data_5KL6
# 
_entry.id   5KL6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KL6         
WWPDB D_1000222406 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5KL2 PDB . 
unspecified 5KL3 PDB . 
unspecified 5KL4 PDB . 
unspecified 5KL5 PDB . 
unspecified 5KL7 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KL6 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hashimoto, H.' 1 
'Cheng, X.'     2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            44 
_citation.language                  ? 
_citation.page_first                10165 
_citation.page_last                 10176 
_citation.title                     
;Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkw766 
_citation.pdbx_database_id_PubMed   27596598 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hashimoto, H.' 1 ? 
primary 'Zhang, X.'     2 ? 
primary 'Zheng, Y.'     3 ? 
primary 'Wilson, G.G.'  4 ? 
primary 'Cheng, X.'     5 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.52 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5KL6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     75.982 
_cell.length_a_esd                 ? 
_cell.length_b                     66.008 
_cell.length_b_esd                 ? 
_cell.length_c                     35.567 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5KL6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Wilms tumor protein'                             11311.947 1   ? Q369R ? ? 
2 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*GP*GP*T)-3')
;
3470.257  1   ? ?     ? ? 
3 polymer     syn 
;DNA (5'-D(*TP*AP*CP*CP*CP*CP*CP*AP*CP*GP*C)-3')
;
3239.127  1   ? ?     ? ? 
4 non-polymer syn 'ZINC ION'                                        65.409    3   ? ?     ? ? 
5 water       nat water                                             18.015    121 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        WT33 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPLGSEKPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFAR
SDELVRHHNMHQR
;
;GPLGSEKPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFAR
SDELVRHHNMHQR
;
A ? 
2 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DG)(DG)(DG)(DG)(DG)(DT)'                                                   
AGCGTGGGGGT                                                                                      B ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DC)(DC)(DC)(DC)(DA)(DC)(DG)(DC)'                                                   
TACCCCCACGC                                                                                      C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  GLU n 
1 7  LYS n 
1 8  PRO n 
1 9  TYR n 
1 10 GLN n 
1 11 CYS n 
1 12 ASP n 
1 13 PHE n 
1 14 LYS n 
1 15 ASP n 
1 16 CYS n 
1 17 GLU n 
1 18 ARG n 
1 19 ARG n 
1 20 PHE n 
1 21 SER n 
1 22 ARG n 
1 23 SER n 
1 24 ASP n 
1 25 ARG n 
1 26 LEU n 
1 27 LYS n 
1 28 ARG n 
1 29 HIS n 
1 30 GLN n 
1 31 ARG n 
1 32 ARG n 
1 33 HIS n 
1 34 THR n 
1 35 GLY n 
1 36 VAL n 
1 37 LYS n 
1 38 PRO n 
1 39 PHE n 
1 40 GLN n 
1 41 CYS n 
1 42 LYS n 
1 43 THR n 
1 44 CYS n 
1 45 GLN n 
1 46 ARG n 
1 47 LYS n 
1 48 PHE n 
1 49 SER n 
1 50 ARG n 
1 51 SER n 
1 52 ASP n 
1 53 HIS n 
1 54 LEU n 
1 55 LYS n 
1 56 THR n 
1 57 HIS n 
1 58 THR n 
1 59 ARG n 
1 60 THR n 
1 61 HIS n 
1 62 THR n 
1 63 GLY n 
1 64 GLU n 
1 65 LYS n 
1 66 PRO n 
1 67 PHE n 
1 68 SER n 
1 69 CYS n 
1 70 ARG n 
1 71 TRP n 
1 72 PRO n 
1 73 SER n 
1 74 CYS n 
1 75 GLN n 
1 76 LYS n 
1 77 LYS n 
1 78 PHE n 
1 79 ALA n 
1 80 ARG n 
1 81 SER n 
1 82 ASP n 
1 83 GLU n 
1 84 LEU n 
1 85 VAL n 
1 86 ARG n 
1 87 HIS n 
1 88 HIS n 
1 89 ASN n 
1 90 MET n 
1 91 HIS n 
1 92 GLN n 
1 93 ARG n 
2 1  DA  n 
2 2  DG  n 
2 3  DC  n 
2 4  DG  n 
2 5  DT  n 
2 6  DG  n 
2 7  DG  n 
2 8  DG  n 
2 9  DG  n 
2 10 DG  n 
2 11 DT  n 
3 1  DT  n 
3 2  DA  n 
3 3  DC  n 
3 4  DC  n 
3 5  DC  n 
3 6  DC  n 
3 7  DC  n 
3 8  DA  n 
3 9  DC  n 
3 10 DG  n 
3 11 DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   93 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 WT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              -KTS 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) RIL-codon plus' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pGEX-6p-1 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pXC1302 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 11 'synthetic construct' ? 32630 ? 
3 1 sample 1 11 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP WT1_HUMAN P19544 P19544-2 1 
;EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELV
RHHNMHQR
;
333 
2 PDB 5KL6      5KL6   ?        2 ?                                                                                           1   
3 PDB 5KL6      5KL6   ?        3 ?                                                                                           1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5KL6 A 6 ? 93 ? P19544 333 ? 420 ? 350 437 
2 2 5KL6 B 1 ? 11 ? 5KL6   1   ? 11  ? 1   11  
3 3 5KL6 C 1 ? 11 ? 5KL6   1   ? 11  ? 1   11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KL6 GLY A 1  ? UNP P19544 ?   ?   'expression tag'      345 1 
1 5KL6 PRO A 2  ? UNP P19544 ?   ?   'expression tag'      346 2 
1 5KL6 LEU A 3  ? UNP P19544 ?   ?   'expression tag'      347 3 
1 5KL6 GLY A 4  ? UNP P19544 ?   ?   'expression tag'      348 4 
1 5KL6 SER A 5  ? UNP P19544 ?   ?   'expression tag'      349 5 
1 5KL6 ARG A 25 ? UNP P19544 GLN 352 'engineered mutation' 369 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KL6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.47 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.29 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% (w/v) PEG 3350, 0.2 M Na-malonate, pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5KL6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.64 
_reflns.d_resolution_low                 30 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19712 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3 
_reflns.percent_possible_obs             91.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.0 
_reflns.pdbx_Rmerge_I_obs                0.075 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.64 
_reflns_shell.d_res_low                   1.70 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        50.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.439 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5KL6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.641 
_refine.ls_d_res_low                             29.031 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     19660 
_refine.ls_number_reflns_R_free                  973 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    91.26 
_refine.ls_percent_reflns_R_free                 4.95 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1748 
_refine.ls_R_factor_R_free                       0.2064 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1732 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4R2R 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.45 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        746 
_refine_hist.pdbx_number_atoms_nucleic_acid   445 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             121 
_refine_hist.number_atoms_total               1315 
_refine_hist.d_res_high                       1.641 
_refine_hist.d_res_low                        29.031 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.012  ? 1386 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.306  ? 1978 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 22.746 ? 612  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.061  ? 214  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008  ? 165  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.6412 1.7278  . . 78  1610 55.00  . . . 0.3434 . 0.2755 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7278 1.8360  . . 129 2587 89.00  . . . 0.2831 . 0.2341 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8360 1.9777  . . 153 2858 98.00  . . . 0.2606 . 0.2145 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9777 2.1767  . . 154 2884 99.00  . . . 0.2530 . 0.2071 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1767 2.4915  . . 154 2898 99.00  . . . 0.2004 . 0.1920 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4915 3.1384  . . 151 2917 100.00 . . . 0.2267 . 0.1881 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1384 29.0351 . . 154 2933 99.00  . . . 0.1681 . 0.1399 . . . . . . . . . . 
# 
_struct.entry_id                     5KL6 
_struct.title                        'Wilms Tumor Protein (WT1) Q369R ZnF2-4 in complex with DNA' 
_struct.pdbx_descriptor              'Wilms tumor protein/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KL6 
_struct_keywords.text            'zinc finger, wilms tumor, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ARG A 22 ? GLY A 35 ? ARG A 366 GLY A 379 1 ? 14 
HELX_P HELX_P2 AA2 ARG A 50 ? GLY A 63 ? ARG A 394 GLY A 407 1 ? 14 
HELX_P HELX_P3 AA3 ARG A 80 ? ARG A 93 ? ARG A 424 ARG A 437 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 11 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 355 A ZN 501 1_555 ? ? ? ? ? ? ?            2.281 ? 
metalc2  metalc ? ? A CYS 16 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 360 A ZN 501 1_555 ? ? ? ? ? ? ?            2.266 ? 
metalc3  metalc ? ? A HIS 29 NE2 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 373 A ZN 501 1_555 ? ? ? ? ? ? ?            2.011 ? 
metalc4  metalc ? ? A HIS 33 NE2 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 377 A ZN 501 1_555 ? ? ? ? ? ? ?            2.059 ? 
metalc5  metalc ? ? A CYS 41 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 385 A ZN 502 1_555 ? ? ? ? ? ? ?            2.301 ? 
metalc6  metalc ? ? A CYS 44 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 388 A ZN 502 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc7  metalc ? ? A HIS 57 NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 401 A ZN 502 1_555 ? ? ? ? ? ? ?            2.020 ? 
metalc8  metalc ? ? A HIS 61 NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 405 A ZN 502 1_555 ? ? ? ? ? ? ?            2.030 ? 
metalc9  metalc ? ? A CYS 69 SG  ? ? ? 1_555 F ZN .  ZN ? ? A CYS 413 A ZN 503 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc10 metalc ? ? A CYS 74 SG  ? ? ? 1_555 F ZN .  ZN ? ? A CYS 418 A ZN 503 1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc11 metalc ? ? A HIS 87 NE2 ? ? ? 1_555 F ZN .  ZN ? ? A HIS 431 A ZN 503 1_555 ? ? ? ? ? ? ?            2.002 ? 
metalc12 metalc ? ? A HIS 91 NE2 ? ? ? 1_555 F ZN .  ZN ? ? A HIS 435 A ZN 503 1_555 ? ? ? ? ? ? ?            1.950 ? 
hydrog1  hydrog ? ? B DG  2  N1  ? ? ? 1_555 C DC 11 N3 ? ? B DG  2   C DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  2  N2  ? ? ? 1_555 C DC 11 O2 ? ? B DG  2   C DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  2  O6  ? ? ? 1_555 C DC 11 N4 ? ? B DG  2   C DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DC  3  N3  ? ? ? 1_555 C DG 10 N1 ? ? B DC  3   C DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DC  3  N4  ? ? ? 1_555 C DG 10 O6 ? ? B DC  3   C DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC  3  O2  ? ? ? 1_555 C DG 10 N2 ? ? B DC  3   C DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  4  N1  ? ? ? 1_555 C DC 9  N3 ? ? B DG  4   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  4  N2  ? ? ? 1_555 C DC 9  O2 ? ? B DG  4   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  4  O6  ? ? ? 1_555 C DC 9  N4 ? ? B DG  4   C DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DT  5  N3  ? ? ? 1_555 C DA 8  N1 ? ? B DT  5   C DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DT  5  O4  ? ? ? 1_555 C DA 8  N6 ? ? B DT  5   C DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  6  N1  ? ? ? 1_555 C DC 7  N3 ? ? B DG  6   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  6  N2  ? ? ? 1_555 C DC 7  O2 ? ? B DG  6   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  6  O6  ? ? ? 1_555 C DC 7  N4 ? ? B DG  6   C DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  7  N1  ? ? ? 1_555 C DC 6  N3 ? ? B DG  7   C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  7  N2  ? ? ? 1_555 C DC 6  O2 ? ? B DG  7   C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  7  O6  ? ? ? 1_555 C DC 6  N4 ? ? B DG  7   C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  8  N1  ? ? ? 1_555 C DC 5  N3 ? ? B DG  8   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  8  N2  ? ? ? 1_555 C DC 5  O2 ? ? B DG  8   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  8  O6  ? ? ? 1_555 C DC 5  N4 ? ? B DG  8   C DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  9  N1  ? ? ? 1_555 C DC 4  N3 ? ? B DG  9   C DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  9  N2  ? ? ? 1_555 C DC 4  O2 ? ? B DG  9   C DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9  O6  ? ? ? 1_555 C DC 4  N4 ? ? B DG  9   C DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  10 N1  ? ? ? 1_555 C DC 3  N3 ? ? B DG  10  C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  10 N2  ? ? ? 1_555 C DC 3  O2 ? ? B DG  10  C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  10 O6  ? ? ? 1_555 C DC 3  N4 ? ? B DG  10  C DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DT  11 N3  ? ? ? 1_555 C DA 2  N1 ? ? B DT  11  C DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DT  11 O4  ? ? ? 1_555 C DA 2  N6 ? ? B DT  11  C DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 9  ? GLN A 10 ? TYR A 353 GLN A 354 
AA1 2 ARG A 19 ? PHE A 20 ? ARG A 363 PHE A 364 
AA2 1 PHE A 39 ? GLN A 40 ? PHE A 383 GLN A 384 
AA2 2 LYS A 47 ? PHE A 48 ? LYS A 391 PHE A 392 
AA3 1 PHE A 67 ? SER A 68 ? PHE A 411 SER A 412 
AA3 2 LYS A 77 ? PHE A 78 ? LYS A 421 PHE A 422 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 9  ? N TYR A 353 O PHE A 20 ? O PHE A 364 
AA2 1 2 N PHE A 39 ? N PHE A 383 O PHE A 48 ? O PHE A 392 
AA3 1 2 N PHE A 67 ? N PHE A 411 O PHE A 78 ? O PHE A 422 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 501 ? 4 'binding site for residue ZN A 501' 
AC2 Software A ZN 502 ? 4 'binding site for residue ZN A 502' 
AC3 Software A ZN 503 ? 4 'binding site for residue ZN A 503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 11 ? CYS A 355 . ? 1_555 ? 
2  AC1 4 CYS A 16 ? CYS A 360 . ? 1_555 ? 
3  AC1 4 HIS A 29 ? HIS A 373 . ? 1_555 ? 
4  AC1 4 HIS A 33 ? HIS A 377 . ? 1_555 ? 
5  AC2 4 CYS A 41 ? CYS A 385 . ? 1_555 ? 
6  AC2 4 CYS A 44 ? CYS A 388 . ? 1_555 ? 
7  AC2 4 HIS A 57 ? HIS A 401 . ? 1_555 ? 
8  AC2 4 HIS A 61 ? HIS A 405 . ? 1_555 ? 
9  AC3 4 CYS A 69 ? CYS A 413 . ? 1_555 ? 
10 AC3 4 CYS A 74 ? CYS A 418 . ? 1_555 ? 
11 AC3 4 HIS A 87 ? HIS A 431 . ? 1_555 ? 
12 AC3 4 HIS A 91 ? HIS A 435 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5KL6 
_atom_sites.fract_transf_matrix[1][1]   0.013161 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000120 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015150 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.028117 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N      . LYS A 1 7  ? 34.357 -272.324 -32.893 1.00 62.15  ? 351 LYS A N      1 
ATOM   2    C  CA     . LYS A 1 7  ? 34.108 -270.988 -32.340 1.00 53.26  ? 351 LYS A CA     1 
ATOM   3    C  C      . LYS A 1 7  ? 34.910 -269.872 -33.031 1.00 64.55  ? 351 LYS A C      1 
ATOM   4    O  O      . LYS A 1 7  ? 35.852 -269.329 -32.451 1.00 50.73  ? 351 LYS A O      1 
ATOM   5    C  CB     . LYS A 1 7  ? 34.425 -270.973 -30.843 1.00 53.25  ? 351 LYS A CB     1 
ATOM   6    C  CG     . LYS A 1 7  ? 33.633 -271.981 -30.029 1.00 47.23  ? 351 LYS A CG     1 
ATOM   7    C  CD     . LYS A 1 7  ? 33.839 -271.737 -28.559 1.00 50.72  ? 351 LYS A CD     1 
ATOM   8    C  CE     . LYS A 1 7  ? 32.844 -272.493 -27.690 1.00 58.61  ? 351 LYS A CE     1 
ATOM   9    N  NZ     . LYS A 1 7  ? 32.733 -271.808 -26.357 1.00 79.28  ? 351 LYS A NZ     1 
ATOM   10   H  HA     . LYS A 1 7  ? 33.166 -270.782 -32.440 1.00 63.91  ? 351 LYS A HA     1 
ATOM   11   H  HB2    . LYS A 1 7  ? 35.367 -271.170 -30.722 1.00 63.91  ? 351 LYS A HB2    1 
ATOM   12   H  HB3    . LYS A 1 7  ? 34.227 -270.090 -30.493 1.00 63.91  ? 351 LYS A HB3    1 
ATOM   13   H  HG2    . LYS A 1 7  ? 32.688 -271.887 -30.228 1.00 56.67  ? 351 LYS A HG2    1 
ATOM   14   H  HG3    . LYS A 1 7  ? 33.938 -272.878 -30.238 1.00 56.67  ? 351 LYS A HG3    1 
ATOM   15   H  HD2    . LYS A 1 7  ? 34.732 -272.026 -28.313 1.00 60.86  ? 351 LYS A HD2    1 
ATOM   16   H  HD3    . LYS A 1 7  ? 33.735 -270.790 -28.377 1.00 60.86  ? 351 LYS A HD3    1 
ATOM   17   H  HE2    . LYS A 1 7  ? 31.971 -272.492 -28.114 1.00 70.33  ? 351 LYS A HE2    1 
ATOM   18   H  HE3    . LYS A 1 7  ? 33.156 -273.400 -27.549 1.00 70.33  ? 351 LYS A HE3    1 
ATOM   19   H  HZ1    . LYS A 1 7  ? 32.153 -272.242 -25.840 1.00 95.14  ? 351 LYS A HZ1    1 
ATOM   20   H  HZ2    . LYS A 1 7  ? 33.527 -271.796 -25.955 1.00 95.14  ? 351 LYS A HZ2    1 
ATOM   21   H  HZ3    . LYS A 1 7  ? 32.452 -270.971 -26.468 1.00 95.14  ? 351 LYS A HZ3    1 
ATOM   22   N  N      . PRO A 1 8  ? 34.512 -269.498 -34.246 1.00 47.66  ? 352 PRO A N      1 
ATOM   23   C  CA     . PRO A 1 8  ? 35.254 -268.480 -35.001 1.00 55.22  ? 352 PRO A CA     1 
ATOM   24   C  C      . PRO A 1 8  ? 34.867 -267.035 -34.708 1.00 47.45  ? 352 PRO A C      1 
ATOM   25   O  O      . PRO A 1 8  ? 35.517 -266.128 -35.239 1.00 51.84  ? 352 PRO A O      1 
ATOM   26   C  CB     . PRO A 1 8  ? 34.907 -268.842 -36.453 1.00 57.71  ? 352 PRO A CB     1 
ATOM   27   C  CG     . PRO A 1 8  ? 33.493 -269.360 -36.354 1.00 49.58  ? 352 PRO A CG     1 
ATOM   28   C  CD     . PRO A 1 8  ? 33.368 -270.022 -35.005 1.00 56.87  ? 352 PRO A CD     1 
ATOM   29   H  HA     . PRO A 1 8  ? 36.208 -268.590 -34.864 1.00 66.27  ? 352 PRO A HA     1 
ATOM   30   H  HB2    . PRO A 1 8  ? 34.950 -268.050 -37.012 1.00 69.25  ? 352 PRO A HB2    1 
ATOM   31   H  HB3    . PRO A 1 8  ? 35.508 -269.531 -36.776 1.00 69.25  ? 352 PRO A HB3    1 
ATOM   32   H  HG2    . PRO A 1 8  ? 32.872 -268.618 -36.426 1.00 59.50  ? 352 PRO A HG2    1 
ATOM   33   H  HG3    . PRO A 1 8  ? 33.335 -270.003 -37.063 1.00 59.50  ? 352 PRO A HG3    1 
ATOM   34   H  HD2    . PRO A 1 8  ? 32.535 -269.764 -34.579 1.00 68.25  ? 352 PRO A HD2    1 
ATOM   35   H  HD3    . PRO A 1 8  ? 33.437 -270.985 -35.095 1.00 68.25  ? 352 PRO A HD3    1 
ATOM   36   N  N      . TYR A 1 9  ? 33.846 -266.785 -33.893 1.00 41.99  ? 353 TYR A N      1 
ATOM   37   C  CA     . TYR A 1 9  ? 33.410 -265.423 -33.575 1.00 37.60  ? 353 TYR A CA     1 
ATOM   38   C  C      . TYR A 1 9  ? 34.023 -265.004 -32.232 1.00 38.22  ? 353 TYR A C      1 
ATOM   39   O  O      . TYR A 1 9  ? 33.418 -265.167 -31.179 1.00 39.86  ? 353 TYR A O      1 
ATOM   40   C  CB     . TYR A 1 9  ? 31.885 -265.359 -33.577 1.00 37.03  ? 353 TYR A CB     1 
ATOM   41   C  CG     . TYR A 1 9  ? 31.252 -265.675 -34.927 1.00 49.39  ? 353 TYR A CG     1 
ATOM   42   C  CD1    . TYR A 1 9  ? 31.151 -264.692 -35.912 1.00 49.70  ? 353 TYR A CD1    1 
ATOM   43   C  CD2    . TYR A 1 9  ? 30.738 -266.940 -35.213 1.00 46.36  ? 353 TYR A CD2    1 
ATOM   44   C  CE1    . TYR A 1 9  ? 30.583 -264.960 -37.159 1.00 60.98  ? 353 TYR A CE1    1 
ATOM   45   C  CE2    . TYR A 1 9  ? 30.163 -267.223 -36.478 1.00 48.89  ? 353 TYR A CE2    1 
ATOM   46   C  CZ     . TYR A 1 9  ? 30.084 -266.217 -37.437 1.00 56.48  ? 353 TYR A CZ     1 
ATOM   47   O  OH     . TYR A 1 9  ? 29.509 -266.448 -38.673 1.00 53.08  ? 353 TYR A OH     1 
ATOM   48   H  H      . TYR A 1 9  ? 33.381 -267.395 -33.505 1.00 50.39  ? 353 TYR A H      1 
ATOM   49   H  HA     . TYR A 1 9  ? 33.736 -264.815 -34.257 1.00 45.12  ? 353 TYR A HA     1 
ATOM   50   H  HB2    . TYR A 1 9  ? 31.545 -266.001 -32.934 1.00 44.44  ? 353 TYR A HB2    1 
ATOM   51   H  HB3    . TYR A 1 9  ? 31.610 -264.464 -33.324 1.00 44.44  ? 353 TYR A HB3    1 
ATOM   52   H  HD1    . TYR A 1 9  ? 31.487 -263.842 -35.740 1.00 59.63  ? 353 TYR A HD1    1 
ATOM   53   H  HD2    . TYR A 1 9  ? 30.795 -267.613 -34.574 1.00 55.63  ? 353 TYR A HD2    1 
ATOM   54   H  HE1    . TYR A 1 9  ? 30.528 -264.287 -37.798 1.00 73.18  ? 353 TYR A HE1    1 
ATOM   55   H  HE2    . TYR A 1 9  ? 29.823 -268.069 -36.659 1.00 58.67  ? 353 TYR A HE2    1 
ATOM   56   H  HH     . TYR A 1 9  ? 29.245 -267.244 -38.723 1.00 63.69  ? 353 TYR A HH     1 
ATOM   57   N  N      . GLN A 1 10 ? 35.249 -264.466 -32.283 1.00 42.38  ? 354 GLN A N      1 
ATOM   58   C  CA     . GLN A 1 10 ? 35.986 -264.037 -31.101 1.00 37.63  ? 354 GLN A CA     1 
ATOM   59   C  C      . GLN A 1 10 ? 35.572 -262.638 -30.672 1.00 37.04  ? 354 GLN A C      1 
ATOM   60   O  O      . GLN A 1 10 ? 35.157 -261.813 -31.488 1.00 39.62  ? 354 GLN A O      1 
ATOM   61   C  CB     . GLN A 1 10 ? 37.489 -264.017 -31.362 1.00 46.28  ? 354 GLN A CB     1 
ATOM   62   C  CG     . GLN A 1 10 ? 38.006 -262.762 -32.117 1.00 79.73  ? 354 GLN A CG     1 
ATOM   63   C  CD     . GLN A 1 10 ? 37.516 -262.656 -33.570 1.00 87.87  ? 354 GLN A CD     1 
ATOM   64   O  OE1    . GLN A 1 10 ? 37.170 -263.657 -34.202 1.00 51.07  ? 354 GLN A OE1    1 
ATOM   65   N  NE2    . GLN A 1 10 ? 37.494 -261.434 -34.103 1.00 63.05  ? 354 GLN A NE2    1 
ATOM   66   H  H      . GLN A 1 10 ? 35.680 -264.340 -33.016 1.00 50.85  ? 354 GLN A H      1 
ATOM   67   H  HA     . GLN A 1 10 ? 35.809 -264.649 -30.369 1.00 45.16  ? 354 GLN A HA     1 
ATOM   68   H  HB2    . GLN A 1 10 ? 37.951 -264.058 -30.510 1.00 55.53  ? 354 GLN A HB2    1 
ATOM   69   H  HB3    . GLN A 1 10 ? 37.719 -264.794 -31.896 1.00 55.53  ? 354 GLN A HB3    1 
ATOM   70   H  HG2    . GLN A 1 10 ? 37.753 -261.952 -31.650 1.00 95.68  ? 354 GLN A HG2    1 
ATOM   71   H  HG3    . GLN A 1 10 ? 38.974 -262.815 -32.151 1.00 95.68  ? 354 GLN A HG3    1 
ATOM   72   H  HE21   . GLN A 1 10 ? 37.746 -260.757 -33.637 1.00 75.66  ? 354 GLN A HE21   1 
ATOM   73   H  HE22   . GLN A 1 10 ? 37.228 -261.323 -34.913 1.00 75.66  ? 354 GLN A HE22   1 
ATOM   74   N  N      . CYS A 1 11 ? 35.696 -262.377 -29.372 1.00 36.16  ? 355 CYS A N      1 
ATOM   75   C  CA     . CYS A 1 11 ? 35.421 -261.053 -28.818 1.00 30.86  ? 355 CYS A CA     1 
ATOM   76   C  C      . CYS A 1 11 ? 36.713 -260.258 -28.770 1.00 33.24  ? 355 CYS A C      1 
ATOM   77   O  O      . CYS A 1 11 ? 37.711 -260.723 -28.215 1.00 52.72  ? 355 CYS A O      1 
ATOM   78   C  CB     . CYS A 1 11 ? 34.825 -261.132 -27.410 1.00 28.98  ? 355 CYS A CB     1 
ATOM   79   S  SG     . CYS A 1 11 ? 34.201 -259.523 -26.834 1.00 28.97  ? 355 CYS A SG     1 
ATOM   80   H  H      . CYS A 1 11 ? 35.940 -262.956 -28.785 1.00 43.39  ? 355 CYS A H      1 
ATOM   81   H  HA     . CYS A 1 11 ? 34.793 -260.585 -29.391 1.00 37.03  ? 355 CYS A HA     1 
ATOM   82   H  HB2    . CYS A 1 11 ? 34.085 -261.759 -27.413 1.00 34.78  ? 355 CYS A HB2    1 
ATOM   83   H  HB3    . CYS A 1 11 ? 35.511 -261.429 -26.791 1.00 34.78  ? 355 CYS A HB3    1 
ATOM   84   N  N      . ASP A 1 12 ? 36.695 -259.063 -29.357 1.00 40.58  ? 356 ASP A N      1 
ATOM   85   C  CA     . ASP A 1 12 ? 37.889 -258.237 -29.439 1.00 41.42  ? 356 ASP A CA     1 
ATOM   86   C  C      . ASP A 1 12 ? 37.943 -257.165 -28.369 1.00 34.54  ? 356 ASP A C      1 
ATOM   87   O  O      . ASP A 1 12 ? 38.900 -256.390 -28.345 1.00 39.91  ? 356 ASP A O      1 
ATOM   88   C  CB     . ASP A 1 12 ? 37.988 -257.591 -30.821 1.00 37.71  ? 356 ASP A CB     1 
ATOM   89   C  CG     . ASP A 1 12 ? 38.398 -258.591 -31.892 1.00 49.53  ? 356 ASP A CG     1 
ATOM   90   O  OD1    . ASP A 1 12 ? 38.902 -259.674 -31.521 1.00 54.37  ? 356 ASP A OD1    1 
ATOM   91   O  OD2    . ASP A 1 12 ? 38.234 -258.305 -33.095 1.00 46.83  ? 356 ASP A OD2    1 
ATOM   92   H  H      . ASP A 1 12 ? 35.998 -258.709 -29.716 1.00 48.69  ? 356 ASP A H      1 
ATOM   93   H  HA     . ASP A 1 12 ? 38.668 -258.802 -29.321 1.00 49.70  ? 356 ASP A HA     1 
ATOM   94   H  HB2    . ASP A 1 12 ? 37.123 -257.226 -31.064 1.00 45.25  ? 356 ASP A HB2    1 
ATOM   95   H  HB3    . ASP A 1 12 ? 38.653 -256.886 -30.796 1.00 45.25  ? 356 ASP A HB3    1 
ATOM   96   N  N      . PHE A 1 13 ? 36.950 -257.104 -27.492 1.00 35.08  ? 357 PHE A N      1 
ATOM   97   C  CA     . PHE A 1 13 ? 36.999 -256.149 -26.398 1.00 33.09  ? 357 PHE A CA     1 
ATOM   98   C  C      . PHE A 1 13 ? 38.210 -256.410 -25.516 1.00 47.76  ? 357 PHE A C      1 
ATOM   99   O  O      . PHE A 1 13 ? 38.658 -257.550 -25.347 1.00 41.70  ? 357 PHE A O      1 
ATOM   100  C  CB     . PHE A 1 13 ? 35.720 -256.222 -25.576 1.00 31.66  ? 357 PHE A CB     1 
ATOM   101  C  CG     . PHE A 1 13 ? 34.567 -255.483 -26.189 1.00 30.54  ? 357 PHE A CG     1 
ATOM   102  C  CD1    . PHE A 1 13 ? 33.896 -255.987 -27.294 1.00 31.59  ? 357 PHE A CD1    1 
ATOM   103  C  CD2    . PHE A 1 13 ? 34.158 -254.271 -25.645 1.00 36.45  ? 357 PHE A CD2    1 
ATOM   104  C  CE1    . PHE A 1 13 ? 32.836 -255.295 -27.844 1.00 29.55  ? 357 PHE A CE1    1 
ATOM   105  C  CE2    . PHE A 1 13 ? 33.117 -253.561 -26.203 1.00 35.93  ? 357 PHE A CE2    1 
ATOM   106  C  CZ     . PHE A 1 13 ? 32.453 -254.064 -27.305 1.00 30.41  ? 357 PHE A CZ     1 
ATOM   107  H  H      . PHE A 1 13 ? 36.246 -257.597 -27.507 1.00 42.09  ? 357 PHE A H      1 
ATOM   108  H  HA     . PHE A 1 13 ? 37.076 -255.252 -26.760 1.00 39.71  ? 357 PHE A HA     1 
ATOM   109  H  HB2    . PHE A 1 13 ? 35.461 -257.152 -25.482 1.00 37.99  ? 357 PHE A HB2    1 
ATOM   110  H  HB3    . PHE A 1 13 ? 35.888 -255.838 -24.701 1.00 37.99  ? 357 PHE A HB3    1 
ATOM   111  H  HD1    . PHE A 1 13 ? 34.157 -256.800 -27.662 1.00 37.91  ? 357 PHE A HD1    1 
ATOM   112  H  HD2    . PHE A 1 13 ? 34.610 -253.922 -24.911 1.00 43.74  ? 357 PHE A HD2    1 
ATOM   113  H  HE1    . PHE A 1 13 ? 32.395 -255.635 -28.589 1.00 35.46  ? 357 PHE A HE1    1 
ATOM   114  H  HE2    . PHE A 1 13 ? 32.854 -252.750 -25.831 1.00 43.12  ? 357 PHE A HE2    1 
ATOM   115  H  HZ     . PHE A 1 13 ? 31.737 -253.597 -27.671 1.00 36.49  ? 357 PHE A HZ     1 
ATOM   116  N  N      . LYS A 1 14 ? 38.739 -255.327 -24.954 1.00 38.79  ? 358 LYS A N      1 
ATOM   117  C  CA     . LYS A 1 14 ? 39.964 -255.397 -24.179 1.00 39.14  ? 358 LYS A CA     1 
ATOM   118  C  C      . LYS A 1 14 ? 39.816 -256.413 -23.053 1.00 36.71  ? 358 LYS A C      1 
ATOM   119  O  O      . LYS A 1 14 ? 38.815 -256.410 -22.336 1.00 40.92  ? 358 LYS A O      1 
ATOM   120  C  CB     . LYS A 1 14 ? 40.282 -254.007 -23.624 1.00 43.12  ? 358 LYS A CB     1 
ATOM   121  C  CG     . LYS A 1 14 ? 41.473 -253.912 -22.683 1.00 56.43  ? 358 LYS A CG     1 
ATOM   122  C  CD     . LYS A 1 14 ? 41.719 -252.448 -22.287 1.00 59.25  ? 358 LYS A CD     1 
ATOM   123  C  CE     . LYS A 1 14 ? 42.285 -252.303 -20.877 1.00 74.57  ? 358 LYS A CE     1 
ATOM   124  N  NZ     . LYS A 1 14 ? 43.669 -252.834 -20.755 1.00 65.68  ? 358 LYS A NZ     1 
ATOM   125  H  H      . LYS A 1 14 ? 38.403 -254.537 -25.009 1.00 46.55  ? 358 LYS A H      1 
ATOM   126  H  HA     . LYS A 1 14 ? 40.695 -255.676 -24.752 1.00 46.97  ? 358 LYS A HA     1 
ATOM   127  H  HB2    . LYS A 1 14 ? 40.458 -253.414 -24.371 1.00 51.74  ? 358 LYS A HB2    1 
ATOM   128  H  HB3    . LYS A 1 14 ? 39.505 -253.689 -23.138 1.00 51.74  ? 358 LYS A HB3    1 
ATOM   129  H  HG2    . LYS A 1 14 ? 41.293 -254.422 -21.878 1.00 67.72  ? 358 LYS A HG2    1 
ATOM   130  H  HG3    . LYS A 1 14 ? 42.266 -254.248 -23.129 1.00 67.72  ? 358 LYS A HG3    1 
ATOM   131  H  HD2    . LYS A 1 14 ? 42.354 -252.056 -22.907 1.00 71.10  ? 358 LYS A HD2    1 
ATOM   132  H  HD3    . LYS A 1 14 ? 40.878 -251.965 -22.324 1.00 71.10  ? 358 LYS A HD3    1 
ATOM   133  H  HE2    . LYS A 1 14 ? 42.303 -251.363 -20.639 1.00 89.49  ? 358 LYS A HE2    1 
ATOM   134  H  HE3    . LYS A 1 14 ? 41.720 -252.792 -20.258 1.00 89.49  ? 358 LYS A HE3    1 
ATOM   135  H  HZ1    . LYS A 1 14 ? 43.962 -252.731 -19.921 1.00 78.81  ? 358 LYS A HZ1    1 
ATOM   136  H  HZ2    . LYS A 1 14 ? 43.682 -253.700 -20.961 1.00 78.81  ? 358 LYS A HZ2    1 
ATOM   137  H  HZ3    . LYS A 1 14 ? 44.212 -252.397 -21.308 1.00 78.81  ? 358 LYS A HZ3    1 
ATOM   138  N  N      . ASP A 1 15 ? 40.817 -257.289 -22.917 1.00 48.17  ? 359 ASP A N      1 
ATOM   139  C  CA     . ASP A 1 15 ? 40.951 -258.264 -21.834 1.00 44.98  ? 359 ASP A CA     1 
ATOM   140  C  C      . ASP A 1 15 ? 39.928 -259.396 -21.903 1.00 56.66  ? 359 ASP A C      1 
ATOM   141  O  O      . ASP A 1 15 ? 39.877 -260.225 -20.985 1.00 57.56  ? 359 ASP A O      1 
ATOM   142  C  CB     . ASP A 1 15 ? 40.853 -257.605 -20.451 1.00 63.81  ? 359 ASP A CB     1 
ATOM   143  C  CG     . ASP A 1 15 ? 42.028 -256.690 -20.147 1.00 66.36  ? 359 ASP A CG     1 
ATOM   144  O  OD1    . ASP A 1 15 ? 43.137 -256.950 -20.660 1.00 62.97  ? 359 ASP A OD1    1 
ATOM   145  O  OD2    . ASP A 1 15 ? 41.843 -255.713 -19.386 1.00 65.66  ? 359 ASP A OD2    1 
ATOM   146  H  H      . ASP A 1 15 ? 41.468 -257.336 -23.477 1.00 57.80  ? 359 ASP A H      1 
ATOM   147  H  HA     . ASP A 1 15 ? 41.830 -258.668 -21.899 1.00 53.98  ? 359 ASP A HA     1 
ATOM   148  H  HB2    . ASP A 1 15 ? 40.041 -257.077 -20.403 1.00 76.58  ? 359 ASP A HB2    1 
ATOM   149  H  HB3    . ASP A 1 15 ? 40.835 -258.299 -19.773 1.00 76.58  ? 359 ASP A HB3    1 
ATOM   150  N  N      . CYS A 1 16 ? 39.119 -259.475 -22.956 1.00 51.72  ? 360 CYS A N      1 
ATOM   151  C  CA     . CYS A 1 16 ? 38.144 -260.551 -23.091 1.00 39.27  ? 360 CYS A CA     1 
ATOM   152  C  C      . CYS A 1 16 ? 38.717 -261.661 -23.964 1.00 46.17  ? 360 CYS A C      1 
ATOM   153  O  O      . CYS A 1 16 ? 39.361 -261.400 -24.988 1.00 53.52  ? 360 CYS A O      1 
ATOM   154  C  CB     . CYS A 1 16 ? 36.838 -260.049 -23.695 1.00 32.71  ? 360 CYS A CB     1 
ATOM   155  S  SG     . CYS A 1 16 ? 35.450 -261.248 -23.659 1.00 34.47  ? 360 CYS A SG     1 
ATOM   156  H  H      . CYS A 1 16 ? 39.115 -258.915 -23.609 1.00 62.07  ? 360 CYS A H      1 
ATOM   157  H  HA     . CYS A 1 16 ? 37.949 -260.922 -22.217 1.00 47.12  ? 360 CYS A HA     1 
ATOM   158  H  HB2    . CYS A 1 16 ? 36.555 -259.261 -23.206 1.00 39.25  ? 360 CYS A HB2    1 
ATOM   159  H  HB3    . CYS A 1 16 ? 36.998 -259.815 -24.623 1.00 39.25  ? 360 CYS A HB3    1 
ATOM   160  N  N      . GLU A 1 17 ? 38.481 -262.902 -23.546 1.00 48.60  ? 361 GLU A N      1 
ATOM   161  C  CA     . GLU A 1 17 ? 38.975 -264.068 -24.266 1.00 41.46  ? 361 GLU A CA     1 
ATOM   162  C  C      . GLU A 1 17 ? 37.853 -264.926 -24.830 1.00 37.97  ? 361 GLU A C      1 
ATOM   163  O  O      . GLU A 1 17 ? 38.110 -266.059 -25.275 1.00 45.40  ? 361 GLU A O      1 
ATOM   164  C  CB     . GLU A 1 17 ? 39.866 -264.901 -23.344 1.00 45.79  ? 361 GLU A CB     1 
ATOM   165  C  CG     . GLU A 1 17 ? 41.058 -264.125 -22.803 1.00 61.82  ? 361 GLU A CG     1 
ATOM   166  C  CD     . GLU A 1 17 ? 41.800 -263.368 -23.893 1.00 91.66  ? 361 GLU A CD     1 
ATOM   167  O  OE1    . GLU A 1 17 ? 42.427 -264.025 -24.750 1.00 80.28  ? 361 GLU A OE1    1 
ATOM   168  O  OE2    . GLU A 1 17 ? 41.736 -262.119 -23.908 1.00 112.53 ? 361 GLU A OE2    1 
ATOM   169  H  H      . GLU A 1 17 ? 38.031 -263.095 -22.839 1.00 58.32  ? 361 GLU A H      1 
ATOM   170  H  HA     . GLU A 1 17 ? 39.509 -263.772 -25.018 1.00 49.75  ? 361 GLU A HA     1 
ATOM   171  H  HB2    . GLU A 1 17 ? 39.340 -265.205 -22.588 1.00 54.95  ? 361 GLU A HB2    1 
ATOM   172  H  HB3    . GLU A 1 17 ? 40.205 -265.663 -23.839 1.00 54.95  ? 361 GLU A HB3    1 
ATOM   173  H  HG2    . GLU A 1 17 ? 40.746 -263.481 -22.148 1.00 74.18  ? 361 GLU A HG2    1 
ATOM   174  H  HG3    . GLU A 1 17 ? 41.680 -264.745 -22.391 1.00 74.18  ? 361 GLU A HG3    1 
ATOM   175  N  N      . ARG A 1 18 ? 36.621 -264.432 -24.842 1.00 37.38  ? 362 ARG A N      1 
ATOM   176  C  CA     . ARG A 1 18 ? 35.521 -265.309 -25.200 1.00 36.04  ? 362 ARG A CA     1 
ATOM   177  C  C      . ARG A 1 18 ? 35.434 -265.500 -26.702 1.00 45.92  ? 362 ARG A C      1 
ATOM   178  O  O      . ARG A 1 18 ? 35.784 -264.617 -27.491 1.00 40.76  ? 362 ARG A O      1 
ATOM   179  C  CB     . ARG A 1 18 ? 34.199 -264.777 -24.671 1.00 34.31  ? 362 ARG A CB     1 
ATOM   180  C  CG     . ARG A 1 18 ? 34.025 -264.971 -23.180 1.00 39.87  ? 362 ARG A CG     1 
ATOM   181  C  CD     . ARG A 1 18 ? 32.604 -265.400 -22.861 1.00 59.44  ? 362 ARG A CD     1 
ATOM   182  N  NE     . ARG A 1 18 ? 32.516 -266.115 -21.592 1.00 63.91  ? 362 ARG A NE     1 
ATOM   183  C  CZ     . ARG A 1 18 ? 32.441 -267.438 -21.470 1.00 69.34  ? 362 ARG A CZ     1 
ATOM   184  N  NH1    . ARG A 1 18 ? 32.440 -268.227 -22.543 1.00 46.17  ? 362 ARG A NH1    1 
ATOM   185  N  NH2    . ARG A 1 18 ? 32.360 -267.980 -20.261 1.00 81.16  ? 362 ARG A NH2    1 
ATOM   186  H  H      . ARG A 1 18 ? 36.402 -263.622 -24.654 1.00 44.86  ? 362 ARG A H      1 
ATOM   187  H  HA     . ARG A 1 18 ? 35.673 -266.180 -24.800 1.00 43.25  ? 362 ARG A HA     1 
ATOM   188  H  HB2    . ARG A 1 18 ? 34.152 -263.825 -24.852 1.00 41.18  ? 362 ARG A HB2    1 
ATOM   189  H  HB3    . ARG A 1 18 ? 33.477 -265.232 -25.130 1.00 41.18  ? 362 ARG A HB3    1 
ATOM   190  H  HG2    . ARG A 1 18 ? 34.631 -265.662 -22.869 1.00 47.84  ? 362 ARG A HG2    1 
ATOM   191  H  HG3    . ARG A 1 18 ? 34.202 -264.134 -22.723 1.00 47.84  ? 362 ARG A HG3    1 
ATOM   192  H  HD2    . ARG A 1 18 ? 32.051 -264.607 -22.789 1.00 71.33  ? 362 ARG A HD2    1 
ATOM   193  H  HD3    . ARG A 1 18 ? 32.264 -265.970 -23.566 1.00 71.33  ? 362 ARG A HD3    1 
ATOM   194  H  HE     . ARG A 1 18 ? 32.512 -265.647 -20.870 1.00 76.69  ? 362 ARG A HE     1 
ATOM   195  H  HH11   . ARG A 1 18 ? 32.491 -267.893 -23.332 1.00 55.40  ? 362 ARG A HH11   1 
ATOM   196  H  HH12   . ARG A 1 18 ? 32.391 -269.080 -22.444 1.00 55.40  ? 362 ARG A HH12   1 
ATOM   197  H  HH21   . ARG A 1 18 ? 32.360 -267.477 -19.563 1.00 97.40  ? 362 ARG A HH21   1 
ATOM   198  H  HH22   . ARG A 1 18 ? 32.312 -268.834 -20.175 1.00 97.40  ? 362 ARG A HH22   1 
ATOM   199  N  N      . ARG A 1 19 ? 34.992 -266.692 -27.088 1.00 39.06  ? 363 ARG A N      1 
ATOM   200  C  CA     . ARG A 1 19 ? 34.755 -267.045 -28.477 1.00 40.88  ? 363 ARG A CA     1 
ATOM   201  C  C      . ARG A 1 19 ? 33.394 -267.710 -28.565 1.00 35.30  ? 363 ARG A C      1 
ATOM   202  O  O      . ARG A 1 19 ? 32.952 -268.365 -27.623 1.00 38.55  ? 363 ARG A O      1 
ATOM   203  C  CB     . ARG A 1 19 ? 35.802 -268.018 -29.042 1.00 45.60  ? 363 ARG A CB     1 
ATOM   204  C  CG     . ARG A 1 19 ? 37.229 -267.515 -29.153 1.00 64.93  ? 363 ARG A CG     1 
ATOM   205  C  CD     . ARG A 1 19 ? 38.112 -268.562 -29.875 1.00 52.13  ? 363 ARG A CD     1 
ATOM   206  N  NE     . ARG A 1 19 ? 38.060 -268.448 -31.337 1.00 71.00  ? 363 ARG A NE     1 
ATOM   207  C  CZ     . ARG A 1 19 ? 38.725 -267.538 -32.050 1.00 87.01  ? 363 ARG A CZ     1 
ATOM   208  N  NH1    . ARG A 1 19 ? 39.496 -266.643 -31.440 1.00 71.43  ? 363 ARG A NH1    1 
ATOM   209  N  NH2    . ARG A 1 19 ? 38.620 -267.515 -33.380 1.00 66.94  ? 363 ARG A NH2    1 
ATOM   210  H  H      . ARG A 1 19 ? 34.817 -267.333 -26.542 1.00 46.87  ? 363 ARG A H      1 
ATOM   211  H  HA     . ARG A 1 19 ? 34.746 -266.244 -29.024 1.00 49.05  ? 363 ARG A HA     1 
ATOM   212  H  HB2    . ARG A 1 19 ? 35.820 -268.804 -28.474 1.00 54.72  ? 363 ARG A HB2    1 
ATOM   213  H  HB3    . ARG A 1 19 ? 35.522 -268.276 -29.934 1.00 54.72  ? 363 ARG A HB3    1 
ATOM   214  H  HG2    . ARG A 1 19 ? 37.244 -266.693 -29.667 1.00 77.91  ? 363 ARG A HG2    1 
ATOM   215  H  HG3    . ARG A 1 19 ? 37.590 -267.367 -28.265 1.00 77.91  ? 363 ARG A HG3    1 
ATOM   216  H  HD2    . ARG A 1 19 ? 39.034 -268.445 -29.596 1.00 62.56  ? 363 ARG A HD2    1 
ATOM   217  H  HD3    . ARG A 1 19 ? 37.805 -269.450 -29.635 1.00 62.56  ? 363 ARG A HD3    1 
ATOM   218  H  HE     . ARG A 1 19 ? 37.566 -269.007 -31.764 1.00 85.20  ? 363 ARG A HE     1 
ATOM   219  H  HH11   . ARG A 1 19 ? 39.573 -266.648 -30.584 1.00 85.72  ? 363 ARG A HH11   1 
ATOM   220  H  HH12   . ARG A 1 19 ? 39.922 -266.057 -31.904 1.00 85.72  ? 363 ARG A HH12   1 
ATOM   221  H  HH21   . ARG A 1 19 ? 38.122 -268.089 -33.782 1.00 80.33  ? 363 ARG A HH21   1 
ATOM   222  H  HH22   . ARG A 1 19 ? 39.048 -266.924 -33.835 1.00 80.33  ? 363 ARG A HH22   1 
ATOM   223  N  N      . PHE A 1 20 ? 32.764 -267.600 -29.727 1.00 44.55  ? 364 PHE A N      1 
ATOM   224  C  CA     . PHE A 1 20 ? 31.423 -268.128 -29.886 1.00 34.84  ? 364 PHE A CA     1 
ATOM   225  C  C      . PHE A 1 20 ? 31.281 -268.873 -31.191 1.00 35.29  ? 364 PHE A C      1 
ATOM   226  O  O      . PHE A 1 20 ? 31.979 -268.602 -32.180 1.00 37.49  ? 364 PHE A O      1 
ATOM   227  C  CB     . PHE A 1 20 ? 30.386 -267.023 -29.824 1.00 29.84  ? 364 PHE A CB     1 
ATOM   228  C  CG     . PHE A 1 20 ? 30.323 -266.348 -28.487 1.00 30.86  ? 364 PHE A CG     1 
ATOM   229  C  CD1    . PHE A 1 20 ? 29.457 -266.806 -27.516 1.00 30.44  ? 364 PHE A CD1    1 
ATOM   230  C  CD2    . PHE A 1 20 ? 31.162 -265.296 -28.185 1.00 33.48  ? 364 PHE A CD2    1 
ATOM   231  C  CE1    . PHE A 1 20 ? 29.402 -266.213 -26.283 1.00 28.61  ? 364 PHE A CE1    1 
ATOM   232  C  CE2    . PHE A 1 20 ? 31.113 -264.681 -26.935 1.00 38.84  ? 364 PHE A CE2    1 
ATOM   233  C  CZ     . PHE A 1 20 ? 30.237 -265.142 -25.985 1.00 27.87  ? 364 PHE A CZ     1 
ATOM   234  H  H      . PHE A 1 20 ? 33.089 -267.228 -30.431 1.00 53.47  ? 364 PHE A H      1 
ATOM   235  H  HA     . PHE A 1 20 ? 31.236 -268.752 -29.168 1.00 41.81  ? 364 PHE A HA     1 
ATOM   236  H  HB2    . PHE A 1 20 ? 30.603 -266.350 -30.488 1.00 35.81  ? 364 PHE A HB2    1 
ATOM   237  H  HB3    . PHE A 1 20 ? 29.512 -267.401 -30.009 1.00 35.81  ? 364 PHE A HB3    1 
ATOM   238  H  HD1    . PHE A 1 20 ? 28.893 -267.521 -27.706 1.00 36.53  ? 364 PHE A HD1    1 
ATOM   239  H  HD2    . PHE A 1 20 ? 31.755 -264.982 -28.829 1.00 40.18  ? 364 PHE A HD2    1 
ATOM   240  H  HE1    . PHE A 1 20 ? 28.805 -266.528 -25.643 1.00 34.33  ? 364 PHE A HE1    1 
ATOM   241  H  HE2    . PHE A 1 20 ? 31.676 -263.966 -26.744 1.00 46.60  ? 364 PHE A HE2    1 
ATOM   242  H  HZ     . PHE A 1 20 ? 30.199 -264.738 -25.148 1.00 33.45  ? 364 PHE A HZ     1 
ATOM   243  N  N      . SER A 1 21 ? 30.339 -269.806 -31.190 1.00 39.18  ? 365 SER A N      1 
ATOM   244  C  CA     . SER A 1 21 ? 30.028 -270.511 -32.415 1.00 38.14  ? 365 SER A CA     1 
ATOM   245  C  C      . SER A 1 21 ? 29.100 -269.730 -33.330 1.00 36.89  ? 365 SER A C      1 
ATOM   246  O  O      . SER A 1 21 ? 29.083 -270.008 -34.537 1.00 40.48  ? 365 SER A O      1 
ATOM   247  C  CB     . SER A 1 21 ? 29.399 -271.884 -32.113 1.00 47.85  ? 365 SER A CB     1 
ATOM   248  O  OG     . SER A 1 21 ? 28.123 -271.720 -31.526 1.00 56.52  ? 365 SER A OG     1 
ATOM   249  H  H      . SER A 1 21 ? 29.875 -270.044 -30.506 1.00 47.01  ? 365 SER A H      1 
ATOM   250  H  HA     . SER A 1 21 ? 30.853 -270.668 -32.900 1.00 45.77  ? 365 SER A HA     1 
ATOM   251  H  HB2    . SER A 1 21 ? 29.306 -272.380 -32.941 1.00 57.42  ? 365 SER A HB2    1 
ATOM   252  H  HB3    . SER A 1 21 ? 29.972 -272.367 -31.497 1.00 57.42  ? 365 SER A HB3    1 
ATOM   253  H  HG     . SER A 1 21 ? 27.590 -271.384 -32.082 1.00 67.82  ? 365 SER A HG     1 
ATOM   254  N  N      . ARG A 1 22 ? 28.336 -268.775 -32.796 1.00 34.87  ? 366 ARG A N      1 
ATOM   255  C  CA     . ARG A 1 22 ? 27.335 -268.049 -33.562 1.00 41.92  ? 366 ARG A CA     1 
ATOM   256  C  C      . ARG A 1 22 ? 27.586 -266.553 -33.438 1.00 42.04  ? 366 ARG A C      1 
ATOM   257  O  O      . ARG A 1 22 ? 28.016 -266.071 -32.390 1.00 34.57  ? 366 ARG A O      1 
ATOM   258  C  CB     . ARG A 1 22 ? 25.930 -268.363 -33.060 1.00 34.10  ? 366 ARG A CB     1 
ATOM   259  C  CG     . ARG A 1 22 ? 25.440 -269.725 -33.420 1.00 43.98  ? 366 ARG A CG     1 
ATOM   260  C  CD     . ARG A 1 22 ? 24.338 -270.138 -32.485 1.00 42.31  ? 366 ARG A CD     1 
ATOM   261  N  NE     . ARG A 1 22 ? 23.193 -269.233 -32.497 1.00 34.06  ? 366 ARG A NE     1 
ATOM   262  C  CZ     . ARG A 1 22 ? 21.957 -269.608 -32.165 1.00 36.07  ? 366 ARG A CZ     1 
ATOM   263  N  NH1    . ARG A 1 22 ? 21.701 -270.871 -31.852 1.00 38.01  ? 366 ARG A NH1    1 
ATOM   264  N  NH2    . ARG A 1 22 ? 20.961 -268.739 -32.199 1.00 36.00  ? 366 ARG A NH2    1 
ATOM   265  H  H      . ARG A 1 22 ? 28.383 -268.528 -31.974 1.00 41.85  ? 366 ARG A H      1 
ATOM   266  H  HA     . ARG A 1 22 ? 27.392 -268.296 -34.498 1.00 50.30  ? 366 ARG A HA     1 
ATOM   267  H  HB2    . ARG A 1 22 ? 25.919 -268.288 -32.093 1.00 40.92  ? 366 ARG A HB2    1 
ATOM   268  H  HB3    . ARG A 1 22 ? 25.316 -267.721 -33.446 1.00 40.92  ? 366 ARG A HB3    1 
ATOM   269  H  HG2    . ARG A 1 22 ? 25.090 -269.716 -34.325 1.00 52.78  ? 366 ARG A HG2    1 
ATOM   270  H  HG3    . ARG A 1 22 ? 26.166 -270.363 -33.342 1.00 52.78  ? 366 ARG A HG3    1 
ATOM   271  H  HD2    . ARG A 1 22 ? 24.034 -271.019 -32.751 1.00 50.77  ? 366 ARG A HD2    1 
ATOM   272  H  HD3    . ARG A 1 22 ? 24.686 -270.168 -31.580 1.00 50.77  ? 366 ARG A HD3    1 
ATOM   273  H  HE     . ARG A 1 22 ? 23.294 -268.461 -32.862 1.00 40.88  ? 366 ARG A HE     1 
ATOM   274  H  HH11   . ARG A 1 22 ? 22.332 -271.453 -31.827 1.00 45.61  ? 366 ARG A HH11   1 
ATOM   275  H  HH12   . ARG A 1 22 ? 20.899 -271.105 -31.648 1.00 45.61  ? 366 ARG A HH12   1 
ATOM   276  H  HH21   . ARG A 1 22 ? 21.113 -267.919 -32.411 1.00 43.20  ? 366 ARG A HH21   1 
ATOM   277  H  HH22   . ARG A 1 22 ? 20.164 -268.990 -31.996 1.00 43.20  ? 366 ARG A HH22   1 
ATOM   278  N  N      . SER A 1 23 ? 27.281 -265.815 -34.507 1.00 36.30  ? 367 SER A N      1 
ATOM   279  C  CA     . SER A 1 23 ? 27.519 -264.370 -34.467 1.00 36.73  ? 367 SER A CA     1 
ATOM   280  C  C      . SER A 1 23 ? 26.509 -263.650 -33.579 1.00 27.92  ? 367 SER A C      1 
ATOM   281  O  O      . SER A 1 23 ? 26.858 -262.638 -32.931 1.00 27.96  ? 367 SER A O      1 
ATOM   282  C  CB     . SER A 1 23 ? 27.486 -263.782 -35.884 1.00 45.92  ? 367 SER A CB     1 
ATOM   283  O  OG     . SER A 1 23 ? 26.161 -263.726 -36.408 1.00 48.68  ? 367 SER A OG     1 
ATOM   284  H  H      . SER A 1 23 ? 26.948 -266.112 -35.242 1.00 43.56  ? 367 SER A H      1 
ATOM   285  H  HA     . SER A 1 23 ? 28.403 -264.210 -34.100 1.00 44.08  ? 367 SER A HA     1 
ATOM   286  H  HB2    . SER A 1 23 ? 27.851 -262.884 -35.859 1.00 55.10  ? 367 SER A HB2    1 
ATOM   287  H  HB3    . SER A 1 23 ? 28.024 -264.340 -36.465 1.00 55.10  ? 367 SER A HB3    1 
ATOM   288  H  HG     . SER A 1 23 ? 26.172 -263.401 -37.183 1.00 58.41  ? 367 SER A HG     1 
ATOM   289  N  N      . ASP A 1 24 ? 25.258 -264.138 -33.541 1.00 30.62  ? 368 ASP A N      1 
ATOM   290  C  CA     . ASP A 1 24 ? 24.273 -263.509 -32.684 1.00 28.44  ? 368 ASP A CA     1 
ATOM   291  C  C      . ASP A 1 24 ? 24.623 -263.710 -31.219 1.00 28.11  ? 368 ASP A C      1 
ATOM   292  O  O      . ASP A 1 24 ? 24.322 -262.846 -30.391 1.00 27.85  ? 368 ASP A O      1 
ATOM   293  C  CB     . ASP A 1 24 ? 22.842 -263.994 -33.013 1.00 37.68  ? 368 ASP A CB     1 
ATOM   294  C  CG     . ASP A 1 24 ? 22.643 -265.506 -32.920 1.00 40.68  ? 368 ASP A CG     1 
ATOM   295  O  OD1    . ASP A 1 24 ? 23.616 -266.242 -32.731 1.00 34.92  ? 368 ASP A OD1    1 
ATOM   296  O  OD2    . ASP A 1 24 ? 21.475 -265.948 -33.041 1.00 36.03  ? 368 ASP A OD2    1 
ATOM   297  H  H      . ASP A 1 24 ? 24.972 -264.812 -33.992 1.00 36.75  ? 368 ASP A H      1 
ATOM   298  H  HA     . ASP A 1 24 ? 24.295 -262.554 -32.853 1.00 34.13  ? 368 ASP A HA     1 
ATOM   299  H  HB2    . ASP A 1 24 ? 22.224 -263.578 -32.392 1.00 45.22  ? 368 ASP A HB2    1 
ATOM   300  H  HB3    . ASP A 1 24 ? 22.625 -263.724 -33.919 1.00 45.22  ? 368 ASP A HB3    1 
ATOM   301  N  N      . ARG A 1 25 ? 25.299 -264.818 -30.886 1.00 25.83  ? 369 ARG A N      1 
ATOM   302  C  CA     . ARG A 1 25 ? 25.687 -265.042 -29.502 1.00 24.01  ? 369 ARG A CA     1 
ATOM   303  C  C      . ARG A 1 25 ? 26.889 -264.191 -29.112 1.00 24.56  ? 369 ARG A C      1 
ATOM   304  O  O      . ARG A 1 25 ? 27.018 -263.780 -27.953 1.00 22.31  ? 369 ARG A O      1 
ATOM   305  C  CB     . ARG A 1 25 ? 25.982 -266.525 -29.297 1.00 24.91  ? 369 ARG A CB     1 
ATOM   306  C  CG     . ARG A 1 25 ? 24.779 -267.400 -29.435 1.00 32.67  ? 369 ARG A CG     1 
ATOM   307  C  CD     . ARG A 1 25 ? 23.910 -267.265 -28.207 1.00 31.19  ? 369 ARG A CD     1 
ATOM   308  N  NE     . ARG A 1 25 ? 22.494 -267.082 -28.531 1.00 29.89  ? 369 ARG A NE     1 
ATOM   309  C  CZ     . ARG A 1 25 ? 21.562 -268.040 -28.504 1.00 32.61  ? 369 ARG A CZ     1 
ATOM   310  N  NH1    . ARG A 1 25 ? 21.858 -269.316 -28.240 1.00 48.33  ? 369 ARG A NH1    1 
ATOM   311  N  NH2    . ARG A 1 25 ? 20.305 -267.707 -28.774 1.00 49.76  ? 369 ARG A NH2    1 
ATOM   312  H  H      . ARG A 1 25 ? 25.537 -265.437 -31.433 1.00 30.99  ? 369 ARG A H      1 
ATOM   313  H  HA     . ARG A 1 25 ? 24.948 -264.796 -28.924 1.00 28.82  ? 369 ARG A HA     1 
ATOM   314  H  HB2    . ARG A 1 25 ? 26.632 -266.808 -29.959 1.00 29.89  ? 369 ARG A HB2    1 
ATOM   315  H  HB3    . ARG A 1 25 ? 26.344 -266.653 -28.406 1.00 29.89  ? 369 ARG A HB3    1 
ATOM   316  H  HG2    . ARG A 1 25 ? 24.264 -267.128 -30.211 1.00 39.20  ? 369 ARG A HG2    1 
ATOM   317  H  HG3    . ARG A 1 25 ? 25.057 -268.326 -29.517 1.00 39.20  ? 369 ARG A HG3    1 
ATOM   318  H  HD2    . ARG A 1 25 ? 24.000 -268.065 -27.667 1.00 37.43  ? 369 ARG A HD2    1 
ATOM   319  H  HD3    . ARG A 1 25 ? 24.198 -266.493 -27.696 1.00 37.43  ? 369 ARG A HD3    1 
ATOM   320  H  HE     . ARG A 1 25 ? 22.262 -266.318 -28.846 1.00 35.87  ? 369 ARG A HE     1 
ATOM   321  H  HH11   . ARG A 1 25 ? 22.665 -269.545 -28.053 1.00 58.00  ? 369 ARG A HH11   1 
ATOM   322  H  HH12   . ARG A 1 25 ? 21.235 -269.907 -28.243 1.00 58.00  ? 369 ARG A HH12   1 
ATOM   323  H  HH21   . ARG A 1 25 ? 20.107 -266.891 -28.961 1.00 59.72  ? 369 ARG A HH21   1 
ATOM   324  H  HH22   . ARG A 1 25 ? 19.694 -268.312 -28.789 1.00 59.72  ? 369 ARG A HH22   1 
ATOM   325  N  N      . LEU A 1 26 ? 27.787 -263.923 -30.054 1.00 26.81  ? 370 LEU A N      1 
ATOM   326  C  CA     . LEU A 1 26 ? 28.839 -262.948 -29.785 1.00 23.25  ? 370 LEU A CA     1 
ATOM   327  C  C      . LEU A 1 26 ? 28.232 -261.563 -29.569 1.00 22.21  ? 370 LEU A C      1 
ATOM   328  O  O      . LEU A 1 26 ? 28.567 -260.869 -28.596 1.00 25.42  ? 370 LEU A O      1 
ATOM   329  C  CB     . LEU A 1 26 ? 29.861 -262.936 -30.938 1.00 27.94  ? 370 LEU A CB     1 
ATOM   330  C  CG     . LEU A 1 26 ? 30.890 -261.795 -30.876 1.00 26.98  ? 370 LEU A CG     1 
ATOM   331  C  CD1    . LEU A 1 26 ? 31.774 -261.883 -29.636 1.00 31.30  ? 370 LEU A CD1    1 
ATOM   332  C  CD2    . LEU A 1 26 ? 31.769 -261.751 -32.126 1.00 31.73  ? 370 LEU A CD2    1 
ATOM   333  H  H      . LEU A 1 26 ? 27.811 -264.280 -30.836 1.00 32.17  ? 370 LEU A H      1 
ATOM   334  H  HA     . LEU A 1 26 ? 29.305 -263.201 -28.973 1.00 27.90  ? 370 LEU A HA     1 
ATOM   335  H  HB2    . LEU A 1 26 ? 30.351 -263.773 -30.926 1.00 33.53  ? 370 LEU A HB2    1 
ATOM   336  H  HB3    . LEU A 1 26 ? 29.380 -262.852 -31.776 1.00 33.53  ? 370 LEU A HB3    1 
ATOM   337  H  HG     . LEU A 1 26 ? 30.418 -260.949 -30.836 1.00 32.38  ? 370 LEU A HG     1 
ATOM   338  H  HD11   . LEU A 1 26 ? 32.423 -261.163 -29.660 1.00 37.56  ? 370 LEU A HD11   1 
ATOM   339  H  HD12   . LEU A 1 26 ? 31.218 -261.801 -28.845 1.00 37.56  ? 370 LEU A HD12   1 
ATOM   340  H  HD13   . LEU A 1 26 ? 32.230 -262.739 -29.634 1.00 37.56  ? 370 LEU A HD13   1 
ATOM   341  H  HD21   . LEU A 1 26 ? 31.201 -261.667 -32.908 1.00 38.08  ? 370 LEU A HD21   1 
ATOM   342  H  HD22   . LEU A 1 26 ? 32.365 -260.988 -32.066 1.00 38.08  ? 370 LEU A HD22   1 
ATOM   343  H  HD23   . LEU A 1 26 ? 32.285 -262.571 -32.178 1.00 38.08  ? 370 LEU A HD23   1 
ATOM   344  N  N      . LYS A 1 27 ? 27.287 -261.162 -30.424 1.00 26.41  ? 371 LYS A N      1 
ATOM   345  C  CA     . LYS A 1 27 ? 26.688 -259.828 -30.281 1.00 25.61  ? 371 LYS A CA     1 
ATOM   346  C  C      . LYS A 1 27 ? 25.961 -259.695 -28.937 1.00 25.77  ? 371 LYS A C      1 
ATOM   347  O  O      . LYS A 1 27 ? 26.070 -258.661 -28.238 1.00 22.61  ? 371 LYS A O      1 
ATOM   348  C  CB     . LYS A 1 27 ? 25.730 -259.574 -31.449 1.00 31.14  ? 371 LYS A CB     1 
ATOM   349  C  CG     . LYS A 1 27 ? 24.821 -258.350 -31.322 1.00 73.27  ? 371 LYS A CG     1 
ATOM   350  C  CD     . LYS A 1 27 ? 23.895 -258.215 -32.534 1.00 60.16  ? 371 LYS A CD     1 
ATOM   351  C  CE     . LYS A 1 27 ? 24.290 -257.021 -33.419 1.00 90.11  ? 371 LYS A CE     1 
ATOM   352  N  NZ     . LYS A 1 27 ? 23.545 -256.956 -34.726 1.00 70.60  ? 371 LYS A NZ     1 
ATOM   353  H  H      . LYS A 1 27 ? 26.981 -261.628 -31.079 1.00 31.69  ? 371 LYS A H      1 
ATOM   354  H  HA     . LYS A 1 27 ? 27.389 -259.159 -30.313 1.00 30.73  ? 371 LYS A HA     1 
ATOM   355  H  HB2    . LYS A 1 27 ? 26.257 -259.460 -32.255 1.00 37.36  ? 371 LYS A HB2    1 
ATOM   356  H  HB3    . LYS A 1 27 ? 25.157 -260.350 -31.547 1.00 37.36  ? 371 LYS A HB3    1 
ATOM   357  H  HG2    . LYS A 1 27 ? 24.266 -258.437 -30.531 1.00 87.92  ? 371 LYS A HG2    1 
ATOM   358  H  HG3    . LYS A 1 27 ? 25.366 -257.550 -31.264 1.00 87.92  ? 371 LYS A HG3    1 
ATOM   359  H  HD2    . LYS A 1 27 ? 23.950 -259.021 -33.070 1.00 72.19  ? 371 LYS A HD2    1 
ATOM   360  H  HD3    . LYS A 1 27 ? 22.985 -258.078 -32.227 1.00 72.19  ? 371 LYS A HD3    1 
ATOM   361  H  HE2    . LYS A 1 27 ? 24.107 -256.201 -32.937 1.00 108.14 ? 371 LYS A HE2    1 
ATOM   362  H  HE3    . LYS A 1 27 ? 25.237 -257.080 -33.620 1.00 108.14 ? 371 LYS A HE3    1 
ATOM   363  H  HZ1    . LYS A 1 27 ? 23.814 -256.248 -35.194 1.00 84.72  ? 371 LYS A HZ1    1 
ATOM   364  H  HZ2    . LYS A 1 27 ? 23.700 -257.693 -35.201 1.00 84.72  ? 371 LYS A HZ2    1 
ATOM   365  H  HZ3    . LYS A 1 27 ? 22.671 -256.888 -34.574 1.00 84.72  ? 371 LYS A HZ3    1 
ATOM   366  N  N      . ARG A 1 28 ? 25.213 -260.736 -28.549 1.00 21.62  ? 372 ARG A N      1 
ATOM   367  C  CA     . ARG A 1 28 ? 24.509 -260.715 -27.267 1.00 20.58  ? 372 ARG A CA     1 
ATOM   368  C  C      . ARG A 1 28 ? 25.487 -260.538 -26.130 1.00 22.03  ? 372 ARG A C      1 
ATOM   369  O  O      . ARG A 1 28 ? 25.275 -259.710 -25.223 1.00 22.50  ? 372 ARG A O      1 
ATOM   370  C  CB     . ARG A 1 28 ? 23.718 -262.021 -27.103 1.00 24.32  ? 372 ARG A CB     1 
ATOM   371  C  CG     . ARG A 1 28 ? 22.742 -262.004 -25.949 1.00 26.99  ? 372 ARG A CG     1 
ATOM   372  C  CD     . ARG A 1 28 ? 21.991 -263.290 -25.853 1.00 23.23  ? 372 ARG A CD     1 
ATOM   373  N  NE     . ARG A 1 28 ? 22.880 -264.371 -25.469 1.00 23.69  ? 372 ARG A NE     1 
ATOM   374  C  CZ     . ARG A 1 28 ? 22.492 -265.623 -25.251 1.00 26.69  ? 372 ARG A CZ     1 
ATOM   375  N  NH1    . ARG A 1 28 ? 21.227 -265.959 -25.380 1.00 28.99  ? 372 ARG A NH1    1 
ATOM   376  N  NH2    . ARG A 1 28 ? 23.376 -266.530 -24.913 1.00 28.31  ? 372 ARG A NH2    1 
ATOM   377  H  H      . ARG A 1 28 ? 25.100 -261.456 -29.006 1.00 25.94  ? 372 ARG A H      1 
ATOM   378  H  HA     . ARG A 1 28 ? 23.884 -259.973 -27.253 1.00 24.70  ? 372 ARG A HA     1 
ATOM   379  H  HB2    . ARG A 1 28 ? 23.214 -262.185 -27.915 1.00 29.18  ? 372 ARG A HB2    1 
ATOM   380  H  HB3    . ARG A 1 28 ? 24.343 -262.747 -26.952 1.00 29.18  ? 372 ARG A HB3    1 
ATOM   381  H  HG2    . ARG A 1 28 ? 23.228 -261.873 -25.120 1.00 32.38  ? 372 ARG A HG2    1 
ATOM   382  H  HG3    . ARG A 1 28 ? 22.102 -261.287 -26.081 1.00 32.38  ? 372 ARG A HG3    1 
ATOM   383  H  HD2    . ARG A 1 28 ? 21.297 -263.210 -25.180 1.00 27.87  ? 372 ARG A HD2    1 
ATOM   384  H  HD3    . ARG A 1 28 ? 21.603 -263.503 -26.716 1.00 27.87  ? 372 ARG A HD3    1 
ATOM   385  H  HE     . ARG A 1 28 ? 23.714 -264.187 -25.371 1.00 28.43  ? 372 ARG A HE     1 
ATOM   386  H  HH11   . ARG A 1 28 ? 20.642 -265.370 -25.604 1.00 34.78  ? 372 ARG A HH11   1 
ATOM   387  H  HH12   . ARG A 1 28 ? 20.983 -266.771 -25.238 1.00 34.78  ? 372 ARG A HH12   1 
ATOM   388  H  HH21   . ARG A 1 28 ? 24.204 -266.313 -24.828 1.00 33.97  ? 372 ARG A HH21   1 
ATOM   389  H  HH22   . ARG A 1 28 ? 23.127 -267.341 -24.771 1.00 33.97  ? 372 ARG A HH22   1 
ATOM   390  N  N      . HIS A 1 29 ? 26.558 -261.326 -26.157 1.00 20.47  ? 373 HIS A N      1 
ATOM   391  C  CA     . HIS A 1 29 ? 27.638 -261.232 -25.180 1.00 22.89  ? 373 HIS A CA     1 
ATOM   392  C  C      . HIS A 1 29 ? 28.192 -259.819 -25.064 1.00 22.71  ? 373 HIS A C      1 
ATOM   393  O  O      . HIS A 1 29 ? 28.463 -259.341 -23.964 1.00 22.25  ? 373 HIS A O      1 
ATOM   394  C  CB     . HIS A 1 29 ? 28.763 -262.195 -25.568 1.00 25.88  ? 373 HIS A CB     1 
ATOM   395  C  CG     . HIS A 1 29 ? 30.081 -261.845 -24.962 1.00 23.81  ? 373 HIS A CG     1 
ATOM   396  N  ND1    . HIS A 1 29 ? 30.415 -262.186 -23.669 1.00 25.96  ? 373 HIS A ND1    1 
ATOM   397  C  CD2    . HIS A 1 29 ? 31.145 -261.175 -25.460 1.00 25.49  ? 373 HIS A CD2    1 
ATOM   398  C  CE1    . HIS A 1 29 ? 31.628 -261.734 -23.395 1.00 28.32  ? 373 HIS A CE1    1 
ATOM   399  N  NE2    . HIS A 1 29 ? 32.090 -261.110 -24.462 1.00 26.94  ? 373 HIS A NE2    1 
ATOM   400  H  H      . HIS A 1 29 ? 26.684 -261.939 -26.747 1.00 24.56  ? 373 HIS A H      1 
ATOM   401  H  HA     . HIS A 1 29 ? 27.302 -261.496 -24.309 1.00 27.46  ? 373 HIS A HA     1 
ATOM   402  H  HB2    . HIS A 1 29 ? 28.525 -263.086 -25.269 1.00 31.06  ? 373 HIS A HB2    1 
ATOM   403  H  HB3    . HIS A 1 29 ? 28.866 -262.187 -26.532 1.00 31.06  ? 373 HIS A HB3    1 
ATOM   404  H  HD1    . HIS A 1 29 ? 29.910 -262.618 -23.123 1.00 31.15  ? 373 HIS A HD1    1 
ATOM   405  H  HD2    . HIS A 1 29 ? 31.217 -260.810 -26.312 1.00 30.59  ? 373 HIS A HD2    1 
ATOM   406  H  HE1    . HIS A 1 29 ? 32.079 -261.839 -22.588 1.00 33.98  ? 373 HIS A HE1    1 
ATOM   407  N  N      . GLN A 1 30 ? 28.424 -259.151 -26.192 1.00 19.98  ? 374 GLN A N      1 
ATOM   408  C  CA     . GLN A 1 30 ? 29.117 -257.869 -26.152 1.00 20.46  ? 374 GLN A CA     1 
ATOM   409  C  C      . GLN A 1 30 ? 28.287 -256.794 -25.442 1.00 22.91  ? 374 GLN A C      1 
ATOM   410  O  O      . GLN A 1 30 ? 28.842 -255.760 -25.038 1.00 24.76  ? 374 GLN A O      1 
ATOM   411  C  CB     . GLN A 1 30 ? 29.494 -257.440 -27.557 1.00 24.95  ? 374 GLN A CB     1 
ATOM   412  C  CG     . GLN A 1 30 ? 30.622 -258.330 -28.132 1.00 24.18  ? 374 GLN A CG     1 
ATOM   413  C  CD     . GLN A 1 30 ? 30.967 -258.052 -29.594 1.00 24.74  ? 374 GLN A CD     1 
ATOM   414  O  OE1    . GLN A 1 30 ? 30.101 -257.728 -30.411 1.00 30.89  ? 374 GLN A OE1    1 
ATOM   415  N  NE2    . GLN A 1 30 ? 32.249 -258.189 -29.925 1.00 30.72  ? 374 GLN A NE2    1 
ATOM   416  H  H      . GLN A 1 30 ? 28.195 -259.413 -26.978 1.00 23.98  ? 374 GLN A H      1 
ATOM   417  H  HA     . GLN A 1 30 ? 29.940 -257.980 -25.650 1.00 24.55  ? 374 GLN A HA     1 
ATOM   418  H  HB2    . GLN A 1 30 ? 28.719 -257.519 -28.135 1.00 29.94  ? 374 GLN A HB2    1 
ATOM   419  H  HB3    . GLN A 1 30 ? 29.809 -256.523 -27.539 1.00 29.94  ? 374 GLN A HB3    1 
ATOM   420  H  HG2    . GLN A 1 30 ? 31.426 -258.187 -27.608 1.00 29.02  ? 374 GLN A HG2    1 
ATOM   421  H  HG3    . GLN A 1 30 ? 30.350 -259.258 -28.065 1.00 29.02  ? 374 GLN A HG3    1 
ATOM   422  H  HE21   . GLN A 1 30 ? 32.824 -258.421 -29.330 1.00 36.86  ? 374 GLN A HE21   1 
ATOM   423  H  HE22   . GLN A 1 30 ? 32.502 -258.045 -30.734 1.00 36.86  ? 374 GLN A HE22   1 
ATOM   424  N  N      . ARG A 1 31 ? 26.973 -257.011 -25.304 1.00 22.56  ? 375 ARG A N      1 
ATOM   425  C  CA     . ARG A 1 31 ? 26.158 -256.086 -24.513 1.00 21.12  ? 375 ARG A CA     1 
ATOM   426  C  C      . ARG A 1 31 ? 26.661 -255.991 -23.088 1.00 24.67  ? 375 ARG A C      1 
ATOM   427  O  O      . ARG A 1 31 ? 26.428 -254.971 -22.435 1.00 24.57  ? 375 ARG A O      1 
ATOM   428  C  CB     . ARG A 1 31 ? 24.693 -256.522 -24.500 1.00 22.99  ? 375 ARG A CB     1 
ATOM   429  C  CG     . ARG A 1 31 ? 23.993 -256.327 -25.851 1.00 33.20  ? 375 ARG A CG     1 
ATOM   430  C  CD     . ARG A 1 31 ? 22.583 -256.960 -25.878 1.00 28.25  ? 375 ARG A CD     1 
ATOM   431  N  NE     . ARG A 1 31 ? 22.244 -257.198 -27.251 1.00 33.55  ? 375 ARG A NE     1 
ATOM   432  C  CZ     . ARG A 1 31 ? 21.367 -258.082 -27.673 1.00 48.39  ? 375 ARG A CZ     1 
ATOM   433  N  NH1    . ARG A 1 31 ? 20.698 -258.809 -26.797 1.00 29.64  ? 375 ARG A NH1    1 
ATOM   434  N  NH2    . ARG A 1 31 ? 21.166 -258.232 -28.968 1.00 44.14  ? 375 ARG A NH2    1 
ATOM   435  H  H      . ARG A 1 31 ? 26.540 -257.669 -25.649 1.00 27.08  ? 375 ARG A H      1 
ATOM   436  H  HA     . ARG A 1 31 ? 26.205 -255.203 -24.910 1.00 25.34  ? 375 ARG A HA     1 
ATOM   437  H  HB2    . ARG A 1 31 ? 24.647 -257.464 -24.273 1.00 27.58  ? 375 ARG A HB2    1 
ATOM   438  H  HB3    . ARG A 1 31 ? 24.215 -255.999 -23.838 1.00 27.58  ? 375 ARG A HB3    1 
ATOM   439  H  HG2    . ARG A 1 31 ? 23.901 -255.378 -26.027 1.00 39.84  ? 375 ARG A HG2    1 
ATOM   440  H  HG3    . ARG A 1 31 ? 24.525 -256.745 -26.547 1.00 39.84  ? 375 ARG A HG3    1 
ATOM   441  H  HD2    . ARG A 1 31 ? 22.594 -257.804 -25.400 1.00 33.90  ? 375 ARG A HD2    1 
ATOM   442  H  HD3    . ARG A 1 31 ? 21.936 -256.349 -25.493 1.00 33.90  ? 375 ARG A HD3    1 
ATOM   443  H  HE     . ARG A 1 31 ? 22.791 -256.891 -27.837 1.00 40.26  ? 375 ARG A HE     1 
ATOM   444  H  HH11   . ARG A 1 31 ? 20.837 -258.714 -25.954 1.00 35.57  ? 375 ARG A HH11   1 
ATOM   445  H  HH12   . ARG A 1 31 ? 20.120 -259.384 -27.072 1.00 35.57  ? 375 ARG A HH12   1 
ATOM   446  H  HH21   . ARG A 1 31 ? 21.602 -257.749 -29.530 1.00 52.97  ? 375 ARG A HH21   1 
ATOM   447  H  HH22   . ARG A 1 31 ? 20.583 -258.798 -29.250 1.00 52.97  ? 375 ARG A HH22   1 
ATOM   448  N  N      . ARG A 1 32 ? 27.337 -257.026 -22.579 1.00 24.24  ? 376 ARG A N      1 
ATOM   449  C  CA     . ARG A 1 32 ? 27.913 -256.937 -21.236 1.00 24.14  ? 376 ARG A CA     1 
ATOM   450  C  C      . ARG A 1 32 ? 28.963 -255.845 -21.151 1.00 28.51  ? 376 ARG A C      1 
ATOM   451  O  O      . ARG A 1 32 ? 29.111 -255.186 -20.116 1.00 34.70  ? 376 ARG A O      1 
ATOM   452  C  CB     . ARG A 1 32 ? 28.563 -258.256 -20.818 1.00 26.02  ? 376 ARG A CB     1 
ATOM   453  C  CG     . ARG A 1 32 ? 27.715 -259.425 -20.913 1.00 42.70  ? 376 ARG A CG     1 
ATOM   454  C  CD     . ARG A 1 32 ? 28.576 -260.654 -20.697 1.00 89.85  ? 376 ARG A CD     1 
ATOM   455  N  NE     . ARG A 1 32 ? 29.375 -260.516 -19.482 1.00 37.10  ? 376 ARG A NE     1 
ATOM   456  C  CZ     . ARG A 1 32 ? 30.267 -261.402 -19.068 1.00 65.95  ? 376 ARG A CZ     1 
ATOM   457  N  NH1    . ARG A 1 32 ? 30.478 -262.533 -19.750 1.00 71.54  ? 376 ARG A NH1    1 
ATOM   458  N  NH2    . ARG A 1 32 ? 30.939 -261.150 -17.956 1.00 68.43  ? 376 ARG A NH2    1 
ATOM   459  H  H      . ARG A 1 32 ? 27.475 -257.773 -22.983 1.00 29.09  ? 376 ARG A H      1 
ATOM   460  H  HA     . ARG A 1 32 ? 27.210 -256.731 -20.601 1.00 28.97  ? 376 ARG A HA     1 
ATOM   461  H  HB2    . ARG A 1 32 ? 29.339 -258.410 -21.379 1.00 31.22  ? 376 ARG A HB2    1 
ATOM   462  H  HB3    . ARG A 1 32 ? 28.843 -258.164 -19.895 1.00 31.22  ? 376 ARG A HB3    1 
ATOM   463  H  HG2    . ARG A 1 32 ? 27.030 -259.373 -20.234 1.00 51.24  ? 376 ARG A HG2    1 
ATOM   464  H  HG3    . ARG A 1 32 ? 27.318 -259.477 -21.796 1.00 51.24  ? 376 ARG A HG3    1 
ATOM   465  H  HD2    . ARG A 1 32 ? 28.025 -261.448 -20.636 1.00 107.82 ? 376 ARG A HD2    1 
ATOM   466  H  HD3    . ARG A 1 32 ? 29.189 -260.739 -21.444 1.00 107.82 ? 376 ARG A HD3    1 
ATOM   467  H  HE     . ARG A 1 32 ? 29.115 -259.932 -18.908 1.00 44.52  ? 376 ARG A HE     1 
ATOM   468  H  HH11   . ARG A 1 32 ? 30.041 -262.690 -20.474 1.00 85.85  ? 376 ARG A HH11   1 
ATOM   469  H  HH12   . ARG A 1 32 ? 31.058 -263.102 -19.467 1.00 85.85  ? 376 ARG A HH12   1 
ATOM   470  H  HH21   . ARG A 1 32 ? 30.793 -260.423 -17.521 1.00 82.12  ? 376 ARG A HH21   1 
ATOM   471  H  HH22   . ARG A 1 32 ? 31.516 -261.717 -17.664 1.00 82.12  ? 376 ARG A HH22   1 
ATOM   472  N  N      . HIS A 1 33 ? 29.728 -255.665 -22.206 1.00 21.55  ? 377 HIS A N      1 
ATOM   473  C  CA     . HIS A 1 33 ? 30.818 -254.708 -22.208 1.00 25.19  ? 377 HIS A CA     1 
ATOM   474  C  C      . HIS A 1 33 ? 30.302 -253.288 -22.414 1.00 31.66  ? 377 HIS A C      1 
ATOM   475  O  O      . HIS A 1 33 ? 30.829 -252.340 -21.840 1.00 29.20  ? 377 HIS A O      1 
ATOM   476  C  CB     . HIS A 1 33 ? 31.830 -255.041 -23.305 1.00 29.55  ? 377 HIS A CB     1 
ATOM   477  C  CG     . HIS A 1 33 ? 32.475 -256.401 -23.196 1.00 27.24  ? 377 HIS A CG     1 
ATOM   478  N  ND1    . HIS A 1 33 ? 33.121 -256.843 -22.064 1.00 30.16  ? 377 HIS A ND1    1 
ATOM   479  C  CD2    . HIS A 1 33 ? 32.645 -257.377 -24.124 1.00 26.44  ? 377 HIS A CD2    1 
ATOM   480  C  CE1    . HIS A 1 33 ? 33.636 -258.043 -22.286 1.00 33.46  ? 377 HIS A CE1    1 
ATOM   481  N  NE2    . HIS A 1 33 ? 33.368 -258.388 -23.536 1.00 26.40  ? 377 HIS A NE2    1 
ATOM   482  H  H      . HIS A 1 33 ? 29.637 -256.091 -22.948 1.00 25.86  ? 377 HIS A H      1 
ATOM   483  H  HA     . HIS A 1 33 ? 31.275 -254.743 -21.353 1.00 30.23  ? 377 HIS A HA     1 
ATOM   484  H  HB2    . HIS A 1 33 ? 31.379 -255.000 -24.163 1.00 35.46  ? 377 HIS A HB2    1 
ATOM   485  H  HB3    . HIS A 1 33 ? 32.539 -254.379 -23.280 1.00 35.46  ? 377 HIS A HB3    1 
ATOM   486  H  HD1    . HIS A 1 33 ? 33.177 -256.409 -21.324 1.00 36.19  ? 377 HIS A HD1    1 
ATOM   487  H  HD2    . HIS A 1 33 ? 32.331 -257.364 -24.999 1.00 31.73  ? 377 HIS A HD2    1 
ATOM   488  H  HE1    . HIS A 1 33 ? 34.104 -258.557 -21.668 1.00 40.15  ? 377 HIS A HE1    1 
ATOM   489  N  N      . THR A 1 34 ? 29.317 -253.123 -23.279 1.00 29.87  ? 378 THR A N      1 
ATOM   490  C  CA     . THR A 1 34 ? 28.822 -251.810 -23.645 1.00 27.40  ? 378 THR A CA     1 
ATOM   491  C  C      . THR A 1 34 ? 27.713 -251.328 -22.732 1.00 30.77  ? 378 THR A C      1 
ATOM   492  O  O      . THR A 1 34 ? 27.435 -250.125 -22.705 1.00 33.07  ? 378 THR A O      1 
ATOM   493  C  CB     . THR A 1 34 ? 28.264 -251.857 -25.057 1.00 23.54  ? 378 THR A CB     1 
ATOM   494  O  OG1    . THR A 1 34 ? 27.202 -252.808 -25.080 1.00 25.35  ? 378 THR A OG1    1 
ATOM   495  C  CG2    . THR A 1 34 ? 29.338 -252.250 -26.068 1.00 29.01  ? 378 THR A CG2    1 
ATOM   496  H  H      . THR A 1 34 ? 28.912 -253.770 -23.675 1.00 35.84  ? 378 THR A H      1 
ATOM   497  H  HA     . THR A 1 34 ? 29.548 -251.167 -23.619 1.00 32.87  ? 378 THR A HA     1 
ATOM   498  H  HB     . THR A 1 34 ? 27.920 -250.983 -25.298 1.00 28.25  ? 378 THR A HB     1 
ATOM   499  H  HG1    . THR A 1 34 ? 27.506 -253.581 -24.959 1.00 30.43  ? 378 THR A HG1    1 
ATOM   500  H  HG21   . THR A 1 34 ? 28.972 -252.226 -26.966 1.00 34.82  ? 378 THR A HG21   1 
ATOM   501  H  HG22   . THR A 1 34 ? 30.084 -251.632 -26.016 1.00 34.82  ? 378 THR A HG22   1 
ATOM   502  H  HG23   . THR A 1 34 ? 29.658 -253.147 -25.882 1.00 34.82  ? 378 THR A HG23   1 
ATOM   503  N  N      . GLY A 1 35 ? 27.032 -252.242 -22.039 1.00 24.22  ? 379 GLY A N      1 
ATOM   504  C  CA     . GLY A 1 35 ? 25.896 -251.874 -21.226 1.00 24.14  ? 379 GLY A CA     1 
ATOM   505  C  C      . GLY A 1 35 ? 24.633 -251.617 -21.994 1.00 27.16  ? 379 GLY A C      1 
ATOM   506  O  O      . GLY A 1 35 ? 23.680 -251.062 -21.433 1.00 28.97  ? 379 GLY A O      1 
ATOM   507  H  H      . GLY A 1 35 ? 27.215 -253.082 -22.029 1.00 29.06  ? 379 GLY A H      1 
ATOM   508  H  HA2    . GLY A 1 35 ? 25.720 -252.585 -20.590 1.00 28.97  ? 379 GLY A HA2    1 
ATOM   509  H  HA3    . GLY A 1 35 ? 26.112 -251.071 -20.727 1.00 28.97  ? 379 GLY A HA3    1 
ATOM   510  N  N      . VAL A 1 36 ? 24.607 -251.956 -23.282 1.00 26.16  ? 380 VAL A N      1 
ATOM   511  C  CA     . VAL A 1 36 ? 23.442 -251.702 -24.109 1.00 23.18  ? 380 VAL A CA     1 
ATOM   512  C  C      . VAL A 1 36 ? 22.285 -252.578 -23.646 1.00 25.73  ? 380 VAL A C      1 
ATOM   513  O  O      . VAL A 1 36 ? 22.465 -253.764 -23.358 1.00 24.74  ? 380 VAL A O      1 
ATOM   514  C  CB     . VAL A 1 36 ? 23.794 -251.943 -25.582 1.00 21.53  ? 380 VAL A CB     1 
ATOM   515  C  CG1    . VAL A 1 36 ? 22.523 -251.976 -26.392 1.00 31.00  ? 380 VAL A CG1    1 
ATOM   516  C  CG2    . VAL A 1 36 ? 24.753 -250.865 -26.069 1.00 29.99  ? 380 VAL A CG2    1 
ATOM   517  H  H      . VAL A 1 36 ? 25.256 -252.336 -23.698 1.00 31.39  ? 380 VAL A H      1 
ATOM   518  H  HA     . VAL A 1 36 ? 23.177 -250.774 -24.010 1.00 27.81  ? 380 VAL A HA     1 
ATOM   519  H  HB     . VAL A 1 36 ? 24.233 -252.803 -25.670 1.00 25.84  ? 380 VAL A HB     1 
ATOM   520  H  HG11   . VAL A 1 36 ? 22.741 -251.811 -27.323 1.00 37.20  ? 380 VAL A HG11   1 
ATOM   521  H  HG12   . VAL A 1 36 ? 22.109 -252.848 -26.302 1.00 37.20  ? 380 VAL A HG12   1 
ATOM   522  H  HG13   . VAL A 1 36 ? 21.923 -251.286 -26.068 1.00 37.20  ? 380 VAL A HG13   1 
ATOM   523  H  HG21   . VAL A 1 36 ? 24.965 -251.029 -27.001 1.00 35.99  ? 380 VAL A HG21   1 
ATOM   524  H  HG22   . VAL A 1 36 ? 24.328 -249.998 -25.973 1.00 35.99  ? 380 VAL A HG22   1 
ATOM   525  H  HG23   . VAL A 1 36 ? 25.562 -250.898 -25.535 1.00 35.99  ? 380 VAL A HG23   1 
ATOM   526  N  N      . LYS A 1 37 ? 21.089 -251.989 -23.563 1.00 27.56  ? 381 LYS A N      1 
ATOM   527  C  CA     A LYS A 1 37 ? 19.892 -252.684 -23.083 0.23 22.99  ? 381 LYS A CA     1 
ATOM   528  C  CA     B LYS A 1 37 ? 19.895 -252.694 -23.089 0.77 31.25  ? 381 LYS A CA     1 
ATOM   529  C  C      . LYS A 1 37 ? 18.758 -252.427 -24.067 1.00 33.72  ? 381 LYS A C      1 
ATOM   530  O  O      . LYS A 1 37 ? 17.962 -251.495 -23.888 1.00 34.01  ? 381 LYS A O      1 
ATOM   531  C  CB     A LYS A 1 37 ? 19.521 -252.237 -21.669 0.23 24.14  ? 381 LYS A CB     1 
ATOM   532  C  CB     B LYS A 1 37 ? 19.552 -252.287 -21.655 0.77 26.32  ? 381 LYS A CB     1 
ATOM   533  C  CG     A LYS A 1 37 ? 20.583 -252.554 -20.624 0.23 26.21  ? 381 LYS A CG     1 
ATOM   534  C  CG     B LYS A 1 37 ? 20.544 -252.829 -20.632 0.77 31.98  ? 381 LYS A CG     1 
ATOM   535  C  CD     A LYS A 1 37 ? 20.046 -252.383 -19.206 0.23 23.17  ? 381 LYS A CD     1 
ATOM   536  C  CD     B LYS A 1 37 ? 20.156 -252.418 -19.217 0.77 38.46  ? 381 LYS A CD     1 
ATOM   537  C  CE     A LYS A 1 37 ? 21.039 -252.886 -18.168 0.23 32.89  ? 381 LYS A CE     1 
ATOM   538  C  CE     B LYS A 1 37 ? 21.136 -252.953 -18.195 0.77 44.43  ? 381 LYS A CE     1 
ATOM   539  N  NZ     A LYS A 1 37 ? 22.236 -252.005 -18.055 0.23 31.03  ? 381 LYS A NZ     1 
ATOM   540  N  NZ     B LYS A 1 37 ? 20.891 -252.361 -16.848 0.77 35.07  ? 381 LYS A NZ     1 
ATOM   541  H  H      A LYS A 1 37 ? 20.944 -251.171 -23.784 0.23 33.07  ? 381 LYS A H      1 
ATOM   542  H  H      B LYS A 1 37 ? 20.942 -251.170 -23.779 0.77 33.07  ? 381 LYS A H      1 
ATOM   543  H  HA     A LYS A 1 37 ? 20.064 -253.637 -23.051 0.23 27.59  ? 381 LYS A HA     1 
ATOM   544  H  HA     B LYS A 1 37 ? 20.072 -253.646 -23.077 0.77 37.50  ? 381 LYS A HA     1 
ATOM   545  H  HB2    A LYS A 1 37 ? 19.384 -251.277 -21.671 0.23 28.97  ? 381 LYS A HB2    1 
ATOM   546  H  HB2    B LYS A 1 37 ? 19.556 -251.319 -21.592 0.77 31.59  ? 381 LYS A HB2    1 
ATOM   547  H  HB3    A LYS A 1 37 ? 18.702 -252.685 -21.405 0.23 28.97  ? 381 LYS A HB3    1 
ATOM   548  H  HB3    B LYS A 1 37 ? 18.673 -252.631 -21.431 0.77 31.59  ? 381 LYS A HB3    1 
ATOM   549  H  HG2    A LYS A 1 37 ? 20.872 -253.474 -20.730 0.23 31.45  ? 381 LYS A HG2    1 
ATOM   550  H  HG2    B LYS A 1 37 ? 20.554 -253.798 -20.676 0.77 38.38  ? 381 LYS A HG2    1 
ATOM   551  H  HG3    A LYS A 1 37 ? 21.334 -251.951 -20.739 0.23 31.45  ? 381 LYS A HG3    1 
ATOM   552  H  HG3    B LYS A 1 37 ? 21.427 -252.474 -20.821 0.77 38.38  ? 381 LYS A HG3    1 
ATOM   553  H  HD2    A LYS A 1 37 ? 19.880 -251.442 -19.038 0.23 27.80  ? 381 LYS A HD2    1 
ATOM   554  H  HD2    B LYS A 1 37 ? 20.150 -251.450 -19.155 0.77 46.15  ? 381 LYS A HD2    1 
ATOM   555  H  HD3    A LYS A 1 37 ? 19.225 -252.891 -19.112 0.23 27.80  ? 381 LYS A HD3    1 
ATOM   556  H  HD3    B LYS A 1 37 ? 19.277 -252.773 -19.010 0.77 46.15  ? 381 LYS A HD3    1 
ATOM   557  H  HE2    A LYS A 1 37 ? 20.604 -252.916 -17.301 0.23 39.47  ? 381 LYS A HE2    1 
ATOM   558  H  HE2    B LYS A 1 37 ? 21.036 -253.915 -18.128 0.77 53.31  ? 381 LYS A HE2    1 
ATOM   559  H  HE3    A LYS A 1 37 ? 21.340 -253.773 -18.421 0.23 39.47  ? 381 LYS A HE3    1 
ATOM   560  H  HE3    B LYS A 1 37 ? 22.039 -252.727 -18.467 0.77 53.31  ? 381 LYS A HE3    1 
ATOM   561  H  HZ1    A LYS A 1 37 ? 21.988 -251.184 -17.817 0.23 37.23  ? 381 LYS A HZ1    1 
ATOM   562  H  HZ1    B LYS A 1 37 ? 21.476 -252.687 -16.262 0.77 42.08  ? 381 LYS A HZ1    1 
ATOM   563  H  HZ2    A LYS A 1 37 ? 22.794 -252.328 -17.441 0.23 37.23  ? 381 LYS A HZ2    1 
ATOM   564  H  HZ2    B LYS A 1 37 ? 20.980 -251.476 -16.884 0.77 42.08  ? 381 LYS A HZ2    1 
ATOM   565  H  HZ3    A LYS A 1 37 ? 22.659 -251.964 -18.837 0.23 37.23  ? 381 LYS A HZ3    1 
ATOM   566  H  HZ3    B LYS A 1 37 ? 20.067 -252.558 -16.575 0.77 42.08  ? 381 LYS A HZ3    1 
ATOM   567  N  N      . PRO A 1 38 ? 18.658 -253.231 -25.135 1.00 26.20  ? 382 PRO A N      1 
ATOM   568  C  CA     . PRO A 1 38 ? 17.716 -252.914 -26.207 1.00 25.45  ? 382 PRO A CA     1 
ATOM   569  C  C      . PRO A 1 38 ? 16.258 -253.078 -25.849 1.00 36.84  ? 382 PRO A C      1 
ATOM   570  O  O      . PRO A 1 38 ? 15.406 -252.567 -26.580 1.00 36.75  ? 382 PRO A O      1 
ATOM   571  C  CB     . PRO A 1 38 ? 18.108 -253.905 -27.323 1.00 35.34  ? 382 PRO A CB     1 
ATOM   572  C  CG     . PRO A 1 38 ? 19.467 -254.359 -26.986 1.00 27.53  ? 382 PRO A CG     1 
ATOM   573  C  CD     . PRO A 1 38 ? 19.518 -254.365 -25.495 1.00 28.53  ? 382 PRO A CD     1 
ATOM   574  H  HA     . PRO A 1 38 ? 17.864 -252.009 -26.522 1.00 30.54  ? 382 PRO A HA     1 
ATOM   575  H  HB2    . PRO A 1 38 ? 17.489 -254.652 -27.328 1.00 42.41  ? 382 PRO A HB2    1 
ATOM   576  H  HB3    . PRO A 1 38 ? 18.102 -253.450 -28.180 1.00 42.41  ? 382 PRO A HB3    1 
ATOM   577  H  HG2    . PRO A 1 38 ? 19.610 -255.252 -27.338 1.00 33.04  ? 382 PRO A HG2    1 
ATOM   578  H  HG3    . PRO A 1 38 ? 20.118 -253.738 -27.349 1.00 33.04  ? 382 PRO A HG3    1 
ATOM   579  H  HD2    . PRO A 1 38 ? 19.153 -255.193 -25.146 1.00 34.24  ? 382 PRO A HD2    1 
ATOM   580  H  HD3    . PRO A 1 38 ? 20.431 -254.223 -25.200 1.00 34.24  ? 382 PRO A HD3    1 
ATOM   581  N  N      . PHE A 1 39 ? 15.924 -253.799 -24.792 1.00 33.01  ? 383 PHE A N      1 
ATOM   582  C  CA     . PHE A 1 39 ? 14.564 -254.288 -24.616 1.00 38.09  ? 383 PHE A CA     1 
ATOM   583  C  C      . PHE A 1 39 ? 13.920 -253.644 -23.400 1.00 35.87  ? 383 PHE A C      1 
ATOM   584  O  O      . PHE A 1 39 ? 14.485 -253.662 -22.308 1.00 43.53  ? 383 PHE A O      1 
ATOM   585  C  CB     . PHE A 1 39 ? 14.596 -255.807 -24.506 1.00 33.04  ? 383 PHE A CB     1 
ATOM   586  C  CG     . PHE A 1 39 ? 15.287 -256.454 -25.677 1.00 27.65  ? 383 PHE A CG     1 
ATOM   587  C  CD1    . PHE A 1 39 ? 14.677 -256.491 -26.915 1.00 32.30  ? 383 PHE A CD1    1 
ATOM   588  C  CD2    . PHE A 1 39 ? 16.578 -256.922 -25.559 1.00 27.82  ? 383 PHE A CD2    1 
ATOM   589  C  CE1    . PHE A 1 39 ? 15.312 -257.067 -27.989 1.00 36.22  ? 383 PHE A CE1    1 
ATOM   590  C  CE2    . PHE A 1 39 ? 17.214 -257.489 -26.630 1.00 34.74  ? 383 PHE A CE2    1 
ATOM   591  C  CZ     . PHE A 1 39 ? 16.591 -257.555 -27.845 1.00 29.33  ? 383 PHE A CZ     1 
ATOM   592  H  H      . PHE A 1 39 ? 16.464 -254.020 -24.161 1.00 39.62  ? 383 PHE A H      1 
ATOM   593  H  HA     . PHE A 1 39 ? 14.033 -254.057 -25.394 1.00 45.71  ? 383 PHE A HA     1 
ATOM   594  H  HB2    . PHE A 1 39 ? 15.073 -256.057 -23.699 1.00 39.65  ? 383 PHE A HB2    1 
ATOM   595  H  HB3    . PHE A 1 39 ? 13.686 -256.142 -24.472 1.00 39.65  ? 383 PHE A HB3    1 
ATOM   596  H  HD1    . PHE A 1 39 ? 13.810 -256.169 -27.011 1.00 38.76  ? 383 PHE A HD1    1 
ATOM   597  H  HD2    . PHE A 1 39 ? 17.006 -256.888 -24.734 1.00 33.39  ? 383 PHE A HD2    1 
ATOM   598  H  HE1    . PHE A 1 39 ? 14.888 -257.107 -28.816 1.00 43.47  ? 383 PHE A HE1    1 
ATOM   599  H  HE2    . PHE A 1 39 ? 18.077 -257.821 -26.534 1.00 41.69  ? 383 PHE A HE2    1 
ATOM   600  H  HZ     . PHE A 1 39 ? 17.028 -257.938 -28.572 1.00 35.19  ? 383 PHE A HZ     1 
ATOM   601  N  N      . GLN A 1 40 ? 12.731 -253.082 -23.587 1.00 37.34  ? 384 GLN A N      1 
ATOM   602  C  CA     . GLN A 1 40 ? 12.102 -252.300 -22.537 1.00 31.71  ? 384 GLN A CA     1 
ATOM   603  C  C      . GLN A 1 40 ? 10.755 -252.867 -22.108 1.00 32.73  ? 384 GLN A C      1 
ATOM   604  O  O      . GLN A 1 40 ? 9.892  -253.154 -22.948 1.00 32.54  ? 384 GLN A O      1 
ATOM   605  C  CB     . GLN A 1 40 ? 11.905 -250.867 -22.976 1.00 35.85  ? 384 GLN A CB     1 
ATOM   606  C  CG     . GLN A 1 40 ? 11.446 -249.992 -21.864 1.00 37.15  ? 384 GLN A CG     1 
ATOM   607  C  CD     . GLN A 1 40 ? 11.362 -248.536 -22.262 1.00 54.44  ? 384 GLN A CD     1 
ATOM   608  O  OE1    . GLN A 1 40 ? 11.108 -248.191 -23.427 1.00 52.49  ? 384 GLN A OE1    1 
ATOM   609  N  NE2    . GLN A 1 40 ? 11.567 -247.663 -21.289 1.00 39.87  ? 384 GLN A NE2    1 
ATOM   610  H  H      . GLN A 1 40 ? 12.271 -253.139 -24.311 1.00 44.81  ? 384 GLN A H      1 
ATOM   611  H  HA     . GLN A 1 40 ? 12.678 -252.291 -21.757 1.00 38.05  ? 384 GLN A HA     1 
ATOM   612  H  HB2    . GLN A 1 40 ? 12.748 -250.518 -23.306 1.00 43.02  ? 384 GLN A HB2    1 
ATOM   613  H  HB3    . GLN A 1 40 ? 11.235 -250.839 -23.677 1.00 43.02  ? 384 GLN A HB3    1 
ATOM   614  H  HG2    . GLN A 1 40 ? 10.562 -250.271 -21.580 1.00 44.58  ? 384 GLN A HG2    1 
ATOM   615  H  HG3    . GLN A 1 40 ? 12.070 -250.066 -21.125 1.00 44.58  ? 384 GLN A HG3    1 
ATOM   616  H  HE21   . GLN A 1 40 ? 11.735 -247.939 -20.492 1.00 47.84  ? 384 GLN A HE21   1 
ATOM   617  H  HE22   . GLN A 1 40 ? 11.532 -246.820 -21.454 1.00 47.84  ? 384 GLN A HE22   1 
ATOM   618  N  N      . CYS A 1 41 ? 10.564 -252.905 -20.784 1.00 35.31  ? 385 CYS A N      1 
ATOM   619  C  CA     . CYS A 1 41 ? 9.298  -253.293 -20.165 1.00 36.69  ? 385 CYS A CA     1 
ATOM   620  C  C      . CYS A 1 41 ? 8.259  -252.190 -20.342 1.00 47.22  ? 385 CYS A C      1 
ATOM   621  O  O      . CYS A 1 41 ? 8.471  -251.050 -19.917 1.00 38.42  ? 385 CYS A O      1 
ATOM   622  C  CB     . CYS A 1 41 ? 9.493  -253.582 -18.678 1.00 33.19  ? 385 CYS A CB     1 
ATOM   623  S  SG     . CYS A 1 41 ? 7.928  -254.099 -17.860 1.00 34.82  ? 385 CYS A SG     1 
ATOM   624  H  H      . CYS A 1 41 ? 11.173 -252.704 -20.211 1.00 42.38  ? 385 CYS A H      1 
ATOM   625  H  HA     . CYS A 1 41 ? 8.961  -254.095 -20.592 1.00 44.03  ? 385 CYS A HA     1 
ATOM   626  H  HB2    . CYS A 1 41 ? 10.138 -254.299 -18.575 1.00 39.83  ? 385 CYS A HB2    1 
ATOM   627  H  HB3    . CYS A 1 41 ? 9.813  -252.779 -18.237 1.00 39.83  ? 385 CYS A HB3    1 
ATOM   628  N  N      . LYS A 1 42 ? 7.127  -252.538 -20.951 1.00 37.41  ? 386 LYS A N      1 
ATOM   629  C  CA     . LYS A 1 42 ? 6.087  -251.558 -21.217 1.00 42.05  ? 386 LYS A CA     1 
ATOM   630  C  C      . LYS A 1 42 ? 5.296  -251.187 -19.973 1.00 42.38  ? 386 LYS A C      1 
ATOM   631  O  O      . LYS A 1 42 ? 4.549  -250.203 -20.004 1.00 44.00  ? 386 LYS A O      1 
ATOM   632  C  CB     . LYS A 1 42 ? 5.168  -252.099 -22.312 1.00 47.82  ? 386 LYS A CB     1 
ATOM   633  C  CG     . LYS A 1 42 ? 5.904  -252.257 -23.632 1.00 64.82  ? 386 LYS A CG     1 
ATOM   634  C  CD     . LYS A 1 42 ? 5.036  -252.806 -24.739 1.00 64.81  ? 386 LYS A CD     1 
ATOM   635  C  CE     . LYS A 1 42 ? 5.835  -252.850 -26.035 1.00 68.59  ? 386 LYS A CE     1 
ATOM   636  N  NZ     . LYS A 1 42 ? 5.035  -253.382 -27.165 1.00 85.22  ? 386 LYS A NZ     1 
ATOM   637  H  H      . LYS A 1 42 ? 6.940  -253.334 -21.218 1.00 44.89  ? 386 LYS A H      1 
ATOM   638  H  HA     . LYS A 1 42 ? 6.502  -250.748 -21.554 1.00 50.47  ? 386 LYS A HA     1 
ATOM   639  H  HB2    . LYS A 1 42 ? 4.831  -252.969 -22.046 1.00 57.38  ? 386 LYS A HB2    1 
ATOM   640  H  HB3    . LYS A 1 42 ? 4.432  -251.481 -22.446 1.00 57.38  ? 386 LYS A HB3    1 
ATOM   641  H  HG2    . LYS A 1 42 ? 6.233  -251.389 -23.914 1.00 77.78  ? 386 LYS A HG2    1 
ATOM   642  H  HG3    . LYS A 1 42 ? 6.647  -252.867 -23.507 1.00 77.78  ? 386 LYS A HG3    1 
ATOM   643  H  HD2    . LYS A 1 42 ? 4.755  -253.707 -24.517 1.00 77.78  ? 386 LYS A HD2    1 
ATOM   644  H  HD3    . LYS A 1 42 ? 4.267  -252.229 -24.868 1.00 77.78  ? 386 LYS A HD3    1 
ATOM   645  H  HE2    . LYS A 1 42 ? 6.121  -251.952 -26.263 1.00 82.31  ? 386 LYS A HE2    1 
ATOM   646  H  HE3    . LYS A 1 42 ? 6.607  -253.425 -25.914 1.00 82.31  ? 386 LYS A HE3    1 
ATOM   647  H  HZ1    . LYS A 1 42 ? 4.764  -254.210 -26.982 1.00 102.26 ? 386 LYS A HZ1    1 
ATOM   648  H  HZ2    . LYS A 1 42 ? 4.322  -252.868 -27.301 1.00 102.26 ? 386 LYS A HZ2    1 
ATOM   649  H  HZ3    . LYS A 1 42 ? 5.527  -253.395 -27.906 1.00 102.26 ? 386 LYS A HZ3    1 
ATOM   650  N  N      . THR A 1 43 ? 5.453  -251.929 -18.878 1.00 52.48  ? 387 THR A N      1 
ATOM   651  C  CA     . THR A 1 43 ? 4.754  -251.613 -17.638 1.00 47.61  ? 387 THR A CA     1 
ATOM   652  C  C      . THR A 1 43 ? 5.555  -250.684 -16.730 1.00 36.23  ? 387 THR A C      1 
ATOM   653  O  O      . THR A 1 43 ? 5.026  -249.670 -16.271 1.00 45.76  ? 387 THR A O      1 
ATOM   654  C  CB     . THR A 1 43 ? 4.416  -252.901 -16.898 1.00 47.75  ? 387 THR A CB     1 
ATOM   655  O  OG1    . THR A 1 43 ? 3.649  -253.732 -17.767 1.00 44.23  ? 387 THR A OG1    1 
ATOM   656  C  CG2    . THR A 1 43 ? 3.615  -252.596 -15.651 1.00 46.89  ? 387 THR A CG2    1 
ATOM   657  H  H      . THR A 1 43 ? 5.959  -252.622 -18.828 1.00 62.98  ? 387 THR A H      1 
ATOM   658  H  HA     . THR A 1 43 ? 3.919  -251.169 -17.853 1.00 57.13  ? 387 THR A HA     1 
ATOM   659  H  HB     . THR A 1 43 ? 5.233  -253.358 -16.642 1.00 57.30  ? 387 THR A HB     1 
ATOM   660  H  HG1    . THR A 1 43 ? 3.451  -254.450 -17.378 1.00 53.08  ? 387 THR A HG1    1 
ATOM   661  H  HG21   . THR A 1 43 ? 3.218  -253.411 -15.307 1.00 56.27  ? 387 THR A HG21   1 
ATOM   662  H  HG22   . THR A 1 43 ? 4.190  -252.215 -14.969 1.00 56.27  ? 387 THR A HG22   1 
ATOM   663  H  HG23   . THR A 1 43 ? 2.907  -251.966 -15.858 1.00 56.27  ? 387 THR A HG23   1 
ATOM   664  N  N      . CYS A 1 44 ? 6.823  -251.006 -16.465 1.00 40.59  ? 388 CYS A N      1 
ATOM   665  C  CA     . CYS A 1 44 ? 7.646  -250.231 -15.545 1.00 41.47  ? 388 CYS A CA     1 
ATOM   666  C  C      . CYS A 1 44 ? 8.805  -249.500 -16.214 1.00 43.23  ? 388 CYS A C      1 
ATOM   667  O  O      . CYS A 1 44 ? 9.557  -248.810 -15.520 1.00 44.90  ? 388 CYS A O      1 
ATOM   668  C  CB     . CYS A 1 44 ? 8.192  -251.151 -14.451 1.00 37.47  ? 388 CYS A CB     1 
ATOM   669  S  SG     . CYS A 1 44 ? 9.493  -252.276 -14.974 1.00 38.15  ? 388 CYS A SG     1 
ATOM   670  H  H      . CYS A 1 44 ? 7.231  -251.679 -16.812 1.00 48.71  ? 388 CYS A H      1 
ATOM   671  H  HA     . CYS A 1 44 ? 7.091  -249.563 -15.114 1.00 49.77  ? 388 CYS A HA     1 
ATOM   672  H  HB2    . CYS A 1 44 ? 8.552  -250.601 -13.738 1.00 44.97  ? 388 CYS A HB2    1 
ATOM   673  H  HB3    . CYS A 1 44 ? 7.461  -251.689 -14.109 1.00 44.97  ? 388 CYS A HB3    1 
ATOM   674  N  N      . GLN A 1 45 ? 8.992  -249.660 -17.529 1.00 39.23  ? 389 GLN A N      1 
ATOM   675  C  CA     . GLN A 1 45 ? 10.002 -248.976 -18.338 1.00 39.14  ? 389 GLN A CA     1 
ATOM   676  C  C      . GLN A 1 45 ? 11.450 -249.394 -18.051 1.00 38.30  ? 389 GLN A C      1 
ATOM   677  O  O      . GLN A 1 45 ? 12.368 -248.817 -18.657 1.00 36.31  ? 389 GLN A O      1 
ATOM   678  C  CB     . GLN A 1 45 ? 9.888  -247.447 -18.213 1.00 43.18  ? 389 GLN A CB     1 
ATOM   679  C  CG     . GLN A 1 45 ? 8.765  -246.884 -19.048 1.00 42.61  ? 389 GLN A CG     1 
ATOM   680  C  CD     . GLN A 1 45 ? 7.413  -247.295 -18.544 1.00 50.82  ? 389 GLN A CD     1 
ATOM   681  O  OE1    . GLN A 1 45 ? 7.111  -247.153 -17.355 1.00 49.74  ? 389 GLN A OE1    1 
ATOM   682  N  NE2    . GLN A 1 45 ? 6.591  -247.840 -19.438 1.00 56.75  ? 389 GLN A NE2    1 
ATOM   683  H  H      . GLN A 1 45 ? 8.512  -250.196 -18.000 1.00 47.08  ? 389 GLN A H      1 
ATOM   684  H  HA     . GLN A 1 45 ? 9.831  -249.192 -19.268 1.00 46.97  ? 389 GLN A HA     1 
ATOM   685  H  HB2    . GLN A 1 45 ? 9.723  -247.208 -17.288 1.00 51.82  ? 389 GLN A HB2    1 
ATOM   686  H  HB3    . GLN A 1 45 ? 10.715 -247.042 -18.516 1.00 51.82  ? 389 GLN A HB3    1 
ATOM   687  H  HG2    . GLN A 1 45 ? 8.811  -245.915 -19.028 1.00 51.14  ? 389 GLN A HG2    1 
ATOM   688  H  HG3    . GLN A 1 45 ? 8.857  -247.203 -19.959 1.00 51.14  ? 389 GLN A HG3    1 
ATOM   689  H  HE21   . GLN A 1 45 ? 6.846  -247.938 -20.253 1.00 68.09  ? 389 GLN A HE21   1 
ATOM   690  H  HE22   . GLN A 1 45 ? 5.805  -248.094 -19.200 1.00 68.09  ? 389 GLN A HE22   1 
ATOM   691  N  N      . ARG A 1 46 ? 11.697 -250.379 -17.185 1.00 40.08  ? 390 ARG A N      1 
ATOM   692  C  CA     . ARG A 1 46 ? 13.056 -250.890 -17.013 1.00 33.03  ? 390 ARG A CA     1 
ATOM   693  C  C      . ARG A 1 46 ? 13.565 -251.494 -18.323 1.00 36.96  ? 390 ARG A C      1 
ATOM   694  O  O      . ARG A 1 46 ? 12.800 -252.096 -19.083 1.00 31.27  ? 390 ARG A O      1 
ATOM   695  C  CB     . ARG A 1 46 ? 13.088 -251.940 -15.911 1.00 34.59  ? 390 ARG A CB     1 
ATOM   696  C  CG     . ARG A 1 46 ? 14.474 -252.396 -15.515 1.00 38.83  ? 390 ARG A CG     1 
ATOM   697  C  CD     . ARG A 1 46 ? 14.433 -253.281 -14.279 1.00 34.39  ? 390 ARG A CD     1 
ATOM   698  N  NE     . ARG A 1 46 ? 15.747 -253.860 -13.979 1.00 40.39  ? 390 ARG A NE     1 
ATOM   699  C  CZ     . ARG A 1 46 ? 16.090 -254.416 -12.820 1.00 33.42  ? 390 ARG A CZ     1 
ATOM   700  N  NH1    . ARG A 1 46 ? 15.220 -254.492 -11.823 1.00 40.89  ? 390 ARG A NH1    1 
ATOM   701  N  NH2    . ARG A 1 46 ? 17.306 -254.909 -12.662 1.00 38.90  ? 390 ARG A NH2    1 
ATOM   702  H  H      . ARG A 1 46 ? 11.105 -250.762 -16.693 1.00 48.10  ? 390 ARG A H      1 
ATOM   703  H  HA     . ARG A 1 46 ? 13.645 -250.162 -16.761 1.00 39.64  ? 390 ARG A HA     1 
ATOM   704  H  HB2    . ARG A 1 46 ? 12.663 -251.572 -15.121 1.00 41.50  ? 390 ARG A HB2    1 
ATOM   705  H  HB3    . ARG A 1 46 ? 12.597 -252.720 -16.212 1.00 41.50  ? 390 ARG A HB3    1 
ATOM   706  H  HG2    . ARG A 1 46 ? 14.864 -252.906 -16.242 1.00 46.59  ? 390 ARG A HG2    1 
ATOM   707  H  HG3    . ARG A 1 46 ? 15.022 -251.621 -15.316 1.00 46.59  ? 390 ARG A HG3    1 
ATOM   708  H  HD2    . ARG A 1 46 ? 14.154 -252.750 -13.517 1.00 41.27  ? 390 ARG A HD2    1 
ATOM   709  H  HD3    . ARG A 1 46 ? 13.808 -254.008 -14.427 1.00 41.27  ? 390 ARG A HD3    1 
ATOM   710  H  HE     . ARG A 1 46 ? 16.341 -253.838 -14.600 1.00 48.47  ? 390 ARG A HE     1 
ATOM   711  H  HH11   . ARG A 1 46 ? 14.426 -254.175 -11.916 1.00 49.06  ? 390 ARG A HH11   1 
ATOM   712  H  HH12   . ARG A 1 46 ? 15.452 -254.855 -11.079 1.00 49.06  ? 390 ARG A HH12   1 
ATOM   713  H  HH21   . ARG A 1 46 ? 17.875 -254.865 -13.305 1.00 46.68  ? 390 ARG A HH21   1 
ATOM   714  H  HH22   . ARG A 1 46 ? 17.530 -255.271 -11.914 1.00 46.68  ? 390 ARG A HH22   1 
ATOM   715  N  N      . LYS A 1 47 ? 14.864 -251.334 -18.597 1.00 33.96  ? 391 LYS A N      1 
ATOM   716  C  CA     . LYS A 1 47 ? 15.439 -251.886 -19.814 1.00 35.47  ? 391 LYS A CA     1 
ATOM   717  C  C      . LYS A 1 47 ? 16.311 -253.091 -19.489 1.00 30.28  ? 391 LYS A C      1 
ATOM   718  O  O      . LYS A 1 47 ? 16.872 -253.184 -18.399 1.00 31.68  ? 391 LYS A O      1 
ATOM   719  C  CB     . LYS A 1 47 ? 16.250 -250.842 -20.572 1.00 33.65  ? 391 LYS A CB     1 
ATOM   720  C  CG     . LYS A 1 47 ? 15.374 -249.699 -21.119 1.00 34.30  ? 391 LYS A CG     1 
ATOM   721  C  CD     . LYS A 1 47 ? 16.137 -248.791 -22.018 1.00 40.19  ? 391 LYS A CD     1 
ATOM   722  C  CE     . LYS A 1 47 ? 15.214 -247.804 -22.703 1.00 54.19  ? 391 LYS A CE     1 
ATOM   723  N  NZ     . LYS A 1 47 ? 16.003 -246.723 -23.360 1.00 59.15  ? 391 LYS A NZ     1 
ATOM   724  H  H      . LYS A 1 47 ? 15.423 -250.914 -18.097 1.00 40.75  ? 391 LYS A H      1 
ATOM   725  H  HA     . LYS A 1 47 ? 14.725 -252.184 -20.398 1.00 42.57  ? 391 LYS A HA     1 
ATOM   726  H  HB2    . LYS A 1 47 ? 16.909 -250.456 -19.973 1.00 40.38  ? 391 LYS A HB2    1 
ATOM   727  H  HB3    . LYS A 1 47 ? 16.692 -251.268 -21.323 1.00 40.38  ? 391 LYS A HB3    1 
ATOM   728  H  HG2    . LYS A 1 47 ? 14.638 -250.077 -21.625 1.00 41.16  ? 391 LYS A HG2    1 
ATOM   729  H  HG3    . LYS A 1 47 ? 15.035 -249.175 -20.377 1.00 41.16  ? 391 LYS A HG3    1 
ATOM   730  H  HD2    . LYS A 1 47 ? 16.785 -248.292 -21.497 1.00 48.23  ? 391 LYS A HD2    1 
ATOM   731  H  HD3    . LYS A 1 47 ? 16.584 -249.315 -22.700 1.00 48.23  ? 391 LYS A HD3    1 
ATOM   732  H  HE2    . LYS A 1 47 ? 14.696 -248.263 -23.383 1.00 65.03  ? 391 LYS A HE2    1 
ATOM   733  H  HE3    . LYS A 1 47 ? 14.627 -247.400 -22.045 1.00 65.03  ? 391 LYS A HE3    1 
ATOM   734  H  HZ1    . LYS A 1 47 ? 15.455 -246.146 -23.759 1.00 70.98  ? 391 LYS A HZ1    1 
ATOM   735  H  HZ2    . LYS A 1 47 ? 16.488 -246.289 -22.753 1.00 70.98  ? 391 LYS A HZ2    1 
ATOM   736  H  HZ3    . LYS A 1 47 ? 16.549 -247.073 -23.970 1.00 70.98  ? 391 LYS A HZ3    1 
ATOM   737  N  N      . PHE A 1 48 ? 16.425 -253.997 -20.468 1.00 26.92  ? 392 PHE A N      1 
ATOM   738  C  CA     . PHE A 1 48 ? 17.079 -255.292 -20.317 1.00 25.49  ? 392 PHE A CA     1 
ATOM   739  C  C      . PHE A 1 48 ? 17.992 -255.584 -21.500 1.00 27.00  ? 392 PHE A C      1 
ATOM   740  O  O      . PHE A 1 48 ? 17.752 -255.139 -22.631 1.00 29.95  ? 392 PHE A O      1 
ATOM   741  C  CB     . PHE A 1 48 ? 16.045 -256.396 -20.197 1.00 25.01  ? 392 PHE A CB     1 
ATOM   742  C  CG     . PHE A 1 48 ? 15.135 -256.224 -19.019 1.00 27.63  ? 392 PHE A CG     1 
ATOM   743  C  CD1    . PHE A 1 48 ? 15.477 -256.774 -17.794 1.00 27.36  ? 392 PHE A CD1    1 
ATOM   744  C  CD2    . PHE A 1 48 ? 13.985 -255.460 -19.108 1.00 28.73  ? 392 PHE A CD2    1 
ATOM   745  C  CE1    . PHE A 1 48 ? 14.649 -256.594 -16.698 1.00 24.69  ? 392 PHE A CE1    1 
ATOM   746  C  CE2    . PHE A 1 48 ? 13.149 -255.281 -18.007 1.00 28.99  ? 392 PHE A CE2    1 
ATOM   747  C  CZ     . PHE A 1 48 ? 13.486 -255.859 -16.802 1.00 27.17  ? 392 PHE A CZ     1 
ATOM   748  H  H      . PHE A 1 48 ? 16.115 -253.872 -21.261 1.00 32.31  ? 392 PHE A H      1 
ATOM   749  H  HA     . PHE A 1 48 ? 17.617 -255.289 -19.510 1.00 30.59  ? 392 PHE A HA     1 
ATOM   750  H  HB2    . PHE A 1 48 ? 15.498 -256.404 -20.998 1.00 30.01  ? 392 PHE A HB2    1 
ATOM   751  H  HB3    . PHE A 1 48 ? 16.502 -257.246 -20.100 1.00 30.01  ? 392 PHE A HB3    1 
ATOM   752  H  HD1    . PHE A 1 48 ? 16.252 -257.281 -17.712 1.00 32.83  ? 392 PHE A HD1    1 
ATOM   753  H  HD2    . PHE A 1 48 ? 13.752 -255.079 -19.924 1.00 34.47  ? 392 PHE A HD2    1 
ATOM   754  H  HE1    . PHE A 1 48 ? 14.876 -256.981 -15.883 1.00 29.62  ? 392 PHE A HE1    1 
ATOM   755  H  HE2    . PHE A 1 48 ? 12.370 -254.779 -18.086 1.00 34.78  ? 392 PHE A HE2    1 
ATOM   756  H  HZ     . PHE A 1 48 ? 12.940 -255.741 -16.058 1.00 32.60  ? 392 PHE A HZ     1 
ATOM   757  N  N      . SER A 1 49 ? 19.052 -256.345 -21.222 1.00 25.46  ? 393 SER A N      1 
ATOM   758  C  CA     . SER A 1 49 ? 20.018 -256.699 -22.250 1.00 24.20  ? 393 SER A CA     1 
ATOM   759  C  C      . SER A 1 49 ? 19.485 -257.739 -23.225 1.00 25.07  ? 393 SER A C      1 
ATOM   760  O  O      . SER A 1 49 ? 19.994 -257.800 -24.355 1.00 28.88  ? 393 SER A O      1 
ATOM   761  C  CB     . SER A 1 49 ? 21.300 -257.232 -21.616 1.00 26.09  ? 393 SER A CB     1 
ATOM   762  O  OG     . SER A 1 49 ? 20.988 -258.440 -20.899 1.00 25.85  ? 393 SER A OG     1 
ATOM   763  H  H      . SER A 1 49 ? 19.230 -256.667 -20.445 1.00 30.55  ? 393 SER A H      1 
ATOM   764  H  HA     . SER A 1 49 ? 20.244 -255.904 -22.757 1.00 29.03  ? 393 SER A HA     1 
ATOM   765  H  HB2    . SER A 1 49 ? 21.947 -257.427 -22.311 1.00 31.30  ? 393 SER A HB2    1 
ATOM   766  H  HB3    . SER A 1 49 ? 21.654 -256.572 -20.999 1.00 31.30  ? 393 SER A HB3    1 
ATOM   767  H  HG     . SER A 1 49 ? 21.682 -258.750 -20.542 1.00 31.02  ? 393 SER A HG     1 
ATOM   768  N  N      . ARG A 1 50 ? 18.476 -258.529 -22.832 1.00 23.90  ? 394 ARG A N      1 
ATOM   769  C  CA     . ARG A 1 50 ? 18.052 -259.707 -23.579 1.00 23.94  ? 394 ARG A CA     1 
ATOM   770  C  C      . ARG A 1 50 ? 16.542 -259.811 -23.627 1.00 27.56  ? 394 ARG A C      1 
ATOM   771  O  O      . ARG A 1 50 ? 15.856 -259.544 -22.633 1.00 25.30  ? 394 ARG A O      1 
ATOM   772  C  CB     . ARG A 1 50 ? 18.628 -260.997 -22.977 1.00 26.96  ? 394 ARG A CB     1 
ATOM   773  C  CG     . ARG A 1 50 ? 20.095 -261.084 -23.148 1.00 23.40  ? 394 ARG A CG     1 
ATOM   774  C  CD     . ARG A 1 50 ? 20.722 -262.233 -22.390 1.00 22.74  ? 394 ARG A CD     1 
ATOM   775  N  NE     . ARG A 1 50 ? 19.948 -263.461 -22.437 1.00 25.25  ? 394 ARG A NE     1 
ATOM   776  C  CZ     . ARG A 1 50 ? 20.470 -264.659 -22.240 1.00 24.62  ? 394 ARG A CZ     1 
ATOM   777  N  NH1    . ARG A 1 50 ? 21.787 -264.801 -22.072 1.00 26.33  ? 394 ARG A NH1    1 
ATOM   778  N  NH2    . ARG A 1 50 ? 19.672 -265.708 -22.243 1.00 24.65  ? 394 ARG A NH2    1 
ATOM   779  H  H      . ARG A 1 50 ? 18.015 -258.394 -22.118 1.00 28.68  ? 394 ARG A H      1 
ATOM   780  H  HA     . ARG A 1 50 ? 18.374 -259.635 -24.491 1.00 28.72  ? 394 ARG A HA     1 
ATOM   781  H  HB2    . ARG A 1 50 ? 18.430 -261.024 -22.028 1.00 32.35  ? 394 ARG A HB2    1 
ATOM   782  H  HB3    . ARG A 1 50 ? 18.228 -261.757 -23.425 1.00 32.35  ? 394 ARG A HB3    1 
ATOM   783  H  HG2    . ARG A 1 50 ? 20.295 -261.204 -24.090 1.00 28.08  ? 394 ARG A HG2    1 
ATOM   784  H  HG3    . ARG A 1 50 ? 20.499 -260.263 -22.827 1.00 28.08  ? 394 ARG A HG3    1 
ATOM   785  H  HD2    . ARG A 1 50 ? 21.593 -262.407 -22.778 1.00 27.28  ? 394 ARG A HD2    1 
ATOM   786  H  HD3    . ARG A 1 50 ? 20.820 -261.978 -21.459 1.00 27.28  ? 394 ARG A HD3    1 
ATOM   787  H  HE     . ARG A 1 50 ? 19.092 -263.395 -22.402 1.00 30.30  ? 394 ARG A HE     1 
ATOM   788  H  HH11   . ARG A 1 50 ? 22.303 -264.115 -22.055 1.00 31.59  ? 394 ARG A HH11   1 
ATOM   789  H  HH12   . ARG A 1 50 ? 22.119 -265.586 -21.957 1.00 31.59  ? 394 ARG A HH12   1 
ATOM   790  H  HH21   . ARG A 1 50 ? 18.828 -265.606 -22.372 1.00 29.58  ? 394 ARG A HH21   1 
ATOM   791  H  HH22   . ARG A 1 50 ? 20.000 -266.498 -22.150 1.00 29.58  ? 394 ARG A HH22   1 
ATOM   792  N  N      . SER A 1 51 ? 16.026 -260.233 -24.786 1.00 28.59  ? 395 SER A N      1 
ATOM   793  C  CA     . SER A 1 51 ? 14.581 -260.239 -24.987 1.00 24.39  ? 395 SER A CA     1 
ATOM   794  C  C      . SER A 1 51 ? 13.918 -261.355 -24.188 1.00 25.16  ? 395 SER A C      1 
ATOM   795  O  O      . SER A 1 51 ? 12.758 -261.212 -23.767 1.00 25.19  ? 395 SER A O      1 
ATOM   796  C  CB     . SER A 1 51 ? 14.249 -260.359 -26.493 1.00 27.45  ? 395 SER A CB     1 
ATOM   797  O  OG     . SER A 1 51 ? 14.749 -261.589 -26.998 1.00 41.94  ? 395 SER A OG     1 
ATOM   798  H  H      . SER A 1 51 ? 16.484 -260.515 -25.457 1.00 34.31  ? 395 SER A H      1 
ATOM   799  H  HA     . SER A 1 51 ? 14.220 -259.396 -24.672 1.00 29.26  ? 395 SER A HA     1 
ATOM   800  H  HB2    . SER A 1 51 ? 13.287 -260.333 -26.611 1.00 32.95  ? 395 SER A HB2    1 
ATOM   801  H  HB3    . SER A 1 51 ? 14.665 -259.625 -26.971 1.00 32.95  ? 395 SER A HB3    1 
ATOM   802  H  HG     . SER A 1 51 ? 14.570 -261.658 -27.816 1.00 50.33  ? 395 SER A HG     1 
ATOM   803  N  N      . ASP A 1 52 ? 14.607 -262.474 -23.993 1.00 25.18  ? 396 ASP A N      1 
ATOM   804  C  CA     . ASP A 1 52 ? 14.001 -263.546 -23.211 1.00 27.47  ? 396 ASP A CA     1 
ATOM   805  C  C      . ASP A 1 52 ? 13.863 -263.143 -21.746 1.00 24.47  ? 396 ASP A C      1 
ATOM   806  O  O      . ASP A 1 52 ? 12.890 -263.522 -21.087 1.00 22.42  ? 396 ASP A O      1 
ATOM   807  C  CB     . ASP A 1 52 ? 14.777 -264.865 -23.331 1.00 24.70  ? 396 ASP A CB     1 
ATOM   808  C  CG     . ASP A 1 52 ? 16.263 -264.747 -23.008 1.00 29.09  ? 396 ASP A CG     1 
ATOM   809  O  OD1    . ASP A 1 52 ? 16.889 -263.707 -23.281 1.00 32.70  ? 396 ASP A OD1    1 
ATOM   810  O  OD2    . ASP A 1 52 ? 16.820 -265.749 -22.521 1.00 30.32  ? 396 ASP A OD2    1 
ATOM   811  H  H      . ASP A 1 52 ? 15.398 -262.635 -24.290 1.00 30.22  ? 396 ASP A H      1 
ATOM   812  H  HA     . ASP A 1 52 ? 13.107 -263.705 -23.553 1.00 32.96  ? 396 ASP A HA     1 
ATOM   813  H  HB2    . ASP A 1 52 ? 14.392 -265.510 -22.717 1.00 29.64  ? 396 ASP A HB2    1 
ATOM   814  H  HB3    . ASP A 1 52 ? 14.698 -265.191 -24.241 1.00 29.64  ? 396 ASP A HB3    1 
ATOM   815  N  N      . HIS A 1 53 ? 14.826 -262.391 -21.228 1.00 21.77  ? 397 HIS A N      1 
ATOM   816  C  CA     . HIS A 1 53 ? 14.765 -261.954 -19.830 1.00 17.32  ? 397 HIS A CA     1 
ATOM   817  C  C      . HIS A 1 53 ? 13.759 -260.829 -19.650 1.00 24.53  ? 397 HIS A C      1 
ATOM   818  O  O      . HIS A 1 53 ? 13.162 -260.697 -18.576 1.00 22.40  ? 397 HIS A O      1 
ATOM   819  C  CB     . HIS A 1 53 ? 16.129 -261.486 -19.365 1.00 21.93  ? 397 HIS A CB     1 
ATOM   820  C  CG     . HIS A 1 53 ? 17.159 -262.561 -19.324 1.00 21.38  ? 397 HIS A CG     1 
ATOM   821  N  ND1    . HIS A 1 53 ? 16.827 -263.898 -19.225 1.00 22.58  ? 397 HIS A ND1    1 
ATOM   822  C  CD2    . HIS A 1 53 ? 18.512 -262.504 -19.335 1.00 25.57  ? 397 HIS A CD2    1 
ATOM   823  C  CE1    . HIS A 1 53 ? 17.937 -264.612 -19.176 1.00 24.16  ? 397 HIS A CE1    1 
ATOM   824  N  NE2    . HIS A 1 53 ? 18.972 -263.795 -19.250 1.00 21.35  ? 397 HIS A NE2    1 
ATOM   825  H  H      . HIS A 1 53 ? 15.521 -262.120 -21.656 1.00 26.13  ? 397 HIS A H      1 
ATOM   826  H  HA     . HIS A 1 53 ? 14.491 -262.699 -19.272 1.00 20.79  ? 397 HIS A HA     1 
ATOM   827  H  HB2    . HIS A 1 53 ? 16.445 -260.797 -19.970 1.00 26.32  ? 397 HIS A HB2    1 
ATOM   828  H  HB3    . HIS A 1 53 ? 16.045 -261.122 -18.470 1.00 26.32  ? 397 HIS A HB3    1 
ATOM   829  H  HD2    . HIS A 1 53 ? 19.032 -261.735 -19.392 1.00 30.68  ? 397 HIS A HD2    1 
ATOM   830  H  HE1    . HIS A 1 53 ? 17.982 -265.539 -19.119 1.00 28.99  ? 397 HIS A HE1    1 
ATOM   831  H  HE2    . HIS A 1 53 ? 19.799 -264.032 -19.244 1.00 25.62  ? 397 HIS A HE2    1 
ATOM   832  N  N      . LEU A 1 54 ? 13.560 -259.991 -20.668 1.00 23.83  ? 398 LEU A N      1 
ATOM   833  C  CA     . LEU A 1 54 ? 12.416 -259.087 -20.595 1.00 26.99  ? 398 LEU A CA     1 
ATOM   834  C  C      . LEU A 1 54 ? 11.122 -259.890 -20.479 1.00 26.85  ? 398 LEU A C      1 
ATOM   835  O  O      . LEU A 1 54 ? 10.224 -259.545 -19.700 1.00 29.23  ? 398 LEU A O      1 
ATOM   836  C  CB     . LEU A 1 54 ? 12.371 -258.155 -21.824 1.00 24.11  ? 398 LEU A CB     1 
ATOM   837  C  CG     . LEU A 1 54 ? 11.056 -257.386 -21.971 1.00 29.51  ? 398 LEU A CG     1 
ATOM   838  C  CD1    . LEU A 1 54 ? 10.839 -256.448 -20.800 1.00 40.55  ? 398 LEU A CD1    1 
ATOM   839  C  CD2    . LEU A 1 54 ? 11.063 -256.623 -23.298 1.00 32.34  ? 398 LEU A CD2    1 
ATOM   840  H  H      . LEU A 1 54 ? 14.045 -259.927 -21.376 1.00 28.59  ? 398 LEU A H      1 
ATOM   841  H  HA     . LEU A 1 54 ? 12.500 -258.535 -19.802 1.00 32.39  ? 398 LEU A HA     1 
ATOM   842  H  HB2    . LEU A 1 54 ? 13.087 -257.505 -21.749 1.00 28.93  ? 398 LEU A HB2    1 
ATOM   843  H  HB3    . LEU A 1 54 ? 12.493 -258.688 -22.625 1.00 28.93  ? 398 LEU A HB3    1 
ATOM   844  H  HG     . LEU A 1 54 ? 10.312 -258.007 -22.001 1.00 35.41  ? 398 LEU A HG     1 
ATOM   845  H  HD11   . LEU A 1 54 ? 9.991  -255.995 -20.918 1.00 48.66  ? 398 LEU A HD11   1 
ATOM   846  H  HD12   . LEU A 1 54 ? 10.826 -256.962 -19.978 1.00 48.66  ? 398 LEU A HD12   1 
ATOM   847  H  HD13   . LEU A 1 54 ? 11.561 -255.801 -20.775 1.00 48.66  ? 398 LEU A HD13   1 
ATOM   848  H  HD21   . LEU A 1 54 ? 10.196 -256.208 -23.427 1.00 38.81  ? 398 LEU A HD21   1 
ATOM   849  H  HD22   . LEU A 1 54 ? 11.754 -255.943 -23.267 1.00 38.81  ? 398 LEU A HD22   1 
ATOM   850  H  HD23   . LEU A 1 54 ? 11.242 -257.246 -24.020 1.00 38.81  ? 398 LEU A HD23   1 
ATOM   851  N  N      . LYS A 1 55 ? 11.002 -260.965 -21.253 1.00 24.70  ? 399 LYS A N      1 
ATOM   852  C  CA     . LYS A 1 55 ? 9.751  -261.717 -21.257 1.00 26.01  ? 399 LYS A CA     1 
ATOM   853  C  C      . LYS A 1 55 ? 9.449  -262.293 -19.869 1.00 23.50  ? 399 LYS A C      1 
ATOM   854  O  O      . LYS A 1 55 ? 8.327  -262.179 -19.367 1.00 25.42  ? 399 LYS A O      1 
ATOM   855  C  CB     . LYS A 1 55 ? 9.831  -262.823 -22.305 1.00 23.46  ? 399 LYS A CB     1 
ATOM   856  C  CG     . LYS A 1 55 ? 8.579  -263.641 -22.430 1.00 26.41  ? 399 LYS A CG     1 
ATOM   857  C  CD     . LYS A 1 55 ? 8.731  -264.715 -23.512 1.00 38.42  ? 399 LYS A CD     1 
ATOM   858  C  CE     . LYS A 1 55 ? 7.381  -265.182 -24.105 1.00 46.84  ? 399 LYS A CE     1 
ATOM   859  N  NZ     . LYS A 1 55 ? 6.726  -266.269 -23.336 1.00 75.42  ? 399 LYS A NZ     1 
ATOM   860  H  H      . LYS A 1 55 ? 11.613 -261.274 -21.773 1.00 29.64  ? 399 LYS A H      1 
ATOM   861  H  HA     . LYS A 1 55 ? 9.024  -261.123 -21.501 1.00 31.21  ? 399 LYS A HA     1 
ATOM   862  H  HB2    . LYS A 1 55 ? 10.009 -262.420 -23.169 1.00 28.15  ? 399 LYS A HB2    1 
ATOM   863  H  HB3    . LYS A 1 55 ? 10.554 -263.424 -22.069 1.00 28.15  ? 399 LYS A HB3    1 
ATOM   864  H  HG2    . LYS A 1 55 ? 8.396  -264.085 -21.587 1.00 31.70  ? 399 LYS A HG2    1 
ATOM   865  H  HG3    . LYS A 1 55 ? 7.840  -263.061 -22.674 1.00 31.70  ? 399 LYS A HG3    1 
ATOM   866  H  HD2    . LYS A 1 55 ? 9.267  -264.357 -24.237 1.00 46.11  ? 399 LYS A HD2    1 
ATOM   867  H  HD3    . LYS A 1 55 ? 9.171  -265.489 -23.127 1.00 46.11  ? 399 LYS A HD3    1 
ATOM   868  H  HE2    . LYS A 1 55 ? 6.771  -264.428 -24.129 1.00 56.20  ? 399 LYS A HE2    1 
ATOM   869  H  HE3    . LYS A 1 55 ? 7.533  -265.509 -25.006 1.00 56.20  ? 399 LYS A HE3    1 
ATOM   870  H  HZ1    . LYS A 1 55 ? 7.256  -266.983 -23.308 1.00 90.50  ? 399 LYS A HZ1    1 
ATOM   871  H  HZ2    . LYS A 1 55 ? 6.562  -265.997 -22.505 1.00 90.50  ? 399 LYS A HZ2    1 
ATOM   872  H  HZ3    . LYS A 1 55 ? 5.957  -266.495 -23.723 1.00 90.50  ? 399 LYS A HZ3    1 
ATOM   873  N  N      . THR A 1 56 ? 10.437 -262.903 -19.229 1.00 22.87  ? 400 THR A N      1 
ATOM   874  C  CA     . THR A 1 56 ? 10.168 -263.472 -17.906 1.00 23.13  ? 400 THR A CA     1 
ATOM   875  C  C      . THR A 1 56 ? 10.038 -262.383 -16.847 1.00 27.62  ? 400 THR A C      1 
ATOM   876  O  O      . THR A 1 56 ? 9.240  -262.528 -15.909 1.00 24.17  ? 400 THR A O      1 
ATOM   877  C  CB     . THR A 1 56 ? 11.239 -264.492 -17.528 1.00 24.07  ? 400 THR A CB     1 
ATOM   878  O  OG1    . THR A 1 56 ? 12.538 -263.898 -17.521 1.00 22.34  ? 400 THR A OG1    1 
ATOM   879  C  CG2    . THR A 1 56 ? 11.248 -265.675 -18.554 1.00 23.78  ? 400 THR A CG2    1 
ATOM   880  H  H      . THR A 1 56 ? 11.241 -263.001 -19.519 1.00 27.44  ? 400 THR A H      1 
ATOM   881  H  HA     . THR A 1 56 ? 9.321  -263.943 -17.942 1.00 27.76  ? 400 THR A HA     1 
ATOM   882  H  HB     . THR A 1 56 ? 11.045 -264.852 -16.648 1.00 28.89  ? 400 THR A HB     1 
ATOM   883  H  HG1    . THR A 1 56 ? 12.565 -263.272 -16.962 1.00 26.81  ? 400 THR A HG1    1 
ATOM   884  H  HG21   . THR A 1 56 ? 11.914 -266.332 -18.296 1.00 28.53  ? 400 THR A HG21   1 
ATOM   885  H  HG22   . THR A 1 56 ? 10.377 -266.101 -18.576 1.00 28.53  ? 400 THR A HG22   1 
ATOM   886  H  HG23   . THR A 1 56 ? 11.459 -265.343 -19.441 1.00 28.53  ? 400 THR A HG23   1 
ATOM   887  N  N      . HIS A 1 57 ? 10.778 -261.277 -16.987 1.00 20.81  ? 401 HIS A N      1 
ATOM   888  C  CA     . HIS A 1 57 ? 10.546 -260.132 -16.112 1.00 24.67  ? 401 HIS A CA     1 
ATOM   889  C  C      . HIS A 1 57 ? 9.091  -259.699 -16.110 1.00 27.59  ? 401 HIS A C      1 
ATOM   890  O  O      . HIS A 1 57 ? 8.538  -259.359 -15.057 1.00 30.58  ? 401 HIS A O      1 
ATOM   891  C  CB     . HIS A 1 57 ? 11.389 -258.935 -16.527 1.00 27.10  ? 401 HIS A CB     1 
ATOM   892  C  CG     . HIS A 1 57 ? 10.898 -257.655 -15.930 1.00 35.10  ? 401 HIS A CG     1 
ATOM   893  N  ND1    . HIS A 1 57 ? 11.183 -257.298 -14.634 1.00 27.77  ? 401 HIS A ND1    1 
ATOM   894  C  CD2    . HIS A 1 57 ? 10.108 -256.669 -16.431 1.00 29.93  ? 401 HIS A CD2    1 
ATOM   895  C  CE1    . HIS A 1 57 ? 10.622 -256.123 -14.377 1.00 29.08  ? 401 HIS A CE1    1 
ATOM   896  N  NE2    . HIS A 1 57 ? 9.951  -255.732 -15.444 1.00 31.41  ? 401 HIS A NE2    1 
ATOM   897  H  H      . HIS A 1 57 ? 11.404 -261.169 -17.567 1.00 24.97  ? 401 HIS A H      1 
ATOM   898  H  HA     . HIS A 1 57 ? 10.790 -260.372 -15.205 1.00 29.61  ? 401 HIS A HA     1 
ATOM   899  H  HB2    . HIS A 1 57 ? 12.303 -259.073 -16.232 1.00 32.52  ? 401 HIS A HB2    1 
ATOM   900  H  HB3    . HIS A 1 57 ? 11.361 -258.847 -17.493 1.00 32.52  ? 401 HIS A HB3    1 
ATOM   901  H  HD1    . HIS A 1 57 ? 11.673 -257.748 -14.088 1.00 33.33  ? 401 HIS A HD1    1 
ATOM   902  H  HD2    . HIS A 1 57 ? 9.748  -256.633 -17.288 1.00 35.91  ? 401 HIS A HD2    1 
ATOM   903  H  HE1    . HIS A 1 57 ? 10.668 -255.666 -13.568 1.00 34.89  ? 401 HIS A HE1    1 
ATOM   904  N  N      . THR A 1 58 ? 8.470  -259.636 -17.290 1.00 26.59  ? 402 THR A N      1 
ATOM   905  C  CA     . THR A 1 58 ? 7.110  -259.128 -17.386 1.00 40.14  ? 402 THR A CA     1 
ATOM   906  C  C      . THR A 1 58 ? 6.138  -259.934 -16.523 1.00 40.19  ? 402 THR A C      1 
ATOM   907  O  O      . THR A 1 58 ? 5.120  -259.397 -16.074 1.00 35.35  ? 402 THR A O      1 
ATOM   908  C  CB     . THR A 1 58 ? 6.685  -259.120 -18.852 1.00 34.30  ? 402 THR A CB     1 
ATOM   909  O  OG1    . THR A 1 58 ? 7.585  -258.282 -19.594 1.00 36.50  ? 402 THR A OG1    1 
ATOM   910  C  CG2    . THR A 1 58 ? 5.284  -258.588 -19.001 1.00 45.07  ? 402 THR A CG2    1 
ATOM   911  H  H      . THR A 1 58 ? 8.814  -259.880 -18.040 1.00 31.91  ? 402 THR A H      1 
ATOM   912  H  HA     . THR A 1 58 ? 7.096  -258.211 -17.069 1.00 48.17  ? 402 THR A HA     1 
ATOM   913  H  HB     . THR A 1 58 ? 6.714  -260.023 -19.205 1.00 41.16  ? 402 THR A HB     1 
ATOM   914  H  HG1    . THR A 1 58 ? 8.367  -258.586 -19.546 1.00 43.80  ? 402 THR A HG1    1 
ATOM   915  H  HG21   . THR A 1 58 ? 5.099  -258.404 -19.935 1.00 54.09  ? 402 THR A HG21   1 
ATOM   916  H  HG22   . THR A 1 58 ? 4.643  -259.239 -18.677 1.00 54.09  ? 402 THR A HG22   1 
ATOM   917  H  HG23   . THR A 1 58 ? 5.186  -257.767 -18.494 1.00 54.09  ? 402 THR A HG23   1 
ATOM   918  N  N      . ARG A 1 59 ? 6.444  -261.202 -16.245 1.00 35.40  ? 403 ARG A N      1 
ATOM   919  C  CA     . ARG A 1 59 ? 5.581  -261.992 -15.367 1.00 30.58  ? 403 ARG A CA     1 
ATOM   920  C  C      . ARG A 1 59 ? 5.607  -261.518 -13.921 1.00 43.47  ? 403 ARG A C      1 
ATOM   921  O  O      . ARG A 1 59 ? 4.700  -261.850 -13.148 1.00 38.69  ? 403 ARG A O      1 
ATOM   922  C  CB     . ARG A 1 59 ? 5.983  -263.473 -15.428 1.00 37.90  ? 403 ARG A CB     1 
ATOM   923  C  CG     . ARG A 1 59 ? 5.940  -264.047 -16.828 1.00 34.05  ? 403 ARG A CG     1 
ATOM   924  C  CD     . ARG A 1 59 ? 5.999  -265.585 -16.827 1.00 46.74  ? 403 ARG A CD     1 
ATOM   925  N  NE     . ARG A 1 59 ? 5.978  -266.148 -18.184 1.00 43.24  ? 403 ARG A NE     1 
ATOM   926  C  CZ     . ARG A 1 59 ? 6.838  -267.045 -18.665 1.00 64.86  ? 403 ARG A CZ     1 
ATOM   927  N  NH1    . ARG A 1 59 ? 7.811  -267.545 -17.909 1.00 38.19  ? 403 ARG A NH1    1 
ATOM   928  N  NH2    . ARG A 1 59 ? 6.716  -267.467 -19.919 1.00 87.37  ? 403 ARG A NH2    1 
ATOM   929  H  H      . ARG A 1 59 ? 7.132  -261.621 -16.546 1.00 42.48  ? 403 ARG A H      1 
ATOM   930  H  HA     . ARG A 1 59 ? 4.669  -261.921 -15.687 1.00 36.70  ? 403 ARG A HA     1 
ATOM   931  H  HB2    . ARG A 1 59 ? 6.889  -263.567 -15.095 1.00 45.48  ? 403 ARG A HB2    1 
ATOM   932  H  HB3    . ARG A 1 59 ? 5.373  -263.987 -14.876 1.00 45.48  ? 403 ARG A HB3    1 
ATOM   933  H  HG2    . ARG A 1 59 ? 5.113  -263.777 -17.257 1.00 40.86  ? 403 ARG A HG2    1 
ATOM   934  H  HG3    . ARG A 1 59 ? 6.701  -263.716 -17.331 1.00 40.86  ? 403 ARG A HG3    1 
ATOM   935  H  HD2    . ARG A 1 59 ? 6.818  -265.855 -16.387 1.00 56.09  ? 403 ARG A HD2    1 
ATOM   936  H  HD3    . ARG A 1 59 ? 5.239  -265.934 -16.341 1.00 56.09  ? 403 ARG A HD3    1 
ATOM   937  H  HE     . ARG A 1 59 ? 5.357  -265.875 -18.713 1.00 51.88  ? 403 ARG A HE     1 
ATOM   938  H  HH11   . ARG A 1 59 ? 7.911  -267.287 -17.096 1.00 45.82  ? 403 ARG A HH11   1 
ATOM   939  H  HH12   . ARG A 1 59 ? 8.351  -268.127 -18.240 1.00 45.82  ? 403 ARG A HH12   1 
ATOM   940  H  HH21   . ARG A 1 59 ? 6.088  -267.157 -20.418 1.00 104.84 ? 403 ARG A HH21   1 
ATOM   941  H  HH22   . ARG A 1 59 ? 7.263  -268.053 -20.231 1.00 104.84 ? 403 ARG A HH22   1 
ATOM   942  N  N      . THR A 1 60 ? 6.626  -260.770 -13.520 1.00 40.79  ? 404 THR A N      1 
ATOM   943  C  CA     . THR A 1 60 ? 6.614  -260.219 -12.176 1.00 38.46  ? 404 THR A CA     1 
ATOM   944  C  C      . THR A 1 60 ? 5.466  -259.238 -11.984 1.00 39.80  ? 404 THR A C      1 
ATOM   945  O  O      . THR A 1 60 ? 5.033  -259.020 -10.846 1.00 42.74  ? 404 THR A O      1 
ATOM   946  C  CB     . THR A 1 60 ? 7.955  -259.555 -11.863 1.00 42.82  ? 404 THR A CB     1 
ATOM   947  O  OG1    . THR A 1 60 ? 8.089  -258.310 -12.570 1.00 39.91  ? 404 THR A OG1    1 
ATOM   948  C  CG2    . THR A 1 60 ? 9.103  -260.500 -12.236 1.00 43.02  ? 404 THR A CG2    1 
ATOM   949  H  H      . THR A 1 60 ? 7.311  -260.567 -13.997 1.00 48.95  ? 404 THR A H      1 
ATOM   950  H  HA     . THR A 1 60 ? 6.490  -260.944 -11.544 1.00 46.15  ? 404 THR A HA     1 
ATOM   951  H  HB     . THR A 1 60 ? 8.007  -259.383 -10.910 1.00 51.39  ? 404 THR A HB     1 
ATOM   952  H  HG1    . THR A 1 60 ? 8.829  -257.956 -12.390 1.00 47.90  ? 404 THR A HG1    1 
ATOM   953  H  HG21   . THR A 1 60 ? 9.941  -260.150 -11.894 1.00 51.62  ? 404 THR A HG21   1 
ATOM   954  H  HG22   . THR A 1 60 ? 8.948  -261.375 -11.848 1.00 51.62  ? 404 THR A HG22   1 
ATOM   955  H  HG23   . THR A 1 60 ? 9.173  -260.593 -13.197 1.00 51.62  ? 404 THR A HG23   1 
ATOM   956  N  N      . HIS A 1 61 ? 4.942  -258.672 -13.078 1.00 36.60  ? 405 HIS A N      1 
ATOM   957  C  CA     . HIS A 1 61 ? 3.823  -257.740 -13.035 1.00 37.42  ? 405 HIS A CA     1 
ATOM   958  C  C      . HIS A 1 61 ? 2.485  -258.443 -13.196 1.00 41.62  ? 405 HIS A C      1 
ATOM   959  O  O      . HIS A 1 61 ? 1.499  -258.020 -12.594 1.00 40.04  ? 405 HIS A O      1 
ATOM   960  C  CB     . HIS A 1 61 ? 3.948  -256.695 -14.138 1.00 35.46  ? 405 HIS A CB     1 
ATOM   961  C  CG     . HIS A 1 61 ? 5.208  -255.889 -14.081 1.00 39.78  ? 405 HIS A CG     1 
ATOM   962  N  ND1    . HIS A 1 61 ? 5.553  -255.119 -12.992 1.00 42.93  ? 405 HIS A ND1    1 
ATOM   963  C  CD2    . HIS A 1 61 ? 6.182  -255.697 -14.999 1.00 41.89  ? 405 HIS A CD2    1 
ATOM   964  C  CE1    . HIS A 1 61 ? 6.703  -254.513 -13.230 1.00 51.51  ? 405 HIS A CE1    1 
ATOM   965  N  NE2    . HIS A 1 61 ? 7.103  -254.841 -14.444 1.00 35.07  ? 405 HIS A NE2    1 
ATOM   966  H  H      . HIS A 1 61 ? 5.230  -258.819 -13.875 1.00 43.92  ? 405 HIS A H      1 
ATOM   967  H  HA     . HIS A 1 61 ? 3.823  -257.280 -12.181 1.00 44.90  ? 405 HIS A HA     1 
ATOM   968  H  HB2    . HIS A 1 61 ? 3.924  -257.145 -14.997 1.00 42.55  ? 405 HIS A HB2    1 
ATOM   969  H  HB3    . HIS A 1 61 ? 3.201  -256.080 -14.070 1.00 42.55  ? 405 HIS A HB3    1 
ATOM   970  H  HD1    . HIS A 1 61 ? 5.101  -255.058 -12.263 1.00 51.51  ? 405 HIS A HD1    1 
ATOM   971  H  HD2    . HIS A 1 61 ? 6.227  -256.083 -15.844 1.00 50.26  ? 405 HIS A HD2    1 
ATOM   972  H  HE1    . HIS A 1 61 ? 7.148  -253.942 -12.646 1.00 61.81  ? 405 HIS A HE1    1 
ATOM   973  N  N      . THR A 1 62 ? 2.418  -259.499 -14.010 1.00 37.02  ? 406 THR A N      1 
ATOM   974  C  CA     . THR A 1 62 ? 1.137  -260.112 -14.337 1.00 34.11  ? 406 THR A CA     1 
ATOM   975  C  C      . THR A 1 62 ? 0.722  -261.187 -13.352 1.00 40.26  ? 406 THR A C      1 
ATOM   976  O  O      . THR A 1 62 ? -0.441 -261.600 -13.368 1.00 43.52  ? 406 THR A O      1 
ATOM   977  C  CB     . THR A 1 62 ? 1.184  -260.756 -15.723 1.00 45.66  ? 406 THR A CB     1 
ATOM   978  O  OG1    . THR A 1 62 ? 2.099  -261.857 -15.698 1.00 40.85  ? 406 THR A OG1    1 
ATOM   979  C  CG2    . THR A 1 62 ? 1.638  -259.757 -16.779 1.00 42.97  ? 406 THR A CG2    1 
ATOM   980  H  H      . THR A 1 62 ? 3.097  -259.874 -14.382 1.00 44.43  ? 406 THR A H      1 
ATOM   981  H  HA     . THR A 1 62 ? 0.449  -259.428 -14.345 1.00 40.94  ? 406 THR A HA     1 
ATOM   982  H  HB     . THR A 1 62 ? 0.300  -261.076 -15.962 1.00 54.79  ? 406 THR A HB     1 
ATOM   983  H  HG1    . THR A 1 62 ? 2.737  -261.685 -15.181 1.00 49.02  ? 406 THR A HG1    1 
ATOM   984  H  HG21   . THR A 1 62 ? 1.583  -260.159 -17.660 1.00 51.56  ? 406 THR A HG21   1 
ATOM   985  H  HG22   . THR A 1 62 ? 1.071  -258.970 -16.755 1.00 51.56  ? 406 THR A HG22   1 
ATOM   986  H  HG23   . THR A 1 62 ? 2.555  -259.490 -16.612 1.00 51.56  ? 406 THR A HG23   1 
ATOM   987  N  N      . GLY A 1 63 ? 1.653  -261.679 -12.538 1.00 46.97  ? 407 GLY A N      1 
ATOM   988  C  CA     . GLY A 1 63 ? 1.382  -262.782 -11.648 1.00 43.29  ? 407 GLY A CA     1 
ATOM   989  C  C      . GLY A 1 63 ? 1.292  -264.138 -12.302 1.00 47.00  ? 407 GLY A C      1 
ATOM   990  O  O      . GLY A 1 63 ? 1.086  -265.129 -11.589 1.00 52.42  ? 407 GLY A O      1 
ATOM   991  H  H      . GLY A 1 63 ? 2.458  -261.382 -12.488 1.00 56.37  ? 407 GLY A H      1 
ATOM   992  H  HA2    . GLY A 1 63 ? 2.082  -262.822 -10.978 1.00 51.94  ? 407 GLY A HA2    1 
ATOM   993  H  HA3    . GLY A 1 63 ? 0.542  -262.616 -11.192 1.00 51.94  ? 407 GLY A HA3    1 
ATOM   994  N  N      . GLU A 1 64 ? 1.454  -264.243 -13.622 1.00 43.44  ? 408 GLU A N      1 
ATOM   995  C  CA     . GLU A 1 64 ? 1.288  -265.544 -14.249 1.00 44.87  ? 408 GLU A CA     1 
ATOM   996  C  C      . GLU A 1 64 ? 2.383  -266.499 -13.765 1.00 40.31  ? 408 GLU A C      1 
ATOM   997  O  O      . GLU A 1 64 ? 3.574  -266.163 -13.749 1.00 37.35  ? 408 GLU A O      1 
ATOM   998  C  CB     . GLU A 1 64 ? 1.262  -265.424 -15.776 1.00 45.06  ? 408 GLU A CB     1 
ATOM   999  C  CG     . GLU A 1 64 ? 2.585  -265.402 -16.548 1.00 83.80  ? 408 GLU A CG     1 
ATOM   1000 C  CD     . GLU A 1 64 ? 2.378  -265.539 -18.079 1.00 94.56  ? 408 GLU A CD     1 
ATOM   1001 O  OE1    . GLU A 1 64 ? 1.985  -266.636 -18.538 1.00 71.65  ? 408 GLU A OE1    1 
ATOM   1002 O  OE2    . GLU A 1 64 ? 2.594  -264.555 -18.825 1.00 59.01  ? 408 GLU A OE2    1 
ATOM   1003 H  H      . GLU A 1 64 ? 1.653  -263.599 -14.156 1.00 52.13  ? 408 GLU A H      1 
ATOM   1004 H  HA     . GLU A 1 64 ? 0.435  -265.913 -13.971 1.00 53.85  ? 408 GLU A HA     1 
ATOM   1005 H  HB2    . GLU A 1 64 ? 0.752  -266.174 -16.121 1.00 54.08  ? 408 GLU A HB2    1 
ATOM   1006 H  HB3    . GLU A 1 64 ? 0.798  -264.602 -15.998 1.00 54.08  ? 408 GLU A HB3    1 
ATOM   1007 H  HG2    . GLU A 1 64 ? 3.045  -264.566 -16.375 1.00 100.56 ? 408 GLU A HG2    1 
ATOM   1008 H  HG3    . GLU A 1 64 ? 3.127  -266.151 -16.260 1.00 100.56 ? 408 GLU A HG3    1 
ATOM   1009 N  N      . LYS A 1 65 ? 1.968  -267.680 -13.333 1.00 38.74  ? 409 LYS A N      1 
ATOM   1010 C  CA     . LYS A 1 65 ? 2.888  -268.709 -12.838 1.00 30.52  ? 409 LYS A CA     1 
ATOM   1011 C  C      . LYS A 1 65 ? 2.594  -269.993 -13.602 1.00 38.35  ? 409 LYS A C      1 
ATOM   1012 O  O      . LYS A 1 65 ? 1.876  -270.875 -13.113 1.00 40.83  ? 409 LYS A O      1 
ATOM   1013 C  CB     . LYS A 1 65 ? 2.756  -268.889 -11.326 1.00 35.55  ? 409 LYS A CB     1 
ATOM   1014 C  CG     . LYS A 1 65 ? 3.143  -267.653 -10.541 1.00 36.54  ? 409 LYS A CG     1 
ATOM   1015 C  CD     . LYS A 1 65 ? 3.065  -267.880 -9.041  1.00 37.96  ? 409 LYS A CD     1 
ATOM   1016 C  CE     . LYS A 1 65 ? 3.351  -266.595 -8.285  1.00 52.13  ? 409 LYS A CE     1 
ATOM   1017 N  NZ     . LYS A 1 65 ? 3.646  -266.863 -6.856  1.00 48.88  ? 409 LYS A NZ     1 
ATOM   1018 H  H      . LYS A 1 65 ? 1.142  -267.920 -13.314 1.00 46.49  ? 409 LYS A H      1 
ATOM   1019 H  HA     . LYS A 1 65 ? 3.801  -268.441 -13.019 1.00 36.62  ? 409 LYS A HA     1 
ATOM   1020 H  HB2    . LYS A 1 65 ? 1.833  -269.100 -11.114 1.00 42.65  ? 409 LYS A HB2    1 
ATOM   1021 H  HB3    . LYS A 1 65 ? 3.334  -269.615 -11.044 1.00 42.65  ? 409 LYS A HB3    1 
ATOM   1022 H  HG2    . LYS A 1 65 ? 4.055  -267.408 -10.762 1.00 43.85  ? 409 LYS A HG2    1 
ATOM   1023 H  HG3    . LYS A 1 65 ? 2.539  -266.930 -10.768 1.00 43.85  ? 409 LYS A HG3    1 
ATOM   1024 H  HD2    . LYS A 1 65 ? 2.173  -268.181 -8.807  1.00 45.55  ? 409 LYS A HD2    1 
ATOM   1025 H  HD3    . LYS A 1 65 ? 3.725  -268.542 -8.780  1.00 45.55  ? 409 LYS A HD3    1 
ATOM   1026 H  HE2    . LYS A 1 65 ? 4.122  -266.157 -8.678  1.00 62.56  ? 409 LYS A HE2    1 
ATOM   1027 H  HE3    . LYS A 1 65 ? 2.574  -266.016 -8.332  1.00 62.56  ? 409 LYS A HE3    1 
ATOM   1028 H  HZ1    . LYS A 1 65 ? 2.950  -267.263 -6.472  1.00 58.65  ? 409 LYS A HZ1    1 
ATOM   1029 H  HZ2    . LYS A 1 65 ? 4.359  -267.392 -6.787  1.00 58.65  ? 409 LYS A HZ2    1 
ATOM   1030 H  HZ3    . LYS A 1 65 ? 3.811  -266.099 -6.431  1.00 58.65  ? 409 LYS A HZ3    1 
ATOM   1031 N  N      . PRO A 1 66 ? 3.154  -270.132 -14.809 1.00 31.76  ? 410 PRO A N      1 
ATOM   1032 C  CA     . PRO A 1 66 ? 2.762  -271.253 -15.673 1.00 56.71  ? 410 PRO A CA     1 
ATOM   1033 C  C      . PRO A 1 66 ? 3.223  -272.605 -15.168 1.00 58.15  ? 410 PRO A C      1 
ATOM   1034 O  O      . PRO A 1 66 ? 2.596  -273.617 -15.503 1.00 49.20  ? 410 PRO A O      1 
ATOM   1035 C  CB     . PRO A 1 66 ? 3.433  -270.920 -17.012 1.00 37.19  ? 410 PRO A CB     1 
ATOM   1036 C  CG     . PRO A 1 66 ? 3.910  -269.507 -16.914 1.00 52.66  ? 410 PRO A CG     1 
ATOM   1037 C  CD     . PRO A 1 66 ? 4.114  -269.227 -15.468 1.00 59.53  ? 410 PRO A CD     1 
ATOM   1038 H  HA     . PRO A 1 66 ? 1.799  -271.266 -15.792 1.00 68.06  ? 410 PRO A HA     1 
ATOM   1039 H  HB2    . PRO A 1 66 ? 4.181  -271.520 -17.156 1.00 44.62  ? 410 PRO A HB2    1 
ATOM   1040 H  HB3    . PRO A 1 66 ? 2.785  -271.009 -17.728 1.00 44.62  ? 410 PRO A HB3    1 
ATOM   1041 H  HG2    . PRO A 1 66 ? 4.745  -269.414 -17.398 1.00 63.20  ? 410 PRO A HG2    1 
ATOM   1042 H  HG3    . PRO A 1 66 ? 3.237  -268.913 -17.282 1.00 63.20  ? 410 PRO A HG3    1 
ATOM   1043 H  HD2    . PRO A 1 66 ? 5.022  -269.446 -15.205 1.00 71.43  ? 410 PRO A HD2    1 
ATOM   1044 H  HD3    . PRO A 1 66 ? 3.901  -268.301 -15.276 1.00 71.43  ? 410 PRO A HD3    1 
ATOM   1045 N  N      . PHE A 1 67 ? 4.295  -272.656 -14.375 1.00 36.00  ? 411 PHE A N      1 
ATOM   1046 C  CA     . PHE A 1 67 ? 4.994  -273.905 -14.079 1.00 40.91  ? 411 PHE A CA     1 
ATOM   1047 C  C      . PHE A 1 67 ? 4.520  -274.469 -12.747 1.00 35.60  ? 411 PHE A C      1 
ATOM   1048 O  O      . PHE A 1 67 ? 4.871  -273.937 -11.686 1.00 30.88  ? 411 PHE A O      1 
ATOM   1049 C  CB     . PHE A 1 67 ? 6.493  -273.658 -14.077 1.00 29.83  ? 411 PHE A CB     1 
ATOM   1050 C  CG     . PHE A 1 67 ? 7.009  -273.222 -15.405 1.00 34.37  ? 411 PHE A CG     1 
ATOM   1051 C  CD1    . PHE A 1 67 ? 7.181  -271.872 -15.690 1.00 34.79  ? 411 PHE A CD1    1 
ATOM   1052 C  CD2    . PHE A 1 67 ? 7.294  -274.144 -16.376 1.00 32.21  ? 411 PHE A CD2    1 
ATOM   1053 C  CE1    . PHE A 1 67 ? 7.650  -271.461 -16.933 1.00 36.19  ? 411 PHE A CE1    1 
ATOM   1054 C  CE2    . PHE A 1 67 ? 7.764  -273.747 -17.617 1.00 37.42  ? 411 PHE A CE2    1 
ATOM   1055 C  CZ     . PHE A 1 67 ? 7.939  -272.405 -17.896 1.00 33.32  ? 411 PHE A CZ     1 
ATOM   1056 H  H      . PHE A 1 67 ? 4.641  -271.969 -13.991 1.00 43.19  ? 411 PHE A H      1 
ATOM   1057 H  HA     . PHE A 1 67 ? 4.795  -274.555 -14.771 1.00 49.09  ? 411 PHE A HA     1 
ATOM   1058 H  HB2    . PHE A 1 67 ? 6.697  -272.962 -13.433 1.00 35.80  ? 411 PHE A HB2    1 
ATOM   1059 H  HB3    . PHE A 1 67 ? 6.948  -274.479 -13.834 1.00 35.80  ? 411 PHE A HB3    1 
ATOM   1060 H  HD1    . PHE A 1 67 ? 6.985  -271.237 -15.040 1.00 41.75  ? 411 PHE A HD1    1 
ATOM   1061 H  HD2    . PHE A 1 67 ? 7.179  -275.049 -16.197 1.00 38.65  ? 411 PHE A HD2    1 
ATOM   1062 H  HE1    . PHE A 1 67 ? 7.767  -270.556 -17.114 1.00 43.42  ? 411 PHE A HE1    1 
ATOM   1063 H  HE2    . PHE A 1 67 ? 7.958  -274.385 -18.265 1.00 44.91  ? 411 PHE A HE2    1 
ATOM   1064 H  HZ     . PHE A 1 67 ? 8.255  -272.139 -18.729 1.00 39.98  ? 411 PHE A HZ     1 
ATOM   1065 N  N      . SER A 1 68 ? 3.741  -275.557 -12.813 1.00 29.71  ? 412 SER A N      1 
ATOM   1066 C  CA     . SER A 1 68 ? 3.101  -276.163 -11.652 1.00 31.74  ? 412 SER A CA     1 
ATOM   1067 C  C      . SER A 1 68 ? 3.873  -277.378 -11.156 1.00 28.68  ? 412 SER A C      1 
ATOM   1068 O  O      . SER A 1 68 ? 4.337  -278.206 -11.948 1.00 30.63  ? 412 SER A O      1 
ATOM   1069 C  CB     . SER A 1 68 ? 1.673  -276.593 -11.987 1.00 36.29  ? 412 SER A CB     1 
ATOM   1070 O  OG     . SER A 1 68 ? 1.069  -275.652 -12.849 1.00 52.31  ? 412 SER A OG     1 
ATOM   1071 H  H      . SER A 1 68 ? 3.567  -275.970 -13.547 1.00 35.65  ? 412 SER A H      1 
ATOM   1072 H  HA     . SER A 1 68 ? 3.062  -275.513 -10.933 1.00 38.08  ? 412 SER A HA     1 
ATOM   1073 H  HB2    . SER A 1 68 ? 1.696  -277.457 -12.427 1.00 43.55  ? 412 SER A HB2    1 
ATOM   1074 H  HB3    . SER A 1 68 ? 1.158  -276.649 -11.167 1.00 43.55  ? 412 SER A HB3    1 
ATOM   1075 H  HG     . SER A 1 68 ? 1.045  -274.898 -12.480 1.00 62.78  ? 412 SER A HG     1 
ATOM   1076 N  N      . CYS A 1 69 ? 3.977  -277.487 -9.834  1.00 28.02  ? 413 CYS A N      1 
ATOM   1077 C  CA     . CYS A 1 69 ? 4.552  -278.676 -9.227  1.00 28.01  ? 413 CYS A CA     1 
ATOM   1078 C  C      . CYS A 1 69 ? 3.709  -279.897 -9.570  1.00 32.23  ? 413 CYS A C      1 
ATOM   1079 O  O      . CYS A 1 69 ? 2.474  -279.859 -9.509  1.00 30.94  ? 413 CYS A O      1 
ATOM   1080 C  CB     . CYS A 1 69 ? 4.642  -278.510 -7.709  1.00 30.22  ? 413 CYS A CB     1 
ATOM   1081 S  SG     . CYS A 1 69 ? 5.466  -279.937 -6.919  1.00 26.77  ? 413 CYS A SG     1 
ATOM   1082 H  H      . CYS A 1 69 ? 3.723  -276.888 -9.272  1.00 33.62  ? 413 CYS A H      1 
ATOM   1083 H  HA     . CYS A 1 69 ? 5.446  -278.817 -9.573  1.00 33.61  ? 413 CYS A HA     1 
ATOM   1084 H  HB2    . CYS A 1 69 ? 5.155  -277.713 -7.505  1.00 36.27  ? 413 CYS A HB2    1 
ATOM   1085 H  HB3    . CYS A 1 69 ? 3.747  -278.436 -7.342  1.00 36.27  ? 413 CYS A HB3    1 
ATOM   1086 N  N      . ARG A 1 70 ? 4.381  -280.995 -9.926  1.00 25.42  ? 414 ARG A N      1 
ATOM   1087 C  CA     . ARG A 1 70 ? 3.696  -282.244 -10.254 1.00 27.86  ? 414 ARG A CA     1 
ATOM   1088 C  C      . ARG A 1 70 ? 3.638  -283.216 -9.092  1.00 26.50  ? 414 ARG A C      1 
ATOM   1089 O  O      . ARG A 1 70 ? 3.067  -284.283 -9.239  1.00 33.51  ? 414 ARG A O      1 
ATOM   1090 C  CB     . ARG A 1 70 ? 4.361  -282.906 -11.466 1.00 33.07  ? 414 ARG A CB     1 
ATOM   1091 C  CG     . ARG A 1 70 ? 4.264  -282.013 -12.717 1.00 39.02  ? 414 ARG A CG     1 
ATOM   1092 C  CD     . ARG A 1 70 ? 4.637  -282.710 -14.019 1.00 49.08  ? 414 ARG A CD     1 
ATOM   1093 N  NE     . ARG A 1 70 ? 6.080  -282.853 -14.179 1.00 93.72  ? 414 ARG A NE     1 
ATOM   1094 C  CZ     . ARG A 1 70 ? 6.893  -281.884 -14.595 1.00 100.67 ? 414 ARG A CZ     1 
ATOM   1095 N  NH1    . ARG A 1 70 ? 6.409  -280.683 -14.891 1.00 73.24  ? 414 ARG A NH1    1 
ATOM   1096 N  NH2    . ARG A 1 70 ? 8.196  -282.115 -14.711 1.00 66.17  ? 414 ARG A NH2    1 
ATOM   1097 H  H      . ARG A 1 70 ? 5.235  -281.041 -9.985  1.00 30.50  ? 414 ARG A H      1 
ATOM   1098 H  HA     . ARG A 1 70 ? 2.782  -282.038 -10.504 1.00 33.43  ? 414 ARG A HA     1 
ATOM   1099 H  HB2    . ARG A 1 70 ? 5.299  -283.059 -11.273 1.00 39.69  ? 414 ARG A HB2    1 
ATOM   1100 H  HB3    . ARG A 1 70 ? 3.916  -283.746 -11.657 1.00 39.69  ? 414 ARG A HB3    1 
ATOM   1101 H  HG2    . ARG A 1 70 ? 3.351  -281.697 -12.803 1.00 46.82  ? 414 ARG A HG2    1 
ATOM   1102 H  HG3    . ARG A 1 70 ? 4.862  -281.257 -12.606 1.00 46.82  ? 414 ARG A HG3    1 
ATOM   1103 H  HD2    . ARG A 1 70 ? 4.246  -283.598 -14.025 1.00 58.90  ? 414 ARG A HD2    1 
ATOM   1104 H  HD3    . ARG A 1 70 ? 4.297  -282.193 -14.766 1.00 58.90  ? 414 ARG A HD3    1 
ATOM   1105 H  HE     . ARG A 1 70 ? 6.430  -283.616 -13.992 1.00 112.47 ? 414 ARG A HE     1 
ATOM   1106 H  HH11   . ARG A 1 70 ? 5.567  -280.524 -14.819 1.00 87.89  ? 414 ARG A HH11   1 
ATOM   1107 H  HH12   . ARG A 1 70 ? 6.940  -280.062 -15.158 1.00 87.89  ? 414 ARG A HH12   1 
ATOM   1108 H  HH21   . ARG A 1 70 ? 8.514  -282.891 -14.519 1.00 79.41  ? 414 ARG A HH21   1 
ATOM   1109 H  HH22   . ARG A 1 70 ? 8.722  -281.489 -14.977 1.00 79.41  ? 414 ARG A HH22   1 
ATOM   1110 N  N      . TRP A 1 71 ? 4.184  -282.850 -7.937  1.00 30.17  ? 415 TRP A N      1 
ATOM   1111 C  CA     . TRP A 1 71 ? 4.112  -283.703 -6.767  1.00 35.60  ? 415 TRP A CA     1 
ATOM   1112 C  C      . TRP A 1 71 ? 2.663  -283.841 -6.297  1.00 46.21  ? 415 TRP A C      1 
ATOM   1113 O  O      . TRP A 1 71 ? 1.923  -282.853 -6.258  1.00 37.93  ? 415 TRP A O      1 
ATOM   1114 C  CB     . TRP A 1 71 ? 4.973  -283.119 -5.654  1.00 38.14  ? 415 TRP A CB     1 
ATOM   1115 C  CG     . TRP A 1 71 ? 5.375  -284.105 -4.670  1.00 71.93  ? 415 TRP A CG     1 
ATOM   1116 C  CD1    . TRP A 1 71 ? 4.755  -284.393 -3.487  1.00 74.57  ? 415 TRP A CD1    1 
ATOM   1117 C  CD2    . TRP A 1 71 ? 6.495  -284.980 -4.767  1.00 46.78  ? 415 TRP A CD2    1 
ATOM   1118 N  NE1    . TRP A 1 71 ? 5.434  -285.391 -2.835  1.00 60.53  ? 415 TRP A NE1    1 
ATOM   1119 C  CE2    . TRP A 1 71 ? 6.507  -285.770 -3.602  1.00 58.66  ? 415 TRP A CE2    1 
ATOM   1120 C  CE3    . TRP A 1 71 ? 7.504  -285.154 -5.713  1.00 37.81  ? 415 TRP A CE3    1 
ATOM   1121 C  CZ2    . TRP A 1 71 ? 7.476  -286.739 -3.374  1.00 49.42  ? 415 TRP A CZ2    1 
ATOM   1122 C  CZ3    . TRP A 1 71 ? 8.464  -286.113 -5.482  1.00 51.93  ? 415 TRP A CZ3    1 
ATOM   1123 C  CH2    . TRP A 1 71 ? 8.447  -286.889 -4.320  1.00 49.47  ? 415 TRP A CH2    1 
ATOM   1124 H  H      . TRP A 1 71 ? 4.602  -282.110 -7.807  1.00 36.20  ? 415 TRP A H      1 
ATOM   1125 H  HA     . TRP A 1 71 ? 4.469  -284.572 -6.999  1.00 42.72  ? 415 TRP A HA     1 
ATOM   1126 H  HB2    . TRP A 1 71 ? 5.777  -282.740 -6.043  1.00 45.77  ? 415 TRP A HB2    1 
ATOM   1127 H  HB3    . TRP A 1 71 ? 4.470  -282.428 -5.196  1.00 45.77  ? 415 TRP A HB3    1 
ATOM   1128 H  HD1    . TRP A 1 71 ? 3.986  -283.975 -3.171  1.00 89.48  ? 415 TRP A HD1    1 
ATOM   1129 H  HE1    . TRP A 1 71 ? 5.215  -285.733 -2.077  1.00 72.63  ? 415 TRP A HE1    1 
ATOM   1130 H  HE3    . TRP A 1 71 ? 7.518  -284.645 -6.491  1.00 45.38  ? 415 TRP A HE3    1 
ATOM   1131 H  HZ2    . TRP A 1 71 ? 7.474  -287.251 -2.598  1.00 59.30  ? 415 TRP A HZ2    1 
ATOM   1132 H  HZ3    . TRP A 1 71 ? 9.137  -286.246 -6.110  1.00 62.32  ? 415 TRP A HZ3    1 
ATOM   1133 H  HH2    . TRP A 1 71 ? 9.111  -287.527 -4.191  1.00 59.37  ? 415 TRP A HH2    1 
ATOM   1134 N  N      . PRO A 1 72 ? 2.234  -285.039 -5.916  1.00 47.62  ? 416 PRO A N      1 
ATOM   1135 C  CA     . PRO A 1 72 ? 0.850  -285.207 -5.451  1.00 50.77  ? 416 PRO A CA     1 
ATOM   1136 C  C      . PRO A 1 72 ? 0.511  -284.255 -4.315  1.00 59.19  ? 416 PRO A C      1 
ATOM   1137 O  O      . PRO A 1 72 ? 1.268  -284.112 -3.350  1.00 41.09  ? 416 PRO A O      1 
ATOM   1138 C  CB     . PRO A 1 72 ? 0.805  -286.661 -4.980  1.00 43.32  ? 416 PRO A CB     1 
ATOM   1139 C  CG     . PRO A 1 72 ? 1.928  -287.349 -5.699  1.00 49.35  ? 416 PRO A CG     1 
ATOM   1140 C  CD     . PRO A 1 72 ? 2.987  -286.308 -5.933  1.00 39.49  ? 416 PRO A CD     1 
ATOM   1141 H  HA     . PRO A 1 72 ? 0.225  -285.081 -6.182  1.00 60.92  ? 416 PRO A HA     1 
ATOM   1142 H  HB2    . PRO A 1 72 ? 0.940  -286.697 -4.020  1.00 51.98  ? 416 PRO A HB2    1 
ATOM   1143 H  HB3    . PRO A 1 72 ? -0.048 -287.055 -5.221  1.00 51.98  ? 416 PRO A HB3    1 
ATOM   1144 H  HG2    . PRO A 1 72 ? 2.274  -288.066 -5.145  1.00 59.22  ? 416 PRO A HG2    1 
ATOM   1145 H  HG3    . PRO A 1 72 ? 1.604  -287.699 -6.544  1.00 59.22  ? 416 PRO A HG3    1 
ATOM   1146 H  HD2    . PRO A 1 72 ? 3.641  -286.325 -5.218  1.00 47.39  ? 416 PRO A HD2    1 
ATOM   1147 H  HD3    . PRO A 1 72 ? 3.401  -286.447 -6.799  1.00 47.39  ? 416 PRO A HD3    1 
ATOM   1148 N  N      . SER A 1 73 ? -0.642 -283.607 -4.438  1.00 47.48  ? 417 SER A N      1 
ATOM   1149 C  CA     . SER A 1 73 ? -1.198 -282.761 -3.383  1.00 50.16  ? 417 SER A CA     1 
ATOM   1150 C  C      . SER A 1 73 ? -0.313 -281.562 -3.063  1.00 50.16  ? 417 SER A C      1 
ATOM   1151 O  O      . SER A 1 73 ? -0.450 -280.959 -1.993  1.00 56.13  ? 417 SER A O      1 
ATOM   1152 C  CB     . SER A 1 73 ? -1.455 -283.562 -2.100  1.00 42.31  ? 417 SER A CB     1 
ATOM   1153 O  OG     . SER A 1 73 ? -2.380 -284.616 -2.305  1.00 55.19  ? 417 SER A OG     1 
ATOM   1154 H  H      . SER A 1 73 ? -1.135 -283.642 -5.142  1.00 56.97  ? 417 SER A H      1 
ATOM   1155 H  HA     . SER A 1 73 ? -2.053 -282.417 -3.686  1.00 60.19  ? 417 SER A HA     1 
ATOM   1156 H  HB2    . SER A 1 73 ? -0.616 -283.939 -1.791  1.00 50.77  ? 417 SER A HB2    1 
ATOM   1157 H  HB3    . SER A 1 73 ? -1.812 -282.963 -1.426  1.00 50.77  ? 417 SER A HB3    1 
ATOM   1158 H  HG     . SER A 1 73 ? -2.086 -285.147 -2.886  1.00 66.23  ? 417 SER A HG     1 
ATOM   1159 N  N      . CYS A 1 74 ? 0.613  -281.210 -3.947  1.00 41.44  ? 418 CYS A N      1 
ATOM   1160 C  CA     . CYS A 1 74 ? 1.319  -279.936 -3.853  1.00 45.86  ? 418 CYS A CA     1 
ATOM   1161 C  C      . CYS A 1 74 ? 0.755  -278.996 -4.914  1.00 48.23  ? 418 CYS A C      1 
ATOM   1162 O  O      . CYS A 1 74 ? 0.641  -279.365 -6.090  1.00 45.40  ? 418 CYS A O      1 
ATOM   1163 C  CB     . CYS A 1 74 ? 2.839  -280.079 -4.030  1.00 37.17  ? 418 CYS A CB     1 
ATOM   1164 S  SG     . CYS A 1 74 ? 3.724  -278.482 -3.833  1.00 34.42  ? 418 CYS A SG     1 
ATOM   1165 H  H      . CYS A 1 74 ? 0.854  -281.693 -4.616  1.00 49.73  ? 418 CYS A H      1 
ATOM   1166 H  HA     . CYS A 1 74 ? 1.156  -279.540 -2.983  1.00 55.03  ? 418 CYS A HA     1 
ATOM   1167 H  HB2    . CYS A 1 74 ? 3.179  -280.695 -3.363  1.00 44.60  ? 418 CYS A HB2    1 
ATOM   1168 H  HB3    . CYS A 1 74 ? 3.024  -280.417 -4.920  1.00 44.60  ? 418 CYS A HB3    1 
ATOM   1169 N  N      . GLN A 1 75 ? 0.409  -277.781 -4.497  1.00 41.50  ? 419 GLN A N      1 
ATOM   1170 C  CA     . GLN A 1 75 ? -0.235 -276.827 -5.384  1.00 41.71  ? 419 GLN A CA     1 
ATOM   1171 C  C      . GLN A 1 75 ? 0.671  -275.650 -5.734  1.00 57.86  ? 419 GLN A C      1 
ATOM   1172 O  O      . GLN A 1 75 ? 0.195  -274.664 -6.305  1.00 40.84  ? 419 GLN A O      1 
ATOM   1173 C  CB     . GLN A 1 75 ? -1.534 -276.329 -4.747  1.00 51.88  ? 419 GLN A CB     1 
ATOM   1174 C  CG     . GLN A 1 75 ? -2.485 -277.449 -4.325  1.00 56.75  ? 419 GLN A CG     1 
ATOM   1175 C  CD     . GLN A 1 75 ? -3.007 -278.273 -5.502  1.00 116.79 ? 419 GLN A CD     1 
ATOM   1176 O  OE1    . GLN A 1 75 ? -2.295 -279.116 -6.062  1.00 109.48 ? 419 GLN A OE1    1 
ATOM   1177 N  NE2    . GLN A 1 75 ? -4.262 -278.034 -5.876  1.00 78.57  ? 419 GLN A NE2    1 
ATOM   1178 H  H      . GLN A 1 75 ? 0.539  -277.486 -3.700  1.00 49.80  ? 419 GLN A H      1 
ATOM   1179 H  HA     . GLN A 1 75 ? -0.468 -277.274 -6.212  1.00 50.05  ? 419 GLN A HA     1 
ATOM   1180 H  HB2    . GLN A 1 75 ? -1.316 -275.812 -3.956  1.00 62.26  ? 419 GLN A HB2    1 
ATOM   1181 H  HB3    . GLN A 1 75 ? -2.001 -275.769 -5.387  1.00 62.26  ? 419 GLN A HB3    1 
ATOM   1182 H  HG2    . GLN A 1 75 ? -2.020 -278.050 -3.722  1.00 68.10  ? 419 GLN A HG2    1 
ATOM   1183 H  HG3    . GLN A 1 75 ? -3.250 -277.057 -3.875  1.00 68.10  ? 419 GLN A HG3    1 
ATOM   1184 H  HE21   . GLN A 1 75 ? -4.729 -277.443 -5.461  1.00 94.29  ? 419 GLN A HE21   1 
ATOM   1185 H  HE22   . GLN A 1 75 ? -4.606 -278.471 -6.533  1.00 94.29  ? 419 GLN A HE22   1 
ATOM   1186 N  N      . LYS A 1 76 ? 1.960  -275.720 -5.411  1.00 40.03  ? 420 LYS A N      1 
ATOM   1187 C  CA     . LYS A 1 76 ? 2.851  -274.608 -5.724  1.00 38.13  ? 420 LYS A CA     1 
ATOM   1188 C  C      . LYS A 1 76 ? 3.003  -274.437 -7.231  1.00 32.05  ? 420 LYS A C      1 
ATOM   1189 O  O      . LYS A 1 76 ? 3.026  -275.408 -7.998  1.00 28.61  ? 420 LYS A O      1 
ATOM   1190 C  CB     . LYS A 1 76 ? 4.220  -274.806 -5.080  1.00 30.58  ? 420 LYS A CB     1 
ATOM   1191 C  CG     . LYS A 1 76 ? 4.212  -274.984 -3.561  1.00 36.19  ? 420 LYS A CG     1 
ATOM   1192 C  CD     . LYS A 1 76 ? 4.291  -273.654 -2.830  1.00 68.10  ? 420 LYS A CD     1 
ATOM   1193 C  CE     . LYS A 1 76 ? 4.411  -273.842 -1.318  1.00 52.16  ? 420 LYS A CE     1 
ATOM   1194 N  NZ     . LYS A 1 76 ? 4.559  -272.533 -0.614  1.00 73.16  ? 420 LYS A NZ     1 
ATOM   1195 H  H      . LYS A 1 76 ? 2.338  -276.386 -5.019  1.00 48.03  ? 420 LYS A H      1 
ATOM   1196 H  HA     . LYS A 1 76 ? 2.470  -273.790 -5.368  1.00 45.76  ? 420 LYS A HA     1 
ATOM   1197 H  HB2    . LYS A 1 76 ? 4.628  -275.598 -5.463  1.00 36.69  ? 420 LYS A HB2    1 
ATOM   1198 H  HB3    . LYS A 1 76 ? 4.768  -274.031 -5.280  1.00 36.69  ? 420 LYS A HB3    1 
ATOM   1199 H  HG2    . LYS A 1 76 ? 3.392  -275.427 -3.294  1.00 43.43  ? 420 LYS A HG2    1 
ATOM   1200 H  HG3    . LYS A 1 76 ? 4.979  -275.517 -3.300  1.00 43.43  ? 420 LYS A HG3    1 
ATOM   1201 H  HD2    . LYS A 1 76 ? 5.072  -273.167 -3.137  1.00 81.72  ? 420 LYS A HD2    1 
ATOM   1202 H  HD3    . LYS A 1 76 ? 3.486  -273.143 -3.009  1.00 81.72  ? 420 LYS A HD3    1 
ATOM   1203 H  HE2    . LYS A 1 76 ? 3.611  -274.278 -0.985  1.00 62.59  ? 420 LYS A HE2    1 
ATOM   1204 H  HE3    . LYS A 1 76 ? 5.193  -274.382 -1.124  1.00 62.59  ? 420 LYS A HE3    1 
ATOM   1205 H  HZ1    . LYS A 1 76 ? 4.627  -272.666 0.263   1.00 87.79  ? 420 LYS A HZ1    1 
ATOM   1206 H  HZ2    . LYS A 1 76 ? 5.290  -272.115 -0.901  1.00 87.79  ? 420 LYS A HZ2    1 
ATOM   1207 H  HZ3    . LYS A 1 76 ? 3.850  -272.020 -0.775  1.00 87.79  ? 420 LYS A HZ3    1 
ATOM   1208 N  N      . LYS A 1 77 ? 3.113  -273.179 -7.652  1.00 27.88  ? 421 LYS A N      1 
ATOM   1209 C  CA     . LYS A 1 77 ? 3.328  -272.773 -9.042  1.00 28.25  ? 421 LYS A CA     1 
ATOM   1210 C  C      . LYS A 1 77 ? 4.411  -271.699 -9.101  1.00 32.30  ? 421 LYS A C      1 
ATOM   1211 O  O      . LYS A 1 77 ? 4.669  -271.004 -8.107  1.00 33.70  ? 421 LYS A O      1 
ATOM   1212 C  CB     . LYS A 1 77 ? 2.042  -272.215 -9.677  1.00 40.95  ? 421 LYS A CB     1 
ATOM   1213 C  CG     . LYS A 1 77 ? 0.870  -273.177 -9.659  1.00 78.34  ? 421 LYS A CG     1 
ATOM   1214 C  CD     . LYS A 1 77 ? -0.410 -272.508 -10.131 1.00 70.59  ? 421 LYS A CD     1 
ATOM   1215 C  CE     . LYS A 1 77 ? -1.609 -273.439 -9.967  1.00 60.40  ? 421 LYS A CE     1 
ATOM   1216 N  NZ     . LYS A 1 77 ? -2.842 -272.847 -10.548 1.00 74.52  ? 421 LYS A NZ     1 
ATOM   1217 H  H      . LYS A 1 77 ? 3.063  -272.506 -7.119  1.00 33.45  ? 421 LYS A H      1 
ATOM   1218 H  HA     . LYS A 1 77 ? 3.622  -273.537 -9.562  1.00 33.90  ? 421 LYS A HA     1 
ATOM   1219 H  HB2    . LYS A 1 77 ? 1.777  -271.418 -9.192  1.00 49.14  ? 421 LYS A HB2    1 
ATOM   1220 H  HB3    . LYS A 1 77 ? 2.225  -271.990 -10.603 1.00 49.14  ? 421 LYS A HB3    1 
ATOM   1221 H  HG2    . LYS A 1 77 ? 1.059  -273.922 -10.250 1.00 94.01  ? 421 LYS A HG2    1 
ATOM   1222 H  HG3    . LYS A 1 77 ? 0.730  -273.494 -8.753  1.00 94.01  ? 421 LYS A HG3    1 
ATOM   1223 H  HD2    . LYS A 1 77 ? -0.569 -271.710 -9.603  1.00 84.71  ? 421 LYS A HD2    1 
ATOM   1224 H  HD3    . LYS A 1 77 ? -0.326 -272.280 -11.070 1.00 84.71  ? 421 LYS A HD3    1 
ATOM   1225 H  HE2    . LYS A 1 77 ? -1.429 -274.276 -10.424 1.00 72.48  ? 421 LYS A HE2    1 
ATOM   1226 H  HE3    . LYS A 1 77 ? -1.764 -273.598 -9.023  1.00 72.48  ? 421 LYS A HE3    1 
ATOM   1227 H  HZ1    . LYS A 1 77 ? -3.527 -273.405 -10.441 1.00 89.43  ? 421 LYS A HZ1    1 
ATOM   1228 H  HZ2    . LYS A 1 77 ? -3.030 -272.078 -10.142 1.00 89.43  ? 421 LYS A HZ2    1 
ATOM   1229 H  HZ3    . LYS A 1 77 ? -2.726 -272.695 -11.417 1.00 89.43  ? 421 LYS A HZ3    1 
ATOM   1230 N  N      . PHE A 1 78 ? 5.023  -271.554 -10.288 1.00 27.63  ? 422 PHE A N      1 
ATOM   1231 C  CA     . PHE A 1 78 ? 6.211  -270.719 -10.470 1.00 25.64  ? 422 PHE A CA     1 
ATOM   1232 C  C      . PHE A 1 78 ? 6.187  -269.977 -11.798 1.00 29.09  ? 422 PHE A C      1 
ATOM   1233 O  O      . PHE A 1 78 ? 5.710  -270.493 -12.813 1.00 32.00  ? 422 PHE A O      1 
ATOM   1234 C  CB     . PHE A 1 78 ? 7.491  -271.547 -10.399 1.00 26.36  ? 422 PHE A CB     1 
ATOM   1235 C  CG     . PHE A 1 78 ? 7.630  -272.239 -9.085  1.00 22.56  ? 422 PHE A CG     1 
ATOM   1236 C  CD1    . PHE A 1 78 ? 8.132  -271.574 -7.993  1.00 26.73  ? 422 PHE A CD1    1 
ATOM   1237 C  CD2    . PHE A 1 78 ? 7.195  -273.544 -8.953  1.00 22.36  ? 422 PHE A CD2    1 
ATOM   1238 C  CE1    . PHE A 1 78 ? 8.203  -272.226 -6.730  1.00 28.49  ? 422 PHE A CE1    1 
ATOM   1239 C  CE2    . PHE A 1 78 ? 7.273  -274.190 -7.720  1.00 26.02  ? 422 PHE A CE2    1 
ATOM   1240 C  CZ     . PHE A 1 78 ? 7.775  -273.521 -6.620  1.00 25.49  ? 422 PHE A CZ     1 
ATOM   1241 H  H      . PHE A 1 78 ? 4.760  -271.938 -11.011 1.00 33.16  ? 422 PHE A H      1 
ATOM   1242 H  HA     . PHE A 1 78 ? 6.243  -270.058 -9.760  1.00 30.77  ? 422 PHE A HA     1 
ATOM   1243 H  HB2    . PHE A 1 78 ? 7.475  -272.221 -11.097 1.00 31.64  ? 422 PHE A HB2    1 
ATOM   1244 H  HB3    . PHE A 1 78 ? 8.255  -270.962 -10.516 1.00 31.64  ? 422 PHE A HB3    1 
ATOM   1245 H  HD1    . PHE A 1 78 ? 8.407  -270.689 -8.075  1.00 32.08  ? 422 PHE A HD1    1 
ATOM   1246 H  HD2    . PHE A 1 78 ? 6.844  -273.992 -9.689  1.00 26.83  ? 422 PHE A HD2    1 
ATOM   1247 H  HE1    . PHE A 1 78 ? 8.552  -271.782 -5.991  1.00 34.19  ? 422 PHE A HE1    1 
ATOM   1248 H  HE2    . PHE A 1 78 ? 6.986  -275.071 -7.637  1.00 31.23  ? 422 PHE A HE2    1 
ATOM   1249 H  HZ     . PHE A 1 78 ? 7.838  -273.960 -5.802  1.00 30.58  ? 422 PHE A HZ     1 
ATOM   1250 N  N      . ALA A 1 79 ? 6.769  -268.782 -11.779 1.00 26.67  ? 423 ALA A N      1 
ATOM   1251 C  CA     . ALA A 1 79 ? 6.835  -267.953 -12.977 1.00 27.37  ? 423 ALA A CA     1 
ATOM   1252 C  C      . ALA A 1 79 ? 7.785  -268.511 -14.026 1.00 25.50  ? 423 ALA A C      1 
ATOM   1253 O  O      . ALA A 1 79 ? 7.579  -268.281 -15.223 1.00 33.15  ? 423 ALA A O      1 
ATOM   1254 C  CB     . ALA A 1 79 ? 7.270  -266.541 -12.599 1.00 34.04  ? 423 ALA A CB     1 
ATOM   1255 H  H      . ALA A 1 79 ? 7.133  -268.428 -11.085 1.00 32.01  ? 423 ALA A H      1 
ATOM   1256 H  HA     . ALA A 1 79 ? 5.952  -267.898 -13.373 1.00 32.85  ? 423 ALA A HA     1 
ATOM   1257 H  HB1    . ALA A 1 79 ? 7.311  -265.998 -13.402 1.00 40.84  ? 423 ALA A HB1    1 
ATOM   1258 H  HB2    . ALA A 1 79 ? 6.624  -266.167 -11.979 1.00 40.84  ? 423 ALA A HB2    1 
ATOM   1259 H  HB3    . ALA A 1 79 ? 8.145  -266.582 -12.182 1.00 40.84  ? 423 ALA A HB3    1 
ATOM   1260 N  N      . ARG A 1 80 ? 8.852  -269.178 -13.607 1.00 23.13  ? 424 ARG A N      1 
ATOM   1261 C  CA     . ARG A 1 80 ? 9.939  -269.605 -14.478 1.00 26.52  ? 424 ARG A CA     1 
ATOM   1262 C  C      . ARG A 1 80 ? 10.232 -271.080 -14.302 1.00 26.55  ? 424 ARG A C      1 
ATOM   1263 O  O      . ARG A 1 80 ? 10.124 -271.641 -13.209 1.00 23.20  ? 424 ARG A O      1 
ATOM   1264 C  CB     . ARG A 1 80 ? 11.254 -268.839 -14.189 1.00 34.39  ? 424 ARG A CB     1 
ATOM   1265 C  CG     . ARG A 1 80 ? 11.588 -267.787 -15.169 1.00 38.27  ? 424 ARG A CG     1 
ATOM   1266 C  CD     . ARG A 1 80 ? 12.645 -266.822 -14.681 1.00 38.99  ? 424 ARG A CD     1 
ATOM   1267 N  NE     . ARG A 1 80 ? 13.766 -267.450 -13.969 1.00 24.55  ? 424 ARG A NE     1 
ATOM   1268 C  CZ     . ARG A 1 80 ? 14.733 -266.743 -13.380 1.00 22.96  ? 424 ARG A CZ     1 
ATOM   1269 N  NH1    . ARG A 1 80 ? 14.722 -265.414 -13.401 1.00 24.41  ? 424 ARG A NH1    1 
ATOM   1270 N  NH2    . ARG A 1 80 ? 15.726 -267.367 -12.735 1.00 23.99  ? 424 ARG A NH2    1 
ATOM   1271 H  H      . ARG A 1 80 ? 8.973  -269.404 -12.786 1.00 27.76  ? 424 ARG A H      1 
ATOM   1272 H  HA     . ARG A 1 80 ? 9.693  -269.451 -15.403 1.00 31.83  ? 424 ARG A HA     1 
ATOM   1273 H  HB2    . ARG A 1 80 ? 11.181 -268.416 -13.319 1.00 41.27  ? 424 ARG A HB2    1 
ATOM   1274 H  HB3    . ARG A 1 80 ? 11.986 -269.476 -14.181 1.00 41.27  ? 424 ARG A HB3    1 
ATOM   1275 H  HG2    . ARG A 1 80 ? 11.919 -268.206 -15.979 1.00 45.92  ? 424 ARG A HG2    1 
ATOM   1276 H  HG3    . ARG A 1 80 ? 10.787 -267.276 -15.366 1.00 45.92  ? 424 ARG A HG3    1 
ATOM   1277 H  HD2    . ARG A 1 80 ? 13.010 -266.350 -15.446 1.00 46.78  ? 424 ARG A HD2    1 
ATOM   1278 H  HD3    . ARG A 1 80 ? 12.230 -266.189 -14.074 1.00 46.78  ? 424 ARG A HD3    1 
ATOM   1279 H  HE     . ARG A 1 80 ? 13.743 -268.299 -13.837 1.00 29.46  ? 424 ARG A HE     1 
ATOM   1280 H  HH11   . ARG A 1 80 ? 14.092 -264.992 -13.806 1.00 29.29  ? 424 ARG A HH11   1 
ATOM   1281 H  HH12   . ARG A 1 80 ? 15.352 -264.975 -13.014 1.00 29.29  ? 424 ARG A HH12   1 
ATOM   1282 H  HH21   . ARG A 1 80 ? 15.749 -268.226 -12.710 1.00 28.78  ? 424 ARG A HH21   1 
ATOM   1283 H  HH22   . ARG A 1 80 ? 16.347 -266.909 -12.356 1.00 28.78  ? 424 ARG A HH22   1 
ATOM   1284 N  N      . SER A 1 81 ? 10.678 -271.700 -15.381 1.00 24.88  ? 425 SER A N      1 
ATOM   1285 C  CA     . SER A 1 81 ? 10.901 -273.141 -15.350 1.00 25.00  ? 425 SER A CA     1 
ATOM   1286 C  C      . SER A 1 81 ? 11.961 -273.537 -14.330 1.00 26.23  ? 425 SER A C      1 
ATOM   1287 O  O      . SER A 1 81 ? 11.823 -274.570 -13.656 1.00 24.09  ? 425 SER A O      1 
ATOM   1288 C  CB     . SER A 1 81 ? 11.321 -273.600 -16.737 1.00 30.65  ? 425 SER A CB     1 
ATOM   1289 O  OG     . SER A 1 81 ? 12.527 -272.941 -17.056 1.00 33.29  ? 425 SER A OG     1 
ATOM   1290 H  H      . SER A 1 81 ? 10.858 -271.321 -16.132 1.00 29.86  ? 425 SER A H      1 
ATOM   1291 H  HA     . SER A 1 81 ? 10.072 -273.589 -15.118 1.00 30.01  ? 425 SER A HA     1 
ATOM   1292 H  HB2    . SER A 1 81 ? 11.465 -274.559 -16.733 1.00 36.77  ? 425 SER A HB2    1 
ATOM   1293 H  HB3    . SER A 1 81 ? 10.637 -273.359 -17.381 1.00 36.77  ? 425 SER A HB3    1 
ATOM   1294 H  HG     . SER A 1 81 ? 12.788 -273.174 -17.820 1.00 39.95  ? 425 SER A HG     1 
ATOM   1295 N  N      . ASP A 1 82 ? 13.042 -272.747 -14.204 1.00 22.36  ? 426 ASP A N      1 
ATOM   1296 C  CA     . ASP A 1 82 ? 14.133 -273.138 -13.314 1.00 24.47  ? 426 ASP A CA     1 
ATOM   1297 C  C      . ASP A 1 82 ? 13.738 -273.029 -11.848 1.00 25.49  ? 426 ASP A C      1 
ATOM   1298 O  O      . ASP A 1 82 ? 14.275 -273.764 -11.007 1.00 25.79  ? 426 ASP A O      1 
ATOM   1299 C  CB     . ASP A 1 82 ? 15.393 -272.312 -13.602 1.00 29.61  ? 426 ASP A CB     1 
ATOM   1300 C  CG     . ASP A 1 82 ? 15.158 -270.792 -13.487 1.00 26.64  ? 426 ASP A CG     1 
ATOM   1301 O  OD1    . ASP A 1 82 ? 14.451 -270.245 -14.347 1.00 28.30  ? 426 ASP A OD1    1 
ATOM   1302 O  OD2    . ASP A 1 82 ? 15.721 -270.150 -12.572 1.00 32.10  ? 426 ASP A OD2    1 
ATOM   1303 H  H      . ASP A 1 82 ? 13.160 -272.001 -14.615 1.00 26.83  ? 426 ASP A H      1 
ATOM   1304 H  HA     . ASP A 1 82 ? 14.350 -274.067 -13.487 1.00 29.36  ? 426 ASP A HA     1 
ATOM   1305 H  HB2    . ASP A 1 82 ? 16.083 -272.557 -12.965 1.00 35.54  ? 426 ASP A HB2    1 
ATOM   1306 H  HB3    . ASP A 1 82 ? 15.694 -272.501 -14.505 1.00 35.54  ? 426 ASP A HB3    1 
ATOM   1307 N  N      . GLU A 1 83 ? 12.786 -272.155 -11.519 1.00 20.52  ? 427 GLU A N      1 
ATOM   1308 C  CA     . GLU A 1 83 ? 12.227 -272.160 -10.160 1.00 18.93  ? 427 GLU A CA     1 
ATOM   1309 C  C      . GLU A 1 83 ? 11.549 -273.491 -9.857  1.00 20.49  ? 427 GLU A C      1 
ATOM   1310 O  O      . GLU A 1 83 ? 11.633 -273.997 -8.730  1.00 25.32  ? 427 GLU A O      1 
ATOM   1311 C  CB     . GLU A 1 83 ? 11.200 -271.041 -9.992  1.00 23.10  ? 427 GLU A CB     1 
ATOM   1312 C  CG     . GLU A 1 83 ? 11.742 -269.631 -10.119 1.00 29.31  ? 427 GLU A CG     1 
ATOM   1313 C  CD     . GLU A 1 83 ? 10.593 -268.641 -10.065 1.00 33.08  ? 427 GLU A CD     1 
ATOM   1314 O  OE1    . GLU A 1 83 ? 10.047 -268.274 -11.119 1.00 31.75  ? 427 GLU A OE1    1 
ATOM   1315 O  OE2    . GLU A 1 83 ? 10.180 -268.293 -8.941  1.00 35.66  ? 427 GLU A OE2    1 
ATOM   1316 H  H      . GLU A 1 83 ? 12.452 -271.563 -12.046 1.00 24.62  ? 427 GLU A H      1 
ATOM   1317 H  HA     . GLU A 1 83 ? 12.940 -272.024 -9.516  1.00 22.72  ? 427 GLU A HA     1 
ATOM   1318 H  HB2    . GLU A 1 83 ? 10.516 -271.151 -10.670 1.00 27.72  ? 427 GLU A HB2    1 
ATOM   1319 H  HB3    . GLU A 1 83 ? 10.800 -271.121 -9.112  1.00 27.72  ? 427 GLU A HB3    1 
ATOM   1320 H  HG2    . GLU A 1 83 ? 12.346 -269.446 -9.383  1.00 35.17  ? 427 GLU A HG2    1 
ATOM   1321 H  HG3    . GLU A 1 83 ? 12.198 -269.532 -10.970 1.00 35.17  ? 427 GLU A HG3    1 
ATOM   1322 N  N      . LEU A 1 84 ? 10.835 -274.050 -10.842 1.00 21.73  ? 428 LEU A N      1 
ATOM   1323 C  CA     . LEU A 1 84 ? 10.162 -275.338 -10.633 1.00 22.12  ? 428 LEU A CA     1 
ATOM   1324 C  C      . LEU A 1 84 ? 11.169 -276.475 -10.563 1.00 26.49  ? 428 LEU A C      1 
ATOM   1325 O  O      . LEU A 1 84 ? 11.010 -277.397 -9.748  1.00 22.89  ? 428 LEU A O      1 
ATOM   1326 C  CB     . LEU A 1 84 ? 9.122  -275.602 -11.720 1.00 22.41  ? 428 LEU A CB     1 
ATOM   1327 C  CG     . LEU A 1 84 ? 8.505  -277.029 -11.648 1.00 24.04  ? 428 LEU A CG     1 
ATOM   1328 C  CD1    . LEU A 1 84 ? 7.790  -277.215 -10.304 1.00 30.03  ? 428 LEU A CD1    1 
ATOM   1329 C  CD2    . LEU A 1 84 ? 7.558  -277.299 -12.806 1.00 33.09  ? 428 LEU A CD2    1 
ATOM   1330 H  H      . LEU A 1 84 ? 10.726 -273.711 -11.625 1.00 26.08  ? 428 LEU A H      1 
ATOM   1331 H  HA     . LEU A 1 84 ? 9.698  -275.305 -9.782  1.00 26.55  ? 428 LEU A HA     1 
ATOM   1332 H  HB2    . LEU A 1 84 ? 8.401  -274.960 -11.627 1.00 26.90  ? 428 LEU A HB2    1 
ATOM   1333 H  HB3    . LEU A 1 84 ? 9.543  -275.503 -12.588 1.00 26.90  ? 428 LEU A HB3    1 
ATOM   1334 H  HG     . LEU A 1 84 ? 9.212  -277.690 -11.701 1.00 28.85  ? 428 LEU A HG     1 
ATOM   1335 H  HD11   . LEU A 1 84 ? 7.369  -278.088 -10.296 1.00 36.04  ? 428 LEU A HD11   1 
ATOM   1336 H  HD12   . LEU A 1 84 ? 8.439  -277.158 -9.586  1.00 36.04  ? 428 LEU A HD12   1 
ATOM   1337 H  HD13   . LEU A 1 84 ? 7.119  -276.521 -10.203 1.00 36.04  ? 428 LEU A HD13   1 
ATOM   1338 H  HD21   . LEU A 1 84 ? 7.201  -278.196 -12.718 1.00 39.70  ? 428 LEU A HD21   1 
ATOM   1339 H  HD22   . LEU A 1 84 ? 6.837  -276.651 -12.781 1.00 39.70  ? 428 LEU A HD22   1 
ATOM   1340 H  HD23   . LEU A 1 84 ? 8.048  -277.217 -13.639 1.00 39.70  ? 428 LEU A HD23   1 
ATOM   1341 N  N      . VAL A 1 85 ? 12.235 -276.414 -11.367 1.00 23.94  ? 429 VAL A N      1 
ATOM   1342 C  CA     . VAL A 1 85 ? 13.322 -277.379 -11.228 1.00 22.69  ? 429 VAL A CA     1 
ATOM   1343 C  C      . VAL A 1 85 ? 13.849 -277.378 -9.803  1.00 26.73  ? 429 VAL A C      1 
ATOM   1344 O  O      . VAL A 1 85 ? 14.031 -278.436 -9.184  1.00 25.90  ? 429 VAL A O      1 
ATOM   1345 C  CB     . VAL A 1 85 ? 14.441 -277.086 -12.235 1.00 26.33  ? 429 VAL A CB     1 
ATOM   1346 C  CG1    . VAL A 1 85 ? 15.675 -277.919 -11.928 1.00 32.72  ? 429 VAL A CG1    1 
ATOM   1347 C  CG2    . VAL A 1 85 ? 13.938 -277.368 -13.626 1.00 26.69  ? 429 VAL A CG2    1 
ATOM   1348 H  H      . VAL A 1 85 ? 12.349 -275.832 -11.990 1.00 28.73  ? 429 VAL A H      1 
ATOM   1349 H  HA     . VAL A 1 85 ? 12.978 -278.267 -11.415 1.00 27.23  ? 429 VAL A HA     1 
ATOM   1350 H  HB     . VAL A 1 85 ? 14.684 -276.148 -12.182 1.00 31.60  ? 429 VAL A HB     1 
ATOM   1351 H  HG11   . VAL A 1 85 ? 16.261 -277.911 -12.701 1.00 39.26  ? 429 VAL A HG11   1 
ATOM   1352 H  HG12   . VAL A 1 85 ? 16.136 -277.538 -11.165 1.00 39.26  ? 429 VAL A HG12   1 
ATOM   1353 H  HG13   . VAL A 1 85 ? 15.401 -278.829 -11.732 1.00 39.26  ? 429 VAL A HG13   1 
ATOM   1354 H  HG21   . VAL A 1 85 ? 12.992 -277.580 -13.585 1.00 32.03  ? 429 VAL A HG21   1 
ATOM   1355 H  HG22   . VAL A 1 85 ? 14.077 -276.581 -14.176 1.00 32.03  ? 429 VAL A HG22   1 
ATOM   1356 H  HG23   . VAL A 1 85 ? 14.429 -278.119 -13.995 1.00 32.03  ? 429 VAL A HG23   1 
ATOM   1357 N  N      . ARG A 1 86 ? 14.125 -276.189 -9.261  1.00 23.48  ? 430 ARG A N      1 
ATOM   1358 C  CA     . ARG A 1 86 ? 14.643 -276.112 -7.898  1.00 22.61  ? 430 ARG A CA     1 
ATOM   1359 C  C      . ARG A 1 86 ? 13.658 -276.710 -6.894  1.00 21.78  ? 430 ARG A C      1 
ATOM   1360 O  O      . ARG A 1 86 ? 14.055 -277.421 -5.962  1.00 25.46  ? 430 ARG A O      1 
ATOM   1361 C  CB     . ARG A 1 86 ? 14.971 -274.647 -7.542  1.00 29.30  ? 430 ARG A CB     1 
ATOM   1362 C  CG     . ARG A 1 86 ? 15.948 -274.496 -6.379  1.00 38.15  ? 430 ARG A CG     1 
ATOM   1363 C  CD     . ARG A 1 86 ? 16.454 -273.034 -6.199  1.00 40.76  ? 430 ARG A CD     1 
ATOM   1364 N  NE     . ARG A 1 86 ? 15.315 -272.156 -6.070  1.00 33.81  ? 430 ARG A NE     1 
ATOM   1365 C  CZ     . ARG A 1 86 ? 15.382 -270.838 -5.920  1.00 30.57  ? 430 ARG A CZ     1 
ATOM   1366 N  NH1    . ARG A 1 86 ? 16.553 -270.222 -5.899  1.00 27.41  ? 430 ARG A NH1    1 
ATOM   1367 N  NH2    . ARG A 1 86 ? 14.262 -270.151 -5.823  1.00 27.30  ? 430 ARG A NH2    1 
ATOM   1368 H  H      . ARG A 1 86 ? 14.023 -275.430 -9.653  1.00 28.18  ? 430 ARG A H      1 
ATOM   1369 H  HA     . ARG A 1 86 ? 15.466 -276.622 -7.846  1.00 27.14  ? 430 ARG A HA     1 
ATOM   1370 H  HB2    . ARG A 1 86 ? 15.365 -274.218 -8.318  1.00 35.16  ? 430 ARG A HB2    1 
ATOM   1371 H  HB3    . ARG A 1 86 ? 14.148 -274.194 -7.299  1.00 35.16  ? 430 ARG A HB3    1 
ATOM   1372 H  HG2    . ARG A 1 86 ? 15.505 -274.763 -5.558  1.00 45.78  ? 430 ARG A HG2    1 
ATOM   1373 H  HG3    . ARG A 1 86 ? 16.719 -275.062 -6.539  1.00 45.78  ? 430 ARG A HG3    1 
ATOM   1374 H  HD2    . ARG A 1 86 ? 16.992 -272.969 -5.396  1.00 48.92  ? 430 ARG A HD2    1 
ATOM   1375 H  HD3    . ARG A 1 86 ? 16.966 -272.767 -6.978  1.00 48.92  ? 430 ARG A HD3    1 
ATOM   1376 H  HE     . ARG A 1 86 ? 14.538 -272.520 -6.021  1.00 40.57  ? 430 ARG A HE     1 
ATOM   1377 H  HH11   . ARG A 1 86 ? 17.281 -270.674 -5.967  1.00 32.89  ? 430 ARG A HH11   1 
ATOM   1378 H  HH12   . ARG A 1 86 ? 16.586 -269.368 -5.805  1.00 32.89  ? 430 ARG A HH12   1 
ATOM   1379 H  HH21   . ARG A 1 86 ? 13.505 -270.558 -5.841  1.00 32.76  ? 430 ARG A HH21   1 
ATOM   1380 H  HH22   . ARG A 1 86 ? 14.289 -269.297 -5.728  1.00 32.76  ? 430 ARG A HH22   1 
ATOM   1381 N  N      . HIS A 1 87 ? 12.369 -276.440 -7.084  1.00 24.53  ? 431 HIS A N      1 
ATOM   1382 C  CA     . HIS A 1 87 ? 11.340 -276.932 -6.181  1.00 25.85  ? 431 HIS A CA     1 
ATOM   1383 C  C      . HIS A 1 87 ? 11.178 -278.449 -6.261  1.00 22.20  ? 431 HIS A C      1 
ATOM   1384 O  O      . HIS A 1 87 ? 11.017 -279.113 -5.232  1.00 22.41  ? 431 HIS A O      1 
ATOM   1385 C  CB     . HIS A 1 87 ? 10.021 -276.237 -6.504  1.00 23.78  ? 431 HIS A CB     1 
ATOM   1386 C  CG     . HIS A 1 87 ? 8.872  -276.722 -5.684  1.00 24.28  ? 431 HIS A CG     1 
ATOM   1387 N  ND1    . HIS A 1 87 ? 8.695  -276.371 -4.356  1.00 29.41  ? 431 HIS A ND1    1 
ATOM   1388 C  CD2    . HIS A 1 87 ? 7.837  -277.531 -5.999  1.00 22.05  ? 431 HIS A CD2    1 
ATOM   1389 C  CE1    . HIS A 1 87 ? 7.595  -276.942 -3.898  1.00 29.44  ? 431 HIS A CE1    1 
ATOM   1390 N  NE2    . HIS A 1 87 ? 7.074  -277.685 -4.860  1.00 28.11  ? 431 HIS A NE2    1 
ATOM   1391 H  H      . HIS A 1 87 ? 12.065 -275.969 -7.736  1.00 29.44  ? 431 HIS A H      1 
ATOM   1392 H  HA     . HIS A 1 87 ? 11.584 -276.704 -5.270  1.00 31.02  ? 431 HIS A HA     1 
ATOM   1393 H  HB2    . HIS A 1 87 ? 10.121 -275.286 -6.342  1.00 28.54  ? 431 HIS A HB2    1 
ATOM   1394 H  HB3    . HIS A 1 87 ? 9.806  -276.392 -7.437  1.00 28.54  ? 431 HIS A HB3    1 
ATOM   1395 H  HD1    . HIS A 1 87 ? 9.212  -275.852 -3.905  1.00 35.29  ? 431 HIS A HD1    1 
ATOM   1396 H  HD2    . HIS A 1 87 ? 7.689  -277.941 -6.820  1.00 26.46  ? 431 HIS A HD2    1 
ATOM   1397 H  HE1    . HIS A 1 87 ? 7.266  -276.869 -3.031  1.00 35.33  ? 431 HIS A HE1    1 
ATOM   1398 N  N      . HIS A 1 88 ? 11.193 -279.016 -7.465  1.00 24.32  ? 432 HIS A N      1 
ATOM   1399 C  CA     . HIS A 1 88 ? 11.132 -280.469 -7.600  1.00 22.10  ? 432 HIS A CA     1 
ATOM   1400 C  C      . HIS A 1 88 ? 12.353 -281.129 -6.964  1.00 22.07  ? 432 HIS A C      1 
ATOM   1401 O  O      . HIS A 1 88 ? 12.251 -282.195 -6.323  1.00 28.33  ? 432 HIS A O      1 
ATOM   1402 C  CB     . HIS A 1 88 ? 11.042 -280.845 -9.087  1.00 23.84  ? 432 HIS A CB     1 
ATOM   1403 C  CG     . HIS A 1 88 ? 9.651  -280.802 -9.654  1.00 21.75  ? 432 HIS A CG     1 
ATOM   1404 N  ND1    . HIS A 1 88 ? 9.404  -280.683 -11.006 1.00 30.67  ? 432 HIS A ND1    1 
ATOM   1405 C  CD2    . HIS A 1 88 ? 8.439  -280.935 -9.062  1.00 30.08  ? 432 HIS A CD2    1 
ATOM   1406 C  CE1    . HIS A 1 88 ? 8.096  -280.727 -11.220 1.00 29.45  ? 432 HIS A CE1    1 
ATOM   1407 N  NE2    . HIS A 1 88 ? 7.488  -280.897 -10.056 1.00 28.14  ? 432 HIS A NE2    1 
ATOM   1408 H  H      . HIS A 1 88 ? 11.237 -278.588 -8.210  1.00 29.18  ? 432 HIS A H      1 
ATOM   1409 H  HA     . HIS A 1 88 ? 10.341 -280.800 -7.147  1.00 26.52  ? 432 HIS A HA     1 
ATOM   1410 H  HB2    . HIS A 1 88 ? 11.588 -280.227 -9.598  1.00 28.60  ? 432 HIS A HB2    1 
ATOM   1411 H  HB3    . HIS A 1 88 ? 11.378 -281.748 -9.200  1.00 28.60  ? 432 HIS A HB3    1 
ATOM   1412 H  HD1    . HIS A 1 88 ? 10.005 -280.594 -11.615 1.00 36.80  ? 432 HIS A HD1    1 
ATOM   1413 H  HD2    . HIS A 1 88 ? 8.280  -281.050 -8.153  1.00 36.10  ? 432 HIS A HD2    1 
ATOM   1414 H  HE1    . HIS A 1 88 ? 7.677  -280.654 -12.047 1.00 35.34  ? 432 HIS A HE1    1 
ATOM   1415 N  N      . ASN A 1 89 ? 13.529 -280.545 -7.166  1.00 27.08  ? 433 ASN A N      1 
ATOM   1416 C  CA     . ASN A 1 89 ? 14.722 -281.073 -6.516  1.00 29.48  ? 433 ASN A CA     1 
ATOM   1417 C  C      . ASN A 1 89 ? 14.504 -281.177 -5.014  1.00 37.66  ? 433 ASN A C      1 
ATOM   1418 O  O      . ASN A 1 89 ? 14.954 -282.131 -4.375  1.00 35.20  ? 433 ASN A O      1 
ATOM   1419 C  CB     . ASN A 1 89 ? 15.931 -280.182 -6.822  1.00 29.56  ? 433 ASN A CB     1 
ATOM   1420 C  CG     . ASN A 1 89 ? 16.458 -280.340 -8.229  1.00 35.19  ? 433 ASN A CG     1 
ATOM   1421 O  OD1    . ASN A 1 89 ? 16.142 -281.295 -8.945  1.00 40.84  ? 433 ASN A OD1    1 
ATOM   1422 N  ND2    . ASN A 1 89 ? 17.302 -279.392 -8.637  1.00 42.12  ? 433 ASN A ND2    1 
ATOM   1423 H  H      . ASN A 1 89 ? 13.662 -279.856 -7.664  1.00 32.49  ? 433 ASN A H      1 
ATOM   1424 H  HA     . ASN A 1 89 ? 14.905 -281.962 -6.858  1.00 35.37  ? 433 ASN A HA     1 
ATOM   1425 H  HB2    . ASN A 1 89 ? 15.674 -279.254 -6.703  1.00 35.48  ? 433 ASN A HB2    1 
ATOM   1426 H  HB3    . ASN A 1 89 ? 16.649 -280.406 -6.209  1.00 35.48  ? 433 ASN A HB3    1 
ATOM   1427 H  HD21   . ASN A 1 89 ? 17.637 -279.426 -9.428  1.00 50.54  ? 433 ASN A HD21   1 
ATOM   1428 H  HD22   . ASN A 1 89 ? 17.512 -278.747 -8.109  1.00 50.54  ? 433 ASN A HD22   1 
ATOM   1429 N  N      . MET A 1 90 ? 13.769 -280.219 -4.437  1.00 30.81  ? 434 MET A N      1 
ATOM   1430 C  CA     . MET A 1 90 ? 13.580 -280.197 -2.985  1.00 36.99  ? 434 MET A CA     1 
ATOM   1431 C  C      . MET A 1 90 ? 12.630 -281.290 -2.500  1.00 33.36  ? 434 MET A C      1 
ATOM   1432 O  O      . MET A 1 90 ? 12.814 -281.828 -1.397  1.00 39.00  ? 434 MET A O      1 
ATOM   1433 C  CB     . MET A 1 90 ? 13.062 -278.826 -2.563  1.00 45.00  ? 434 MET A CB     1 
ATOM   1434 C  CG     . MET A 1 90 ? 12.543 -278.800 -1.141  1.00 57.05  ? 434 MET A CG     1 
ATOM   1435 S  SD     . MET A 1 90 ? 10.851 -279.343 -0.899  1.00 53.28  ? 434 MET A SD     1 
ATOM   1436 C  CE     . MET A 1 90 ? 10.001 -278.205 -1.977  1.00 53.17  ? 434 MET A CE     1 
ATOM   1437 H  H      . MET A 1 90 ? 13.376 -279.581 -4.858  1.00 36.97  ? 434 MET A H      1 
ATOM   1438 H  HA     . MET A 1 90 ? 14.437 -280.335 -2.559  1.00 44.39  ? 434 MET A HA     1 
ATOM   1439 H  HB2    . MET A 1 90 ? 13.788 -278.186 -2.625  1.00 54.00  ? 434 MET A HB2    1 
ATOM   1440 H  HB3    . MET A 1 90 ? 12.344 -278.565 -3.158  1.00 54.00  ? 434 MET A HB3    1 
ATOM   1441 H  HG2    . MET A 1 90 ? 13.106 -279.380 -0.605  1.00 68.46  ? 434 MET A HG2    1 
ATOM   1442 H  HG3    . MET A 1 90 ? 12.609 -277.906 -0.803  1.00 68.46  ? 434 MET A HG3    1 
ATOM   1443 H  HE1    . MET A 1 90 ? 9.056  -278.209 -1.757  1.00 63.80  ? 434 MET A HE1    1 
ATOM   1444 H  HE2    . MET A 1 90 ? 10.367 -277.316 -1.848  1.00 63.80  ? 434 MET A HE2    1 
ATOM   1445 H  HE3    . MET A 1 90 ? 10.127 -278.485 -2.897  1.00 63.80  ? 434 MET A HE3    1 
ATOM   1446 N  N      . HIS A 1 91 ? 11.590 -281.615 -3.274  1.00 33.39  ? 435 HIS A N      1 
ATOM   1447 C  CA     . HIS A 1 91 ? 10.643 -282.633 -2.835  1.00 38.55  ? 435 HIS A CA     1 
ATOM   1448 C  C      . HIS A 1 91 ? 11.337 -283.955 -2.623  1.00 49.30  ? 435 HIS A C      1 
ATOM   1449 O  O      . HIS A 1 91 ? 10.920 -284.747 -1.777  1.00 48.02  ? 435 HIS A O      1 
ATOM   1450 C  CB     . HIS A 1 91 ? 9.534  -282.852 -3.855  1.00 33.77  ? 435 HIS A CB     1 
ATOM   1451 C  CG     . HIS A 1 91 ? 8.352  -281.956 -3.689  1.00 34.51  ? 435 HIS A CG     1 
ATOM   1452 N  ND1    . HIS A 1 91 ? 7.444  -282.109 -2.662  1.00 34.74  ? 435 HIS A ND1    1 
ATOM   1453 C  CD2    . HIS A 1 91 ? 7.901  -280.927 -4.440  1.00 33.67  ? 435 HIS A CD2    1 
ATOM   1454 C  CE1    . HIS A 1 91 ? 6.502  -281.190 -2.773  1.00 44.15  ? 435 HIS A CE1    1 
ATOM   1455 N  NE2    . HIS A 1 91 ? 6.749  -280.468 -3.852  1.00 30.51  ? 435 HIS A NE2    1 
ATOM   1456 H  H      . HIS A 1 91 ? 11.416 -281.267 -4.041  1.00 40.06  ? 435 HIS A H      1 
ATOM   1457 H  HA     . HIS A 1 91 ? 10.240 -282.359 -1.996  1.00 46.26  ? 435 HIS A HA     1 
ATOM   1458 H  HB2    . HIS A 1 91 ? 9.895  -282.701 -4.743  1.00 40.53  ? 435 HIS A HB2    1 
ATOM   1459 H  HB3    . HIS A 1 91 ? 9.222  -283.767 -3.781  1.00 40.53  ? 435 HIS A HB3    1 
ATOM   1460 H  HD1    . HIS A 1 91 ? 7.494  -282.697 -2.036  1.00 41.68  ? 435 HIS A HD1    1 
ATOM   1461 H  HD2    . HIS A 1 91 ? 8.300  -280.590 -5.210  1.00 40.41  ? 435 HIS A HD2    1 
ATOM   1462 H  HE1    . HIS A 1 91 ? 5.778  -281.081 -2.200  1.00 52.98  ? 435 HIS A HE1    1 
ATOM   1463 N  N      . GLN A 1 92 ? 12.375 -284.216 -3.409  1.00 39.12  ? 436 GLN A N      1 
ATOM   1464 C  CA     . GLN A 1 92 ? 13.099 -285.471 -3.304  1.00 89.46  ? 436 GLN A CA     1 
ATOM   1465 C  C      . GLN A 1 92 ? 14.109 -285.455 -2.161  1.00 103.85 ? 436 GLN A C      1 
ATOM   1466 O  O      . GLN A 1 92 ? 14.310 -286.481 -1.500  1.00 82.28  ? 436 GLN A O      1 
ATOM   1467 C  CB     . GLN A 1 92 ? 13.803 -285.746 -4.615  1.00 54.04  ? 436 GLN A CB     1 
ATOM   1468 C  CG     . GLN A 1 92 ? 14.600 -286.984 -4.528  1.00 97.09  ? 436 GLN A CG     1 
ATOM   1469 C  CD     . GLN A 1 92 ? 15.088 -287.417 -5.858  1.00 102.68 ? 436 GLN A CD     1 
ATOM   1470 O  OE1    . GLN A 1 92 ? 14.789 -286.795 -6.876  1.00 126.93 ? 436 GLN A OE1    1 
ATOM   1471 N  NE2    . GLN A 1 92 ? 15.841 -288.493 -5.872  1.00 62.72  ? 436 GLN A NE2    1 
ATOM   1472 H  H      . GLN A 1 92 ? 12.679 -283.682 -4.011  1.00 46.94  ? 436 GLN A H      1 
ATOM   1473 H  HA     . GLN A 1 92 ? 12.469 -286.190 -3.142  1.00 107.35 ? 436 GLN A HA     1 
ATOM   1474 H  HB2    . GLN A 1 92 ? 13.143 -285.854 -5.318  1.00 64.85  ? 436 GLN A HB2    1 
ATOM   1475 H  HB3    . GLN A 1 92 ? 14.400 -285.010 -4.821  1.00 64.85  ? 436 GLN A HB3    1 
ATOM   1476 H  HG2    . GLN A 1 92 ? 15.374 -286.837 -3.963  1.00 116.50 ? 436 GLN A HG2    1 
ATOM   1477 H  HG3    . GLN A 1 92 ? 14.046 -287.691 -4.166  1.00 116.50 ? 436 GLN A HG3    1 
ATOM   1478 H  HE21   . GLN A 1 92 ? 15.806 -289.051 -5.219  1.00 75.26  ? 436 GLN A HE21   1 
ATOM   1479 H  HE22   . GLN A 1 92 ? 16.368 -288.639 -6.535  1.00 75.26  ? 436 GLN A HE22   1 
ATOM   1480 N  N      . ARG A 1 93 ? 14.765 -284.309 -1.954  1.00 44.85  ? 437 ARG A N      1 
ATOM   1481 C  CA     . ARG A 1 93 ? 15.723 -284.048 -0.861  1.00 50.22  ? 437 ARG A CA     1 
ATOM   1482 C  C      . ARG A 1 93 ? 17.062 -283.664 -1.499  1.00 53.44  ? 437 ARG A C      1 
ATOM   1483 O  O      . ARG A 1 93 ? 18.021 -284.451 -1.500  1.00 55.54  ? 437 ARG A O      1 
ATOM   1484 C  CB     . ARG A 1 93 ? 15.897 -285.254 0.094   1.00 51.01  ? 437 ARG A CB     1 
ATOM   1485 H  H      . ARG A 1 93 ? 14.666 -283.625 -2.465  1.00 53.82  ? 437 ARG A H      1 
ATOM   1486 H  HA     . ARG A 1 93 ? 15.410 -283.293 -0.338  1.00 60.26  ? 437 ARG A HA     1 
ATOM   1487 O  "O5'"  . DA  B 2 1  ? 11.930 -270.966 -2.037  1.00 61.20  ? 1   DA  B "O5'"  1 
ATOM   1488 C  "C5'"  . DA  B 2 1  ? 10.899 -270.522 -1.176  1.00 34.64  ? 1   DA  B "C5'"  1 
ATOM   1489 C  "C4'"  . DA  B 2 1  ? 10.536 -269.058 -1.432  1.00 46.05  ? 1   DA  B "C4'"  1 
ATOM   1490 O  "O4'"  . DA  B 2 1  ? 11.679 -268.218 -1.110  1.00 39.65  ? 1   DA  B "O4'"  1 
ATOM   1491 C  "C3'"  . DA  B 2 1  ? 10.141 -268.709 -2.868  1.00 39.02  ? 1   DA  B "C3'"  1 
ATOM   1492 O  "O3'"  . DA  B 2 1  ? 9.039  -267.771 -2.870  1.00 43.08  ? 1   DA  B "O3'"  1 
ATOM   1493 C  "C2'"  . DA  B 2 1  ? 11.422 -268.113 -3.462  1.00 38.52  ? 1   DA  B "C2'"  1 
ATOM   1494 C  "C1'"  . DA  B 2 1  ? 12.113 -267.481 -2.248  1.00 31.60  ? 1   DA  B "C1'"  1 
ATOM   1495 N  N9     . DA  B 2 1  ? 13.581 -267.521 -2.298  1.00 35.17  ? 1   DA  B N9     1 
ATOM   1496 C  C8     . DA  B 2 1  ? 14.450 -266.449 -2.342  1.00 38.33  ? 1   DA  B C8     1 
ATOM   1497 N  N7     . DA  B 2 1  ? 15.722 -266.800 -2.376  1.00 29.91  ? 1   DA  B N7     1 
ATOM   1498 C  C5     . DA  B 2 1  ? 15.691 -268.189 -2.380  1.00 31.40  ? 1   DA  B C5     1 
ATOM   1499 C  C6     . DA  B 2 1  ? 16.710 -269.171 -2.372  1.00 25.27  ? 1   DA  B C6     1 
ATOM   1500 N  N6     . DA  B 2 1  ? 18.018 -268.886 -2.404  1.00 33.61  ? 1   DA  B N6     1 
ATOM   1501 N  N1     . DA  B 2 1  ? 16.321 -270.476 -2.368  1.00 32.71  ? 1   DA  B N1     1 
ATOM   1502 C  C2     . DA  B 2 1  ? 15.018 -270.755 -2.347  1.00 33.30  ? 1   DA  B C2     1 
ATOM   1503 N  N3     . DA  B 2 1  ? 13.980 -269.929 -2.318  1.00 39.48  ? 1   DA  B N3     1 
ATOM   1504 C  C4     . DA  B 2 1  ? 14.383 -268.650 -2.315  1.00 31.54  ? 1   DA  B C4     1 
ATOM   1505 H  "H5'"  . DA  B 2 1  ? 11.192 -270.619 -0.256  1.00 41.56  ? 1   DA  B "H5'"  1 
ATOM   1506 H  "H5''" . DA  B 2 1  ? 10.112 -271.072 -1.316  1.00 41.56  ? 1   DA  B "H5''" 1 
ATOM   1507 H  "H4'"  . DA  B 2 1  ? 9.802  -268.817 -0.845  1.00 55.26  ? 1   DA  B "H4'"  1 
ATOM   1508 H  "H3'"  . DA  B 2 1  ? 9.895  -269.514 -3.349  1.00 46.82  ? 1   DA  B "H3'"  1 
ATOM   1509 H  "H2'"  . DA  B 2 1  ? 11.977 -268.809 -3.847  1.00 46.22  ? 1   DA  B "H2'"  1 
ATOM   1510 H  "H2''" . DA  B 2 1  ? 11.209 -267.437 -4.124  1.00 46.22  ? 1   DA  B "H2''" 1 
ATOM   1511 H  "H1'"  . DA  B 2 1  ? 11.822 -266.560 -2.160  1.00 37.93  ? 1   DA  B "H1'"  1 
ATOM   1512 H  H8     . DA  B 2 1  ? 14.167 -265.563 -2.326  1.00 45.99  ? 1   DA  B H8     1 
ATOM   1513 H  H61    . DA  B 2 1  ? 18.596 -269.522 -2.422  1.00 40.34  ? 1   DA  B H61    1 
ATOM   1514 H  H62    . DA  B 2 1  ? 18.280 -268.067 -2.407  1.00 40.34  ? 1   DA  B H62    1 
ATOM   1515 H  H2     . DA  B 2 1  ? 14.806 -271.660 -2.326  1.00 39.96  ? 1   DA  B H2     1 
ATOM   1516 H  "HO5'" . DA  B 2 1  ? 11.863 -270.851 -2.866  1.00 73.44  ? 1   DA  B "HO5'" 1 
ATOM   1517 P  P      . DG  B 2 2  ? 8.178  -267.468 -4.203  1.00 40.81  ? 2   DG  B P      1 
ATOM   1518 O  OP1    . DG  B 2 2  ? 6.928  -266.930 -3.591  1.00 41.65  ? 2   DG  B OP1    1 
ATOM   1519 O  OP2    . DG  B 2 2  ? 8.115  -268.668 -5.081  1.00 45.06  ? 2   DG  B OP2    1 
ATOM   1520 O  "O5'"  . DG  B 2 2  ? 9.029  -266.377 -5.008  1.00 37.90  ? 2   DG  B "O5'"  1 
ATOM   1521 C  "C5'"  . DG  B 2 2  ? 8.969  -265.034 -4.593  1.00 50.26  ? 2   DG  B "C5'"  1 
ATOM   1522 C  "C4'"  A DG  B 2 2  ? 9.816  -264.120 -5.454  0.36 38.71  ? 2   DG  B "C4'"  1 
ATOM   1523 C  "C4'"  B DG  B 2 2  ? 9.763  -264.149 -5.539  0.64 39.00  ? 2   DG  B "C4'"  1 
ATOM   1524 O  "O4'"  A DG  B 2 2  ? 11.224 -264.426 -5.293  0.36 30.08  ? 2   DG  B "O4'"  1 
ATOM   1525 O  "O4'"  B DG  B 2 2  ? 11.184 -264.386 -5.353  0.64 32.28  ? 2   DG  B "O4'"  1 
ATOM   1526 C  "C3'"  A DG  B 2 2  ? 9.540  -264.189 -6.944  0.36 32.60  ? 2   DG  B "C3'"  1 
ATOM   1527 C  "C3'"  B DG  B 2 2  ? 9.473  -264.373 -7.021  0.64 31.51  ? 2   DG  B "C3'"  1 
ATOM   1528 O  "O3'"  A DG  B 2 2  ? 9.463  -262.877 -7.437  0.36 23.63  ? 2   DG  B "O3'"  1 
ATOM   1529 O  "O3'"  B DG  B 2 2  ? 9.153  -263.124 -7.654  0.64 36.49  ? 2   DG  B "O3'"  1 
ATOM   1530 C  "C2'"  A DG  B 2 2  ? 10.732 -264.969 -7.503  0.36 27.35  ? 2   DG  B "C2'"  1 
ATOM   1531 C  "C2'"  B DG  B 2 2  ? 10.754 -265.011 -7.570  0.64 28.23  ? 2   DG  B "C2'"  1 
ATOM   1532 C  "C1'"  A DG  B 2 2  ? 11.838 -264.547 -6.559  0.36 26.53  ? 2   DG  B "C1'"  1 
ATOM   1533 C  "C1'"  B DG  B 2 2  ? 11.826 -264.546 -6.594  0.64 29.67  ? 2   DG  B "C1'"  1 
ATOM   1534 N  N9     . DG  B 2 2  ? 12.934 -265.484 -6.391  1.00 27.14  ? 2   DG  B N9     1 
ATOM   1535 C  C8     . DG  B 2 2  ? 12.860 -266.866 -6.315  1.00 27.10  ? 2   DG  B C8     1 
ATOM   1536 N  N7     . DG  B 2 2  ? 14.019 -267.439 -6.083  1.00 27.84  ? 2   DG  B N7     1 
ATOM   1537 C  C5     . DG  B 2 2  ? 14.906 -266.353 -5.960  1.00 27.50  ? 2   DG  B C5     1 
ATOM   1538 C  C6     . DG  B 2 2  ? 16.309 -266.326 -5.713  1.00 24.44  ? 2   DG  B C6     1 
ATOM   1539 O  O6     . DG  B 2 2  ? 17.082 -267.288 -5.522  1.00 25.87  ? 2   DG  B O6     1 
ATOM   1540 N  N1     . DG  B 2 2  ? 16.800 -265.021 -5.690  1.00 27.49  ? 2   DG  B N1     1 
ATOM   1541 C  C2     . DG  B 2 2  ? 16.039 -263.884 -5.887  1.00 25.94  ? 2   DG  B C2     1 
ATOM   1542 N  N2     . DG  B 2 2  ? 16.682 -262.702 -5.817  1.00 29.90  ? 2   DG  B N2     1 
ATOM   1543 N  N3     . DG  B 2 2  ? 14.739 -263.895 -6.120  1.00 26.55  ? 2   DG  B N3     1 
ATOM   1544 C  C4     . DG  B 2 2  ? 14.239 -265.159 -6.132  1.00 26.36  ? 2   DG  B C4     1 
ATOM   1545 H  "H5'"  A DG  B 2 2  ? 9.279  -264.976 -3.676  0.36 60.31  ? 2   DG  B "H5'"  1 
ATOM   1546 H  "H5'"  B DG  B 2 2  ? 9.338  -264.958 -3.699  0.64 60.31  ? 2   DG  B "H5'"  1 
ATOM   1547 H  "H5''" A DG  B 2 2  ? 8.047  -264.735 -4.632  0.36 60.31  ? 2   DG  B "H5''" 1 
ATOM   1548 H  "H5''" B DG  B 2 2  ? 8.044  -264.743 -4.583  0.64 60.31  ? 2   DG  B "H5''" 1 
ATOM   1549 H  "H4'"  A DG  B 2 2  ? 9.669  -263.207 -5.161  0.36 46.46  ? 2   DG  B "H4'"  1 
ATOM   1550 H  "H4'"  B DG  B 2 2  ? 9.574  -263.222 -5.325  0.64 46.80  ? 2   DG  B "H4'"  1 
ATOM   1551 H  "H3'"  A DG  B 2 2  ? 8.712  -264.666 -7.113  0.36 39.12  ? 2   DG  B "H3'"  1 
ATOM   1552 H  "H3'"  B DG  B 2 2  ? 8.731  -264.990 -7.119  0.64 37.81  ? 2   DG  B "H3'"  1 
ATOM   1553 H  "H2'"  A DG  B 2 2  ? 10.575 -265.925 -7.450  0.36 32.82  ? 2   DG  B "H2'"  1 
ATOM   1554 H  "H2'"  B DG  B 2 2  ? 10.681 -265.978 -7.564  0.64 33.87  ? 2   DG  B "H2'"  1 
ATOM   1555 H  "H2''" A DG  B 2 2  ? 10.930 -264.697 -8.412  0.36 32.82  ? 2   DG  B "H2''" 1 
ATOM   1556 H  "H2''" B DG  B 2 2  ? 10.944 -264.687 -8.463  0.64 33.87  ? 2   DG  B "H2''" 1 
ATOM   1557 H  "H1'"  A DG  B 2 2  ? 12.187 -263.684 -6.833  0.36 31.84  ? 2   DG  B "H1'"  1 
ATOM   1558 H  "H1'"  B DG  B 2 2  ? 12.178 -263.691 -6.886  0.64 35.60  ? 2   DG  B "H1'"  1 
ATOM   1559 H  H8     . DG  B 2 2  ? 12.069 -267.342 -6.430  1.00 32.52  ? 2   DG  B H8     1 
ATOM   1560 H  H1     . DG  B 2 2  ? 17.641 -264.916 -5.543  1.00 32.99  ? 2   DG  B H1     1 
ATOM   1561 H  H21    . DG  B 2 2  ? 16.246 -261.968 -5.923  1.00 35.88  ? 2   DG  B H21    1 
ATOM   1562 H  H22    . DG  B 2 2  ? 17.528 -262.681 -5.666  1.00 35.88  ? 2   DG  B H22    1 
ATOM   1563 P  P      . DC  B 2 3  ? 9.194  -262.595 -8.989  1.00 32.53  ? 3   DC  B P      1 
ATOM   1564 O  OP1    . DC  B 2 3  ? 8.453  -261.322 -8.975  1.00 48.19  ? 3   DC  B OP1    1 
ATOM   1565 O  OP2    . DC  B 2 3  ? 8.605  -263.787 -9.651  1.00 32.14  ? 3   DC  B OP2    1 
ATOM   1566 O  "O5'"  . DC  B 2 3  ? 10.629 -262.309 -9.558  1.00 26.48  ? 3   DC  B "O5'"  1 
ATOM   1567 C  "C5'"  . DC  B 2 3  ? 11.349 -261.214 -9.092  1.00 30.98  ? 3   DC  B "C5'"  1 
ATOM   1568 C  "C4'"  . DC  B 2 3  ? 12.744 -261.286 -9.612  1.00 29.08  ? 3   DC  B "C4'"  1 
ATOM   1569 O  "O4'"  . DC  B 2 3  ? 13.429 -262.436 -9.027  1.00 27.58  ? 3   DC  B "O4'"  1 
ATOM   1570 C  "C3'"  . DC  B 2 3  ? 12.849 -261.477 -11.147 1.00 27.68  ? 3   DC  B "C3'"  1 
ATOM   1571 O  "O3'"  . DC  B 2 3  ? 13.830 -260.633 -11.640 1.00 22.32  ? 3   DC  B "O3'"  1 
ATOM   1572 C  "C2'"  . DC  B 2 3  ? 13.268 -262.936 -11.263 1.00 25.03  ? 3   DC  B "C2'"  1 
ATOM   1573 C  "C1'"  . DC  B 2 3  ? 14.191 -263.009 -10.062 1.00 29.71  ? 3   DC  B "C1'"  1 
ATOM   1574 N  N1     . DC  B 2 3  ? 14.688 -264.369 -9.709  1.00 25.87  ? 3   DC  B N1     1 
ATOM   1575 C  C2     . DC  B 2 3  ? 16.007 -264.489 -9.244  1.00 23.62  ? 3   DC  B C2     1 
ATOM   1576 O  O2     . DC  B 2 3  ? 16.680 -263.457 -9.090  1.00 24.58  ? 3   DC  B O2     1 
ATOM   1577 N  N3     . DC  B 2 3  ? 16.497 -265.706 -8.978  1.00 24.54  ? 3   DC  B N3     1 
ATOM   1578 C  C4     . DC  B 2 3  ? 15.730 -266.787 -9.134  1.00 24.37  ? 3   DC  B C4     1 
ATOM   1579 N  N4     . DC  B 2 3  ? 16.258 -267.968 -8.844  1.00 26.16  ? 3   DC  B N4     1 
ATOM   1580 C  C5     . DC  B 2 3  ? 14.381 -266.696 -9.602  1.00 27.07  ? 3   DC  B C5     1 
ATOM   1581 C  C6     . DC  B 2 3  ? 13.909 -265.471 -9.878  1.00 22.28  ? 3   DC  B C6     1 
ATOM   1582 H  "H5'"  . DC  B 2 3  ? 11.364 -261.225 -8.122  1.00 37.18  ? 3   DC  B "H5'"  1 
ATOM   1583 H  "H5''" . DC  B 2 3  ? 10.930 -260.395 -9.401  1.00 37.18  ? 3   DC  B "H5''" 1 
ATOM   1584 H  "H4'"  . DC  B 2 3  ? 13.216 -260.477 -9.362  1.00 34.90  ? 3   DC  B "H4'"  1 
ATOM   1585 H  "H3'"  . DC  B 2 3  ? 11.995 -261.320 -11.580 1.00 33.21  ? 3   DC  B "H3'"  1 
ATOM   1586 H  "H2'"  . DC  B 2 3  ? 12.508 -263.530 -11.163 1.00 30.03  ? 3   DC  B "H2'"  1 
ATOM   1587 H  "H2''" . DC  B 2 3  ? 13.748 -263.102 -12.089 1.00 30.03  ? 3   DC  B "H2''" 1 
ATOM   1588 H  "H1'"  . DC  B 2 3  ? 14.955 -262.438 -10.231 1.00 35.65  ? 3   DC  B "H1'"  1 
ATOM   1589 H  H41    . DC  B 2 3  ? 15.788 -268.683 -8.934  1.00 31.39  ? 3   DC  B H41    1 
ATOM   1590 H  H42    . DC  B 2 3  ? 17.070 -268.019 -8.565  1.00 31.39  ? 3   DC  B H42    1 
ATOM   1591 H  H5     . DC  B 2 3  ? 13.858 -267.455 -9.723  1.00 32.49  ? 3   DC  B H5     1 
ATOM   1592 H  H6     . DC  B 2 3  ? 13.042 -265.375 -10.201 1.00 26.73  ? 3   DC  B H6     1 
ATOM   1593 P  P      . DG  B 2 4  ? 13.693 -259.829 -13.015 1.00 25.77  ? 4   DG  B P      1 
ATOM   1594 O  OP1    . DG  B 2 4  ? 12.703 -258.737 -12.804 1.00 29.16  ? 4   DG  B OP1    1 
ATOM   1595 O  OP2    . DG  B 2 4  ? 13.465 -260.800 -14.131 1.00 27.99  ? 4   DG  B OP2    1 
ATOM   1596 O  "O5'"  . DG  B 2 4  ? 15.172 -259.298 -13.160 1.00 24.61  ? 4   DG  B "O5'"  1 
ATOM   1597 C  "C5'"  . DG  B 2 4  ? 15.737 -258.448 -12.122 1.00 30.70  ? 4   DG  B "C5'"  1 
ATOM   1598 C  "C4'"  . DG  B 2 4  ? 17.248 -258.514 -12.136 1.00 25.12  ? 4   DG  B "C4'"  1 
ATOM   1599 O  "O4'"  . DG  B 2 4  ? 17.686 -259.776 -11.561 1.00 25.73  ? 4   DG  B "O4'"  1 
ATOM   1600 C  "C3'"  . DG  B 2 4  ? 17.861 -258.440 -13.540 1.00 22.83  ? 4   DG  B "C3'"  1 
ATOM   1601 O  "O3'"  . DG  B 2 4  ? 19.051 -257.728 -13.517 1.00 27.91  ? 4   DG  B "O3'"  1 
ATOM   1602 C  "C2'"  . DG  B 2 4  ? 18.097 -259.900 -13.883 1.00 21.81  ? 4   DG  B "C2'"  1 
ATOM   1603 C  "C1'"  . DG  B 2 4  ? 18.442 -260.493 -12.511 1.00 22.37  ? 4   DG  B "C1'"  1 
ATOM   1604 N  N9     . DG  B 2 4  ? 18.105 -261.899 -12.389 1.00 24.00  ? 4   DG  B N9     1 
ATOM   1605 C  C8     . DG  B 2 4  ? 16.863 -262.456 -12.495 1.00 24.28  ? 4   DG  B C8     1 
ATOM   1606 N  N7     . DG  B 2 4  ? 16.873 -263.772 -12.356 1.00 28.84  ? 4   DG  B N7     1 
ATOM   1607 C  C5     . DG  B 2 4  ? 18.216 -264.076 -12.151 1.00 23.16  ? 4   DG  B C5     1 
ATOM   1608 C  C6     . DG  B 2 4  ? 18.834 -265.332 -11.929 1.00 19.04  ? 4   DG  B C6     1 
ATOM   1609 O  O6     . DG  B 2 4  ? 18.320 -266.427 -11.887 1.00 22.34  ? 4   DG  B O6     1 
ATOM   1610 N  N1     . DG  B 2 4  ? 20.205 -265.212 -11.778 1.00 21.96  ? 4   DG  B N1     1 
ATOM   1611 C  C2     . DG  B 2 4  ? 20.889 -264.031 -11.801 1.00 22.29  ? 4   DG  B C2     1 
ATOM   1612 N  N2     . DG  B 2 4  ? 22.207 -264.131 -11.635 1.00 27.19  ? 4   DG  B N2     1 
ATOM   1613 N  N3     . DG  B 2 4  ? 20.332 -262.839 -11.982 1.00 24.30  ? 4   DG  B N3     1 
ATOM   1614 C  C4     . DG  B 2 4  ? 18.983 -262.949 -12.167 1.00 22.57  ? 4   DG  B C4     1 
ATOM   1615 H  "H5'"  . DG  B 2 4  ? 15.413 -258.743 -11.257 1.00 36.84  ? 4   DG  B "H5'"  1 
ATOM   1616 H  "H5''" . DG  B 2 4  ? 15.456 -257.532 -12.272 1.00 36.84  ? 4   DG  B "H5''" 1 
ATOM   1617 H  "H4'"  . DG  B 2 4  ? 17.600 -257.786 -11.601 1.00 30.15  ? 4   DG  B "H4'"  1 
ATOM   1618 H  "H3'"  . DG  B 2 4  ? 17.234 -258.041 -14.163 1.00 27.39  ? 4   DG  B "H3'"  1 
ATOM   1619 H  "H2'"  . DG  B 2 4  ? 17.293 -260.305 -14.243 1.00 26.17  ? 4   DG  B "H2'"  1 
ATOM   1620 H  "H2''" . DG  B 2 4  ? 18.841 -259.995 -14.498 1.00 26.17  ? 4   DG  B "H2''" 1 
ATOM   1621 H  "H1'"  . DG  B 2 4  ? 19.387 -260.369 -12.333 1.00 26.84  ? 4   DG  B "H1'"  1 
ATOM   1622 H  H8     . DG  B 2 4  ? 16.090 -261.962 -12.648 1.00 29.13  ? 4   DG  B H8     1 
ATOM   1623 H  H1     . DG  B 2 4  ? 20.655 -265.931 -11.635 1.00 26.35  ? 4   DG  B H1     1 
ATOM   1624 H  H21    . DG  B 2 4  ? 22.697 -263.424 -11.645 1.00 32.63  ? 4   DG  B H21    1 
ATOM   1625 H  H22    . DG  B 2 4  ? 22.568 -264.903 -11.518 1.00 32.63  ? 4   DG  B H22    1 
ATOM   1626 P  P      A DT  B 2 5  ? 19.672 -257.148 -14.881 0.13 21.96  ? 5   DT  B P      1 
ATOM   1627 P  P      B DT  B 2 5  ? 19.690 -257.166 -14.878 0.87 27.02  ? 5   DT  B P      1 
ATOM   1628 O  OP1    A DT  B 2 5  ? 20.564 -256.030 -14.498 0.13 22.24  ? 5   DT  B OP1    1 
ATOM   1629 O  OP1    B DT  B 2 5  ? 20.633 -256.127 -14.409 0.87 33.08  ? 5   DT  B OP1    1 
ATOM   1630 O  OP2    A DT  B 2 5  ? 18.566 -256.918 -15.830 0.13 18.98  ? 5   DT  B OP2    1 
ATOM   1631 O  OP2    B DT  B 2 5  ? 18.629 -256.880 -15.835 0.87 25.08  ? 5   DT  B OP2    1 
ATOM   1632 O  "O5'"  A DT  B 2 5  ? 20.556 -258.354 -15.446 0.13 22.07  ? 5   DT  B "O5'"  1 
ATOM   1633 O  "O5'"  B DT  B 2 5  ? 20.528 -258.380 -15.463 0.87 28.28  ? 5   DT  B "O5'"  1 
ATOM   1634 C  "C5'"  A DT  B 2 5  ? 21.657 -258.845 -14.690 0.13 17.14  ? 5   DT  B "C5'"  1 
ATOM   1635 C  "C5'"  B DT  B 2 5  ? 21.766 -258.740 -14.894 0.87 28.54  ? 5   DT  B "C5'"  1 
ATOM   1636 C  "C4'"  A DT  B 2 5  ? 22.259 -260.083 -15.337 0.13 27.85  ? 5   DT  B "C4'"  1 
ATOM   1637 C  "C4'"  B DT  B 2 5  ? 22.276 -260.022 -15.529 0.87 30.93  ? 5   DT  B "C4'"  1 
ATOM   1638 O  "O4'"  A DT  B 2 5  ? 21.504 -261.264 -14.941 0.13 21.74  ? 5   DT  B "O4'"  1 
ATOM   1639 O  "O4'"  B DT  B 2 5  ? 21.467 -261.145 -15.055 0.87 25.60  ? 5   DT  B "O4'"  1 
ATOM   1640 C  "C3'"  A DT  B 2 5  ? 22.241 -260.098 -16.874 0.13 12.73  ? 5   DT  B "C3'"  1 
ATOM   1641 C  "C3'"  B DT  B 2 5  ? 22.187 -260.080 -17.071 0.87 29.02  ? 5   DT  B "C3'"  1 
ATOM   1642 O  "O3'"  A DT  B 2 5  ? 23.477 -260.603 -17.390 0.13 11.70  ? 5   DT  B "O3'"  1 
ATOM   1643 O  "O3'"  B DT  B 2 5  ? 23.416 -260.546 -17.653 0.87 29.65  ? 5   DT  B "O3'"  1 
ATOM   1644 C  "C2'"  A DT  B 2 5  ? 21.081 -261.028 -17.185 0.13 21.48  ? 5   DT  B "C2'"  1 
ATOM   1645 C  "C2'"  B DT  B 2 5  ? 21.054 -261.062 -17.311 0.87 24.92  ? 5   DT  B "C2'"  1 
ATOM   1646 C  "C1'"  A DT  B 2 5  ? 21.308 -262.044 -16.097 0.13 14.07  ? 5   DT  B "C1'"  1 
ATOM   1647 C  "C1'"  B DT  B 2 5  ? 21.297 -262.014 -16.142 0.87 30.77  ? 5   DT  B "C1'"  1 
ATOM   1648 N  N1     . DT  B 2 5  ? 20.230 -263.027 -15.867 1.00 21.38  ? 5   DT  B N1     1 
ATOM   1649 C  C2     . DT  B 2 5  ? 20.607 -264.304 -15.464 1.00 18.38  ? 5   DT  B C2     1 
ATOM   1650 O  O2     . DT  B 2 5  ? 21.773 -264.622 -15.302 1.00 22.21  ? 5   DT  B O2     1 
ATOM   1651 N  N3     . DT  B 2 5  ? 19.607 -265.169 -15.274 1.00 18.58  ? 5   DT  B N3     1 
ATOM   1652 C  C4     . DT  B 2 5  ? 18.256 -264.922 -15.411 1.00 20.46  ? 5   DT  B C4     1 
ATOM   1653 O  O4     . DT  B 2 5  ? 17.426 -265.775 -15.205 1.00 23.53  ? 5   DT  B O4     1 
ATOM   1654 C  C5     . DT  B 2 5  ? 17.901 -263.583 -15.821 1.00 20.28  ? 5   DT  B C5     1 
ATOM   1655 C  C7     . DT  B 2 5  ? 16.456 -263.244 -15.978 1.00 25.04  ? 5   DT  B C7     1 
ATOM   1656 C  C6     . DT  B 2 5  ? 18.892 -262.698 -16.030 1.00 22.09  ? 5   DT  B C6     1 
ATOM   1657 H  "H5'"  A DT  B 2 5  ? 21.354 -259.069 -13.796 0.13 20.57  ? 5   DT  B "H5'"  1 
ATOM   1658 H  "H5'"  B DT  B 2 5  ? 21.654 -258.876 -13.940 0.87 34.25  ? 5   DT  B "H5'"  1 
ATOM   1659 H  "H5''" A DT  B 2 5  ? 22.336 -258.155 -14.632 0.13 20.57  ? 5   DT  B "H5''" 1 
ATOM   1660 H  "H5''" B DT  B 2 5  ? 22.408 -258.029 -15.045 0.87 34.25  ? 5   DT  B "H5''" 1 
ATOM   1661 H  "H4'"  A DT  B 2 5  ? 23.175 -260.181 -15.034 0.13 33.43  ? 5   DT  B "H4'"  1 
ATOM   1662 H  "H4'"  B DT  B 2 5  ? 23.198 -260.162 -15.261 0.87 37.11  ? 5   DT  B "H4'"  1 
ATOM   1663 H  "H3'"  A DT  B 2 5  ? 22.065 -259.209 -17.220 0.13 15.27  ? 5   DT  B "H3'"  1 
ATOM   1664 H  "H3'"  B DT  B 2 5  ? 21.955 -259.208 -17.426 0.87 34.82  ? 5   DT  B "H3'"  1 
ATOM   1665 H  "H2'"  A DT  B 2 5  ? 20.229 -260.577 -17.079 0.13 25.77  ? 5   DT  B "H2'"  1 
ATOM   1666 H  "H2'"  B DT  B 2 5  ? 20.190 -260.626 -17.239 0.87 29.90  ? 5   DT  B "H2'"  1 
ATOM   1667 H  "H2''" A DT  B 2 5  ? 21.171 -261.425 -18.065 0.13 25.77  ? 5   DT  B "H2''" 1 
ATOM   1668 H  "H2''" B DT  B 2 5  ? 21.156 -261.516 -18.162 0.87 29.90  ? 5   DT  B "H2''" 1 
ATOM   1669 H  "H1'"  A DT  B 2 5  ? 22.129 -262.523 -16.290 0.13 16.88  ? 5   DT  B "H1'"  1 
ATOM   1670 H  "H1'"  B DT  B 2 5  ? 22.133 -262.481 -16.296 0.87 36.92  ? 5   DT  B "H1'"  1 
ATOM   1671 H  H3     . DT  B 2 5  ? 19.828 -265.961 -15.021 1.00 22.30  ? 5   DT  B H3     1 
ATOM   1672 H  H71    . DT  B 2 5  ? 15.963 -264.040 -16.229 1.00 30.04  ? 5   DT  B H71    1 
ATOM   1673 H  H72    . DT  B 2 5  ? 16.111 -262.902 -15.139 1.00 30.04  ? 5   DT  B H72    1 
ATOM   1674 H  H73    . DT  B 2 5  ? 16.355 -262.570 -16.668 1.00 30.04  ? 5   DT  B H73    1 
ATOM   1675 H  H6     . DT  B 2 5  ? 18.672 -261.835 -16.296 1.00 26.51  ? 5   DT  B H6     1 
ATOM   1676 P  P      A DG  B 2 6  ? 24.461 -259.610 -18.171 0.51 34.12  ? 6   DG  B P      1 
ATOM   1677 P  P      B DG  B 2 6  ? 24.012 -259.858 -18.986 0.49 17.68  ? 6   DG  B P      1 
ATOM   1678 O  OP1    A DG  B 2 6  ? 25.163 -258.813 -17.137 0.51 50.60  ? 6   DG  B OP1    1 
ATOM   1679 O  OP1    B DG  B 2 6  ? 24.493 -258.499 -18.564 0.49 14.27  ? 6   DG  B OP1    1 
ATOM   1680 O  OP2    A DG  B 2 6  ? 23.676 -258.937 -19.224 0.51 24.94  ? 6   DG  B OP2    1 
ATOM   1681 O  OP2    B DG  B 2 6  ? 23.039 -259.916 -20.107 0.49 20.33  ? 6   DG  B OP2    1 
ATOM   1682 O  "O5'"  A DG  B 2 6  ? 25.528 -260.525 -18.945 0.51 17.15  ? 6   DG  B "O5'"  1 
ATOM   1683 O  "O5'"  B DG  B 2 6  ? 25.114 -260.943 -19.503 0.49 40.04  ? 6   DG  B "O5'"  1 
ATOM   1684 C  "C5'"  A DG  B 2 6  ? 25.184 -261.692 -19.690 0.51 16.91  ? 6   DG  B "C5'"  1 
ATOM   1685 C  "C5'"  B DG  B 2 6  ? 26.168 -261.386 -18.642 0.49 54.00  ? 6   DG  B "C5'"  1 
ATOM   1686 C  "C4'"  A DG  B 2 6  ? 25.919 -262.854 -19.094 0.51 11.79  ? 6   DG  B "C4'"  1 
ATOM   1687 C  "C4'"  B DG  B 2 6  ? 26.332 -262.920 -18.593 0.49 34.60  ? 6   DG  B "C4'"  1 
ATOM   1688 O  "O4'"  A DG  B 2 6  ? 25.162 -263.337 -17.969 0.51 17.19  ? 6   DG  B "O4'"  1 
ATOM   1689 O  "O4'"  B DG  B 2 6  ? 25.248 -263.441 -17.815 0.49 26.83  ? 6   DG  B "O4'"  1 
ATOM   1690 C  "C3'"  A DG  B 2 6  ? 26.160 -264.068 -19.979 0.51 13.29  ? 6   DG  B "C3'"  1 
ATOM   1691 C  "C3'"  B DG  B 2 6  ? 26.274 -263.755 -19.895 0.49 38.60  ? 6   DG  B "C3'"  1 
ATOM   1692 O  "O3'"  A DG  B 2 6  ? 27.443 -263.982 -20.567 0.51 16.73  ? 6   DG  B "O3'"  1 
ATOM   1693 O  "O3'"  B DG  B 2 6  ? 27.544 -263.852 -20.578 0.49 40.73  ? 6   DG  B "O3'"  1 
ATOM   1694 C  "C2'"  A DG  B 2 6  ? 26.077 -265.224 -19.009 0.51 13.25  ? 6   DG  B "C2'"  1 
ATOM   1695 C  "C2'"  B DG  B 2 6  ? 25.882 -265.117 -19.358 0.49 34.30  ? 6   DG  B "C2'"  1 
ATOM   1696 C  "C1'"  A DG  B 2 6  ? 25.080 -264.741 -17.992 0.51 14.56  ? 6   DG  B "C1'"  1 
ATOM   1697 C  "C1'"  B DG  B 2 6  ? 25.090 -264.808 -18.093 0.49 30.10  ? 6   DG  B "C1'"  1 
ATOM   1698 N  N9     . DG  B 2 6  ? 23.683 -265.100 -18.254 1.00 21.50  ? 6   DG  B N9     1 
ATOM   1699 C  C8     . DG  B 2 6  ? 22.664 -264.217 -18.494 1.00 24.85  ? 6   DG  B C8     1 
ATOM   1700 N  N7     . DG  B 2 6  ? 21.516 -264.773 -18.587 1.00 24.33  ? 6   DG  B N7     1 
ATOM   1701 C  C5     . DG  B 2 6  ? 21.784 -266.123 -18.380 1.00 19.99  ? 6   DG  B C5     1 
ATOM   1702 C  C6     . DG  B 2 6  ? 20.929 -267.238 -18.364 1.00 18.27  ? 6   DG  B C6     1 
ATOM   1703 O  O6     . DG  B 2 6  ? 19.691 -267.288 -18.533 1.00 21.64  ? 6   DG  B O6     1 
ATOM   1704 N  N1     . DG  B 2 6  ? 21.634 -268.426 -18.123 1.00 21.05  ? 6   DG  B N1     1 
ATOM   1705 C  C2     . DG  B 2 6  ? 22.993 -268.512 -17.919 1.00 20.40  ? 6   DG  B C2     1 
ATOM   1706 N  N2     . DG  B 2 6  ? 23.490 -269.732 -17.714 1.00 25.92  ? 6   DG  B N2     1 
ATOM   1707 N  N3     . DG  B 2 6  ? 23.802 -267.472 -17.921 1.00 19.94  ? 6   DG  B N3     1 
ATOM   1708 C  C4     . DG  B 2 6  ? 23.127 -266.314 -18.166 1.00 20.29  ? 6   DG  B C4     1 
ATOM   1709 H  "H5'"  A DG  B 2 6  ? 25.446 -261.579 -20.617 0.51 20.29  ? 6   DG  B "H5'"  1 
ATOM   1710 H  "H5'"  B DG  B 2 6  ? 25.975 -261.074 -17.746 0.49 64.80  ? 6   DG  B "H5'"  1 
ATOM   1711 H  "H5''" A DG  B 2 6  ? 24.228 -261.846 -19.636 0.51 20.29  ? 6   DG  B "H5''" 1 
ATOM   1712 H  "H5''" B DG  B 2 6  ? 26.991 -260.995 -18.922 0.49 64.80  ? 6   DG  B "H5''" 1 
ATOM   1713 H  "H4'"  A DG  B 2 6  ? 26.777 -262.538 -18.772 0.51 14.15  ? 6   DG  B "H4'"  1 
ATOM   1714 H  "H4'"  B DG  B 2 6  ? 27.163 -263.123 -18.137 0.49 41.52  ? 6   DG  B "H4'"  1 
ATOM   1715 H  "H3'"  A DG  B 2 6  ? 25.472 -264.139 -20.659 0.51 15.95  ? 6   DG  B "H3'"  1 
ATOM   1716 H  "H3'"  B DG  B 2 6  ? 25.588 -263.413 -20.490 0.49 46.32  ? 6   DG  B "H3'"  1 
ATOM   1717 H  "H2'"  A DG  B 2 6  ? 25.753 -266.022 -19.454 0.51 15.90  ? 6   DG  B "H2'"  1 
ATOM   1718 H  "H2'"  B DG  B 2 6  ? 25.327 -265.585 -19.998 0.49 41.16  ? 6   DG  B "H2'"  1 
ATOM   1719 H  "H2''" A DG  B 2 6  ? 26.939 -265.386 -18.594 0.51 15.90  ? 6   DG  B "H2''" 1 
ATOM   1720 H  "H2''" B DG  B 2 6  ? 26.672 -265.638 -19.145 0.49 41.16  ? 6   DG  B "H2''" 1 
ATOM   1721 H  "H1'"  A DG  B 2 6  ? 25.332 -265.083 -17.120 0.51 17.47  ? 6   DG  B "H1'"  1 
ATOM   1722 H  "H1'"  B DG  B 2 6  ? 25.445 -265.329 -17.356 0.49 36.12  ? 6   DG  B "H1'"  1 
ATOM   1723 H  H8     . DG  B 2 6  ? 22.794 -263.300 -18.576 1.00 29.81  ? 6   DG  B H8     1 
ATOM   1724 H  H1     . DG  B 2 6  ? 21.183 -269.158 -18.102 1.00 25.26  ? 6   DG  B H1     1 
ATOM   1725 H  H21    . DG  B 2 6  ? 24.334 -269.836 -17.584 1.00 31.10  ? 6   DG  B H21    1 
ATOM   1726 H  H22    . DG  B 2 6  ? 22.967 -270.415 -17.712 1.00 31.10  ? 6   DG  B H22    1 
ATOM   1727 P  P      . DG  B 2 7  ? 27.697 -264.493 -22.070 1.00 24.45  ? 7   DG  B P      1 
ATOM   1728 O  OP1    . DG  B 2 7  ? 29.134 -264.153 -22.298 1.00 25.21  ? 7   DG  B OP1    1 
ATOM   1729 O  OP2    . DG  B 2 7  ? 26.566 -264.093 -22.965 1.00 25.76  ? 7   DG  B OP2    1 
ATOM   1730 O  "O5'"  . DG  B 2 7  ? 27.572 -266.093 -21.937 1.00 26.17  ? 7   DG  B "O5'"  1 
ATOM   1731 C  "C5'"  . DG  B 2 7  ? 28.522 -266.826 -21.183 1.00 25.42  ? 7   DG  B "C5'"  1 
ATOM   1732 C  "C4'"  . DG  B 2 7  ? 28.210 -268.293 -21.216 1.00 25.66  ? 7   DG  B "C4'"  1 
ATOM   1733 O  "O4'"  . DG  B 2 7  ? 26.929 -268.508 -20.591 1.00 32.94  ? 7   DG  B "O4'"  1 
ATOM   1734 C  "C3'"  . DG  B 2 7  ? 28.132 -268.869 -22.641 1.00 39.87  ? 7   DG  B "C3'"  1 
ATOM   1735 O  "O3'"  . DG  B 2 7  ? 29.016 -269.934 -22.802 1.00 30.51  ? 7   DG  B "O3'"  1 
ATOM   1736 C  "C2'"  . DG  B 2 7  ? 26.694 -269.306 -22.807 1.00 53.29  ? 7   DG  B "C2'"  1 
ATOM   1737 C  "C1'"  . DG  B 2 7  ? 26.110 -269.314 -21.408 1.00 49.46  ? 7   DG  B "C1'"  1 
ATOM   1738 N  N9     . DG  B 2 7  ? 24.746 -268.795 -21.420 1.00 30.61  ? 7   DG  B N9     1 
ATOM   1739 C  C8     . DG  B 2 7  ? 24.356 -267.500 -21.583 1.00 23.14  ? 7   DG  B C8     1 
ATOM   1740 N  N7     . DG  B 2 7  ? 23.068 -267.356 -21.598 1.00 22.61  ? 7   DG  B N7     1 
ATOM   1741 C  C5     . DG  B 2 7  ? 22.589 -268.635 -21.467 1.00 22.73  ? 7   DG  B C5     1 
ATOM   1742 C  C6     . DG  B 2 7  ? 21.271 -269.106 -21.441 1.00 21.26  ? 7   DG  B C6     1 
ATOM   1743 O  O6     . DG  B 2 7  ? 20.229 -268.457 -21.522 1.00 29.21  ? 7   DG  B O6     1 
ATOM   1744 N  N1     . DG  B 2 7  ? 21.223 -270.484 -21.305 1.00 25.29  ? 7   DG  B N1     1 
ATOM   1745 C  C2     . DG  B 2 7  ? 22.307 -271.284 -21.208 1.00 30.47  ? 7   DG  B C2     1 
ATOM   1746 N  N2     . DG  B 2 7  ? 22.073 -272.572 -21.084 1.00 32.03  ? 7   DG  B N2     1 
ATOM   1747 N  N3     . DG  B 2 7  ? 23.542 -270.858 -21.259 1.00 32.41  ? 7   DG  B N3     1 
ATOM   1748 C  C4     . DG  B 2 7  ? 23.605 -269.524 -21.360 1.00 29.91  ? 7   DG  B C4     1 
ATOM   1749 H  "H5'"  . DG  B 2 7  ? 28.507 -266.517 -20.264 1.00 30.50  ? 7   DG  B "H5'"  1 
ATOM   1750 H  "H5''" . DG  B 2 7  ? 29.406 -266.679 -21.554 1.00 30.50  ? 7   DG  B "H5''" 1 
ATOM   1751 H  "H4'"  . DG  B 2 7  ? 28.890 -268.773 -20.717 1.00 30.79  ? 7   DG  B "H4'"  1 
ATOM   1752 H  "H3'"  . DG  B 2 7  ? 28.338 -268.174 -23.285 1.00 47.84  ? 7   DG  B "H3'"  1 
ATOM   1753 H  "H2'"  . DG  B 2 7  ? 26.215 -268.676 -23.367 1.00 63.95  ? 7   DG  B "H2'"  1 
ATOM   1754 H  "H2''" . DG  B 2 7  ? 26.650 -270.191 -23.187 1.00 63.95  ? 7   DG  B "H2''" 1 
ATOM   1755 H  "H1'"  . DG  B 2 7  ? 26.107 -270.221 -21.065 1.00 59.35  ? 7   DG  B "H1'"  1 
ATOM   1756 H  H8     . DG  B 2 7  ? 24.952 -266.789 -21.644 1.00 27.77  ? 7   DG  B H8     1 
ATOM   1757 H  H1     . DG  B 2 7  ? 20.448 -270.855 -21.269 1.00 30.35  ? 7   DG  B H1     1 
ATOM   1758 H  H21    . DG  B 2 7  ? 21.264 -272.861 -21.050 1.00 38.44  ? 7   DG  B H21    1 
ATOM   1759 H  H22    . DG  B 2 7  ? 22.729 -273.126 -21.037 1.00 38.44  ? 7   DG  B H22    1 
ATOM   1760 P  P      . DG  B 2 8  ? 29.205 -270.604 -24.240 1.00 35.00  ? 8   DG  B P      1 
ATOM   1761 O  OP1    . DG  B 2 8  ? 30.389 -271.477 -24.068 1.00 36.76  ? 8   DG  B OP1    1 
ATOM   1762 O  OP2    . DG  B 2 8  ? 29.217 -269.595 -25.340 1.00 45.74  ? 8   DG  B OP2    1 
ATOM   1763 O  "O5'"  . DG  B 2 8  ? 27.866 -271.471 -24.471 1.00 37.55  ? 8   DG  B "O5'"  1 
ATOM   1764 C  "C5'"  . DG  B 2 8  ? 27.678 -272.703 -23.744 1.00 31.64  ? 8   DG  B "C5'"  1 
ATOM   1765 C  "C4'"  . DG  B 2 8  ? 26.402 -273.391 -24.153 1.00 38.37  ? 8   DG  B "C4'"  1 
ATOM   1766 O  "O4'"  . DG  B 2 8  ? 25.279 -272.614 -23.711 1.00 39.72  ? 8   DG  B "O4'"  1 
ATOM   1767 C  "C3'"  . DG  B 2 8  ? 26.239 -273.573 -25.655 1.00 45.70  ? 8   DG  B "C3'"  1 
ATOM   1768 O  "O3'"  . DG  B 2 8  ? 26.441 -274.932 -26.015 1.00 45.08  ? 8   DG  B "O3'"  1 
ATOM   1769 C  "C2'"  . DG  B 2 8  ? 24.814 -273.126 -25.947 1.00 47.11  ? 8   DG  B "C2'"  1 
ATOM   1770 C  "C1'"  . DG  B 2 8  ? 24.221 -272.793 -24.600 1.00 52.62  ? 8   DG  B "C1'"  1 
ATOM   1771 N  N9     . DG  B 2 8  ? 23.442 -271.584 -24.653 1.00 36.97  ? 8   DG  B N9     1 
ATOM   1772 C  C8     . DG  B 2 8  ? 23.921 -270.309 -24.788 1.00 35.34  ? 8   DG  B C8     1 
ATOM   1773 N  N7     . DG  B 2 8  ? 22.972 -269.410 -24.829 1.00 26.32  ? 8   DG  B N7     1 
ATOM   1774 C  C5     . DG  B 2 8  ? 21.805 -270.154 -24.715 1.00 24.97  ? 8   DG  B C5     1 
ATOM   1775 C  C6     . DG  B 2 8  ? 20.476 -269.736 -24.745 1.00 25.54  ? 8   DG  B C6     1 
ATOM   1776 O  O6     . DG  B 2 8  ? 20.040 -268.592 -24.820 1.00 27.32  ? 8   DG  B O6     1 
ATOM   1777 N  N1     . DG  B 2 8  ? 19.612 -270.780 -24.637 1.00 24.39  ? 8   DG  B N1     1 
ATOM   1778 C  C2     . DG  B 2 8  ? 19.966 -272.089 -24.522 1.00 24.64  ? 8   DG  B C2     1 
ATOM   1779 N  N2     . DG  B 2 8  ? 18.958 -272.944 -24.426 1.00 26.93  ? 8   DG  B N2     1 
ATOM   1780 N  N3     . DG  B 2 8  ? 21.216 -272.522 -24.505 1.00 30.89  ? 8   DG  B N3     1 
ATOM   1781 C  C4     . DG  B 2 8  ? 22.082 -271.489 -24.628 1.00 26.23  ? 8   DG  B C4     1 
ATOM   1782 H  "H5'"  . DG  B 2 8  ? 27.644 -272.509 -22.794 1.00 37.97  ? 8   DG  B "H5'"  1 
ATOM   1783 H  "H5''" . DG  B 2 8  ? 28.427 -273.293 -23.920 1.00 37.97  ? 8   DG  B "H5''" 1 
ATOM   1784 H  "H4'"  . DG  B 2 8  ? 26.367 -274.262 -23.727 1.00 46.04  ? 8   DG  B "H4'"  1 
ATOM   1785 H  "H3'"  . DG  B 2 8  ? 26.868 -273.006 -26.128 1.00 54.85  ? 8   DG  B "H3'"  1 
ATOM   1786 H  "H2'"  . DG  B 2 8  ? 24.818 -272.341 -26.517 1.00 56.53  ? 8   DG  B "H2'"  1 
ATOM   1787 H  "H2''" . DG  B 2 8  ? 24.314 -273.843 -26.364 1.00 56.53  ? 8   DG  B "H2''" 1 
ATOM   1788 H  "H1'"  . DG  B 2 8  ? 23.663 -273.527 -24.299 1.00 63.14  ? 8   DG  B "H1'"  1 
ATOM   1789 H  H8     . DG  B 2 8  ? 24.827 -270.102 -24.824 1.00 42.41  ? 8   DG  B H8     1 
ATOM   1790 H  H1     . DG  B 2 8  ? 18.772 -270.596 -24.616 1.00 29.27  ? 8   DG  B H1     1 
ATOM   1791 H  H21    . DG  B 2 8  ? 19.114 -273.787 -24.355 1.00 32.31  ? 8   DG  B H21    1 
ATOM   1792 H  H22    . DG  B 2 8  ? 18.148 -272.657 -24.434 1.00 32.31  ? 8   DG  B H22    1 
ATOM   1793 P  P      . DG  B 2 9  ? 26.370 -275.385 -27.542 1.00 44.43  ? 9   DG  B P      1 
ATOM   1794 O  OP1    . DG  B 2 9  ? 26.970 -276.742 -27.552 1.00 48.83  ? 9   DG  B OP1    1 
ATOM   1795 O  OP2    . DG  B 2 9  ? 26.940 -274.344 -28.429 1.00 53.48  ? 9   DG  B OP2    1 
ATOM   1796 O  "O5'"  . DG  B 2 9  ? 24.798 -275.542 -27.853 1.00 37.30  ? 9   DG  B "O5'"  1 
ATOM   1797 C  "C5'"  . DG  B 2 9  ? 24.070 -276.552 -27.172 1.00 54.50  ? 9   DG  B "C5'"  1 
ATOM   1798 C  "C4'"  . DG  B 2 9  ? 22.609 -276.570 -27.566 1.00 44.04  ? 9   DG  B "C4'"  1 
ATOM   1799 O  "O4'"  . DG  B 2 9  ? 21.970 -275.419 -27.024 1.00 51.17  ? 9   DG  B "O4'"  1 
ATOM   1800 C  "C3'"  . DG  B 2 9  ? 22.305 -276.501 -29.064 1.00 75.67  ? 9   DG  B "C3'"  1 
ATOM   1801 O  "O3'"  . DG  B 2 9  ? 22.180 -277.775 -29.621 1.00 83.73  ? 9   DG  B "O3'"  1 
ATOM   1802 C  "C2'"  . DG  B 2 9  ? 20.981 -275.765 -29.134 1.00 55.91  ? 9   DG  B "C2'"  1 
ATOM   1803 C  "C1'"  . DG  B 2 9  ? 20.790 -275.197 -27.752 1.00 67.27  ? 9   DG  B "C1'"  1 
ATOM   1804 N  N9     . DG  B 2 9  ? 20.533 -273.805 -27.802 1.00 48.20  ? 9   DG  B N9     1 
ATOM   1805 C  C8     . DG  B 2 9  ? 21.454 -272.794 -27.920 1.00 44.20  ? 9   DG  B C8     1 
ATOM   1806 N  N7     . DG  B 2 9  ? 20.912 -271.620 -27.980 1.00 36.49  ? 9   DG  B N7     1 
ATOM   1807 C  C5     . DG  B 2 9  ? 19.547 -271.883 -27.912 1.00 32.24  ? 9   DG  B C5     1 
ATOM   1808 C  C6     . DG  B 2 9  ? 18.473 -270.997 -27.912 1.00 33.76  ? 9   DG  B C6     1 
ATOM   1809 O  O6     . DG  B 2 9  ? 18.520 -269.773 -27.953 1.00 32.60  ? 9   DG  B O6     1 
ATOM   1810 N  N1     . DG  B 2 9  ? 17.258 -271.664 -27.843 1.00 33.40  ? 9   DG  B N1     1 
ATOM   1811 C  C2     . DG  B 2 9  ? 17.113 -273.032 -27.767 1.00 45.32  ? 9   DG  B C2     1 
ATOM   1812 N  N2     . DG  B 2 9  ? 15.863 -273.496 -27.704 1.00 42.85  ? 9   DG  B N2     1 
ATOM   1813 N  N3     . DG  B 2 9  ? 18.125 -273.884 -27.739 1.00 36.54  ? 9   DG  B N3     1 
ATOM   1814 C  C4     . DG  B 2 9  ? 19.307 -273.228 -27.817 1.00 35.83  ? 9   DG  B C4     1 
ATOM   1815 H  "H5'"  . DG  B 2 9  ? 24.136 -276.397 -26.217 1.00 65.40  ? 9   DG  B "H5'"  1 
ATOM   1816 H  "H5''" . DG  B 2 9  ? 24.462 -277.415 -27.378 1.00 65.40  ? 9   DG  B "H5''" 1 
ATOM   1817 H  "H4'"  . DG  B 2 9  ? 22.193 -277.365 -27.197 1.00 52.85  ? 9   DG  B "H4'"  1 
ATOM   1818 H  "H3'"  . DG  B 2 9  ? 22.994 -275.997 -29.524 1.00 90.81  ? 9   DG  B "H3'"  1 
ATOM   1819 H  "H2'"  . DG  B 2 9  ? 21.019 -275.054 -29.793 1.00 67.09  ? 9   DG  B "H2'"  1 
ATOM   1820 H  "H2''" . DG  B 2 9  ? 20.264 -276.375 -29.332 1.00 67.09  ? 9   DG  B "H2''" 1 
ATOM   1821 H  "H1'"  . DG  B 2 9  ? 20.050 -275.648 -27.315 1.00 80.72  ? 9   DG  B "H1'"  1 
ATOM   1822 H  H8     . DG  B 2 9  ? 22.373 -272.936 -27.931 1.00 53.04  ? 9   DG  B H8     1 
ATOM   1823 H  H1     . DG  B 2 9  ? 16.542 -271.187 -27.842 1.00 40.08  ? 9   DG  B H1     1 
ATOM   1824 H  H21    . DG  B 2 9  ? 15.721 -274.342 -27.646 1.00 51.42  ? 9   DG  B H21    1 
ATOM   1825 H  H22    . DG  B 2 9  ? 15.200 -272.949 -27.722 1.00 51.42  ? 9   DG  B H22    1 
ATOM   1826 P  P      . DG  B 2 10 ? 21.679 -277.954 -31.139 1.00 64.12  ? 10  DG  B P      1 
ATOM   1827 O  OP1    . DG  B 2 10 ? 21.586 -279.424 -31.266 1.00 76.85  ? 10  DG  B OP1    1 
ATOM   1828 O  OP2    . DG  B 2 10 ? 22.500 -277.092 -32.040 1.00 53.51  ? 10  DG  B OP2    1 
ATOM   1829 O  "O5'"  . DG  B 2 10 ? 20.208 -277.308 -31.213 1.00 59.05  ? 10  DG  B "O5'"  1 
ATOM   1830 C  "C5'"  . DG  B 2 10 ? 19.058 -278.066 -30.879 1.00 45.36  ? 10  DG  B "C5'"  1 
ATOM   1831 C  "C4'"  . DG  B 2 10 ? 17.797 -277.202 -30.971 1.00 39.06  ? 10  DG  B "C4'"  1 
ATOM   1832 O  "O4'"  . DG  B 2 10 ? 18.118 -275.862 -30.627 1.00 41.86  ? 10  DG  B "O4'"  1 
ATOM   1833 C  "C3'"  . DG  B 2 10 ? 17.150 -277.090 -32.362 1.00 59.37  ? 10  DG  B "C3'"  1 
ATOM   1834 O  "O3'"  . DG  B 2 10 ? 15.997 -277.894 -32.441 1.00 85.65  ? 10  DG  B "O3'"  1 
ATOM   1835 C  "C2'"  . DG  B 2 10 ? 16.794 -275.610 -32.506 1.00 43.70  ? 10  DG  B "C2'"  1 
ATOM   1836 C  "C1'"  . DG  B 2 10 ? 17.149 -275.024 -31.173 1.00 39.71  ? 10  DG  B "C1'"  1 
ATOM   1837 N  N9     . DG  B 2 10 ? 17.708 -273.684 -31.239 1.00 39.84  ? 10  DG  B N9     1 
ATOM   1838 C  C8     . DG  B 2 10 ? 19.034 -273.348 -31.326 1.00 31.03  ? 10  DG  B C8     1 
ATOM   1839 N  N7     . DG  B 2 10 ? 19.240 -272.058 -31.317 1.00 35.12  ? 10  DG  B N7     1 
ATOM   1840 C  C5     . DG  B 2 10 ? 17.965 -271.515 -31.232 1.00 29.81  ? 10  DG  B C5     1 
ATOM   1841 C  C6     . DG  B 2 10 ? 17.543 -270.157 -31.249 1.00 29.07  ? 10  DG  B C6     1 
ATOM   1842 O  O6     . DG  B 2 10 ? 18.251 -269.139 -31.289 1.00 31.86  ? 10  DG  B O6     1 
ATOM   1843 N  N1     . DG  B 2 10 ? 16.152 -270.051 -31.163 1.00 31.53  ? 10  DG  B N1     1 
ATOM   1844 C  C2     . DG  B 2 10 ? 15.284 -271.126 -31.083 1.00 32.30  ? 10  DG  B C2     1 
ATOM   1845 N  N2     . DG  B 2 10 ? 13.973 -270.843 -31.017 1.00 43.99  ? 10  DG  B N2     1 
ATOM   1846 N  N3     . DG  B 2 10 ? 15.668 -272.390 -31.111 1.00 40.46  ? 10  DG  B N3     1 
ATOM   1847 C  C4     . DG  B 2 10 ? 17.016 -272.508 -31.188 1.00 29.15  ? 10  DG  B C4     1 
ATOM   1848 H  "H5'"  . DG  B 2 10 ? 19.149 -278.403 -29.974 1.00 54.43  ? 10  DG  B "H5'"  1 
ATOM   1849 H  "H5''" . DG  B 2 10 ? 18.979 -278.814 -31.492 1.00 54.43  ? 10  DG  B "H5''" 1 
ATOM   1850 H  "H4'"  . DG  B 2 10 ? 17.138 -277.539 -30.344 1.00 46.88  ? 10  DG  B "H4'"  1 
ATOM   1851 H  "H3'"  . DG  B 2 10 ? 17.786 -277.348 -33.047 1.00 71.25  ? 10  DG  B "H3'"  1 
ATOM   1852 H  "H2'"  . DG  B 2 10 ? 17.321 -275.200 -33.209 1.00 52.44  ? 10  DG  B "H2'"  1 
ATOM   1853 H  "H2''" . DG  B 2 10 ? 15.846 -275.504 -32.683 1.00 52.44  ? 10  DG  B "H2''" 1 
ATOM   1854 H  "H1'"  . DG  B 2 10 ? 16.365 -275.021 -30.601 1.00 47.65  ? 10  DG  B "H1'"  1 
ATOM   1855 H  H8     . DG  B 2 10 ? 19.720 -273.975 -31.346 1.00 37.24  ? 10  DG  B H8     1 
ATOM   1856 H  H1     . DG  B 2 10 ? 15.813 -269.261 -31.138 1.00 37.84  ? 10  DG  B H1     1 
ATOM   1857 H  H21    . DG  B 2 10 ? 13.710 -270.024 -30.998 1.00 52.79  ? 10  DG  B H21    1 
ATOM   1858 H  H22    . DG  B 2 10 ? 13.396 -271.480 -30.994 1.00 52.79  ? 10  DG  B H22    1 
ATOM   1859 P  P      . DT  B 2 11 ? 15.375 -278.287 -33.869 1.00 74.15  ? 11  DT  B P      1 
ATOM   1860 O  OP1    . DT  B 2 11 ? 14.417 -279.372 -33.544 1.00 72.98  ? 11  DT  B OP1    1 
ATOM   1861 O  OP2    . DT  B 2 11 ? 16.499 -278.560 -34.802 1.00 53.78  ? 11  DT  B OP2    1 
ATOM   1862 O  "O5'"  . DT  B 2 11 ? 14.570 -276.968 -34.344 1.00 51.31  ? 11  DT  B "O5'"  1 
ATOM   1863 C  "C5'"  . DT  B 2 11 ? 13.419 -276.542 -33.599 1.00 42.84  ? 11  DT  B "C5'"  1 
ATOM   1864 C  "C4'"  . DT  B 2 11 ? 12.808 -275.254 -34.149 1.00 52.95  ? 11  DT  B "C4'"  1 
ATOM   1865 O  "O4'"  . DT  B 2 11 ? 13.629 -274.109 -33.777 1.00 51.91  ? 11  DT  B "O4'"  1 
ATOM   1866 C  "C3'"  . DT  B 2 11 ? 12.666 -275.196 -35.670 1.00 42.90  ? 11  DT  B "C3'"  1 
ATOM   1867 O  "O3'"  . DT  B 2 11 ? 11.307 -274.957 -36.049 1.00 46.60  ? 11  DT  B "O3'"  1 
ATOM   1868 C  "C2'"  . DT  B 2 11 ? 13.596 -274.065 -36.104 1.00 38.38  ? 11  DT  B "C2'"  1 
ATOM   1869 C  "C1'"  . DT  B 2 11 ? 13.676 -273.208 -34.873 1.00 35.64  ? 11  DT  B "C1'"  1 
ATOM   1870 N  N1     . DT  B 2 11 ? 14.897 -272.425 -34.785 1.00 37.38  ? 11  DT  B N1     1 
ATOM   1871 C  C2     . DT  B 2 11 ? 14.792 -271.087 -34.550 1.00 35.52  ? 11  DT  B C2     1 
ATOM   1872 O  O2     . DT  B 2 11 ? 13.713 -270.524 -34.454 1.00 44.85  ? 11  DT  B O2     1 
ATOM   1873 N  N3     . DT  B 2 11 ? 15.981 -270.430 -34.502 1.00 34.09  ? 11  DT  B N3     1 
ATOM   1874 C  C4     . DT  B 2 11 ? 17.235 -270.978 -34.618 1.00 30.68  ? 11  DT  B C4     1 
ATOM   1875 O  O4     . DT  B 2 11 ? 18.249 -270.319 -34.550 1.00 32.78  ? 11  DT  B O4     1 
ATOM   1876 C  C5     . DT  B 2 11 ? 17.266 -272.398 -34.841 1.00 35.13  ? 11  DT  B C5     1 
ATOM   1877 C  C7     . DT  B 2 11 ? 18.579 -273.107 -34.994 1.00 34.87  ? 11  DT  B C7     1 
ATOM   1878 C  C6     . DT  B 2 11 ? 16.113 -273.043 -34.907 1.00 33.06  ? 11  DT  B C6     1 
ATOM   1879 H  "H5'"  . DT  B 2 11 ? 13.680 -276.396 -32.676 1.00 51.41  ? 11  DT  B "H5'"  1 
ATOM   1880 H  "H5''" . DT  B 2 11 ? 12.750 -277.244 -33.628 1.00 51.41  ? 11  DT  B "H5''" 1 
ATOM   1881 H  "H4'"  . DT  B 2 11 ? 11.929 -275.141 -33.755 1.00 63.54  ? 11  DT  B "H4'"  1 
ATOM   1882 H  "H3'"  . DT  B 2 11 ? 12.970 -276.020 -36.055 1.00 51.48  ? 11  DT  B "H3'"  1 
ATOM   1883 H  "HO3'" . DT  B 2 11 ? 11.110 -274.274 -36.497 1.00 55.92  ? 11  DT  B "HO3'" 1 
ATOM   1884 H  "H2'"  . DT  B 2 11 ? 14.468 -274.414 -36.343 1.00 46.06  ? 11  DT  B "H2'"  1 
ATOM   1885 H  "H2''" . DT  B 2 11 ? 13.210 -273.568 -36.842 1.00 46.06  ? 11  DT  B "H2''" 1 
ATOM   1886 H  "H1'"  . DT  B 2 11 ? 12.907 -272.620 -34.840 1.00 42.77  ? 11  DT  B "H1'"  1 
ATOM   1887 H  H3     . DT  B 2 11 ? 15.945 -269.582 -34.364 1.00 40.90  ? 11  DT  B H3     1 
ATOM   1888 H  H71    . DT  B 2 11 ? 19.295 -272.455 -35.049 1.00 41.85  ? 11  DT  B H71    1 
ATOM   1889 H  H72    . DT  B 2 11 ? 18.726 -273.684 -34.229 1.00 41.85  ? 11  DT  B H72    1 
ATOM   1890 H  H73    . DT  B 2 11 ? 18.566 -273.641 -35.804 1.00 41.85  ? 11  DT  B H73    1 
ATOM   1891 H  H6     . DT  B 2 11 ? 16.129 -273.961 -35.056 1.00 39.67  ? 11  DT  B H6     1 
ATOM   1892 O  "O5'"  . DT  C 3 1  ? 21.100 -260.205 -35.800 1.00 51.89  ? 1   DT  C "O5'"  1 
ATOM   1893 C  "C5'"  . DT  C 3 1  ? 20.705 -259.282 -36.838 1.00 38.36  ? 1   DT  C "C5'"  1 
ATOM   1894 C  "C4'"  . DT  C 3 1  ? 19.243 -259.457 -37.238 1.00 44.53  ? 1   DT  C "C4'"  1 
ATOM   1895 O  "O4'"  . DT  C 3 1  ? 19.102 -260.469 -38.300 1.00 45.01  ? 1   DT  C "O4'"  1 
ATOM   1896 C  "C3'"  . DT  C 3 1  ? 18.336 -259.931 -36.129 1.00 43.13  ? 1   DT  C "C3'"  1 
ATOM   1897 O  "O3'"  . DT  C 3 1  ? 17.931 -258.823 -35.361 1.00 60.09  ? 1   DT  C "O3'"  1 
ATOM   1898 C  "C2'"  . DT  C 3 1  ? 17.201 -260.594 -36.906 1.00 38.05  ? 1   DT  C "C2'"  1 
ATOM   1899 C  "C1'"  . DT  C 3 1  ? 17.935 -261.256 -38.051 1.00 43.91  ? 1   DT  C "C1'"  1 
ATOM   1900 N  N1     . DT  C 3 1  ? 18.361 -262.656 -37.752 1.00 41.09  ? 1   DT  C N1     1 
ATOM   1901 C  C2     . DT  C 3 1  ? 17.465 -263.690 -37.931 1.00 35.22  ? 1   DT  C C2     1 
ATOM   1902 O  O2     . DT  C 3 1  ? 16.315 -263.522 -38.307 1.00 41.12  ? 1   DT  C O2     1 
ATOM   1903 N  N3     . DT  C 3 1  ? 17.960 -264.937 -37.627 1.00 33.02  ? 1   DT  C N3     1 
ATOM   1904 C  C4     . DT  C 3 1  ? 19.250 -265.250 -37.205 1.00 34.76  ? 1   DT  C C4     1 
ATOM   1905 O  O4     . DT  C 3 1  ? 19.621 -266.418 -36.992 1.00 34.44  ? 1   DT  C O4     1 
ATOM   1906 C  C5     . DT  C 3 1  ? 20.127 -264.108 -37.011 1.00 38.13  ? 1   DT  C C5     1 
ATOM   1907 C  C7     . DT  C 3 1  ? 21.532 -264.310 -36.542 1.00 39.82  ? 1   DT  C C7     1 
ATOM   1908 C  C6     . DT  C 3 1  ? 19.652 -262.885 -37.303 1.00 35.13  ? 1   DT  C C6     1 
ATOM   1909 H  "H5'"  . DT  C 3 1  ? 21.263 -259.428 -37.617 1.00 46.03  ? 1   DT  C "H5'"  1 
ATOM   1910 H  "H5''" . DT  C 3 1  ? 20.838 -258.375 -36.520 1.00 46.03  ? 1   DT  C "H5''" 1 
ATOM   1911 H  "H4'"  . DT  C 3 1  ? 18.909 -258.609 -37.571 1.00 53.43  ? 1   DT  C "H4'"  1 
ATOM   1912 H  "H3'"  . DT  C 3 1  ? 18.791 -260.583 -35.574 1.00 51.76  ? 1   DT  C "H3'"  1 
ATOM   1913 H  "H2'"  . DT  C 3 1  ? 16.753 -261.259 -36.362 1.00 45.67  ? 1   DT  C "H2'"  1 
ATOM   1914 H  "H2''" . DT  C 3 1  ? 16.574 -259.931 -37.236 1.00 45.67  ? 1   DT  C "H2''" 1 
ATOM   1915 H  "H1'"  . DT  C 3 1  ? 17.371 -261.253 -38.840 1.00 52.70  ? 1   DT  C "H1'"  1 
ATOM   1916 H  H3     . DT  C 3 1  ? 17.427 -265.600 -37.752 1.00 39.63  ? 1   DT  C H3     1 
ATOM   1917 H  H71    . DT  C 3 1  ? 21.523 -264.722 -35.664 1.00 47.78  ? 1   DT  C H71    1 
ATOM   1918 H  H72    . DT  C 3 1  ? 22.001 -264.887 -37.165 1.00 47.78  ? 1   DT  C H72    1 
ATOM   1919 H  H73    . DT  C 3 1  ? 21.983 -263.453 -36.493 1.00 47.78  ? 1   DT  C H73    1 
ATOM   1920 H  H6     . DT  C 3 1  ? 20.218 -262.155 -37.197 1.00 42.16  ? 1   DT  C H6     1 
ATOM   1921 H  "HO5'" . DT  C 3 1  ? 21.887 -260.195 -35.506 1.00 62.26  ? 1   DT  C "HO5'" 1 
ATOM   1922 P  P      A DA  C 3 2  ? 16.685 -258.889 -34.349 0.50 97.34  ? 2   DA  C P      1 
ATOM   1923 P  P      B DA  C 3 2  ? 17.541 -259.053 -33.824 0.50 41.98  ? 2   DA  C P      1 
ATOM   1924 O  OP1    A DA  C 3 2  ? 16.129 -257.514 -34.248 0.50 47.68  ? 2   DA  C OP1    1 
ATOM   1925 O  OP1    B DA  C 3 2  ? 17.103 -257.743 -33.288 0.50 52.47  ? 2   DA  C OP1    1 
ATOM   1926 O  OP2    A DA  C 3 2  ? 17.191 -259.633 -33.166 0.50 41.64  ? 2   DA  C OP2    1 
ATOM   1927 O  OP2    B DA  C 3 2  ? 18.610 -259.850 -33.173 0.50 40.89  ? 2   DA  C OP2    1 
ATOM   1928 O  "O5'"  A DA  C 3 2  ? 15.624 -259.845 -35.072 0.50 98.23  ? 2   DA  C "O5'"  1 
ATOM   1929 O  "O5'"  B DA  C 3 2  ? 16.274 -260.010 -33.901 0.50 33.60  ? 2   DA  C "O5'"  1 
ATOM   1930 C  "C5'"  A DA  C 3 2  ? 14.292 -259.429 -35.367 0.50 30.10  ? 2   DA  C "C5'"  1 
ATOM   1931 C  "C5'"  B DA  C 3 2  ? 15.077 -259.537 -34.475 0.50 28.40  ? 2   DA  C "C5'"  1 
ATOM   1932 C  "C4'"  A DA  C 3 2  ? 13.362 -260.614 -35.204 0.50 39.07  ? 2   DA  C "C4'"  1 
ATOM   1933 C  "C4'"  B DA  C 3 2  ? 13.981 -260.573 -34.371 0.50 52.62  ? 2   DA  C "C4'"  1 
ATOM   1934 O  "O4'"  A DA  C 3 2  ? 14.077 -261.801 -35.638 0.50 33.53  ? 2   DA  C "O4'"  1 
ATOM   1935 O  "O4'"  B DA  C 3 2  ? 14.221 -261.629 -35.338 0.50 53.56  ? 2   DA  C "O4'"  1 
ATOM   1936 C  "C3'"  A DA  C 3 2  ? 12.920 -260.868 -33.764 0.50 48.59  ? 2   DA  C "C3'"  1 
ATOM   1937 C  "C3'"  B DA  C 3 2  ? 13.880 -261.293 -33.033 0.50 38.82  ? 2   DA  C "C3'"  1 
ATOM   1938 O  "O3'"  A DA  C 3 2  ? 11.515 -260.670 -33.611 0.50 42.00  ? 2   DA  C "O3'"  1 
ATOM   1939 O  "O3'"  B DA  C 3 2  ? 13.130 -260.528 -32.085 0.50 73.03  ? 2   DA  C "O3'"  1 
ATOM   1940 C  "C2'"  A DA  C 3 2  ? 13.334 -262.308 -33.459 0.50 44.37  ? 2   DA  C "C2'"  1 
ATOM   1941 C  "C2'"  B DA  C 3 2  ? 13.184 -262.570 -33.455 0.50 53.40  ? 2   DA  C "C2'"  1 
ATOM   1942 C  "C1'"  A DA  C 3 2  ? 13.838 -262.878 -34.767 0.50 43.08  ? 2   DA  C "C1'"  1 
ATOM   1943 C  "C1'"  B DA  C 3 2  ? 13.868 -262.875 -34.768 0.50 41.95  ? 2   DA  C "C1'"  1 
ATOM   1944 N  N9     . DA  C 3 2  ? 15.061 -263.690 -34.615 1.00 40.18  ? 2   DA  C N9     1 
ATOM   1945 C  C8     . DA  C 3 2  ? 16.353 -263.268 -34.482 1.00 43.57  ? 2   DA  C C8     1 
ATOM   1946 N  N7     . DA  C 3 2  ? 17.227 -264.262 -34.352 1.00 32.48  ? 2   DA  C N7     1 
ATOM   1947 C  C5     . DA  C 3 2  ? 16.444 -265.395 -34.413 1.00 32.99  ? 2   DA  C C5     1 
ATOM   1948 C  C6     . DA  C 3 2  ? 16.744 -266.775 -34.359 1.00 34.30  ? 2   DA  C C6     1 
ATOM   1949 N  N6     . DA  C 3 2  ? 17.977 -267.270 -34.208 1.00 33.58  ? 2   DA  C N6     1 
ATOM   1950 N  N1     . DA  C 3 2  ? 15.712 -267.632 -34.427 1.00 33.20  ? 2   DA  C N1     1 
ATOM   1951 C  C2     . DA  C 3 2  ? 14.475 -267.153 -34.577 1.00 37.76  ? 2   DA  C C2     1 
ATOM   1952 N  N3     . DA  C 3 2  ? 14.074 -265.892 -34.660 1.00 43.34  ? 2   DA  C N3     1 
ATOM   1953 C  C4     . DA  C 3 2  ? 15.110 -265.057 -34.556 1.00 38.51  ? 2   DA  C C4     1 
ATOM   1954 H  "H5'"  A DA  C 3 2  ? 14.247 -259.104 -36.280 0.50 36.12  ? 2   DA  C "H5'"  1 
ATOM   1955 H  "H5'"  B DA  C 3 2  ? 15.232 -259.330 -35.410 0.50 34.08  ? 2   DA  C "H5'"  1 
ATOM   1956 H  "H5''" A DA  C 3 2  ? 14.029 -258.723 -34.757 0.50 36.12  ? 2   DA  C "H5''" 1 
ATOM   1957 H  "H5''" B DA  C 3 2  ? 14.799 -258.731 -34.012 0.50 34.08  ? 2   DA  C "H5''" 1 
ATOM   1958 H  "H4'"  A DA  C 3 2  ? 12.579 -260.488 -35.763 0.50 46.88  ? 2   DA  C "H4'"  1 
ATOM   1959 H  "H4'"  B DA  C 3 2  ? 13.129 -260.152 -34.568 0.50 63.14  ? 2   DA  C "H4'"  1 
ATOM   1960 H  "H3'"  A DA  C 3 2  ? 13.396 -260.265 -33.172 0.50 58.31  ? 2   DA  C "H3'"  1 
ATOM   1961 H  "H3'"  B DA  C 3 2  ? 14.765 -261.489 -32.688 0.50 46.59  ? 2   DA  C "H3'"  1 
ATOM   1962 H  "H2'"  A DA  C 3 2  ? 14.039 -262.322 -32.792 0.50 53.24  ? 2   DA  C "H2'"  1 
ATOM   1963 H  "H2'"  B DA  C 3 2  ? 13.335 -263.277 -32.813 0.50 64.08  ? 2   DA  C "H2'"  1 
ATOM   1964 H  "H2''" A DA  C 3 2  ? 12.570 -262.817 -33.152 0.50 53.24  ? 2   DA  C "H2''" 1 
ATOM   1965 H  "H2''" B DA  C 3 2  ? 12.240 -262.419 -33.595 0.50 64.08  ? 2   DA  C "H2''" 1 
ATOM   1966 H  "H1'"  A DA  C 3 2  ? 13.143 -263.436 -35.149 0.50 51.70  ? 2   DA  C "H1'"  1 
ATOM   1967 H  "H1'"  B DA  C 3 2  ? 13.244 -263.329 -35.355 0.50 50.34  ? 2   DA  C "H1'"  1 
ATOM   1968 H  H8     . DA  C 3 2  ? 16.598 -262.371 -34.480 1.00 52.28  ? 2   DA  C H8     1 
ATOM   1969 H  H61    . DA  C 3 2  ? 18.096 -268.120 -34.157 1.00 40.30  ? 2   DA  C H61    1 
ATOM   1970 H  H62    . DA  C 3 2  ? 18.651 -266.738 -34.162 1.00 40.30  ? 2   DA  C H62    1 
ATOM   1971 H  H2     . DA  C 3 2  ? 13.802 -267.792 -34.635 1.00 45.32  ? 2   DA  C H2     1 
ATOM   1972 P  P      A DC  C 3 3  ? 10.914 -260.218 -32.188 0.50 47.17  ? 3   DC  C P      1 
ATOM   1973 P  P      B DC  C 3 3  ? 13.039 -260.944 -30.533 0.50 45.48  ? 3   DC  C P      1 
ATOM   1974 O  OP1    A DC  C 3 3  ? 9.809  -259.278 -32.443 0.50 52.04  ? 3   DC  C OP1    1 
ATOM   1975 O  OP1    B DC  C 3 3  ? 12.263 -259.841 -29.922 0.50 39.42  ? 3   DC  C OP1    1 
ATOM   1976 O  OP2    A DC  C 3 3  ? 12.007 -259.867 -31.259 0.50 39.02  ? 3   DC  C OP2    1 
ATOM   1977 O  OP2    B DC  C 3 3  ? 14.352 -261.296 -29.927 0.50 28.23  ? 3   DC  C OP2    1 
ATOM   1978 O  "O5'"  A DC  C 3 3  ? 10.312 -261.559 -31.602 0.50 37.65  ? 3   DC  C "O5'"  1 
ATOM   1979 O  "O5'"  B DC  C 3 3  ? 12.215 -262.308 -30.540 0.50 71.08  ? 3   DC  C "O5'"  1 
ATOM   1980 C  "C5'"  A DC  C 3 3  ? 11.120 -262.422 -30.881 0.50 70.67  ? 3   DC  C "C5'"  1 
ATOM   1981 C  "C5'"  B DC  C 3 3  ? 10.936 -262.413 -31.169 0.50 41.64  ? 3   DC  C "C5'"  1 
ATOM   1982 C  "C4'"  A DC  C 3 3  ? 10.592 -263.835 -30.972 0.50 59.65  ? 3   DC  C "C4'"  1 
ATOM   1983 C  "C4'"  B DC  C 3 3  ? 10.474 -263.862 -31.133 0.50 35.61  ? 3   DC  C "C4'"  1 
ATOM   1984 O  "O4'"  A DC  C 3 3  ? 11.530 -264.651 -31.714 0.50 46.54  ? 3   DC  C "O4'"  1 
ATOM   1985 O  "O4'"  B DC  C 3 3  ? 11.472 -264.696 -31.793 0.50 44.09  ? 3   DC  C "O4'"  1 
ATOM   1986 C  "C3'"  A DC  C 3 3  ? 10.383 -264.495 -29.616 0.50 44.50  ? 3   DC  C "C3'"  1 
ATOM   1987 C  "C3'"  B DC  C 3 3  ? 10.304 -264.413 -29.710 0.50 49.37  ? 3   DC  C "C3'"  1 
ATOM   1988 O  "O3'"  A DC  C 3 3  ? 9.057  -264.914 -29.468 0.50 61.61  ? 3   DC  C "O3'"  1 
ATOM   1989 O  "O3'"  B DC  C 3 3  ? 9.001  -264.922 -29.499 0.50 57.97  ? 3   DC  C "O3'"  1 
ATOM   1990 C  "C2'"  A DC  C 3 3  ? 11.352 -265.665 -29.569 0.50 51.67  ? 3   DC  C "C2'"  1 
ATOM   1991 C  "C2'"  B DC  C 3 3  ? 11.358 -265.504 -29.560 0.50 49.15  ? 3   DC  C "C2'"  1 
ATOM   1992 C  "C1'"  A DC  C 3 3  ? 11.878 -265.809 -30.986 0.50 43.09  ? 3   DC  C "C1'"  1 
ATOM   1993 C  "C1'"  B DC  C 3 3  ? 11.849 -265.789 -30.971 0.50 42.72  ? 3   DC  C "C1'"  1 
ATOM   1994 N  N1     . DC  C 3 3  ? 13.345 -265.959 -31.011 1.00 42.61  ? 3   DC  C N1     1 
ATOM   1995 C  C2     . DC  C 3 3  ? 13.900 -267.230 -31.138 1.00 39.82  ? 3   DC  C C2     1 
ATOM   1996 O  O2     . DC  C 3 3  ? 13.147 -268.201 -31.249 1.00 54.18  ? 3   DC  C O2     1 
ATOM   1997 N  N3     . DC  C 3 3  ? 15.254 -267.360 -31.150 1.00 33.84  ? 3   DC  C N3     1 
ATOM   1998 C  C4     . DC  C 3 3  ? 16.030 -266.288 -31.009 1.00 30.64  ? 3   DC  C C4     1 
ATOM   1999 N  N4     . DC  C 3 3  ? 17.356 -266.463 -31.017 1.00 34.60  ? 3   DC  C N4     1 
ATOM   2000 C  C5     . DC  C 3 3  ? 15.486 -264.981 -30.874 1.00 34.02  ? 3   DC  C C5     1 
ATOM   2001 C  C6     . DC  C 3 3  ? 14.146 -264.864 -30.864 1.00 31.92  ? 3   DC  C C6     1 
ATOM   2002 H  "H5'"  A DC  C 3 3  ? 11.131 -262.143 -29.953 0.50 84.80  ? 3   DC  C "H5'"  1 
ATOM   2003 H  "H5'"  B DC  C 3 3  ? 10.992 -262.111 -32.083 0.50 49.97  ? 3   DC  C "H5'"  1 
ATOM   2004 H  "H5''" A DC  C 3 3  ? 12.019 -262.391 -31.229 0.50 84.80  ? 3   DC  C "H5''" 1 
ATOM   2005 H  "H5''" B DC  C 3 3  ? 10.298 -261.862 -30.689 0.50 49.97  ? 3   DC  C "H5''" 1 
ATOM   2006 H  "H4'"  A DC  C 3 3  ? 9.746  -263.822 -31.446 0.50 71.58  ? 3   DC  C "H4'"  1 
ATOM   2007 H  "H4'"  B DC  C 3 3  ? 9.631  -263.939 -31.607 0.50 42.74  ? 3   DC  C "H4'"  1 
ATOM   2008 H  "H3'"  A DC  C 3 3  ? 10.604 -263.867 -28.912 0.50 53.40  ? 3   DC  C "H3'"  1 
ATOM   2009 H  "H3'"  B DC  C 3 3  ? 10.481 -263.706 -29.070 0.50 59.24  ? 3   DC  C "H3'"  1 
ATOM   2010 H  "H2'"  A DC  C 3 3  ? 12.081 -265.474 -28.958 0.50 62.00  ? 3   DC  C "H2'"  1 
ATOM   2011 H  "H2'"  B DC  C 3 3  ? 12.090 -265.190 -29.006 0.50 58.98  ? 3   DC  C "H2'"  1 
ATOM   2012 H  "H2''" A DC  C 3 3  ? 10.891 -266.473 -29.300 0.50 62.00  ? 3   DC  C "H2''" 1 
ATOM   2013 H  "H2''" B DC  C 3 3  ? 10.964 -266.301 -29.176 0.50 58.98  ? 3   DC  C "H2''" 1 
ATOM   2014 H  "H1'"  A DC  C 3 3  ? 11.468 -266.583 -31.403 0.50 51.71  ? 3   DC  C "H1'"  1 
ATOM   2015 H  "H1'"  B DC  C 3 3  ? 11.425 -266.596 -31.300 0.50 51.26  ? 3   DC  C "H1'"  1 
ATOM   2016 H  H41    . DC  C 3 3  ? 17.880 -265.787 -30.928 1.00 41.52  ? 3   DC  C H41    1 
ATOM   2017 H  H42    . DC  C 3 3  ? 17.685 -267.252 -31.111 1.00 41.52  ? 3   DC  C H42    1 
ATOM   2018 H  H5     . DC  C 3 3  ? 16.036 -264.237 -30.781 1.00 40.82  ? 3   DC  C H5     1 
ATOM   2019 H  H6     . DC  C 3 3  ? 13.760 -264.023 -30.774 1.00 38.31  ? 3   DC  C H6     1 
ATOM   2020 P  P      . DC  C 3 4  ? 8.552  -265.350 -28.014 1.00 55.74  ? 4   DC  C P      1 
ATOM   2021 O  OP1    . DC  C 3 4  ? 7.068  -265.340 -28.038 1.00 63.71  ? 4   DC  C OP1    1 
ATOM   2022 O  OP2    . DC  C 3 4  ? 9.342  -264.538 -27.066 1.00 47.60  ? 4   DC  C OP2    1 
ATOM   2023 O  "O5'"  . DC  C 3 4  ? 9.103  -266.844 -27.850 1.00 51.52  ? 4   DC  C "O5'"  1 
ATOM   2024 C  "C5'"  . DC  C 3 4  ? 8.599  -267.862 -28.681 1.00 45.78  ? 4   DC  C "C5'"  1 
ATOM   2025 C  "C4'"  . DC  C 3 4  ? 9.248  -269.201 -28.369 1.00 40.94  ? 4   DC  C "C4'"  1 
ATOM   2026 O  "O4'"  . DC  C 3 4  ? 10.525 -269.301 -29.040 1.00 52.52  ? 4   DC  C "O4'"  1 
ATOM   2027 C  "C3'"  . DC  C 3 4  ? 9.588  -269.449 -26.922 1.00 49.74  ? 4   DC  C "C3'"  1 
ATOM   2028 O  "O3'"  . DC  C 3 4  ? 8.445  -269.862 -26.179 1.00 47.99  ? 4   DC  C "O3'"  1 
ATOM   2029 C  "C2'"  . DC  C 3 4  ? 10.641 -270.550 -27.032 1.00 46.16  ? 4   DC  C "C2'"  1 
ATOM   2030 C  "C1'"  . DC  C 3 4  ? 11.355 -270.215 -28.338 1.00 45.19  ? 4   DC  C "C1'"  1 
ATOM   2031 N  N1     . DC  C 3 4  ? 12.686 -269.600 -28.116 1.00 39.49  ? 4   DC  C N1     1 
ATOM   2032 C  C2     . DC  C 3 4  ? 13.811 -270.418 -27.997 1.00 39.73  ? 4   DC  C C2     1 
ATOM   2033 O  O2     . DC  C 3 4  ? 13.679 -271.643 -28.124 1.00 51.57  ? 4   DC  C O2     1 
ATOM   2034 N  N3     . DC  C 3 4  ? 15.021 -269.840 -27.775 1.00 34.72  ? 4   DC  C N3     1 
ATOM   2035 C  C4     . DC  C 3 4  ? 15.115 -268.509 -27.663 1.00 34.53  ? 4   DC  C C4     1 
ATOM   2036 N  N4     . DC  C 3 4  ? 16.316 -267.976 -27.461 1.00 45.31  ? 4   DC  C N4     1 
ATOM   2037 C  C5     . DC  C 3 4  ? 13.976 -267.668 -27.756 1.00 48.10  ? 4   DC  C C5     1 
ATOM   2038 C  C6     . DC  C 3 4  ? 12.792 -268.249 -27.970 1.00 48.11  ? 4   DC  C C6     1 
ATOM   2039 H  "H5'"  . DC  C 3 4  ? 8.775  -267.632 -29.607 1.00 54.94  ? 4   DC  C "H5'"  1 
ATOM   2040 H  "H5''" . DC  C 3 4  ? 7.641  -267.935 -28.548 1.00 54.94  ? 4   DC  C "H5''" 1 
ATOM   2041 H  "H4'"  . DC  C 3 4  ? 8.669  -269.913 -28.684 1.00 49.13  ? 4   DC  C "H4'"  1 
ATOM   2042 H  "H3'"  . DC  C 3 4  ? 9.977  -268.653 -26.528 1.00 59.68  ? 4   DC  C "H3'"  1 
ATOM   2043 H  "H2'"  . DC  C 3 4  ? 11.257 -270.505 -26.291 1.00 55.40  ? 4   DC  C "H2'"  1 
ATOM   2044 H  "H2''" . DC  C 3 4  ? 10.222 -271.423 -27.083 1.00 55.40  ? 4   DC  C "H2''" 1 
ATOM   2045 H  "H1'"  . DC  C 3 4  ? 11.458 -271.023 -28.864 1.00 54.22  ? 4   DC  C "H1'"  1 
ATOM   2046 H  H41    . DC  C 3 4  ? 16.401 -267.124 -27.386 1.00 54.37  ? 4   DC  C H41    1 
ATOM   2047 H  H42    . DC  C 3 4  ? 17.008 -268.484 -27.405 1.00 54.37  ? 4   DC  C H42    1 
ATOM   2048 H  H5     . DC  C 3 4  ? 14.052 -266.745 -27.676 1.00 57.71  ? 4   DC  C H5     1 
ATOM   2049 H  H6     . DC  C 3 4  ? 12.031 -267.721 -28.042 1.00 57.74  ? 4   DC  C H6     1 
ATOM   2050 P  P      . DC  C 3 5  ? 8.520  -269.860 -24.581 1.00 48.82  ? 5   DC  C P      1 
ATOM   2051 O  OP1    . DC  C 3 5  ? 7.546  -270.826 -24.028 1.00 64.85  ? 5   DC  C OP1    1 
ATOM   2052 O  OP2    . DC  C 3 5  ? 8.595  -268.444 -24.139 1.00 47.83  ? 5   DC  C OP2    1 
ATOM   2053 O  "O5'"  . DC  C 3 5  ? 9.993  -270.371 -24.340 1.00 64.47  ? 5   DC  C "O5'"  1 
ATOM   2054 C  "C5'"  . DC  C 3 5  ? 10.269 -271.213 -23.350 1.00 39.50  ? 5   DC  C "C5'"  1 
ATOM   2055 C  "C4'"  . DC  C 3 5  ? 11.409 -272.131 -23.741 1.00 43.84  ? 5   DC  C "C4'"  1 
ATOM   2056 O  "O4'"  . DC  C 3 5  ? 12.328 -271.494 -24.652 1.00 36.88  ? 5   DC  C "O4'"  1 
ATOM   2057 C  "C3'"  . DC  C 3 5  ? 12.266 -272.533 -22.594 1.00 35.29  ? 5   DC  C "C3'"  1 
ATOM   2058 O  "O3'"  . DC  C 3 5  ? 11.699 -273.590 -21.969 1.00 35.49  ? 5   DC  C "O3'"  1 
ATOM   2059 C  "C2'"  . DC  C 3 5  ? 13.583 -272.898 -23.237 1.00 33.44  ? 5   DC  C "C2'"  1 
ATOM   2060 C  "C1'"  . DC  C 3 5  ? 13.618 -272.048 -24.482 1.00 34.03  ? 5   DC  C "C1'"  1 
ATOM   2061 N  N1     . DC  C 3 5  ? 14.623 -270.948 -24.405 1.00 30.75  ? 5   DC  C N1     1 
ATOM   2062 C  C2     . DC  C 3 5  ? 15.980 -271.256 -24.535 1.00 33.26  ? 5   DC  C C2     1 
ATOM   2063 O  O2     . DC  C 3 5  ? 16.318 -272.435 -24.679 1.00 32.77  ? 5   DC  C O2     1 
ATOM   2064 N  N3     . DC  C 3 5  ? 16.887 -270.255 -24.513 1.00 25.15  ? 5   DC  C N3     1 
ATOM   2065 C  C4     . DC  C 3 5  ? 16.482 -269.000 -24.367 1.00 29.63  ? 5   DC  C C4     1 
ATOM   2066 N  N4     . DC  C 3 5  ? 17.416 -268.050 -24.329 1.00 32.15  ? 5   DC  C N4     1 
ATOM   2067 C  C5     . DC  C 3 5  ? 15.098 -268.663 -24.237 1.00 29.84  ? 5   DC  C C5     1 
ATOM   2068 C  C6     . DC  C 3 5  ? 14.212 -269.658 -24.269 1.00 31.18  ? 5   DC  C C6     1 
ATOM   2069 H  "H5'"  . DC  C 3 5  ? 9.484  -271.746 -23.152 1.00 47.40  ? 5   DC  C "H5'"  1 
ATOM   2070 H  "H5''" . DC  C 3 5  ? 10.520 -270.708 -22.561 1.00 47.40  ? 5   DC  C "H5''" 1 
ATOM   2071 H  "H4'"  . DC  C 3 5  ? 11.046 -272.927 -24.161 1.00 52.60  ? 5   DC  C "H4'"  1 
ATOM   2072 H  "H3'"  . DC  C 3 5  ? 12.381 -271.792 -21.979 1.00 42.35  ? 5   DC  C "H3'"  1 
ATOM   2073 H  "H2'"  . DC  C 3 5  ? 14.321 -272.674 -22.652 1.00 40.13  ? 5   DC  C "H2'"  1 
ATOM   2074 H  "H2''" . DC  C 3 5  ? 13.601 -273.840 -23.467 1.00 40.13  ? 5   DC  C "H2''" 1 
ATOM   2075 H  "H1'"  . DC  C 3 5  ? 13.823 -272.612 -25.244 1.00 40.84  ? 5   DC  C "H1'"  1 
ATOM   2076 H  H41    . DC  C 3 5  ? 17.188 -267.226 -24.237 1.00 38.58  ? 5   DC  C H41    1 
ATOM   2077 H  H42    . DC  C 3 5  ? 18.247 -268.261 -24.397 1.00 38.58  ? 5   DC  C H42    1 
ATOM   2078 H  H5     . DC  C 3 5  ? 14.826 -267.780 -24.133 1.00 35.81  ? 5   DC  C H5     1 
ATOM   2079 H  H6     . DC  C 3 5  ? 13.304 -269.469 -24.195 1.00 37.42  ? 5   DC  C H6     1 
ATOM   2080 P  P      . DC  C 3 6  ? 11.965 -273.860 -20.424 1.00 33.08  ? 6   DC  C P      1 
ATOM   2081 O  OP1    . DC  C 3 6  ? 10.894 -274.777 -20.021 1.00 42.34  ? 6   DC  C OP1    1 
ATOM   2082 O  OP2    . DC  C 3 6  ? 12.203 -272.586 -19.657 1.00 30.13  ? 6   DC  C OP2    1 
ATOM   2083 O  "O5'"  . DC  C 3 6  ? 13.368 -274.637 -20.394 1.00 32.79  ? 6   DC  C "O5'"  1 
ATOM   2084 C  "C5'"  . DC  C 3 6  ? 13.586 -275.829 -21.211 1.00 31.29  ? 6   DC  C "C5'"  1 
ATOM   2085 C  "C4'"  . DC  C 3 6  ? 15.047 -276.262 -21.120 1.00 31.80  ? 6   DC  C "C4'"  1 
ATOM   2086 O  "O4'"  . DC  C 3 6  ? 15.937 -275.204 -21.649 1.00 29.39  ? 6   DC  C "O4'"  1 
ATOM   2087 C  "C3'"  . DC  C 3 6  ? 15.534 -276.512 -19.694 1.00 31.06  ? 6   DC  C "C3'"  1 
ATOM   2088 O  "O3'"  . DC  C 3 6  ? 16.439 -277.600 -19.639 1.00 32.24  ? 6   DC  C "O3'"  1 
ATOM   2089 C  "C2'"  . DC  C 3 6  ? 16.212 -275.212 -19.322 1.00 29.36  ? 6   DC  C "C2'"  1 
ATOM   2090 C  "C1'"  . DC  C 3 6  ? 16.849 -274.800 -20.634 1.00 33.51  ? 6   DC  C "C1'"  1 
ATOM   2091 N  N1     . DC  C 3 6  ? 17.090 -273.330 -20.748 1.00 26.79  ? 6   DC  C N1     1 
ATOM   2092 C  C2     . DC  C 3 6  ? 18.380 -272.857 -20.985 1.00 24.01  ? 6   DC  C C2     1 
ATOM   2093 O  O2     . DC  C 3 6  ? 19.306 -273.669 -21.126 1.00 34.65  ? 6   DC  C O2     1 
ATOM   2094 N  N3     . DC  C 3 6  ? 18.577 -271.506 -21.078 1.00 23.13  ? 6   DC  C N3     1 
ATOM   2095 C  C4     . DC  C 3 6  ? 17.532 -270.668 -20.942 1.00 27.46  ? 6   DC  C C4     1 
ATOM   2096 N  N4     . DC  C 3 6  ? 17.759 -269.344 -21.058 1.00 24.78  ? 6   DC  C N4     1 
ATOM   2097 C  C5     . DC  C 3 6  ? 16.212 -271.150 -20.649 1.00 26.09  ? 6   DC  C C5     1 
ATOM   2098 C  C6     . DC  C 3 6  ? 16.043 -272.472 -20.576 1.00 27.28  ? 6   DC  C C6     1 
ATOM   2099 H  "H5'"  . DC  C 3 6  ? 13.366 -275.632 -22.134 1.00 37.55  ? 6   DC  C "H5'"  1 
ATOM   2100 H  "H5''" . DC  C 3 6  ? 13.017 -276.547 -20.891 1.00 37.55  ? 6   DC  C "H5''" 1 
ATOM   2101 H  "H4'"  . DC  C 3 6  ? 15.171 -277.070 -21.643 1.00 38.16  ? 6   DC  C "H4'"  1 
ATOM   2102 H  "H3'"  . DC  C 3 6  ? 14.779 -276.674 -19.107 1.00 37.27  ? 6   DC  C "H3'"  1 
ATOM   2103 H  "H2'"  . DC  C 3 6  ? 15.561 -274.556 -19.030 1.00 35.23  ? 6   DC  C "H2'"  1 
ATOM   2104 H  "H2''" . DC  C 3 6  ? 16.888 -275.358 -18.642 1.00 35.23  ? 6   DC  C "H2''" 1 
ATOM   2105 H  "H1'"  . DC  C 3 6  ? 17.686 -275.276 -20.747 1.00 40.21  ? 6   DC  C "H1'"  1 
ATOM   2106 H  H41    . DC  C 3 6  ? 18.554 -269.056 -21.216 1.00 29.73  ? 6   DC  C H41    1 
ATOM   2107 H  H42    . DC  C 3 6  ? 17.109 -268.787 -20.974 1.00 29.73  ? 6   DC  C H42    1 
ATOM   2108 H  H5     . DC  C 3 6  ? 15.493 -270.566 -20.564 1.00 31.31  ? 6   DC  C H5     1 
ATOM   2109 H  H6     . DC  C 3 6  ? 15.195 -272.815 -20.408 1.00 32.73  ? 6   DC  C H6     1 
ATOM   2110 P  P      . DC  C 3 7  ? 16.862 -278.223 -18.211 1.00 37.94  ? 7   DC  C P      1 
ATOM   2111 O  OP1    . DC  C 3 7  ? 17.241 -279.623 -18.528 1.00 37.90  ? 7   DC  C OP1    1 
ATOM   2112 O  OP2    . DC  C 3 7  ? 15.821 -277.892 -17.215 1.00 40.88  ? 7   DC  C OP2    1 
ATOM   2113 O  "O5'"  . DC  C 3 7  ? 18.184 -277.430 -17.800 1.00 33.69  ? 7   DC  C "O5'"  1 
ATOM   2114 C  "C5'"  . DC  C 3 7  ? 19.342 -277.550 -18.596 1.00 32.66  ? 7   DC  C "C5'"  1 
ATOM   2115 C  "C4'"  . DC  C 3 7  ? 20.447 -276.661 -18.081 1.00 31.34  ? 7   DC  C "C4'"  1 
ATOM   2116 O  "O4'"  . DC  C 3 7  ? 20.175 -275.268 -18.396 1.00 28.96  ? 7   DC  C "O4'"  1 
ATOM   2117 C  "C3'"  . DC  C 3 7  ? 20.672 -276.714 -16.574 1.00 30.12  ? 7   DC  C "C3'"  1 
ATOM   2118 O  "O3'"  . DC  C 3 7  ? 22.007 -277.139 -16.372 1.00 28.50  ? 7   DC  C "O3'"  1 
ATOM   2119 C  "C2'"  . DC  C 3 7  ? 20.396 -275.282 -16.094 1.00 26.93  ? 7   DC  C "C2'"  1 
ATOM   2120 C  "C1'"  . DC  C 3 7  ? 20.640 -274.462 -17.342 1.00 24.07  ? 7   DC  C "C1'"  1 
ATOM   2121 N  N1     . DC  C 3 7  ? 19.927 -273.155 -17.406 1.00 23.01  ? 7   DC  C N1     1 
ATOM   2122 C  C2     . DC  C 3 7  ? 20.654 -272.002 -17.686 1.00 21.42  ? 7   DC  C C2     1 
ATOM   2123 O  O2     . DC  C 3 7  ? 21.879 -272.089 -17.822 1.00 25.64  ? 7   DC  C O2     1 
ATOM   2124 N  N3     . DC  C 3 7  ? 20.014 -270.826 -17.779 1.00 20.11  ? 7   DC  C N3     1 
ATOM   2125 C  C4     . DC  C 3 7  ? 18.694 -270.770 -17.632 1.00 20.68  ? 7   DC  C C4     1 
ATOM   2126 N  N4     . DC  C 3 7  ? 18.106 -269.597 -17.744 1.00 22.48  ? 7   DC  C N4     1 
ATOM   2127 C  C5     . DC  C 3 7  ? 17.920 -271.935 -17.369 1.00 23.56  ? 7   DC  C C5     1 
ATOM   2128 C  C6     . DC  C 3 7  ? 18.573 -273.107 -17.279 1.00 22.98  ? 7   DC  C C6     1 
ATOM   2129 H  "H5'"  . DC  C 3 7  ? 19.129 -277.297 -19.508 1.00 39.19  ? 7   DC  C "H5'"  1 
ATOM   2130 H  "H5''" . DC  C 3 7  ? 19.643 -278.472 -18.583 1.00 39.19  ? 7   DC  C "H5''" 1 
ATOM   2131 H  "H4'"  . DC  C 3 7  ? 21.273 -276.917 -18.521 1.00 37.61  ? 7   DC  C "H4'"  1 
ATOM   2132 H  "H3'"  . DC  C 3 7  ? 20.051 -277.335 -16.162 1.00 36.15  ? 7   DC  C "H3'"  1 
ATOM   2133 H  "H2'"  . DC  C 3 7  ? 19.478 -275.192 -15.796 1.00 32.31  ? 7   DC  C "H2'"  1 
ATOM   2134 H  "H2''" . DC  C 3 7  ? 21.014 -275.029 -15.391 1.00 32.31  ? 7   DC  C "H2''" 1 
ATOM   2135 H  "H1'"  . DC  C 3 7  ? 21.592 -274.317 -17.447 1.00 28.88  ? 7   DC  C "H1'"  1 
ATOM   2136 H  H41    . DC  C 3 7  ? 18.575 -268.895 -17.908 1.00 26.97  ? 7   DC  C H41    1 
ATOM   2137 H  H42    . DC  C 3 7  ? 17.253 -269.533 -17.653 1.00 26.97  ? 7   DC  C H42    1 
ATOM   2138 H  H5     . DC  C 3 7  ? 16.997 -271.888 -17.267 1.00 28.27  ? 7   DC  C H5     1 
ATOM   2139 H  H6     . DC  C 3 7  ? 18.098 -273.888 -17.105 1.00 27.57  ? 7   DC  C H6     1 
ATOM   2140 P  P      A DA  C 3 8  ? 22.676 -277.327 -14.949 0.60 27.31  ? 8   DA  C P      1 
ATOM   2141 P  P      B DA  C 3 8  ? 22.485 -277.529 -14.894 0.40 58.29  ? 8   DA  C P      1 
ATOM   2142 O  OP1    A DA  C 3 8  ? 23.872 -278.162 -15.206 0.60 34.63  ? 8   DA  C OP1    1 
ATOM   2143 O  OP1    B DA  C 3 8  ? 23.762 -278.261 -15.057 0.40 52.30  ? 8   DA  C OP1    1 
ATOM   2144 O  OP2    A DA  C 3 8  ? 21.669 -277.679 -13.910 0.60 37.20  ? 8   DA  C OP2    1 
ATOM   2145 O  OP2    B DA  C 3 8  ? 21.338 -278.196 -14.218 0.40 24.87  ? 8   DA  C OP2    1 
ATOM   2146 O  "O5'"  A DA  C 3 8  ? 23.179 -275.877 -14.582 0.60 39.29  ? 8   DA  C "O5'"  1 
ATOM   2147 O  "O5'"  B DA  C 3 8  ? 22.839 -276.112 -14.228 0.40 22.56  ? 8   DA  C "O5'"  1 
ATOM   2148 C  "C5'"  A DA  C 3 8  ? 24.066 -275.236 -15.446 0.60 28.16  ? 8   DA  C "C5'"  1 
ATOM   2149 C  "C5'"  B DA  C 3 8  ? 24.078 -275.522 -14.570 0.40 32.88  ? 8   DA  C "C5'"  1 
ATOM   2150 C  "C4'"  A DA  C 3 8  ? 24.397 -273.871 -14.913 0.60 31.06  ? 8   DA  C "C4'"  1 
ATOM   2151 C  "C4'"  B DA  C 3 8  ? 24.162 -274.077 -14.154 0.40 44.11  ? 8   DA  C "C4'"  1 
ATOM   2152 O  "O4'"  A DA  C 3 8  ? 23.319 -272.945 -15.216 0.60 73.72  ? 8   DA  C "O4'"  1 
ATOM   2153 O  "O4'"  B DA  C 3 8  ? 23.145 -273.289 -14.801 0.40 23.79  ? 8   DA  C "O4'"  1 
ATOM   2154 C  "C3'"  A DA  C 3 8  ? 24.584 -273.844 -13.401 0.60 43.01  ? 8   DA  C "C3'"  1 
ATOM   2155 C  "C3'"  B DA  C 3 8  ? 23.940 -273.809 -12.684 0.40 36.94  ? 8   DA  C "C3'"  1 
ATOM   2156 O  "O3'"  A DA  C 3 8  ? 25.927 -273.492 -13.116 0.60 44.18  ? 8   DA  C "O3'"  1 
ATOM   2157 O  "O3'"  B DA  C 3 8  ? 25.127 -274.095 -11.942 0.40 79.59  ? 8   DA  C "O3'"  1 
ATOM   2158 C  "C2'"  A DA  C 3 8  ? 23.538 -272.825 -12.897 0.60 49.04  ? 8   DA  C "C2'"  1 
ATOM   2159 C  "C2'"  B DA  C 3 8  ? 23.572 -272.328 -12.676 0.40 66.31  ? 8   DA  C "C2'"  1 
ATOM   2160 C  "C1'"  A DA  C 3 8  ? 23.177 -272.036 -14.154 0.60 50.68  ? 8   DA  C "C1'"  1 
ATOM   2161 C  "C1'"  B DA  C 3 8  ? 23.130 -272.045 -14.121 0.40 48.07  ? 8   DA  C "C1'"  1 
ATOM   2162 N  N9     . DA  C 3 8  ? 21.805 -271.468 -14.191 1.00 39.30  ? 8   DA  C N9     1 
ATOM   2163 C  C8     . DA  C 3 8  ? 20.607 -272.117 -14.019 1.00 26.24  ? 8   DA  C C8     1 
ATOM   2164 N  N7     . DA  C 3 8  ? 19.557 -271.337 -14.126 1.00 30.73  ? 8   DA  C N7     1 
ATOM   2165 C  C5     . DA  C 3 8  ? 20.118 -270.082 -14.366 1.00 22.87  ? 8   DA  C C5     1 
ATOM   2166 C  C6     . DA  C 3 8  ? 19.556 -268.819 -14.571 1.00 17.88  ? 8   DA  C C6     1 
ATOM   2167 N  N6     . DA  C 3 8  ? 18.251 -268.587 -14.548 1.00 22.84  ? 8   DA  C N6     1 
ATOM   2168 N  N1     . DA  C 3 8  ? 20.386 -267.801 -14.753 1.00 19.94  ? 8   DA  C N1     1 
ATOM   2169 C  C2     . DA  C 3 8  ? 21.690 -268.013 -14.773 1.00 20.05  ? 8   DA  C C2     1 
ATOM   2170 N  N3     . DA  C 3 8  ? 22.345 -269.139 -14.606 1.00 30.12  ? 8   DA  C N3     1 
ATOM   2171 C  C4     . DA  C 3 8  ? 21.487 -270.147 -14.394 1.00 25.54  ? 8   DA  C C4     1 
ATOM   2172 H  "H5'"  A DA  C 3 8  ? 23.658 -275.150 -16.322 0.60 33.79  ? 8   DA  C "H5'"  1 
ATOM   2173 H  "H5'"  B DA  C 3 8  ? 24.198 -275.579 -15.531 0.40 39.46  ? 8   DA  C "H5'"  1 
ATOM   2174 H  "H5''" A DA  C 3 8  ? 24.879 -275.759 -15.520 0.60 33.79  ? 8   DA  C "H5''" 1 
ATOM   2175 H  "H5''" B DA  C 3 8  ? 24.790 -276.015 -14.135 0.40 39.46  ? 8   DA  C "H5''" 1 
ATOM   2176 H  "H4'"  A DA  C 3 8  ? 25.211 -273.556 -15.337 0.60 37.27  ? 8   DA  C "H4'"  1 
ATOM   2177 H  "H4'"  B DA  C 3 8  ? 25.032 -273.731 -14.406 0.40 52.93  ? 8   DA  C "H4'"  1 
ATOM   2178 H  "H3'"  A DA  C 3 8  ? 24.392 -274.719 -13.031 0.60 51.61  ? 8   DA  C "H3'"  1 
ATOM   2179 H  "H3'"  B DA  C 3 8  ? 23.199 -274.341 -12.354 0.40 44.33  ? 8   DA  C "H3'"  1 
ATOM   2180 H  "H2'"  A DA  C 3 8  ? 22.758 -273.282 -12.545 0.60 58.84  ? 8   DA  C "H2'"  1 
ATOM   2181 H  "H2'"  B DA  C 3 8  ? 22.841 -272.167 -12.062 0.40 79.57  ? 8   DA  C "H2'"  1 
ATOM   2182 H  "H2''" A DA  C 3 8  ? 23.926 -272.241 -12.227 0.60 58.84  ? 8   DA  C "H2''" 1 
ATOM   2183 H  "H2''" B DA  C 3 8  ? 24.339 -271.786 -12.443 0.40 79.57  ? 8   DA  C "H2''" 1 
ATOM   2184 H  "H1'"  A DA  C 3 8  ? 23.818 -271.317 -14.268 0.60 60.82  ? 8   DA  C "H1'"  1 
ATOM   2185 H  "H1'"  B DA  C 3 8  ? 23.765 -271.443 -14.539 0.40 57.68  ? 8   DA  C "H1'"  1 
ATOM   2186 H  H8     . DA  C 3 8  ? 20.544 -273.033 -13.870 1.00 31.48  ? 8   DA  C H8     1 
ATOM   2187 H  H61    . DA  C 3 8  ? 17.701 -269.237 -14.431 1.00 27.41  ? 8   DA  C H61    1 
ATOM   2188 H  H62    . DA  C 3 8  ? 17.955 -267.786 -14.650 1.00 27.41  ? 8   DA  C H62    1 
ATOM   2189 H  H2     . DA  C 3 8  ? 22.216 -267.261 -14.922 1.00 24.06  ? 8   DA  C H2     1 
ATOM   2190 P  P      A DC  C 3 9  ? 26.571 -273.692 -11.658 0.52 36.66  ? 9   DC  C P      1 
ATOM   2191 P  P      B DC  C 3 9  ? 25.242 -273.775 -10.370 0.48 34.72  ? 9   DC  C P      1 
ATOM   2192 O  OP1    A DC  C 3 9  ? 27.929 -274.229 -11.892 0.52 37.47  ? 9   DC  C OP1    1 
ATOM   2193 O  OP1    B DC  C 3 9  ? 26.434 -274.531 -9.928  0.48 48.58  ? 9   DC  C OP1    1 
ATOM   2194 O  OP2    A DC  C 3 9  ? 25.623 -274.403 -10.772 0.52 43.84  ? 9   DC  C OP2    1 
ATOM   2195 O  OP2    B DC  C 3 9  ? 23.953 -273.970 -9.684  0.48 32.96  ? 9   DC  C OP2    1 
ATOM   2196 O  "O5'"  A DC  C 3 9  ? 26.739 -272.194 -11.159 0.52 53.94  ? 9   DC  C "O5'"  1 
ATOM   2197 O  "O5'"  B DC  C 3 9  ? 25.661 -272.241 -10.323 0.48 37.57  ? 9   DC  C "O5'"  1 
ATOM   2198 C  "C5'"  A DC  C 3 9  ? 27.298 -271.241 -12.050 0.52 31.16  ? 9   DC  C "C5'"  1 
ATOM   2199 C  "C5'"  B DC  C 3 9  ? 26.687 -271.788 -11.194 0.48 25.64  ? 9   DC  C "C5'"  1 
ATOM   2200 C  "C4'"  A DC  C 3 9  ? 27.052 -269.829 -11.564 0.52 21.97  ? 9   DC  C "C4'"  1 
ATOM   2201 C  "C4'"  B DC  C 3 9  ? 26.834 -270.284 -11.143 0.48 45.06  ? 9   DC  C "C4'"  1 
ATOM   2202 O  "O4'"  A DC  C 3 9  ? 25.686 -269.414 -11.868 0.52 22.99  ? 9   DC  C "O4'"  1 
ATOM   2203 O  "O4'"  B DC  C 3 9  ? 25.628 -269.661 -11.664 0.48 56.79  ? 9   DC  C "O4'"  1 
ATOM   2204 C  "C3'"  A DC  C 3 9  ? 27.227 -269.627 -10.059 0.52 42.71  ? 9   DC  C "C3'"  1 
ATOM   2205 C  "C3'"  B DC  C 3 9  ? 27.037 -269.708 -9.748  0.48 22.79  ? 9   DC  C "C3'"  1 
ATOM   2206 O  "O3'"  A DC  C 3 9  ? 28.075 -268.524 -9.857  0.52 33.72  ? 9   DC  C "O3'"  1 
ATOM   2207 O  "O3'"  B DC  C 3 9  ? 28.003 -268.671 -9.782  0.48 35.72  ? 9   DC  C "O3'"  1 
ATOM   2208 C  "C2'"  A DC  C 3 9  ? 25.800 -269.393 -9.546  0.52 32.65  ? 9   DC  C "C2'"  1 
ATOM   2209 C  "C2'"  B DC  C 3 9  ? 25.657 -269.196 -9.370  0.48 30.11  ? 9   DC  C "C2'"  1 
ATOM   2210 C  "C1'"  A DC  C 3 9  ? 25.149 -268.732 -10.747 0.52 26.63  ? 9   DC  C "C1'"  1 
ATOM   2211 C  "C1'"  B DC  C 3 9  ? 25.103 -268.758 -10.717 0.48 24.00  ? 9   DC  C "C1'"  1 
ATOM   2212 N  N1     . DC  C 3 9  ? 23.617 -268.794 -10.809 1.00 26.98  ? 9   DC  C N1     1 
ATOM   2213 C  C2     . DC  C 3 9  ? 22.902 -267.628 -11.145 1.00 22.24  ? 9   DC  C C2     1 
ATOM   2214 O  O2     . DC  C 3 9  ? 23.521 -266.584 -11.330 1.00 27.62  ? 9   DC  C O2     1 
ATOM   2215 N  N3     . DC  C 3 9  ? 21.550 -267.677 -11.229 1.00 22.17  ? 9   DC  C N3     1 
ATOM   2216 C  C4     . DC  C 3 9  ? 20.922 -268.834 -11.033 1.00 23.09  ? 9   DC  C C4     1 
ATOM   2217 N  N4     . DC  C 3 9  ? 19.578 -268.834 -11.106 1.00 20.43  ? 9   DC  C N4     1 
ATOM   2218 C  C5     . DC  C 3 9  ? 21.632 -270.033 -10.701 1.00 28.60  ? 9   DC  C C5     1 
ATOM   2219 C  C6     . DC  C 3 9  ? 22.966 -269.966 -10.609 1.00 25.31  ? 9   DC  C C6     1 
ATOM   2220 H  "H5'"  A DC  C 3 9  ? 26.897 -271.349 -12.926 0.52 37.40  ? 9   DC  C "H5'"  1 
ATOM   2221 H  "H5'"  B DC  C 3 9  ? 26.475 -272.055 -12.102 0.48 30.76  ? 9   DC  C "H5'"  1 
ATOM   2222 H  "H5''" A DC  C 3 9  ? 28.254 -271.392 -12.118 0.52 37.40  ? 9   DC  C "H5''" 1 
ATOM   2223 H  "H5''" B DC  C 3 9  ? 27.527 -272.197 -10.932 0.48 30.76  ? 9   DC  C "H5''" 1 
ATOM   2224 H  "H4'"  A DC  C 3 9  ? 27.664 -269.235 -12.026 0.52 26.37  ? 9   DC  C "H4'"  1 
ATOM   2225 H  "H4'"  B DC  C 3 9  ? 27.585 -270.025 -11.700 0.48 54.07  ? 9   DC  C "H4'"  1 
ATOM   2226 H  "H3'"  A DC  C 3 9  ? 27.605 -270.423 -9.654  0.52 51.26  ? 9   DC  C "H3'"  1 
ATOM   2227 H  "H3'"  B DC  C 3 9  ? 27.314 -270.407 -9.136  0.48 27.35  ? 9   DC  C "H3'"  1 
ATOM   2228 H  "H2'"  A DC  C 3 9  ? 25.366 -270.234 -9.335  0.52 39.18  ? 9   DC  C "H2'"  1 
ATOM   2229 H  "H2'"  B DC  C 3 9  ? 25.119 -269.906 -8.987  0.48 36.13  ? 9   DC  C "H2'"  1 
ATOM   2230 H  "H2''" A DC  C 3 9  ? 25.800 -268.797 -8.781  0.52 39.18  ? 9   DC  C "H2''" 1 
ATOM   2231 H  "H2''" B DC  C 3 9  ? 25.723 -268.443 -8.762  0.48 36.13  ? 9   DC  C "H2''" 1 
ATOM   2232 H  "H1'"  A DC  C 3 9  ? 25.428 -267.804 -10.782 0.52 31.96  ? 9   DC  C "H1'"  1 
ATOM   2233 H  "H1'"  B DC  C 3 9  ? 25.418 -267.864 -10.918 0.48 28.80  ? 9   DC  C "H1'"  1 
ATOM   2234 H  H41    . DC  C 3 9  ? 19.141 -269.565 -10.984 1.00 24.52  ? 9   DC  C H41    1 
ATOM   2235 H  H42    . DC  C 3 9  ? 19.157 -268.103 -11.274 1.00 24.52  ? 9   DC  C H42    1 
ATOM   2236 H  H5     . DC  C 3 9  ? 21.180 -270.832 -10.549 1.00 34.32  ? 9   DC  C H5     1 
ATOM   2237 H  H6     . DC  C 3 9  ? 23.452 -270.732 -10.404 1.00 30.37  ? 9   DC  C H6     1 
ATOM   2238 P  P      . DG  C 3 10 ? 28.681 -268.167 -8.425  1.00 37.48  ? 10  DG  C P      1 
ATOM   2239 O  OP1    . DG  C 3 10 ? 29.984 -267.552 -8.752  1.00 43.76  ? 10  DG  C OP1    1 
ATOM   2240 O  OP2    . DG  C 3 10 ? 28.559 -269.259 -7.444  1.00 39.41  ? 10  DG  C OP2    1 
ATOM   2241 O  "O5'"  . DG  C 3 10 ? 27.704 -267.029 -7.902  1.00 36.10  ? 10  DG  C "O5'"  1 
ATOM   2242 C  "C5'"  . DG  C 3 10 ? 27.568 -265.854 -8.661  1.00 37.44  ? 10  DG  C "C5'"  1 
ATOM   2243 C  "C4'"  . DG  C 3 10 ? 26.404 -265.029 -8.184  1.00 33.99  ? 10  DG  C "C4'"  1 
ATOM   2244 O  "O4'"  . DG  C 3 10 ? 25.183 -265.663 -8.582  1.00 35.31  ? 10  DG  C "O4'"  1 
ATOM   2245 C  "C3'"  . DG  C 3 10 ? 26.309 -264.860 -6.663  1.00 33.49  ? 10  DG  C "C3'"  1 
ATOM   2246 O  "O3'"  . DG  C 3 10 ? 26.767 -263.596 -6.299  1.00 44.12  ? 10  DG  C "O3'"  1 
ATOM   2247 C  "C2'"  . DG  C 3 10 ? 24.821 -265.042 -6.357  1.00 42.62  ? 10  DG  C "C2'"  1 
ATOM   2248 C  "C1'"  . DG  C 3 10 ? 24.178 -265.226 -7.733  1.00 31.70  ? 10  DG  C "C1'"  1 
ATOM   2249 N  N9     . DG  C 3 10 ? 23.102 -266.198 -7.752  1.00 26.43  ? 10  DG  C N9     1 
ATOM   2250 C  C8     . DG  C 3 10 ? 23.181 -267.546 -7.517  1.00 25.25  ? 10  DG  C C8     1 
ATOM   2251 N  N7     . DG  C 3 10 ? 22.026 -268.150 -7.614  1.00 29.77  ? 10  DG  C N7     1 
ATOM   2252 C  C5     . DG  C 3 10 ? 21.140 -267.124 -7.896  1.00 22.68  ? 10  DG  C C5     1 
ATOM   2253 C  C6     . DG  C 3 10 ? 19.755 -267.160 -8.103  1.00 21.55  ? 10  DG  C C6     1 
ATOM   2254 O  O6     . DG  C 3 10 ? 19.005 -268.145 -8.048  1.00 26.66  ? 10  DG  C O6     1 
ATOM   2255 N  N1     . DG  C 3 10 ? 19.247 -265.900 -8.357  1.00 24.83  ? 10  DG  C N1     1 
ATOM   2256 C  C2     . DG  C 3 10 ? 19.990 -264.752 -8.437  1.00 23.89  ? 10  DG  C C2     1 
ATOM   2257 N  N2     . DG  C 3 10 ? 19.333 -263.625 -8.687  1.00 26.36  ? 10  DG  C N2     1 
ATOM   2258 N  N3     . DG  C 3 10 ? 21.278 -264.710 -8.240  1.00 26.70  ? 10  DG  C N3     1 
ATOM   2259 C  C4     . DG  C 3 10 ? 21.786 -265.927 -7.986  1.00 23.66  ? 10  DG  C C4     1 
ATOM   2260 H  "H5'"  . DG  C 3 10 ? 27.429 -266.091 -9.591  1.00 44.93  ? 10  DG  C "H5'"  1 
ATOM   2261 H  "H5''" . DG  C 3 10 ? 28.381 -265.330 -8.584  1.00 44.93  ? 10  DG  C "H5''" 1 
ATOM   2262 H  "H4'"  . DG  C 3 10 ? 26.451 -264.152 -8.595  1.00 40.79  ? 10  DG  C "H4'"  1 
ATOM   2263 H  "H3'"  . DG  C 3 10 ? 26.829 -265.547 -6.217  1.00 40.19  ? 10  DG  C "H3'"  1 
ATOM   2264 H  "H2'"  . DG  C 3 10 ? 24.680 -265.829 -5.807  1.00 51.15  ? 10  DG  C "H2'"  1 
ATOM   2265 H  "H2''" . DG  C 3 10 ? 24.467 -264.253 -5.921  1.00 51.15  ? 10  DG  C "H2''" 1 
ATOM   2266 H  "H1'"  . DG  C 3 10 ? 23.844 -264.372 -8.047  1.00 38.04  ? 10  DG  C "H1'"  1 
ATOM   2267 H  H8     . DG  C 3 10 ? 23.979 -267.991 -7.344  1.00 30.30  ? 10  DG  C H8     1 
ATOM   2268 H  H1     . DG  C 3 10 ? 18.401 -265.835 -8.496  1.00 29.79  ? 10  DG  C H1     1 
ATOM   2269 H  H21    . DG  C 3 10 ? 19.759 -262.879 -8.726  1.00 31.63  ? 10  DG  C H21    1 
ATOM   2270 H  H22    . DG  C 3 10 ? 18.482 -263.642 -8.810  1.00 31.63  ? 10  DG  C H22    1 
ATOM   2271 P  P      . DC  C 3 11 ? 26.858 -263.172 -4.750  1.00 44.06  ? 11  DC  C P      1 
ATOM   2272 O  OP1    . DC  C 3 11 ? 28.109 -262.421 -4.631  1.00 46.43  ? 11  DC  C OP1    1 
ATOM   2273 O  OP2    . DC  C 3 11 ? 26.598 -264.303 -3.817  1.00 40.48  ? 11  DC  C OP2    1 
ATOM   2274 O  "O5'"  . DC  C 3 11 ? 25.602 -262.220 -4.568  1.00 42.31  ? 11  DC  C "O5'"  1 
ATOM   2275 C  "C5'"  . DC  C 3 11 ? 25.277 -261.243 -5.544  1.00 33.19  ? 11  DC  C "C5'"  1 
ATOM   2276 C  "C4'"  . DC  C 3 11 ? 23.898 -260.686 -5.239  1.00 38.28  ? 11  DC  C "C4'"  1 
ATOM   2277 O  "O4'"  . DC  C 3 11 ? 22.879 -261.683 -5.621  1.00 33.64  ? 11  DC  C "O4'"  1 
ATOM   2278 C  "C3'"  . DC  C 3 11 ? 23.661 -260.395 -3.768  1.00 45.71  ? 11  DC  C "C3'"  1 
ATOM   2279 O  "O3'"  . DC  C 3 11 ? 22.980 -259.159 -3.602  1.00 44.93  ? 11  DC  C "O3'"  1 
ATOM   2280 C  "C2'"  . DC  C 3 11 ? 22.842 -261.596 -3.311  1.00 34.86  ? 11  DC  C "C2'"  1 
ATOM   2281 C  "C1'"  . DC  C 3 11 ? 22.022 -261.905 -4.541  1.00 34.02  ? 11  DC  C "C1'"  1 
ATOM   2282 N  N1     . DC  C 3 11 ? 21.492 -263.330 -4.618  1.00 29.74  ? 11  DC  C N1     1 
ATOM   2283 C  C2     . DC  C 3 11 ? 20.152 -263.543 -4.981  1.00 30.80  ? 11  DC  C C2     1 
ATOM   2284 O  O2     . DC  C 3 11 ? 19.431 -262.569 -5.236  1.00 27.76  ? 11  DC  C O2     1 
ATOM   2285 N  N3     . DC  C 3 11 ? 19.672 -264.818 -5.009  1.00 26.53  ? 11  DC  C N3     1 
ATOM   2286 C  C4     . DC  C 3 11 ? 20.470 -265.833 -4.721  1.00 27.68  ? 11  DC  C C4     1 
ATOM   2287 N  N4     . DC  C 3 11 ? 19.952 -267.081 -4.801  1.00 27.96  ? 11  DC  C N4     1 
ATOM   2288 C  C5     . DC  C 3 11 ? 21.848 -265.640 -4.357  1.00 28.10  ? 11  DC  C C5     1 
ATOM   2289 C  C6     . DC  C 3 11 ? 22.310 -264.384 -4.326  1.00 29.31  ? 11  DC  C C6     1 
ATOM   2290 H  "H5'"  . DC  C 3 11 ? 25.276 -261.650 -6.424  1.00 39.82  ? 11  DC  C "H5'"  1 
ATOM   2291 H  "H5''" . DC  C 3 11 ? 25.930 -260.527 -5.517  1.00 39.82  ? 11  DC  C "H5''" 1 
ATOM   2292 H  "H4'"  . DC  C 3 11 ? 23.760 -259.875 -5.752  1.00 45.94  ? 11  DC  C "H4'"  1 
ATOM   2293 H  "H3'"  . DC  C 3 11 ? 24.508 -260.373 -3.295  1.00 54.85  ? 11  DC  C "H3'"  1 
ATOM   2294 H  "HO3'" . DC  C 3 11 ? 22.143 -259.130 -3.659  1.00 53.92  ? 11  DC  C "HO3'" 1 
ATOM   2295 H  "H2'"  . DC  C 3 11 ? 23.421 -262.339 -3.083  1.00 41.83  ? 11  DC  C "H2'"  1 
ATOM   2296 H  "H2''" . DC  C 3 11 ? 22.269 -261.359 -2.565  1.00 41.83  ? 11  DC  C "H2''" 1 
ATOM   2297 H  "H1'"  . DC  C 3 11 ? 21.279 -261.284 -4.592  1.00 40.83  ? 11  DC  C "H1'"  1 
ATOM   2298 H  H41    . DC  C 3 11 ? 19.130 -267.192 -5.029  1.00 33.55  ? 11  DC  C H41    1 
ATOM   2299 H  H42    . DC  C 3 11 ? 20.445 -267.763 -4.624  1.00 33.55  ? 11  DC  C H42    1 
ATOM   2300 H  H5     . DC  C 3 11 ? 22.401 -266.362 -4.161  1.00 33.72  ? 11  DC  C H5     1 
ATOM   2301 H  H6     . DC  C 3 11 ? 23.192 -264.226 -4.079  1.00 35.17  ? 11  DC  C H6     1 
HETATM 2302 ZN ZN     . ZN  D 4 .  ? 33.796 -260.062 -24.655 1.00 28.57  ? 501 ZN  A ZN     1 
HETATM 2303 ZN ZN     . ZN  E 4 .  ? 8.608  -254.240 -15.666 1.00 33.15  ? 502 ZN  A ZN     1 
HETATM 2304 ZN ZN     . ZN  F 4 .  ? 5.698  -279.138 -4.815  1.00 28.45  ? 503 ZN  A ZN     1 
HETATM 2305 O  O      . HOH G 5 .  ? 39.519 -261.410 -27.430 1.00 37.12  ? 601 HOH A O      1 
HETATM 2306 O  O      . HOH G 5 .  ? 21.298 -265.095 -29.165 1.00 46.55  ? 602 HOH A O      1 
HETATM 2307 O  O      . HOH G 5 .  ? 0.603  -281.743 -7.971  1.00 46.89  ? 603 HOH A O      1 
HETATM 2308 O  O      . HOH G 5 .  ? 23.547 -250.048 -18.976 1.00 42.12  ? 604 HOH A O      1 
HETATM 2309 O  O      . HOH G 5 .  ? 14.197 -247.065 -18.573 1.00 43.05  ? 605 HOH A O      1 
HETATM 2310 O  O      . HOH G 5 .  ? 31.733 -268.430 -24.979 1.00 43.64  ? 606 HOH A O      1 
HETATM 2311 O  O      . HOH G 5 .  ? 4.481  -279.098 -14.334 1.00 39.90  ? 607 HOH A O      1 
HETATM 2312 O  O      . HOH G 5 .  ? 10.354 -269.245 -6.563  1.00 33.16  ? 608 HOH A O      1 
HETATM 2313 O  O      . HOH G 5 .  ? 17.820 -254.430 -16.311 1.00 33.49  ? 609 HOH A O      1 
HETATM 2314 O  O      . HOH G 5 .  ? 14.232 -274.823 -16.329 1.00 35.08  ? 610 HOH A O      1 
HETATM 2315 O  O      . HOH G 5 .  ? 15.559 -267.312 -20.761 1.00 33.83  ? 611 HOH A O      1 
HETATM 2316 O  O      . HOH G 5 .  ? 12.517 -254.542 -11.535 1.00 41.78  ? 612 HOH A O      1 
HETATM 2317 O  O      . HOH G 5 .  ? 13.991 -264.201 -26.902 1.00 39.07  ? 613 HOH A O      1 
HETATM 2318 O  O      . HOH G 5 .  ? 15.051 -269.653 -16.954 1.00 29.62  ? 614 HOH A O      1 
HETATM 2319 O  O      . HOH G 5 .  ? 4.460  -264.217 -11.782 1.00 36.37  ? 615 HOH A O      1 
HETATM 2320 O  O      . HOH G 5 .  ? 14.551 -265.371 -18.718 1.00 23.24  ? 616 HOH A O      1 
HETATM 2321 O  O      . HOH G 5 .  ? 16.273 -277.263 -4.322  1.00 35.44  ? 617 HOH A O      1 
HETATM 2322 O  O      . HOH G 5 .  ? 23.943 -254.708 -21.216 1.00 24.63  ? 618 HOH A O      1 
HETATM 2323 O  O      . HOH G 5 .  ? 27.325 -269.703 -29.785 1.00 28.01  ? 619 HOH A O      1 
HETATM 2324 O  O      . HOH G 5 .  ? 7.485  -267.638 -9.193  1.00 26.64  ? 620 HOH A O      1 
HETATM 2325 O  O      . HOH G 5 .  ? 1.059  -268.994 -19.702 1.00 43.72  ? 621 HOH A O      1 
HETATM 2326 O  O      . HOH G 5 .  ? 29.884 -257.995 -33.184 1.00 43.95  ? 622 HOH A O      1 
HETATM 2327 O  O      . HOH G 5 .  ? 8.903  -269.408 -19.685 1.00 41.37  ? 623 HOH A O      1 
HETATM 2328 O  O      . HOH G 5 .  ? 25.695 -247.939 -22.570 1.00 33.06  ? 624 HOH A O      1 
HETATM 2329 O  O      . HOH G 5 .  ? 17.026 -274.280 -11.019 1.00 33.16  ? 625 HOH A O      1 
HETATM 2330 O  O      . HOH G 5 .  ? 10.511 -259.947 -24.903 1.00 37.73  ? 626 HOH A O      1 
HETATM 2331 O  O      . HOH G 5 .  ? 40.455 -259.128 -26.856 1.00 43.52  ? 627 HOH A O      1 
HETATM 2332 O  O      . HOH G 5 .  ? 18.497 -259.208 -19.789 1.00 22.73  ? 628 HOH A O      1 
HETATM 2333 O  O      . HOH G 5 .  ? 26.172 -255.924 -29.008 1.00 28.46  ? 629 HOH A O      1 
HETATM 2334 O  O      . HOH G 5 .  ? 37.521 -263.488 -20.932 1.00 44.86  ? 630 HOH A O      1 
HETATM 2335 O  O      . HOH G 5 .  ? 12.293 -272.466 -6.415  1.00 32.99  ? 631 HOH A O      1 
HETATM 2336 O  O      . HOH G 5 .  ? 26.563 -253.802 -27.677 1.00 27.25  ? 632 HOH A O      1 
HETATM 2337 O  O      . HOH G 5 .  ? 17.062 -282.110 -11.525 1.00 38.10  ? 633 HOH A O      1 
HETATM 2338 O  O      . HOH G 5 .  ? 24.454 -261.544 -35.655 1.00 40.28  ? 634 HOH A O      1 
HETATM 2339 O  O      . HOH G 5 .  ? 0.891  -277.595 -8.342  1.00 48.69  ? 635 HOH A O      1 
HETATM 2340 O  O      . HOH G 5 .  ? 5.760  -262.247 -20.665 1.00 43.73  ? 636 HOH A O      1 
HETATM 2341 O  O      . HOH G 5 .  ? 34.739 -268.904 -25.251 1.00 40.75  ? 637 HOH A O      1 
HETATM 2342 O  O      . HOH G 5 .  ? 40.326 -261.247 -29.329 1.00 47.64  ? 638 HOH A O      1 
HETATM 2343 O  O      . HOH G 5 .  ? 25.950 -273.370 -32.496 1.00 44.29  ? 639 HOH A O      1 
HETATM 2344 O  O      . HOH G 5 .  ? 22.010 -261.114 -30.717 1.00 36.73  ? 640 HOH A O      1 
HETATM 2345 O  O      . HOH G 5 .  ? 10.642 -276.969 -14.810 1.00 32.74  ? 641 HOH A O      1 
HETATM 2346 O  O      . HOH G 5 .  ? 19.949 -256.480 -18.435 1.00 23.99  ? 642 HOH A O      1 
HETATM 2347 O  O      . HOH G 5 .  ? 10.815 -279.409 -13.245 1.00 35.77  ? 643 HOH A O      1 
HETATM 2348 O  O      . HOH G 5 .  ? 34.693 -258.646 -31.528 1.00 42.27  ? 644 HOH A O      1 
HETATM 2349 O  O      . HOH G 5 .  ? 15.279 -270.641 -9.687  1.00 26.99  ? 645 HOH A O      1 
HETATM 2350 O  O      . HOH G 5 .  ? 11.804 -266.160 -21.911 1.00 34.06  ? 646 HOH A O      1 
HETATM 2351 O  O      . HOH G 5 .  ? -2.406 -260.504 -15.306 1.00 46.03  ? 647 HOH A O      1 
HETATM 2352 O  O      . HOH G 5 .  ? 4.676  -271.202 -5.130  1.00 52.45  ? 648 HOH A O      1 
HETATM 2353 O  O      . HOH G 5 .  ? 10.627 -270.109 -17.944 1.00 34.87  ? 649 HOH A O      1 
HETATM 2354 O  O      . HOH G 5 .  ? 6.453  -255.496 -21.064 1.00 48.30  ? 650 HOH A O      1 
HETATM 2355 O  O      . HOH G 5 .  ? 38.678 -263.704 -27.598 1.00 40.57  ? 651 HOH A O      1 
HETATM 2356 O  O      . HOH G 5 .  ? 5.105  -264.730 -20.733 1.00 39.87  ? 652 HOH A O      1 
HETATM 2357 O  O      . HOH G 5 .  ? 11.838 -252.708 -26.478 1.00 47.98  ? 653 HOH A O      1 
HETATM 2358 O  O      . HOH G 5 .  ? 5.774  -264.676 -6.616  1.00 47.81  ? 654 HOH A O      1 
HETATM 2359 O  O      . HOH G 5 .  ? 27.581 -256.241 -31.427 1.00 47.07  ? 655 HOH A O      1 
HETATM 2360 O  O      . HOH G 5 .  ? 29.389 -270.590 -28.310 1.00 38.98  ? 656 HOH A O      1 
HETATM 2361 O  O      . HOH G 5 .  ? 18.642 -264.250 -25.865 1.00 36.48  ? 657 HOH A O      1 
HETATM 2362 O  O      . HOH G 5 .  ? 26.796 -255.424 -17.988 1.00 53.45  ? 658 HOH A O      1 
HETATM 2363 O  O      . HOH G 5 .  ? 10.714 -264.255 -13.666 1.00 28.06  ? 659 HOH A O      1 
HETATM 2364 O  O      . HOH G 5 .  ? 18.488 -261.200 -26.854 1.00 24.95  ? 660 HOH A O      1 
HETATM 2365 O  O      . HOH G 5 .  ? 16.637 -256.114 -9.353  1.00 41.85  ? 661 HOH A O      1 
HETATM 2366 O  O      . HOH G 5 .  ? 20.450 -261.948 -28.970 1.00 43.82  ? 662 HOH A O      1 
HETATM 2367 O  O      . HOH G 5 .  ? 34.103 -261.368 -20.837 1.00 44.72  ? 663 HOH A O      1 
HETATM 2368 O  O      . HOH G 5 .  ? 8.232  -259.391 -23.705 1.00 45.17  ? 664 HOH A O      1 
HETATM 2369 O  O      . HOH G 5 .  ? 10.687 -253.167 -12.367 1.00 45.32  ? 665 HOH A O      1 
HETATM 2370 O  O      . HOH G 5 .  ? 15.748 -275.177 -2.626  1.00 37.58  ? 666 HOH A O      1 
HETATM 2371 O  O      . HOH G 5 .  ? -1.664 -257.788 -15.737 1.00 41.67  ? 667 HOH A O      1 
HETATM 2372 O  O      . HOH H 5 .  ? 20.504 -270.221 -35.253 1.00 34.49  ? 101 HOH B O      1 
HETATM 2373 O  O      . HOH H 5 .  ? 6.331  -265.043 -9.481  1.00 37.16  ? 102 HOH B O      1 
HETATM 2374 O  O      . HOH H 5 .  ? 17.100 -276.428 -35.777 1.00 40.41  ? 103 HOH B O      1 
HETATM 2375 O  O      . HOH H 5 .  ? 10.473 -265.245 -11.179 1.00 25.29  ? 104 HOH B O      1 
HETATM 2376 O  O      . HOH H 5 .  ? 13.373 -281.473 -34.412 1.00 45.23  ? 105 HOH B O      1 
HETATM 2377 O  O      . HOH H 5 .  ? 5.806  -261.269 -8.460  1.00 46.34  ? 106 HOH B O      1 
HETATM 2378 O  O      . HOH H 5 .  ? 12.181 -257.391 -10.658 1.00 33.63  ? 107 HOH B O      1 
HETATM 2379 O  O      . HOH H 5 .  ? 24.136 -263.132 -22.662 1.00 26.92  ? 108 HOH B O      1 
HETATM 2380 O  O      . HOH H 5 .  ? 6.237  -268.756 -6.928  1.00 34.00  ? 109 HOH B O      1 
HETATM 2381 O  O      . HOH H 5 .  ? 19.806 -253.559 -13.924 1.00 43.30  ? 110 HOH B O      1 
HETATM 2382 O  O      . HOH H 5 .  ? 12.912 -263.307 -14.825 1.00 22.86  ? 111 HOH B O      1 
HETATM 2383 O  O      . HOH H 5 .  ? 24.236 -263.793 -14.664 1.00 42.42  ? 112 HOH B O      1 
HETATM 2384 O  O      . HOH H 5 .  ? 10.800 -274.695 -38.670 1.00 34.53  ? 113 HOH B O      1 
HETATM 2385 O  O      . HOH H 5 .  ? 16.807 -260.773 -8.965  1.00 34.92  ? 114 HOH B O      1 
HETATM 2386 O  O      . HOH H 5 .  ? 7.121  -270.770 -3.728  1.00 39.81  ? 115 HOH B O      1 
HETATM 2387 O  O      . HOH H 5 .  ? 25.178 -272.758 -20.280 1.00 47.70  ? 116 HOH B O      1 
HETATM 2388 O  O      . HOH H 5 .  ? 21.518 -275.174 -24.037 1.00 40.81  ? 117 HOH B O      1 
HETATM 2389 O  O      . HOH H 5 .  ? 19.984 -270.770 -2.331  1.00 42.57  ? 118 HOH B O      1 
HETATM 2390 O  O      . HOH H 5 .  ? 22.671 -255.246 -16.038 1.00 39.41  ? 119 HOH B O      1 
HETATM 2391 O  O      . HOH H 5 .  ? 29.496 -273.327 -28.396 1.00 46.74  ? 120 HOH B O      1 
HETATM 2392 O  O      . HOH H 5 .  ? 25.871 -264.800 -25.541 1.00 28.01  ? 121 HOH B O      1 
HETATM 2393 O  O      . HOH H 5 .  ? 21.456 -256.168 -11.772 1.00 41.68  ? 122 HOH B O      1 
HETATM 2394 O  O      . HOH H 5 .  ? 26.273 -267.759 -16.696 1.00 37.70  ? 123 HOH B O      1 
HETATM 2395 O  O      . HOH H 5 .  ? 24.116 -260.264 -22.657 1.00 30.72  ? 124 HOH B O      1 
HETATM 2396 O  O      . HOH H 5 .  ? 17.477 -272.923 -3.056  1.00 37.60  ? 125 HOH B O      1 
HETATM 2397 O  O      . HOH H 5 .  ? 15.507 -267.043 -16.828 1.00 30.38  ? 126 HOH B O      1 
HETATM 2398 O  O      . HOH H 5 .  ? 26.727 -269.032 -26.568 1.00 40.24  ? 127 HOH B O      1 
HETATM 2399 O  O      . HOH H 5 .  ? 22.694 -256.285 -18.370 1.00 30.87  ? 128 HOH B O      1 
HETATM 2400 O  O      . HOH H 5 .  ? 17.774 -259.378 -17.103 1.00 20.70  ? 129 HOH B O      1 
HETATM 2401 O  O      . HOH H 5 .  ? 15.006 -260.034 -16.444 1.00 22.59  ? 130 HOH B O      1 
HETATM 2402 O  O      . HOH H 5 .  ? 25.789 -261.659 -15.506 1.00 34.42  ? 131 HOH B O      1 
HETATM 2403 O  O      . HOH H 5 .  ? 13.349 -261.248 -5.923  1.00 37.20  ? 132 HOH B O      1 
HETATM 2404 O  O      . HOH H 5 .  ? 21.343 -260.569 -10.271 1.00 42.15  ? 133 HOH B O      1 
HETATM 2405 O  O      . HOH H 5 .  ? 16.835 -279.642 -37.608 1.00 49.95  ? 134 HOH B O      1 
HETATM 2406 O  O      . HOH H 5 .  ? 30.365 -274.000 -25.925 1.00 48.05  ? 135 HOH B O      1 
HETATM 2407 O  O      . HOH I 5 .  ? 18.469 -280.348 -20.445 1.00 54.04  ? 101 HOH C O      1 
HETATM 2408 O  O      . HOH I 5 .  ? 19.111 -277.573 -13.351 1.00 36.97  ? 102 HOH C O      1 
HETATM 2409 O  O      . HOH I 5 .  ? 11.543 -264.920 -25.910 1.00 45.15  ? 103 HOH C O      1 
HETATM 2410 O  O      . HOH I 5 .  ? 21.386 -269.122 -4.004  1.00 36.74  ? 104 HOH C O      1 
HETATM 2411 O  O      . HOH I 5 .  ? 20.612 -275.856 -21.734 1.00 41.70  ? 105 HOH C O      1 
HETATM 2412 O  O      . HOH I 5 .  ? 22.532 -262.412 -8.375  1.00 40.79  ? 106 HOH C O      1 
HETATM 2413 O  O      . HOH I 5 .  ? 25.003 -269.123 -14.523 1.00 42.45  ? 107 HOH C O      1 
HETATM 2414 O  O      . HOH I 5 .  ? 21.484 -267.574 -35.434 1.00 43.30  ? 108 HOH C O      1 
HETATM 2415 O  O      . HOH I 5 .  ? 26.290 -269.213 -6.000  1.00 46.61  ? 109 HOH C O      1 
HETATM 2416 O  O      . HOH I 5 .  ? 15.886 -275.090 -24.554 1.00 34.86  ? 110 HOH C O      1 
HETATM 2417 O  O      . HOH I 5 .  ? 14.350 -261.725 -38.933 1.00 45.86  ? 111 HOH C O      1 
HETATM 2418 O  O      . HOH I 5 .  ? 16.524 -265.178 -27.116 1.00 45.59  ? 112 HOH C O      1 
HETATM 2419 O  O      . HOH I 5 .  ? 18.003 -271.167 -10.755 1.00 36.51  ? 113 HOH C O      1 
HETATM 2420 O  O      . HOH I 5 .  ? 12.924 -269.882 -18.967 1.00 34.12  ? 114 HOH C O      1 
HETATM 2421 O  O      . HOH I 5 .  ? 26.484 -277.736 -14.049 1.00 47.67  ? 115 HOH C O      1 
HETATM 2422 O  O      . HOH I 5 .  ? 16.503 -275.466 -15.748 1.00 28.34  ? 116 HOH C O      1 
HETATM 2423 O  O      . HOH I 5 .  ? 12.621 -277.406 -16.822 1.00 41.08  ? 117 HOH C O      1 
HETATM 2424 O  O      . HOH I 5 .  ? 11.850 -267.059 -24.330 1.00 40.09  ? 118 HOH C O      1 
HETATM 2425 O  O      . HOH I 5 .  ? 17.954 -275.368 -13.268 1.00 32.94  ? 119 HOH C O      1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . LYS A 7  ? 0.9020 0.6156 0.8437 0.1182  0.2454  -0.2045 351 LYS A N     
2    C  CA    . LYS A 7  ? 0.7672 0.5285 0.7279 0.1061  0.2311  -0.1877 351 LYS A CA    
3    C  C     . LYS A 7  ? 0.8830 0.7014 0.8681 0.0947  0.2542  -0.1929 351 LYS A C     
4    O  O     . LYS A 7  ? 0.6642 0.5420 0.7212 0.1133  0.2535  -0.1882 351 LYS A O     
5    C  CB    . LYS A 7  ? 0.7356 0.5256 0.7622 0.1374  0.2043  -0.1709 351 LYS A CB    
6    C  CG    . LYS A 7  ? 0.6863 0.4195 0.6886 0.1466  0.1785  -0.1600 351 LYS A CG    
7    C  CD    . LYS A 7  ? 0.7017 0.4662 0.7593 0.1705  0.1482  -0.1379 351 LYS A CD    
8    C  CE    . LYS A 7  ? 0.8329 0.5404 0.8536 0.1702  0.1203  -0.1203 351 LYS A CE    
9    N  NZ    . LYS A 7  ? 1.0691 0.8216 1.1218 0.1745  0.0842  -0.0930 351 LYS A NZ    
22   N  N     . PRO A 8  ? 0.6955 0.4965 0.6188 0.0608  0.2711  -0.1996 352 PRO A N     
23   C  CA    . PRO A 8  ? 0.7720 0.6174 0.7088 0.0458  0.2939  -0.2027 352 PRO A CA    
24   C  C     . PRO A 8  ? 0.6619 0.5418 0.5993 0.0240  0.2804  -0.1849 352 PRO A C     
25   O  O     . PRO A 8  ? 0.7009 0.6164 0.6523 0.0105  0.2968  -0.1847 352 PRO A O     
26   C  CB    . PRO A 8  ? 0.8442 0.6442 0.7044 0.0182  0.3140  -0.2153 352 PRO A CB    
27   C  CG    . PRO A 8  ? 0.7811 0.5264 0.5763 0.0016  0.2888  -0.2079 352 PRO A CG    
28   C  CD    . PRO A 8  ? 0.8617 0.6010 0.6982 0.0322  0.2670  -0.2023 352 PRO A CD    
36   N  N     . TYR A 9  ? 0.6020 0.4701 0.5232 0.0196  0.2521  -0.1701 353 TYR A N     
37   C  CA    . TYR A 9  ? 0.5377 0.4344 0.4566 0.0005  0.2393  -0.1533 353 TYR A CA    
38   C  C     . TYR A 9  ? 0.4998 0.4496 0.5026 0.0246  0.2202  -0.1425 353 TYR A C     
39   O  O     . TYR A 9  ? 0.5188 0.4651 0.5306 0.0347  0.1853  -0.1261 353 TYR A O     
40   C  CB    . TYR A 9  ? 0.5651 0.4248 0.4171 -0.0213 0.2090  -0.1359 353 TYR A CB    
41   C  CG    . TYR A 9  ? 0.7641 0.5788 0.5338 -0.0501 0.2188  -0.1422 353 TYR A CG    
42   C  CD1   . TYR A 9  ? 0.7765 0.5994 0.5123 -0.0779 0.2229  -0.1327 353 TYR A CD1   
43   C  CD2   . TYR A 9  ? 0.7543 0.5207 0.4864 -0.0507 0.2150  -0.1514 353 TYR A CD2   
44   C  CE1   . TYR A 9  ? 0.9533 0.7410 0.6228 -0.1038 0.2223  -0.1329 353 TYR A CE1   
45   C  CE2   . TYR A 9  ? 0.8200 0.5528 0.4849 -0.0797 0.2167  -0.1532 353 TYR A CE2   
46   C  CZ    . TYR A 9  ? 0.9218 0.6673 0.5569 -0.1055 0.2193  -0.1437 353 TYR A CZ    
47   O  OH    . TYR A 9  ? 0.9105 0.6243 0.4819 -0.1339 0.2176  -0.1439 353 TYR A OH    
57   N  N     . GLN A 10 ? 0.5153 0.5166 0.5782 0.0306  0.2408  -0.1503 354 GLN A N     
58   C  CA    . GLN A 10 ? 0.4088 0.4672 0.5539 0.0493  0.2231  -0.1424 354 GLN A CA    
59   C  C     . GLN A 10 ? 0.3963 0.4758 0.5352 0.0259  0.2005  -0.1225 354 GLN A C     
60   O  O     . GLN A 10 ? 0.4496 0.5152 0.5406 -0.0031 0.2110  -0.1180 354 GLN A O     
61   C  CB    . GLN A 10 ? 0.4814 0.5887 0.6882 0.0599  0.2421  -0.1516 354 GLN A CB    
62   C  CG    . GLN A 10 ? 0.8965 1.0327 1.1003 0.0290  0.2611  -0.1507 354 GLN A CG    
63   C  CD    . GLN A 10 ? 1.0418 1.1323 1.1646 0.0012  0.2852  -0.1558 354 GLN A CD    
64   O  OE1   . GLN A 10 ? 0.6045 0.6514 0.6845 0.0065  0.2954  -0.1663 354 GLN A OE1   
65   N  NE2   . GLN A 10 ? 0.7334 0.8302 0.8319 -0.0297 0.2911  -0.1470 354 GLN A NE2   
74   N  N     . CYS A 11 ? 0.3600 0.4693 0.5447 0.0388  0.1689  -0.1102 355 CYS A N     
75   C  CA    . CYS A 11 ? 0.2867 0.4143 0.4715 0.0196  0.1489  -0.0948 355 CYS A CA    
76   C  C     . CYS A 11 ? 0.2762 0.4620 0.5247 0.0128  0.1634  -0.1024 355 CYS A C     
77   O  O     . CYS A 11 ? 0.4852 0.7150 0.8028 0.0339  0.1618  -0.1101 355 CYS A O     
78   C  CB    . CYS A 11 ? 0.2618 0.3869 0.4523 0.0321  0.1086  -0.0796 355 CYS A CB    
79   S  SG    . CYS A 11 ? 0.2669 0.3951 0.4388 0.0080  0.0886  -0.0637 355 CYS A SG    
84   N  N     . ASP A 12 ? 0.3762 0.5627 0.6029 -0.0174 0.1765  -0.0988 356 ASP A N     
85   C  CA    . ASP A 12 ? 0.3514 0.5898 0.6326 -0.0322 0.1939  -0.1060 356 ASP A CA    
86   C  C     . ASP A 12 ? 0.2498 0.5088 0.5539 -0.0439 0.1657  -0.0954 356 ASP A C     
87   O  O     . ASP A 12 ? 0.2948 0.5881 0.6335 -0.0597 0.1712  -0.0975 356 ASP A O     
88   C  CB    . ASP A 12 ? 0.3289 0.5433 0.5605 -0.0602 0.2229  -0.1056 356 ASP A CB    
89   C  CG    . ASP A 12 ? 0.4877 0.6900 0.7044 -0.0503 0.2503  -0.1191 356 ASP A CG    
90   O  OD1   . ASP A 12 ? 0.5282 0.7495 0.7878 -0.0209 0.2494  -0.1291 356 ASP A OD1   
91   O  OD2   . ASP A 12 ? 0.4825 0.6537 0.6431 -0.0713 0.2708  -0.1190 356 ASP A OD2   
96   N  N     . PHE A 13 ? 0.2768 0.5059 0.5500 -0.0367 0.1321  -0.0821 357 PHE A N     
97   C  CA    . PHE A 13 ? 0.2418 0.4847 0.5310 -0.0468 0.1064  -0.0756 357 PHE A CA    
98   C  C     . PHE A 13 ? 0.3805 0.6865 0.7477 -0.0363 0.0937  -0.0841 357 PHE A C     
99   O  O     . PHE A 13 ? 0.2835 0.6129 0.6880 -0.0090 0.0912  -0.0890 357 PHE A O     
100  C  CB    . PHE A 13 ? 0.2522 0.4544 0.4963 -0.0370 0.0768  -0.0625 357 PHE A CB    
101  C  CG    . PHE A 13 ? 0.2761 0.4279 0.4565 -0.0522 0.0815  -0.0508 357 PHE A CG    
102  C  CD1   . PHE A 13 ? 0.3144 0.4348 0.4510 -0.0520 0.0962  -0.0472 357 PHE A CD1   
103  C  CD2   . PHE A 13 ? 0.3618 0.4967 0.5262 -0.0664 0.0700  -0.0435 357 PHE A CD2   
104  C  CE1   . PHE A 13 ? 0.3200 0.3999 0.4027 -0.0647 0.0954  -0.0332 357 PHE A CE1   
105  C  CE2   . PHE A 13 ? 0.3872 0.4775 0.5005 -0.0759 0.0731  -0.0305 357 PHE A CE2   
106  C  CZ    . PHE A 13 ? 0.3382 0.4043 0.4129 -0.0746 0.0839  -0.0236 357 PHE A CZ    
116  N  N     . LYS A 14 ? 0.2501 0.5820 0.6417 -0.0587 0.0843  -0.0850 358 LYS A N     
117  C  CA    . LYS A 14 ? 0.2173 0.6027 0.6673 -0.0538 0.0669  -0.0871 358 LYS A CA    
118  C  C     . LYS A 14 ? 0.1782 0.5730 0.6434 -0.0232 0.0332  -0.0818 358 LYS A C     
119  O  O     . LYS A 14 ? 0.2532 0.6179 0.6839 -0.0198 0.0115  -0.0768 358 LYS A O     
120  C  CB    . LYS A 14 ? 0.2666 0.6568 0.7149 -0.0860 0.0554  -0.0861 358 LYS A CB    
121  C  CG    . LYS A 14 ? 0.4008 0.8434 0.8998 -0.0876 0.0314  -0.0852 358 LYS A CG    
122  C  CD    . LYS A 14 ? 0.4428 0.8782 0.9301 -0.1249 0.0248  -0.0865 358 LYS A CD    
123  C  CE    . LYS A 14 ? 0.6194 1.0848 1.1292 -0.1287 -0.0137 -0.0840 358 LYS A CE    
124  N  NZ    . LYS A 14 ? 0.4611 0.9954 1.0390 -0.1203 -0.0200 -0.0805 358 LYS A NZ    
138  N  N     . ASP A 15 ? 0.2952 0.7279 0.8070 -0.0008 0.0295  -0.0806 359 ASP A N     
139  C  CA    . ASP A 15 ? 0.2467 0.6891 0.7732 0.0277  -0.0032 -0.0707 359 ASP A CA    
140  C  C     . ASP A 15 ? 0.4216 0.8174 0.9138 0.0546  -0.0052 -0.0674 359 ASP A C     
141  O  O     . ASP A 15 ? 0.4358 0.8255 0.9257 0.0766  -0.0325 -0.0560 359 ASP A O     
142  C  CB    . ASP A 15 ? 0.4879 0.9351 1.0016 0.0137  -0.0412 -0.0628 359 ASP A CB    
143  C  CG    . ASP A 15 ? 0.4905 0.9875 1.0435 -0.0107 -0.0471 -0.0640 359 ASP A CG    
144  O  OD1   . ASP A 15 ? 0.4146 0.9575 1.0206 -0.0051 -0.0325 -0.0654 359 ASP A OD1   
145  O  OD2   . ASP A 15 ? 0.4917 0.9809 1.0221 -0.0362 -0.0659 -0.0640 359 ASP A OD2   
150  N  N     . CYS A 16 ? 0.3813 0.7416 0.8423 0.0513  0.0227  -0.0753 360 CYS A N     
151  C  CA    . CYS A 16 ? 0.2527 0.5639 0.6754 0.0729  0.0219  -0.0719 360 CYS A CA    
152  C  C     . CYS A 16 ? 0.3331 0.6435 0.7777 0.0957  0.0482  -0.0807 360 CYS A C     
153  O  O     . CYS A 16 ? 0.4159 0.7430 0.8745 0.0858  0.0808  -0.0919 360 CYS A O     
154  C  CB    . CYS A 16 ? 0.2150 0.4686 0.5592 0.0522  0.0333  -0.0676 360 CYS A CB    
155  S  SG    . CYS A 16 ? 0.2814 0.4679 0.5604 0.0684  0.0245  -0.0578 360 CYS A SG    
160  N  N     . GLU A 17 ? 0.3760 0.6582 0.8125 0.1245  0.0342  -0.0741 361 GLU A N     
161  C  CA    . GLU A 17 ? 0.2867 0.5549 0.7336 0.1486  0.0571  -0.0817 361 GLU A CA    
162  C  C     . GLU A 17 ? 0.2836 0.4833 0.6760 0.1555  0.0692  -0.0868 361 GLU A C     
163  O  O     . GLU A 17 ? 0.3880 0.5602 0.7767 0.1771  0.0838  -0.0927 361 GLU A O     
164  C  CB    . GLU A 17 ? 0.3212 0.6117 0.8071 0.1777  0.0335  -0.0690 361 GLU A CB    
165  C  CG    . GLU A 17 ? 0.4818 0.8434 1.0236 0.1699  0.0213  -0.0644 361 GLU A CG    
166  C  CD    . GLU A 17 ? 0.8377 1.2368 1.4082 0.1514  0.0566  -0.0803 361 GLU A CD    
167  O  OE1   . GLU A 17 ? 0.6850 1.0893 1.2757 0.1675  0.0857  -0.0908 361 GLU A OE1   
168  O  OE2   . GLU A 17 ? 1.0967 1.5150 1.6640 0.1195  0.0568  -0.0822 361 GLU A OE2   
175  N  N     . ARG A 18 ? 0.3096 0.4720 0.6387 0.1322  0.0617  -0.0800 362 ARG A N     
176  C  CA    . ARG A 18 ? 0.3373 0.4316 0.6005 0.1327  0.0642  -0.0778 362 ARG A CA    
177  C  C     . ARG A 18 ? 0.4817 0.5498 0.7135 0.1214  0.1033  -0.0957 362 ARG A C     
178  O  O     . ARG A 18 ? 0.4067 0.4998 0.6422 0.1017  0.1262  -0.1043 362 ARG A O     
179  C  CB    . ARG A 18 ? 0.3435 0.4112 0.5491 0.1110  0.0410  -0.0613 362 ARG A CB    
180  C  CG    . ARG A 18 ? 0.4102 0.4814 0.6231 0.1225  0.0044  -0.0442 362 ARG A CG    
181  C  CD    . ARG A 18 ? 0.6965 0.7165 0.8454 0.1129  -0.0087 -0.0315 362 ARG A CD    
182  N  NE    . ARG A 18 ? 0.7575 0.7648 0.9059 0.1288  -0.0370 -0.0165 362 ARG A NE    
183  C  CZ    . ARG A 18 ? 0.8439 0.8097 0.9810 0.1468  -0.0406 -0.0125 362 ARG A CZ    
184  N  NH1   . ARG A 18 ? 0.5658 0.4971 0.6914 0.1516  -0.0162 -0.0258 362 ARG A NH1   
185  N  NH2   . ARG A 18 ? 1.0000 0.9528 1.1312 0.1585  -0.0683 0.0049  362 ARG A NH2   
199  N  N     . ARG A 19 ? 0.4249 0.4380 0.6211 0.1320  0.1114  -0.1017 363 ARG A N     
200  C  CA    . ARG A 19 ? 0.4765 0.4510 0.6256 0.1187  0.1460  -0.1199 363 ARG A CA    
201  C  C     . ARG A 19 ? 0.4527 0.3616 0.5269 0.1053  0.1325  -0.1130 363 ARG A C     
202  O  O     . ARG A 19 ? 0.5023 0.3887 0.5736 0.1178  0.1065  -0.0998 363 ARG A O     
203  C  CB    . ARG A 19 ? 0.5266 0.4966 0.7095 0.1454  0.1766  -0.1414 363 ARG A CB    
204  C  CG    . ARG A 19 ? 0.7257 0.7653 0.9759 0.1541  0.1884  -0.1454 363 ARG A CG    
205  C  CD    . ARG A 19 ? 0.5639 0.5926 0.8243 0.1754  0.2132  -0.1614 363 ARG A CD    
206  N  NE    . ARG A 19 ? 0.8261 0.8334 1.0381 0.1511  0.2497  -0.1794 363 ARG A NE    
207  C  CZ    . ARG A 19 ? 1.0099 1.0595 1.2363 0.1322  0.2726  -0.1849 363 ARG A CZ    
208  N  NH1   . ARG A 19 ? 0.7689 0.8857 1.0594 0.1331  0.2635  -0.1754 363 ARG A NH1   
209  N  NH2   . ARG A 19 ? 0.7829 0.8052 0.9555 0.1091  0.3030  -0.1988 363 ARG A NH2   
223  N  N     . PHE A 20 ? 0.6008 0.4788 0.6133 0.0781  0.1507  -0.1219 364 PHE A N     
224  C  CA    . PHE A 20 ? 0.5186 0.3431 0.4621 0.0588  0.1359  -0.1150 364 PHE A CA    
225  C  C     . PHE A 20 ? 0.5604 0.3333 0.4472 0.0454  0.1647  -0.1373 364 PHE A C     
226  O  O     . PHE A 20 ? 0.5862 0.3678 0.4702 0.0403  0.1977  -0.1556 364 PHE A O     
227  C  CB    . PHE A 20 ? 0.4591 0.3011 0.3737 0.0307  0.1147  -0.0954 364 PHE A CB    
228  C  CG    . PHE A 20 ? 0.4452 0.3258 0.4015 0.0406  0.0867  -0.0755 364 PHE A CG    
229  C  CD1   . PHE A 20 ? 0.4496 0.3131 0.3940 0.0427  0.0598  -0.0600 364 PHE A CD1   
230  C  CD2   . PHE A 20 ? 0.4455 0.3768 0.4497 0.0453  0.0890  -0.0739 364 PHE A CD2   
231  C  CE1   . PHE A 20 ? 0.4061 0.3006 0.3801 0.0501  0.0370  -0.0441 364 PHE A CE1   
232  C  CE2   . PHE A 20 ? 0.4932 0.4545 0.5280 0.0517  0.0633  -0.0585 364 PHE A CE2   
233  C  CZ    . PHE A 20 ? 0.3664 0.3085 0.3840 0.0548  0.0381  -0.0442 364 PHE A CZ    
243  N  N     . SER A 21 ? 0.6450 0.3621 0.4814 0.0357  0.1528  -0.1362 365 SER A N     
244  C  CA    . SER A 21 ? 0.6715 0.3353 0.4424 0.0154  0.1739  -0.1562 365 SER A CA    
245  C  C     . SER A 21 ? 0.6748 0.3418 0.3851 -0.0258 0.1679  -0.1497 365 SER A C     
246  O  O     . SER A 21 ? 0.7393 0.3892 0.4097 -0.0449 0.1823  -0.1596 365 SER A O     
247  C  CB    . SER A 21 ? 0.8232 0.4288 0.5660 0.0163  0.1603  -0.1557 365 SER A CB    
248  O  OG    . SER A 21 ? 0.9474 0.5414 0.6586 -0.0052 0.1297  -0.1366 365 SER A OG    
254  N  N     . ARG A 22 ? 0.6358 0.3375 0.3518 -0.0379 0.1392  -0.1249 366 ARG A N     
255  C  CA    . ARG A 22 ? 0.7411 0.4469 0.4047 -0.0732 0.1265  -0.1132 366 ARG A CA    
256  C  C     . ARG A 22 ? 0.7134 0.4739 0.4099 -0.0729 0.1221  -0.0967 366 ARG A C     
257  O  O     . ARG A 22 ? 0.5865 0.3836 0.3434 -0.0510 0.1134  -0.0866 366 ARG A O     
258  C  CB    . ARG A 22 ? 0.6528 0.3482 0.2947 -0.0893 0.0921  -0.0946 366 ARG A CB    
259  C  CG    . ARG A 22 ? 0.8132 0.4502 0.4077 -0.1031 0.0933  -0.1081 366 ARG A CG    
260  C  CD    . ARG A 22 ? 0.7929 0.4255 0.3892 -0.1105 0.0629  -0.0903 366 ARG A CD    
261  N  NE    . ARG A 22 ? 0.6763 0.3501 0.2679 -0.1328 0.0358  -0.0663 366 ARG A NE    
262  C  CZ    . ARG A 22 ? 0.7061 0.3795 0.2849 -0.1533 0.0112  -0.0523 366 ARG A CZ    
263  N  NH1   . ARG A 22 ? 0.7492 0.3804 0.3146 -0.1576 0.0110  -0.0583 366 ARG A NH1   
264  N  NH2   . ARG A 22 ? 0.6843 0.4061 0.2773 -0.1666 -0.0110 -0.0286 366 ARG A NH2   
278  N  N     . SER A 23 ? 0.6558 0.4170 0.3065 -0.0994 0.1264  -0.0928 367 SER A N     
279  C  CA    . SER A 23 ? 0.6393 0.4417 0.3147 -0.1010 0.1239  -0.0763 367 SER A CA    
280  C  C     . SER A 23 ? 0.5118 0.3400 0.2092 -0.0995 0.0880  -0.0483 367 SER A C     
281  O  O     . SER A 23 ? 0.4864 0.3478 0.2281 -0.0880 0.0841  -0.0372 367 SER A O     
282  C  CB    . SER A 23 ? 0.7738 0.5682 0.4027 -0.1270 0.1332  -0.0738 367 SER A CB    
283  O  OG    . SER A 23 ? 0.8238 0.6086 0.4170 -0.1476 0.1023  -0.0555 367 SER A OG    
289  N  N     . ASP A 24 ? 0.5605 0.3745 0.2285 -0.1123 0.0634  -0.0380 368 ASP A N     
290  C  CA    . ASP A 24 ? 0.5147 0.3570 0.2090 -0.1089 0.0339  -0.0133 368 ASP A CA    
291  C  C     . ASP A 24 ? 0.4860 0.3451 0.2370 -0.0823 0.0298  -0.0132 368 ASP A C     
292  O  O     . ASP A 24 ? 0.4620 0.3500 0.2461 -0.0732 0.0164  0.0022  368 ASP A O     
293  C  CB    . ASP A 24 ? 0.6459 0.4797 0.3062 -0.1304 0.0093  -0.0020 368 ASP A CB    
294  C  CG    . ASP A 24 ? 0.7046 0.5017 0.3393 -0.1375 0.0108  -0.0177 368 ASP A CG    
295  O  OD1   . ASP A 24 ? 0.6369 0.4099 0.2800 -0.1222 0.0320  -0.0378 368 ASP A OD1   
296  O  OD2   . ASP A 24 ? 0.6463 0.4459 0.2768 -0.1535 -0.0095 -0.0076 368 ASP A OD2   
301  N  N     . ARG A 25 ? 0.4610 0.2991 0.2213 -0.0690 0.0416  -0.0304 369 ARG A N     
302  C  CA    . ARG A 25 ? 0.4174 0.2693 0.2258 -0.0444 0.0344  -0.0278 369 ARG A CA    
303  C  C     . ARG A 25 ? 0.3977 0.2820 0.2536 -0.0270 0.0451  -0.0314 369 ARG A C     
304  O  O     . ARG A 25 ? 0.3489 0.2572 0.2418 -0.0133 0.0323  -0.0227 369 ARG A O     
305  C  CB    . ARG A 25 ? 0.4438 0.2575 0.2452 -0.0345 0.0403  -0.0413 369 ARG A CB    
306  C  CG    . ARG A 25 ? 0.5674 0.3481 0.3257 -0.0545 0.0270  -0.0369 369 ARG A CG    
307  C  CD    . ARG A 25 ? 0.5357 0.3360 0.3133 -0.0529 0.0034  -0.0164 369 ARG A CD    
308  N  NE    . ARG A 25 ? 0.5253 0.3338 0.2766 -0.0797 -0.0128 -0.0030 369 ARG A NE    
309  C  CZ    . ARG A 25 ? 0.5772 0.3610 0.3007 -0.0990 -0.0228 -0.0004 369 ARG A CZ    
310  N  NH1   . ARG A 25 ? 0.7974 0.5335 0.5055 -0.0957 -0.0170 -0.0108 369 ARG A NH1   
311  N  NH2   . ARG A 25 ? 0.7904 0.5974 0.5030 -0.1226 -0.0392 0.0135  369 ARG A NH2   
325  N  N     . LEU A 26 ? 0.4263 0.3123 0.2799 -0.0303 0.0694  -0.0450 370 LEU A N     
326  C  CA    . LEU A 26 ? 0.3540 0.2766 0.2529 -0.0217 0.0792  -0.0468 370 LEU A CA    
327  C  C     . LEU A 26 ? 0.3350 0.2761 0.2329 -0.0329 0.0648  -0.0281 370 LEU A C     
328  O  O     . LEU A 26 ? 0.3540 0.3208 0.2909 -0.0232 0.0560  -0.0229 370 LEU A O     
329  C  CB    . LEU A 26 ? 0.4154 0.3370 0.3091 -0.0276 0.1129  -0.0652 370 LEU A CB    
330  C  CG    . LEU A 26 ? 0.3759 0.3373 0.3119 -0.0282 0.1259  -0.0662 370 LEU A CG    
331  C  CD1   . LEU A 26 ? 0.3953 0.3927 0.4011 -0.0040 0.1176  -0.0690 370 LEU A CD1   
332  C  CD2   . LEU A 26 ? 0.4404 0.4011 0.3641 -0.0398 0.1634  -0.0833 370 LEU A CD2   
344  N  N     . LYS A 27 ? 0.4084 0.3342 0.2608 -0.0527 0.0600  -0.0172 371 LYS A N     
345  C  CA    . LYS A 27 ? 0.3938 0.3321 0.2472 -0.0592 0.0471  0.0020  371 LYS A CA    
346  C  C     . LYS A 27 ? 0.3824 0.3342 0.2623 -0.0460 0.0248  0.0132  371 LYS A C     
347  O  O     . LYS A 27 ? 0.3288 0.2960 0.2342 -0.0401 0.0204  0.0197  371 LYS A O     
348  C  CB    . LYS A 27 ? 0.4875 0.4076 0.2880 -0.0802 0.0411  0.0149  371 LYS A CB    
349  C  CG    . LYS A 27 ? 1.0182 0.9464 0.8192 -0.0823 0.0228  0.0390  371 LYS A CG    
350  C  CD    . LYS A 27 ? 0.8716 0.7869 0.6274 -0.0999 0.0114  0.0528  371 LYS A CD    
351  C  CE    . LYS A 27 ? 1.2569 1.1652 1.0019 -0.1069 0.0191  0.0604  371 LYS A CE    
352  N  NZ    . LYS A 27 ? 1.0230 0.9223 0.7370 -0.1187 0.0070  0.0680  371 LYS A NZ    
366  N  N     . ARG A 28 ? 0.3360 0.2789 0.2065 -0.0434 0.0128  0.0145  372 ARG A N     
367  C  CA    . ARG A 28 ? 0.3120 0.2673 0.2028 -0.0333 -0.0042 0.0242  372 ARG A CA    
368  C  C     . ARG A 28 ? 0.3131 0.2827 0.2412 -0.0168 -0.0028 0.0169  372 ARG A C     
369  O  O     . ARG A 28 ? 0.3086 0.2924 0.2539 -0.0115 -0.0104 0.0234  372 ARG A O     
370  C  CB    . ARG A 28 ? 0.3708 0.3104 0.2427 -0.0375 -0.0134 0.0251  372 ARG A CB    
371  C  CG    . ARG A 28 ? 0.3960 0.3489 0.2805 -0.0336 -0.0283 0.0376  372 ARG A CG    
372  C  CD    . ARG A 28 ? 0.3610 0.2965 0.2249 -0.0433 -0.0355 0.0391  372 ARG A CD    
373  N  NE    . ARG A 28 ? 0.3757 0.2858 0.2388 -0.0332 -0.0300 0.0273  372 ARG A NE    
374  C  CZ    . ARG A 28 ? 0.4295 0.3115 0.2731 -0.0391 -0.0340 0.0269  372 ARG A CZ    
375  N  NH1   . ARG A 28 ? 0.4651 0.3465 0.2897 -0.0592 -0.0432 0.0363  372 ARG A NH1   
376  N  NH2   . ARG A 28 ? 0.4582 0.3133 0.3041 -0.0252 -0.0293 0.0179  372 ARG A NH2   
390  N  N     . HIS A 29 ? 0.2904 0.2562 0.2311 -0.0084 0.0065  0.0030  373 HIS A N     
391  C  CA    . HIS A 29 ? 0.3012 0.2868 0.2816 0.0069  0.0047  -0.0034 373 HIS A CA    
392  C  C     . HIS A 29 ? 0.2843 0.2926 0.2862 0.0022  0.0087  -0.0038 373 HIS A C     
393  O  O     . HIS A 29 ? 0.2660 0.2899 0.2894 0.0079  -0.0021 -0.0028 373 HIS A O     
394  C  CB    . HIS A 29 ? 0.3344 0.3171 0.3319 0.0180  0.0178  -0.0182 373 HIS A CB    
395  C  CG    . HIS A 29 ? 0.2804 0.2963 0.3279 0.0303  0.0187  -0.0254 373 HIS A CG    
396  N  ND1   . HIS A 29 ? 0.2953 0.3234 0.3677 0.0457  -0.0006 -0.0213 373 HIS A ND1   
397  C  CD2   . HIS A 29 ? 0.2826 0.3255 0.3604 0.0267  0.0350  -0.0353 373 HIS A CD2   
398  C  CE1   . HIS A 29 ? 0.2976 0.3620 0.4162 0.0515  0.0008  -0.0284 373 HIS A CE1   
399  N  NE2   . HIS A 29 ? 0.2740 0.3497 0.3997 0.0396  0.0236  -0.0375 373 HIS A NE2   
407  N  N     . GLN A 30 ? 0.2535 0.2601 0.2456 -0.0108 0.0245  -0.0058 374 GLN A N     
408  C  CA    . GLN A 30 ? 0.2476 0.2701 0.2597 -0.0183 0.0313  -0.0073 374 GLN A CA    
409  C  C     . GLN A 30 ? 0.2826 0.2998 0.2881 -0.0204 0.0182  0.0045  374 GLN A C     
410  O  O     . GLN A 30 ? 0.2976 0.3227 0.3204 -0.0256 0.0200  0.0018  374 GLN A O     
411  C  CB    . GLN A 30 ? 0.3127 0.3279 0.3073 -0.0344 0.0529  -0.0097 374 GLN A CB    
412  C  CG    . GLN A 30 ? 0.2931 0.3202 0.3056 -0.0307 0.0734  -0.0272 374 GLN A CG    
413  C  CD    . GLN A 30 ? 0.3128 0.3294 0.2978 -0.0494 0.1000  -0.0317 374 GLN A CD    
414  O  OE1   . GLN A 30 ? 0.4162 0.4060 0.3517 -0.0638 0.0989  -0.0202 374 GLN A OE1   
415  N  NE2   . GLN A 30 ? 0.3696 0.4102 0.3874 -0.0495 0.1241  -0.0477 374 GLN A NE2   
424  N  N     . ARG A 31 ? 0.2903 0.2942 0.2727 -0.0175 0.0069  0.0164  375 ARG A N     
425  C  CA    . ARG A 31 ? 0.2731 0.2740 0.2554 -0.0144 -0.0021 0.0253  375 ARG A CA    
426  C  C     . ARG A 31 ? 0.3074 0.3199 0.3101 -0.0071 -0.0095 0.0169  375 ARG A C     
427  O  O     . ARG A 31 ? 0.3073 0.3148 0.3114 -0.0074 -0.0109 0.0175  375 ARG A O     
428  C  CB    . ARG A 31 ? 0.3041 0.3003 0.2690 -0.0112 -0.0119 0.0383  375 ARG A CB    
429  C  CG    . ARG A 31 ? 0.4445 0.4309 0.3860 -0.0207 -0.0110 0.0506  375 ARG A CG    
430  C  CD    . ARG A 31 ? 0.3835 0.3752 0.3146 -0.0207 -0.0236 0.0628  375 ARG A CD    
431  N  NE    . ARG A 31 ? 0.4626 0.4461 0.3661 -0.0342 -0.0256 0.0702  375 ARG A NE    
432  C  CZ    . ARG A 31 ? 0.6555 0.6413 0.5419 -0.0430 -0.0358 0.0759  375 ARG A CZ    
433  N  NH1   . ARG A 31 ? 0.4102 0.4072 0.3088 -0.0391 -0.0428 0.0759  375 ARG A NH1   
434  N  NH2   . ARG A 31 ? 0.6136 0.5902 0.4733 -0.0566 -0.0371 0.0778  375 ARG A NH2   
448  N  N     . ARG A 32 ? 0.2936 0.3180 0.3093 -0.0002 -0.0151 0.0094  376 ARG A N     
449  C  CA    . ARG A 32 ? 0.2830 0.3200 0.3142 0.0046  -0.0265 0.0033  376 ARG A CA    
450  C  C     . ARG A 32 ? 0.3270 0.3765 0.3798 -0.0049 -0.0224 -0.0062 376 ARG A C     
451  O  O     . ARG A 32 ? 0.4045 0.4557 0.4581 -0.0083 -0.0308 -0.0108 376 ARG A O     
452  C  CB    . ARG A 32 ? 0.2991 0.3461 0.3433 0.0158  -0.0359 0.0005  376 ARG A CB    
453  C  CG    . ARG A 32 ? 0.5235 0.5528 0.5459 0.0217  -0.0391 0.0083  376 ARG A CG    
454  C  CD    . ARG A 32 ? 1.1146 1.1464 1.1530 0.0349  -0.0456 0.0051  376 ARG A CD    
455  N  NE    . ARG A 32 ? 0.4337 0.4845 0.4916 0.0413  -0.0623 0.0039  376 ARG A NE    
456  C  CZ    . ARG A 32 ? 0.7885 0.8482 0.8689 0.0561  -0.0738 0.0038  376 ARG A CZ    
457  N  NH1   . ARG A 32 ? 0.8620 0.9077 0.9486 0.0684  -0.0667 0.0028  376 ARG A NH1   
458  N  NH2   . ARG A 32 ? 0.8081 0.8887 0.9033 0.0588  -0.0935 0.0048  376 ARG A NH2   
472  N  N     . HIS A 33 ? 0.2312 0.2888 0.2988 -0.0125 -0.0085 -0.0107 377 HIS A N     
473  C  CA    . HIS A 33 ? 0.2638 0.3372 0.3561 -0.0262 -0.0025 -0.0199 377 HIS A CA    
474  C  C     . HIS A 33 ? 0.3619 0.4078 0.4332 -0.0395 0.0049  -0.0157 377 HIS A C     
475  O  O     . HIS A 33 ? 0.3278 0.3739 0.4079 -0.0515 0.0032  -0.0231 377 HIS A O     
476  C  CB    . HIS A 33 ? 0.3041 0.3978 0.4208 -0.0312 0.0150  -0.0264 377 HIS A CB    
477  C  CG    . HIS A 33 ? 0.2573 0.3757 0.4020 -0.0144 0.0115  -0.0322 377 HIS A CG    
478  N  ND1   . HIS A 33 ? 0.2749 0.4202 0.4507 -0.0036 -0.0080 -0.0357 377 HIS A ND1   
479  C  CD2   . HIS A 33 ? 0.2471 0.3645 0.3931 -0.0063 0.0260  -0.0354 377 HIS A CD2   
480  C  CE1   . HIS A 33 ? 0.3042 0.4635 0.5036 0.0140  -0.0063 -0.0387 377 HIS A CE1   
481  N  NE2   . HIS A 33 ? 0.2267 0.3677 0.4085 0.0126  0.0165  -0.0406 377 HIS A NE2   
489  N  N     . THR A 34 ? 0.3569 0.3773 0.4005 -0.0384 0.0123  -0.0035 378 THR A N     
490  C  CA    . THR A 34 ? 0.3421 0.3319 0.3669 -0.0471 0.0194  0.0044  378 THR A CA    
491  C  C     . THR A 34 ? 0.3960 0.3660 0.4072 -0.0359 0.0107  0.0090  378 THR A C     
492  O  O     . THR A 34 ? 0.4379 0.3791 0.4394 -0.0399 0.0161  0.0119  378 THR A O     
493  C  CB    . THR A 34 ? 0.3067 0.2803 0.3075 -0.0502 0.0281  0.0187  378 THR A CB    
494  O  OG1   . THR A 34 ? 0.3329 0.3091 0.3213 -0.0365 0.0181  0.0268  378 THR A OG1   
495  C  CG2   . THR A 34 ? 0.3690 0.3572 0.3762 -0.0635 0.0435  0.0122  378 THR A CG2   
503  N  N     . GLY A 35 ? 0.3099 0.2914 0.3189 -0.0219 0.0003  0.0102  379 GLY A N     
504  C  CA    . GLY A 35 ? 0.3172 0.2851 0.3149 -0.0110 -0.0029 0.0141  379 GLY A CA    
505  C  C     . GLY A 35 ? 0.3627 0.3182 0.3510 -0.0026 -0.0002 0.0315  379 GLY A C     
506  O  O     . GLY A 35 ? 0.3898 0.3348 0.3764 0.0083  0.0015  0.0351  379 GLY A O     
510  N  N     . VAL A 36 ? 0.3515 0.3087 0.3337 -0.0077 0.0006  0.0422  380 VAL A N     
511  C  CA    . VAL A 36 ? 0.3195 0.2688 0.2922 -0.0020 -0.0023 0.0616  380 VAL A CA    
512  C  C     . VAL A 36 ? 0.3433 0.3135 0.3208 0.0086  -0.0111 0.0673  380 VAL A C     
513  O  O     . VAL A 36 ? 0.3258 0.3119 0.3022 0.0059  -0.0153 0.0607  380 VAL A O     
514  C  CB    . VAL A 36 ? 0.3060 0.2510 0.2611 -0.0153 -0.0005 0.0699  380 VAL A CB    
515  C  CG1   . VAL A 36 ? 0.4300 0.3748 0.3730 -0.0110 -0.0109 0.0914  380 VAL A CG1   
516  C  CG2   . VAL A 36 ? 0.4229 0.3446 0.3720 -0.0280 0.0113  0.0682  380 VAL A CG2   
526  N  N     . LYS A 37 ? 0.3639 0.3339 0.3494 0.0210  -0.0130 0.0803  381 LYS A N     
527  C  CA    A LYS A 37 ? 0.2934 0.2896 0.2905 0.0293  -0.0186 0.0864  381 LYS A CA    
528  C  CA    B LYS A 37 ? 0.3981 0.3943 0.3950 0.0292  -0.0187 0.0864  381 LYS A CA    
529  C  C     . LYS A 37 ? 0.4234 0.4301 0.4278 0.0341  -0.0281 0.1091  381 LYS A C     
530  O  O     . LYS A 37 ? 0.4209 0.4267 0.4447 0.0507  -0.0259 0.1189  381 LYS A O     
531  C  CB    A LYS A 37 ? 0.3039 0.3004 0.3130 0.0418  -0.0091 0.0765  381 LYS A CB    
532  C  CB    B LYS A 37 ? 0.3315 0.3285 0.3401 0.0412  -0.0093 0.0760  381 LYS A CB    
533  C  CG    A LYS A 37 ? 0.3363 0.3257 0.3337 0.0348  -0.0055 0.0562  381 LYS A CG    
534  C  CG    B LYS A 37 ? 0.4082 0.4021 0.4049 0.0336  -0.0072 0.0569  381 LYS A CG    
535  C  CD    A LYS A 37 ? 0.2971 0.2885 0.2947 0.0430  0.0031  0.0468  381 LYS A CD    
536  C  CD    B LYS A 37 ? 0.4913 0.4821 0.4878 0.0419  0.0025  0.0460  381 LYS A CD    
537  C  CE    A LYS A 37 ? 0.4274 0.4151 0.4072 0.0337  0.0001  0.0305  381 LYS A CE    
538  C  CE    B LYS A 37 ? 0.5736 0.5616 0.5528 0.0327  -0.0009 0.0303  381 LYS A CE    
539  N  NZ    A LYS A 37 ? 0.4130 0.3787 0.3873 0.0265  0.0011  0.0172  381 LYS A NZ    
540  N  NZ    B LYS A 37 ? 0.4630 0.4396 0.4300 0.0365  0.0095  0.0172  381 LYS A NZ    
567  N  N     . PRO A 38 ? 0.3304 0.3461 0.3191 0.0203  -0.0394 0.1174  382 PRO A N     
568  C  CA    . PRO A 38 ? 0.3187 0.3403 0.3078 0.0196  -0.0492 0.1289  382 PRO A CA    
569  C  C     . PRO A 38 ? 0.4416 0.4970 0.4610 0.0284  -0.0553 0.1361  382 PRO A C     
570  O  O     . PRO A 38 ? 0.4346 0.4983 0.4635 0.0328  -0.0647 0.1489  382 PRO A O     
571  C  CB    . PRO A 38 ? 0.4552 0.4734 0.4141 -0.0011 -0.0543 0.1238  382 PRO A CB    
572  C  CG    . PRO A 38 ? 0.3663 0.3696 0.3101 -0.0084 -0.0445 0.1116  382 PRO A CG    
573  C  CD    . PRO A 38 ? 0.3686 0.3811 0.3344 0.0034  -0.0397 0.1063  382 PRO A CD    
581  N  N     . PHE A 39 ? 0.3807 0.4583 0.4154 0.0298  -0.0507 0.1304  383 PHE A N     
582  C  CA    . PHE A 39 ? 0.4230 0.5399 0.4844 0.0296  -0.0560 0.1384  383 PHE A CA    
583  C  C     . PHE A 39 ? 0.3759 0.5129 0.4740 0.0521  -0.0437 0.1418  383 PHE A C     
584  O  O     . PHE A 39 ? 0.4770 0.6055 0.5716 0.0590  -0.0309 0.1323  383 PHE A O     
585  C  CB    . PHE A 39 ? 0.3612 0.4875 0.4069 0.0088  -0.0593 0.1310  383 PHE A CB    
586  C  CG    . PHE A 39 ? 0.3126 0.4147 0.3231 -0.0095 -0.0660 0.1240  383 PHE A CG    
587  C  CD1   . PHE A 39 ? 0.3712 0.4798 0.3762 -0.0198 -0.0783 0.1327  383 PHE A CD1   
588  C  CD2   . PHE A 39 ? 0.3329 0.4069 0.3174 -0.0143 -0.0593 0.1100  383 PHE A CD2   
589  C  CE1   . PHE A 39 ? 0.4401 0.5261 0.4100 -0.0362 -0.0818 0.1261  383 PHE A CE1   
590  C  CE2   . PHE A 39 ? 0.4367 0.4913 0.3922 -0.0282 -0.0617 0.1040  383 PHE A CE2   
591  C  CZ    . PHE A 39 ? 0.3699 0.4287 0.3157 -0.0395 -0.0718 0.1113  383 PHE A CZ    
601  N  N     . GLN A 40 ? 0.3815 0.4041 0.6333 0.0067  0.0186  0.1826  384 GLN A N     
602  C  CA    . GLN A 40 ? 0.3058 0.3108 0.5882 0.0110  0.0236  0.1750  384 GLN A CA    
603  C  C     . GLN A 40 ? 0.3123 0.3376 0.5937 0.0194  0.0100  0.1707  384 GLN A C     
604  O  O     . GLN A 40 ? 0.3043 0.3548 0.5772 0.0291  -0.0015 0.1873  384 GLN A O     
605  C  CB    . GLN A 40 ? 0.3595 0.3393 0.6635 0.0221  0.0407  0.2010  384 GLN A CB    
606  C  CG    . GLN A 40 ? 0.3743 0.3286 0.7086 0.0259  0.0488  0.1906  384 GLN A CG    
607  C  CD    . GLN A 40 ? 0.5968 0.5265 0.9453 0.0350  0.0686  0.2074  384 GLN A CD    
608  O  OE1   . GLN A 40 ? 0.5753 0.5114 0.9077 0.0474  0.0739  0.2344  384 GLN A OE1   
609  N  NE2   . GLN A 40 ? 0.4135 0.3156 0.7855 0.0307  0.0793  0.1876  384 GLN A NE2   
618  N  N     . CYS A 41 ? 0.3451 0.3578 0.6389 0.0181  0.0129  0.1483  385 CYS A N     
619  C  CA    . CYS A 41 ? 0.3555 0.3806 0.6579 0.0268  0.0086  0.1446  385 CYS A CA    
620  C  C     . CYS A 41 ? 0.4811 0.5026 0.8103 0.0434  0.0141  0.1669  385 CYS A C     
621  O  O     . CYS A 41 ? 0.3755 0.3646 0.7198 0.0488  0.0278  0.1695  385 CYS A O     
622  C  CB    . CYS A 41 ? 0.3189 0.3240 0.6183 0.0264  0.0152  0.1168  385 CYS A CB    
623  S  SG    . CYS A 41 ? 0.3313 0.3472 0.6443 0.0387  0.0193  0.1152  385 CYS A SG    
628  N  N     . LYS A 42 ? 0.3429 0.3982 0.6802 0.0523  0.0027  0.1809  386 LYS A N     
629  C  CA    . LYS A 42 ? 0.3922 0.4516 0.7541 0.0721  0.0056  0.2036  386 LYS A CA    
630  C  C     . LYS A 42 ? 0.3948 0.4407 0.7748 0.0773  0.0187  0.1914  386 LYS A C     
631  O  O     . LYS A 42 ? 0.4140 0.4551 0.8028 0.0896  0.0264  0.2023  386 LYS A O     
632  C  CB    . LYS A 42 ? 0.4495 0.5567 0.8107 0.0791  -0.0150 0.2149  386 LYS A CB    
633  C  CG    . LYS A 42 ? 0.6729 0.7878 1.0021 0.0796  -0.0257 0.2286  386 LYS A CG    
634  C  CD    . LYS A 42 ? 0.6613 0.8212 0.9801 0.0885  -0.0501 0.2323  386 LYS A CD    
635  C  CE    . LYS A 42 ? 0.7248 0.8827 0.9985 0.0937  -0.0564 0.2455  386 LYS A CE    
636  N  NZ    . LYS A 42 ? 0.9286 1.1263 1.1831 0.1059  -0.0834 0.2433  386 LYS A NZ    
650  N  N     . THR A 43 ? 0.5258 0.5626 0.9055 0.0711  0.0234  0.1696  387 THR A N     
651  C  CA    . THR A 43 ? 0.4682 0.4875 0.8531 0.0783  0.0387  0.1577  387 THR A CA    
652  C  C     . THR A 43 ? 0.3452 0.3185 0.7130 0.0790  0.0513  0.1420  387 THR A C     
653  O  O     . THR A 43 ? 0.4706 0.4268 0.8410 0.0885  0.0621  0.1436  387 THR A O     
654  C  CB    . THR A 43 ? 0.4661 0.4963 0.8518 0.0752  0.0413  0.1426  387 THR A CB    
655  O  OG1   . THR A 43 ? 0.3980 0.4750 0.8076 0.0711  0.0278  0.1523  387 THR A OG1   
656  C  CG2   . THR A 43 ? 0.4621 0.4735 0.8461 0.0851  0.0601  0.1341  387 THR A CG2   
664  N  N     . CYS A 44 ? 0.4119 0.3667 0.7636 0.0697  0.0484  0.1248  388 CYS A N     
665  C  CA    . CYS A 44 ? 0.4401 0.3563 0.7794 0.0696  0.0551  0.1025  388 CYS A CA    
666  C  C     . CYS A 44 ? 0.4637 0.3648 0.8140 0.0583  0.0541  0.1044  388 CYS A C     
667  O  O     . CYS A 44 ? 0.4946 0.3666 0.8449 0.0554  0.0577  0.0827  388 CYS A O     
668  C  CB    . CYS A 44 ? 0.4020 0.3077 0.7142 0.0708  0.0530  0.0738  388 CYS A CB    
669  S  SG    . CYS A 44 ? 0.4096 0.3292 0.7107 0.0558  0.0400  0.0635  388 CYS A SG    
674  N  N     . GLN A 45 ? 0.4039 0.3242 0.7625 0.0519  0.0498  0.1283  389 GLN A N     
675  C  CA    . GLN A 45 ? 0.4039 0.3117 0.7715 0.0414  0.0552  0.1366  389 GLN A CA    
676  C  C     . GLN A 45 ? 0.3964 0.2951 0.7639 0.0245  0.0514  0.1122  389 GLN A C     
677  O  O     . GLN A 45 ? 0.3695 0.2583 0.7519 0.0133  0.0596  0.1168  389 GLN A O     
678  C  CB    . GLN A 45 ? 0.4597 0.3401 0.8408 0.0462  0.0710  0.1394  389 GLN A CB    
679  C  CG    . GLN A 45 ? 0.4487 0.3412 0.8292 0.0615  0.0763  0.1707  389 GLN A CG    
680  C  CD    . GLN A 45 ? 0.5472 0.4594 0.9245 0.0747  0.0701  0.1721  389 GLN A CD    
681  O  OE1   . GLN A 45 ? 0.5393 0.4360 0.9145 0.0782  0.0739  0.1525  389 GLN A OE1   
682  N  NE2   . GLN A 45 ? 0.6106 0.5587 0.9867 0.0826  0.0601  0.1937  389 GLN A NE2   
691  N  N     . ARG A 46 ? 0.4227 0.3315 0.7688 0.0228  0.0405  0.0845  390 ARG A N     
692  C  CA    . ARG A 46 ? 0.3339 0.2485 0.6728 0.0089  0.0334  0.0596  390 ARG A CA    
693  C  C     . ARG A 46 ? 0.3777 0.3190 0.7076 -0.0027 0.0312  0.0789  390 ARG A C     
694  O  O     . ARG A 46 ? 0.3043 0.2672 0.6166 0.0017  0.0269  0.1007  390 ARG A O     
695  C  CB    . ARG A 46 ? 0.3622 0.2825 0.6694 0.0164  0.0235  0.0317  390 ARG A CB    
696  C  CG    . ARG A 46 ? 0.4166 0.3430 0.7157 0.0086  0.0139  0.0016  390 ARG A CG    
697  C  CD    . ARG A 46 ? 0.3742 0.2976 0.6350 0.0249  0.0069  -0.0251 390 ARG A CD    
698  N  NE    . ARG A 46 ? 0.4500 0.3863 0.6983 0.0217  -0.0050 -0.0525 390 ARG A NE    
699  C  CZ    . ARG A 46 ? 0.3748 0.3052 0.5896 0.0398  -0.0133 -0.0822 390 ARG A CZ    
700  N  NH1   . ARG A 46 ? 0.4865 0.3937 0.6734 0.0625  -0.0077 -0.0875 390 ARG A NH1   
701  N  NH2   . ARG A 46 ? 0.4409 0.3888 0.6482 0.0387  -0.0257 -0.1056 390 ARG A NH2   
715  N  N     . LYS A 47 ? 0.3352 0.2760 0.6791 -0.0167 0.0339  0.0693  391 LYS A N     
716  C  CA    . LYS A 47 ? 0.3512 0.3134 0.6832 -0.0250 0.0354  0.0877  391 LYS A CA    
717  C  C     . LYS A 47 ? 0.2860 0.2697 0.5949 -0.0310 0.0237  0.0636  391 LYS A C     
718  O  O     . LYS A 47 ? 0.3032 0.2831 0.6173 -0.0310 0.0168  0.0312  391 LYS A O     
719  C  CB    . LYS A 47 ? 0.3217 0.2680 0.6889 -0.0345 0.0545  0.1028  391 LYS A CB    
720  C  CG    . LYS A 47 ? 0.3334 0.2554 0.7146 -0.0238 0.0701  0.1346  391 LYS A CG    
721  C  CD    . LYS A 47 ? 0.4066 0.3185 0.8019 -0.0264 0.0913  0.1485  391 LYS A CD    
722  C  CE    . LYS A 47 ? 0.5911 0.4880 0.9799 -0.0086 0.1049  0.1787  391 LYS A CE    
723  N  NZ    . LYS A 47 ? 0.6539 0.5311 1.0624 -0.0106 0.1311  0.1878  391 LYS A NZ    
737  N  N     . PHE A 48 ? 0.2458 0.2512 0.5260 -0.0328 0.0211  0.0795  392 PHE A N     
738  C  CA    . PHE A 48 ? 0.2315 0.2562 0.4808 -0.0352 0.0118  0.0624  392 PHE A CA    
739  C  C     . PHE A 48 ? 0.2485 0.2866 0.4909 -0.0425 0.0185  0.0776  392 PHE A C     
740  O  O     . PHE A 48 ? 0.2868 0.3223 0.5289 -0.0411 0.0279  0.1075  392 PHE A O     
741  C  CB    . PHE A 48 ? 0.2350 0.2689 0.4464 -0.0272 0.0022  0.0636  392 PHE A CB    
742  C  CG    . PHE A 48 ? 0.2713 0.2913 0.4872 -0.0174 0.0007  0.0510  392 PHE A CG    
743  C  CD1   . PHE A 48 ? 0.2758 0.2890 0.4749 -0.0101 -0.0025 0.0227  392 PHE A CD1   
744  C  CD2   . PHE A 48 ? 0.2814 0.2937 0.5163 -0.0115 0.0041  0.0680  392 PHE A CD2   
745  C  CE1   . PHE A 48 ? 0.2482 0.2440 0.4458 0.0031  0.0001  0.0130  392 PHE A CE1   
746  C  CE2   . PHE A 48 ? 0.2879 0.2860 0.5274 -0.0003 0.0065  0.0579  392 PHE A CE2   
747  C  CZ    . PHE A 48 ? 0.2750 0.2631 0.4942 0.0070  0.0056  0.0307  392 PHE A CZ    
757  N  N     . SER A 49 ? 0.2273 0.2793 0.4607 -0.0463 0.0149  0.0576  393 SER A N     
758  C  CA    . SER A 49 ? 0.2091 0.2744 0.4358 -0.0515 0.0238  0.0701  393 SER A CA    
759  C  C     . SER A 49 ? 0.2352 0.3088 0.4085 -0.0452 0.0194  0.0887  393 SER A C     
760  O  O     . SER A 49 ? 0.2860 0.3636 0.4476 -0.0451 0.0297  0.1090  393 SER A O     
761  C  CB    . SER A 49 ? 0.2247 0.3065 0.4600 -0.0547 0.0200  0.0416  393 SER A CB    
762  O  OG    . SER A 49 ? 0.2350 0.3219 0.4251 -0.0445 0.0057  0.0235  393 SER A OG    
768  N  N     . ARG A 50 ? 0.2302 0.3046 0.3731 -0.0395 0.0060  0.0816  394 ARG A N     
769  C  CA    . ARG A 50 ? 0.2435 0.3266 0.3393 -0.0362 -0.0013 0.0884  394 ARG A CA    
770  C  C     . ARG A 50 ? 0.2913 0.3745 0.3815 -0.0324 -0.0116 0.0947  394 ARG A C     
771  O  O     . ARG A 50 ? 0.2581 0.3347 0.3683 -0.0308 -0.0133 0.0845  394 ARG A O     
772  C  CB    . ARG A 50 ? 0.2905 0.3777 0.3560 -0.0353 -0.0047 0.0654  394 ARG A CB    
773  C  CG    . ARG A 50 ? 0.2416 0.3373 0.3101 -0.0369 0.0034  0.0607  394 ARG A CG    
774  C  CD    . ARG A 50 ? 0.2411 0.3408 0.2819 -0.0309 0.0003  0.0371  394 ARG A CD    
775  N  NE    . ARG A 50 ? 0.2911 0.3826 0.2856 -0.0268 -0.0041 0.0346  394 ARG A NE    
776  C  CZ    . ARG A 50 ? 0.2965 0.3861 0.2528 -0.0201 -0.0020 0.0226  394 ARG A CZ    
777  N  NH1   . ARG A 50 ? 0.3140 0.4153 0.2711 -0.0148 0.0021  0.0137  394 ARG A NH1   
778  N  NH2   . ARG A 50 ? 0.3129 0.3895 0.2343 -0.0188 -0.0028 0.0195  394 ARG A NH2   
792  N  N     . SER A 51 ? 0.3103 0.4026 0.3736 -0.0291 -0.0190 0.1100  395 SER A N     
793  C  CA    . SER A 51 ? 0.2525 0.3534 0.3207 -0.0251 -0.0318 0.1156  395 SER A CA    
794  C  C     . SER A 51 ? 0.2632 0.3665 0.3262 -0.0301 -0.0378 0.0936  395 SER A C     
795  O  O     . SER A 51 ? 0.2537 0.3620 0.3416 -0.0291 -0.0423 0.0922  395 SER A O     
796  C  CB    . SER A 51 ? 0.2969 0.4100 0.3362 -0.0166 -0.0424 0.1344  395 SER A CB    
797  O  OG    . SER A 51 ? 0.4937 0.6097 0.4903 -0.0195 -0.0470 0.1242  395 SER A OG    
803  N  N     . ASP A 52 ? 0.2754 0.3736 0.3079 -0.0342 -0.0348 0.0781  396 ASP A N     
804  C  CA    . ASP A 52 ? 0.3082 0.4008 0.3347 -0.0375 -0.0337 0.0596  396 ASP A CA    
805  C  C     . ASP A 52 ? 0.2674 0.3458 0.3167 -0.0329 -0.0227 0.0496  396 ASP A C     
806  O  O     . ASP A 52 ? 0.2388 0.3126 0.3005 -0.0324 -0.0185 0.0430  396 ASP A O     
807  C  CB    . ASP A 52 ? 0.2904 0.3748 0.2734 -0.0395 -0.0297 0.0467  396 ASP A CB    
808  C  CG    . ASP A 52 ? 0.3530 0.4311 0.3212 -0.0345 -0.0205 0.0432  396 ASP A CG    
809  O  OD1   . ASP A 52 ? 0.3903 0.4746 0.3775 -0.0335 -0.0193 0.0541  396 ASP A OD1   
810  O  OD2   . ASP A 52 ? 0.3818 0.4493 0.3208 -0.0310 -0.0133 0.0291  396 ASP A OD2   
815  N  N     . HIS A 53 ? 0.2333 0.3045 0.2895 -0.0286 -0.0173 0.0470  397 HIS A N     
816  C  CA    . HIS A 53 ? 0.1771 0.2330 0.2481 -0.0202 -0.0100 0.0340  397 HIS A CA    
817  C  C     . HIS A 53 ? 0.2561 0.3108 0.3653 -0.0182 -0.0102 0.0448  397 HIS A C     
818  O  O     . HIS A 53 ? 0.2306 0.2718 0.3488 -0.0097 -0.0031 0.0367  397 HIS A O     
819  C  CB    . HIS A 53 ? 0.2363 0.2889 0.3081 -0.0167 -0.0089 0.0221  397 HIS A CB    
820  C  CG    . HIS A 53 ? 0.2406 0.2955 0.2764 -0.0135 -0.0077 0.0096  397 HIS A CG    
821  N  ND1   . HIS A 53 ? 0.2706 0.3178 0.2694 -0.0100 -0.0030 0.0048  397 HIS A ND1   
822  C  CD2   . HIS A 53 ? 0.2911 0.3550 0.3254 -0.0122 -0.0088 0.0006  397 HIS A CD2   
823  C  CE1   . HIS A 53 ? 0.2999 0.3487 0.2693 -0.0042 -0.0013 -0.0052 397 HIS A CE1   
824  N  NE2   . HIS A 53 ? 0.2524 0.3148 0.2442 -0.0051 -0.0059 -0.0081 397 HIS A NE2   
832  N  N     . LEU A 54 ? 0.2370 0.3029 0.3654 -0.0221 -0.0158 0.0646  398 LEU A N     
833  C  CA    . LEU A 54 ? 0.2658 0.3326 0.4272 -0.0172 -0.0159 0.0773  398 LEU A CA    
834  C  C     . LEU A 54 ? 0.2584 0.3365 0.4250 -0.0169 -0.0185 0.0757  398 LEU A C     
835  O  O     . LEU A 54 ? 0.2821 0.3549 0.4735 -0.0102 -0.0117 0.0752  398 LEU A O     
836  C  CB    . LEU A 54 ? 0.2223 0.2982 0.3955 -0.0163 -0.0203 0.1021  398 LEU A CB    
837  C  CG    . LEU A 54 ? 0.2786 0.3616 0.4809 -0.0073 -0.0231 0.1182  398 LEU A CG    
838  C  CD1   . LEU A 54 ? 0.4166 0.4774 0.6465 -0.0011 -0.0114 0.1129  398 LEU A CD1   
839  C  CD2   . LEU A 54 ? 0.3126 0.4030 0.5132 -0.0005 -0.0268 0.1449  398 LEU A CD2   
851  N  N     . LYS A 55 ? 0.2328 0.3261 0.3798 -0.0243 -0.0269 0.0738  399 LYS A N     
852  C  CA    . LYS A 55 ? 0.2387 0.3464 0.4032 -0.0279 -0.0300 0.0697  399 LYS A CA    
853  C  C     . LYS A 55 ? 0.2127 0.2996 0.3806 -0.0249 -0.0105 0.0553  399 LYS A C     
854  O  O     . LYS A 55 ? 0.2241 0.3152 0.4267 -0.0219 -0.0031 0.0571  399 LYS A O     
855  C  CB    . LYS A 55 ? 0.2097 0.3321 0.3495 -0.0375 -0.0429 0.0643  399 LYS A CB    
856  C  CG    . LYS A 55 ? 0.2320 0.3728 0.3988 -0.0453 -0.0483 0.0553  399 LYS A CG    
857  C  CD    . LYS A 55 ? 0.3896 0.5415 0.5289 -0.0549 -0.0638 0.0454  399 LYS A CD    
858  C  CE    . LYS A 55 ? 0.4721 0.6568 0.6507 -0.0628 -0.0816 0.0365  399 LYS A CE    
859  N  NZ    . LYS A 55 ? 0.8278 1.0039 1.0339 -0.0762 -0.0651 0.0179  399 LYS A NZ    
873  N  N     . THR A 56 ? 0.2245 0.2886 0.3556 -0.0223 -0.0001 0.0423  400 THR A N     
874  C  CA    . THR A 56 ? 0.2387 0.2778 0.3623 -0.0128 0.0212  0.0310  400 THR A CA    
875  C  C     . THR A 56 ? 0.2964 0.3194 0.4335 0.0028  0.0298  0.0318  400 THR A C     
876  O  O     . THR A 56 ? 0.2546 0.2624 0.4015 0.0132  0.0480  0.0303  400 THR A O     
877  C  CB    . THR A 56 ? 0.2740 0.2930 0.3477 -0.0085 0.0294  0.0173  400 THR A CB    
878  O  OG1   . THR A 56 ? 0.2590 0.2770 0.3130 -0.0031 0.0204  0.0134  400 THR A OG1   
879  C  CG2   . THR A 56 ? 0.2720 0.3009 0.3304 -0.0236 0.0239  0.0151  400 THR A CG2   
887  N  N     . HIS A 57 ? 0.2092 0.2326 0.3489 0.0052  0.0194  0.0340  401 HIS A N     
888  C  CA    . HIS A 57 ? 0.2576 0.2649 0.4149 0.0184  0.0252  0.0334  401 HIS A CA    
889  C  C     . HIS A 57 ? 0.2786 0.2941 0.4757 0.0210  0.0313  0.0478  401 HIS A C     
890  O  O     . HIS A 57 ? 0.3209 0.3166 0.5243 0.0363  0.0463  0.0451  401 HIS A O     
891  C  CB    . HIS A 57 ? 0.2840 0.2926 0.4530 0.0149  0.0141  0.0359  401 HIS A CB    
892  C  CG    . HIS A 57 ? 0.3816 0.3746 0.5774 0.0251  0.0191  0.0389  401 HIS A CG    
893  N  ND1   . HIS A 57 ? 0.3022 0.2676 0.4854 0.0409  0.0258  0.0200  401 HIS A ND1   
894  C  CD2   . HIS A 57 ? 0.3026 0.3015 0.5330 0.0252  0.0187  0.0581  401 HIS A CD2   
895  C  CE1   . HIS A 57 ? 0.3140 0.2667 0.5242 0.0478  0.0299  0.0264  401 HIS A CE1   
896  N  NE2   . HIS A 57 ? 0.3271 0.2995 0.5670 0.0387  0.0271  0.0508  401 HIS A NE2   
904  N  N     . THR A 58 ? 0.2470 0.2927 0.4707 0.0096  0.0189  0.0630  402 THR A N     
905  C  CA    . THR A 58 ? 0.3983 0.4603 0.6667 0.0139  0.0208  0.0767  402 THR A CA    
906  C  C     . THR A 58 ? 0.3951 0.4527 0.6791 0.0180  0.0406  0.0711  402 THR A C     
907  O  O     . THR A 58 ? 0.3209 0.3813 0.6409 0.0280  0.0513  0.0795  402 THR A O     
908  C  CB    . THR A 58 ? 0.3055 0.4053 0.5924 0.0044  -0.0003 0.0899  402 THR A CB    
909  O  OG1   . THR A 58 ? 0.3400 0.4364 0.6104 0.0047  -0.0108 0.0997  402 THR A OG1   
910  C  CG2   . THR A 58 ? 0.4171 0.5416 0.7539 0.0117  -0.0021 0.1031  402 THR A CG2   
918  N  N     . ARG A 59 ? 0.3465 0.3937 0.6047 0.0124  0.0501  0.0584  403 ARG A N     
919  C  CA    . ARG A 59 ? 0.2850 0.3197 0.5573 0.0175  0.0770  0.0549  403 ARG A CA    
920  C  C     . ARG A 59 ? 0.4676 0.4635 0.7205 0.0425  0.1013  0.0528  403 ARG A C     
921  O  O     . ARG A 59 ? 0.4048 0.3888 0.6765 0.0523  0.1286  0.0562  403 ARG A O     
922  C  CB    . ARG A 59 ? 0.3907 0.4152 0.6342 0.0075  0.0854  0.0430  403 ARG A CB    
923  C  CG    . ARG A 59 ? 0.3260 0.3847 0.5829 -0.0156 0.0615  0.0411  403 ARG A CG    
924  C  CD    . ARG A 59 ? 0.4965 0.5420 0.7375 -0.0267 0.0757  0.0286  403 ARG A CD    
925  N  NE    . ARG A 59 ? 0.4395 0.5149 0.6883 -0.0476 0.0502  0.0227  403 ARG A NE    
926  C  CZ    . ARG A 59 ? 0.7321 0.7960 0.9365 -0.0551 0.0455  0.0128  403 ARG A CZ    
927  N  NH1   . ARG A 59 ? 0.4247 0.4507 0.5756 -0.0437 0.0643  0.0082  403 ARG A NH1   
928  N  NH2   . ARG A 59 ? 1.0061 1.0968 1.2167 -0.0712 0.0209  0.0066  403 ARG A NH2   
942  N  N     . THR A 60 ? 0.4529 0.4278 0.6693 0.0542  0.0931  0.0458  404 THR A N     
943  C  CA    . THR A 60 ? 0.4425 0.3810 0.6378 0.0809  0.1112  0.0402  404 THR A CA    
944  C  C     . THR A 60 ? 0.4452 0.3911 0.6759 0.0836  0.1156  0.0531  404 THR A C     
945  O  O     . THR A 60 ? 0.4989 0.4235 0.7016 0.0950  0.1289  0.0500  404 THR A O     
946  C  CB    . THR A 60 ? 0.5168 0.4387 0.6715 0.0879  0.0940  0.0241  404 THR A CB    
947  O  OG1   . THR A 60 ? 0.4644 0.4002 0.6520 0.0791  0.0760  0.0311  404 THR A OG1   
948  C  CG2   . THR A 60 ? 0.5297 0.4554 0.6493 0.0799  0.0843  0.0124  404 THR A CG2   
956  N  N     . HIS A 61 ? 0.3745 0.3539 0.6622 0.0741  0.1023  0.0686  405 HIS A N     
957  C  CA    . HIS A 61 ? 0.3693 0.3594 0.6930 0.0784  0.1059  0.0825  405 HIS A CA    
958  C  C     . HIS A 61 ? 0.3970 0.4139 0.7703 0.0727  0.1189  0.0922  405 HIS A C     
959  O  O     . HIS A 61 ? 0.3747 0.3858 0.7608 0.0797  0.1336  0.0993  405 HIS A O     
960  C  CB    . HIS A 61 ? 0.3272 0.3401 0.6799 0.0739  0.0829  0.0954  405 HIS A CB    
961  C  CG    . HIS A 61 ? 0.4018 0.3887 0.7209 0.0756  0.0723  0.0867  405 HIS A CG    
962  N  ND1   . HIS A 61 ? 0.4654 0.4168 0.7488 0.0858  0.0794  0.0724  405 HIS A ND1   
963  C  CD2   . HIS A 61 ? 0.4289 0.4242 0.7385 0.0624  0.0533  0.0870  405 HIS A CD2   
964  C  CE1   . HIS A 61 ? 0.5820 0.5203 0.8548 0.0824  0.0670  0.0641  405 HIS A CE1   
965  N  NE2   . HIS A 61 ? 0.3595 0.3225 0.6506 0.0686  0.0535  0.0751  405 HIS A NE2   
973  N  N     . THR A 62 ? 0.3192 0.3680 0.7195 0.0563  0.1119  0.0902  406 THR A N     
974  C  CA    . THR A 62 ? 0.2544 0.3343 0.7074 0.0443  0.1162  0.0940  406 THR A CA    
975  C  C     . THR A 62 ? 0.3451 0.3948 0.7896 0.0454  0.1498  0.0877  406 THR A C     
976  O  O     . THR A 62 ? 0.3674 0.4310 0.8549 0.0382  0.1580  0.0898  406 THR A O     
977  C  CB    . THR A 62 ? 0.3789 0.5035 0.8524 0.0209  0.0868  0.0889  406 THR A CB    
978  O  OG1   . THR A 62 ? 0.3373 0.4436 0.7712 0.0098  0.0913  0.0753  406 THR A OG1   
979  C  CG2   . THR A 62 ? 0.3380 0.4867 0.8078 0.0218  0.0543  0.0984  406 THR A CG2   
987  N  N     . GLY A 63 ? 0.5729 0.3577 0.8541 0.1836  0.0473  0.1448  407 GLY A N     
988  C  CA    . GLY A 63 ? 0.5046 0.3391 0.8010 0.1792  0.0601  0.1204  407 GLY A CA    
989  C  C     . GLY A 63 ? 0.5263 0.4296 0.8299 0.1636  0.0366  0.1367  407 GLY A C     
990  O  O     . GLY A 63 ? 0.5788 0.5203 0.8925 0.1581  0.0470  0.1182  407 GLY A O     
994  N  N     . GLU A 64 ? 0.4787 0.3992 0.7725 0.1526  0.0060  0.1693  408 GLU A N     
995  C  CA    . GLU A 64 ? 0.4723 0.4620 0.7707 0.1337  -0.0167 0.1812  408 GLU A CA    
996  C  C     . GLU A 64 ? 0.4329 0.4122 0.6865 0.1047  -0.0092 0.1526  408 GLU A C     
997  O  O     . GLU A 64 ? 0.4279 0.3578 0.6335 0.0872  -0.0046 0.1402  408 GLU A O     
998  C  CB    . GLU A 64 ? 0.4718 0.4845 0.7559 0.1207  -0.0500 0.2163  408 GLU A CB    
999  C  CG    . GLU A 64 ? 0.9935 0.9720 1.2186 0.0899  -0.0625 0.2225  408 GLU A CG    
1000 C  CD    . GLU A 64 ? 1.1208 1.1426 1.3295 0.0710  -0.0941 0.2525  408 GLU A CD    
1001 O  OE1   . GLU A 64 ? 0.8078 0.8946 1.0199 0.0526  -0.1098 0.2526  408 GLU A OE1   
1002 O  OE2   . GLU A 64 ? 0.6880 0.6775 0.8767 0.0717  -0.1017 0.2738  408 GLU A OE2   
1009 N  N     . LYS A 65 ? 0.3943 0.4221 0.6556 0.0949  -0.0063 0.1368  409 LYS A N     
1010 C  CA    . LYS A 65 ? 0.3083 0.3295 0.5217 0.0682  0.0008  0.1075  409 LYS A CA    
1011 C  C     . LYS A 65 ? 0.3919 0.4647 0.6006 0.0457  -0.0184 0.1132  409 LYS A C     
1012 O  O     . LYS A 65 ? 0.4060 0.5126 0.6329 0.0421  -0.0116 0.1050  409 LYS A O     
1013 C  CB    . LYS A 65 ? 0.3744 0.3850 0.5911 0.0766  0.0299  0.0795  409 LYS A CB    
1014 C  CG    . LYS A 65 ? 0.4073 0.3624 0.6188 0.0916  0.0521  0.0654  409 LYS A CG    
1015 C  CD    . LYS A 65 ? 0.4290 0.3797 0.6335 0.0934  0.0811  0.0350  409 LYS A CD    
1016 C  CE    . LYS A 65 ? 0.6293 0.5240 0.8276 0.1049  0.1060  0.0158  409 LYS A CE    
1017 N  NZ    . LYS A 65 ? 0.5994 0.4895 0.7683 0.0947  0.1312  -0.0176 409 LYS A NZ    
1031 N  N     . PRO A 66 ? 0.3165 0.3938 0.4965 0.0257  -0.0399 0.1250  410 PRO A N     
1032 C  CA    . PRO A 66 ? 0.6181 0.7436 0.7931 0.0013  -0.0575 0.1287  410 PRO A CA    
1033 C  C     . PRO A 66 ? 0.6480 0.7671 0.7943 -0.0171 -0.0455 0.0999  410 PRO A C     
1034 O  O     . PRO A 66 ? 0.5218 0.6747 0.6730 -0.0354 -0.0513 0.0974  410 PRO A O     
1035 C  CB    . PRO A 66 ? 0.3827 0.5060 0.5242 -0.0167 -0.0783 0.1440  410 PRO A CB    
1036 C  CG    . PRO A 66 ? 0.5945 0.6722 0.7343 0.0013  -0.0745 0.1579  410 PRO A CG    
1037 C  CD    . PRO A 66 ? 0.6910 0.7305 0.8402 0.0205  -0.0473 0.1348  410 PRO A CD    
1045 N  N     . PHE A 67 ? 0.3914 0.4683 0.5079 -0.0135 -0.0294 0.0795  411 PHE A N     
1046 C  CA    . PHE A 67 ? 0.4686 0.5331 0.5527 -0.0272 -0.0217 0.0579  411 PHE A CA    
1047 C  C     . PHE A 67 ? 0.3998 0.4587 0.4943 -0.0186 -0.0032 0.0483  411 PHE A C     
1048 O  O     . PHE A 67 ? 0.3481 0.3862 0.4392 -0.0039 0.0109  0.0412  411 PHE A O     
1049 C  CB    . PHE A 67 ? 0.3498 0.3857 0.3981 -0.0282 -0.0187 0.0456  411 PHE A CB    
1050 C  CG    . PHE A 67 ? 0.4105 0.4537 0.4419 -0.0428 -0.0336 0.0537  411 PHE A CG    
1051 C  CD1   . PHE A 67 ? 0.4188 0.4501 0.4530 -0.0382 -0.0385 0.0690  411 PHE A CD1   
1052 C  CD2   . PHE A 67 ? 0.3854 0.4433 0.3949 -0.0634 -0.0405 0.0459  411 PHE A CD2   
1053 C  CE1   . PHE A 67 ? 0.4415 0.4792 0.4541 -0.0558 -0.0521 0.0806  411 PHE A CE1   
1054 C  CE2   . PHE A 67 ? 0.4547 0.5244 0.4429 -0.0813 -0.0524 0.0525  411 PHE A CE2   
1055 C  CZ    . PHE A 67 ? 0.4051 0.4669 0.3939 -0.0783 -0.0592 0.0722  411 PHE A CZ    
1065 N  N     . SER A 68 ? 0.3165 0.3940 0.4184 -0.0331 -0.0024 0.0473  412 SER A N     
1066 C  CA    . SER A 68 ? 0.3392 0.4162 0.4503 -0.0317 0.0153  0.0426  412 SER A CA    
1067 C  C     . SER A 68 ? 0.3263 0.3661 0.3974 -0.0395 0.0245  0.0305  412 SER A C     
1068 O  O     . SER A 68 ? 0.3628 0.3892 0.4120 -0.0536 0.0179  0.0243  412 SER A O     
1069 C  CB    . SER A 68 ? 0.3697 0.4927 0.5165 -0.0469 0.0122  0.0509  412 SER A CB    
1070 O  OG    . SER A 68 ? 0.5470 0.7110 0.7297 -0.0403 -0.0047 0.0674  412 SER A OG    
1076 N  N     . CYS A 69 ? 0.3266 0.3498 0.3881 -0.0295 0.0409  0.0279  413 CYS A N     
1077 C  CA    . CYS A 69 ? 0.3498 0.3380 0.3764 -0.0333 0.0491  0.0246  413 CYS A CA    
1078 C  C     . CYS A 69 ? 0.4046 0.3880 0.4320 -0.0575 0.0528  0.0261  413 CYS A C     
1079 O  O     . CYS A 69 ? 0.3677 0.3837 0.4240 -0.0710 0.0574  0.0305  413 CYS A O     
1080 C  CB    . CYS A 69 ? 0.3850 0.3650 0.3985 -0.0224 0.0645  0.0262  413 CYS A CB    
1081 S  SG    . CYS A 69 ? 0.3716 0.3066 0.3388 -0.0213 0.0703  0.0321  413 CYS A SG    
1086 N  N     . ARG A 70 ? 0.3416 0.2849 0.3392 -0.0638 0.0528  0.0208  414 ARG A N     
1087 C  CA    . ARG A 70 ? 0.3821 0.3045 0.3718 -0.0915 0.0596  0.0181  414 ARG A CA    
1088 C  C     . ARG A 70 ? 0.3881 0.2660 0.3529 -0.0932 0.0770  0.0270  414 ARG A C     
1089 O  O     . ARG A 70 ? 0.4899 0.3394 0.4439 -0.1194 0.0862  0.0256  414 ARG A O     
1090 C  CB    . ARG A 70 ? 0.4633 0.3595 0.4338 -0.1006 0.0533  0.0033  414 ARG A CB    
1091 C  CG    . ARG A 70 ? 0.5163 0.4610 0.5051 -0.1079 0.0353  -0.0019 414 ARG A CG    
1092 C  CD    . ARG A 70 ? 0.6560 0.5857 0.6233 -0.1285 0.0317  -0.0205 414 ARG A CD    
1093 N  NE    . ARG A 70 ? 1.2396 1.1372 1.1843 -0.1062 0.0351  -0.0312 414 ARG A NE    
1094 C  CZ    . ARG A 70 ? 1.3177 1.2419 1.2652 -0.0914 0.0249  -0.0313 414 ARG A CZ    
1095 N  NH1   . ARG A 70 ? 0.9479 0.9188 0.9161 -0.0944 0.0104  -0.0188 414 ARG A NH1   
1096 N  NH2   . ARG A 70 ? 0.8929 0.7969 0.8244 -0.0732 0.0303  -0.0427 414 ARG A NH2   
1110 N  N     . TRP A 71 ? 0.4408 0.3126 0.3930 -0.0700 0.0816  0.0368  415 TRP A N     
1111 C  CA    . TRP A 71 ? 0.5318 0.3656 0.4551 -0.0722 0.0964  0.0514  415 TRP A CA    
1112 C  C     . TRP A 71 ? 0.6532 0.5108 0.5916 -0.1011 0.1112  0.0561  415 TRP A C     
1113 O  O     . TRP A 71 ? 0.5171 0.4330 0.4911 -0.1024 0.1116  0.0515  415 TRP A O     
1114 C  CB    . TRP A 71 ? 0.5682 0.4075 0.4735 -0.0452 0.0951  0.0604  415 TRP A CB    
1115 C  CG    . TRP A 71 ? 1.0247 0.8179 0.8906 -0.0399 0.1026  0.0801  415 TRP A CG    
1116 C  CD1   . TRP A 71 ? 1.0666 0.8552 0.9114 -0.0527 0.1172  0.0963  415 TRP A CD1   
1117 C  CD2   . TRP A 71 ? 0.7304 0.4748 0.5721 -0.0189 0.0966  0.0893  415 TRP A CD2   
1118 N  NE1   . TRP A 71 ? 0.9199 0.6558 0.7241 -0.0417 0.1179  0.1195  415 TRP A NE1   
1119 C  CE2   . TRP A 71 ? 0.9052 0.6130 0.7107 -0.0176 0.1051  0.1160  415 TRP A CE2   
1120 C  CE3   . TRP A 71 ? 0.6189 0.3503 0.4675 0.0006  0.0861  0.0781  415 TRP A CE3   
1121 C  CZ2   . TRP A 71 ? 0.8137 0.4699 0.5941 0.0071  0.1008  0.1349  415 TRP A CZ2   
1122 C  CZ3   . TRP A 71 ? 0.8207 0.5045 0.6480 0.0255  0.0854  0.0921  415 TRP A CZ3   
1123 C  CH2   . TRP A 71 ? 0.8134 0.4581 0.6083 0.0312  0.0916  0.1224  415 TRP A CH2   
1134 N  N     . PRO A 72 ? 0.6940 0.5076 0.6079 -0.1241 0.1253  0.0656  416 PRO A N     
1135 C  CA    . PRO A 72 ? 0.7177 0.5634 0.6478 -0.1558 0.1405  0.0689  416 PRO A CA    
1136 C  C     . PRO A 72 ? 0.8054 0.6982 0.7454 -0.1457 0.1519  0.0741  416 PRO A C     
1137 O  O     . PRO A 72 ? 0.5938 0.4665 0.5010 -0.1256 0.1543  0.0842  416 PRO A O     
1138 C  CB    . PRO A 72 ? 0.6551 0.4409 0.5499 -0.1677 0.1460  0.0796  416 PRO A CB    
1139 C  CG    . PRO A 72 ? 0.7611 0.4818 0.6321 -0.1518 0.1372  0.0760  416 PRO A CG    
1140 C  CD    . PRO A 72 ? 0.6313 0.3640 0.5050 -0.1208 0.1282  0.0735  416 PRO A CD    
1148 N  N     . SER A 73 ? 0.6183 0.5799 0.6058 -0.1586 0.1582  0.0658  417 SER A N     
1149 C  CA    . SER A 73 ? 0.6302 0.6412 0.6345 -0.1507 0.1744  0.0646  417 SER A CA    
1150 C  C     . SER A 73 ? 0.6290 0.6461 0.6308 -0.1143 0.1681  0.0575  417 SER A C     
1151 O  O     . SER A 73 ? 0.6999 0.7374 0.6955 -0.1076 0.1850  0.0540  417 SER A O     
1152 C  CB    . SER A 73 ? 0.5507 0.5403 0.5164 -0.1630 0.1874  0.0775  417 SER A CB    
1153 O  OG    . SER A 73 ? 0.7127 0.6996 0.6848 -0.1930 0.1899  0.0818  417 SER A OG    
1159 N  N     . CYS A 74 ? 0.5241 0.5237 0.5268 -0.0940 0.1456  0.0529  418 CYS A N     
1160 C  CA    . CYS A 74 ? 0.5737 0.5858 0.5830 -0.0652 0.1385  0.0432  418 CYS A CA    
1161 C  C     . CYS A 74 ? 0.5713 0.6250 0.6362 -0.0571 0.1283  0.0355  418 CYS A C     
1162 O  O     . CYS A 74 ? 0.5296 0.5862 0.6091 -0.0663 0.1120  0.0378  418 CYS A O     
1163 C  CB    . CYS A 74 ? 0.4900 0.4605 0.4616 -0.0485 0.1212  0.0452  418 CYS A CB    
1164 S  SG    . CYS A 74 ? 0.4489 0.4352 0.4237 -0.0234 0.1151  0.0307  418 CYS A SG    
1169 N  N     . GLN A 75 ? 0.4666 0.5504 0.5600 -0.0401 0.1384  0.0267  419 GLN A N     
1170 C  CA    . GLN A 75 ? 0.4372 0.5599 0.5876 -0.0270 0.1302  0.0256  419 GLN A CA    
1171 C  C     . GLN A 75 ? 0.6500 0.7512 0.7972 -0.0031 0.1191  0.0201  419 GLN A C     
1172 O  O     . GLN A 75 ? 0.4123 0.5359 0.6035 0.0133  0.1148  0.0221  419 GLN A O     
1173 C  CB    . GLN A 75 ? 0.5327 0.7074 0.7313 -0.0229 0.1541  0.0209  419 GLN A CB    
1174 C  CG    . GLN A 75 ? 0.5838 0.7866 0.7860 -0.0530 0.1689  0.0255  419 GLN A CG    
1175 C  CD    . GLN A 75 ? 1.3298 1.5551 1.5526 -0.0767 0.1494  0.0360  419 GLN A CD    
1176 O  OE1   . GLN A 75 ? 1.2655 1.4461 1.4481 -0.0916 0.1338  0.0399  419 GLN A OE1   
1177 N  NE2   . GLN A 75 ? 0.7997 1.0989 1.0868 -0.0808 0.1514  0.0388  419 GLN A NE2   
1186 N  N     . LYS A 76 ? 0.4542 0.5144 0.5522 -0.0011 0.1142  0.0152  420 LYS A N     
1187 C  CA    . LYS A 76 ? 0.4384 0.4797 0.5309 0.0141  0.1055  0.0083  420 LYS A CA    
1188 C  C     . LYS A 76 ? 0.3542 0.3988 0.4649 0.0148  0.0815  0.0185  420 LYS A C     
1189 O  O     . LYS A 76 ? 0.3118 0.3596 0.4158 0.0009  0.0681  0.0258  420 LYS A O     
1190 C  CB    . LYS A 76 ? 0.3702 0.3822 0.4093 0.0118  0.1033  0.0012  420 LYS A CB    
1191 C  CG    . LYS A 76 ? 0.4517 0.4631 0.4602 0.0073  0.1235  -0.0062 420 LYS A CG    
1192 C  CD    . LYS A 76 ? 0.8568 0.8662 0.8644 0.0142  0.1403  -0.0266 420 LYS A CD    
1193 C  CE    . LYS A 76 ? 0.6677 0.6809 0.6333 0.0039  0.1594  -0.0364 420 LYS A CE    
1194 N  NZ    . LYS A 76 ? 0.9384 0.9449 0.8963 0.0056  0.1785  -0.0635 420 LYS A NZ    
1208 N  N     . LYS A 77 ? 0.2968 0.3363 0.4261 0.0291  0.0778  0.0184  421 LYS A N     
1209 C  CA    . LYS A 77 ? 0.2975 0.3384 0.4376 0.0293  0.0554  0.0312  421 LYS A CA    
1210 C  C     . LYS A 77 ? 0.3679 0.3734 0.4860 0.0350  0.0539  0.0247  421 LYS A C     
1211 O  O     . LYS A 77 ? 0.3960 0.3801 0.5045 0.0419  0.0718  0.0097  421 LYS A O     
1212 C  CB    . LYS A 77 ? 0.4276 0.5044 0.6239 0.0410  0.0501  0.0480  421 LYS A CB    
1213 C  CG    . LYS A 77 ? 0.8756 1.0003 1.1008 0.0302  0.0517  0.0534  421 LYS A CG    
1214 C  CD    . LYS A 77 ? 0.7389 0.9142 1.0292 0.0465  0.0470  0.0705  421 LYS A CD    
1215 C  CE    . LYS A 77 ? 0.5792 0.8137 0.9022 0.0310  0.0519  0.0725  421 LYS A CE    
1216 N  NZ    . LYS A 77 ? 0.7119 1.0137 1.1059 0.0473  0.0423  0.0922  421 LYS A NZ    
1230 N  N     . PHE A 78 ? 0.3139 0.3148 0.4213 0.0272  0.0342  0.0344  422 PHE A N     
1231 C  CA    . PHE A 78 ? 0.3080 0.2785 0.3878 0.0231  0.0319  0.0283  422 PHE A CA    
1232 C  C     . PHE A 78 ? 0.3499 0.3170 0.4385 0.0210  0.0151  0.0484  422 PHE A C     
1233 O  O     . PHE A 78 ? 0.3739 0.3693 0.4728 0.0144  -0.0018 0.0643  422 PHE A O     
1234 C  CB    . PHE A 78 ? 0.3303 0.3011 0.3703 0.0090  0.0275  0.0157  422 PHE A CB    
1235 C  CG    . PHE A 78 ? 0.2867 0.2589 0.3117 0.0118  0.0406  0.0026  422 PHE A CG    
1236 C  CD1   . PHE A 78 ? 0.3496 0.3086 0.3575 0.0127  0.0538  -0.0126 422 PHE A CD1   
1237 C  CD2   . PHE A 78 ? 0.2798 0.2648 0.3048 0.0101  0.0402  0.0066  422 PHE A CD2   
1238 C  CE1   . PHE A 78 ? 0.3760 0.3419 0.3646 0.0131  0.0644  -0.0208 422 PHE A CE1   
1239 C  CE2   . PHE A 78 ? 0.3330 0.3158 0.3400 0.0121  0.0518  0.0009  422 PHE A CE2   
1240 C  CZ    . PHE A 78 ? 0.3344 0.3113 0.3227 0.0141  0.0626  -0.0112 422 PHE A CZ    
1250 N  N     . ALA A 79 ? 0.3350 0.2655 0.4129 0.0217  0.0200  0.0471  423 ALA A N     
1251 C  CA    . ALA A 79 ? 0.3481 0.2651 0.4268 0.0180  0.0054  0.0705  423 ALA A CA    
1252 C  C     . ALA A 79 ? 0.3299 0.2642 0.3747 -0.0074 -0.0107 0.0726  423 ALA A C     
1253 O  O     . ALA A 79 ? 0.4238 0.3677 0.4679 -0.0149 -0.0278 0.0964  423 ALA A O     
1254 C  CB    . ALA A 79 ? 0.4541 0.3147 0.5244 0.0210  0.0194  0.0664  423 ALA A CB    
1260 N  N     . ARG A 80 ? 0.3071 0.2482 0.3236 -0.0201 -0.0051 0.0490  424 ARG A N     
1261 C  CA    . ARG A 80 ? 0.3545 0.3121 0.3412 -0.0419 -0.0137 0.0443  424 ARG A CA    
1262 C  C     . ARG A 80 ? 0.3476 0.3333 0.3277 -0.0422 -0.0132 0.0281  424 ARG A C     
1263 O  O     . ARG A 80 ? 0.3036 0.2886 0.2891 -0.0300 -0.0037 0.0166  424 ARG A O     
1264 C  CB    . ARG A 80 ? 0.4685 0.4089 0.4294 -0.0568 -0.0053 0.0300  424 ARG A CB    
1265 C  CG    . ARG A 80 ? 0.5294 0.4495 0.4751 -0.0749 -0.0108 0.0465  424 ARG A CG    
1266 C  CD    . ARG A 80 ? 0.5543 0.4482 0.4788 -0.0927 0.0014  0.0320  424 ARG A CD    
1267 N  NE    . ARG A 80 ? 0.3640 0.2922 0.2764 -0.1010 0.0078  0.0032  424 ARG A NE    
1268 C  CZ    . ARG A 80 ? 0.3520 0.2731 0.2472 -0.1203 0.0177  -0.0146 424 ARG A CZ    
1269 N  NH1   . ARG A 80 ? 0.3915 0.2603 0.2756 -0.1355 0.0258  -0.0098 424 ARG A NH1   
1270 N  NH2   . ARG A 80 ? 0.3517 0.3184 0.2412 -0.1251 0.0195  -0.0370 424 ARG A NH2   
1284 N  N     . SER A 81 ? 0.3248 0.3314 0.2892 -0.0574 -0.0213 0.0269  425 SER A N     
1285 C  CA    . SER A 81 ? 0.3229 0.3452 0.2820 -0.0558 -0.0184 0.0113  425 SER A CA    
1286 C  C     . SER A 81 ? 0.3407 0.3636 0.2924 -0.0452 -0.0078 -0.0069 425 SER A C     
1287 O  O     . SER A 81 ? 0.3134 0.3334 0.2684 -0.0322 -0.0027 -0.0129 425 SER A O     
1288 C  CB    . SER A 81 ? 0.3941 0.4361 0.3341 -0.0759 -0.0245 0.0073  425 SER A CB    
1289 O  OG    . SER A 81 ? 0.4310 0.4805 0.3536 -0.0872 -0.0216 0.0012  425 SER A OG    
1295 N  N     . ASP A 82 ? 0.2931 0.3224 0.2339 -0.0524 -0.0054 -0.0139 426 ASP A N     
1296 C  CA    . ASP A 82 ? 0.3155 0.3625 0.2517 -0.0439 0.0005  -0.0294 426 ASP A CA    
1297 C  C     . ASP A 82 ? 0.3315 0.3651 0.2717 -0.0301 0.0055  -0.0292 426 ASP A C     
1298 O  O     . ASP A 82 ? 0.3315 0.3800 0.2684 -0.0174 0.0073  -0.0351 426 ASP A O     
1299 C  CB    . ASP A 82 ? 0.3769 0.4465 0.3018 -0.0621 0.0016  -0.0387 426 ASP A CB    
1300 C  CG    . ASP A 82 ? 0.3508 0.3921 0.2692 -0.0785 0.0030  -0.0317 426 ASP A CG    
1301 O  OD1   . ASP A 82 ? 0.3798 0.3980 0.2976 -0.0865 -0.0014 -0.0154 426 ASP A OD1   
1302 O  OD2   . ASP A 82 ? 0.4220 0.4637 0.3341 -0.0846 0.0084  -0.0423 426 ASP A OD2   
1307 N  N     . GLU A 83 ? 0.2751 0.2823 0.2222 -0.0308 0.0087  -0.0215 427 GLU A N     
1308 C  CA    . GLU A 83 ? 0.2578 0.2540 0.2074 -0.0192 0.0176  -0.0240 427 GLU A CA    
1309 C  C     . GLU A 83 ? 0.2748 0.2729 0.2307 -0.0058 0.0182  -0.0178 427 GLU A C     
1310 O  O     . GLU A 83 ? 0.3383 0.3390 0.2847 0.0025  0.0236  -0.0200 427 GLU A O     
1311 C  CB    . GLU A 83 ? 0.3156 0.2830 0.2791 -0.0181 0.0250  -0.0187 427 GLU A CB    
1312 C  CG    . GLU A 83 ? 0.4046 0.3505 0.3585 -0.0320 0.0289  -0.0245 427 GLU A CG    
1313 C  CD    . GLU A 83 ? 0.4576 0.3669 0.4323 -0.0223 0.0377  -0.0159 427 GLU A CD    
1314 O  OE1   . GLU A 83 ? 0.4388 0.3382 0.4293 -0.0198 0.0291  0.0042  427 GLU A OE1   
1315 O  OE2   . GLU A 83 ? 0.4945 0.3891 0.4714 -0.0149 0.0537  -0.0285 427 GLU A OE2   
1322 N  N     . LEU A 84 ? 0.2873 0.2832 0.2553 -0.0077 0.0130  -0.0090 428 LEU A N     
1323 C  CA    . LEU A 84 ? 0.2928 0.2838 0.2640 -0.0021 0.0157  -0.0048 428 LEU A CA    
1324 C  C     . LEU A 84 ? 0.3531 0.3450 0.3083 0.0053  0.0155  -0.0110 428 LEU A C     
1325 O  O     . LEU A 84 ? 0.3141 0.2931 0.2626 0.0150  0.0209  -0.0066 428 LEU A O     
1326 C  CB    . LEU A 84 ? 0.2904 0.2840 0.2772 -0.0124 0.0097  0.0031  428 LEU A CB    
1327 C  CG    . LEU A 84 ? 0.3146 0.2988 0.3002 -0.0156 0.0141  0.0034  428 LEU A CG    
1328 C  CD1   . LEU A 84 ? 0.3912 0.3679 0.3819 -0.0083 0.0257  0.0088  428 LEU A CD1   
1329 C  CD2   . LEU A 84 ? 0.4209 0.4178 0.4185 -0.0337 0.0062  0.0075  428 LEU A CD2   
1341 N  N     . VAL A 85 ? 0.3176 0.3247 0.2673 0.0024  0.0107  -0.0197 429 VAL A N     
1342 C  CA    . VAL A 85 ? 0.3015 0.3163 0.2444 0.0168  0.0123  -0.0264 429 VAL A CA    
1343 C  C     . VAL A 85 ? 0.3516 0.3763 0.2877 0.0317  0.0125  -0.0216 429 VAL A C     
1344 O  O     . VAL A 85 ? 0.3462 0.3605 0.2772 0.0496  0.0143  -0.0142 429 VAL A O     
1345 C  CB    . VAL A 85 ? 0.3381 0.3815 0.2809 0.0102  0.0101  -0.0393 429 VAL A CB    
1346 C  CG1   . VAL A 85 ? 0.4110 0.4752 0.3569 0.0319  0.0126  -0.0462 429 VAL A CG1   
1347 C  CG2   . VAL A 85 ? 0.3462 0.3809 0.2870 -0.0059 0.0104  -0.0440 429 VAL A CG2   
1357 N  N     . ARG A 86 ? 0.3056 0.3486 0.2380 0.0227  0.0107  -0.0251 430 ARG A N     
1358 C  CA    . ARG A 86 ? 0.2928 0.3539 0.2125 0.0301  0.0095  -0.0231 430 ARG A CA    
1359 C  C     . ARG A 86 ? 0.2940 0.3293 0.2041 0.0373  0.0156  -0.0103 430 ARG A C     
1360 O  O     . ARG A 86 ? 0.3428 0.3858 0.2390 0.0506  0.0131  0.0001  430 ARG A O     
1361 C  CB    . ARG A 86 ? 0.3747 0.4515 0.2873 0.0107  0.0102  -0.0350 430 ARG A CB    
1362 C  CG    . ARG A 86 ? 0.4791 0.5951 0.3755 0.0102  0.0054  -0.0393 430 ARG A CG    
1363 C  CD    . ARG A 86 ? 0.5109 0.6408 0.3971 -0.0174 0.0079  -0.0577 430 ARG A CD    
1364 N  NE    . ARG A 86 ? 0.4395 0.5223 0.3229 -0.0275 0.0208  -0.0622 430 ARG A NE    
1365 C  CZ    . ARG A 86 ? 0.4068 0.4740 0.2806 -0.0498 0.0292  -0.0780 430 ARG A CZ    
1366 N  NH1   . ARG A 86 ? 0.3589 0.4525 0.2301 -0.0685 0.0241  -0.0871 430 ARG A NH1   
1367 N  NH2   . ARG A 86 ? 0.3794 0.4001 0.2579 -0.0498 0.0431  -0.0799 430 ARG A NH2   
1381 N  N     . HIS A 87 ? 0.3347 0.3441 0.2531 0.0283  0.0235  -0.0086 431 HIS A N     
1382 C  CA    . HIS A 87 ? 0.3597 0.3508 0.2715 0.0297  0.0329  0.0015  431 HIS A CA    
1383 C  C     . HIS A 87 ? 0.3230 0.2908 0.2297 0.0391  0.0334  0.0150  431 HIS A C     
1384 O  O     . HIS A 87 ? 0.3354 0.2927 0.2233 0.0443  0.0379  0.0282  431 HIS A O     
1385 C  CB    . HIS A 87 ? 0.3299 0.3112 0.2626 0.0195  0.0414  -0.0010 431 HIS A CB    
1386 C  CG    . HIS A 87 ? 0.3394 0.3115 0.2718 0.0173  0.0543  0.0069  431 HIS A CG    
1387 N  ND1   . HIS A 87 ? 0.4081 0.3863 0.3230 0.0156  0.0661  0.0044  431 HIS A ND1   
1388 C  CD2   . HIS A 87 ? 0.3104 0.2717 0.2556 0.0117  0.0591  0.0155  431 HIS A CD2   
1389 C  CE1   . HIS A 87 ? 0.4093 0.3818 0.3276 0.0106  0.0788  0.0124  431 HIS A CE1   
1390 N  NE2   . HIS A 87 ? 0.3895 0.3518 0.3269 0.0074  0.0742  0.0199  431 HIS A NE2   
1398 N  N     . HIS A 88 ? 0.3501 0.3049 0.2690 0.0387  0.0307  0.0116  432 HIS A N     
1399 C  CA    . HIS A 88 ? 0.3359 0.2564 0.2473 0.0463  0.0345  0.0198  432 HIS A CA    
1400 C  C     . HIS A 88 ? 0.3393 0.2615 0.2376 0.0716  0.0299  0.0291  432 HIS A C     
1401 O  O     . HIS A 88 ? 0.4349 0.3237 0.3178 0.0828  0.0342  0.0465  432 HIS A O     
1402 C  CB    . HIS A 88 ? 0.3578 0.2670 0.2808 0.0374  0.0343  0.0069  432 HIS A CB    
1403 C  CG    . HIS A 88 ? 0.3303 0.2323 0.2639 0.0133  0.0376  0.0056  432 HIS A CG    
1404 N  ND1   . HIS A 88 ? 0.4373 0.3479 0.3800 -0.0030 0.0331  -0.0057 432 HIS A ND1   
1405 C  CD2   . HIS A 88 ? 0.4369 0.3319 0.3742 0.0013  0.0448  0.0149  432 HIS A CD2   
1406 C  CE1   . HIS A 88 ? 0.4172 0.3305 0.3711 -0.0230 0.0343  -0.0018 432 HIS A CE1   
1407 N  NE2   . HIS A 88 ? 0.4037 0.3083 0.3574 -0.0204 0.0427  0.0096  432 HIS A NE2   
1415 N  N     . ASN A 89 ? 0.3870 0.3493 0.2924 0.0809  0.0209  0.0202  433 ASN A N     
1416 C  CA    . ASN A 89 ? 0.4122 0.3948 0.3130 0.1074  0.0133  0.0312  433 ASN A CA    
1417 C  C     . ASN A 89 ? 0.5238 0.5075 0.3996 0.1106  0.0107  0.0527  433 ASN A C     
1418 O  O     . ASN A 89 ? 0.4998 0.4729 0.3647 0.1339  0.0066  0.0750  433 ASN A O     
1419 C  CB    . ASN A 89 ? 0.3886 0.4319 0.3028 0.1082  0.0038  0.0166  433 ASN A CB    
1420 C  CG    . ASN A 89 ? 0.4510 0.5004 0.3858 0.1101  0.0074  -0.0015 433 ASN A CG    
1421 O  OD1   . ASN A 89 ? 0.5349 0.5435 0.4733 0.1171  0.0163  -0.0042 433 ASN A OD1   
1422 N  ND2   . ASN A 89 ? 0.5181 0.6191 0.4631 0.0996  0.0024  -0.0163 433 ASN A ND2   
1429 N  N     . MET A 90 ? 0.4373 0.4310 0.3023 0.0878  0.0147  0.0473  434 MET A N     
1430 C  CA    . MET A 90 ? 0.5226 0.5252 0.3576 0.0848  0.0148  0.0628  434 MET A CA    
1431 C  C     . MET A 90 ? 0.4991 0.4520 0.3165 0.0851  0.0252  0.0850  434 MET A C     
1432 O  O     . MET A 90 ? 0.5805 0.5330 0.3681 0.0923  0.0219  0.1092  434 MET A O     
1433 C  CB    . MET A 90 ? 0.6188 0.6423 0.4486 0.0600  0.0219  0.0438  434 MET A CB    
1434 C  CG    . MET A 90 ? 0.7818 0.8087 0.5772 0.0497  0.0295  0.0536  434 MET A CG    
1435 S  SD    . MET A 90 ? 0.7496 0.7327 0.5421 0.0372  0.0511  0.0625  434 MET A SD    
1436 C  CE    . MET A 90 ? 0.7347 0.7163 0.5691 0.0253  0.0611  0.0347  434 MET A CE    
1446 N  N     . HIS A 91 ? 0.5076 0.4215 0.3395 0.0731  0.0374  0.0788  435 HIS A N     
1447 C  CA    . HIS A 91 ? 0.5943 0.4615 0.4089 0.0652  0.0497  0.0978  435 HIS A CA    
1448 C  C     . HIS A 91 ? 0.7491 0.5773 0.5470 0.0895  0.0451  0.1233  435 HIS A C     
1449 O  O     . HIS A 91 ? 0.7541 0.5478 0.5228 0.0868  0.0516  0.1493  435 HIS A O     
1450 C  CB    . HIS A 91 ? 0.5355 0.3754 0.3723 0.0457  0.0609  0.0849  435 HIS A CB    
1451 C  CG    . HIS A 91 ? 0.5319 0.3972 0.3823 0.0224  0.0711  0.0737  435 HIS A CG    
1452 N  ND1   . HIS A 91 ? 0.5409 0.4041 0.3748 0.0071  0.0856  0.0846  435 HIS A ND1   
1453 C  CD2   . HIS A 91 ? 0.5015 0.3950 0.3830 0.0139  0.0703  0.0544  435 HIS A CD2   
1454 C  CE1   . HIS A 91 ? 0.6412 0.5351 0.5011 -0.0068 0.0948  0.0691  435 HIS A CE1   
1455 N  NE2   . HIS A 91 ? 0.4533 0.3630 0.3429 -0.0012 0.0844  0.0529  435 HIS A NE2   
1463 N  N     . GLN A 92 ? 0.6127 0.4438 0.4297 0.1138  0.0359  0.1168  436 GLN A N     
1464 C  CA    . GLN A 92 ? 1.2660 1.0569 1.0760 0.1455  0.0334  0.1399  436 GLN A CA    
1465 C  C     . GLN A 92 ? 1.4391 1.2723 1.2345 0.1698  0.0160  0.1661  436 GLN A C     
1466 O  O     . GLN A 92 ? 1.1776 0.9839 0.9648 0.1802  0.0128  0.1900  436 GLN A O     
1467 C  CB    . GLN A 92 ? 0.8092 0.5938 0.6503 0.1630  0.0342  0.1180  436 GLN A CB    
1468 C  CG    . GLN A 92 ? 1.3645 1.1144 1.2100 0.1969  0.0338  0.1350  436 GLN A CG    
1469 C  CD    . GLN A 92 ? 1.4320 1.1643 1.3051 0.2087  0.0426  0.1082  436 GLN A CD    
1470 O  OE1   . GLN A 92 ? 1.7326 1.4750 1.6152 0.1910  0.0486  0.0795  436 GLN A OE1   
1471 N  NE2   . GLN A 92 ? 0.9284 0.6388 0.8159 0.2344  0.0435  0.1151  436 GLN A NE2   
1480 N  N     . ARG A 93 ? 0.5944 0.5109 0.5988 0.1466  -0.0141 0.1392  437 ARG A N     
1481 C  CA    . ARG A 93 ? 0.6190 0.5742 0.7148 0.1287  -0.0054 0.1315  437 ARG A CA    
1482 C  C     . ARG A 93 ? 0.6328 0.6038 0.7940 0.1167  0.0214  0.1040  437 ARG A C     
1483 O  O     . ARG A 93 ? 0.6428 0.6166 0.8506 0.1098  0.0434  0.0721  437 ARG A O     
1484 C  CB    . ARG A 93 ? 0.6294 0.5894 0.7194 0.1244  0.0004  0.1406  437 ARG A CB    
1487 O  "O5'" . DA  B 1  ? 0.8909 0.8316 0.6029 -0.1136 0.0791  0.0981  1   DA  B "O5'" 
1488 C  "C5'" . DA  B 1  ? 0.5429 0.5232 0.2499 -0.1106 0.1001  0.1009  1   DA  B "C5'" 
1489 C  "C4'" . DA  B 1  ? 0.6761 0.6805 0.3932 -0.0954 0.1167  0.0802  1   DA  B "C4'" 
1490 O  "O4'" . DA  B 1  ? 0.6101 0.5940 0.3022 -0.0824 0.1105  0.0603  1   DA  B "O4'" 
1491 C  "C3'" . DA  B 1  ? 0.5730 0.5805 0.3290 -0.0962 0.1169  0.0755  1   DA  B "C3'" 
1492 O  "O3'" . DA  B 1  ? 0.6038 0.6515 0.3815 -0.0886 0.1377  0.0677  1   DA  B "O3'" 
1493 C  "C2'" . DA  B 1  ? 0.5805 0.5545 0.3283 -0.0884 0.1044  0.0585  1   DA  B "C2'" 
1494 C  "C1'" . DA  B 1  ? 0.5070 0.4758 0.2180 -0.0761 0.1062  0.0454  1   DA  B "C1'" 
1495 N  N9    . DA  B 1  ? 0.5738 0.4985 0.2641 -0.0719 0.0870  0.0387  1   DA  B N9    
1496 C  C8    . DA  B 1  ? 0.6215 0.5290 0.3056 -0.0554 0.0813  0.0181  1   DA  B C8    
1497 N  N7    . DA  B 1  ? 0.5316 0.4010 0.2038 -0.0538 0.0612  0.0188  1   DA  B N7    
1498 C  C5    . DA  B 1  ? 0.5560 0.4141 0.2228 -0.0709 0.0544  0.0394  1   DA  B C5    
1499 C  C6    . DA  B 1  ? 0.4930 0.3152 0.1520 -0.0767 0.0339  0.0483  1   DA  B C6    
1500 N  N6    . DA  B 1  ? 0.6128 0.4020 0.2623 -0.0669 0.0180  0.0397  1   DA  B N6    
1501 N  N1    . DA  B 1  ? 0.5846 0.4068 0.2513 -0.0920 0.0288  0.0661  1   DA  B N1    
1502 C  C2    . DA  B 1  ? 0.5765 0.4323 0.2564 -0.1007 0.0427  0.0762  1   DA  B C2    
1503 N  N3    . DA  B 1  ? 0.6396 0.5322 0.3281 -0.0964 0.0629  0.0713  1   DA  B N3    
1504 C  C4    . DA  B 1  ? 0.5417 0.4340 0.2226 -0.0814 0.0683  0.0517  1   DA  B C4    
1517 P  P     . DG  B 2  ? 0.5538 0.6174 0.3794 -0.0920 0.1408  0.0685  2   DG  B P     
1518 O  OP1   . DG  B 2  ? 0.5452 0.6520 0.3854 -0.0863 0.1631  0.0675  2   DG  B OP1   
1519 O  OP2   . DG  B 2  ? 0.6097 0.6521 0.4503 -0.1064 0.1245  0.0856  2   DG  B OP2   
1520 O  "O5'" . DG  B 2  ? 0.5197 0.5682 0.3520 -0.0827 0.1356  0.0470  2   DG  B "O5'" 
1521 C  "C5'" . DG  B 2  ? 0.6686 0.7365 0.5045 -0.0658 0.1480  0.0243  2   DG  B "C5'" 
1522 C  "C4'" A DG  B 2  ? 0.5220 0.5683 0.3807 -0.0517 0.1312  0.0078  2   DG  B "C4'" 
1523 C  "C4'" B DG  B 2  ? 0.5245 0.5716 0.3858 -0.0527 0.1311  0.0088  2   DG  B "C4'" 
1524 O  "O4'" A DG  B 2  ? 0.4364 0.4419 0.2648 -0.0489 0.1140  0.0054  2   DG  B "O4'" 
1525 O  "O4'" B DG  B 2  ? 0.4629 0.4696 0.2940 -0.0487 0.1141  0.0052  2   DG  B "O4'" 
1526 C  "C3'" A DG  B 2  ? 0.4315 0.4771 0.3301 -0.0600 0.1223  0.0157  2   DG  B "C3'" 
1527 C  "C3'" B DG  B 2  ? 0.4179 0.4631 0.3163 -0.0631 0.1222  0.0189  2   DG  B "C3'" 
1528 O  "O3'" A DG  B 2  ? 0.3017 0.3593 0.2367 -0.0455 0.1190  0.0002  2   DG  B "O3'" 
1529 O  "O3'" B DG  B 2  ? 0.4611 0.5236 0.4017 -0.0512 0.1208  0.0061  2   DG  B "O3'" 
1530 C  "C2'" A DG  B 2  ? 0.3848 0.3899 0.2646 -0.0661 0.1034  0.0216  2   DG  B "C2'" 
1531 C  "C2'" B DG  B 2  ? 0.3961 0.4000 0.2764 -0.0667 0.1026  0.0222  2   DG  B "C2'" 
1532 C  "C1'" A DG  B 2  ? 0.3913 0.3759 0.2409 -0.0518 0.0977  0.0083  2   DG  B "C1'" 
1533 C  "C1'" B DG  B 2  ? 0.4306 0.4154 0.2812 -0.0520 0.0976  0.0084  2   DG  B "C1'" 
1534 N  N9    . DG  B 2  ? 0.4215 0.3700 0.2399 -0.0571 0.0844  0.0150  2   DG  B N9    
1535 C  C8    . DG  B 2  ? 0.4318 0.3667 0.2312 -0.0740 0.0818  0.0326  2   DG  B C8    
1536 N  N7    . DG  B 2  ? 0.4604 0.3611 0.2364 -0.0734 0.0672  0.0335  2   DG  B N7    
1537 C  C5    . DG  B 2  ? 0.4578 0.3509 0.2361 -0.0555 0.0610  0.0164  2   DG  B C5    
1538 C  C6    . DG  B 2  ? 0.4344 0.2963 0.1978 -0.0470 0.0449  0.0105  2   DG  B C6    
1539 O  O6    . DG  B 2  ? 0.4682 0.3019 0.2128 -0.0527 0.0331  0.0183  2   DG  B O6    
1540 N  N1    . DG  B 2  ? 0.4676 0.3326 0.2442 -0.0303 0.0409  -0.0053 2   DG  B N1    
1541 C  C2    . DG  B 2  ? 0.4302 0.3231 0.2325 -0.0222 0.0498  -0.0155 2   DG  B C2    
1542 N  N2    . DG  B 2  ? 0.4774 0.3661 0.2926 -0.0065 0.0400  -0.0297 2   DG  B N2    
1543 N  N3    . DG  B 2  ? 0.4229 0.3450 0.2407 -0.0289 0.0651  -0.0114 2   DG  B N3    
1544 C  C4    . DG  B 2  ? 0.4255 0.3468 0.2293 -0.0458 0.0706  0.0051  2   DG  B C4    
1563 P  P     . DC  B 3  ? 0.3985 0.4599 0.3777 -0.0519 0.1081  0.0062  3   DC  B P     
1564 O  OP1   . DC  B 3  ? 0.5737 0.6641 0.5931 -0.0394 0.1134  -0.0062 3   DC  B OP1   
1565 O  OP2   . DC  B 3  ? 0.3932 0.4549 0.3730 -0.0729 0.1088  0.0264  3   DC  B OP2   
1566 O  "O5'" . DC  B 3  ? 0.3345 0.3644 0.3074 -0.0455 0.0883  0.0001  3   DC  B "O5'" 
1567 C  "C5'" . DC  B 3  ? 0.3929 0.4161 0.3682 -0.0275 0.0812  -0.0166 3   DC  B "C5'" 
1568 C  "C4'" . DC  B 3  ? 0.3817 0.3758 0.3474 -0.0260 0.0635  -0.0160 3   DC  B "C4'" 
1569 O  "O4'" . DC  B 3  ? 0.3855 0.3546 0.3078 -0.0313 0.0635  -0.0108 3   DC  B "O4'" 
1570 C  "C3'" . DC  B 3  ? 0.3556 0.3508 0.3452 -0.0372 0.0537  -0.0049 3   DC  B "C3'" 
1571 O  "O3'" . DC  B 3  ? 0.2849 0.2728 0.2904 -0.0290 0.0384  -0.0093 3   DC  B "O3'" 
1572 C  "C2'" . DC  B 3  ? 0.3399 0.3142 0.2968 -0.0488 0.0537  0.0045  3   DC  B "C2'" 
1573 C  "C1'" . DC  B 3  ? 0.4174 0.3699 0.3416 -0.0385 0.0518  -0.0033 3   DC  B "C1'" 
1574 N  N1    . DC  B 3  ? 0.3887 0.3165 0.2777 -0.0466 0.0504  0.0041  3   DC  B N1    
1575 C  C2    . DC  B 3  ? 0.3761 0.2770 0.2442 -0.0388 0.0394  -0.0006 3   DC  B C2    
1576 O  O2    . DC  B 3  ? 0.3856 0.2848 0.2634 -0.0258 0.0321  -0.0101 3   DC  B O2    
1577 N  N3    . DC  B 3  ? 0.4044 0.2816 0.2464 -0.0458 0.0350  0.0062  3   DC  B N3    
1578 C  C4    . DC  B 3  ? 0.4043 0.2822 0.2395 -0.0605 0.0399  0.0174  3   DC  B C4    
1579 N  N4    . DC  B 3  ? 0.4433 0.2947 0.2561 -0.0670 0.0318  0.0240  3   DC  B N4    
1580 C  C5    . DC  B 3  ? 0.4229 0.3280 0.2778 -0.0695 0.0509  0.0232  3   DC  B C5    
1581 C  C6    . DC  B 3  ? 0.3449 0.2749 0.2266 -0.0619 0.0564  0.0161  3   DC  B C6    
1593 P  P     . DG  B 4  ? 0.3084 0.3137 0.3571 -0.0335 0.0271  -0.0028 4   DG  B P     
1594 O  OP1   . DG  B 4  ? 0.3318 0.3594 0.4168 -0.0271 0.0287  -0.0086 4   DG  B OP1   
1595 O  OP2   . DG  B 4  ? 0.3372 0.3448 0.3816 -0.0502 0.0281  0.0098  4   DG  B OP2   
1596 O  "O5'" . DG  B 4  ? 0.2989 0.2888 0.3476 -0.0251 0.0111  -0.0052 4   DG  B "O5'" 
1597 C  "C5'" . DG  B 4  ? 0.3801 0.3588 0.4277 -0.0089 0.0043  -0.0177 4   DG  B "C5'" 
1598 C  "C4'" . DG  B 4  ? 0.3205 0.2787 0.3554 -0.0045 -0.0085 -0.0164 4   DG  B "C4'" 
1599 O  "O4'" . DG  B 4  ? 0.3493 0.2867 0.3417 -0.0069 -0.0008 -0.0167 4   DG  B "O4'" 
1600 C  "C3'" . DG  B 4  ? 0.2807 0.2495 0.3371 -0.0131 -0.0182 -0.0032 4   DG  B "C3'" 
1601 O  "O3'" . DG  B 4  ? 0.3433 0.3050 0.4122 -0.0055 -0.0344 -0.0022 4   DG  B "O3'" 
1602 C  "C2'" . DG  B 4  ? 0.2814 0.2409 0.3063 -0.0221 -0.0088 0.0010  4   DG  B "C2'" 
1603 C  "C1'" . DG  B 4  ? 0.3090 0.2425 0.2982 -0.0144 -0.0045 -0.0078 4   DG  B "C1'" 
1604 N  N9    . DG  B 4  ? 0.3433 0.2662 0.3024 -0.0231 0.0062  -0.0053 4   DG  B N9    
1605 C  C8    . DG  B 4  ? 0.3444 0.2778 0.3002 -0.0334 0.0179  -0.0016 4   DG  B C8    
1606 N  N7    . DG  B 4  ? 0.4164 0.3339 0.3454 -0.0409 0.0219  0.0019  4   DG  B N7    
1607 C  C5    . DG  B 4  ? 0.3564 0.2521 0.2713 -0.0341 0.0127  -0.0011 4   DG  B C5    
1608 C  C6    . DG  B 4  ? 0.3209 0.1916 0.2108 -0.0368 0.0096  0.0000  4   DG  B C6    
1609 O  O6    . DG  B 4  ? 0.3707 0.2325 0.2455 -0.0465 0.0129  0.0044  4   DG  B O6    
1610 N  N1    . DG  B 4  ? 0.3635 0.2191 0.2518 -0.0270 -0.0009 -0.0038 4   DG  B N1    
1611 C  C2    . DG  B 4  ? 0.3588 0.2222 0.2660 -0.0170 -0.0080 -0.0065 4   DG  B C2    
1612 N  N2    . DG  B 4  ? 0.4266 0.2744 0.3322 -0.0093 -0.0184 -0.0079 4   DG  B N2    
1613 N  N3    . DG  B 4  ? 0.3696 0.2540 0.2997 -0.0149 -0.0072 -0.0071 4   DG  B N3    
1614 C  C4    . DG  B 4  ? 0.3417 0.2414 0.2745 -0.0234 0.0038  -0.0050 4   DG  B C4    
1626 P  P     A DT  B 5  ? 0.2500 0.2321 0.3524 -0.0129 -0.0474 0.0131  5   DT  B P     
1627 P  P     B DT  B 5  ? 0.3144 0.2962 0.4162 -0.0129 -0.0474 0.0131  5   DT  B P     
1628 O  OP1   A DT  B 5  ? 0.2479 0.2238 0.3735 -0.0030 -0.0669 0.0133  5   DT  B OP1   
1629 O  OP1   B DT  B 5  ? 0.3874 0.3607 0.5088 -0.0023 -0.0661 0.0124  5   DT  B OP1   
1630 O  OP2   A DT  B 5  ? 0.1963 0.2032 0.3216 -0.0245 -0.0446 0.0210  5   DT  B OP2   
1631 O  OP2   B DT  B 5  ? 0.2733 0.2800 0.3995 -0.0242 -0.0454 0.0213  5   DT  B OP2   
1632 O  "O5'" A DT  B 5  ? 0.2614 0.2394 0.3379 -0.0183 -0.0410 0.0178  5   DT  B "O5'" 
1633 O  "O5'" B DT  B 5  ? 0.3401 0.3183 0.4162 -0.0186 -0.0405 0.0178  5   DT  B "O5'" 
1634 C  "C5'" A DT  B 5  ? 0.2142 0.1686 0.2684 -0.0094 -0.0432 0.0123  5   DT  B "C5'" 
1635 C  "C5'" B DT  B 5  ? 0.3554 0.3139 0.4150 -0.0102 -0.0449 0.0145  5   DT  B "C5'" 
1636 C  "C4'" A DT  B 5  ? 0.3569 0.3101 0.3913 -0.0142 -0.0357 0.0143  5   DT  B "C4'" 
1637 C  "C4'" B DT  B 5  ? 0.3932 0.3506 0.4313 -0.0153 -0.0361 0.0158  5   DT  B "C4'" 
1638 O  "O4'" A DT  B 5  ? 0.2951 0.2329 0.2980 -0.0181 -0.0228 0.0074  5   DT  B "O4'" 
1639 O  "O4'" B DT  B 5  ? 0.3416 0.2827 0.3483 -0.0186 -0.0233 0.0083  5   DT  B "O4'" 
1640 C  "C3'" A DT  B 5  ? 0.1498 0.1335 0.2004 -0.0248 -0.0339 0.0243  5   DT  B "C3'" 
1641 C  "C3'" B DT  B 5  ? 0.3539 0.3420 0.4067 -0.0265 -0.0336 0.0256  5   DT  B "C3'" 
1642 O  "O3'" A DT  B 5  ? 0.1363 0.1245 0.1838 -0.0223 -0.0346 0.0260  5   DT  B "O3'" 
1643 O  "O3'" B DT  B 5  ? 0.3604 0.3551 0.4111 -0.0244 -0.0343 0.0279  5   DT  B "O3'" 
1644 C  "C2'" A DT  B 5  ? 0.2675 0.2502 0.2984 -0.0342 -0.0213 0.0205  5   DT  B "C2'" 
1645 C  "C2'" B DT  B 5  ? 0.3103 0.2951 0.3415 -0.0352 -0.0209 0.0210  5   DT  B "C2'" 
1646 C  "C1'" A DT  B 5  ? 0.1949 0.1455 0.1941 -0.0277 -0.0164 0.0104  5   DT  B "C1'" 
1647 C  "C1'" B DT  B 5  ? 0.4056 0.3574 0.4059 -0.0279 -0.0165 0.0107  5   DT  B "C1'" 
1648 N  N1    . DT  B 5  ? 0.2985 0.2384 0.2756 -0.0350 -0.0064 0.0068  5   DT  B N1    
1649 C  C2    . DT  B 5  ? 0.2778 0.1930 0.2275 -0.0339 -0.0041 0.0014  5   DT  B C2    
1650 O  O2    . DT  B 5  ? 0.3323 0.2349 0.2769 -0.0262 -0.0094 -0.0018 5   DT  B O2    
1651 N  N3    . DT  B 5  ? 0.2887 0.1952 0.2222 -0.0425 0.0024  0.0014  5   DT  B N3    
1652 C  C4    . DT  B 5  ? 0.3049 0.2261 0.2463 -0.0517 0.0087  0.0061  5   DT  B C4    
1653 O  O4    . DT  B 5  ? 0.3509 0.2643 0.2790 -0.0601 0.0136  0.0082  5   DT  B O4    
1654 C  C5    . DT  B 5  ? 0.2843 0.2311 0.2551 -0.0511 0.0071  0.0099  5   DT  B C5    
1655 C  C7    . DT  B 5  ? 0.3336 0.2979 0.3198 -0.0598 0.0127  0.0149  5   DT  B C7    
1656 C  C6    . DT  B 5  ? 0.2994 0.2533 0.2866 -0.0431 -0.0012 0.0103  5   DT  B C6    
1676 P  P     A DG  B 6  ? 0.3992 0.4167 0.4805 -0.0230 -0.0456 0.0403  6   DG  B P     
1677 P  P     B DG  B 6  ? 0.1863 0.2202 0.2652 -0.0311 -0.0396 0.0427  6   DG  B P     
1678 O  OP1   A DG  B 6  ? 0.6089 0.6094 0.7042 -0.0126 -0.0596 0.0412  6   DG  B OP1   
1679 O  OP1   B DG  B 6  ? 0.1308 0.1688 0.2425 -0.0270 -0.0562 0.0529  6   DG  B OP1   
1680 O  OP2   A DG  B 6  ? 0.2659 0.3142 0.3674 -0.0358 -0.0471 0.0520  6   DG  B OP2   
1681 O  OP2   B DG  B 6  ? 0.2117 0.2694 0.2915 -0.0449 -0.0342 0.0480  6   DG  B OP2   
1682 O  "O5'" A DG  B 6  ? 0.1831 0.2132 0.2552 -0.0215 -0.0384 0.0391  6   DG  B "O5'" 
1683 O  "O5'" B DG  B 6  ? 0.4734 0.5115 0.5365 -0.0268 -0.0318 0.0371  6   DG  B "O5'" 
1684 C  "C5'" A DG  B 6  ? 0.1867 0.2208 0.2349 -0.0260 -0.0255 0.0303  6   DG  B "C5'" 
1685 C  "C5'" B DG  B 6  ? 0.6602 0.6749 0.7167 -0.0142 -0.0345 0.0302  6   DG  B "C5'" 
1686 C  "C4'" A DG  B 6  ? 0.1379 0.1447 0.1654 -0.0153 -0.0218 0.0167  6   DG  B "C4'" 
1687 C  "C4'" B DG  B 6  ? 0.4309 0.4257 0.4581 -0.0099 -0.0248 0.0150  6   DG  B "C4'" 
1688 O  "O4'" A DG  B 6  ? 0.2256 0.1958 0.2316 -0.0140 -0.0215 0.0088  6   DG  B "O4'" 
1689 O  "O4'" B DG  B 6  ? 0.3501 0.3154 0.3538 -0.0126 -0.0219 0.0075  6   DG  B "O4'" 
1690 C  "C3'" A DG  B 6  ? 0.1602 0.1739 0.1709 -0.0149 -0.0121 0.0055  6   DG  B "C3'" 
1691 C  "C3'" B DG  B 6  ? 0.4776 0.4943 0.4946 -0.0146 -0.0142 0.0089  6   DG  B "C3'" 
1692 O  "O3'" A DG  B 6  ? 0.1899 0.2292 0.2166 -0.0082 -0.0112 0.0076  6   DG  B "O3'" 
1693 O  "O3'" B DG  B 6  ? 0.4916 0.5340 0.5219 -0.0080 -0.0119 0.0093  6   DG  B "O3'" 
1694 C  "C2'" A DG  B 6  ? 0.1819 0.1528 0.1687 -0.0087 -0.0122 -0.0079 6   DG  B "C2'" 
1695 C  "C2'" B DG  B 6  ? 0.4449 0.4253 0.4330 -0.0117 -0.0105 -0.0066 6   DG  B "C2'" 
1696 C  "C1'" A DG  B 6  ? 0.2071 0.1578 0.1882 -0.0132 -0.0155 -0.0032 6   DG  B "C1'" 
1697 C  "C1'" B DG  B 6  ? 0.4037 0.3558 0.3843 -0.0135 -0.0149 -0.0037 6   DG  B "C1'" 
1698 N  N9    . DG  B 6  ? 0.3002 0.2491 0.2676 -0.0244 -0.0096 -0.0044 6   DG  B N9    
1699 C  C8    . DG  B 6  ? 0.3329 0.2991 0.3120 -0.0334 -0.0089 0.0042  6   DG  B C8    
1700 N  N7    . DG  B 6  ? 0.3328 0.2926 0.2990 -0.0423 -0.0042 0.0024  6   DG  B N7    
1701 C  C5    . DG  B 6  ? 0.2939 0.2286 0.2373 -0.0396 -0.0029 -0.0077 6   DG  B C5    
1702 C  C6    . DG  B 6  ? 0.2844 0.2010 0.2089 -0.0472 -0.0011 -0.0121 6   DG  B C6    
1703 O  O6    . DG  B 6  ? 0.3261 0.2467 0.2494 -0.0585 0.0016  -0.0072 6   DG  B O6    
1704 N  N1    . DG  B 6  ? 0.3333 0.2238 0.2426 -0.0410 -0.0047 -0.0221 6   DG  B N1    
1705 C  C2    . DG  B 6  ? 0.3256 0.2104 0.2391 -0.0282 -0.0083 -0.0278 6   DG  B C2    
1706 N  N2    . DG  B 6  ? 0.4082 0.2663 0.3103 -0.0232 -0.0134 -0.0378 6   DG  B N2    
1707 N  N3    . DG  B 6  ? 0.3076 0.2113 0.2389 -0.0213 -0.0088 -0.0229 6   DG  B N3    
1708 C  C4    . DG  B 6  ? 0.2995 0.2270 0.2443 -0.0280 -0.0065 -0.0127 6   DG  B C4    
1727 P  P     . DG  B 7  ? 0.2768 0.3536 0.2987 -0.0109 -0.0003 0.0021  7   DG  B P     
1728 O  OP1   . DG  B 7  ? 0.2691 0.3735 0.3154 -0.0022 -0.0002 0.0081  7   DG  B OP1   
1729 O  OP2   . DG  B 7  ? 0.2880 0.3863 0.3043 -0.0265 0.0020  0.0093  7   DG  B OP2   
1730 O  "O5'" . DG  B 7  ? 0.3186 0.3633 0.3125 -0.0038 0.0045  -0.0214 7   DG  B "O5'" 
1731 C  "C5'" . DG  B 7  ? 0.3171 0.3361 0.3126 0.0105  0.0014  -0.0319 7   DG  B "C5'" 
1732 C  "C4'" . DG  B 7  ? 0.3377 0.3273 0.3098 0.0143  0.0026  -0.0525 7   DG  B "C4'" 
1733 O  "O4'" . DG  B 7  ? 0.4466 0.4049 0.4001 0.0039  -0.0015 -0.0500 7   DG  B "O4'" 
1734 C  "C3'" . DG  B 7  ? 0.5119 0.5295 0.4735 0.0137  0.0119  -0.0666 7   DG  B "C3'" 
1735 O  "O3'" . DG  B 7  ? 0.3958 0.4057 0.3578 0.0288  0.0130  -0.0872 7   DG  B "O3'" 
1736 C  "C2'" . DG  B 7  ? 0.6962 0.6945 0.6341 0.0008  0.0100  -0.0695 7   DG  B "C2'" 
1737 C  "C1'" . DG  B 7  ? 0.6625 0.6195 0.5972 -0.0027 0.0016  -0.0611 7   DG  B "C1'" 
1738 N  N9    . DG  B 7  ? 0.4255 0.3841 0.3535 -0.0183 0.0018  -0.0495 7   DG  B N9    
1739 C  C8    . DG  B 7  ? 0.3173 0.3024 0.2595 -0.0264 0.0033  -0.0328 7   DG  B C8    
1740 N  N7    . DG  B 7  ? 0.3139 0.2950 0.2501 -0.0389 0.0028  -0.0266 7   DG  B N7    
1741 C  C5    . DG  B 7  ? 0.3320 0.2836 0.2478 -0.0402 0.0010  -0.0385 7   DG  B C5    
1742 C  C6    . DG  B 7  ? 0.3221 0.2590 0.2265 -0.0525 -0.0009 -0.0367 7   DG  B C6    
1743 O  O6    . DG  B 7  ? 0.4167 0.3654 0.3277 -0.0639 0.0002  -0.0248 7   DG  B O6    
1744 N  N1    . DG  B 7  ? 0.3892 0.2947 0.2771 -0.0507 -0.0061 -0.0495 7   DG  B N1    
1745 C  C2    . DG  B 7  ? 0.4613 0.3510 0.3456 -0.0374 -0.0093 -0.0640 7   DG  B C2    
1746 N  N2    . DG  B 7  ? 0.4959 0.3533 0.3679 -0.0378 -0.0178 -0.0748 7   DG  B N2    
1747 N  N3    . DG  B 7  ? 0.4768 0.3821 0.3727 -0.0248 -0.0060 -0.0672 7   DG  B N3    
1748 C  C4    . DG  B 7  ? 0.4299 0.3660 0.3406 -0.0276 -0.0007 -0.0529 7   DG  B C4    
1760 P  P     . DG  B 8  ? 0.4461 0.4866 0.3971 0.0338  0.0231  -0.1081 8   DG  B P     
1761 O  OP1   . DG  B 8  ? 0.4669 0.4989 0.4309 0.0538  0.0227  -0.1275 8   DG  B OP1   
1762 O  OP2   . DG  B 8  ? 0.5619 0.6594 0.5164 0.0249  0.0336  -0.0955 8   DG  B OP2   
1763 O  "O5'" . DG  B 8  ? 0.4987 0.5079 0.4200 0.0238  0.0176  -0.1197 8   DG  B "O5'" 
1764 C  "C5'" . DG  B 8  ? 0.4440 0.4010 0.3574 0.0294  0.0059  -0.1343 8   DG  B "C5'" 
1765 C  "C4'" . DG  B 8  ? 0.5442 0.4802 0.4333 0.0176  0.0000  -0.1417 8   DG  B "C4'" 
1766 O  "O4'" . DG  B 8  ? 0.5638 0.4963 0.4491 -0.0004 -0.0013 -0.1183 8   DG  B "O4'" 
1767 C  "C3'" . DG  B 8  ? 0.6317 0.6000 0.5048 0.0167  0.0071  -0.1577 8   DG  B "C3'" 
1768 O  "O3'" . DG  B 8  ? 0.6347 0.5776 0.5003 0.0268  0.0007  -0.1796 8   DG  B "O3'" 
1769 C  "C2'" . DG  B 8  ? 0.6539 0.6236 0.5124 -0.0047 0.0047  -0.1423 8   DG  B "C2'" 
1770 C  "C1'" . DG  B 8  ? 0.7308 0.6699 0.5986 -0.0130 -0.0019 -0.1211 8   DG  B "C1'" 
1771 N  N9    . DG  B 8  ? 0.5231 0.4856 0.3958 -0.0283 0.0023  -0.0976 8   DG  B N9    
1772 C  C8    . DG  B 8  ? 0.4845 0.4843 0.3739 -0.0290 0.0097  -0.0819 8   DG  B C8    
1773 N  N7    . DG  B 8  ? 0.3646 0.3766 0.2589 -0.0439 0.0091  -0.0630 8   DG  B N7    
1774 C  C5    . DG  B 8  ? 0.3620 0.3453 0.2416 -0.0534 0.0028  -0.0664 8   DG  B C5    
1775 C  C6    . DG  B 8  ? 0.3686 0.3524 0.2495 -0.0698 -0.0003 -0.0521 8   DG  B C6    
1776 O  O6    . DG  B 8  ? 0.3781 0.3855 0.2746 -0.0784 0.0013  -0.0344 8   DG  B O6    
1777 N  N1    . DG  B 8  ? 0.3690 0.3220 0.2358 -0.0761 -0.0074 -0.0589 8   DG  B N1    
1778 C  C2    . DG  B 8  ? 0.3872 0.3091 0.2401 -0.0680 -0.0135 -0.0776 8   DG  B C2    
1779 N  N2    . DG  B 8  ? 0.4285 0.3224 0.2723 -0.0780 -0.0233 -0.0786 8   DG  B N2    
1780 N  N3    . DG  B 8  ? 0.4675 0.3864 0.3197 -0.0513 -0.0118 -0.0935 8   DG  B N3    
1781 C  C4    . DG  B 8  ? 0.3927 0.3454 0.2584 -0.0448 -0.0022 -0.0867 8   DG  B C4    
1793 P  P     . DG  B 9  ? 0.6247 0.5911 0.4723 0.0284  0.0061  -0.1951 9   DG  B P     
1794 O  OP1   . DG  B 9  ? 0.6881 0.6261 0.5411 0.0426  -0.0003 -0.2139 9   DG  B OP1   
1795 O  OP2   . DG  B 9  ? 0.7180 0.7462 0.5676 0.0293  0.0225  -0.1915 9   DG  B OP2   
1796 O  "O5'" . DG  B 9  ? 0.5489 0.4950 0.3733 0.0088  -0.0039 -0.1883 9   DG  B "O5'" 
1797 C  "C5'" . DG  B 9  ? 0.7853 0.6789 0.6067 0.0026  -0.0190 -0.1882 9   DG  B "C5'" 
1798 C  "C4'" . DG  B 9  ? 0.6628 0.5452 0.4652 -0.0164 -0.0281 -0.1809 9   DG  B "C4'" 
1799 O  "O4'" . DG  B 9  ? 0.7450 0.6439 0.5554 -0.0282 -0.0264 -0.1607 9   DG  B "O4'" 
1800 C  "C3'" . DG  B 9  ? 1.0618 0.9704 0.8431 -0.0183 -0.0262 -0.1894 9   DG  B "C3'" 
1801 O  "O3'" . DG  B 9  ? 1.1774 1.0584 0.9456 -0.0162 -0.0344 -0.2076 9   DG  B "O3'" 
1802 C  "C2'" . DG  B 9  ? 0.8083 0.7277 0.5882 -0.0373 -0.0321 -0.1711 9   DG  B "C2'" 
1803 C  "C1'" . DG  B 9  ? 0.9482 0.8587 0.7490 -0.0445 -0.0305 -0.1531 9   DG  B "C1'" 
1804 N  N9    . DG  B 9  ? 0.6932 0.6394 0.4989 -0.0588 -0.0190 -0.1324 9   DG  B N9    
1805 C  C8    . DG  B 9  ? 0.6260 0.6116 0.4418 -0.0534 -0.0054 -0.1259 9   DG  B C8    
1806 N  N7    . DG  B 9  ? 0.5162 0.5274 0.3428 -0.0671 -0.0019 -0.1013 9   DG  B N7    
1807 C  C5    . DG  B 9  ? 0.4717 0.4606 0.2929 -0.0828 -0.0119 -0.0936 9   DG  B C5    
1808 C  C6    . DG  B 9  ? 0.4829 0.4842 0.3157 -0.1003 -0.0138 -0.0700 9   DG  B C6    
1809 O  O6    . DG  B 9  ? 0.4522 0.4842 0.3025 -0.1053 -0.0087 -0.0513 9   DG  B O6    
1810 N  N1    . DG  B 9  ? 0.4896 0.4632 0.3162 -0.1125 -0.0248 -0.0685 9   DG  B N1    
1811 C  C2    . DG  B 9  ? 0.6579 0.5942 0.4700 -0.1085 -0.0347 -0.0861 9   DG  B C2    
1812 N  N2    . DG  B 9  ? 0.6319 0.5485 0.4476 -0.1208 -0.0453 -0.0769 9   DG  B N2    
1813 N  N3    . DG  B 9  ? 0.5535 0.4757 0.3589 -0.0897 -0.0349 -0.1078 9   DG  B N3    
1814 C  C4    . DG  B 9  ? 0.5349 0.4847 0.3418 -0.0792 -0.0224 -0.1124 9   DG  B C4    
1826 P  P     . DG  B 10 ? 0.9340 0.8283 0.6739 -0.0199 -0.0372 -0.2182 10  DG  B P     
1827 O  OP1   . DG  B 10 ? 1.1084 0.9663 0.8451 -0.0186 -0.0473 -0.2377 10  DG  B OP1   
1828 O  OP2   . DG  B 10 ? 0.7817 0.7320 0.5195 -0.0113 -0.0199 -0.2204 10  DG  B OP2   
1829 O  "O5'" . DG  B 10 ? 0.8713 0.7668 0.6057 -0.0380 -0.0497 -0.1985 10  DG  B "O5'" 
1830 C  "C5'" . DG  B 10 ? 0.7071 0.5678 0.4484 -0.0452 -0.0712 -0.1950 10  DG  B "C5'" 
1831 C  "C4'" . DG  B 10 ? 0.6108 0.5042 0.3692 -0.0657 -0.0718 -0.1779 10  DG  B "C4'" 
1832 O  "O4'" . DG  B 10 ? 0.6350 0.5570 0.3984 -0.0731 -0.0542 -0.1566 10  DG  B "O4'" 
1833 C  "C3'" . DG  B 10 ? 0.8701 0.7795 0.6063 -0.0741 -0.0768 -0.1798 10  DG  B "C3'" 
1834 O  "O3'" . DG  B 10 ? 1.2068 1.0958 0.9517 -0.0851 -0.0936 -0.1819 10  DG  B "O3'" 
1835 C  "C2'" . DG  B 10 ? 0.6576 0.6044 0.3983 -0.0929 -0.0630 -0.1512 10  DG  B "C2'" 
1836 C  "C1'" . DG  B 10 ? 0.6006 0.5452 0.3629 -0.0936 -0.0531 -0.1365 10  DG  B "C1'" 
1837 N  N9    . DG  B 10 ? 0.5864 0.5726 0.3549 -0.0975 -0.0369 -0.1213 10  DG  B N9    
1838 C  C8    . DG  B 10 ? 0.4664 0.4775 0.2350 -0.0828 -0.0234 -0.1293 10  DG  B C8    
1839 N  N7    . DG  B 10 ? 0.5014 0.5503 0.2827 -0.0914 -0.0132 -0.1092 10  DG  B N7    
1840 C  C5    . DG  B 10 ? 0.4324 0.4789 0.2214 -0.1123 -0.0208 -0.0879 10  DG  B C5    
1841 C  C6    . DG  B 10 ? 0.4069 0.4842 0.2135 -0.1285 -0.0187 -0.0607 10  DG  B C6    
1842 O  O6    . DG  B 10 ? 0.4262 0.5385 0.2457 -0.1278 -0.0106 -0.0486 10  DG  B O6    
1843 N  N1    . DG  B 10 ? 0.4403 0.5032 0.2545 -0.1459 -0.0293 -0.0457 10  DG  B N1    
1844 C  C2    . DG  B 10 ? 0.4654 0.4910 0.2710 -0.1484 -0.0399 -0.0540 10  DG  B C2    
1845 N  N2    . DG  B 10 ? 0.6106 0.6306 0.4303 -0.1650 -0.0481 -0.0349 10  DG  B N2    
1846 N  N3    . DG  B 10 ? 0.5836 0.5812 0.3726 -0.1345 -0.0437 -0.0781 10  DG  B N3    
1847 C  C4    . DG  B 10 ? 0.4390 0.4483 0.2203 -0.1164 -0.0340 -0.0948 10  DG  B C4    
1859 P  P     . DT  B 11 ? 1.0665 0.9614 0.7897 -0.0885 -0.1061 -0.1947 11  DT  B P     
1860 O  OP1   . DT  B 11 ? 1.0555 0.9214 0.7961 -0.0999 -0.1205 -0.1975 11  DT  B OP1   
1861 O  OP2   . DT  B 11 ? 0.8211 0.7147 0.5077 -0.0658 -0.1052 -0.2184 11  DT  B OP2   
1862 O  "O5'" . DT  B 11 ? 0.7700 0.6914 0.4883 -0.1115 -0.0994 -0.1629 11  DT  B "O5'" 
1863 C  "C5'" . DT  B 11 ? 0.6583 0.5700 0.3993 -0.1328 -0.1020 -0.1333 11  DT  B "C5'" 
1864 C  "C4'" . DT  B 11 ? 0.7753 0.7191 0.5176 -0.1519 -0.0961 -0.1069 11  DT  B "C4'" 
1865 O  "O4'" . DT  B 11 ? 0.7492 0.7239 0.4991 -0.1501 -0.0779 -0.0956 11  DT  B "O4'" 
1866 C  "C3'" . DT  B 11 ? 0.6494 0.6133 0.3672 -0.1552 -0.1014 -0.1146 11  DT  B "C3'" 
1867 O  "O3'" . DT  B 11 ? 0.6948 0.6555 0.4203 -0.1763 -0.1128 -0.0939 11  DT  B "O3'" 
1868 C  "C2'" . DT  B 11 ? 0.5794 0.5875 0.2914 -0.1534 -0.0835 -0.1077 11  DT  B "C2'" 
1869 C  "C1'" . DT  B 11 ? 0.5331 0.5468 0.2743 -0.1587 -0.0729 -0.0862 11  DT  B "C1'" 
1870 N  N1    . DT  B 11 ? 0.5433 0.5900 0.2871 -0.1497 -0.0558 -0.0854 11  DT  B N1    
1871 C  C2    . DT  B 11 ? 0.5024 0.5788 0.2684 -0.1626 -0.0487 -0.0586 11  DT  B C2    
1872 O  O2    . DT  B 11 ? 0.6151 0.6911 0.3978 -0.1800 -0.0556 -0.0362 11  DT  B O2    
1873 N  N3    . DT  B 11 ? 0.4721 0.5798 0.2432 -0.1536 -0.0349 -0.0581 11  DT  B N3    
1874 C  C4    . DT  B 11 ? 0.4321 0.5443 0.1893 -0.1330 -0.0256 -0.0807 11  DT  B C4    
1875 O  O4    . DT  B 11 ? 0.4452 0.5880 0.2122 -0.1264 -0.0135 -0.0763 11  DT  B O4    
1876 C  C5    . DT  B 11 ? 0.5077 0.5855 0.2415 -0.1190 -0.0329 -0.1093 11  DT  B C5    
1877 C  C7    . DT  B 11 ? 0.5091 0.5866 0.2293 -0.0950 -0.0244 -0.1356 11  DT  B C7    
1878 C  C6    . DT  B 11 ? 0.4937 0.5403 0.2220 -0.1279 -0.0486 -0.1106 11  DT  B C6    
1892 O  "O5'" . DT  C 1  ? 0.8095 0.6546 0.5073 -0.0653 0.1229  -0.0460 1   DT  C "O5'" 
1893 C  "C5'" . DT  C 1  ? 0.6525 0.4839 0.3211 -0.0653 0.1260  -0.0346 1   DT  C "C5'" 
1894 C  "C4'" . DT  C 1  ? 0.7328 0.5802 0.3789 -0.0615 0.1131  -0.0148 1   DT  C "C4'" 
1895 O  "O4'" . DT  C 1  ? 0.7448 0.5921 0.3732 -0.0773 0.1055  -0.0192 1   DT  C "O4'" 
1896 C  "C3'" . DT  C 1  ? 0.7018 0.5756 0.3615 -0.0531 0.1028  -0.0048 1   DT  C "C3'" 
1897 O  "O3'" . DT  C 1  ? 0.9142 0.7902 0.5789 -0.0350 0.1074  0.0086  1   DT  C "O3'" 
1898 C  "C2'" . DT  C 1  ? 0.6376 0.5312 0.2771 -0.0608 0.0867  0.0103  1   DT  C "C2'" 
1899 C  "C1'" . DT  C 1  ? 0.7238 0.5962 0.3485 -0.0795 0.0886  -0.0068 1   DT  C "C1'" 
1900 N  N1    . DT  C 1  ? 0.6856 0.5550 0.3204 -0.0925 0.0849  -0.0245 1   DT  C N1    
1901 C  C2    . DT  C 1  ? 0.6107 0.4935 0.2340 -0.1056 0.0677  -0.0184 1   DT  C C2    
1902 O  O2    . DT  C 1  ? 0.6820 0.5872 0.2932 -0.1072 0.0535  0.0022  1   DT  C O2    
1903 N  N3    . DT  C 1  ? 0.5846 0.4558 0.2143 -0.1161 0.0668  -0.0357 1   DT  C N3    
1904 C  C4    . DT  C 1  ? 0.6055 0.4593 0.2558 -0.1110 0.0810  -0.0561 1   DT  C C4    
1905 O  O4    . DT  C 1  ? 0.6035 0.4468 0.2584 -0.1168 0.0796  -0.0685 1   DT  C O4    
1906 C  C5    . DT  C 1  ? 0.6430 0.4941 0.3115 -0.0977 0.0962  -0.0593 1   DT  C C5    
1907 C  C7    . DT  C 1  ? 0.6560 0.5019 0.3550 -0.0919 0.1082  -0.0760 1   DT  C C7    
1908 C  C6    . DT  C 1  ? 0.6075 0.4625 0.2649 -0.0912 0.0976  -0.0448 1   DT  C C6    
1922 P  P     A DA  C 2  ? 1.3724 1.2795 1.0466 -0.0203 0.0983  0.0289  2   DA  C P     
1923 P  P     B DA  C 2  ? 0.6708 0.5652 0.3590 -0.0237 0.1046  0.0119  2   DA  C P     
1924 O  OP1   A DA  C 2  ? 0.7480 0.6491 0.4144 -0.0012 0.1039  0.0468  2   DA  C OP1   
1925 O  OP1   B DA  C 2  ? 0.8066 0.6942 0.4929 -0.0044 0.1112  0.0260  2   DA  C OP1   
1926 O  OP2   A DA  C 2  ? 0.6576 0.5681 0.3563 -0.0226 0.0990  0.0138  2   DA  C OP2   
1927 O  OP2   B DA  C 2  ? 0.6513 0.5401 0.3622 -0.0329 0.1073  -0.0113 2   DA  C OP2   
1928 O  "O5'" A DA  C 2  ? 1.3779 1.3150 1.0395 -0.0302 0.0802  0.0439  2   DA  C "O5'" 
1929 O  "O5'" B DA  C 2  ? 0.5548 0.4838 0.2381 -0.0269 0.0876  0.0291  2   DA  C "O5'" 
1930 C  "C5'" A DA  C 2  ? 0.5068 0.4763 0.1605 -0.0193 0.0694  0.0741  2   DA  C "C5'" 
1931 C  "C5'" B DA  C 2  ? 0.4860 0.4380 0.1551 -0.0188 0.0789  0.0561  2   DA  C "C5'" 
1932 C  "C4'" A DA  C 2  ? 0.6079 0.6072 0.2694 -0.0287 0.0497  0.0825  2   DA  C "C4'" 
1933 C  "C4'" B DA  C 2  ? 0.7790 0.7683 0.4520 -0.0253 0.0596  0.0710  2   DA  C "C4'" 
1934 O  "O4'" A DA  C 2  ? 0.5431 0.5291 0.2018 -0.0555 0.0448  0.0590  2   DA  C "O4'" 
1935 O  "O4'" B DA  C 2  ? 0.7964 0.7797 0.4590 -0.0509 0.0490  0.0577  2   DA  C "O4'" 
1936 C  "C3'" A DA  C 2  ? 0.7098 0.7344 0.4022 -0.0201 0.0463  0.0878  2   DA  C "C3'" 
1937 C  "C3'" B DA  C 2  ? 0.5893 0.5972 0.2886 -0.0265 0.0553  0.0672  2   DA  C "C3'" 
1938 O  "O3'" A DA  C 2  ? 0.6051 0.6724 0.3184 -0.0086 0.0322  0.1128  2   DA  C "O3'" 
1939 O  "O3'" B DA  C 2  ? 1.0089 1.0365 0.7294 -0.0014 0.0574  0.0849  2   DA  C "O3'" 
1940 C  "C2'" A DA  C 2  ? 0.6513 0.6804 0.3542 -0.0439 0.0374  0.0699  2   DA  C "C2'" 
1941 C  "C2'" B DA  C 2  ? 0.7626 0.7980 0.4683 -0.0477 0.0330  0.0708  2   DA  C "C2'" 
1942 C  "C1'" A DA  C 2  ? 0.6512 0.6560 0.3298 -0.0657 0.0342  0.0552  2   DA  C "C1'" 
1943 C  "C1'" B DA  C 2  ? 0.6373 0.6412 0.3156 -0.0658 0.0346  0.0546  2   DA  C "C1'" 
1944 N  N9    . DA  C 2  ? 0.6261 0.5975 0.3029 -0.0797 0.0424  0.0257  2   DA  C N9    
1945 C  C8    . DA  C 2  ? 0.6791 0.6177 0.3587 -0.0735 0.0617  0.0050  2   DA  C C8    
1946 N  N7    . DA  C 2  ? 0.5432 0.4632 0.2279 -0.0845 0.0645  -0.0176 2   DA  C N7    
1947 C  C5    . DA  C 2  ? 0.5478 0.4808 0.2247 -0.1006 0.0468  -0.0123 2   DA  C C5    
1948 C  C6    . DA  C 2  ? 0.5712 0.4882 0.2437 -0.1162 0.0411  -0.0275 2   DA  C C6    
1949 N  N6    . DA  C 2  ? 0.5688 0.4575 0.2496 -0.1132 0.0536  -0.0509 2   DA  C N6    
1950 N  N1    . DA  C 2  ? 0.5544 0.4879 0.2190 -0.1330 0.0213  -0.0158 2   DA  C N1    
1951 C  C2    . DA  C 2  ? 0.5976 0.5703 0.2670 -0.1329 0.0075  0.0100  2   DA  C C2    
1952 N  N3    . DA  C 2  ? 0.6584 0.6529 0.3353 -0.1147 0.0115  0.0270  2   DA  C N3    
1953 C  C4    . DA  C 2  ? 0.6062 0.5746 0.2822 -0.0996 0.0320  0.0144  2   DA  C C4    
1972 P  P     A DC  C 3  ? 0.6503 0.7432 0.3986 0.0154  0.0360  0.1239  3   DC  C P     
1973 P  P     B DC  C 3  ? 0.6433 0.6896 0.3951 0.0072  0.0573  0.0830  3   DC  C P     
1974 O  OP1   A DC  C 3  ? 0.7004 0.8189 0.4578 0.0371  0.0335  0.1475  3   DC  C OP1   
1975 O  OP1   B DC  C 3  ? 0.5585 0.6143 0.3250 0.0338  0.0623  0.0994  3   DC  C OP1   
1976 O  OP2   A DC  C 3  ? 0.5593 0.6168 0.3066 0.0230  0.0545  0.1059  3   DC  C OP2   
1977 O  OP2   B DC  C 3  ? 0.4339 0.4469 0.1918 -0.0004 0.0668  0.0546  3   DC  C OP2   
1978 O  "O5'" A DC  C 3  ? 0.5065 0.6417 0.2822 -0.0004 0.0188  0.1263  3   DC  C "O5'" 
1979 O  "O5'" B DC  C 3  ? 0.9482 1.0362 0.7162 -0.0124 0.0346  0.0907  3   DC  C "O5'" 
1980 C  "C5'" A DC  C 3  ? 0.9285 1.0496 0.7069 -0.0133 0.0210  0.1083  3   DC  C "C5'" 
1981 C  "C5'" B DC  C 3  ? 0.5602 0.6854 0.3365 -0.0151 0.0180  0.1113  3   DC  C "C5'" 
1982 C  "C4'" A DC  C 3  ? 0.7766 0.9249 0.5651 -0.0400 0.0008  0.1088  3   DC  C "C4'" 
1983 C  "C4'" B DC  C 3  ? 0.4714 0.6227 0.2591 -0.0417 -0.0013 0.1104  3   DC  C "C4'" 
1984 O  "O4'" A DC  C 3  ? 0.6316 0.7438 0.3927 -0.0652 -0.0006 0.0872  3   DC  C "O4'" 
1985 O  "O4'" B DC  C 3  ? 0.6004 0.7139 0.3609 -0.0667 -0.0019 0.0878  3   DC  C "O4'" 
1986 C  "C3'" A DC  C 3  ? 0.5693 0.7375 0.3841 -0.0401 -0.0023 0.1094  3   DC  C "C3'" 
1987 C  "C3'" B DC  C 3  ? 0.6303 0.8004 0.4450 -0.0391 -0.0026 0.1111  3   DC  C "C3'" 
1988 O  "O3'" A DC  C 3  ? 0.7605 0.9795 0.6009 -0.0456 -0.0172 0.1283  3   DC  C "O3'" 
1989 O  "O3'" B DC  C 3  ? 0.7135 0.9345 0.5545 -0.0460 -0.0179 0.1291  3   DC  C "O3'" 
1990 C  "C2'" A DC  C 3  ? 0.6759 0.8128 0.4744 -0.0649 -0.0051 0.0871  3   DC  C "C2'" 
1991 C  "C2'" B DC  C 3  ? 0.6439 0.7809 0.4428 -0.0616 -0.0034 0.0880  3   DC  C "C2'" 
1992 C  "C1'" A DC  C 3  ? 0.5883 0.6942 0.3547 -0.0815 -0.0058 0.0747  3   DC  C "C1'" 
1993 C  "C1'" B DC  C 3  ? 0.5830 0.6901 0.3501 -0.0809 -0.0058 0.0753  3   DC  C "C1'" 
1994 N  N1    . DC  C 3  ? 0.6028 0.6563 0.3598 -0.0819 0.0086  0.0451  3   DC  C N1    
1995 C  C2    . DC  C 3  ? 0.5796 0.6061 0.3271 -0.1020 0.0037  0.0260  3   DC  C C2    
1996 O  O2    . DC  C 3  ? 0.7591 0.7994 0.5000 -0.1228 -0.0130 0.0336  3   DC  C O2    
1997 N  N3    . DC  C 3  ? 0.5187 0.5042 0.2630 -0.0982 0.0180  0.0005  3   DC  C N3    
1998 C  C4    . DC  C 3  ? 0.4795 0.4540 0.2308 -0.0803 0.0351  -0.0064 3   DC  C C4    
1999 N  N4    . DC  C 3  ? 0.5396 0.4832 0.2919 -0.0786 0.0483  -0.0302 3   DC  C N4    
2000 C  C5    . DC  C 3  ? 0.5145 0.5081 0.2699 -0.0632 0.0403  0.0113  3   DC  C C5    
2001 C  C6    . DC  C 3  ? 0.4742 0.5061 0.2326 -0.0620 0.0273  0.0369  3   DC  C C6    
2020 P  P     . DC  C 4  ? 0.6659 0.9144 0.5375 -0.0409 -0.0184 0.1350  4   DC  C P     
2021 O  OP1   . DC  C 4  ? 0.7365 1.0467 0.6374 -0.0407 -0.0278 0.1584  4   DC  C OP1   
2022 O  OP2   . DC  C 4  ? 0.5723 0.7932 0.4430 -0.0152 0.0004  0.1270  4   DC  C OP2   
2023 O  "O5'" . DC  C 4  ? 0.6238 0.8506 0.4831 -0.0724 -0.0288 0.1193  4   DC  C "O5'" 
2024 C  "C5'" . DC  C 4  ? 0.5513 0.7864 0.4019 -0.1042 -0.0458 0.1203  4   DC  C "C5'" 
2025 C  "C4'" . DC  C 4  ? 0.5079 0.7071 0.3406 -0.1295 -0.0519 0.1032  4   DC  C "C4'" 
2026 O  "O4'" . DC  C 4  ? 0.6848 0.8282 0.4827 -0.1340 -0.0447 0.0801  4   DC  C "O4'" 
2027 C  "C3'" . DC  C 4  ? 0.6162 0.8114 0.4621 -0.1196 -0.0466 0.1007  4   DC  C "C3'" 
2028 O  "O3'" . DC  C 4  ? 0.5699 0.8099 0.4436 -0.1258 -0.0546 0.1183  4   DC  C "O3'" 
2029 C  "C2'" . DC  C 4  ? 0.5992 0.7367 0.4182 -0.1379 -0.0483 0.0761  4   DC  C "C2'" 
2030 C  "C1'" . DC  C 4  ? 0.6065 0.7107 0.3997 -0.1397 -0.0424 0.0612  4   DC  C "C1'" 
2031 N  N1    . DC  C 4  ? 0.5450 0.6123 0.3430 -0.1162 -0.0236 0.0403  4   DC  C N1    
2032 C  C2    . DC  C 4  ? 0.5669 0.5866 0.3562 -0.1195 -0.0186 0.0162  4   DC  C C2    
2033 O  O2    . DC  C 4  ? 0.7293 0.7290 0.5013 -0.1408 -0.0288 0.0117  4   DC  C O2    
2034 N  N3    . DC  C 4  ? 0.5082 0.5047 0.3064 -0.0997 -0.0025 -0.0010 4   DC  C N3    
2035 C  C4    . DC  C 4  ? 0.4967 0.5085 0.3066 -0.0806 0.0085  0.0040  4   DC  C C4    
2036 N  N4    . DC  C 4  ? 0.6384 0.6281 0.4549 -0.0668 0.0234  -0.0131 4   DC  C N4    
2037 C  C5    . DC  C 4  ? 0.6544 0.7047 0.4683 -0.0749 0.0050  0.0278  4   DC  C C5    
2038 C  C6    . DC  C 4  ? 0.6455 0.7265 0.4562 -0.0913 -0.0111 0.0460  4   DC  C C6    
2050 P  P     . DC  C 5  ? 0.5714 0.8190 0.4646 -0.1100 -0.0476 0.1214  5   DC  C P     
2051 O  OP1   . DC  C 5  ? 0.7593 1.0372 0.6674 -0.1317 -0.0587 0.1337  5   DC  C OP1   
2052 O  OP2   . DC  C 5  ? 0.5497 0.8095 0.4582 -0.0736 -0.0313 0.1265  5   DC  C OP2   
2053 O  "O5'" . DC  C 5  ? 0.7984 0.9830 0.6682 -0.1115 -0.0429 0.0958  5   DC  C "O5'" 
2054 C  "C5'" . DC  C 5  ? 0.4871 0.6535 0.3602 -0.1166 -0.0451 0.0895  5   DC  C "C5'" 
2055 C  "C4'" . DC  C 5  ? 0.5704 0.6746 0.4206 -0.1276 -0.0460 0.0641  5   DC  C "C4'" 
2056 O  "O4'" . DC  C 5  ? 0.4944 0.5718 0.3349 -0.1166 -0.0358 0.0475  5   DC  C "O4'" 
2057 C  "C3'" . DC  C 5  ? 0.4695 0.5443 0.3272 -0.1153 -0.0410 0.0519  5   DC  C "C3'" 
2058 O  "O3'" . DC  C 5  ? 0.4733 0.5489 0.3264 -0.1334 -0.0519 0.0607  5   DC  C "O3'" 
2059 C  "C2'" . DC  C 5  ? 0.4692 0.4909 0.3105 -0.1130 -0.0354 0.0265  5   DC  C "C2'" 
2060 C  "C1'" . DC  C 5  ? 0.4773 0.5051 0.3108 -0.1116 -0.0297 0.0240  5   DC  C "C1'" 
2061 N  N1    . DC  C 5  ? 0.4341 0.4542 0.2799 -0.0867 -0.0138 0.0116  5   DC  C N1    
2062 C  C2    . DC  C 5  ? 0.4801 0.4615 0.3222 -0.0802 -0.0058 -0.0112 5   DC  C C2    
2063 O  O2    . DC  C 5  ? 0.4891 0.4394 0.3167 -0.0908 -0.0107 -0.0206 5   DC  C O2    
2064 N  N3    . DC  C 5  ? 0.3747 0.3533 0.2276 -0.0627 0.0080  -0.0218 5   DC  C N3    
2065 C  C4    . DC  C 5  ? 0.4207 0.4234 0.2818 -0.0517 0.0144  -0.0115 5   DC  C C4    
2066 N  N4    . DC  C 5  ? 0.4539 0.4473 0.3205 -0.0387 0.0280  -0.0230 5   DC  C N4    
2067 C  C5    . DC  C 5  ? 0.4110 0.4487 0.2742 -0.0534 0.0077  0.0119  5   DC  C C5    
2068 C  C6    . DC  C 5  ? 0.4254 0.4756 0.2837 -0.0711 -0.0066 0.0231  5   DC  C C6    
2080 P  P     . DC  C 6  ? 0.4399 0.5107 0.3064 -0.1210 -0.0498 0.0619  6   DC  C P     
2081 O  OP1   . DC  C 6  ? 0.5534 0.6414 0.4138 -0.1462 -0.0619 0.0794  6   DC  C OP1   
2082 O  OP2   . DC  C 6  ? 0.3871 0.4810 0.2767 -0.0915 -0.0371 0.0635  6   DC  C OP2   
2083 O  "O5'" . DC  C 6  ? 0.4615 0.4707 0.3137 -0.1157 -0.0478 0.0381  6   DC  C "O5'" 
2084 C  "C5'" . DC  C 6  ? 0.4680 0.4316 0.2893 -0.1366 -0.0545 0.0282  6   DC  C "C5'" 
2085 C  "C4'" . DC  C 6  ? 0.4928 0.4066 0.3088 -0.1192 -0.0474 0.0065  6   DC  C "C4'" 
2086 O  "O4'" . DC  C 6  ? 0.4552 0.3755 0.2859 -0.0988 -0.0348 -0.0071 6   DC  C "O4'" 
2087 C  "C3'" . DC  C 6  ? 0.4805 0.3891 0.3104 -0.1026 -0.0478 0.0078  6   DC  C "C3'" 
2088 O  "O3'" . DC  C 6  ? 0.5189 0.3747 0.3313 -0.0981 -0.0483 -0.0048 6   DC  C "O3'" 
2089 C  "C2'" . DC  C 6  ? 0.4404 0.3761 0.2990 -0.0771 -0.0372 0.0020  6   DC  C "C2'" 
2090 C  "C1'" . DC  C 6  ? 0.4988 0.4222 0.3521 -0.0747 -0.0287 -0.0133 6   DC  C "C1'" 
2091 N  N1    . DC  C 6  ? 0.3972 0.3505 0.2702 -0.0601 -0.0181 -0.0154 6   DC  C N1    
2092 C  C2    . DC  C 6  ? 0.3626 0.3047 0.2449 -0.0449 -0.0075 -0.0330 6   DC  C C2    
2093 O  O2    . DC  C 6  ? 0.5085 0.4216 0.3865 -0.0405 -0.0065 -0.0460 6   DC  C O2    
2094 N  N3    . DC  C 6  ? 0.3405 0.3036 0.2348 -0.0354 0.0024  -0.0346 6   DC  C N3    
2095 C  C4    . DC  C 6  ? 0.3856 0.3762 0.2815 -0.0363 0.0028  -0.0191 6   DC  C C4    
2096 N  N4    . DC  C 6  ? 0.3465 0.3475 0.2475 -0.0259 0.0142  -0.0211 6   DC  C N4    
2097 C  C5    . DC  C 6  ? 0.3636 0.3726 0.2551 -0.0477 -0.0076 0.0001  6   DC  C C5    
2098 C  C6    . DC  C 6  ? 0.3883 0.3793 0.2689 -0.0615 -0.0182 0.0010  6   DC  C C6    
2110 P  P     . DC  C 7  ? 0.5944 0.4355 0.4115 -0.0852 -0.0528 -0.0006 7   DC  C P     
2111 O  OP1   . DC  C 7  ? 0.6259 0.4047 0.4095 -0.0914 -0.0558 -0.0076 7   DC  C OP1   
2112 O  OP2   . DC  C 7  ? 0.6149 0.4951 0.4431 -0.0931 -0.0584 0.0190  7   DC  C OP2   
2113 O  "O5'" . DC  C 7  ? 0.5269 0.3805 0.3726 -0.0542 -0.0440 -0.0134 7   DC  C "O5'" 
2114 C  "C5'" . DC  C 7  ? 0.5219 0.3516 0.3673 -0.0409 -0.0357 -0.0317 7   DC  C "C5'" 
2115 C  "C4'" . DC  C 7  ? 0.4858 0.3421 0.3630 -0.0171 -0.0291 -0.0402 7   DC  C "C4'" 
2116 O  "O4'" . DC  C 7  ? 0.4379 0.3318 0.3306 -0.0191 -0.0222 -0.0403 7   DC  C "O4'" 
2117 C  "C3'" . DC  C 7  ? 0.4616 0.3306 0.3523 -0.0054 -0.0365 -0.0318 7   DC  C "C3'" 
2118 O  "O3'" . DC  C 7  ? 0.4417 0.2983 0.3429 0.0156  -0.0350 -0.0421 7   DC  C "O3'" 
2119 C  "C2'" . DC  C 7  ? 0.3997 0.3131 0.3103 -0.0040 -0.0328 -0.0281 7   DC  C "C2'" 
2120 C  "C1'" . DC  C 7  ? 0.3593 0.2806 0.2745 -0.0057 -0.0215 -0.0394 7   DC  C "C1'" 
2121 N  N1    . DC  C 7  ? 0.3339 0.2856 0.2548 -0.0103 -0.0158 -0.0334 7   DC  C N1    
2122 C  C2    . DC  C 7  ? 0.3049 0.2705 0.2385 -0.0025 -0.0053 -0.0440 7   DC  C C2    
2123 O  O2    . DC  C 7  ? 0.3563 0.3170 0.3009 0.0063  -0.0017 -0.0577 7   DC  C O2    
2124 N  N3    . DC  C 7  ? 0.2824 0.2664 0.2152 -0.0043 0.0014  -0.0382 7   DC  C N3    
2125 C  C4    . DC  C 7  ? 0.2883 0.2845 0.2130 -0.0110 -0.0019 -0.0216 7   DC  C C4    
2126 N  N4    . DC  C 7  ? 0.3057 0.3190 0.2294 -0.0078 0.0063  -0.0150 7   DC  C N4    
2127 C  C5    . DC  C 7  ? 0.3292 0.3204 0.2454 -0.0213 -0.0132 -0.0102 7   DC  C C5    
2128 C  C6    . DC  C 7  ? 0.3322 0.2968 0.2440 -0.0221 -0.0199 -0.0171 7   DC  C C6    
2140 P  P     A DA  C 8  ? 0.4184 0.2853 0.3339 0.0326  -0.0434 -0.0366 8   DA  C P     
2141 P  P     B DA  C 8  ? 0.8148 0.6753 0.7246 0.0303  -0.0451 -0.0341 8   DA  C P     
2142 O  OP1   A DA  C 8  ? 0.5177 0.3618 0.4363 0.0531  -0.0413 -0.0456 8   DA  C OP1   
2143 O  OP1   B DA  C 8  ? 0.7431 0.5848 0.6591 0.0522  -0.0431 -0.0433 8   DA  C OP1   
2144 O  OP2   A DA  C 8  ? 0.5498 0.4134 0.4505 0.0219  -0.0539 -0.0194 8   DA  C OP2   
2145 O  OP2   B DA  C 8  ? 0.4048 0.2488 0.2915 0.0153  -0.0547 -0.0175 8   DA  C OP2   
2146 O  "O5'" A DA  C 8  ? 0.5452 0.4588 0.4888 0.0378  -0.0389 -0.0420 8   DA  C "O5'" 
2147 O  "O5'" B DA  C 8  ? 0.3370 0.2460 0.2741 0.0353  -0.0430 -0.0361 8   DA  C "O5'" 
2148 C  "C5'" A DA  C 8  ? 0.3939 0.3215 0.3545 0.0437  -0.0281 -0.0570 8   DA  C "C5'" 
2149 C  "C5'" B DA  C 8  ? 0.4532 0.3821 0.4141 0.0480  -0.0360 -0.0501 8   DA  C "C5'" 
2150 C  "C4'" A DA  C 8  ? 0.4119 0.3771 0.3911 0.0432  -0.0253 -0.0599 8   DA  C "C4'" 
2151 C  "C4'" B DA  C 8  ? 0.5782 0.5437 0.5540 0.0439  -0.0323 -0.0526 8   DA  C "C4'" 
2152 O  "O4'" A DA  C 8  ? 0.9536 0.9252 0.9221 0.0290  -0.0196 -0.0555 8   DA  C "O4'" 
2153 O  "O4'" B DA  C 8  ? 0.3236 0.2915 0.2888 0.0297  -0.0245 -0.0506 8   DA  C "O4'" 
2154 C  "C3'" A DA  C 8  ? 0.5566 0.5366 0.5410 0.0488  -0.0367 -0.0517 8   DA  C "C3'" 
2155 C  "C3'" B DA  C 8  ? 0.4831 0.4629 0.4577 0.0443  -0.0419 -0.0424 8   DA  C "C3'" 
2156 O  "O3'" A DA  C 8  ? 0.5548 0.5606 0.5633 0.0591  -0.0373 -0.0608 8   DA  C "O3'" 
2157 O  "O3'" B DA  C 8  ? 1.0135 1.0063 1.0043 0.0582  -0.0500 -0.0450 8   DA  C "O3'" 
2158 C  "C2'" A DA  C 8  ? 0.6327 0.6241 0.6063 0.0365  -0.0345 -0.0443 8   DA  C "C2'" 
2159 C  "C2'" B DA  C 8  ? 0.8481 0.8482 0.8232 0.0354  -0.0330 -0.0452 8   DA  C "C2'" 
2160 C  "C1'" A DA  C 8  ? 0.6540 0.6461 0.6256 0.0284  -0.0213 -0.0509 8   DA  C "C1'" 
2161 C  "C1'" B DA  C 8  ? 0.6212 0.6131 0.5921 0.0282  -0.0215 -0.0503 8   DA  C "C1'" 
2162 N  N9    . DA  C 8  ? 0.5142 0.5083 0.4708 0.0188  -0.0174 -0.0399 8   DA  C N9    
2163 C  C8    . DA  C 8  ? 0.3554 0.3430 0.2985 0.0116  -0.0228 -0.0252 8   DA  C C8    
2164 N  N7    . DA  C 8  ? 0.4100 0.4109 0.3467 0.0064  -0.0167 -0.0163 8   DA  C N7    
2165 C  C5    . DA  C 8  ? 0.3062 0.3147 0.2481 0.0113  -0.0060 -0.0265 8   DA  C C5    
2166 C  C6    . DA  C 8  ? 0.2422 0.2595 0.1778 0.0124  0.0055  -0.0236 8   DA  C C6    
2167 N  N6    . DA  C 8  ? 0.3038 0.3324 0.2317 0.0115  0.0082  -0.0079 8   DA  C N6    
2168 N  N1    . DA  C 8  ? 0.2687 0.2833 0.2056 0.0150  0.0146  -0.0361 8   DA  C N1    
2169 C  C2    . DA  C 8  ? 0.2668 0.2794 0.2157 0.0151  0.0120  -0.0502 8   DA  C C2    
2170 N  N3    . DA  C 8  ? 0.3909 0.4024 0.3513 0.0174  0.0017  -0.0535 8   DA  C N3    
2171 C  C4    . DA  C 8  ? 0.3371 0.3424 0.2910 0.0162  -0.0068 -0.0412 8   DA  C C4    
2190 P  P     A DC  C 9  ? 0.4505 0.4746 0.4678 0.0683  -0.0519 -0.0543 9   DC  C P     
2191 P  P     B DC  C 9  ? 0.4398 0.4504 0.4292 0.0591  -0.0615 -0.0370 9   DC  C P     
2192 O  OP1   A DC  C 9  ? 0.4473 0.4867 0.4896 0.0856  -0.0535 -0.0607 9   DC  C OP1   
2193 O  OP1   B DC  C 9  ? 0.6070 0.6263 0.6124 0.0760  -0.0719 -0.0371 9   DC  C OP1   
2194 O  OP2   A DC  C 9  ? 0.5562 0.5585 0.5509 0.0666  -0.0621 -0.0389 9   DC  C OP2   
2195 O  OP2   B DC  C 9  ? 0.4304 0.4262 0.3956 0.0503  -0.0649 -0.0228 9   DC  C OP2   
2196 O  "O5'" A DC  C 9  ? 0.6587 0.7110 0.6800 0.0564  -0.0489 -0.0597 9   DC  C "O5'" 
2197 O  "O5'" B DC  C 9  ? 0.4635 0.5021 0.4621 0.0508  -0.0539 -0.0476 9   DC  C "O5'" 
2198 C  "C5'" A DC  C 9  ? 0.3609 0.4284 0.3948 0.0499  -0.0362 -0.0733 9   DC  C "C5'" 
2199 C  "C5'" B DC  C 9  ? 0.2993 0.3551 0.3196 0.0524  -0.0461 -0.0617 9   DC  C "C5'" 
2200 C  "C4'" A DC  C 9  ? 0.2458 0.3213 0.2678 0.0354  -0.0316 -0.0762 9   DC  C "C4'" 
2201 C  "C4'" B DC  C 9  ? 0.5409 0.6121 0.5592 0.0391  -0.0377 -0.0702 9   DC  C "C4'" 
2202 O  "O4'" A DC  C 9  ? 0.2742 0.3267 0.2724 0.0290  -0.0229 -0.0701 9   DC  C "O4'" 
2203 O  "O4'" B DC  C 9  ? 0.7028 0.7544 0.7005 0.0308  -0.0261 -0.0676 9   DC  C "O4'" 
2204 C  "C3'" A DC  C 9  ? 0.5070 0.5941 0.5218 0.0332  -0.0443 -0.0708 9   DC  C "C3'" 
2205 C  "C3'" B DC  C 9  ? 0.2574 0.3417 0.2670 0.0335  -0.0469 -0.0676 9   DC  C "C3'" 
2206 O  "O3'" A DC  C 9  ? 0.3846 0.4925 0.4042 0.0215  -0.0417 -0.0815 9   DC  C "O3'" 
2207 O  "O3'" B DC  C 9  ? 0.4106 0.5171 0.4296 0.0231  -0.0432 -0.0798 9   DC  C "O3'" 
2208 C  "C2'" A DC  C 9  ? 0.3973 0.4609 0.3822 0.0289  -0.0414 -0.0603 9   DC  C "C2'" 
2209 C  "C2'" B DC  C 9  ? 0.3674 0.4296 0.3471 0.0272  -0.0407 -0.0596 9   DC  C "C2'" 
2210 C  "C1'" A DC  C 9  ? 0.3274 0.3782 0.3064 0.0239  -0.0248 -0.0644 9   DC  C "C1'" 
2211 C  "C1'" B DC  C 9  ? 0.2944 0.3447 0.2727 0.0240  -0.0251 -0.0638 9   DC  C "C1'" 
2212 N  N1    . DC  C 9  ? 0.3441 0.3778 0.3032 0.0236  -0.0197 -0.0517 9   DC  C N1    
2213 C  C2    . DC  C 9  ? 0.2917 0.3183 0.2352 0.0194  -0.0055 -0.0517 9   DC  C C2    
2214 O  O2    . DC  C 9  ? 0.3608 0.3871 0.3015 0.0143  0.0028  -0.0627 9   DC  C O2    
2215 N  N3    . DC  C 9  ? 0.2967 0.3179 0.2278 0.0211  -0.0009 -0.0384 9   DC  C N3    
2216 C  C4    . DC  C 9  ? 0.3076 0.3293 0.2404 0.0221  -0.0102 -0.0266 9   DC  C C4    
2217 N  N4    . DC  C 9  ? 0.2761 0.3008 0.1995 0.0211  -0.0057 -0.0124 9   DC  C N4    
2218 C  C5    . DC  C 9  ? 0.3747 0.3943 0.3177 0.0242  -0.0242 -0.0275 9   DC  C C5    
2219 C  C6    . DC  C 9  ? 0.3263 0.3524 0.2830 0.0273  -0.0283 -0.0397 9   DC  C C6    
2238 P  P     . DG  C 10 ? 0.4276 0.5548 0.4415 0.0143  -0.0559 -0.0805 10  DG  C P     
2239 O  OP1   . DG  C 10 ? 0.4887 0.6490 0.5251 0.0043  -0.0549 -0.0929 10  DG  C OP1   
2240 O  OP2   . DG  C 10 ? 0.4521 0.5805 0.4647 0.0265  -0.0728 -0.0674 10  DG  C OP2   
2241 O  "O5'" . DG  C 10 ? 0.4325 0.5320 0.4072 0.0016  -0.0464 -0.0805 10  DG  C "O5'" 
2242 C  "C5'" . DG  C 10 ? 0.4579 0.5436 0.4210 -0.0095 -0.0290 -0.0904 10  DG  C "C5'" 
2243 C  "C4'" . DG  C 10 ? 0.4382 0.4912 0.3621 -0.0123 -0.0183 -0.0861 10  DG  C "C4'" 
2244 O  "O4'" . DG  C 10 ? 0.4598 0.4998 0.3820 0.0007  -0.0139 -0.0739 10  DG  C "O4'" 
2245 C  "C3'" . DG  C 10 ? 0.4421 0.4904 0.3400 -0.0169 -0.0275 -0.0824 10  DG  C "C3'" 
2246 O  "O3'" . DG  C 10 ? 0.5893 0.6256 0.4614 -0.0342 -0.0211 -0.0939 10  DG  C "O3'" 
2247 C  "C2'" . DG  C 10 ? 0.5727 0.5982 0.4486 -0.0057 -0.0200 -0.0690 10  DG  C "C2'" 
2248 C  "C1'" . DG  C 10 ? 0.4306 0.4520 0.3219 0.0023  -0.0086 -0.0659 10  DG  C "C1'" 
2249 N  N9    . DG  C 10 ? 0.3627 0.3838 0.2577 0.0130  -0.0113 -0.0506 10  DG  C N9    
2250 C  C8    . DG  C 10 ? 0.3391 0.3705 0.2499 0.0183  -0.0262 -0.0425 10  DG  C C8    
2251 N  N7    . DG  C 10 ? 0.3995 0.4256 0.3060 0.0227  -0.0244 -0.0289 10  DG  C N7    
2252 C  C5    . DG  C 10 ? 0.3175 0.3359 0.2082 0.0231  -0.0078 -0.0269 10  DG  C C5    
2253 C  C6    . DG  C 10 ? 0.3053 0.3245 0.1890 0.0273  0.0008  -0.0128 10  DG  C C6    
2254 O  O6    . DG  C 10 ? 0.3660 0.3923 0.2547 0.0271  -0.0054 0.0006  10  DG  C O6    
2255 N  N1    . DG  C 10 ? 0.3545 0.3660 0.2228 0.0313  0.0182  -0.0138 10  DG  C N1    
2256 C  C2    . DG  C 10 ? 0.3519 0.3480 0.2077 0.0288  0.0269  -0.0281 10  DG  C C2    
2257 N  N2    . DG  C 10 ? 0.3946 0.3764 0.2305 0.0355  0.0450  -0.0261 10  DG  C N2    
2258 N  N3    . DG  C 10 ? 0.3861 0.3813 0.2470 0.0199  0.0185  -0.0421 10  DG  C N3    
2259 C  C4    . DG  C 10 ? 0.3356 0.3464 0.2169 0.0187  0.0010  -0.0402 10  DG  C C4    
2271 P  P     . DC  C 11 ? 0.6040 0.6302 0.4397 -0.0451 -0.0292 -0.0945 11  DC  C P     
2272 O  OP1   . DC  C 11 ? 0.6305 0.6694 0.4643 -0.0682 -0.0343 -0.1086 11  DC  C OP1   
2273 O  OP2   . DC  C 11 ? 0.5526 0.5923 0.3931 -0.0341 -0.0458 -0.0812 11  DC  C OP2   
2274 O  "O5'" . DC  C 11 ? 0.6127 0.5923 0.4025 -0.0411 -0.0076 -0.0925 11  DC  C "O5'" 
2275 C  "C5'" . DC  C 11 ? 0.5098 0.4635 0.2877 -0.0418 0.0132  -0.0985 11  DC  C "C5'" 
2276 C  "C4'" . DC  C 11 ? 0.5988 0.5163 0.3395 -0.0279 0.0319  -0.0901 11  DC  C "C4'" 
2277 O  "O4'" . DC  C 11 ? 0.5254 0.4611 0.2917 -0.0080 0.0310  -0.0736 11  DC  C "O4'" 
2278 C  "C3'" . DC  C 11 ? 0.7136 0.6109 0.4122 -0.0314 0.0310  -0.0896 11  DC  C "C3'" 
2279 O  "O3'" . DC  C 11 ? 0.7278 0.5857 0.3937 -0.0257 0.0520  -0.0890 11  DC  C "O3'" 
2280 C  "C2'" . DC  C 11 ? 0.5628 0.4825 0.2791 -0.0151 0.0224  -0.0723 11  DC  C "C2'" 
2281 C  "C1'" . DC  C 11 ? 0.5399 0.4688 0.2841 0.0006  0.0321  -0.0628 11  DC  C "C1'" 
2282 N  N1    . DC  C 11 ? 0.4649 0.4235 0.2415 0.0106  0.0196  -0.0474 11  DC  C N1    
2283 C  C2    . DC  C 11 ? 0.4763 0.4380 0.2560 0.0249  0.0308  -0.0323 11  DC  C C2    
2284 O  O2    . DC  C 11 ? 0.4506 0.3942 0.2099 0.0334  0.0507  -0.0306 11  DC  C O2    
2285 N  N3    . DC  C 11 ? 0.4069 0.3911 0.2100 0.0287  0.0194  -0.0189 11  DC  C N3    
2286 C  C4    . DC  C 11 ? 0.4115 0.4084 0.2320 0.0228  -0.0005 -0.0201 11  DC  C C4    
2287 N  N4    . DC  C 11 ? 0.4051 0.4150 0.2423 0.0258  -0.0100 -0.0068 11  DC  C N4    
2288 C  C5    . DC  C 11 ? 0.4161 0.4141 0.2374 0.0131  -0.0120 -0.0341 11  DC  C C5    
2289 C  C6    . DC  C 11 ? 0.4438 0.4256 0.2443 0.0054  -0.0020 -0.0474 11  DC  C C6    
2302 ZN ZN    . ZN  D .  ? 0.2651 0.3667 0.4538 0.0259  0.0319  -0.0383 501 ZN  A ZN    
2303 ZN ZN    . ZN  E .  ? 0.3112 0.2937 0.6546 0.0203  0.0826  0.0501  502 ZN  A ZN    
2304 ZN ZN    . ZN  F .  ? 0.3866 0.3464 0.3477 -0.0081 0.1011  0.0216  503 ZN  A ZN    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  345 ?   ?   ?   A . n 
A 1 2  PRO 2  346 ?   ?   ?   A . n 
A 1 3  LEU 3  347 ?   ?   ?   A . n 
A 1 4  GLY 4  348 ?   ?   ?   A . n 
A 1 5  SER 5  349 ?   ?   ?   A . n 
A 1 6  GLU 6  350 ?   ?   ?   A . n 
A 1 7  LYS 7  351 351 LYS LYS A . n 
A 1 8  PRO 8  352 352 PRO PRO A . n 
A 1 9  TYR 9  353 353 TYR TYR A . n 
A 1 10 GLN 10 354 354 GLN GLN A . n 
A 1 11 CYS 11 355 355 CYS CYS A . n 
A 1 12 ASP 12 356 356 ASP ASP A . n 
A 1 13 PHE 13 357 357 PHE PHE A . n 
A 1 14 LYS 14 358 358 LYS LYS A . n 
A 1 15 ASP 15 359 359 ASP ASP A . n 
A 1 16 CYS 16 360 360 CYS CYS A . n 
A 1 17 GLU 17 361 361 GLU GLU A . n 
A 1 18 ARG 18 362 362 ARG ARG A . n 
A 1 19 ARG 19 363 363 ARG ARG A . n 
A 1 20 PHE 20 364 364 PHE PHE A . n 
A 1 21 SER 21 365 365 SER SER A . n 
A 1 22 ARG 22 366 366 ARG ARG A . n 
A 1 23 SER 23 367 367 SER SER A . n 
A 1 24 ASP 24 368 368 ASP ASP A . n 
A 1 25 ARG 25 369 369 ARG ARG A . n 
A 1 26 LEU 26 370 370 LEU LEU A . n 
A 1 27 LYS 27 371 371 LYS LYS A . n 
A 1 28 ARG 28 372 372 ARG ARG A . n 
A 1 29 HIS 29 373 373 HIS HIS A . n 
A 1 30 GLN 30 374 374 GLN GLN A . n 
A 1 31 ARG 31 375 375 ARG ARG A . n 
A 1 32 ARG 32 376 376 ARG ARG A . n 
A 1 33 HIS 33 377 377 HIS HIS A . n 
A 1 34 THR 34 378 378 THR THR A . n 
A 1 35 GLY 35 379 379 GLY GLY A . n 
A 1 36 VAL 36 380 380 VAL VAL A . n 
A 1 37 LYS 37 381 381 LYS LYS A . n 
A 1 38 PRO 38 382 382 PRO PRO A . n 
A 1 39 PHE 39 383 383 PHE PHE A . n 
A 1 40 GLN 40 384 384 GLN GLN A . n 
A 1 41 CYS 41 385 385 CYS CYS A . n 
A 1 42 LYS 42 386 386 LYS LYS A . n 
A 1 43 THR 43 387 387 THR THR A . n 
A 1 44 CYS 44 388 388 CYS CYS A . n 
A 1 45 GLN 45 389 389 GLN GLN A . n 
A 1 46 ARG 46 390 390 ARG ARG A . n 
A 1 47 LYS 47 391 391 LYS LYS A . n 
A 1 48 PHE 48 392 392 PHE PHE A . n 
A 1 49 SER 49 393 393 SER SER A . n 
A 1 50 ARG 50 394 394 ARG ARG A . n 
A 1 51 SER 51 395 395 SER SER A . n 
A 1 52 ASP 52 396 396 ASP ASP A . n 
A 1 53 HIS 53 397 397 HIS HIS A . n 
A 1 54 LEU 54 398 398 LEU LEU A . n 
A 1 55 LYS 55 399 399 LYS LYS A . n 
A 1 56 THR 56 400 400 THR THR A . n 
A 1 57 HIS 57 401 401 HIS HIS A . n 
A 1 58 THR 58 402 402 THR THR A . n 
A 1 59 ARG 59 403 403 ARG ARG A . n 
A 1 60 THR 60 404 404 THR THR A . n 
A 1 61 HIS 61 405 405 HIS HIS A . n 
A 1 62 THR 62 406 406 THR THR A . n 
A 1 63 GLY 63 407 407 GLY GLY A . n 
A 1 64 GLU 64 408 408 GLU GLU A . n 
A 1 65 LYS 65 409 409 LYS LYS A . n 
A 1 66 PRO 66 410 410 PRO PRO A . n 
A 1 67 PHE 67 411 411 PHE PHE A . n 
A 1 68 SER 68 412 412 SER SER A . n 
A 1 69 CYS 69 413 413 CYS CYS A . n 
A 1 70 ARG 70 414 414 ARG ARG A . n 
A 1 71 TRP 71 415 415 TRP TRP A . n 
A 1 72 PRO 72 416 416 PRO PRO A . n 
A 1 73 SER 73 417 417 SER SER A . n 
A 1 74 CYS 74 418 418 CYS CYS A . n 
A 1 75 GLN 75 419 419 GLN GLN A . n 
A 1 76 LYS 76 420 420 LYS LYS A . n 
A 1 77 LYS 77 421 421 LYS LYS A . n 
A 1 78 PHE 78 422 422 PHE PHE A . n 
A 1 79 ALA 79 423 423 ALA ALA A . n 
A 1 80 ARG 80 424 424 ARG ARG A . n 
A 1 81 SER 81 425 425 SER SER A . n 
A 1 82 ASP 82 426 426 ASP ASP A . n 
A 1 83 GLU 83 427 427 GLU GLU A . n 
A 1 84 LEU 84 428 428 LEU LEU A . n 
A 1 85 VAL 85 429 429 VAL VAL A . n 
A 1 86 ARG 86 430 430 ARG ARG A . n 
A 1 87 HIS 87 431 431 HIS HIS A . n 
A 1 88 HIS 88 432 432 HIS HIS A . n 
A 1 89 ASN 89 433 433 ASN ASN A . n 
A 1 90 MET 90 434 434 MET MET A . n 
A 1 91 HIS 91 435 435 HIS HIS A . n 
A 1 92 GLN 92 436 436 GLN GLN A . n 
A 1 93 ARG 93 437 437 ARG ARG A . n 
B 2 1  DA  1  1   1   DA  DA  B . n 
B 2 2  DG  2  2   2   DG  DG  B . n 
B 2 3  DC  3  3   3   DC  DC  B . n 
B 2 4  DG  4  4   4   DG  DG  B . n 
B 2 5  DT  5  5   5   DT  DT  B . n 
B 2 6  DG  6  6   6   DG  DG  B . n 
B 2 7  DG  7  7   7   DG  DG  B . n 
B 2 8  DG  8  8   8   DG  DG  B . n 
B 2 9  DG  9  9   9   DG  DG  B . n 
B 2 10 DG  10 10  10  DG  DG  B . n 
B 2 11 DT  11 11  11  DT  DT  B . n 
C 3 1  DT  1  1   1   DT  DT  C . n 
C 3 2  DA  2  2   2   DA  DA  C . n 
C 3 3  DC  3  3   3   DC  DC  C . n 
C 3 4  DC  4  4   4   DC  DC  C . n 
C 3 5  DC  5  5   5   DC  DC  C . n 
C 3 6  DC  6  6   6   DC  DC  C . n 
C 3 7  DC  7  7   7   DC  DC  C . n 
C 3 8  DA  8  8   8   DA  DA  C . n 
C 3 9  DC  9  9   9   DC  DC  C . n 
C 3 10 DG  10 10  10  DG  DG  C . n 
C 3 11 DC  11 11  11  DC  DC  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1  501 1   ZN  ZN  A . 
E 4 ZN  1  502 2   ZN  ZN  A . 
F 4 ZN  1  503 3   ZN  ZN  A . 
G 5 HOH 1  601 2   HOH HOH A . 
G 5 HOH 2  602 126 HOH HOH A . 
G 5 HOH 3  603 87  HOH HOH A . 
G 5 HOH 4  604 61  HOH HOH A . 
G 5 HOH 5  605 84  HOH HOH A . 
G 5 HOH 6  606 48  HOH HOH A . 
G 5 HOH 7  607 32  HOH HOH A . 
G 5 HOH 8  608 74  HOH HOH A . 
G 5 HOH 9  609 10  HOH HOH A . 
G 5 HOH 10 610 55  HOH HOH A . 
G 5 HOH 11 611 54  HOH HOH A . 
G 5 HOH 12 612 102 HOH HOH A . 
G 5 HOH 13 613 18  HOH HOH A . 
G 5 HOH 14 614 26  HOH HOH A . 
G 5 HOH 15 615 66  HOH HOH A . 
G 5 HOH 16 616 19  HOH HOH A . 
G 5 HOH 17 617 40  HOH HOH A . 
G 5 HOH 18 618 9   HOH HOH A . 
G 5 HOH 19 619 3   HOH HOH A . 
G 5 HOH 20 620 29  HOH HOH A . 
G 5 HOH 21 621 109 HOH HOH A . 
G 5 HOH 22 622 107 HOH HOH A . 
G 5 HOH 23 623 23  HOH HOH A . 
G 5 HOH 24 624 35  HOH HOH A . 
G 5 HOH 25 625 36  HOH HOH A . 
G 5 HOH 26 626 62  HOH HOH A . 
G 5 HOH 27 627 76  HOH HOH A . 
G 5 HOH 28 628 15  HOH HOH A . 
G 5 HOH 29 629 52  HOH HOH A . 
G 5 HOH 30 630 105 HOH HOH A . 
G 5 HOH 31 631 39  HOH HOH A . 
G 5 HOH 32 632 8   HOH HOH A . 
G 5 HOH 33 633 42  HOH HOH A . 
G 5 HOH 34 634 51  HOH HOH A . 
G 5 HOH 35 635 104 HOH HOH A . 
G 5 HOH 36 636 79  HOH HOH A . 
G 5 HOH 37 637 47  HOH HOH A . 
G 5 HOH 38 638 103 HOH HOH A . 
G 5 HOH 39 639 77  HOH HOH A . 
G 5 HOH 40 640 4   HOH HOH A . 
G 5 HOH 41 641 33  HOH HOH A . 
G 5 HOH 42 642 11  HOH HOH A . 
G 5 HOH 43 643 34  HOH HOH A . 
G 5 HOH 44 644 113 HOH HOH A . 
G 5 HOH 45 645 38  HOH HOH A . 
G 5 HOH 46 646 97  HOH HOH A . 
G 5 HOH 47 647 100 HOH HOH A . 
G 5 HOH 48 648 81  HOH HOH A . 
G 5 HOH 49 649 24  HOH HOH A . 
G 5 HOH 50 650 95  HOH HOH A . 
G 5 HOH 51 651 1   HOH HOH A . 
G 5 HOH 52 652 28  HOH HOH A . 
G 5 HOH 53 653 128 HOH HOH A . 
G 5 HOH 54 654 67  HOH HOH A . 
G 5 HOH 55 655 60  HOH HOH A . 
G 5 HOH 56 656 71  HOH HOH A . 
G 5 HOH 57 657 17  HOH HOH A . 
G 5 HOH 58 658 53  HOH HOH A . 
G 5 HOH 59 659 21  HOH HOH A . 
G 5 HOH 60 660 70  HOH HOH A . 
G 5 HOH 61 661 99  HOH HOH A . 
G 5 HOH 62 662 118 HOH HOH A . 
G 5 HOH 63 663 108 HOH HOH A . 
G 5 HOH 64 664 63  HOH HOH A . 
G 5 HOH 65 665 127 HOH HOH A . 
G 5 HOH 66 666 50  HOH HOH A . 
G 5 HOH 67 667 106 HOH HOH A . 
H 5 HOH 1  101 49  HOH HOH B . 
H 5 HOH 2  102 31  HOH HOH B . 
H 5 HOH 3  103 130 HOH HOH B . 
H 5 HOH 4  104 22  HOH HOH B . 
H 5 HOH 5  105 82  HOH HOH B . 
H 5 HOH 6  106 78  HOH HOH B . 
H 5 HOH 7  107 73  HOH HOH B . 
H 5 HOH 8  108 6   HOH HOH B . 
H 5 HOH 9  109 30  HOH HOH B . 
H 5 HOH 10 110 12  HOH HOH B . 
H 5 HOH 11 111 20  HOH HOH B . 
H 5 HOH 12 112 120 HOH HOH B . 
H 5 HOH 13 113 116 HOH HOH B . 
H 5 HOH 14 114 115 HOH HOH B . 
H 5 HOH 15 115 91  HOH HOH B . 
H 5 HOH 16 116 94  HOH HOH B . 
H 5 HOH 17 117 58  HOH HOH B . 
H 5 HOH 18 118 83  HOH HOH B . 
H 5 HOH 19 119 75  HOH HOH B . 
H 5 HOH 20 120 59  HOH HOH B . 
H 5 HOH 21 121 5   HOH HOH B . 
H 5 HOH 22 122 44  HOH HOH B . 
H 5 HOH 23 123 45  HOH HOH B . 
H 5 HOH 24 124 7   HOH HOH B . 
H 5 HOH 25 125 41  HOH HOH B . 
H 5 HOH 26 126 27  HOH HOH B . 
H 5 HOH 27 127 85  HOH HOH B . 
H 5 HOH 28 128 16  HOH HOH B . 
H 5 HOH 29 129 14  HOH HOH B . 
H 5 HOH 30 130 13  HOH HOH B . 
H 5 HOH 31 131 119 HOH HOH B . 
H 5 HOH 32 132 43  HOH HOH B . 
H 5 HOH 33 133 96  HOH HOH B . 
H 5 HOH 34 134 110 HOH HOH B . 
H 5 HOH 35 135 90  HOH HOH B . 
I 5 HOH 1  101 89  HOH HOH C . 
I 5 HOH 2  102 37  HOH HOH C . 
I 5 HOH 3  103 88  HOH HOH C . 
I 5 HOH 4  104 114 HOH HOH C . 
I 5 HOH 5  105 65  HOH HOH C . 
I 5 HOH 6  106 46  HOH HOH C . 
I 5 HOH 7  107 125 HOH HOH C . 
I 5 HOH 8  108 72  HOH HOH C . 
I 5 HOH 9  109 117 HOH HOH C . 
I 5 HOH 10 110 64  HOH HOH C . 
I 5 HOH 11 111 93  HOH HOH C . 
I 5 HOH 12 112 112 HOH HOH C . 
I 5 HOH 13 113 68  HOH HOH C . 
I 5 HOH 14 114 25  HOH HOH C . 
I 5 HOH 15 115 98  HOH HOH C . 
I 5 HOH 16 116 56  HOH HOH C . 
I 5 HOH 17 117 129 HOH HOH C . 
I 5 HOH 18 118 124 HOH HOH C . 
I 5 HOH 19 119 57  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3670 ? 
1 MORE         -15  ? 
1 'SSA (A^2)'  8770 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 11 ? A CYS 355 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 SG  ? A CYS 16 ? A CYS 360 ? 1_555 114.5 ? 
2  SG  ? A CYS 11 ? A CYS 355 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 29 ? A HIS 373 ? 1_555 111.4 ? 
3  SG  ? A CYS 16 ? A CYS 360 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 29 ? A HIS 373 ? 1_555 107.7 ? 
4  SG  ? A CYS 11 ? A CYS 355 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 33 ? A HIS 377 ? 1_555 111.3 ? 
5  SG  ? A CYS 16 ? A CYS 360 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 33 ? A HIS 377 ? 1_555 109.8 ? 
6  NE2 ? A HIS 29 ? A HIS 373 ? 1_555 ZN ? D ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 33 ? A HIS 377 ? 1_555 101.3 ? 
7  SG  ? A CYS 41 ? A CYS 385 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 SG  ? A CYS 44 ? A CYS 388 ? 1_555 110.7 ? 
8  SG  ? A CYS 41 ? A CYS 385 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 57 ? A HIS 401 ? 1_555 110.3 ? 
9  SG  ? A CYS 44 ? A CYS 388 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 57 ? A HIS 401 ? 1_555 110.3 ? 
10 SG  ? A CYS 41 ? A CYS 385 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 61 ? A HIS 405 ? 1_555 111.9 ? 
11 SG  ? A CYS 44 ? A CYS 388 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 61 ? A HIS 405 ? 1_555 111.3 ? 
12 NE2 ? A HIS 57 ? A HIS 401 ? 1_555 ZN ? E ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 61 ? A HIS 405 ? 1_555 102.0 ? 
13 SG  ? A CYS 69 ? A CYS 413 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 SG  ? A CYS 74 ? A CYS 418 ? 1_555 114.2 ? 
14 SG  ? A CYS 69 ? A CYS 413 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 87 ? A HIS 431 ? 1_555 107.8 ? 
15 SG  ? A CYS 74 ? A CYS 418 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 87 ? A HIS 431 ? 1_555 113.1 ? 
16 SG  ? A CYS 69 ? A CYS 413 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 91 ? A HIS 435 ? 1_555 105.9 ? 
17 SG  ? A CYS 74 ? A CYS 418 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 91 ? A HIS 435 ? 1_555 116.5 ? 
18 NE2 ? A HIS 87 ? A HIS 431 ? 1_555 ZN ? F ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 91 ? A HIS 435 ? 1_555 97.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-09-14 
2 'Structure model' 1 1 2016-09-21 
3 'Structure model' 1 2 2016-12-14 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_audit_support 
2 5 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_audit_support.funding_organization' 
2 5 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 29.8146 -260.9393 -27.2640 0.2484 0.2489 0.2509 -0.0006 0.0520  -0.0307 3.5929 5.3080 5.3098 
1.6490  -0.4964 -0.2273 -0.2004 0.2912  -0.2463 -0.6073 0.3791 -0.8592 0.3529  0.5045  -0.1340 
'X-RAY DIFFRACTION' 2 ? refined 10.8415 -257.2223 -18.8395 0.1810 0.2208 0.4017 0.0021  -0.0013 0.0797  3.5246 5.1253 3.3489 
-3.1688 -1.8915 0.6565  -0.0604 0.4210  0.7552  0.0251  0.2516 0.4004  -0.2376 -0.2073 -0.1318 
'X-RAY DIFFRACTION' 3 ? refined 7.3913  -276.1955 -8.9402  0.1919 0.1734 0.1903 0.0017  0.0372  0.0101  6.3009 3.8970 7.4362 
2.3538  -1.5593 0.0759  -0.1070 -0.1038 0.0699  0.2227  0.1940 0.5202  0.1948  -0.1728 -0.0997 
'X-RAY DIFFRACTION' 4 ? refined 18.6746 -267.0042 -18.1970 0.2053 0.1287 0.1322 -0.0656 0.0042  -0.0006 3.7511 2.5535 1.5214 
0.4609  2.0978  -0.6748 -0.0526 0.2681  -0.0476 0.1334  0.1634 0.0473  0.4852  -0.1026 -0.0141 
'X-RAY DIFFRACTION' 5 ? refined 18.3795 -268.0570 -20.8876 0.2480 0.2503 0.1541 -0.0140 0.0268  -0.0279 1.4610 2.4451 5.2370 
0.5905  -0.7303 -1.0045 0.0511  0.0552  -0.1569 -0.2265 0.3724 -0.1240 0.1350  -0.3609 -0.2810 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 351 through 383 )
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 384 through 406 )
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 407 through 436 )
;
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 1 through 11 )
;
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 1 through 11 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(dev_2257: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HE A ARG 369 ? ? O A HOH 602 ? ? 1.59 
2 1 O  A HOH 601 ? ? O A HOH 638 ? ? 2.07 
3 1 O  A CYS 355 ? ? O A HOH 601 ? ? 2.09 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" B DG 2 ? B P     B DC 3 ? ? 1.437 1.607 -0.170 0.012 Y 
2 1 "O3'" C DC 5 ? ? "C3'" C DC 5 ? ? 1.353 1.419 -0.066 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "C3'" B DG 2 ? B "O3'" B DG 2 ? B P     B DC 3 ? ? 136.34 119.70 16.64 1.20 Y 
2 1 "O3'" B DG 2 ? B P     B DC 3 ? ? "O5'" B DC 3 ? ? 115.47 104.00 11.47 1.90 Y 
3 1 "O4'" B DC 3 ? ? "C1'" B DC 3 ? ? N1    B DC 3 ? ? 112.21 108.30 3.91  0.30 N 
4 1 "O4'" B DT 5 ? B "C1'" B DT 5 ? B N1    B DT 5 ? ? 111.31 108.30 3.01  0.30 N 
5 1 "O5'" B DG 6 ? B P     B DG 6 ? B OP1   B DG 6 ? B 118.34 110.70 7.64  1.20 N 
6 1 "O5'" B DG 6 ? B P     B DG 6 ? B OP2   B DG 6 ? B 100.22 105.70 -5.48 0.90 N 
7 1 "O4'" B DG 7 ? ? "C1'" B DG 7 ? ? N9    B DG 7 ? ? 110.14 108.30 1.84  0.30 N 
8 1 "O4'" C DA 2 ? A "C1'" C DA 2 ? A N9    C DA 2 ? ? 110.15 108.30 1.85  0.30 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 437 ? CG  ? A ARG 93 CG  
2 1 Y 1 A ARG 437 ? CD  ? A ARG 93 CD  
3 1 Y 1 A ARG 437 ? NE  ? A ARG 93 NE  
4 1 Y 1 A ARG 437 ? CZ  ? A ARG 93 CZ  
5 1 Y 1 A ARG 437 ? NH1 ? A ARG 93 NH1 
6 1 Y 1 A ARG 437 ? NH2 ? A ARG 93 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 345 ? A GLY 1 
2 1 Y 1 A PRO 346 ? A PRO 2 
3 1 Y 1 A LEU 347 ? A LEU 3 
4 1 Y 1 A GLY 348 ? A GLY 4 
5 1 Y 1 A SER 349 ? A SER 5 
6 1 Y 1 A GLU 350 ? A GLU 6 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5KL6 'double helix'        
5KL6 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 2  1_555 C DC 11 1_555 -0.316 -0.070 -0.011 -4.326 -2.524  0.918  1  B_DG2:DC11_C B 2  ? C 11 ? 19 1 
1 B DC 3  1_555 C DG 10 1_555 0.156  -0.200 -0.160 9.171  -5.907  0.850  2  B_DC3:DG10_C B 3  ? C 10 ? 19 1 
1 B DG 4  1_555 C DC 9  1_555 -0.233 -0.182 -0.004 -3.360 -6.564  -1.558 3  B_DG4:DC9_C  B 4  ? C 9  ? 19 1 
1 B DT 5  1_555 C DA 8  1_555 -0.049 -0.160 -0.194 7.330  -3.561  2.657  4  B_DT5:DA8_C  B 5  ? C 8  ? 20 1 
1 B DG 6  1_555 C DC 7  1_555 -0.187 -0.129 0.040  -7.208 -12.676 -0.794 5  B_DG6:DC7_C  B 6  ? C 7  ? 19 1 
1 B DG 7  1_555 C DC 6  1_555 -0.121 -0.237 -0.119 -7.683 -8.677  -5.222 6  B_DG7:DC6_C  B 7  ? C 6  ? 19 1 
1 B DG 8  1_555 C DC 5  1_555 -0.008 -0.270 0.024  -3.417 -9.948  -1.763 7  B_DG8:DC5_C  B 8  ? C 5  ? 19 1 
1 B DG 9  1_555 C DC 4  1_555 -0.308 -0.223 0.364  5.660  -11.837 -3.194 8  B_DG9:DC4_C  B 9  ? C 4  ? 19 1 
1 B DG 10 1_555 C DC 3  1_555 -0.327 -0.225 -0.153 -3.645 -7.038  -0.311 9  B_DG10:DC3_C B 10 ? C 3  ? 19 1 
1 B DT 11 1_555 C DA 2  1_555 0.037  -0.116 -0.203 10.273 -8.078  4.067  10 B_DT11:DA2_C B 11 ? C 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 2  1_555 C DC 11 1_555 B DC 3  1_555 C DG 10 1_555 0.570  -0.231 2.984 0.706  3.353  28.832 -1.131 -0.996 2.951 6.704  
-1.412 29.031 1 BB_DG2DC3:DG10DC11_CC B 2  ? C 11 ? B 3  ? C 10 ? 
1 B DC 3  1_555 C DG 10 1_555 B DG 4  1_555 C DC 9  1_555 -1.170 -0.274 3.520 -5.107 5.918  35.651 -1.335 1.095  3.559 9.525  
8.219  36.471 2 BB_DC3DG4:DC9DG10_CC  B 3  ? C 10 ? B 4  ? C 9  ? 
1 B DG 4  1_555 C DC 9  1_555 B DT 5  1_555 C DA 8  1_555 0.724  -0.422 3.162 1.046  6.715  28.643 -2.206 -1.212 3.011 13.338 
-2.078 29.421 3 BB_DG4DT5:DA8DC9_CC   B 4  ? C 9  ? B 5  ? C 8  ? 
1 B DT 5  1_555 C DA 8  1_555 B DG 6  1_555 C DC 7  1_555 -1.047 -0.440 3.673 -5.211 0.333  34.627 -0.789 0.842  3.782 0.556  
8.693  35.006 4 BB_DT5DG6:DC7DA8_CC   B 5  ? C 8  ? B 6  ? C 7  ? 
1 B DG 6  1_555 C DC 7  1_555 B DG 7  1_555 C DC 6  1_555 -0.609 -1.019 3.359 0.852  6.736  34.468 -2.694 1.137  3.096 11.234 
-1.420 35.110 5 BB_DG6DG7:DC6DC7_CC   B 6  ? C 7  ? B 7  ? C 6  ? 
1 B DG 7  1_555 C DC 6  1_555 B DG 8  1_555 C DC 5  1_555 0.446  -0.926 3.332 -3.038 3.416  35.338 -2.010 -1.171 3.183 5.598  
4.978  35.623 6 BB_DG7DG8:DC5DC6_CC   B 7  ? C 6  ? B 8  ? C 5  ? 
1 B DG 8  1_555 C DC 5  1_555 B DG 9  1_555 C DC 4  1_555 -1.131 -1.792 3.018 -5.694 2.042  21.919 -5.242 0.937  3.033 5.243  
14.619 22.728 7 BB_DG8DG9:DC4DC5_CC   B 8  ? C 5  ? B 9  ? C 4  ? 
1 B DG 9  1_555 C DC 4  1_555 B DG 10 1_555 C DC 3  1_555 0.675  -1.359 3.591 5.255  -1.200 32.512 -2.167 -0.187 3.699 -2.126 
-9.306 32.944 8 BB_DG9DG10:DC3DC4_CC  B 9  ? C 4  ? B 10 ? C 3  ? 
1 B DG 10 1_555 C DC 3  1_555 B DT 11 1_555 C DA 2  1_555 0.004  -0.883 3.044 -0.406 3.684  32.714 -2.133 -0.071 2.930 6.515  
0.718  32.917 9 BB_DG10DT11:DA2DC3_CC B 10 ? C 3  ? B 11 ? C 2  ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM049245 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#