5  103  HIS 103  103  103  HIS HIS F . n 
E 5  104  ASP 104  104  104  ASP ASP F . n 
E 5  105  ASP 105  105  105  ASP ASP F . n 
E 5  106  ILE 106  106  106  ILE ILE F . n 
E 5  107  VAL 107  107  107  VAL VAL F . n 
E 5  108  THR 108  108  108  THR THR F . n 
E 5  109  GLU 109  109  109  GLU GLU F . n 
E 5  110  PHE 110  110  110  PHE PHE F . n 
E 5  111  GLY 111  111  111  GLY GLY F . n 
E 5  112  ASP 112  112  112  ASP ASP F . n 
E 5  113  SER 113  113  113  SER SER F . n 
E 5  114  ALA 114  114  114  ALA ALA F . n 
E 5  115  CYS 115  115  115  CYS CYS F . n 
E 5  116  PHE 116  116  116  PHE PHE F . n 
E 5  117  THR 117  117  117  THR THR F . n 
E 5  118  LEU 118  118  118  LEU LEU F . n 
E 5  119  SER 119  119  119  SER SER F . n 
E 5  120  LEU 120  120  120  LEU LEU F . n 
E 5  121  LEU 121  121  121  LEU LEU F . n 
E 5  122  GLY 122  122  122  GLY GLY F . n 
E 5  123  HIS 123  123  123  HIS HIS F . n 
E 5  124  VAL 124  124  124  VAL VAL F . n 
E 5  125  TYR 125  125  125  TYR TYR F . n 
E 5  126  CYS 126  126  126  CYS CYS F . n 
E 5  127  LYS 127  127  127  LYS LYS F . n 
E 5  128  THR 128  128  128  THR THR F . n 
E 5  129  ASP 129  129  129  ASP ASP F . n 
E 5  130  ARG 130  130  130  ARG ARG F . n 
E 5  131  LEU 131  131  131  LEU LEU F . n 
E 5  132  ALA 132  132  132  ALA ALA F . n 
E 5  133  LYS 133  133  133  LYS LYS F . n 
E 5  134  GLY 134  134  134  GLY GLY F . n 
E 5  135  SER 135  135  135  SER SER F . n 
E 5  136  GLU 136  136  136  GLU GLU F . n 
E 5  137  CYS 137  137  137  CYS CYS F . n 
E 5  138  TYR 138  138  138  TYR TYR F . n 
E 5  139  GLN 139  139  139  GLN GLN F . n 
E 5  140  LYS 140  140  140  LYS LYS F . n 
E 5  141  SER 141  141  141  SER SER F . n 
E 5  142  LEU 142  142  142  LEU LEU F . n 
E 5  143  SER 143  143  143  SER SER F . n 
E 5  144  LEU 144  144  144  LEU LEU F . n 
E 5  145  ASN 145  145  145  ASN ASN F . n 
E 5  146  PRO 146  146  146  PRO PRO F . n 
E 5  147  PHE 147  147  147  PHE PHE F . n 
E 5  148  LEU 148  148  148  LEU LEU F . n 
E 5  149  TRP 149  149  149  TRP TRP F . n 
E 5  150  SER 150  150  150  SER SER F . n 
E 5  151  PRO 151  151  151  PRO PRO F . n 
E 5  152  PHE 152  152  152  PHE PHE F . n 
E 5  153  GLU 153  153  153  GLU GLU F . n 
E 5  154  SER 154  154  154  SER SER F . n 
E 5  155  LEU 155  155  155  LEU LEU F . n 
E 5  156  CYS 156  156  156  CYS CYS F . n 
E 5  157  GLU 157  157  157  GLU GLU F . n 
E 5  158  ILE 158  158  158  ILE ILE F . n 
E 5  159  GLY 159  159  159  GLY GLY F . n 
E 5  160  GLU 160  160  160  GLU GLU F . n 
E 5  161  LYS 161  161  161  LYS LYS F . n 
E 5  162  PRO 162  162  162  PRO PRO F . n 
E 5  163  ASP 163  163  163  ASP ASP F . n 
E 5  164  PRO 164  164  164  PRO PRO F . n 
E 5  165  ASP 165  165  165  ASP ASP F . n 
E 5  166  GLN 166  166  166  GLN GLN F . n 
E 5  167  THR 167  167  167  THR THR F . n 
E 5  168  PHE 168  168  168  PHE ALA F . n 
E 5  169  LYS 169  169  169  LYS ALA F . n 
E 5  170  PHE 170  170  170  PHE ALA F . n 
E 5  171  THR 171  171  ?    ?   ?   F . n 
E 5  172  SER 172  172  ?    ?   ?   F . n 
E 5  173  LEU 173  173  ?    ?   ?   F . n 
E 5  174  GLN 174  174  ?    ?   ?   F . n 
E 5  175  ASN 175  175  ?    ?   ?   F . n 
E 5  176  PHE 176  176  ?    ?   ?   F . n 
E 5  177  SER 177  177  ?    ?   ?   F . n 
E 5  178  ASN 178  178  ?    ?   ?   F . n 
E 5  179  CYS 179  179  ?    ?   ?   F . n 
E 5  180  LEU 180  180  ?    ?   ?   F . n 
E 5  181  PRO 181  181  ?    ?   ?   F . n 
E 5  182  ASN 182  182  ?    ?   ?   F . n 
E 5  183  SER 183  183  ?    ?   ?   F . n 
E 5  184  CYS 184  184  ?    ?   ?   F . n 
E 5  185  THR 185  185  ?    ?   ?   F . n 
E 5  186  THR 186  186  ?    ?   ?   F . n 
E 5  187  GLN 187  187  ?    ?   ?   F . n 
E 5  188  VAL 188  188  ?    ?   ?   F . n 
E 5  189  PRO 189  189  ?    ?   ?   F . n 
E 5  190  ASN 190  190  ?    ?   ?   F . n 
E 5  191  HIS 191  191  ?    ?   ?   F . n 
E 5  192  SER 192  192  ?    ?   ?   F . n 
E 5  193  LEU 193  193  ?    ?   ?   F . n 
E 5  194  SER 194  194  ?    ?   ?   F . n 
E 5  195  HIS 195  195  ?    ?   ?   F . n 
E 5  196  ARG 196  196  ?    ?   ?   F . n 
E 5  197  GLN 197  197  ?    ?   ?   F . n 
E 5  198  PRO 198  198  ?    ?   ?   F . n 
E 5  199  GLU 199  199  ?    ?   ?   F . n 
E 5  200  THR 200  200  ?    ?   ?   F . n 
E 5  201  VAL 201  201  ?    ?   ?   F . n 
E 5  202  LEU 202  202  ?    ?   ?   F . n 
E 5  203  THR 203  203  ?    ?   ?   F . n 
E 5  204  GLU 204  204  ?    ?   ?   F . n 
E 5  205  THR 205  205  ?    ?   ?   F . n 
E 5  206  PRO 206  206  ?    ?   ?   F . n 
E 5  207  GLN 207  207  ?    ?   ?   F . n 
E 5  208  ASP 208  208  ?    ?   ?   F . n 
E 5  209  THR 209  209  ?    ?   ?   F . n 
E 5  210  ILE 210  210  ?    ?   ?   F . n 
E 5  211  GLU 211  211  ?    ?   ?   F . n 
E 5  212  LEU 212  212  ?    ?   ?   F . n 
E 5  213  ASN 213  213  ?    ?   ?   F . n 
E 5  214  ARG 214  214  ?    ?   ?   F . n 
E 5  215  LEU 215  215  ?    ?   ?   F . n 
E 5  216  ASN 216  216  ?    ?   ?   F . n 
E 5  217  LEU 217  217  ?    ?   ?   F . n 
E 5  218  GLU 218  218  ?    ?   ?   F . n 
E 5  219  SER 219  219  ?    ?   ?   F . n 
E 5  220  SER 220  220  ?    ?   ?   F . n 
E 5  221  ASN 221  221  ?    ?   ?   F . n 
E 5  222  SER 222  222  ?    ?   ?   F . n 
E 5  223  LYS 223  223  ?    ?   ?   F . n 
E 5  224  TYR 224  224  ?    ?   ?   F . n 
E 5  225  SER 225  225  ?    ?   ?   F . n 
E 5  226  LEU 226  226  ?    ?   ?   F . n 
E 5  227  ASN 227  227  ?    ?   ?   F . n 
E 5  228  THR 228  228  ?    ?   ?   F . n 
E 5  229  ASP 229  229  ?    ?   ?   F . n 
E 5  230  SER 230  230  ?    ?   ?   F . n 
E 5  231  SER 231  231  ?    ?   ?   F . n 
E 5  232  VAL 232  232  ?    ?   ?   F . n 
E 5  233  SER 233  233  ?    ?   ?   F . n 
E 5  234  TYR 234  234  ?    ?   ?   F . n 
E 5  235  ILE 235  235  ?    ?   ?   F . n 
E 5  236  ASP 236  236  ?    ?   ?   F . n 
E 5  237  SER 237  237  ?    ?   ?   F . n 
E 5  238  ALA 238  238  ?    ?   ?   F . n 
E 5  239  VAL 239  239  ?    ?   ?   F . n 
E 5  240  ILE 240  240  ?    ?   ?   F . n 
E 5  241  SER 241  241  ?    ?   ?   F . n 
E 5  242  PRO 242  242  ?    ?   ?   F . n 
E 5  243  ASP 243  243  ?    ?   ?   F . n 
E 5  244  THR 244  244  ?    ?   ?   F . n 
E 5  245  VAL 245  245  ?    ?   ?   F . n 
E 5  246  PRO 246  246  ?    ?   ?   F . n 
E 5  247  LEU 247  247  ?    ?   ?   F . n 
E 5  248  GLY 248  248  ?    ?   ?   F . n 
E 5  249  THR 249  249  ?    ?   ?   F . n 
E 5  250  GLY 250  250  ?    ?   ?   F . n 
E 5  251  THR 251  251  ?    ?   ?   F . n 
E 5  252  SER 252  252  ?    ?   ?   F . n 
E 5  253  ILE 253  253  ?    ?   ?   F . n 
E 5  254  LEU 254  254  ?    ?   ?   F . n 
E 5  255  SER 255  255  ?    ?   ?   F . n 
E 5  256  LYS 256  256  ?    ?   ?   F . n 
E 5  257  GLN 257  257  ?    ?   ?   F . n 
E 5  258  VAL 258  258  ?    ?   ?   F . n 
E 5  259  GLN 259  259  ?    ?   ?   F . n 
E 5  260  ASN 260  260  ?    ?   ?   F . n 
E 5  261  LYS 261  261  ?    ?   ?   F . n 
E 5  262  PRO 262  262  ?    ?   ?   F . n 
E 5  263  LYS 263  263  ?    ?   ?   F . n 
E 5  264  THR 264  264  ?    ?   ?   F . n 
E 5  265  GLY 265  265  ?    ?   ?   F . n 
E 5  266  ARG 266  266  ?    ?   ?   F . n 
E 5  267  SER 267  267  ?    ?   ?   F . n 
E 5  268  LEU 268  268  ?    ?   ?   F . n 
E 5  269  LEU 269  269  ?    ?   ?   F . n 
E 5  270  GLY 270  270  ?    ?   ?   F . n 
E 5  271  GLY 271  271  ?    ?   ?   F . n 
E 5  272  PRO 272  272  ?    ?   ?   F . n 
E 5  273  ALA 273  273  ?    ?   ?   F . n 
E 5  274  ALA 274  274  ?    ?   ?   F . n 
E 5  275  LEU 275  275  ?    ?   ?   F . n 
E 5  276  SER 276  276  ?    ?   ?   F . n 
E 5  277  PRO 277  277  ?    ?   ?   F . n 
E 5  278  LEU 278  278  ?    ?   ?   F . n 
E 5  279  THR 279  279  ?    ?   ?   F . n 
E 5  280  PRO 280  280  ?    ?   ?   F . n 
E 5  281  SER 281  281  ?    ?   ?   F . n 
E 5  282  PHE 282  282  ?    ?   ?   F . n 
E 5  283  GLY 283  283  ?    ?   ?   F . n 
E 5  284  ILE 284  284  ?    ?   ?   F . n 
E 5  285  LEU 285  285  ?    ?   ?   F . n 
E 5  286  PRO 286  286  ?    ?   ?   F . n 
E 5  287  LEU 287  287  ?    ?   ?   F . n 
E 5  288  GLU 288  288  ?    ?   ?   F . n 
E 5  289  THR 289  289  ?    ?   ?   F . n 
E 5  290  PRO 290  290  ?    ?   ?   F . n 
E 5  291  SER 291  291  ?    ?   ?   F . n 
E 5  292  PRO 292  292  ?    ?   ?   F . n 
E 5  293  GLY 293  293  ?    ?   ?   F . n 
E 5  294  ASP 294  294  ?    ?   ?   F . n 
E 5  295  GLY 295  295  ?    ?   ?   F . n 
E 5  296  SER 296  296  ?    ?   ?   F . n 
E 5  297  TYR 297  297  ?    ?   ?   F . n 
E 5  298  LEU 298  298  ?    ?   ?   F . n 
E 5  299  GLN 299  299  ?    ?   ?   F . n 
E 5  300  ASN 300  300  ?    ?   ?   F . n 
E 5  301  TYR 301  301  ?    ?   ?   F . n 
E 5  302  THR 302  302  ?    ?   ?   F . n 
E 5  303  ASN 303  303  ?    ?   ?   F . n 
E 5  304  THR 304  304  ?    ?   ?   F . n 
E 5  305  PRO 305  305  ?    ?   ?   F . n 
E 5  306  PRO 306  306  ?    ?   ?   F . n 
E 5  307  VAL 307  307  ?    ?   ?   F . n 
E 5  308  ILE 308  308  ?    ?   ?   F . n 
E 5  309  ASP 309  309  ?    ?   ?   F . n 
E 5  310  VAL 310  310  ?    ?   ?   F . n 
E 5  311  PRO 311  311  ?    ?   ?   F . n 
E 5  312  SER 312  312  ?    ?   ?   F . n 
E 5  313  THR 313  313  ?    ?   ?   F . n 
E 5  314  GLY 314  314  ?    ?   ?   F . n 
E 5  315  ALA 315  315  ?    ?   ?   F . n 
E 5  316  PRO 316  316  ?    ?   ?   F . n 
E 5  317  SER 317  317  ?    ?   ?   F . n 
E 5  318  LYS 318  318  ?    ?   ?   F . n 
E 5  319  LYS 319  319  ?    ?   ?   F . n 
E 5  320  SER 320  320  ?    ?   ?   F . n 
E 5  321  VAL 321  321  ?    ?   ?   F . n 
E 5  322  ALA 322  322  ?    ?   ?   F . n 
E 5  323  ARG 323  323  ?    ?   ?   F . n 
E 5  324  ILE 324  324  ?    ?   ?   F . n 
E 5  325  GLY 325  325  ?    ?   ?   F . n 
E 5  326  GLN 326  326  ?    ?   ?   F . n 
E 5  327  THR 327  327  ?    ?   ?   F . n 
E 5  328  GLY 328  328  ?    ?   ?   F . n 
E 5  329  THR 329  329  ?    ?   ?   F . n 
E 5  330  LYS 330  330  ?    ?   ?   F . n 
E 5  331  SER 331  331  ?    ?   ?   F . n 
E 5  332  VAL 332  332  ?    ?   ?   F . n 
E 5  333  PHE 333  333  ?    ?   ?   F . n 
E 5  334  SER 334  334  ?    ?   ?   F . n 
E 5  335  GLN 335  335  ?    ?   ?   F . n 
E 5  336  SER 336  336  ?    ?   ?   F . n 
E 5  337  GLY 337  337  ?    ?   ?   F . n 
E 5  338  ASN 338  338  ?    ?   ?   F . n 
E 5  339  SER 339  339  ?    ?   ?   F . n 
E 5  340  ARG 340  340  ?    ?   ?   F . n 
E 5  341  GLU 341  341  ?    ?   ?   F . n 
E 5  342  VAL 342  342  ?    ?   ?   F . n 
E 5  343  THR 343  343  ?    ?   ?   F . n 
E 5  344  PRO 344  344  ?    ?   ?   F . n 
E 5  345  ILE 345  345  ?    ?   ?   F . n 
E 5  346  LEU 346  346  ?    ?   ?   F . n 
E 5  347  ALA 347  347  ?    ?   ?   F . n 
E 5  348  GLN 348  348  ?    ?   ?   F . n 
E 5  349  THR 349  349  ?    ?   ?   F . n 
E 5  350  GLN 350  350  ?    ?   ?   F . n 
E 5  351  SER 351  351  ?    ?   ?   F . n 
E 5  352  SER 352  352  ?    ?   ?   F . n 
E 5  353  GLY 353  353  ?    ?   ?   F . n 
E 5  354  PRO 354  354  ?    ?   ?   F . n 
E 5  355  GLN 355  355  ?    ?   ?   F . n 
E 5  356  THR 356  356  ?    ?   ?   F . n 
E 5  357  SER 357  357  ?    ?   ?   F . n 
E 5  358  THR 358  358  ?    ?   ?   F . n 
E 5  359  THR 359  359  ?    ?   ?   F . n 
E 5  360  PRO 360  360  ?    ?   ?   F . n 
E 5  361  GLN 361  361  ?    ?   ?   F . n 
E 5  362  VAL 362  362  ?    ?   ?   F . n 
E 5  363  LEU 363  363  ?    ?   ?   F . n 
E 5  364  SER 364  364  ?    ?   ?   F . n 
E 5  365  PRO 365  365  ?    ?   ?   F . n 
E 5  366  THR 366  366  ?    ?   ?   F . n 
E 5  367  ILE 367  367  ?    ?   ?   F . n 
E 5  368  THR 368  368  ?    ?   ?   F . n 
E 5  369  SER 369  369  ?    ?   ?   F . n 
E 5  370  PRO 370  370  ?    ?   ?   F . n 
E 5  371  PRO 371  371  ?    ?   ?   F . n 
E 5  372  ASN 372  372  ?    ?   ?   F . n 
E 5  373  ALA 373  373  ?    ?   ?   F . n 
E 5  374  LEU 374  374  ?    ?   ?   F . n 
E 5  375  PRO 375  375  ?    ?   ?   F . n 
E 5  376  ARG 376  376  ?    ?   ?   F . n 
E 5  377  ARG 377  377  ?    ?   ?   F . n 
E 5  378  SER 378  378  ?    ?   ?   F . n 
E 5  379  SER 379  379  ?    ?   ?   F . n 
E 5  380  ARG 380  380  ?    ?   ?   F . n 
E 5  381  LEU 381  381  ?    ?   ?   F . n 
E 5  382  PHE 382  382  ?    ?   ?   F . n 
E 5  383  THR 383  383  ?    ?   ?   F . n 
E 5  384  SER 384  384  ?    ?   ?   F . n 
E 5  385  ASP 385  385  ?    ?   ?   F . n 
E 5  386  SER 386  386  ?    ?   ?   F . n 
E 5  387  SER 387  387  ?    ?   ?   F . n 
E 5  388  THR 388  388  ?    ?   ?   F . n 
E 5  389  THR 389  389  ?    ?   ?   F . n 
E 5  390  LYS 390  390  ?    ?   ?   F . n 
E 5  391  GLU 391  391  ?    ?   ?   F . n 
E 5  392  ASN 392  392  ?    ?   ?   F . n 
E 5  393  SER 393  393  ?    ?   ?   F . n 
E 5  394  LYS 394  394  ?    ?   ?   F . n 
E 5  395  LYS 395  395  ?    ?   ?   F . n 
E 5  396  LEU 396  396  ?    ?   ?   F . n 
E 5  397  LYS 397  397  ?    ?   ?   F . n 
E 5  398  MET 398  398  ?    ?   ?   F . n 
E 5  399  LYS 399  399  ?    ?   ?   F . n 
E 5  400  PHE 400  400  ?    ?   ?   F . n 
E 5  401  PRO 401  401  ?    ?   ?   F . n 
E 5  402  PRO 402  402  ?    ?   ?   F . n 
E 5  403  LYS 403  403  ?    ?   ?   F . n 
E 5  404  ILE 404  404  ?    ?   ?   F . n 
E 5  405  PRO 405  405  ?    ?   ?   F . n 
E 5  406  ASN 406  406  ?    ?   ?   F . n 
E 5  407  ARG 407  407  ?    ?   ?   F . n 
E 5  408  LYS 408  408  ?    ?   ?   F . n 
E 5  409  THR 409  409  ?    ?   ?   F . n 
E 5  410  LYS 410  410  ?    ?   ?   F . n 
E 5  411  SER 411  411  ?    ?   ?   F . n 
E 5  412  LYS 412  412  ?    ?   ?   F . n 
E 5  413  THR 413  413  ?    ?   ?   F . n 
E 5  414  ASN 414  414  ?    ?   ?   F . n 
E 5  415  LYS 415  415  ?    ?   ?   F . n 
E 5  416  GLY 416  416  ?    ?   ?   F . n 
E 5  417  GLY 417  417  ?    ?   ?   F . n 
E 5  418  ILE 418  418  ?    ?   ?   F . n 
E 5  419  THR 419  419  ?    ?   ?   F . n 
E 5  420  GLN 420  420  ?    ?   ?   F . n 
E 5  421  PRO 421  421  ?    ?   ?   F . n 
E 5  422  ASN 422  422  ?    ?   ?   F . n 
E 5  423  ILE 423  423  ?    ?   ?   F . n 
E 5  424  ASN 424  424  ?    ?   ?   F . n 
E 5  425  ASP 425  425  ?    ?   ?   F . n 
E 5  426  SER 426  426  ?    ?   ?   F . n 
E 5  427  LEU 427  427  ?    ?   ?   F . n 
E 5  428  GLU 428  428  ?    ?   ?   F . n 
E 5  429  ILE 429  429  ?    ?   ?   F . n 
E 5  430  THR 430  430  ?    ?   ?   F . n 
E 5  431  LYS 431  431  ?    ?   ?   F . n 
E 5  432  LEU 432  432  ?    ?   ?   F . n 
E 5  433  ASP 433  433  ?    ?   ?   F . n 
E 5  434  SER 434  434  ?    ?   ?   F . n 
E 5  435  SER 435  435  ?    ?   ?   F . n 
E 5  436  ILE 436  436  ?    ?   ?   F . n 
E 5  437  ILE 437  437  ?    ?   ?   F . n 
E 5  438  SER 438  438  ?    ?   ?   F . n 
E 5  439  GLU 439  439  ?    ?   ?   F . n 
E 5  440  GLY 440  440  ?    ?   ?   F . n 
E 5  441  LYS 441  441  ?    ?   ?   F . n 
E 5  442  ILE 442  442  ?    ?   ?   F . n 
E 5  443  SER 443  443  ?    ?   ?   F . n 
E 5  444  THR 444  444  ?    ?   ?   F . n 
E 5  445  ILE 445  445  ?    ?   ?   F . n 
E 5  446  THR 446  446  ?    ?   ?   F . n 
E 5  447  PRO 447  447  ?    ?   ?   F . n 
E 5  448  GLN 448  448  ?    ?   ?   F . n 
E 5  449  ILE 449  449  ?    ?   ?   F . n 
E 5  450  GLN 450  450  ?    ?   ?   F . n 
E 5  451  ALA 451  451  451  ALA ALA F . n 
E 5  452  PHE 452  452  452  PHE PHE F . n 
E 5  453  ASN 453  453  453  ASN ASN F . n 
E 5  454  LEU 454  454  454  LEU LEU F . n 
E 5  455  GLN 455  455  455  GLN GLN F . n 
E 5  456  LYS 456  456  456  LYS LYS F . n 
E 5  457  ALA 457  457  457  ALA ALA F . n 
E 5  458  ALA 458  458  458  ALA ALA F . n 
E 5  459  ALA 459  459  459  ALA ALA F . n 
E 5  460  GLU 460  460  460  GLU GLU F . n 
E 5  461  GLY 461  461  461  GLY GLY F . n 
E 5  462  LEU 462  462  462  LEU LEU F . n 
E 5  463  MET 463  463  463  MET MET F . n 
E 5  464  SER 464  464  464  SER SER F . n 
E 5  465  LEU 465  465  465  LEU LEU F . n 
E 5  466  LEU 466  466  466  LEU LEU F . n 
E 5  467  ARG 467  467  467  ARG ARG F . n 
E 5  468  GLU 468  468  468  GLU GLU F . n 
E 5  469  MET 469  469  469  MET MET F . n 
E 5  470  GLY 470  470  470  GLY GLY F . n 
E 5  471  LYS 471  471  471  LYS LYS F . n 
E 5  472  GLY 472  472  472  GLY GLY F . n 
E 5  473  TYR 473  473  473  TYR TYR F . n 
E 5  474  LEU 474  474  474  LEU LEU F . n 
E 5  475  ALA 475  475  475  ALA ALA F . n 
E 5  476  LEU 476  476  476  LEU LEU F . n 
E 5  477  CYS 477  477  477  CYS CYS F . n 
E 5  478  SER 478  478  478  SER SER F . n 
E 5  479  TYR 479  479  479  TYR TYR F . n 
E 5  480  ASN 480  480  480  ASN ASN F . n 
E 5  481  CYS 481  481  481  CYS CYS F . n 
E 5  482  LYS 482  482  482  LYS LYS F . n 
E 5  483  GLU 483  483  483  GLU GLU F . n 
E 5  484  ALA 484  484  484  ALA ALA F . n 
E 5  485  ILE 485  485  485  ILE ILE F . n 
E 5  486  ASN 486  486  486  ASN ASN F . n 
E 5  487  ILE 487  487  487  ILE ILE F . n 
E 5  488  LEU 488  488  488  LEU LEU F . n 
E 5  489  SER 489  489  489  SER SER F . n 
E 5  490  HIS 490  490  490  HIS HIS F . n 
E 5  491  LEU 491  491  491  LEU LEU F . n 
E 5  492  PRO 492  492  492  PRO PRO F . n 
E 5  493  SER 493  493  493  SER SER F . n 
E 5  494  HIS 494  494  494  HIS HIS F . n 
E 5  495  HIS 495  495  495  HIS HIS F . n 
E 5  496  TYR 496  496  496  TYR TYR F . n 
E 5  497  ASN 497  497  497  ASN ASN F . n 
E 5  498  THR 498  498  498  THR THR F . n 
E 5  499  GLY 499  499  499  GLY GLY F . n 
E 5  500  TRP 500  500  500  TRP TRP F . n 
E 5  501  VAL 501  501  501  VAL VAL F . n 
E 5  502  LEU 502  502  502  LEU LEU F . n 
E 5  503  CYS 503  503  503  CYS CYS F . n 
E 5  504  GLN 504  504  504  GLN GLN F . n 
E 5  505  ILE 505  505  505  ILE ILE F . n 
E 5  506  GLY 506  506  506  GLY GLY F . n 
E 5  507  ARG 507  507  507  ARG ARG F . n 
E 5  508  ALA 508  508  508  ALA ALA F . n 
E 5  509  TYR 509  509  509  TYR TYR F . n 
E 5  510  PHE 510  510  510  PHE PHE F . n 
E 5  511  GLU 511  511  511  GLU GLU F . n 
E 5  512  LEU 512  512  512  LEU LEU F . n 
E 5  513  SER 513  513  513  SER SER F . n 
E 5  514  GLU 514  514  514  GLU GLU F . n 
E 5  515  TYR 515  515  515  TYR TYR F . n 
E 5  516  MET 516  516  516  MET MET F . n 
E 5  517  GLN 517  517  517  GLN GLN F . n 
E 5  518  ALA 518  518  518  ALA ALA F . n 
E 5  519  GLU 519  519  519  GLU GLU F . n 
E 5  520  ARG 520  520  520  ARG ARG F . n 
E 5  521  ILE 521  521  521  ILE ILE F . n 
E