data_5L4G
# 
_entry.id   5L4G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5L4G         
WWPDB D_1200000097 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          EMD-4002 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5L4G 
_pdbx_database_status.recvd_initial_deposition_date   2016-05-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           N 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schweitzer, A.'  1 
'Aufderheide, A.' 2 
'Rudack, T.'      3 
'Beck, F.'        4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            113 
_citation.language                  ? 
_citation.page_first                7816 
_citation.page_last                 7821 
_citation.title                     'Structure of the human 26S proteasome at a resolution of 3.9 angstrom.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1608050113 
_citation.pdbx_database_id_PubMed   27342858 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schweitzer, A.'  1  ? 
primary 'Aufderheide, A.' 2  ? 
primary 'Rudack, T.'      3  ? 
primary 'Beck, F.'        4  ? 
primary 'Pfeifer, G.'     5  ? 
primary 'Plitzko, J.M.'   6  ? 
primary 'Sakata, E.'      7  ? 
primary 'Schulten, K.'    8  ? 
primary 'Forster, F.'     9  ? 
primary 'Baumeister, W.'  10 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5L4G 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5L4G 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Proteasome subunit alpha type-6'     27432.459 2 3.4.25.1 ? ? ? 
2  polymer     nat 'Proteasome subunit alpha type-2'     25927.535 2 3.4.25.1 ? ? ? 
3  polymer     nat 'Proteasome subunit alpha type-4'     29525.842 2 3.4.25.1 ? ? ? 
4  polymer     nat 'Proteasome subunit alpha type-7'     27929.891 2 3.4.25.1 ? ? ? 
5  polymer     nat 'Proteasome subunit alpha type-5'     26435.977 2 3.4.25.1 ? ? ? 
6  polymer     nat 'Proteasome subunit alpha type-1'     29595.627 2 3.4.25.1 ? ? ? 
7  polymer     nat 'Proteasome subunit alpha type-3'     28469.252 2 3.4.25.1 ? ? ? 
8  polymer     nat 'Proteasome subunit beta type-1'      26522.396 2 3.4.25.1 ? ? ? 
9  polymer     man 'Proteasome subunit beta type-2'      22864.277 2 3.4.25.1 ? ? ? 
10 polymer     nat 'Proteasome subunit beta type-3'      22972.896 2 3.4.25.1 ? ? ? 
11 polymer     nat 'Proteasome subunit beta type-4'      29231.178 2 3.4.25.1 ? ? ? 
12 polymer     nat 'Proteasome subunit beta type-5'      28510.248 2 3.4.25.1 ? ? ? 
13 polymer     nat 'Proteasome subunit beta type-6'      25377.652 2 3.4.25.1 ? ? ? 
14 polymer     nat 'Proteasome subunit beta type-7'      30000.418 2 3.4.25.1 ? ? ? 
15 polymer     nat '26S protease regulatory subunit 7'   48700.805 1 ?        ? ? ? 
16 polymer     nat '26S protease regulatory subunit 4'   49260.504 1 ?        ? ? ? 
17 polymer     nat '26S protease regulatory subunit 6B'  47426.141 1 ?        ? ? ? 
18 polymer     nat '26S protease regulatory subunit 10B' 44241.008 1 ?        ? ? ? 
19 polymer     nat '26S protease regulatory subunit 6A'  49266.457 1 ?        ? ? ? 
20 polymer     nat '26S protease regulatory subunit 8'   45694.047 1 ?        ? ? ? 
21 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"           507.181   5 ?        ? ? ? 
22 non-polymer syn 'MAGNESIUM ION'                       24.305    5 ?        ? ? ? 
23 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"            427.201   1 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  '27 kDa prosomal protein,p27K,Macropain iota chain,Multicatalytic endopeptidase complex iota chain,Proteasome iota chain' 
2  'Macropain subunit C3,Multicatalytic endopeptidase complex subunit C3,Proteasome component C3' 
3  'Macropain subunit C9,Multicatalytic endopeptidase complex subunit C9,Proteasome component C9,Proteasome subunit L' 
4  'Proteasome subunit RC6-1,Proteasome subunit XAPC7' 
5  'Macropain zeta chain,Multicatalytic endopeptidase complex zeta chain,Proteasome zeta chain' 
6  
;30 kDa prosomal protein,PROS-30,Macropain subunit C2,Multicatalytic endopeptidase complex subunit C2,Proteasome component C2,Proteasome nu chain
;
7  'Macropain subunit C8,Multicatalytic endopeptidase complex subunit C8,Proteasome component C8' 
8  'Macropain subunit C5,Multicatalytic endopeptidase complex subunit C5,Proteasome component C5,Proteasome gamma chain' 
9  'Macropain subunit C7-I,Multicatalytic endopeptidase complex subunit C7-I,Proteasome component C7-I' 
10 'Proteasome chain 13,Proteasome component C10-II,Proteasome theta chain' 
11 
;26 kDa prosomal protein,PROS-26,Macropain beta chain,Multicatalytic endopeptidase complex beta chain,Proteasome beta chain,Proteasome chain 3,HsN3
;
12 
;Macropain epsilon chain,Multicatalytic endopeptidase complex epsilon chain,Proteasome chain 6,Proteasome epsilon chain,Proteasome subunit MB1,Proteasome subunit X
;
13 'Macropain delta chain,Multicatalytic endopeptidase complex delta chain,Proteasome delta chain,Proteasome subunit Y' 
14 'Macropain chain Z,Multicatalytic endopeptidase complex chain Z,Proteasome subunit Z' 
15 '26S proteasome AAA-ATPase subunit RPT1,Proteasome 26S subunit ATPase 2,Protein MSS1' 
16 'P26s4,26S proteasome AAA-ATPase subunit RPT2,Proteasome 26S subunit ATPase 1' 
17 
'26S proteasome AAA-ATPase subunit RPT3,MB67-interacting protein,MIP224,Proteasome 26S subunit ATPase 4,Tat-binding protein 7,TBP-7' 
18 '26S proteasome AAA-ATPase subunit RPT4,Proteasome 26S subunit ATPase 6,Proteasome subunit p42' 
19 '26S proteasome AAA-ATPase subunit RPT5,Proteasome 26S subunit ATPase 3,Proteasome subunit P50,Tat-binding protein 1,TBP-1' 
20 
;26S proteasome AAA-ATPase subunit RPT6,Proteasome 26S subunit ATPase 5,Proteasome subunit p45,Thyroid hormone receptor-interacting protein 1,TRIP1,p45/SUG
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVM
TGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYY
CGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
;
;MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVM
TGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYY
CGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
;
N,A ? 
2  'polypeptide(L)' no no 
;MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG
PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKA
TAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
;
;MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG
PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKA
TAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
;
O,B ? 
3  'polypeptide(L)' no no 
;MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGIT
SDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWK
ATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
;
;MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGIT
SDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWK
ATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
;
P,C ? 
4  'polypeptide(L)' no no 
;MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA
RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANA
IGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
;
;MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA
RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANA
IGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
;
Q,D ? 
5  'polypeptide(L)' no no 
;MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG
LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
;
;MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG
LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
;
R,E ? 
6  'polypeptide(L)' no no 
;MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD
ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
;
;MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD
ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
;
S,F ? 
7  'polypeptide(L)' no no 
;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG
LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYG
YWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
;
;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG
LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYG
YWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
;
T,G ? 
8  'polypeptide(L)' no no 
;MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVI
GCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQR
DSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRK
D
;
;MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVI
GCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQR
DSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRK
D
;
U,1 ? 
9  'polypeptide(L)' no no 
;MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA
ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
;
;MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA
ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
;
V,2 ? 
10 'polypeptide(L)' no no 
;MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR
QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDP
DHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
;
;MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR
QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDP
DHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
;
W,3 ? 
11 'polypeptide(L)' no no 
;MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLAR
FRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGY
ADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSTETNWDIAHMISGFE
;
;MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLAR
FRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGY
ADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSTETNWDIAHMISGFE
;
X,4 ? 
12 'polypeptide(L)' no no 
;MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRAT
AGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMI
CGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
;
;MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRAT
AGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMI
CGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
;
Y,5 ? 
13 'polypeptide(L)' no no 
;MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRS
GSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFA
IGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA
;
;MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRS
GSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFA
IGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA
;
Z,6 ? 
14 'polypeptide(L)' no no 
;MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFI
SPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHG
STDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
;
;MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFI
SPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHG
STDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
;
8,7 ? 
15 'polypeptide(L)' no no 
;MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDL
AADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPT
VTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMA
TNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRAR
RKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN
;
;MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDL
AADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPT
VTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMA
TNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRAR
RKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN
;
H   ? 
16 'polypeptide(L)' no no 
;MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIR
NQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVI
GVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFD
SRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICT
EAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
;
;MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIR
NQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVI
GVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFD
SRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICT
EAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
;
I   ? 
17 'polypeptide(L)' no no 
;MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVK
RIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKP
DVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPA
LLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFE
KAYKTVIKKDEQEHEFYK
;
;MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVK
RIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKP
DVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPA
LLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFE
KAYKTVIKKDEQEHEFYK
;
K   ? 
18 'polypeptide(L)' no no 
;MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYV
VGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQ
RVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPI
TKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
;
;MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYV
VGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQ
RVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPI
TKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
;
L   ? 
19 'polypeptide(L)' no no 
;MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKI
KVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLI
LETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGF
QPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVC
VEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA
;
;MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKI
KVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLI
LETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGF
QPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVC
VEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA
;
M   ? 
20 'polypeptide(L)' no no 
;MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAM
DKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKE
IKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPP
NEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMS
IKKLWK
;
;MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAM
DKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKE
IKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPP
NEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMS
IKKLWK
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   SER n 
1  3   ARG n 
1  4   GLY n 
1  5   SER n 
1  6   SER n 
1  7   ALA n 
1  8   GLY n 
1  9   PHE n 
1  10  ASP n 
1  11  ARG n 
1  12  HIS n 
1  13  ILE n 
1  14  THR n 
1  15  ILE n 
1  16  PHE n 
1  17  SER n 
1  18  PRO n 
1  19  GLU n 
1  20  GLY n 
1  21  ARG n 
1  22  LEU n 
1  23  TYR n 
1  24  GLN n 
1  25  VAL n 
1  26  GLU n 
1  27  TYR n 
1  28  ALA n 
1  29  PHE n 
1  30  LYS n 
1  31  ALA n 
1  32  ILE n 
1  33  ASN n 
1  34  GLN n 
1  35  GLY n 
1  36  GLY n 
1  37  LEU n 
1  38  THR n 
1  39  SER n 
1  40  VAL n 
1  41  ALA n 
1  42  VAL n 
1  43  ARG n 
1  44  GLY n 
1  45  LYS n 
1  46  ASP n 
1  47  CYS n 
1  48  ALA n 
1  49  VAL n 
1  50  ILE n 
1  51  VAL n 
1  52  THR n 
1  53  GLN n 
1  54  LYS n 
1  55  LYS n 
1  56  VAL n 
1  57  PRO n 
1  58  ASP n 
1  59  LYS n 
1  60  LEU n 
1  61  LEU n 
1  62  ASP n 
1  63  SER n 
1  64  SER n 
1  65  THR n 
1  66  VAL n 
1  67  THR n 
1  68  HIS n 
1  69  LEU n 
1  70  PHE n 
1  71  LYS n 
1  72  ILE n 
1  73  THR n 
1  74  GLU n 
1  75  ASN n 
1  76  ILE n 
1  77  GLY n 
1  78  CYS n 
1  79  VAL n 
1  80  MET n 
1  81  THR n 
1  82  GLY n 
1  83  MET n 
1  84  THR n 
1  85  ALA n 
1  86  ASP n 
1  87  SER n 
1  88  ARG n 
1  89  SER n 
1  90  GLN n 
1  91  VAL n 
1  92  GLN n 
1  93  ARG n 
1  94  ALA n 
1  95  ARG n 
1  96  TYR n 
1  97  GLU n 
1  98  ALA n 
1  99  ALA n 
1  100 ASN n 
1  101 TRP n 
1  102 LYS n 
1  103 TYR n 
1  104 LYS n 
1  105 TYR n 
1  106 GLY n 
1  107 TYR n 
1  108 GLU n 
1  109 ILE n 
1  110 PRO n 
1  111 VAL n 
1  112 ASP n 
1  113 MET n 
1  114 LEU n 
1  115 CYS n 
1  116 LYS n 
1  117 ARG n 
1  118 ILE n 
1  119 ALA n 
1  120 ASP n 
1  121 ILE n 
1  122 SER n 
1  123 GLN n 
1  124 VAL n 
1  125 TYR n 
1  126 THR n 
1  127 GLN n 
1  128 ASN n 
1  129 ALA n 
1  130 GLU n 
1  131 MET n 
1  132 ARG n 
1  133 PRO n 
1  134 LEU n 
1  135 GLY n 
1  136 CYS n 
1  137 CYS n 
1  138 MET n 
1  139 ILE n 
1  140 LEU n 
1  141 ILE n 
1  142 GLY n 
1  143 ILE n 
1  144 ASP n 
1  145 GLU n 
1  146 GLU n 
1  147 GLN n 
1  148 GLY n 
1  149 PRO n 
1  150 GLN n 
1  151 VAL n 
1  152 TYR n 
1  153 LYS n 
1  154 CYS n 
1  155 ASP n 
1  156 PRO n 
1  157 ALA n 
1  158 GLY n 
1  159 TYR n 
1  160 TYR n 
1  161 CYS n 
1  162 GLY n 
1  163 PHE n 
1  164 LYS n 
1  165 ALA n 
1  166 THR n 
1  167 ALA n 
1  168 ALA n 
1  169 GLY n 
1  170 VAL n 
1  171 LYS n 
1  172 GLN n 
1  173 THR n 
1  174 GLU n 
1  175 SER n 
1  176 THR n 
1  177 SER n 
1  178 PHE n 
1  179 LEU n 
1  180 GLU n 
1  181 LYS n 
1  182 LYS n 
1  183 VAL n 
1  184 LYS n 
1  185 LYS n 
1  186 LYS n 
1  187 PHE n 
1  188 ASP n 
1  189 TRP n 
1  190 THR n 
1  191 PHE n 
1  192 GLU n 
1  193 GLN n 
1  194 THR n 
1  195 VAL n 
1  196 GLU n 
1  197 THR n 
1  198 ALA n 
1  199 ILE n 
1  200 THR n 
1  201 CYS n 
1  202 LEU n 
1  203 SER n 
1  204 THR n 
1  205 VAL n 
1  206 LEU n 
1  207 SER n 
1  208 ILE n 
1  209 ASP n 
1  210 PHE n 
1  211 LYS n 
1  212 PRO n 
1  213 SER n 
1  214 GLU n 
1  215 ILE n 
1  216 GLU n 
1  217 VAL n 
1  218 GLY n 
1  219 VAL n 
1  220 VAL n 
1  221 THR n 
1  222 VAL n 
1  223 GLU n 
1  224 ASN n 
1  225 PRO n 
1  226 LYS n 
1  227 PHE n 
1  228 ARG n 
1  229 ILE n 
1  230 LEU n 
1  231 THR n 
1  232 GLU n 
1  233 ALA n 
1  234 GLU n 
1  235 ILE n 
1  236 ASP n 
1  237 ALA n 
1  238 HIS n 
1  239 LEU n 
1  240 VAL n 
1  241 ALA n 
1  242 LEU n 
1  243 ALA n 
1  244 GLU n 
1  245 ARG n 
1  246 ASP n 
2  1   MET n 
2  2   ALA n 
2  3   GLU n 
2  4   ARG n 
2  5   GLY n 
2  6   TYR n 
2  7   SER n 
2  8   PHE n 
2  9   SER n 
2  10  LEU n 
2  11  THR n 
2  12  THR n 
2  13  PHE n 
2  14  SER n 
2  15  PRO n 
2  16  SER n 
2  17  GLY n 
2  18  LYS n 
2  19  LEU n 
2  20  VAL n 
2  21  GLN n 
2  22  ILE n 
2  23  GLU n 
2  24  TYR n 
2  25  ALA n 
2  26  LEU n 
2  27  ALA n 
2  28  ALA n 
2  29  VAL n 
2  30  ALA n 
2  31  GLY n 
2  32  GLY n 
2  33  ALA n 
2  34  PRO n 
2  35  SER n 
2  36  VAL n 
2  37  GLY n 
2  38  ILE n 
2  39  LYS n 
2  40  ALA n 
2  41  ALA n 
2  42  ASN n 
2  43  GLY n 
2  44  VAL n 
2  45  VAL n 
2  46  LEU n 
2  47  ALA n 
2  48  THR n 
2  49  GLU n 
2  50  LYS n 
2  51  LYS n 
2  52  GLN n 
2  53  LYS n 
2  54  SER n 
2  55  ILE n 
2  56  LEU n 
2  57  TYR n 
2  58  ASP n 
2  59  GLU n 
2  60  ARG n 
2  61  SER n 
2  62  VAL n 
2  63  HIS n 
2  64  LYS n 
2  65  VAL n 
2  66  GLU n 
2  67  PRO n 
2  68  ILE n 
2  69  THR n 
2  70  LYS n 
2  71  HIS n 
2  72  ILE n 
2  73  GLY n 
2  74  LEU n 
2  75  VAL n 
2  76  TYR n 
2  77  SER n 
2  78  GLY n 
2  79  MET n 
2  80  GLY n 
2  81  PRO n 
2  82  ASP n 
2  83  TYR n 
2  84  ARG n 
2  85  VAL n 
2  86  LEU n 
2  87  VAL n 
2  88  HIS n 
2  89  ARG n 
2  90  ALA n 
2  91  ARG n 
2  92  LYS n 
2  93  LEU n 
2  94  ALA n 
2  95  GLN n 
2  96  GLN n 
2  97  TYR n 
2  98  TYR n 
2  99  LEU n 
2  100 VAL n 
2  101 TYR n 
2  102 GLN n 
2  103 GLU n 
2  104 PRO n 
2  105 ILE n 
2  106 PRO n 
2  107 THR n 
2  108 ALA n 
2  109 GLN n 
2  110 LEU n 
2  111 VAL n 
2  112 GLN n 
2  113 ARG n 
2  114 VAL n 
2  115 ALA n 
2  116 SER n 
2  117 VAL n 
2  118 MET n 
2  119 GLN n 
2  120 GLU n 
2  121 TYR n 
2  122 THR n 
2  123 GLN n 
2  124 SER n 
2  125 GLY n 
2  126 GLY n 
2  127 VAL n 
2  128 ARG n 
2  129 PRO n 
2  130 PHE n 
2  131 GLY n 
2  132 VAL n 
2  133 SER n 
2  134 LEU n 
2  135 LEU n 
2  136 ILE n 
2  137 CYS n 
2  138 GLY n 
2  139 TRP n 
2  140 ASN n 
2  141 GLU n 
2  142 GLY n 
2  143 ARG n 
2  144 PRO n 
2  145 TYR n 
2  146 LEU n 
2  147 PHE n 
2  148 GLN n 
2  149 SER n 
2  150 ASP n 
2  151 PRO n 
2  152 SER n 
2  153 GLY n 
2  154 ALA n 
2  155 TYR n 
2  156 PHE n 
2  157 ALA n 
2  158 TRP n 
2  159 LYS n 
2  160 ALA n 
2  161 THR n 
2  162 ALA n 
2  163 MET n 
2  164 GLY n 
2  165 LYS n 
2  166 ASN n 
2  167 TYR n 
2  168 VAL n 
2  169 ASN n 
2  170 GLY n 
2  171 LYS n 
2  172 THR n 
2  173 PHE n 
2  174 LEU n 
2  175 GLU n 
2  176 LYS n 
2  177 ARG n 
2  178 TYR n 
2  179 ASN n 
2  180 GLU n 
2  181 ASP n 
2  182 LEU n 
2  183 GLU n 
2  184 LEU n 
2  185 GLU n 
2  186 ASP n 
2  187 ALA n 
2  188 ILE n 
2  189 HIS n 
2  190 THR n 
2  191 ALA n 
2  192 ILE n 
2  193 LEU n 
2  194 THR n 
2  195 LEU n 
2  196 LYS n 
2  197 GLU n 
2  198 SER n 
2  199 PHE n 
2  200 GLU n 
2  201 GLY n 
2  202 GLN n 
2  203 MET n 
2  204 THR n 
2  205 GLU n 
2  206 ASP n 
2  207 ASN n 
2  208 ILE n 
2  209 GLU n 
2  210 VAL n 
2  211 GLY n 
2  212 ILE n 
2  213 CYS n 
2  214 ASN n 
2  215 GLU n 
2  216 ALA n 
2  217 GLY n 
2  218 PHE n 
2  219 ARG n 
2  220 ARG n 
2  221 LEU n 
2  222 THR n 
2  223 PRO n 
2  224 THR n 
2  225 GLU n 
2  226 VAL n 
2  227 LYS n 
2  228 ASP n 
2  229 TYR n 
2  230 LEU n 
2  231 ALA n 
2  232 ALA n 
2  233 ILE n 
2  234 ALA n 
3  1   MET n 
3  2   SER n 
3  3   ARG n 
3  4   ARG n 
3  5   TYR n 
3  6   ASP n 
3  7   SER n 
3  8   ARG n 
3  9   THR n 
3  10  THR n 
3  11  ILE n 
3  12  PHE n 
3  13  SER n 
3  14  PRO n 
3  15  GLU n 
3  16  GLY n 
3  17  ARG n 
3  18  LEU n 
3  19  TYR n 
3  20  GLN n 
3  21  VAL n 
3  22  GLU n 
3  23  TYR n 
3  24  ALA n 
3  25  MET n 
3  26  GLU n 
3  27  ALA n 
3  28  ILE n 
3  29  GLY n 
3  30  HIS n 
3  31  ALA n 
3  32  GLY n 
3  33  THR n 
3  34  CYS n 
3  35  LEU n 
3  36  GLY n 
3  37  ILE n 
3  38  LEU n 
3  39  ALA n 
3  40  ASN n 
3  41  ASP n 
3  42  GLY n 
3  43  VAL n 
3  44  LEU n 
3  45  LEU n 
3  46  ALA n 
3  47  ALA n 
3  48  GLU n 
3  49  ARG n 
3  50  ARG n 
3  51  ASN n 
3  52  ILE n 
3  53  HIS n 
3  54  LYS n 
3  55  LEU n 
3  56  LEU n 
3  57  ASP n 
3  58  GLU n 
3  59  VAL n 
3  60  PHE n 
3  61  PHE n 
3  62  SER n 
3  63  GLU n 
3  64  LYS n 
3  65  ILE n 
3  66  TYR n 
3  67  LYS n 
3  68  LEU n 
3  69  ASN n 
3  70  GLU n 
3  71  ASP n 
3  72  MET n 
3  73  ALA n 
3  74  CYS n 
3  75  SER n 
3  76  VAL n 
3  77  ALA n 
3  78  GLY n 
3  79  ILE n 
3  80  THR n 
3  81  SER n 
3  82  ASP n 
3  83  ALA n 
3  84  ASN n 
3  85  VAL n 
3  86  LEU n 
3  87  THR n 
3  88  ASN n 
3  89  GLU n 
3  90  LEU n 
3  91  ARG n 
3  92  LEU n 
3  93  ILE n 
3  94  ALA n 
3  95  GLN n 
3  96  ARG n 
3  97  TYR n 
3  98  LEU n 
3  99  LEU n 
3  100 GLN n 
3  101 TYR n 
3  102 GLN n 
3  103 GLU n 
3  104 PRO n 
3  105 ILE n 
3  106 PRO n 
3  107 CYS n 
3  108 GLU n 
3  109 GLN n 
3  110 LEU n 
3  111 VAL n 
3  112 THR n 
3  113 ALA n 
3  114 LEU n 
3  115 CYS n 
3  116 ASP n 
3  117 ILE n 
3  118 LYS n 
3  119 GLN n 
3  120 ALA n 
3  121 TYR n 
3  122 THR n 
3  123 GLN n 
3  124 PHE n 
3  125 GLY n 
3  126 GLY n 
3  127 LYS n 
3  128 ARG n 
3  129 PRO n 
3  130 PHE n 
3  131 GLY n 
3  132 VAL n 
3  133 SER n 
3  134 LEU n 
3  135 LEU n 
3  136 TYR n 
3  137 ILE n 
3  138 GLY n 
3  139 TRP n 
3  140 ASP n 
3  141 LYS n 
3  142 HIS n 
3  143 TYR n 
3  144 GLY n 
3  145 PHE n 
3  146 GLN n 
3  147 LEU n 
3  148 TYR n 
3  149 GLN n 
3  150 SER n 
3  151 ASP n 
3  152 PRO n 
3  153 SER n 
3  154 GLY n 
3  155 ASN n 
3  156 TYR n 
3  157 GLY n 
3  158 GLY n 
3  159 TRP n 
3  160 LYS n 
3  161 ALA n 
3  162 THR n 
3  163 CYS n 
3  164 ILE n 
3  165 GLY n 
3  166 ASN n 
3  167 ASN n 
3  168 SER n 
3  169 ALA n 
3  170 ALA n 
3  171 ALA n 
3  172 VAL n 
3  173 SER n 
3  174 MET n 
3  175 LEU n 
3  176 LYS n 
3  177 GLN n 
3  178 ASP n 
3  179 TYR n 
3  180 LYS n 
3  181 GLU n 
3  182 GLY n 
3  183 GLU n 
3  184 MET n 
3  185 THR n 
3  186 LEU n 
3  187 LYS n 
3  188 SER n 
3  189 ALA n 
3  190 LEU n 
3  191 ALA n 
3  192 LEU n 
3  193 ALA n 
3  194 ILE n 
3  195 LYS n 
3  196 VAL n 
3  197 LEU n 
3  198 ASN n 
3  199 LYS n 
3  200 THR n 
3  201 MET n 
3  202 ASP n 
3  203 VAL n 
3  204 SER n 
3  205 LYS n 
3  206 LEU n 
3  207 SER n 
3  208 ALA n 
3  209 GLU n 
3  210 LYS n 
3  211 VAL n 
3  212 GLU n 
3  213 ILE n 
3  214 ALA n 
3  215 THR n 
3  216 LEU n 
3  217 THR n 
3  218 ARG n 
3  219 GLU n 
3  220 ASN n 
3  221 GLY n 
3  222 LYS n 
3  223 THR n 
3  224 VAL n 
3  225 ILE n 
3  226 ARG n 
3  227 VAL n 
3  228 LEU n 
3  229 LYS n 
3  230 GLN n 
3  231 LYS n 
3  232 GLU n 
3  233 VAL n 
3  234 GLU n 
3  235 GLN n 
3  236 LEU n 
3  237 ILE n 
3  238 LYS n 
3  239 LYS n 
3  240 HIS n 
3  241 GLU n 
3  242 GLU n 
3  243 GLU n 
3  244 GLU n 
3  245 ALA n 
3  246 LYS n 
3  247 ALA n 
3  248 GLU n 
3  249 ARG n 
3  250 GLU n 
3  251 LYS n 
3  252 LYS n 
3  253 GLU n 
3  254 LYS n 
3  255 GLU n 
3  256 GLN n 
3  257 LYS n 
3  258 GLU n 
3  259 LYS n 
3  260 ASP n 
3  261 LYS n 
4  1   MET n 
4  2   SER n 
4  3   TYR n 
4  4   ASP n 
4  5   ARG n 
4  6   ALA n 
4  7   ILE n 
4  8   THR n 
4  9   VAL n 
4  10  PHE n 
4  11  SER n 
4  12  PRO n 
4  13  ASP n 
4  14  GLY n 
4  15  HIS n 
4  16  LEU n 
4  17  PHE n 
4  18  GLN n 
4  19  VAL n 
4  20  GLU n 
4  21  TYR n 
4  22  ALA n 
4  23  GLN n 
4  24  GLU n 
4  25  ALA n 
4  26  VAL n 
4  27  LYS n 
4  28  LYS n 
4  29  GLY n 
4  30  SER n 
4  31  THR n 
4  32  ALA n 
4  33  VAL n 
4  34  GLY n 
4  35  VAL n 
4  36  ARG n 
4  37  GLY n 
4  38  ARG n 
4  39  ASP n 
4  40  ILE n 
4  41  VAL n 
4  42  VAL n 
4  43  LEU n 
4  44  GLY n 
4  45  VAL n 
4  46  GLU n 
4  47  LYS n 
4  48  LYS n 
4  49  SER n 
4  50  VAL n 
4  51  ALA n 
4  52  LYS n 
4  53  LEU n 
4  54  GLN n 
4  55  ASP n 
4  56  GLU n 
4  57  ARG n 
4  58  THR n 
4  59  VAL n 
4  60  ARG n 
4  61  LYS n 
4  62  ILE n 
4  63  CYS n 
4  64  ALA n 
4  65  LEU n 
4  66  ASP n 
4  67  ASP n 
4  68  ASN n 
4  69  VAL n 
4  70  CYS n 
4  71  MET n 
4  72  ALA n 
4  73  PHE n 
4  74  ALA n 
4  75  GLY n 
4  76  LEU n 
4  77  THR n 
4  78  ALA n 
4  79  ASP n 
4  80  ALA n 
4  81  ARG n 
4  82  ILE n 
4  83  VAL n 
4  84  ILE n 
4  85  ASN n 
4  86  ARG n 
4  87  ALA n 
4  88  ARG n 
4  89  VAL n 
4  90  GLU n 
4  91  CYS n 
4  92  GLN n 
4  93  SER n 
4  94  HIS n 
4  95  ARG n 
4  96  LEU n 
4  97  THR n 
4  98  VAL n 
4  99  GLU n 
4  100 ASP n 
4  101 PRO n 
4  102 VAL n 
4  103 THR n 
4  104 VAL n 
4  105 GLU n 
4  106 TYR n 
4  107 ILE n 
4  108 THR n 
4  109 ARG n 
4  110 TYR n 
4  111 ILE n 
4  112 ALA n 
4  113 SER n 
4  114 LEU n 
4  115 LYS n 
4  116 GLN n 
4  117 ARG n 
4  118 TYR n 
4  119 THR n 
4  120 GLN n 
4  121 SER n 
4  122 ASN n 
4  123 GLY n 
4  124 ARG n 
4  125 ARG n 
4  126 PRO n 
4  127 PHE n 
4  128 GLY n 
4  129 ILE n 
4  130 SER n 
4  131 ALA n 
4  132 LEU n 
4  133 ILE n 
4  134 VAL n 
4  135 GLY n 
4  136 PHE n 
4  137 ASP n 
4  138 PHE n 
4  139 ASP n 
4  140 GLY n 
4  141 THR n 
4  142 PRO n 
4  143 ARG n 
4  144 LEU n 
4  145 TYR n 
4  146 GLN n 
4  147 THR n 
4  148 ASP n 
4  149 PRO n 
4  150 SER n 
4  151 GLY n 
4  152 THR n 
4  153 TYR n 
4  154 HIS n 
4  155 ALA n 
4  156 TRP n 
4  157 LYS n 
4  158 ALA n 
4  159 ASN n 
4  160 ALA n 
4  161 ILE n 
4  162 GLY n 
4  163 ARG n 
4  164 GLY n 
4  165 ALA n 
4  166 LYS n 
4  167 SER n 
4  168 VAL n 
4  169 ARG n 
4  170 GLU n 
4  171 PHE n 
4  172 LEU n 
4  173 GLU n 
4  174 LYS n 
4  175 ASN n 
4  176 TYR n 
4  177 THR n 
4  178 ASP n 
4  179 GLU n 
4  180 ALA n 
4  181 ILE n 
4  182 GLU n 
4  183 THR n 
4  184 ASP n 
4  185 ASP n 
4  186 LEU n 
4  187 THR n 
4  188 ILE n 
4  189 LYS n 
4  190 LEU n 
4  191 VAL n 
4  192 ILE n 
4  193 LYS n 
4  194 ALA n 
4  195 LEU n 
4  196 LEU n 
4  197 GLU n 
4  198 VAL n 
4  199 VAL n 
4  200 GLN n 
4  201 SER n 
4  202 GLY n 
4  203 GLY n 
4  204 LYS n 
4  205 ASN n 
4  206 ILE n 
4  207 GLU n 
4  208 LEU n 
4  209 ALA n 
4  210 VAL n 
4  211 MET n 
4  212 ARG n 
4  213 ARG n 
4  214 ASP n 
4  215 GLN n 
4  216 SER n 
4  217 LEU n 
4  218 LYS n 
4  219 ILE n 
4  220 LEU n 
4  221 ASN n 
4  222 PRO n 
4  223 GLU n 
4  224 GLU n 
4  225 ILE n 
4  226 GLU n 
4  227 LYS n 
4  228 TYR n 
4  229 VAL n 
4  230 ALA n 
4  231 GLU n 
4  232 ILE n 
4  233 GLU n 
4  234 LYS n 
4  235 GLU n 
4  236 LYS n 
4  237 GLU n 
4  238 GLU n 
4  239 ASN n 
4  240 GLU n 
4  241 LYS n 
4  242 LYS n 
4  243 LYS n 
4  244 GLN n 
4  245 LYS n 
4  246 LYS n 
4  247 ALA n 
4  248 SER n 
5  1   MET n 
5  2   PHE n 
5  3   LEU n 
5  4   THR n 
5  5   ARG n 
5  6   SER n 
5  7   GLU n 
5  8   TYR n 
5  9   ASP n 
5  10  ARG n 
5  11  GLY n 
5  12  VAL n 
5  13  ASN n 
5  14  THR n 
5  15  PHE n 
5  16  SER n 
5  17  PRO n 
5  18  GLU n 
5  19  GLY n 
5  20  ARG n 
5  21  LEU n 
5  22  PHE n 
5  23  GLN n 
5  24  VAL n 
5  25  GLU n 
5  26  TYR n 
5  27  ALA n 
5  28  ILE n 
5  29  GLU n 
5  30  ALA n 
5  31  ILE n 
5  32  LYS n 
5  33  LEU n 
5  34  GLY n 
5  35  SER n 
5  36  THR n 
5  37  ALA n 
5  38  ILE n 
5  39  GLY n 
5  40  ILE n 
5  41  GLN n 
5  42  THR n 
5  43  SER n 
5  44  GLU n 
5  45  GLY n 
5  46  VAL n 
5  47  CYS n 
5  48  LEU n 
5  49  ALA n 
5  50  VAL n 
5  51  GLU n 
5  52  LYS n 
5  53  ARG n 
5  54  ILE n 
5  55  THR n 
5  56  SER n 
5  57  PRO n 
5  58  LEU n 
5  59  MET n 
5  60  GLU n 
5  61  PRO n 
5  62  SER n 
5  63  SER n 
5  64  ILE n 
5  65  GLU n 
5  66  LYS n 
5  67  ILE n 
5  68  VAL n 
5  69  GLU n 
5  70  ILE n 
5  71  ASP n 
5  72  ALA n 
5  73  HIS n 
5  74  ILE n 
5  75  GLY n 
5  76  CYS n 
5  77  ALA n 
5  78  MET n 
5  79  SER n 
5  80  GLY n 
5  81  LEU n 
5  82  ILE n 
5  83  ALA n 
5  84  ASP n 
5  85  ALA n 
5  86  LYS n 
5  87  THR n 
5  88  LEU n 
5  89  ILE n 
5  90  ASP n 
5  91  LYS n 
5  92  ALA n 
5  93  ARG n 
5  94  VAL n 
5  95  GLU n 
5  96  THR n 
5  97  GLN n 
5  98  ASN n 
5  99  HIS n 
5  100 TRP n 
5  101 PHE n 
5  102 THR n 
5  103 TYR n 
5  104 ASN n 
5  105 GLU n 
5  106 THR n 
5  107 MET n 
5  108 THR n 
5  109 VAL n 
5  110 GLU n 
5  111 SER n 
5  112 VAL n 
5  113 THR n 
5  114 GLN n 
5  115 ALA n 
5  116 VAL n 
5  117 SER n 
5  118 ASN n 
5  119 LEU n 
5  120 ALA n 
5  121 LEU n 
5  122 GLN n 
5  123 PHE n 
5  124 GLY n 
5  125 GLU n 
5  126 GLU n 
5  127 ASP n 
5  128 ALA n 
5  129 ASP n 
5  130 PRO n 
5  131 GLY n 
5  132 ALA n 
5  133 MET n 
5  134 SER n 
5  135 ARG n 
5  136 PRO n 
5  137 PHE n 
5  138 GLY n 
5  139 VAL n 
5  140 ALA n 
5  141 LEU n 
5  142 LEU n 
5  143 PHE n 
5  144 GLY n 
5  145 GLY n 
5  146 VAL n 
5  147 ASP n 
5  148 GLU n 
5  149 LYS n 
5  150 GLY n 
5  151 PRO n 
5  152 GLN n 
5  153 LEU n 
5  154 PHE n 
5  155 HIS n 
5  156 MET n 
5  157 ASP n 
5  158 PRO n 
5  159 SER n 
5  160 GLY n 
5  161 THR n 
5  162 PHE n 
5  163 VAL n 
5  164 GLN n 
5  165 CYS n 
5  166 ASP n 
5  167 ALA n 
5  168 ARG n 
5  169 ALA n 
5  170 ILE n 
5  171 GLY n 
5  172 SER n 
5  173 ALA n 
5  174 SER n 
5  175 GLU n 
5  176 GLY n 
5  177 ALA n 
5  178 GLN n 
5  179 SER n 
5  180 SER n 
5  181 LEU n 
5  182 GLN n 
5  183 GLU n 
5  184 VAL n 
5  185 TYR n 
5  186 HIS n 
5  187 LYS n 
5  188 SER n 
5  189 MET n 
5  190 THR n 
5  191 LEU n 
5  192 LYS n 
5  193 GLU n 
5  194 ALA n 
5  195 ILE n 
5  196 LYS n 
5  197 SER n 
5  198 SER n 
5  199 LEU n 
5  200 ILE n 
5  201 ILE n 
5  202 LEU n 
5  203 LYS n 
5  204 GLN n 
5  205 VAL n 
5  206 MET n 
5  207 GLU n 
5  208 GLU n 
5  209 LYS n 
5  210 LEU n 
5  211 ASN n 
5  212 ALA n 
5  213 THR n 
5  214 ASN n 
5  215 ILE n 
5  216 GLU n 
5  217 LEU n 
5  218 ALA n 
5  219 THR n 
5  220 VAL n 
5  221 GLN n 
5  222 PRO n 
5  223 GLY n 
5  224 GLN n 
5  225 ASN n 
5  226 PHE n 
5  227 HIS n 
5  228 MET n 
5  229 PHE n 
5  230 THR n 
5  231 LYS n 
5  232 GLU n 
5  233 GLU n 
5  234 LEU n 
5  235 GLU n 
5  236 GLU n 
5  237 VAL n 
5  238 ILE n 
5  239 LYS n 
5  240 ASP n 
5  241 ILE n 
6  1   MET n 
6  2   PHE n 
6  3   ARG n 
6  4   ASN n 
6  5   GLN n 
6  6   TYR n 
6  7   ASP n 
6  8   ASN n 
6  9   ASP n 
6  10  VAL n 
6  11  THR n 
6  12  VAL n 
6  13  TRP n 
6  14  SER n 
6  15  PRO n 
6  16  GLN n 
6  17  GLY n 
6  18  ARG n 
6  19  ILE n 
6  20  HIS n 
6  21  GLN n 
6  22  ILE n 
6  23  GLU n 
6  24  TYR n 
6  25  ALA n 
6  26  MET n 
6  27  GLU n 
6  28  ALA n 
6  29  VAL n 
6  30  LYS n 
6  31  GLN n 
6  32  GLY n 
6  33  SER n 
6  34  ALA n 
6  35  THR n 
6  36  VAL n 
6  37  GLY n 
6  38  LEU n 
6  39  LYS n 
6  40  SER n 
6  41  LYS n 
6  42  THR n 
6  43  HIS n 
6  44  ALA n 
6  45  VAL n 
6  46  LEU n 
6  47  VAL n 
6  48  ALA n 
6  49  LEU n 
6  50  LYS n 
6  51  ARG n 
6  52  ALA n 
6  53  GLN n 
6  54  SER n 
6  55  GLU n 
6  56  LEU n 
6  57  ALA n 
6  58  ALA n 
6  59  HIS n 
6  60  GLN n 
6  61  LYS n 
6  62  LYS n 
6  63  ILE n 
6  64  LEU n 
6  65  HIS n 
6  66  VAL n 
6  67  ASP n 
6  68  ASN n 
6  69  HIS n 
6  70  ILE n 
6  71  GLY n 
6  72  ILE n 
6  73  SER n 
6  74  ILE n 
6  75  ALA n 
6  76  GLY n 
6  77  LEU n 
6  78  THR n 
6  79  ALA n 
6  80  ASP n 
6  81  ALA n 
6  82  ARG n 
6  83  LEU n 
6  84  LEU n 
6  85  CYS n 
6  86  ASN n 
6  87  PHE n 
6  88  MET n 
6  89  ARG n 
6  90  GLN n 
6  91  GLU n 
6  92  CYS n 
6  93  LEU n 
6  94  ASP n 
6  95  SER n 
6  96  ARG n 
6  97  PHE n 
6  98  VAL n 
6  99  PHE n 
6  100 ASP n 
6  101 ARG n 
6  102 PRO n 
6  103 LEU n 
6  104 PRO n 
6  105 VAL n 
6  106 SER n 
6  107 ARG n 
6  108 LEU n 
6  109 VAL n 
6  110 SER n 
6  111 LEU n 
6  112 ILE n 
6  113 GLY n 
6  114 SER n 
6  115 LYS n 
6  116 THR n 
6  117 GLN n 
6  118 ILE n 
6  119 PRO n 
6  120 THR n 
6  121 GLN n 
6  122 ARG n 
6  123 TYR n 
6  124 GLY n 
6  125 ARG n 
6  126 ARG n 
6  127 PRO n 
6  128 TYR n 
6  129 GLY n 
6  130 VAL n 
6  131 GLY n 
6  132 LEU n 
6  133 LEU n 
6  134 ILE n 
6  135 ALA n 
6  136 GLY n 
6  137 TYR n 
6  138 ASP n 
6  139 ASP n 
6  140 MET n 
6  141 GLY n 
6  142 PRO n 
6  143 HIS n 
6  144 ILE n 
6  145 PHE n 
6  146 GLN n 
6  147 THR n 
6  148 CYS n 
6  149 PRO n 
6  150 SER n 
6  151 ALA n 
6  152 ASN n 
6  153 TYR n 
6  154 PHE n 
6  155 ASP n 
6  156 CYS n 
6  157 ARG n 
6  158 ALA n 
6  159 MET n 
6  160 SER n 
6  161 ILE n 
6  162 GLY n 
6  163 ALA n 
6  164 ARG n 
6  165 SER n 
6  166 GLN n 
6  167 SER n 
6  168 ALA n 
6  169 ARG n 
6  170 THR n 
6  171 TYR n 
6  172 LEU n 
6  173 GLU n 
6  174 ARG n 
6  175 HIS n 
6  176 MET n 
6  177 SER n 
6  178 GLU n 
6  179 PHE n 
6  180 MET n 
6  181 GLU n 
6  182 CYS n 
6  183 ASN n 
6  184 LEU n 
6  185 ASN n 
6  186 GLU n 
6  187 LEU n 
6  188 VAL n 
6  189 LYS n 
6  190 HIS n 
6  191 GLY n 
6  192 LEU n 
6  193 ARG n 
6  194 ALA n 
6  195 LEU n 
6  196 ARG n 
6  197 GLU n 
6  198 THR n 
6  199 LEU n 
6  200 PRO n 
6  201 ALA n 
6  202 GLU n 
6  203 GLN n 
6  204 ASP n 
6  205 LEU n 
6  206 THR n 
6  207 THR n 
6  208 LYS n 
6  209 ASN n 
6  210 VAL n 
6  211 SER n 
6  212 ILE n 
6  213 GLY n 
6  214 ILE n 
6  215 VAL n 
6  216 GLY n 
6  217 LYS n 
6  218 ASP n 
6  219 LEU n 
6  220 GLU n 
6  221 PHE n 
6  222 THR n 
6  223 ILE n 
6  224 TYR n 
6  225 ASP n 
6  226 ASP n 
6  227 ASP n 
6  228 ASP n 
6  229 VAL n 
6  230 SER n 
6  231 PRO n 
6  232 PHE n 
6  233 LEU n 
6  234 GLU n 
6  235 GLY n 
6  236 LEU n 
6  237 GLU n 
6  238 GLU n 
6  239 ARG n 
6  240 PRO n 
6  241 GLN n 
6  242 ARG n 
6  243 LYS n 
6  244 ALA n 
6  245 GLN n 
6  246 PRO n 
6  247 ALA n 
6  248 GLN n 
6  249 PRO n 
6  250 ALA n 
6  251 ASP n 
6  252 GLU n 
6  253 PRO n 
6  254 ALA n 
6  255 GLU n 
6  256 LYS n 
6  257 ALA n 
6  258 ASP n 
6  259 GLU n 
6  260 PRO n 
6  261 MET n 
6  262 GLU n 
6  263 HIS n 
7  1   MET n 
7  2   SER n 
7  3   SER n 
7  4   ILE n 
7  5   GLY n 
7  6   THR n 
7  7   GLY n 
7  8   TYR n 
7  9   ASP n 
7  10  LEU n 
7  11  SER n 
7  12  ALA n 
7  13  SER n 
7  14  THR n 
7  15  PHE n 
7  16  SER n 
7  17  PRO n 
7  18  ASP n 
7  19  GLY n 
7  20  ARG n 
7  21  VAL n 
7  22  PHE n 
7  23  GLN n 
7  24  VAL n 
7  25  GLU n 
7  26  TYR n 
7  27  ALA n 
7  28  MET n 
7  29  LYS n 
7  30  ALA n 
7  31  VAL n 
7  32  GLU n 
7  33  ASN n 
7  34  SER n 
7  35  SER n 
7  36  THR n 
7  37  ALA n 
7  38  ILE n 
7  39  GLY n 
7  40  ILE n 
7  41  ARG n 
7  42  CYS n 
7  43  LYS n 
7  44  ASP n 
7  45  GLY n 
7  46  VAL n 
7  47  VAL n 
7  48  PHE n 
7  49  GLY n 
7  50  VAL n 
7  51  GLU n 
7  52  LYS n 
7  53  LEU n 
7  54  VAL n 
7  55  LEU n 
7  56  SER n 
7  57  LYS n 
7  58  LEU n 
7  59  TYR n 
7  60  GLU n 
7  61  GLU n 
7  62  GLY n 
7  63  SER n 
7  64  ASN n 
7  65  LYS n 
7  66  ARG n 
7  67  LEU n 
7  68  PHE n 
7  69  ASN n 
7  70  VAL n 
7  71  ASP n 
7  72  ARG n 
7  73  HIS n 
7  74  VAL n 
7  75  GLY n 
7  76  MET n 
7  77  ALA n 
7  78  VAL n 
7  79  ALA n 
7  80  GLY n 
7  81  LEU n 
7  82  LEU n 
7  83  ALA n 
7  84  ASP n 
7  85  ALA n 
7  86  ARG n 
7  87  SER n 
7  88  LEU n 
7  89  ALA n 
7  90  ASP n 
7  91  ILE n 
7  92  ALA n 
7  93  ARG n 
7  94  GLU n 
7  95  GLU n 
7  96  ALA n 
7  97  SER n 
7  98  ASN n 
7  99  PHE n 
7  100 ARG n 
7  101 SER n 
7  102 ASN n 
7  103 PHE n 
7  104 GLY n 
7  105 TYR n 
7  106 ASN n 
7  107 ILE n 
7  108 PRO n 
7  109 LEU n 
7  110 LYS n 
7  111 HIS n 
7  112 LEU n 
7  113 ALA n 
7  114 ASP n 
7  115 ARG n 
7  116 VAL n 
7  117 ALA n 
7  118 MET n 
7  119 TYR n 
7  120 VAL n 
7  121 HIS n 
7  122 ALA n 
7  123 TYR n 
7  124 THR n 
7  125 LEU n 
7  126 TYR n 
7  127 SER n 
7  128 ALA n 
7  129 VAL n 
7  130 ARG n 
7  131 PRO n 
7  132 PHE n 
7  133 GLY n 
7  134 CYS n 
7  135 SER n 
7  136 PHE n 
7  137 MET n 
7  138 LEU n 
7  139 GLY n 
7  140 SER n 
7  141 TYR n 
7  142 SER n 
7  143 VAL n 
7  144 ASN n 
7  145 ASP n 
7  146 GLY n 
7  147 ALA n 
7  148 GLN n 
7  149 LEU n 
7  150 TYR n 
7  151 MET n 
7  152 ILE n 
7  153 ASP n 
7  154 PRO n 
7  155 SER n 
7  156 GLY n 
7  157 VAL n 
7  158 SER n 
7  159 TYR n 
7  160 GLY n 
7  161 TYR n 
7  162 TRP n 
7  163 GLY n 
7  164 CYS n 
7  165 ALA n 
7  166 ILE n 
7  167 GLY n 
7  168 LYS n 
7  169 ALA n 
7  170 ARG n 
7  171 GLN n 
7  172 ALA n 
7  173 ALA n 
7  174 LYS n 
7  175 THR n 
7  176 GLU n 
7  177 ILE n 
7  178 GLU n 
7  179 LYS n 
7  180 LEU n 
7  181 GLN n 
7  182 MET n 
7  183 LYS n 
7  184 GLU n 
7  185 MET n 
7  186 THR n 
7  187 CYS n 
7  188 ARG n 
7  189 ASP n 
7  190 ILE n 
7  191 VAL n 
7  192 LYS n 
7  193 GLU n 
7  194 VAL n 
7  195 ALA n 
7  196 LYS n 
7  197 ILE n 
7  198 ILE n 
7  199 TYR n 
7  200 ILE n 
7  201 VAL n 
7  202 HIS n 
7  203 ASP n 
7  204 GLU n 
7  205 VAL n 
7  206 LYS n 
7  207 ASP n 
7  208 LYS n 
7  209 ALA n 
7  210 PHE n 
7  211 GLU n 
7  212 LEU n 
7  213 GLU n 
7  214 LEU n 
7  215 SER n 
7  216 TRP n 
7  217 VAL n 
7  218 GLY n 
7  219 GLU n 
7  220 LEU n 
7  221 THR n 
7  222 ASN n 
7  223 GLY n 
7  224 ARG n 
7  225 HIS n 
7  226 GLU n 
7  227 ILE n 
7  228 VAL n 
7  229 PRO n 
7  230 LYS n 
7  231 ASP n 
7  232 ILE n 
7  233 ARG n 
7  234 GLU n 
7  235 GLU n 
7  236 ALA n 
7  237 GLU n 
7  238 LYS n 
7  239 TYR n 
7  240 ALA n 
7  241 LYS n 
7  242 GLU n 
7  243 SER n 
7  244 LEU n 
7  245 LYS n 
7  246 GLU n 
7  247 GLU n 
7  248 ASP n 
7  249 GLU n 
7  250 SER n 
7  251 ASP n 
7  252 ASP n 
7  253 ASP n 
7  254 ASN n 
7  255 MET n 
8  1   MET n 
8  2   LEU n 
8  3   SER n 
8  4   SER n 
8  5   THR n 
8  6   ALA n 
8  7   MET n 
8  8   TYR n 
8  9   SER n 
8  10  ALA n 
8  11  PRO n 
8  12  GLY n 
8  13  ARG n 
8  14  ASP n 
8  15  LEU n 
8  16  GLY n 
8  17  MET n 
8  18  GLU n 
8  19  PRO n 
8  20  HIS n 
8  21  ARG n 
8  22  ALA n 
8  23  ALA n 
8  24  GLY n 
8  25  PRO n 
8  26  LEU n 
8  27  GLN n 
8  28  LEU n 
8  29  ARG n 
8  30  PHE n 
8  31  SER n 
8  32  PRO n 
8  33  TYR n 
8  34  VAL n 
8  35  PHE n 
8  36  ASN n 
8  37  GLY n 
8  38  GLY n 
8  39  THR n 
8  40  ILE n 
8  41  LEU n 
8  42  ALA n 
8  43  ILE n 
8  44  ALA n 
8  45  GLY n 
8  46  GLU n 
8  47  ASP n 
8  48  PHE n 
8  49  ALA n 
8  50  ILE n 
8  51  VAL n 
8  52  ALA n 
8  53  SER n 
8  54  ASP n 
8  55  THR n 
8  56  ARG n 
8  57  LEU n 
8  58  SER n 
8  59  GLU n 
8  60  GLY n 
8  61  PHE n 
8  62  SER n 
8  63  ILE n 
8  64  HIS n 
8  65  THR n 
8  66  ARG n 
8  67  ASP n 
8  68  SER n 
8  69  PRO n 
8  70  LYS n 
8  71  CYS n 
8  72  TYR n 
8  73  LYS n 
8  74  LEU n 
8  75  THR n 
8  76  ASP n 
8  77  LYS n 
8  78  THR n 
8  79  VAL n 
8  80  ILE n 
8  81  GLY n 
8  82  CYS n 
8  83  SER n 
8  84  GLY n 
8  85  PHE n 
8  86  HIS n 
8  87  GLY n 
8  88  ASP n 
8  89  CYS n 
8  90  LEU n 
8  91  THR n 
8  92  LEU n 
8  93  THR n 
8  94  LYS n 
8  95  ILE n 
8  96  ILE n 
8  97  GLU n 
8  98  ALA n 
8  99  ARG n 
8  100 LEU n 
8  101 LYS n 
8  102 MET n 
8  103 TYR n 
8  104 LYS n 
8  105 HIS n 
8  106 SER n 
8  107 ASN n 
8  108 ASN n 
8  109 LYS n 
8  110 ALA n 
8  111 MET n 
8  112 THR n 
8  113 THR n 
8  114 GLY n 
8  115 ALA n 
8  116 ILE n 
8  117 ALA n 
8  118 ALA n 
8  119 MET n 
8  120 LEU n 
8  121 SER n 
8  122 THR n 
8  123 ILE n 
8  124 LEU n 
8  125 TYR n 
8  126 SER n 
8  127 ARG n 
8  128 ARG n 
8  129 PHE n 
8  130 PHE n 
8  131 PRO n 
8  132 TYR n 
8  133 TYR n 
8  134 VAL n 
8  135 TYR n 
8  136 ASN n 
8  137 ILE n 
8  138 ILE n 
8  139 GLY n 
8  140 GLY n 
8  141 LEU n 
8  142 ASP n 
8  143 GLU n 
8  144 GLU n 
8  145 GLY n 
8  146 LYS n 
8  147 GLY n 
8  148 ALA n 
8  149 VAL n 
8  150 TYR n 
8  151 SER n 
8  152 PHE n 
8  153 ASP n 
8  154 PRO n 
8  155 VAL n 
8  156 GLY n 
8  157 SER n 
8  158 TYR n 
8  159 GLN n 
8  160 ARG n 
8  161 ASP n 
8  162 SER n 
8  163 PHE n 
8  164 LYS n 
8  165 ALA n 
8  166 GLY n 
8  167 GLY n 
8  168 SER n 
8  169 ALA n 
8  170 SER n 
8  171 ALA n 
8  172 MET n 
8  173 LEU n 
8  174 GLN n 
8  175 PRO n 
8  176 LEU n 
8  177 LEU n 
8  178 ASP n 
8  179 ASN n 
8  180 GLN n 
8  181 VAL n 
8  182 GLY n 
8  183 PHE n 
8  184 LYS n 
8  185 ASN n 
8  186 MET n 
8  187 GLN n 
8  188 ASN n 
8  189 VAL n 
8  190 GLU n 
8  191 HIS n 
8  192 VAL n 
8  193 PRO n 
8  194 LEU n 
8  195 SER n 
8  196 LEU n 
8  197 ASP n 
8  198 ARG n 
8  199 ALA n 
8  200 MET n 
8  201 ARG n 
8  202 LEU n 
8  203 VAL n 
8  204 LYS n 
8  205 ASP n 
8  206 VAL n 
8  207 PHE n 
8  208 ILE n 
8  209 SER n 
8  210 ALA n 
8  211 ALA n 
8  212 GLU n 
8  213 ARG n 
8  214 ASP n 
8  215 VAL n 
8  216 TYR n 
8  217 THR n 
8  218 GLY n 
8  219 ASP n 
8  220 ALA n 
8  221 LEU n 
8  222 ARG n 
8  223 ILE n 
8  224 CYS n 
8  225 ILE n 
8  226 VAL n 
8  227 THR n 
8  228 LYS n 
8  229 GLU n 
8  230 GLY n 
8  231 ILE n 
8  232 ARG n 
8  233 GLU n 
8  234 GLU n 
8  235 THR n 
8  236 VAL n 
8  237 SER n 
8  238 LEU n 
8  239 ARG n 
8  240 LYS n 
8  241 ASP n 
9  1   MET n 
9  2   GLU n 
9  3   TYR n 
9  4   LEU n 
9  5   ILE n 
9  6   GLY n 
9  7   ILE n 
9  8   GLN n 
9  9   GLY n 
9  10  PRO n 
9  11  ASP n 
9  12  TYR n 
9  13  VAL n 
9  14  LEU n 
9  15  VAL n 
9  16  ALA n 
9  17  SER n 
9  18  ASP n 
9  19  ARG n 
9  20  VAL n 
9  21  ALA n 
9  22  ALA n 
9  23  SER n 
9  24  ASN n 
9  25  ILE n 
9  26  VAL n 
9  27  GLN n 
9  28  MET n 
9  29  LYS n 
9  30  ASP n 
9  31  ASP n 
9  32  HIS n 
9  33  ASP n 
9  34  LYS n 
9  35  MET n 
9  36  PHE n 
9  37  LYS n 
9  38  MET n 
9  39  SER n 
9  40  GLU n 
9  41  LYS n 
9  42  ILE n 
9  43  LEU n 
9  44  LEU n 
9  45  LEU n 
9  46  CYS n 
9  47  VAL n 
9  48  GLY n 
9  49  GLU n 
9  50  ALA n 
9  51  GLY n 
9  52  ASP n 
9  53  THR n 
9  54  VAL n 
9  55  GLN n 
9  56  PHE n 
9  57  ALA n 
9  58  GLU n 
9  59  TYR n 
9  60  ILE n 
9  61  GLN n 
9  62  LYS n 
9  63  ASN n 
9  64  VAL n 
9  65  GLN n 
9  66  LEU n 
9  67  TYR n 
9  68  LYS n 
9  69  MET n 
9  70  ARG n 
9  71  ASN n 
9  72  GLY n 
9  73  TYR n 
9  74  GLU n 
9  75  LEU n 
9  76  SER n 
9  77  PRO n 
9  78  THR n 
9  79  ALA n 
9  80  ALA n 
9  81  ALA n 
9  82  ASN n 
9  83  PHE n 
9  84  THR n 
9  85  ARG n 
9  86  ARG n 
9  87  ASN n 
9  88  LEU n 
9  89  ALA n 
9  90  ASP n 
9  91  CYS n 
9  92  LEU n 
9  93  ARG n 
9  94  SER n 
9  95  ARG n 
9  96  THR n 
9  97  PRO n 
9  98  TYR n 
9  99  HIS n 
9  100 VAL n 
9  101 ASN n 
9  102 LEU n 
9  103 LEU n 
9  104 LEU n 
9  105 ALA n 
9  106 GLY n 
9  107 TYR n 
9  108 ASP n 
9  109 GLU n 
9  110 HIS n 
9  111 GLU n 
9  112 GLY n 
9  113 PRO n 
9  114 ALA n 
9  115 LEU n 
9  116 TYR n 
9  117 TYR n 
9  118 MET n 
9  119 ASP n 
9  120 TYR n 
9  121 LEU n 
9  122 ALA n 
9  123 ALA n 
9  124 LEU n 
9  125 ALA n 
9  126 LYS n 
9  127 ALA n 
9  128 PRO n 
9  129 PHE n 
9  130 ALA n 
9  131 ALA n 
9  132 HIS n 
9  133 GLY n 
9  134 TYR n 
9  135 GLY n 
9  136 ALA n 
9  137 PHE n 
9  138 LEU n 
9  139 THR n 
9  140 LEU n 
9  141 SER n 
9  142 ILE n 
9  143 LEU n 
9  144 ASP n 
9  145 ARG n 
9  146 TYR n 
9  147 TYR n 
9  148 THR n 
9  149 PRO n 
9  150 THR n 
9  151 ILE n 
9  152 SER n 
9  153 ARG n 
9  154 GLU n 
9  155 ARG n 
9  156 ALA n 
9  157 VAL n 
9  158 GLU n 
9  159 LEU n 
9  160 LEU n 
9  161 ARG n 
9  162 LYS n 
9  163 CYS n 
9  164 LEU n 
9  165 GLU n 
9  166 GLU n 
9  167 LEU n 
9  168 GLN n 
9  169 LYS n 
9  170 ARG n 
9  171 PHE n 
9  172 ILE n 
9  173 LEU n 
9  174 ASN n 
9  175 LEU n 
9  176 PRO n 
9  177 THR n 
9  178 PHE n 
9  179 SER n 
9  180 VAL n 
9  181 ARG n 
9  182 ILE n 
9  183 ILE n 
9  184 ASP n 
9  185 LYS n 
9  186 ASN n 
9  187 GLY n 
9  188 ILE n 
9  189 HIS n 
9  190 ASP n 
9  191 LEU n 
9  192 ASP n 
9  193 ASN n 
9  194 ILE n 
9  195 SER n 
9  196 PHE n 
9  197 PRO n 
9  198 LYS n 
9  199 GLN n 
9  200 GLY n 
9  201 SER n 
10 1   MET n 
10 2   SER n 
10 3   ILE n 
10 4   MET n 
10 5   SER n 
10 6   TYR n 
10 7   ASN n 
10 8   GLY n 
10 9   GLY n 
10 10  ALA n 
10 11  VAL n 
10 12  MET n 
10 13  ALA n 
10 14  MET n 
10 15  LYS n 
10 16  GLY n 
10 17  LYS n 
10 18  ASN n 
10 19  CYS n 
10 20  VAL n 
10 21  ALA n 
10 22  ILE n 
10 23  ALA n 
10 24  ALA n 
10 25  ASP n 
10 26  ARG n 
10 27  ARG n 
10 28  PHE n 
10 29  GLY n 
10 30  ILE n 
10 31  GLN n 
10 32  ALA n 
10 33  GLN n 
10 34  MET n 
10 35  VAL n 
10 36  THR n 
10 37  THR n 
10 38  ASP n 
10 39  PHE n 
10 40  GLN n 
10 41  LYS n 
10 42  ILE n 
10 43  PHE n 
10 44  PRO n 
10 45  MET n 
10 46  GLY n 
10 47  ASP n 
10 48  ARG n 
10 49  LEU n 
10 50  TYR n 
10 51  ILE n 
10 52  GLY n 
10 53  LEU n 
10 54  ALA n 
10 55  GLY n 
10 56  LEU n 
10 57  ALA n 
10 58  THR n 
10 59  ASP n 
10 60  VAL n 
10 61  GLN n 
10 62  THR n 
10 63  VAL n 
10 64  ALA n 
10 65  GLN n 
10 66  ARG n 
10 67  LEU n 
10 68  LYS n 
10 69  PHE n 
10 70  ARG n 
10 71  LEU n 
10 72  ASN n 
10 73  LEU n 
10 74  TYR n 
10 75  GLU n 
10 76  LEU n 
10 77  LYS n 
10 78  GLU n 
10 79  GLY n 
10 80  ARG n 
10 81  GLN n 
10 82  ILE n 
10 83  LYS n 
10 84  PRO n 
10 85  TYR n 
10 86  THR n 
10 87  LEU n 
10 88  MET n 
10 89  SER n 
10 90  MET n 
10 91  VAL n 
10 92  ALA n 
10 93  ASN n 
10 94  LEU n 
10 95  LEU n 
10 96  TYR n 
10 97  GLU n 
10 98  LYS n 
10 99  ARG n 
10 100 PHE n 
10 101 GLY n 
10 102 PRO n 
10 103 TYR n 
10 104 TYR n 
10 105 THR n 
10 106 GLU n 
10 107 PRO n 
10 108 VAL n 
10 109 ILE n 
10 110 ALA n 
10 111 GLY n 
10 112 LEU n 
10 113 ASP n 
10 114 PRO n 
10 115 LYS n 
10 116 THR n 
10 117 PHE n 
10 118 LYS n 
10 119 PRO n 
10 120 PHE n 
10 121 ILE n 
10 122 CYS n 
10 123 SER n 
10 124 LEU n 
10 125 ASP n 
10 126 LEU n 
10 127 ILE n 
10 128 GLY n 
10 129 CYS n 
10 130 PRO n 
10 131 MET n 
10 132 VAL n 
10 133 THR n 
10 134 ASP n 
10 135 ASP n 
10 136 PHE n 
10 137 VAL n 
10 138 VAL n 
10 139 SER n 
10 140 GLY n 
10 141 THR n 
10 142 CYS n 
10 143 ALA n 
10 144 GLU n 
10 145 GLN n 
10 146 MET n 
10 147 TYR n 
10 148 GLY n 
10 149 MET n 
10 150 CYS n 
10 151 GLU n 
10 152 SER n 
10 153 LEU n 
10 154 TRP n 
10 155 GLU n 
10 156 PRO n 
10 157 ASN n 
10 158 MET n 
10 159 ASP n 
10 160 PRO n 
10 161 ASP n 
10 162 HIS n 
10 163 LEU n 
10 164 PHE n 
10 165 GLU n 
10 166 THR n 
10 167 ILE n 
10 168 SER n 
10 169 GLN n 
10 170 ALA n 
10 171 MET n 
10 172 LEU n 
10 173 ASN n 
10 174 ALA n 
10 175 VAL n 
10 176 ASP n 
10 177 ARG n 
10 178 ASP n 
10 179 ALA n 
10 180 VAL n 
10 181 SER n 
10 182 GLY n 
10 183 MET n 
10 184 GLY n 
10 185 VAL n 
10 186 ILE n 
10 187 VAL n 
10 188 HIS n 
10 189 ILE n 
10 190 ILE n 
10 191 GLU n 
10 192 LYS n 
10 193 ASP n 
10 194 LYS n 
10 195 ILE n 
10 196 THR n 
10 197 THR n 
10 198 ARG n 
10 199 THR n 
10 200 LEU n 
10 201 LYS n 
10 202 ALA n 
10 203 ARG n 
10 204 MET n 
10 205 ASP n 
11 1   MET n 
11 2   GLU n 
11 3   ALA n 
11 4   PHE n 
11 5   LEU n 
11 6   GLY n 
11 7   SER n 
11 8   ARG n 
11 9   SER n 
11 10  GLY n 
11 11  LEU n 
11 12  TRP n 
11 13  ALA n 
11 14  GLY n 
11 15  GLY n 
11 16  PRO n 
11 17  ALA n 
11 18  PRO n 
11 19  GLY n 
11 20  GLN n 
11 21  PHE n 
11 22  TYR n 
11 23  ARG n 
11 24  ILE n 
11 25  PRO n 
11 26  SER n 
11 27  THR n 
11 28  PRO n 
11 29  ASP n 
11 30  SER n 
11 31  PHE n 
11 32  MET n 
11 33  ASP n 
11 34  PRO n 
11 35  ALA n 
11 36  SER n 
11 37  ALA n 
11 38  LEU n 
11 39  TYR n 
11 40  ARG n 
11 41  GLY n 
11 42  PRO n 
11 43  ILE n 
11 44  THR n 
11 45  ARG n 
11 46  THR n 
11 47  GLN n 
11 48  ASN n 
11 49  PRO n 
11 50  MET n 
11 51  VAL n 
11 52  THR n 
11 53  GLY n 
11 54  THR n 
11 55  SER n 
11 56  VAL n 
11 57  LEU n 
11 58  GLY n 
11 59  VAL n 
11 60  LYS n 
11 61  PHE n 
11 62  GLU n 
11 63  GLY n 
11 64  GLY n 
11 65  VAL n 
11 66  VAL n 
11 67  ILE n 
11 68  ALA n 
11 69  ALA n 
11 70  ASP n 
11 71  MET n 
11 72  LEU n 
11 73  GLY n 
11 74  SER n 
11 75  TYR n 
11 76  GLY n 
11 77  SER n 
11 78  LEU n 
11 79  ALA n 
11 80  ARG n 
11 81  PHE n 
11 82  ARG n 
11 83  ASN n 
11 84  ILE n 
11 85  SER n 
11 86  ARG n 
11 87  ILE n 
11 88  MET n 
11 89  ARG n 
11 90  VAL n 
11 91  ASN n 
11 92  ASN n 
11 93  SER n 
11 94  THR n 
11 95  MET n 
11 96  LEU n 
11 97  GLY n 
11 98  ALA n 
11 99  SER n 
11 100 GLY n 
11 101 ASP n 
11 102 TYR n 
11 103 ALA n 
11 104 ASP n 
11 105 PHE n 
11 106 GLN n 
11 107 TYR n 
11 108 LEU n 
11 109 LYS n 
11 110 GLN n 
11 111 VAL n 
11 112 LEU n 
11 113 GLY n 
11 114 GLN n 
11 115 MET n 
11 116 VAL n 
11 117 ILE n 
11 118 ASP n 
11 119 GLU n 
11 120 GLU n 
11 121 LEU n 
11 122 LEU n 
11 123 GLY n 
11 124 ASP n 
11 125 GLY n 
11 126 HIS n 
11 127 SER n 
11 128 TYR n 
11 129 SER n 
11 130 PRO n 
11 131 ARG n 
11 132 ALA n 
11 133 ILE n 
11 134 HIS n 
11 135 SER n 
11 136 TRP n 
11 137 LEU n 
11 138 THR n 
11 139 ARG n 
11 140 ALA n 
11 141 MET n 
11 142 TYR n 
11 143 SER n 
11 144 ARG n 
11 145 ARG n 
11 146 SER n 
11 147 LYS n 
11 148 MET n 
11 149 ASN n 
11 150 PRO n 
11 151 LEU n 
11 152 TRP n 
11 153 ASN n 
11 154 THR n 
11 155 MET n 
11 156 VAL n 
11 157 ILE n 
11 158 GLY n 
11 159 GLY n 
11 160 TYR n 
11 161 ALA n 
11 162 ASP n 
11 163 GLY n 
11 164 GLU n 
11 165 SER n 
11 166 PHE n 
11 167 LEU n 
11 168 GLY n 
11 169 TYR n 
11 170 VAL n 
11 171 ASP n 
11 172 MET n 
11 173 LEU n 
11 174 GLY n 
11 175 VAL n 
11 176 ALA n 
11 177 TYR n 
11 178 GLU n 
11 179 ALA n 
11 180 PRO n 
11 181 SER n 
11 182 LEU n 
11 183 ALA n 
11 184 THR n 
11 185 GLY n 
11 186 TYR n 
11 187 GLY n 
11 188 ALA n 
11 189 TYR n 
11 190 LEU n 
11 191 ALA n 
11 192 GLN n 
11 193 PRO n 
11 194 LEU n 
11 195 LEU n 
11 196 ARG n 
11 197 GLU n 
11 198 VAL n 
11 199 LEU n 
11 200 GLU n 
11 201 LYS n 
11 202 GLN n 
11 203 PRO n 
11 204 VAL n 
11 205 LEU n 
11 206 SER n 
11 207 GLN n 
11 208 THR n 
11 209 GLU n 
11 210 ALA n 
11 211 ARG n 
11 212 ASP n 
11 213 LEU n 
11 214 VAL n 
11 215 GLU n 
11 216 ARG n 
11 217 CYS n 
11 218 MET n 
11 219 ARG n 
11 220 VAL n 
11 221 LEU n 
11 222 TYR n 
11 223 TYR n 
11 224 ARG n 
11 225 ASP n 
11 226 ALA n 
11 227 ARG n 
11 228 SER n 
11 229 TYR n 
11 230 ASN n 
11 231 ARG n 
11 232 PHE n 
11 233 GLN n 
11 234 ILE n 
11 235 ALA n 
11 236 THR n 
11 237 VAL n 
11 238 THR n 
11 239 GLU n 
11 240 LYS n 
11 241 GLY n 
11 242 VAL n 
11 243 GLU n 
11 244 ILE n 
11 245 GLU n 
11 246 GLY n 
11 247 PRO n 
11 248 LEU n 
11 249 SER n 
11 250 THR n 
11 251 GLU n 
11 252 THR n 
11 253 ASN n 
11 254 TRP n 
11 255 ASP n 
11 256 ILE n 
11 257 ALA n 
11 258 HIS n 
11 259 MET n 
11 260 ILE n 
11 261 SER n 
11 262 GLY n 
11 263 PHE n 
11 264 GLU n 
12 1   MET n 
12 2   ALA n 
12 3   LEU n 
12 4   ALA n 
12 5   SER n 
12 6   VAL n 
12 7   LEU n 
12 8   GLU n 
12 9   ARG n 
12 10  PRO n 
12 11  LEU n 
12 12  PRO n 
12 13  VAL n 
12 14  ASN n 
12 15  GLN n 
12 16  ARG n 
12 17  GLY n 
12 18  PHE n 
12 19  PHE n 
12 20  GLY n 
12 21  LEU n 
12 22  GLY n 
12 23  GLY n 
12 24  ARG n 
12 25  ALA n 
12 26  ASP n 
12 27  LEU n 
12 28  LEU n 
12 29  ASP n 
12 30  LEU n 
12 31  GLY n 
12 32  PRO n 
12 33  GLY n 
12 34  SER n 
12 35  LEU n 
12 36  SER n 
12 37  ASP n 
12 38  GLY n 
12 39  LEU n 
12 40  SER n 
12 41  LEU n 
12 42  ALA n 
12 43  ALA n 
12 44  PRO n 
12 45  GLY n 
12 46  TRP n 
12 47  GLY n 
12 48  VAL n 
12 49  PRO n 
12 50  GLU n 
12 51  GLU n 
12 52  PRO n 
12 53  GLY n 
12 54  ILE n 
12 55  GLU n 
12 56  MET n 
12 57  LEU n 
12 58  HIS n 
12 59  GLY n 
12 60  THR n 
12 61  THR n 
12 62  THR n 
12 63  LEU n 
12 64  ALA n 
12 65  PHE n 
12 66  LYS n 
12 67  PHE n 
12 68  ARG n 
12 69  HIS n 
12 70  GLY n 
12 71  VAL n 
12 72  ILE n 
12 73  VAL n 
12 74  ALA n 
12 75  ALA n 
12 76  ASP n 
12 77  SER n 
12 78  ARG n 
12 79  ALA n 
12 80  THR n 
12 81  ALA n 
12 82  GLY n 
12 83  ALA n 
12 84  TYR n 
12 85  ILE n 
12 86  ALA n 
12 87  SER n 
12 88  GLN n 
12 89  THR n 
12 90  VAL n 
12 91  LYS n 
12 92  LYS n 
12 93  VAL n 
12 94  ILE n 
12 95  GLU n 
12 96  ILE n 
12 97  ASN n 
12 98  PRO n 
12 99  TYR n 
12 100 LEU n 
12 101 LEU n 
12 102 GLY n 
12 103 THR n 
12 104 MET n 
12 105 ALA n 
12 106 GLY n 
12 107 GLY n 
12 108 ALA n 
12 109 ALA n 
12 110 ASP n 
12 111 CYS n 
12 112 SER n 
12 113 PHE n 
12 114 TRP n 
12 115 GLU n 
12 116 ARG n 
12 117 LEU n 
12 118 LEU n 
12 119 ALA n 
12 120 ARG n 
12 121 GLN n 
12 122 CYS n 
12 123 ARG n 
12 124 ILE n 
12 125 TYR n 
12 126 GLU n 
12 127 LEU n 
12 128 ARG n 
12 129 ASN n 
12 130 LYS n 
12 131 GLU n 
12 132 ARG n 
12 133 ILE n 
12 134 SER n 
12 135 VAL n 
12 136 ALA n 
12 137 ALA n 
12 138 ALA n 
12 139 SER n 
12 140 LYS n 
12 141 LEU n 
12 142 LEU n 
12 143 ALA n 
12 144 ASN n 
12 145 MET n 
12 146 VAL n 
12 147 TYR n 
12 148 GLN n 
12 149 TYR n 
12 150 LYS n 
12 151 GLY n 
12 152 MET n 
12 153 GLY n 
12 154 LEU n 
12 155 SER n 
12 156 MET n 
12 157 GLY n 
12 158 THR n 
12 159 MET n 
12 160 ILE n 
12 161 CYS n 
12 162 GLY n 
12 163 TRP n 
12 164 ASP n 
12 165 LYS n 
12 166 ARG n 
12 167 GLY n 
12 168 PRO n 
12 169 GLY n 
12 170 LEU n 
12 171 TYR n 
12 172 TYR n 
12 173 VAL n 
12 174 ASP n 
12 175 SER n 
12 176 GLU n 
12 177 GLY n 
12 178 ASN n 
12 179 ARG n 
12 180 ILE n 
12 181 SER n 
12 182 GLY n 
12 183 ALA n 
12 184 THR n 
12 185 PHE n 
12 186 SER n 
12 187 VAL n 
12 188 GLY n 
12 189 SER n 
12 190 GLY n 
12 191 SER n 
12 192 VAL n 
12 193 TYR n 
12 194 ALA n 
12 195 TYR n 
12 196 GLY n 
12 197 VAL n 
12 198 MET n 
12 199 ASP n 
12 200 ARG n 
12 201 GLY n 
12 202 TYR n 
12 203 SER n 
12 204 TYR n 
12 205 ASP n 
12 206 LEU n 
12 207 GLU n 
12 208 VAL n 
12 209 GLU n 
12 210 GLN n 
12 211 ALA n 
12 212 TYR n 
12 213 ASP n 
12 214 LEU n 
12 215 ALA n 
12 216 ARG n 
12 217 ARG n 
12 218 ALA n 
12 219 ILE n 
12 220 TYR n 
12 221 GLN n 
12 222 ALA n 
12 223 THR n 
12 224 TYR n 
12 225 ARG n 
12 226 ASP n 
12 227 ALA n 
12 228 TYR n 
12 229 SER n 
12 230 GLY n 
12 231 GLY n 
12 232 ALA n 
12 233 VAL n 
12 234 ASN n 
12 235 LEU n 
12 236 TYR n 
12 237 HIS n 
12 238 VAL n 
12 239 ARG n 
12 240 GLU n 
12 241 ASP n 
12 242 GLY n 
12 243 TRP n 
12 244 ILE n 
12 245 ARG n 
12 246 VAL n 
12 247 SER n 
12 248 SER n 
12 249 ASP n 
12 250 ASN n 
12 251 VAL n 
12 252 ALA n 
12 253 ASP n 
12 254 LEU n 
12 255 HIS n 
12 256 GLU n 
12 257 LYS n 
12 258 TYR n 
12 259 SER n 
12 260 GLY n 
12 261 SER n 
12 262 THR n 
12 263 PRO n 
13 1   MET n 
13 2   ALA n 
13 3   ALA n 
13 4   THR n 
13 5   LEU n 
13 6   LEU n 
13 7   ALA n 
13 8   ALA n 
13 9   ARG n 
13 10  GLY n 
13 11  ALA n 
13 12  GLY n 
13 13  PRO n 
13 14  ALA n 
13 15  PRO n 
13 16  ALA n 
13 17  TRP n 
13 18  GLY n 
13 19  PRO n 
13 20  GLU n 
13 21  ALA n 
13 22  PHE n 
13 23  THR n 
13 24  PRO n 
13 25  ASP n 
13 26  TRP n 
13 27  GLU n 
13 28  SER n 
13 29  ARG n 
13 30  GLU n 
13 31  VAL n 
13 32  SER n 
13 33  THR n 
13 34  GLY n 
13 35  THR n 
13 36  THR n 
13 37  ILE n 
13 38  MET n 
13 39  ALA n 
13 40  VAL n 
13 41  GLN n 
13 42  PHE n 
13 43  ASP n 
13 44  GLY n 
13 45  GLY n 
13 46  VAL n 
13 47  VAL n 
13 48  LEU n 
13 49  GLY n 
13 50  ALA n 
13 51  ASP n 
13 52  SER n 
13 53  ARG n 
13 54  THR n 
13 55  THR n 
13 56  THR n 
13 57  GLY n 
13 58  SER n 
13 59  TYR n 
13 60  ILE n 
13 61  ALA n 
13 62  ASN n 
13 63  ARG n 
13 64  VAL n 
13 65  THR n 
13 66  ASP n 
13 67  LYS n 
13 68  LEU n 
13 69  THR n 
13 70  PRO n 
13 71  ILE n 
13 72  HIS n 
13 73  ASP n 
13 74  ARG n 
13 75  ILE n 
13 76  PHE n 
13 77  CYS n 
13 78  CYS n 
13 79  ARG n 
13 80  SER n 
13 81  GLY n 
13 82  SER n 
13 83  ALA n 
13 84  ALA n 
13 85  ASP n 
13 86  THR n 
13 87  GLN n 
13 88  ALA n 
13 89  VAL n 
13 90  ALA n 
13 91  ASP n 
13 92  ALA n 
13 93  VAL n 
13 94  THR n 
13 95  TYR n 
13 96  GLN n 
13 97  LEU n 
13 98  GLY n 
13 99  PHE n 
13 100 HIS n 
13 101 SER n 
13 102 ILE n 
13 103 GLU n 
13 104 LEU n 
13 105 ASN n 
13 106 GLU n 
13 107 PRO n 
13 108 PRO n 
13 109 LEU n 
13 110 VAL n 
13 111 HIS n 
13 112 THR n 
13 113 ALA n 
13 114 ALA n 
13 115 SER n 
13 116 LEU n 
13 117 PHE n 
13 118 LYS n 
13 119 GLU n 
13 120 MET n 
13 121 CYS n 
13 122 TYR n 
13 123 ARG n 
13 124 TYR n 
13 125 ARG n 
13 126 GLU n 
13 127 ASP n 
13 128 LEU n 
13 129 MET n 
13 130 ALA n 
13 131 GLY n 
13 132 ILE n 
13 133 ILE n 
13 134 ILE n 
13 135 ALA n 
13 136 GLY n 
13 137 TRP n 
13 138 ASP n 
13 139 PRO n 
13 140 GLN n 
13 141 GLU n 
13 142 GLY n 
13 143 GLY n 
13 144 GLN n 
13 145 VAL n 
13 146 TYR n 
13 147 SER n 
13 148 VAL n 
13 149 PRO n 
13 150 MET n 
13 151 GLY n 
13 152 GLY n 
13 153 MET n 
13 154 MET n 
13 155 VAL n 
13 156 ARG n 
13 157 GLN n 
13 158 SER n 
13 159 PHE n 
13 160 ALA n 
13 161 ILE n 
13 162 GLY n 
13 163 GLY n 
13 164 SER n 
13 165 GLY n 
13 166 SER n 
13 167 SER n 
13 168 TYR n 
13 169 ILE n 
13 170 TYR n 
13 171 GLY n 
13 172 TYR n 
13 173 VAL n 
13 174 ASP n 
13 175 ALA n 
13 176 THR n 
13 177 TYR n 
13 178 ARG n 
13 179 GLU n 
13 180 GLY n 
13 181 MET n 
13 182 THR n 
13 183 LYS n 
13 184 GLU n 
13 185 GLU n 
13 186 CYS n 
13 187 LEU n 
13 188 GLN n 
13 189 PHE n 
13 190 THR n 
13 191 ALA n 
13 192 ASN n 
13 193 ALA n 
13 194 LEU n 
13 195 ALA n 
13 196 LEU n 
13 197 ALA n 
13 198 MET n 
13 199 GLU n 
13 200 ARG n 
13 201 ASP n 
13 202 GLY n 
13 203 SER n 
13 204 SER n 
13 205 GLY n 
13 206 GLY n 
13 207 VAL n 
13 208 ILE n 
13 209 ARG n 
13 210 LEU n 
13 211 ALA n 
13 212 ALA n 
13 213 ILE n 
13 214 ALA n 
13 215 GLU n 
13 216 SER n 
13 217 GLY n 
13 218 VAL n 
13 219 GLU n 
13 220 ARG n 
13 221 GLN n 
13 222 VAL n 
13 223 LEU n 
13 224 LEU n 
13 225 GLY n 
13 226 ASP n 
13 227 GLN n 
13 228 ILE n 
13 229 PRO n 
13 230 LYS n 
13 231 PHE n 
13 232 ALA n 
13 233 VAL n 
13 234 ALA n 
13 235 THR n 
13 236 LEU n 
13 237 PRO n 
13 238 PRO n 
13 239 ALA n 
14 1   MET n 
14 2   ALA n 
14 3   ALA n 
14 4   VAL n 
14 5   SER n 
14 6   VAL n 
14 7   TYR n 
14 8   ALA n 
14 9   PRO n 
14 10  PRO n 
14 11  VAL n 
14 12  GLY n 
14 13  GLY n 
14 14  PHE n 
14 15  SER n 
14 16  PHE n 
14 17  ASP n 
14 18  ASN n 
14 19  CYS n 
14 20  ARG n 
14 21  ARG n 
14 22  ASN n 
14 23  ALA n 
14 24  VAL n 
14 25  LEU n 
14 26  GLU n 
14 27  ALA n 
14 28  ASP n 
14 29  PHE n 
14 30  ALA n 
14 31  LYS n 
14 32  ARG n 
14 33  GLY n 
14 34  TYR n 
14 35  LYS n 
14 36  LEU n 
14 37  PRO n 
14 38  LYS n 
14 39  VAL n 
14 40  ARG n 
14 41  LYS n 
14 42  THR n 
14 43  GLY n 
14 44  THR n 
14 45  THR n 
14 46  ILE n 
14 47  ALA n 
14 48  GLY n 
14 49  VAL n 
14 50  VAL n 
14 51  TYR n 
14 52  LYS n 
14 53  ASP n 
14 54  GLY n 
14 55  ILE n 
14 56  VAL n 
14 57  LEU n 
14 58  GLY n 
14 59  ALA n 
14 60  ASP n 
14 61  THR n 
14 62  ARG n 
14 63  ALA n 
14 64  THR n 
14 65  GLU n 
14 66  GLY n 
14 67  MET n 
14 68  VAL n 
14 69  VAL n 
14 70  ALA n 
14 71  ASP n 
14 72  LYS n 
14 73  ASN n 
14 74  CYS n 
14 75  SER n 
14 76  LYS n 
14 77  ILE n 
14 78  HIS n 
14 79  PHE n 
14 80  ILE n 
14 81  SER n 
14 82  PRO n 
14 83  ASN n 
14 84  ILE n 
14 85  TYR n 
14 86  CYS n 
14 87  CYS n 
14 88  GLY n 
14 89  ALA n 
14 90  GLY n 
14 91  THR n 
14 92  ALA n 
14 93  ALA n 
14 94  ASP n 
14 95  THR n 
14 96  ASP n 
14 97  MET n 
14 98  THR n 
14 99  THR n 
14 100 GLN n 
14 101 LEU n 
14 102 ILE n 
14 103 SER n 
14 104 SER n 
14 105 ASN n 
14 106 LEU n 
14 107 GLU n 
14 108 LEU n 
14 109 HIS n 
14 110 SER n 
14 111 LEU n 
14 112 SER n 
14 113 THR n 
14 114 GLY n 
14 115 ARG n 
14 116 LEU n 
14 117 PRO n 
14 118 ARG n 
14 119 VAL n 
14 120 VAL n 
14 121 THR n 
14 122 ALA n 
14 123 ASN n 
14 124 ARG n 
14 125 MET n 
14 126 LEU n 
14 127 LYS n 
14 128 GLN n 
14 129 MET n 
14 130 LEU n 
14 131 PHE n 
14 132 ARG n 
14 133 TYR n 
14 134 GLN n 
14 135 GLY n 
14 136 TYR n 
14 137 ILE n 
14 138 GLY n 
14 139 ALA n 
14 140 ALA n 
14 141 LEU n 
14 142 VAL n 
14 143 LEU n 
14 144 GLY n 
14 145 GLY n 
14 146 VAL n 
14 147 ASP n 
14 148 VAL n 
14 149 THR n 
14 150 GLY n 
14 151 PRO n 
14 152 HIS n 
14 153 LEU n 
14 154 TYR n 
14 155 SER n 
14 156 ILE n 
14 157 TYR n 
14 158 PRO n 
14 159 HIS n 
14 160 GLY n 
14 161 SER n 
14 162 THR n 
14 163 ASP n 
14 164 LYS n 
14 165 LEU n 
14 166 PRO n 
14 167 TYR n 
14 168 VAL n 
14 169 THR n 
14 170 MET n 
14 171 GLY n 
14 172 SER n 
14 173 GLY n 
14 174 SER n 
14 175 LEU n 
14 176 ALA n 
14 177 ALA n 
14 178 MET n 
14 179 ALA n 
14 180 VAL n 
14 181 PHE n 
14 182 GLU n 
14 183 ASP n 
14 184 LYS n 
14 185 PHE n 
14 186 ARG n 
14 187 PRO n 
14 188 ASP n 
14 189 MET n 
14 190 GLU n 
14 191 GLU n 
14 192 GLU n 
14 193 GLU n 
14 194 ALA n 
14 195 LYS n 
14 196 ASN n 
14 197 LEU n 
14 198 VAL n 
14 199 SER n 
14 200 GLU n 
14 201 ALA n 
14 202 ILE n 
14 203 ALA n 
14 204 ALA n 
14 205 GLY n 
14 206 ILE n 
14 207 PHE n 
14 208 ASN n 
14 209 ASP n 
14 210 LEU n 
14 211 GLY n 
14 212 SER n 
14 213 GLY n 
14 214 SER n 
14 215 ASN n 
14 216 ILE n 
14 217 ASP n 
14 218 LEU n 
14 219 CYS n 
14 220 VAL n 
14 221 ILE n 
14 222 SER n 
14 223 LYS n 
14 224 ASN n 
14 225 LYS n 
14 226 LEU n 
14 227 ASP n 
14 228 PHE n 
14 229 LEU n 
14 230 ARG n 
14 231 PRO n 
14 232 TYR n 
14 233 THR n 
14 234 VAL n 
14 235 PRO n 
14 236 ASN n 
14 237 LYS n 
14 238 LYS n 
14 239 GLY n 
14 240 THR n 
14 241 ARG n 
14 242 LEU n 
14 243 GLY n 
14 244 ARG n 
14 245 TYR n 
14 246 ARG n 
14 247 CYS n 
14 248 GLU n 
14 249 LYS n 
14 250 GLY n 
14 251 THR n 
14 252 THR n 
14 253 ALA n 
14 254 VAL n 
14 255 LEU n 
14 256 THR n 
14 257 GLU n 
14 258 LYS n 
14 259 ILE n 
14 260 THR n 
14 261 PRO n 
14 262 LEU n 
14 263 GLU n 
14 264 ILE n 
14 265 GLU n 
14 266 VAL n 
14 267 LEU n 
14 268 GLU n 
14 269 GLU n 
14 270 THR n 
14 271 VAL n 
14 272 GLN n 
14 273 THR n 
14 274 MET n 
14 275 ASP n 
14 276 THR n 
14 277 SER n 
15 1   MET n 
15 2   PRO n 
15 3   ASP n 
15 4   TYR n 
15 5   LEU n 
15 6   GLY n 
15 7   ALA n 
15 8   ASP n 
15 9   GLN n 
15 10  ARG n 
15 11  LYS n 
15 12  THR n 
15 13  LYS n 
15 14  GLU n 
15 15  ASP n 
15 16  GLU n 
15 17  LYS n 
15 18  ASP n 
15 19  ASP n 
15 20  LYS n 
15 21  PRO n 
15 22  ILE n 
15 23  ARG n 
15 24  ALA n 
15 25  LEU n 
15 26  ASP n 
15 27  GLU n 
15 28  GLY n 
15 29  ASP n 
15 30  ILE n 
15 31  ALA n 
15 32  LEU n 
15 33  LEU n 
15 34  LYS n 
15 35  THR n 
15 36  TYR n 
15 37  GLY n 
15 38  GLN n 
15 39  SER n 
15 40  THR n 
15 41  TYR n 
15 42  SER n 
15 43  ARG n 
15 44  GLN n 
15 45  ILE n 
15 46  LYS n 
15 47  GLN n 
15 48  VAL n 
15 49  GLU n 
15 50  ASP n 
15 51  ASP n 
15 52  ILE n 
15 53  GLN n 
15 54  GLN n 
15 55  LEU n 
15 56  LEU n 
15 57  LYS n 
15 58  LYS n 
15 59  ILE n 
15 60  ASN n 
15 61  GLU n 
15 62  LEU n 
15 63  THR n 
15 64  GLY n 
15 65  ILE n 
15 66  LYS n 
15 67  GLU n 
15 68  SER n 
15 69  ASP n 
15 70  THR n 
15 71  GLY n 
15 72  LEU n 
15 73  ALA n 
15 74  PRO n 
15 75  PRO n 
15 76  ALA n 
15 77  LEU n 
15 78  TRP n 
15 79  ASP n 
15 80  LEU n 
15 81  ALA n 
15 82  ALA n 
15 83  ASP n 
15 84  LYS n 
15 85  GLN n 
15 86  THR n 
15 87  LEU n 
15 88  GLN n 
15 89  SER n 
15 90  GLU n 
15 91  GLN n 
15 92  PRO n 
15 93  LEU n 
15 94  GLN n 
15 95  VAL n 
15 96  ALA n 
15 97  ARG n 
15 98  CYS n 
15 99  THR n 
15 100 LYS n 
15 101 ILE n 
15 102 ILE n 
15 103 ASN n 
15 104 ALA n 
15 105 ASP n 
15 106 SER n 
15 107 GLU n 
15 108 ASP n 
15 109 PRO n 
15 110 LYS n 
15 111 TYR n 
15 112 ILE n 
15 113 ILE n 
15 114 ASN n 
15 115 VAL n 
15 116 LYS n 
15 117 GLN n 
15 118 PHE n 
15 119 ALA n 
15 120 LYS n 
15 121 PHE n 
15 122 VAL n 
15 123 VAL n 
15 124 ASP n 
15 125 LEU n 
15 126 SER n 
15 127 ASP n 
15 128 GLN n 
15 129 VAL n 
15 130 ALA n 
15 131 PRO n 
15 132 THR n 
15 133 ASP n 
15 134 ILE n 
15 135 GLU n 
15 136 GLU n 
15 137 GLY n 
15 138 MET n 
15 139 ARG n 
15 140 VAL n 
15 141 GLY n 
15 142 VAL n 
15 143 ASP n 
15 144 ARG n 
15 145 ASN n 
15 146 LYS n 
15 147 TYR n 
15 148 GLN n 
15 149 ILE n 
15 150 HIS n 
15 151 ILE n 
15 152 PRO n 
15 153 LEU n 
15 154 PRO n 
15 155 PRO n 
15 156 LYS n 
15 157 ILE n 
15 158 ASP n 
15 159 PRO n 
15 160 THR n 
15 161 VAL n 
15 162 THR n 
15 163 MET n 
15 164 MET n 
15 165 GLN n 
15 166 VAL n 
15 167 GLU n 
15 168 GLU n 
15 169 LYS n 
15 170 PRO n 
15 171 ASP n 
15 172 VAL n 
15 173 THR n 
15 174 TYR n 
15 175 SER n 
15 176 ASP n 
15 177 VAL n 
15 178 GLY n 
15 179 GLY n 
15 180 CYS n 
15 181 LYS n 
15 182 GLU n 
15 183 GLN n 
15 184 ILE n 
15 185 GLU n 
15 186 LYS n 
15 187 LEU n 
15 188 ARG n 
15 189 GLU n 
15 190 VAL n 
15 191 VAL n 
15 192 GLU n 
15 193 THR n 
15 194 PRO n 
15 195 LEU n 
15 196 LEU n 
15 197 HIS n 
15 198 PRO n 
15 199 GLU n 
15 200 ARG n 
15 201 PHE n 
15 202 VAL n 
15 203 ASN n 
15 204 LEU n 
15 205 GLY n 
15 206 ILE n 
15 207 GLU n 
15 208 PRO n 
15 209 PRO n 
15 210 LYS n 
15 211 GLY n 
15 212 VAL n 
15 213 LEU n 
15 214 LEU n 
15 215 PHE n 
15 216 GLY n 
15 217 PRO n 
15 218 PRO n 
15 219 GLY n 
15 220 THR n 
15 221 GLY n 
15 222 LYS n 
15 223 THR n 
15 224 LEU n 
15 225 CYS n 
15 226 ALA n 
15 227 ARG n 
15 228 ALA n 
15 229 VAL n 
15 230 ALA n 
15 231 ASN n 
15 232 ARG n 
15 233 THR n 
15 234 ASP n 
15 235 ALA n 
15 236 CYS n 
15 237 PHE n 
15 238 ILE n 
15 239 ARG n 
15 240 VAL n 
15 241 ILE n 
15 242 GLY n 
15 243 SER n 
15 244 GLU n 
15 245 LEU n 
15 246 VAL n 
15 247 GLN n 
15 248 LYS n 
15 249 TYR n 
15 250 VAL n 
15 251 GLY n 
15 252 GLU n 
15 253 GLY n 
15 254 ALA n 
15 255 ARG n 
15 256 MET n 
15 257 VAL n 
15 258 ARG n 
15 259 GLU n 
15 260 LEU n 
15 261 PHE n 
15 262 GLU n 
15 263 MET n 
15 264 ALA n 
15 265 ARG n 
15 266 THR n 
15 267 LYS n 
15 268 LYS n 
15 269 ALA n 
15 270 CYS n 
15 271 LEU n 
15 272 ILE n 
15 273 PHE n 
15 274 PHE n 
15 275 ASP n 
15 276 GLU n 
15 277 ILE n 
15 278 ASP n 
15 279 ALA n 
15 280 ILE n 
15 281 GLY n 
15 282 GLY n 
15 283 ALA n 
15 284 ARG n 
15 285 PHE n 
15 286 ASP n 
15 287 ASP n 
15 288 GLY n 
15 289 ALA n 
15 290 GLY n 
15 291 GLY n 
15 292 ASP n 
15 293 ASN n 
15 294 GLU n 
15 295 VAL n 
15 296 GLN n 
15 297 ARG n 
15 298 THR n 
15 299 MET n 
15 300 LEU n 
15 301 GLU n 
15 302 LEU n 
15 303 ILE n 
15 304 ASN n 
15 305 GLN n 
15 306 LEU n 
15 307 ASP n 
15 308 GLY n 
15 309 PHE n 
15 310 ASP n 
15 311 PRO n 
15 312 ARG n 
15 313 GLY n 
15 314 ASN n 
15 315 ILE n 
15 316 LYS n 
15 317 VAL n 
15 318 LEU n 
15 319 MET n 
15 320 ALA n 
15 321 THR n 
15 322 ASN n 
15 323 ARG n 
15 324 PRO n 
15 325 ASP n 
15 326 THR n 
15 327 LEU n 
15 328 ASP n 
15 329 PRO n 
15 330 ALA n 
15 331 LEU n 
15 332 MET n 
15 333 ARG n 
15 334 PRO n 
15 335 GLY n 
15 336 ARG n 
15 337 LEU n 
15 338 ASP n 
15 339 ARG n 
15 340 LYS n 
15 341 ILE n 
15 342 GLU n 
15 343 PHE n 
15 344 SER n 
15 345 LEU n 
15 346 PRO n 
15 347 ASP n 
15 348 LEU n 
15 349 GLU n 
15 350 GLY n 
15 351 ARG n 
15 352 THR n 
15 353 HIS n 
15 354 ILE n 
15 355 PHE n 
15 356 LYS n 
15 357 ILE n 
15 358 HIS n 
15 359 ALA n 
15 360 ARG n 
15 361 SER n 
15 362 MET n 
15 363 SER n 
15 364 VAL n 
15 365 GLU n 
15 366 ARG n 
15 367 ASP n 
15 368 ILE n 
15 369 ARG n 
15 370 PHE n 
15 371 GLU n 
15 372 LEU n 
15 373 LEU n 
15 374 ALA n 
15 375 ARG n 
15 376 LEU n 
15 377 CYS n 
15 378 PRO n 
15 379 ASN n 
15 380 SER n 
15 381 THR n 
15 382 GLY n 
15 383 ALA n 
15 384 GLU n 
15 385 ILE n 
15 386 ARG n 
15 387 SER n 
15 388 VAL n 
15 389 CYS n 
15 390 THR n 
15 391 GLU n 
15 392 ALA n 
15 393 GLY n 
15 394 MET n 
15 395 PHE n 
15 396 ALA n 
15 397 ILE n 
15 398 ARG n 
15 399 ALA n 
15 400 ARG n 
15 401 ARG n 
15 402 LYS n 
15 403 ILE n 
15 404 ALA n 
15 405 THR n 
15 406 GLU n 
15 407 LYS n 
15 408 ASP n 
15 409 PHE n 
15 410 LEU n 
15 411 GLU n 
15 412 ALA n 
15 413 VAL n 
15 414 ASN n 
15 415 LYS n 
15 416 VAL n 
15 417 ILE n 
15 418 LYS n 
15 419 SER n 
15 420 TYR n 
15 421 ALA n 
15 422 LYS n 
15 423 PHE n 
15 424 SER n 
15 425 ALA n 
15 426 THR n 
15 427 PRO n 
15 428 ARG n 
15 429 TYR n 
15 430 MET n 
15 431 THR n 
15 432 TYR n 
15 433 ASN n 
16 1   MET n 
16 2   GLY n 
16 3   GLN n 
16 4   SER n 
16 5   GLN n 
16 6   SER n 
16 7   GLY n 
16 8   GLY n 
16 9   HIS n 
16 10  GLY n 
16 11  PRO n 
16 12  GLY n 
16 13  GLY n 
16 14  GLY n 
16 15  LYS n 
16 16  LYS n 
16 17  ASP n 
16 18  ASP n 
16 19  LYS n 
16 20  ASP n 
16 21  LYS n 
16 22  LYS n 
16 23  LYS n 
16 24  LYS n 
16 25  TYR n 
16 26  GLU n 
16 27  PRO n 
16 28  PRO n 
16 29  VAL n 
16 30  PRO n 
16 31  THR n 
16 32  ARG n 
16 33  VAL n 
16 34  GLY n 
16 35  LYS n 
16 36  LYS n 
16 37  LYS n 
16 38  LYS n 
16 39  LYS n 
16 40  THR n 
16 41  LYS n 
16 42  GLY n 
16 43  PRO n 
16 44  ASP n 
16 45  ALA n 
16 46  ALA n 
16 47  SER n 
16 48  LYS n 
16 49  LEU n 
16 50  PRO n 
16 51  LEU n 
16 52  VAL n 
16 53  THR n 
16 54  PRO n 
16 55  HIS n 
16 56  THR n 
16 57  GLN n 
16 58  CYS n 
16 59  ARG n 
16 60  LEU n 
16 61  LYS n 
16 62  LEU n 
16 63  LEU n 
16 64  LYS n 
16 65  LEU n 
16 66  GLU n 
16 67  ARG n 
16 68  ILE n 
16 69  LYS n 
16 70  ASP n 
16 71  TYR n 
16 72  LEU n 
16 73  LEU n 
16 74  MET n 
16 75  GLU n 
16 76  GLU n 
16 77  GLU n 
16 78  PHE n 
16 79  ILE n 
16 80  ARG n 
16 81  ASN n 
16 82  GLN n 
16 83  GLU n 
16 84  GLN n 
16 85  MET n 
16 86  LYS n 
16 87  PRO n 
16 88  LEU n 
16 89  GLU n 
16 90  GLU n 
16 91  LYS n 
16 92  GLN n 
16 93  GLU n 
16 94  GLU n 
16 95  GLU n 
16 96  ARG n 
16 97  SER n 
16 98  LYS n 
16 99  VAL n 
16 100 ASP n 
16 101 ASP n 
16 102 LEU n 
16 103 ARG n 
16 104 GLY n 
16 105 THR n 
16 106 PRO n 
16 107 MET n 
16 108 SER n 
16 109 VAL n 
16 110 GLY n 
16 111 THR n 
16 112 LEU n 
16 113 GLU n 
16 114 GLU n 
16 115 ILE n 
16 116 ILE n 
16 117 ASP n 
16 118 ASP n 
16 119 ASN n 
16 120 HIS n 
16 121 ALA n 
16 122 ILE n 
16 123 VAL n 
16 124 SER n 
16 125 THR n 
16 126 SER n 
16 127 VAL n 
16 128 GLY n 
16 129 SER n 
16 130 GLU n 
16 131 HIS n 
16 132 TYR n 
16 133 VAL n 
16 134 SER n 
16 135 ILE n 
16 136 LEU n 
16 137 SER n 
16 138 PHE n 
16 139 VAL n 
16 140 ASP n 
16 141 LYS n 
16 142 ASP n 
16 143 LEU n 
16 144 LEU n 
16 145 GLU n 
16 146 PRO n 
16 147 GLY n 
16 148 CYS n 
16 149 SER n 
16 150 VAL n 
16 151 LEU n 
16 152 LEU n 
16 153 ASN n 
16 154 HIS n 
16 155 LYS n 
16 156 VAL n 
16 157 HIS n 
16 158 ALA n 
16 159 VAL n 
16 160 ILE n 
16 161 GLY n 
16 162 VAL n 
16 163 LEU n 
16 164 MET n 
16 165 ASP n 
16 166 ASP n 
16 167 THR n 
16 168 ASP n 
16 169 PRO n 
16 170 LEU n 
16 171 VAL n 
16 172 THR n 
16 173 VAL n 
16 174 MET n 
16 175 LYS n 
16 176 VAL n 
16 177 GLU n 
16 178 LYS n 
16 179 ALA n 
16 180 PRO n 
16 181 GLN n 
16 182 GLU n 
16 183 THR n 
16 184 TYR n 
16 185 ALA n 
16 186 ASP n 
16 187 ILE n 
16 188 GLY n 
16 189 GLY n 
16 190 LEU n 
16 191 ASP n 
16 192 ASN n 
16 193 GLN n 
16 194 ILE n 
16 195 GLN n 
16 196 GLU n 
16 197 ILE n 
16 198 LYS n 
16 199 GLU n 
16 200 SER n 
16 201 VAL n 
16 202 GLU n 
16 203 LEU n 
16 204 PRO n 
16 205 LEU n 
16 206 THR n 
16 207 HIS n 
16 208 PRO n 
16 209 GLU n 
16 210 TYR n 
16 211 TYR n 
16 212 GLU n 
16 213 GLU n 
16 214 MET n 
16 215 GLY n 
16 216 ILE n 
16 217 LYS n 
16 218 PRO n 
16 219 PRO n 
16 220 LYS n 
16 221 GLY n 
16 222 VAL n 
16 223 ILE n 
16 224 LEU n 
16 225 TYR n 
16 226 GLY n 
16 227 PRO n 
16 228 PRO n 
16 229 GLY n 
16 230 THR n 
16 231 GLY n 
16 232 LYS n 
16 233 THR n 
16 234 LEU n 
16 235 LEU n 
16 236 ALA n 
16 237 LYS n 
16 238 ALA n 
16 239 VAL n 
16 240 ALA n 
16 241 ASN n 
16 242 GLN n 
16 243 THR n 
16 244 SER n 
16 245 ALA n 
16 246 THR n 
16 247 PHE n 
16 248 LEU n 
16 249 ARG n 
16 250 VAL n 
16 251 VAL n 
16 252 GLY n 
16 253 SER n 
16 254 GLU n 
16 255 LEU n 
16 256 ILE n 
16 257 GLN n 
16 258 LYS n 
16 259 TYR n 
16 260 LEU n 
16 261 GLY n 
16 262 ASP n 
16 263 GLY n 
16 264 PRO n 
16 265 LYS n 
16 266 LEU n 
16 267 VAL n 
16 268 ARG n 
16 269 GLU n 
16 270 LEU n 
16 271 PHE n 
16 272 ARG n 
16 273 VAL n 
16 274 ALA n 
16 275 GLU n 
16 276 GLU n 
16 277 HIS n 
16 278 ALA n 
16 279 PRO n 
16 280 SER n 
16 281 ILE n 
16 282 VAL n 
16 283 PHE n 
16 284 ILE n 
16 285 ASP n 
16 286 GLU n 
16 287 ILE n 
16 288 ASP n 
16 289 ALA n 
16 290 ILE n 
16 291 GLY n 
16 292 THR n 
16 293 LYS n 
16 294 ARG n 
16 295 TYR n 
16 296 ASP n 
16 297 SER n 
16 298 ASN n 
16 299 SER n 
16 300 GLY n 
16 301 GLY n 
16 302 GLU n 
16 303 ARG n 
16 304 GLU n 
16 305 ILE n 
16 306 GLN n 
16 307 ARG n 
16 308 THR n 
16 309 MET n 
16 310 LEU n 
16 311 GLU n 
16 312 LEU n 
16 313 LEU n 
16 314 ASN n 
16 315 GLN n 
16 316 LEU n 
16 317 ASP n 
16 318 GLY n 
16 319 PHE n 
16 320 ASP n 
16 321 SER n 
16 322 ARG n 
16 323 GLY n 
16 324 ASP n 
16 325 VAL n 
16 326 LYS n 
16 327 VAL n 
16 328 ILE n 
16 329 MET n 
16 330 ALA n 
16 331 THR n 
16 332 ASN n 
16 333 ARG n 
16 334 ILE n 
16 335 GLU n 
16 336 THR n 
16 337 LEU n 
16 338 ASP n 
16 339 PRO n 
16 340 ALA n 
16 341 LEU n 
16 342 ILE n 
16 343 ARG n 
16 344 PRO n 
16 345 GLY n 
16 346 ARG n 
16 347 ILE n 
16 348 ASP n 
16 349 ARG n 
16 350 LYS n 
16 351 ILE n 
16 352 GLU n 
16 353 PHE n 
16 354 PRO n 
16 355 LEU n 
16 356 PRO n 
16 357 ASP n 
16 358 GLU n 
16 359 LYS n 
16 360 THR n 
16 361 LYS n 
16 362 LYS n 
16 363 ARG n 
16 364 ILE n 
16 365 PHE n 
16 366 GLN n 
16 367 ILE n 
16 368 HIS n 
16 369 THR n 
16 370 SER n 
16 371 ARG n 
16 372 MET n 
16 373 THR n 
16 374 LEU n 
16 375 ALA n 
16 376 ASP n 
16 377 ASP n 
16 378 VAL n 
16 379 THR n 
16 380 LEU n 
16 381 ASP n 
16 382 ASP n 
16 383 LEU n 
16 384 ILE n 
16 385 MET n 
16 386 ALA n 
16 387 LYS n 
16 388 ASP n 
16 389 ASP n 
16 390 LEU n 
16 391 SER n 
16 392 GLY n 
16 393 ALA n 
16 394 ASP n 
16 395 ILE n 
16 396 LYS n 
16 397 ALA n 
16 398 ILE n 
16 399 CYS n 
16 400 THR n 
16 401 GLU n 
16 402 ALA n 
16 403 GLY n 
16 404 LEU n 
16 405 MET n 
16 406 ALA n 
16 407 LEU n 
16 408 ARG n 
16 409 GLU n 
16 410 ARG n 
16 411 ARG n 
16 412 MET n 
16 413 LYS n 
16 414 VAL n 
16 415 THR n 
16 416 ASN n 
16 417 GLU n 
16 418 ASP n 
16 419 PHE n 
16 420 LYS n 
16 421 LYS n 
16 422 SER n 
16 423 LYS n 
16 424 GLU n 
16 425 ASN n 
16 426 VAL n 
16 427 LEU n 
16 428 TYR n 
16 429 LYS n 
16 430 LYS n 
16 431 GLN n 
16 432 GLU n 
16 433 GLY n 
16 434 THR n 
16 435 PRO n 
16 436 GLU n 
16 437 GLY n 
16 438 LEU n 
16 439 TYR n 
16 440 LEU n 
17 1   MET n 
17 2   GLU n 
17 3   GLU n 
17 4   ILE n 
17 5   GLY n 
17 6   ILE n 
17 7   LEU n 
17 8   VAL n 
17 9   GLU n 
17 10  LYS n 
17 11  ALA n 
17 12  GLN n 
17 13  ASP n 
17 14  GLU n 
17 15  ILE n 
17 16  PRO n 
17 17  ALA n 
17 18  LEU n 
17 19  SER n 
17 20  VAL n 
17 21  SER n 
17 22  ARG n 
17 23  PRO n 
17 24  GLN n 
17 25  THR n 
17 26  GLY n 
17 27  LEU n 
17 28  SER n 
17 29  PHE n 
17 30  LEU n 
17 31  GLY n 
17 32  PRO n 
17 33  GLU n 
17 34  PRO n 
17 35  GLU n 
17 36  ASP n 
17 37  LEU n 
17 38  GLU n 
17 39  ASP n 
17 40  LEU n 
17 41  TYR n 
17 42  SER n 
17 43  ARG n 
17 44  TYR n 
17 45  LYS n 
17 46  LYS n 
17 47  LEU n 
17 48  GLN n 
17 49  GLN n 
17 50  GLU n 
17 51  LEU n 
17 52  GLU n 
17 53  PHE n 
17 54  LEU n 
17 55  GLU n 
17 56  VAL n 
17 57  GLN n 
17 58  GLU n 
17 59  GLU n 
17 60  TYR n 
17 61  ILE n 
17 62  LYS n 
17 63  ASP n 
17 64  GLU n 
17 65  GLN n 
17 66  LYS n 
17 67  ASN n 
17 68  LEU n 
17 69  LYS n 
17 70  LYS n 
17 71  GLU n 
17 72  PHE n 
17 73  LEU n 
17 74  HIS n 
17 75  ALA n 
17 76  GLN n 
17 77  GLU n 
17 78  GLU n 
17 79  VAL n 
17 80  LYS n 
17 81  ARG n 
17 82  ILE n 
17 83  GLN n 
17 84  SER n 
17 85  ILE n 
17 86  PRO n 
17 87  LEU n 
17 88  VAL n 
17 89  ILE n 
17 90  GLY n 
17 91  GLN n 
17 92  PHE n 
17 93  LEU n 
17 94  GLU n 
17 95  ALA n 
17 96  VAL n 
17 97  ASP n 
17 98  GLN n 
17 99  ASN n 
17 100 THR n 
17 101 ALA n 
17 102 ILE n 
17 103 VAL n 
17 104 GLY n 
17 105 SER n 
17 106 THR n 
17 107 THR n 
17 108 GLY n 
17 109 SER n 
17 110 ASN n 
17 111 TYR n 
17 112 TYR n 
17 113 VAL n 
17 114 ARG n 
17 115 ILE n 
17 116 LEU n 
17 117 SER n 
17 118 THR n 
17 119 ILE n 
17 120 ASP n 
17 121 ARG n 
17 122 GLU n 
17 123 LEU n 
17 124 LEU n 
17 125 LYS n 
17 126 PRO n 
17 127 ASN n 
17 128 ALA n 
17 129 SER n 
17 130 VAL n 
17 131 ALA n 
17 132 LEU n 
17 133 HIS n 
17 134 LYS n 
17 135 HIS n 
17 136 SER n 
17 137 ASN n 
17 138 ALA n 
17 139 LEU n 
17 140 VAL n 
17 141 ASP n 
17 142 VAL n 
17 143 LEU n 
17 144 PRO n 
17 145 PRO n 
17 146 GLU n 
17 147 ALA n 
17 148 ASP n 
17 149 SER n 
17 150 SER n 
17 151 ILE n 
17 152 MET n 
17 153 MET n 
17 154 LEU n 
17 155 THR n 
17 156 SER n 
17 157 ASP n 
17 158 GLN n 
17 159 LYS n 
17 160 PRO n 
17 161 ASP n 
17 162 VAL n 
17 163 MET n 
17 164 TYR n 
17 165 ALA n 
17 166 ASP n 
17 167 ILE n 
17 168 GLY n 
17 169 GLY n 
17 170 MET n 
17 171 ASP n 
17 172 ILE n 
17 173 GLN n 
17 174 LYS n 
17 175 GLN n 
17 176 GLU n 
17 177 VAL n 
17 178 ARG n 
17 179 GLU n 
17 180 ALA n 
17 181 VAL n 
17 182 GLU n 
17 183 LEU n 
17 184 PRO n 
17 185 LEU n 
17 186 THR n 
17 187 HIS n 
17 188 PHE n 
17 189 GLU n 
17 190 LEU n 
17 191 TYR n 
17 192 LYS n 
17 193 GLN n 
17 194 ILE n 
17 195 GLY n 
17 196 ILE n 
17 197 ASP n 
17 198 PRO n 
17 199 PRO n 
17 200 ARG n 
17 201 GLY n 
17 202 VAL n 
17 203 LEU n 
17 204 MET n 
17 205 TYR n 
17 206 GLY n 
17 207 PRO n 
17 208 PRO n 
17 209 GLY n 
17 210 CYS n 
17 211 GLY n 
17 212 LYS n 
17 213 THR n 
17 214 MET n 
17 215 LEU n 
17 216 ALA n 
17 217 LYS n 
17 218 ALA n 
17 219 VAL n 
17 220 ALA n 
17 221 HIS n 
17 222 HIS n 
17 223 THR n 
17 224 THR n 
17 225 ALA n 
17 226 ALA n 
17 227 PHE n 
17 228 ILE n 
17 229 ARG n 
17 230 VAL n 
17 231 VAL n 
17 232 GLY n 
17 233 SER n 
17 234 GLU n 
17 235 PHE n 
17 236 VAL n 
17 237 GLN n 
17 238 LYS n 
17 239 TYR n 
17 240 LEU n 
17 241 GLY n 
17 242 GLU n 
17 243 GLY n 
17 244 PRO n 
17 245 ARG n 
17 246 MET n 
17 247 VAL n 
17 248 ARG n 
17 249 ASP n 
17 250 VAL n 
17 251 PHE n 
17 252 ARG n 
17 253 LEU n 
17 254 ALA n 
17 255 LYS n 
17 256 GLU n 
17 257 ASN n 
17 258 ALA n 
17 259 PRO n 
17 260 ALA n 
17 261 ILE n 
17 262 ILE n 
17 263 PHE n 
17 264 ILE n 
17 265 ASP n 
17 266 GLU n 
17 267 ILE n 
17 268 ASP n 
17 269 ALA n 
17 270 ILE n 
17 271 ALA n 
17 272 THR n 
17 273 LYS n 
17 274 ARG n 
17 275 PHE n 
17 276 ASP n 
17 277 ALA n 
17 278 GLN n 
17 279 THR n 
17 280 GLY n 
17 281 ALA n 
17 282 ASP n 
17 283 ARG n 
17 284 GLU n 
17 285 VAL n 
17 286 GLN n 
17 287 ARG n 
17 288 ILE n 
17 289 LEU n 
17 290 LEU n 
17 291 GLU n 
17 292 LEU n 
17 293 LEU n 
17 294 ASN n 
17 295 GLN n 
17 296 MET n 
17 297 ASP n 
17 298 GLY n 
17 299 PHE n 
17 300 ASP n 
17 301 GLN n 
17 302 ASN n 
17 303 VAL n 
17 304 ASN n 
17 305 VAL n 
17 306 LYS n 
17 307 VAL n 
17 308 ILE n 
17 309 MET n 
17 310 ALA n 
17 311 THR n 
17 312 ASN n 
17 313 ARG n 
17 314 ALA n 
17 315 ASP n 
17 316 THR n 
17 317 LEU n 
17 318 ASP n 
17 319 PRO n 
17 320 ALA n 
17 321 LEU n 
17 322 LEU n 
17 323 ARG n 
17 324 PRO n 
17 325 GLY n 
17 326 ARG n 
17 327 LEU n 
17 328 ASP n 
17 329 ARG n 
17 330 LYS n 
17 331 ILE n 
17 332 GLU n 
17 333 PHE n 
17 334 PRO n 
17 335 LEU n 
17 336 PRO n 
17 337 ASP n 
17 338 ARG n 
17 339 ARG n 
17 340 GLN n 
17 341 LYS n 
17 342 ARG n 
17 343 LEU n 
17 344 ILE n 
17 345 PHE n 
17 346 SER n 
17 347 THR n 
17 348 ILE n 
17 349 THR n 
17 350 SER n 
17 351 LYS n 
17 352 MET n 
17 353 ASN n 
17 354 LEU n 
17 355 SER n 
17 356 GLU n 
17 357 GLU n 
17 358 VAL n 
17 359 ASP n 
17 360 LEU n 
17 361 GLU n 
17 362 ASP n 
17 363 TYR n 
17 364 VAL n 
17 365 ALA n 
17 366 ARG n 
17 367 PRO n 
17 368 ASP n 
17 369 LYS n 
17 370 ILE n 
17 371 SER n 
17 372 GLY n 
17 373 ALA n 
17 374 ASP n 
17 375 ILE n 
17 376 ASN n 
17 377 SER n 
17 378 ILE n 
17 379 CYS n 
17 380 GLN n 
17 381 GLU n 
17 382 SER n 
17 383 GLY n 
17 384 MET n 
17 385 LEU n 
17 386 ALA n 
17 387 VAL n 
17 388 ARG n 
17 389 GLU n 
17 390 ASN n 
17 391 ARG n 
17 392 TYR n 
17 393 ILE n 
17 394 VAL n 
17 395 LEU n 
17 396 ALA n 
17 397 LYS n 
17 398 ASP n 
17 399 PHE n 
17 400 GLU n 
17 401 LYS n 
17 402 ALA n 
17 403 TYR n 
17 404 LYS n 
17 405 THR n 
17 406 VAL n 
17 407 ILE n 
17 408 LYS n 
17 409 LYS n 
17 410 ASP n 
17 411 GLU n 
17 412 GLN n 
17 413 GLU n 
17 414 HIS n 
17 415 GLU n 
17 416 PHE n 
17 417 TYR n 
17 418 LYS n 
18 1   MET n 
18 2   ALA n 
18 3   ASP n 
18 4   PRO n 
18 5   ARG n 
18 6   ASP n 
18 7   LYS n 
18 8   ALA n 
18 9   LEU n 
18 10  GLN n 
18 11  ASP n 
18 12  TYR n 
18 13  ARG n 
18 14  LYS n 
18 15  LYS n 
18 16  LEU n 
18 17  LEU n 
18 18  GLU n 
18 19  HIS n 
18 20  LYS n 
18 21  GLU n 
18 22  ILE n 
18 23  ASP n 
18 24  GLY n 
18 25  ARG n 
18 26  LEU n 
18 27  LYS n 
18 28  GLU n 
18 29  LEU n 
18 30  ARG n 
18 31  GLU n 
18 32  GLN n 
18 33  LEU n 
18 34  LYS n 
18 35  GLU n 
18 36  LEU n 
18 37  THR n 
18 38  LYS n 
18 39  GLN n 
18 40  TYR n 
18 41  GLU n 
18 42  LYS n 
18 43  SER n 
18 44  GLU n 
18 45  ASN n 
18 46  ASP n 
18 47  LEU n 
18 48  LYS n 
18 49  ALA n 
18 50  LEU n 
18 51  GLN n 
18 52  SER n 
18 53  VAL n 
18 54  GLY n 
18 55  GLN n 
18 56  ILE n 
18 57  VAL n 
18 58  GLY n 
18 59  GLU n 
18 60  VAL n 
18 61  LEU n 
18 62  LYS n 
18 63  GLN n 
18 64  LEU n 
18 65  THR n 
18 66  GLU n 
18 67  GLU n 
18 68  LYS n 
18 69  PHE n 
18 70  ILE n 
18 71  VAL n 
18 72  LYS n 
18 73  ALA n 
18 74  THR n 
18 75  ASN n 
18 76  GLY n 
18 77  PRO n 
18 78  ARG n 
18 79  TYR n 
18 80  VAL n 
18 81  VAL n 
18 82  GLY n 
18 83  CYS n 
18 84  ARG n 
18 85  ARG n 
18 86  GLN n 
18 87  LEU n 
18 88  ASP n 
18 89  LYS n 
18 90  SER n 
18 91  LYS n 
18 92  LEU n 
18 93  LYS n 
18 94  PRO n 
18 95  GLY n 
18 96  THR n 
18 97  ARG n 
18 98  VAL n 
18 99  ALA n 
18 100 LEU n 
18 101 ASP n 
18 102 MET n 
18 103 THR n 
18 104 THR n 
18 105 LEU n 
18 106 THR n 
18 107 ILE n 
18 108 MET n 
18 109 ARG n 
18 110 TYR n 
18 111 LEU n 
18 112 PRO n 
18 113 ARG n 
18 114 GLU n 
18 115 VAL n 
18 116 ASP n 
18 117 PRO n 
18 118 LEU n 
18 119 VAL n 
18 120 TYR n 
18 121 ASN n 
18 122 MET n 
18 123 SER n 
18 124 HIS n 
18 125 GLU n 
18 126 ASP n 
18 127 PRO n 
18 128 GLY n 
18 129 ASN n 
18 130 VAL n 
18 131 SER n 
18 132 TYR n 
18 133 SER n 
18 134 GLU n 
18 135 ILE n 
18 136 GLY n 
18 137 GLY n 
18 138 LEU n 
18 139 SER n 
18 140 GLU n 
18 141 GLN n 
18 142 ILE n 
18 143 ARG n 
18 144 GLU n 
18 145 LEU n 
18 146 ARG n 
18 147 GLU n 
18 148 VAL n 
18 149 ILE n 
18 150 GLU n 
18 151 LEU n 
18 152 PRO n 
18 153 LEU n 
18 154 THR n 
18 155 ASN n 
18 156 PRO n 
18 157 GLU n 
18 158 LEU n 
18 159 PHE n 
18 160 GLN n 
18 161 ARG n 
18 162 VAL n 
18 163 GLY n 
18 164 ILE n 
18 165 ILE n 
18 166 PRO n 
18 167 PRO n 
18 168 LYS n 
18 169 GLY n 
18 170 CYS n 
18 171 LEU n 
18 172 LEU n 
18 173 TYR n 
18 174 GLY n 
18 175 PRO n 
18 176 PRO n 
18 177 GLY n 
18 178 THR n 
18 179 GLY n 
18 180 LYS n 
18 181 THR n 
18 182 LEU n 
18 183 LEU n 
18 184 ALA n 
18 185 ARG n 
18 186 ALA n 
18 187 VAL n 
18 188 ALA n 
18 189 SER n 
18 190 GLN n 
18 191 LEU n 
18 192 ASP n 
18 193 CYS n 
18 194 ASN n 
18 195 PHE n 
18 196 LEU n 
18 197 LYS n 
18 198 VAL n 
18 199 VAL n 
18 200 SER n 
18 201 SER n 
18 202 SER n 
18 203 ILE n 
18 204 VAL n 
18 205 ASP n 
18 206 LYS n 
18 207 TYR n 
18 208 ILE n 
18 209 GLY n 
18 210 GLU n 
18 211 SER n 
18 212 ALA n 
18 213 ARG n 
18 214 LEU n 
18 215 ILE n 
18 216 ARG n 
18 217 GLU n 
18 218 MET n 
18 219 PHE n 
18 220 ASN n 
18 221 TYR n 
18 222 ALA n 
18 223 ARG n 
18 224 ASP n 
18 225 HIS n 
18 226 GLN n 
18 227 PRO n 
18 228 CYS n 
18 229 ILE n 
18 230 ILE n 
18 231 PHE n 
18 232 MET n 
18 233 ASP n 
18 234 GLU n 
18 235 ILE n 
18 236 ASP n 
18 237 ALA n 
18 238 ILE n 
18 239 GLY n 
18 240 GLY n 
18 241 ARG n 
18 242 ARG n 
18 243 PHE n 
18 244 SER n 
18 245 GLU n 
18 246 GLY n 
18 247 THR n 
18 248 SER n 
18 249 ALA n 
18 250 ASP n 
18 251 ARG n 
18 252 GLU n 
18 253 ILE n 
18 254 GLN n 
18 255 ARG n 
18 256 THR n 
18 257 LEU n 
18 258 MET n 
18 259 GLU n 
18 260 LEU n 
18 261 LEU n 
18 262 ASN n 
18 263 GLN n 
18 264 MET n 
18 265 ASP n 
18 266 GLY n 
18 267 PHE n 
18 268 ASP n 
18 269 THR n 
18 270 LEU n 
18 271 HIS n 
18 272 ARG n 
18 273 VAL n 
18 274 LYS n 
18 275 MET n 
18 276 ILE n 
18 277 MET n 
18 278 ALA n 
18 279 THR n 
18 280 ASN n 
18 281 ARG n 
18 282 PRO n 
18 283 ASP n 
18 284 THR n 
18 285 LEU n 
18 286 ASP n 
18 287 PRO n 
18 288 ALA n 
18 289 LEU n 
18 290 LEU n 
18 291 ARG n 
18 292 PRO n 
18 293 GLY n 
18 294 ARG n 
18 295 LEU n 
18 296 ASP n 
18 297 ARG n 
18 298 LYS n 
18 299 ILE n 
18 300 HIS n 
18 301 ILE n 
18 302 ASP n 
18 303 LEU n 
18 304 PRO n 
18 305 ASN n 
18 306 GLU n 
18 307 GLN n 
18 308 ALA n 
18 309 ARG n 
18 310 LEU n 
18 311 ASP n 
18 312 ILE n 
18 313 LEU n 
18 314 LYS n 
18 315 ILE n 
18 316 HIS n 
18 317 ALA n 
18 318 GLY n 
18 319 PRO n 
18 320 ILE n 
18 321 THR n 
18 322 LYS n 
18 323 HIS n 
18 324 GLY n 
18 325 GLU n 
18 326 ILE n 
18 327 ASP n 
18 328 TYR n 
18 329 GLU n 
18 330 ALA n 
18 331 ILE n 
18 332 VAL n 
18 333 LYS n 
18 334 LEU n 
18 335 SER n 
18 336 ASP n 
18 337 GLY n 
18 338 PHE n 
18 339 ASN n 
18 340 GLY n 
18 341 ALA n 
18 342 ASP n 
18 343 LEU n 
18 344 ARG n 
18 345 ASN n 
18 346 VAL n 
18 347 CYS n 
18 348 THR n 
18 349 GLU n 
18 350 ALA n 
18 351 GLY n 
18 352 MET n 
18 353 PHE n 
18 354 ALA n 
18 355 ILE n 
18 356 ARG n 
18 357 ALA n 
18 358 ASP n 
18 359 HIS n 
18 360 ASP n 
18 361 PHE n 
18 362 VAL n 
18 363 VAL n 
18 364 GLN n 
18 365 GLU n 
18 366 ASP n 
18 367 PHE n 
18 368 MET n 
18 369 LYS n 
18 370 ALA n 
18 371 VAL n 
18 372 ARG n 
18 373 LYS n 
18 374 VAL n 
18 375 ALA n 
18 376 ASP n 
18 377 SER n 
18 378 LYS n 
18 379 LYS n 
18 380 LEU n 
18 381 GLU n 
18 382 SER n 
18 383 LYS n 
18 384 LEU n 
18 385 ASP n 
18 386 TYR n 
18 387 LYS n 
18 388 PRO n 
18 389 VAL n 
19 1   MET n 
19 2   ASN n 
19 3   LEU n 
19 4   LEU n 
19 5   PRO n 
19 6   ASN n 
19 7   ILE n 
19 8   GLU n 
19 9   SER n 
19 10  PRO n 
19 11  VAL n 
19 12  THR n 
19 13  ARG n 
19 14  GLN n 
19 15  GLU n 
19 16  LYS n 
19 17  MET n 
19 18  ALA n 
19 19  THR n 
19 20  VAL n 
19 21  TRP n 
19 22  ASP n 
19 23  GLU n 
19 24  ALA n 
19 25  GLU n 
19 26  GLN n 
19 27  ASP n 
19 28  GLY n 
19 29  ILE n 
19 30  GLY n 
19 31  GLU n 
19 32  GLU n 
19 33  VAL n 
19 34  LEU n 
19 35  LYS n 
19 36  MET n 
19 37  SER n 
19 38  THR n 
19 39  GLU n 
19 40  GLU n 
19 41  ILE n 
19 42  ILE n 
19 43  GLN n 
19 44  ARG n 
19 45  THR n 
19 46  ARG n 
19 47  LEU n 
19 48  LEU n 
19 49  ASP n 
19 50  SER n 
19 51  GLU n 
19 52  ILE n 
19 53  LYS n 
19 54  ILE n 
19 55  MET n 
19 56  LYS n 
19 57  SER n 
19 58  GLU n 
19 59  VAL n 
19 60  LEU n 
19 61  ARG n 
19 62  VAL n 
19 63  THR n 
19 64  HIS n 
19 65  GLU n 
19 66  LEU n 
19 67  GLN n 
19 68  ALA n 
19 69  MET n 
19 70  LYS n 
19 71  ASP n 
19 72  LYS n 
19 73  ILE n 
19 74  LYS n 
19 75  GLU n 
19 76  ASN n 
19 77  SER n 
19 78  GLU n 
19 79  LYS n 
19 80  ILE n 
19 81  LYS n 
19 82  VAL n 
19 83  ASN n 
19 84  LYS n 
19 85  THR n 
19 86  LEU n 
19 87  PRO n 
19 88  TYR n 
19 89  LEU n 
19 90  VAL n 
19 91  SER n 
19 92  ASN n 
19 93  VAL n 
19 94  ILE n 
19 95  GLU n 
19 96  LEU n 
19 97  LEU n 
19 98  ASP n 
19 99  VAL n 
19 100 ASP n 
19 101 PRO n 
19 102 ASN n 
19 103 ASP n 
19 104 GLN n 
19 105 GLU n 
19 106 GLU n 
19 107 ASP n 
19 108 GLY n 
19 109 ALA n 
19 110 ASN n 
19 111 ILE n 
19 112 ASP n 
19 113 LEU n 
19 114 ASP n 
19 115 SER n 
19 116 GLN n 
19 117 ARG n 
19 118 LYS n 
19 119 GLY n 
19 120 LYS n 
19 121 CYS n 
19 122 ALA n 
19 123 VAL n 
19 124 ILE n 
19 125 LYS n 
19 126 THR n 
19 127 SER n 
19 128 THR n 
19 129 ARG n 
19 130 GLN n 
19 131 THR n 
19 132 TYR n 
19 133 PHE n 
19 134 LEU n 
19 135 PRO n 
19 136 VAL n 
19 137 ILE n 
19 138 GLY n 
19 139 LEU n 
19 140 VAL n 
19 141 ASP n 
19 142 ALA n 
19 143 GLU n 
19 144 LYS n 
19 145 LEU n 
19 146 LYS n 
19 147 PRO n 
19 148 GLY n 
19 149 ASP n 
19 150 LEU n 
19 151 VAL n 
19 152 GLY n 
19 153 VAL n 
19 154 ASN n 
19 155 LYS n 
19 156 ASP n 
19 157 SER n 
19 158 TYR n 
19 159 LEU n 
19 160 ILE n 
19 161 LEU n 
19 162 GLU n 
19 163 THR n 
19 164 LEU n 
19 165 PRO n 
19 166 THR n 
19 167 GLU n 
19 168 TYR n 
19 169 ASP n 
19 170 SER n 
19 171 ARG n 
19 172 VAL n 
19 173 LYS n 
19 174 ALA n 
19 175 MET n 
19 176 GLU n 
19 177 VAL n 
19 178 ASP n 
19 179 GLU n 
19 180 ARG n 
19 181 PRO n 
19 182 THR n 
19 183 GLU n 
19 184 GLN n 
19 185 TYR n 
19 186 SER n 
19 187 ASP n 
19 188 ILE n 
19 189 GLY n 
19 190 GLY n 
19 191 LEU n 
19 192 ASP n 
19 193 LYS n 
19 194 GLN n 
19 195 ILE n 
19 196 GLN n 
19 197 GLU n 
19 198 LEU n 
19 199 VAL n 
19 200 GLU n 
19 201 ALA n 
19 202 ILE n 
19 203 VAL n 
19 204 LEU n 
19 205 PRO n 
19 206 MET n 
19 207 ASN n 
19 208 HIS n 
19 209 LYS n 
19 210 GLU n 
19 211 LYS n 
19 212 PHE n 
19 213 GLU n 
19 214 ASN n 
19 215 LEU n 
19 216 GLY n 
19 217 ILE n 
19 218 GLN n 
19 219 PRO n 
19 220 PRO n 
19 221 LYS n 
19 222 GLY n 
19 223 VAL n 
19 224 LEU n 
19 225 MET n 
19 226 TYR n 
19 227 GLY n 
19 228 PRO n 
19 229 PRO n 
19 230 GLY n 
19 231 THR n 
19 232 GLY n 
19 233 LYS n 
19 234 THR n 
19 235 LEU n 
19 236 LEU n 
19 237 ALA n 
19 238 ARG n 
19 239 ALA n 
19 240 CYS n 
19 241 ALA n 
19 242 ALA n 
19 243 GLN n 
19 244 THR n 
19 245 LYS n 
19 246 ALA n 
19 247 THR n 
19 248 PHE n 
19 249 LEU n 
19 250 LYS n 
19 251 LEU n 
19 252 ALA n 
19 253 GLY n 
19 254 PRO n 
19 255 GLN n 
19 256 LEU n 
19 257 VAL n 
19 258 GLN n 
19 259 MET n 
19 260 PHE n 
19 261 ILE n 
19 262 GLY n 
19 263 ASP n 
19 264 GLY n 
19 265 ALA n 
19 266 LYS n 
19 267 LEU n 
19 268 VAL n 
19 269 ARG n 
19 270 ASP n 
19 271 ALA n 
19 272 PHE n 
19 273 ALA n 
19 274 LEU n 
19 275 ALA n 
19 276 LYS n 
19 277 GLU n 
19 278 LYS n 
19 279 ALA n 
19 280 PRO n 
19 281 SER n 
19 282 ILE n 
19 283 ILE n 
19 284 PHE n 
19 285 ILE n 
19 286 ASP n 
19 287 GLU n 
19 288 LEU n 
19 289 ASP n 
19 290 ALA n 
19 291 ILE n 
19 292 GLY n 
19 293 THR n 
19 294 LYS n 
19 295 ARG n 
19 296 PHE n 
19 297 ASP n 
19 298 SER n 
19 299 GLU n 
19 300 LYS n 
19 301 ALA n 
19 302 GLY n 
19 303 ASP n 
19 304 ARG n 
19 305 GLU n 
19 306 VAL n 
19 307 GLN n 
19 308 ARG n 
19 309 THR n 
19 310 MET n 
19 311 LEU n 
19 312 GLU n 
19 313 LEU n 
19 314 LEU n 
19 315 ASN n 
19 316 GLN n 
19 317 LEU n 
19 318 ASP n 
19 319 GLY n 
19 320 PHE n 
19 321 GLN n 
19 322 PRO n 
19 323 ASN n 
19 324 THR n 
19 325 GLN n 
19 326 VAL n 
19 327 LYS n 
19 328 VAL n 
19 329 ILE n 
19 330 ALA n 
19 331 ALA n 
19 332 THR n 
19 333 ASN n 
19 334 ARG n 
19 335 VAL n 
19 336 ASP n 
19 337 ILE n 
19 338 LEU n 
19 339 ASP n 
19 340 PRO n 
19 341 ALA n 
19 342 LEU n 
19 343 LEU n 
19 344 ARG n 
19 345 SER n 
19 346 GLY n 
19 347 ARG n 
19 348 LEU n 
19 349 ASP n 
19 350 ARG n 
19 351 LYS n 
19 352 ILE n 
19 353 GLU n 
19 354 PHE n 
19 355 PRO n 
19 356 MET n 
19 357 PRO n 
19 358 ASN n 
19 359 GLU n 
19 360 GLU n 
19 361 ALA n 
19 362 ARG n 
19 363 ALA n 
19 364 ARG n 
19 365 ILE n 
19 366 MET n 
19 367 GLN n 
19 368 ILE n 
19 369 HIS n 
19 370 SER n 
19 371 ARG n 
19 372 LYS n 
19 373 MET n 
19 374 ASN n 
19 375 VAL n 
19 376 SER n 
19 377 PRO n 
19 378 ASP n 
19 379 VAL n 
19 380 ASN n 
19 381 TYR n 
19 382 GLU n 
19 383 GLU n 
19 384 LEU n 
19 385 ALA n 
19 386 ARG n 
19 387 CYS n 
19 388 THR n 
19 389 ASP n 
19 390 ASP n 
19 391 PHE n 
19 392 ASN n 
19 393 GLY n 
19 394 ALA n 
19 395 GLN n 
19 396 CYS n 
19 397 LYS n 
19 398 ALA n 
19 399 VAL n 
19 400 CYS n 
19 401 VAL n 
19 402 GLU n 
19 403 ALA n 
19 404 GLY n 
19 405 MET n 
19 406 ILE n 
19 407 ALA n 
19 408 LEU n 
19 409 ARG n 
19 410 ARG n 
19 411 GLY n 
19 412 ALA n 
19 413 THR n 
19 414 GLU n 
19 415 LEU n 
19 416 THR n 
19 417 HIS n 
19 418 GLU n 
19 419 ASP n 
19 420 TYR n 
19 421 MET n 
19 422 GLU n 
19 423 GLY n 
19 424 ILE n 
19 425 LEU n 
19 426 GLU n 
19 427 VAL n 
19 428 GLN n 
19 429 ALA n 
19 430 LYS n 
19 431 LYS n 
19 432 LYS n 
19 433 ALA n 
19 434 ASN n 
19 435 LEU n 
19 436 GLN n 
19 437 TYR n 
19 438 TYR n 
19 439 ALA n 
20 1   MET n 
20 2   ALA n 
20 3   LEU n 
20 4   ASP n 
20 5   GLY n 
20 6   PRO n 
20 7   GLU n 
20 8   GLN n 
20 9   MET n 
20 10  GLU n 
20 11  LEU n 
20 12  GLU n 
20 13  GLU n 
20 14  GLY n 
20 15  LYS n 
20 16  ALA n 
20 17  GLY n 
20 18  SER n 
20 19  GLY n 
20 20  LEU n 
20 21  ARG n 
20 22  GLN n 
20 23  TYR n 
20 24  TYR n 
20 25  LEU n 
20 26  SER n 
20 27  LYS n 
20 28  ILE n 
20 29  GLU n 
20 30  GLU n 
20 31  LEU n 
20 32  GLN n 
20 33  LEU n 
20 34  ILE n 
20 35  VAL n 
20 36  ASN n 
20 37  ASP n 
20 38  LYS n 
20 39  SER n 
20 40  GLN n 
20 41  ASN n 
20 42  LEU n 
20 43  ARG n 
20 44  ARG n 
20 45  LEU n 
20 46  GLN n 
20 47  ALA n 
20 48  GLN n 
20 49  ARG n 
20 50  ASN n 
20 51  GLU n 
20 52  LEU n 
20 53  ASN n 
20 54  ALA n 
20 55  LYS n 
20 56  VAL n 
20 57  ARG n 
20 58  LEU n 
20 59  LEU n 
20 60  ARG n 
20 61  GLU n 
20 62  GLU n 
20 63  LEU n 
20 64  GLN n 
20 65  LEU n 
20 66  LEU n 
20 67  GLN n 
20 68  GLU n 
20 69  GLN n 
20 70  GLY n 
20 71  SER n 
20 72  TYR n 
20 73  VAL n 
20 74  GLY n 
20 75  GLU n 
20 76  VAL n 
20 77  VAL n 
20 78  ARG n 
20 79  ALA n 
20 80  MET n 
20 81  ASP n 
20 82  LYS n 
20 83  LYS n 
20 84  LYS n 
20 85  VAL n 
20 86  LEU n 
20 87  VAL n 
20 88  LYS n 
20 89  VAL n 
20 90  HIS n 
20 91  PRO n 
20 92  GLU n 
20 93  GLY n 
20 94  LYS n 
20 95  PHE n 
20 96  VAL n 
20 97  VAL n 
20 98  ASP n 
20 99  VAL n 
20 100 ASP n 
20 101 LYS n 
20 102 ASN n 
20 103 ILE n 
20 104 ASP n 
20 105 ILE n 
20 106 ASN n 
20 107 ASP n 
20 108 VAL n 
20 109 THR n 
20 110 PRO n 
20 111 ASN n 
20 112 CYS n 
20 113 ARG n 
20 114 VAL n 
20 115 ALA n 
20 116 LEU n 
20 117 ARG n 
20 118 ASN n 
20 119 ASP n 
20 120 SER n 
20 121 TYR n 
20 122 THR n 
20 123 LEU n 
20 124 HIS n 
20 125 LYS n 
20 126 ILE n 
20 127 LEU n 
20 128 PRO n 
20 129 ASN n 
20 130 LYS n 
20 131 VAL n 
20 132 ASP n 
20 133 PRO n 
20 134 LEU n 
20 135 VAL n 
20 136 SER n 
20 137 LEU n 
20 138 MET n 
20 139 MET n 
20 140 VAL n 
20 141 GLU n 
20 142 LYS n 
20 143 VAL n 
20 144 PRO n 
20 145 ASP n 
20 146 SER n 
20 147 THR n 
20 148 TYR n 
20 149 GLU n 
20 150 MET n 
20 151 ILE n 
20 152 GLY n 
20 153 GLY n 
20 154 LEU n 
20 155 ASP n 
20 156 LYS n 
20 157 GLN n 
20 158 ILE n 
20 159 LYS n 
20 160 GLU n 
20 161 ILE n 
20 162 LYS n 
20 163 GLU n 
20 164 VAL n 
20 165 ILE n 
20 166 GLU n 
20 167 LEU n 
20 168 PRO n 
20 169 VAL n 
20 170 LYS n 
20 171 HIS n 
20 172 PRO n 
20 173 GLU n 
20 174 LEU n 
20 175 PHE n 
20 176 GLU n 
20 177 ALA n 
20 178 LEU n 
20 179 GLY n 
20 180 ILE n 
20 181 ALA n 
20 182 GLN n 
20 183 PRO n 
20 184 LYS n 
20 185 GLY n 
20 186 VAL n 
20 187 LEU n 
20 188 LEU n 
20 189 TYR n 
20 190 GLY n 
20 191 PRO n 
20 192 PRO n 
20 193 GLY n 
20 194 THR n 
20 195 GLY n 
20 196 LYS n 
20 197 THR n 
20 198 LEU n 
20 199 LEU n 
20 200 ALA n 
20 201 ARG n 
20 202 ALA n 
20 203 VAL n 
20 204 ALA n 
20 205 HIS n 
20 206 HIS n 
20 207 THR n 
20 208 ASP n 
20 209 CYS n 
20 210 THR n 
20 211 PHE n 
20 212 ILE n 
20 213 ARG n 
20 214 VAL n 
20 215 SER n 
20 216 GLY n 
20 217 SER n 
20 218 GLU n 
20 219 LEU n 
20 220 VAL n 
20 221 GLN n 
20 222 LYS n 
20 223 PHE n 
20 224 ILE n 
20 225 GLY n 
20 226 GLU n 
20 227 GLY n 
20 228 ALA n 
20 229 ARG n 
20 230 MET n 
20 231 VAL n 
20 232 ARG n 
20 233 GLU n 
20 234 LEU n 
20 235 PHE n 
20 236 VAL n 
20 237 MET n 
20 238 ALA n 
20 239 ARG n 
20 240 GLU n 
20 241 HIS n 
20 242 ALA n 
20 243 PRO n 
20 244 SER n 
20 245 ILE n 
20 246 ILE n 
20 247 PHE n 
20 248 MET n 
20 249 ASP n 
20 250 GLU n 
20 251 ILE n 
20 252 ASP n 
20 253 SER n 
20 254 ILE n 
20 255 GLY n 
20 256 SER n 
20 257 SER n 
20 258 ARG n 
20 259 LEU n 
20 260 GLU n 
20 261 GLY n 
20 262 GLY n 
20 263 SER n 
20 264 GLY n 
20 265 GLY n 
20 266 ASP n 
20 267 SER n 
20 268 GLU n 
20 269 VAL n 
20 270 GLN n 
20 271 ARG n 
20 272 THR n 
20 273 MET n 
20 274 LEU n 
20 275 GLU n 
20 276 LEU n 
20 277 LEU n 
20 278 ASN n 
20 279 GLN n 
20 280 LEU n 
20 281 ASP n 
20 282 GLY n 
20 283 PHE n 
20 284 GLU n 
20 285 ALA n 
20 286 THR n 
20 287 LYS n 
20 288 ASN n 
20 289 ILE n 
20 290 LYS n 
20 291 VAL n 
20 292 ILE n 
20 293 MET n 
20 294 ALA n 
20 295 THR n 
20 296 ASN n 
20 297 ARG n 
20 298 ILE n 
20 299 ASP n 
20 300 ILE n 
20 301 LEU n 
20 302 ASP n 
20 303 SER n 
20 304 ALA n 
20 305 LEU n 
20 306 LEU n 
20 307 ARG n 
20 308 PRO n 
20 309 GLY n 
20 310 ARG n 
20 311 ILE n 
20 312 ASP n 
20 313 ARG n 
20 314 LYS n 
20 315 ILE n 
20 316 GLU n 
20 317 PHE n 
20 318 PRO n 
20 319 PRO n 
20 320 PRO n 
20 321 ASN n 
20 322 GLU n 
20 323 GLU n 
20 324 ALA n 
20 325 ARG n 
20 326 LEU n 
20 327 ASP n 
20 328 ILE n 
20 329 LEU n 
20 330 LYS n 
20 331 ILE n 
20 332 HIS n 
20 333 SER n 
20 334 ARG n 
20 335 LYS n 
20 336 MET n 
20 337 ASN n 
20 338 LEU n 
20 339 THR n 
20 340 ARG n 
20 341 GLY n 
20 342 ILE n 
20 343 ASN n 
20 344 LEU n 
20 345 ARG n 
20 346 LYS n 
20 347 ILE n 
20 348 ALA n 
20 349 GLU n 
20 350 LEU n 
20 351 MET n 
20 352 PRO n 
20 353 GLY n 
20 354 ALA n 
20 355 SER n 
20 356 GLY n 
20 357 ALA n 
20 358 GLU n 
20 359 VAL n 
20 360 LYS n 
20 361 GLY n 
20 362 VAL n 
20 363 CYS n 
20 364 THR n 
20 365 GLU n 
20 366 ALA n 
20 367 GLY n 
20 368 MET n 
20 369 TYR n 
20 370 ALA n 
20 371 LEU n 
20 372 ARG n 
20 373 GLU n 
20 374 ARG n 
20 375 ARG n 
20 376 VAL n 
20 377 HIS n 
20 378 VAL n 
20 379 THR n 
20 380 GLN n 
20 381 GLU n 
20 382 ASP n 
20 383 PHE n 
20 384 GLU n 
20 385 MET n 
20 386 ALA n 
20 387 VAL n 
20 388 ALA n 
20 389 LYS n 
20 390 VAL n 
20 391 MET n 
20 392 GLN n 
20 393 LYS n 
20 394 ASP n 
20 395 SER n 
20 396 GLU n 
20 397 LYS n 
20 398 ASN n 
20 399 MET n 
20 400 SER n 
20 401 ILE n 
20 402 LYS n 
20 403 LYS n 
20 404 LEU n 
20 405 TRP n 
20 406 LYS n 
# 
_entity_src_gen.entity_id                          9 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   201 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PSMB2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 246 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 234 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 261 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 248 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 241 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 263 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 255 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 241 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 205 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 264 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 263 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 239 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1 277 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1 433 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1 440 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 1 418 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample 1 389 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample 1 439 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample 1 406 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP PSA6_HUMAN  P60900 ? 1  
;MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVM
TGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYY
CGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
;
1 
2  UNP PSA2_HUMAN  P25787 ? 2  
;MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG
PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKA
TAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
;
1 
3  UNP PSA4_HUMAN  P25789 ? 3  
;MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGIT
SDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWK
ATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
;
1 
4  UNP PSA7_HUMAN  O14818 ? 4  
;MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA
RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANA
IGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
;
1 
5  UNP PSA5_HUMAN  P28066 ? 5  
;MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG
LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
;
1 
6  UNP PSA1_HUMAN  P25786 ? 6  
;MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD
ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
;
1 
7  UNP PSA3_HUMAN  P25788 ? 7  
;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG
LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYG
YWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
;
1 
8  UNP PSB1_HUMAN  P20618 ? 8  
;MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVI
GCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQR
DSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRK
D
;
1 
9  UNP PSB2_HUMAN  P49721 ? 9  
;MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA
ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
;
1 
10 UNP PSB3_HUMAN  P49720 ? 10 
;MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR
QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDP
DHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
;
1 
11 UNP PSB4_HUMAN  P28070 ? 11 
;MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLAR
FRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGY
ADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSTETNWDIAHMISGFE
;
1 
12 UNP PSB5_HUMAN  P28074 ? 12 
;MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRAT
AGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMI
CGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
;
1 
13 UNP PSB6_HUMAN  P28072 ? 13 
;MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRS
GSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFA
IGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA
;
1 
14 UNP PSB7_HUMAN  Q99436 ? 14 
;MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFI
SPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHG
STDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
;
1 
15 UNP PRS7_HUMAN  P35998 ? 15 
;MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDL
AADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPT
VTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMA
TNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRAR
RKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN
;
1 
16 UNP PRS4_HUMAN  P62191 ? 16 
;MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIR
NQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVI
GVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFD
SRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICT
EAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
;
1 
17 UNP PRS6B_HUMAN P43686 ? 17 
;MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVK
RIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKP
DVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPA
LLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFE
KAYKTVIKKDEQEHEFYK
;
1 
18 UNP PRS10_HUMAN P62333 ? 18 
;MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYV
VGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQ
RVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPI
TKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
;
1 
19 UNP PRS6A_HUMAN P17980 ? 19 
;MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKI
KVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLI
LETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGF
QPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVC
VEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA
;
1 
20 UNP PRS8_HUMAN  P62195 ? 20 
;MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAM
DKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKE
IKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPP
NEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMS
IKKLWK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5L4G N 1 ? 246 ? P60900 1 ? 246 ? 1   246 
2  2  5L4G O 1 ? 234 ? P25787 1 ? 234 ? 0   233 
3  3  5L4G P 1 ? 261 ? P25789 1 ? 261 ? 1   261 
4  4  5L4G Q 1 ? 248 ? O14818 1 ? 248 ? 1   248 
5  5  5L4G R 1 ? 241 ? P28066 1 ? 241 ? 1   241 
6  6  5L4G S 1 ? 263 ? P25786 1 ? 263 ? 1   263 
7  7  5L4G T 1 ? 255 ? P25788 1 ? 255 ? 0   254 
8  8  5L4G U 1 ? 241 ? P20618 1 ? 241 ? -27 213 
9  9  5L4G V 1 ? 201 ? P49721 1 ? 201 ? 1   201 
10 10 5L4G W 1 ? 205 ? P49720 1 ? 205 ? 1   205 
11 11 5L4G X 1 ? 264 ? P28070 1 ? 264 ? -44 219 
12 12 5L4G Y 1 ? 263 ? P28074 1 ? 263 ? -58 204 
13 13 5L4G Z 1 ? 239 ? P28072 1 ? 239 ? -33 205 
14 14 5L4G 8 1 ? 277 ? Q99436 1 ? 277 ? -42 234 
15 1  5L4G A 1 ? 246 ? P60900 1 ? 246 ? 1   246 
16 2  5L4G B 1 ? 234 ? P25787 1 ? 234 ? 0   233 
17 3  5L4G C 1 ? 261 ? P25789 1 ? 261 ? 1   261 
18 4  5L4G D 1 ? 248 ? O14818 1 ? 248 ? 1   248 
19 5  5L4G E 1 ? 241 ? P28066 1 ? 241 ? 1   241 
20 6  5L4G F 1 ? 263 ? P25786 1 ? 263 ? 1   263 
21 7  5L4G G 1 ? 255 ? P25788 1 ? 255 ? 0   254 
22 8  5L4G 1 1 ? 241 ? P20618 1 ? 241 ? -27 213 
23 9  5L4G 2 1 ? 201 ? P49721 1 ? 201 ? 1   201 
24 10 5L4G 3 1 ? 205 ? P49720 1 ? 205 ? 1   205 
25 11 5L4G 4 1 ? 264 ? P28070 1 ? 264 ? -44 219 
26 12 5L4G 5 1 ? 263 ? P28074 1 ? 263 ? -58 204 
27 13 5L4G 6 1 ? 239 ? P28072 1 ? 239 ? -33 205 
28 14 5L4G 7 1 ? 277 ? Q99436 1 ? 277 ? -42 234 
29 15 5L4G H 1 ? 433 ? P35998 1 ? 433 ? 1   433 
30 16 5L4G I 1 ? 440 ? P62191 1 ? 440 ? 1   440 
31 17 5L4G K 1 ? 418 ? P43686 1 ? 418 ? 1   418 
32 18 5L4G L 1 ? 389 ? P62333 1 ? 389 ? 1   389 
33 19 5L4G M 1 ? 439 ? P17980 1 ? 439 ? 1   439 
34 20 5L4G J 1 ? 406 ? P62195 1 ? 406 ? 1   406 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"  ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5L4G 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5L4G 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            4.019 
_refine.ls_d_res_low                             9.999 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     4203206 
_refine.ls_number_reflns_R_free                  105155 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_percent_reflns_R_free                 2.50 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2033 
_refine.ls_R_factor_R_free                       0.2053 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2033 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 20.73 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.43 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.007  ? 68568 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.867  ? 92569 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 15.614 ? 41790 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.047  ? 10403 ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.006  ? 11976 ? f_plane_restr      ? ? 
# 
_struct.entry_id                     5L4G 
_struct.title                        'The human 26S proteasome at 3.9 A' 
_struct.pdbx_descriptor              
;Proteasome subunit alpha type-6 (E.C.3.4.25.1), Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1), Proteasome subunit beta type-2 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), 26S protease regulatory subunit 7, 26S protease regulatory subunit 4, 26S protease regulatory subunit 6B, 26S protease regulatory subunit 10B, 26S protease regulatory subunit 6A, 26S protease regulatory subunit 8
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5L4G 
_struct_keywords.text            'proteostasis, AAA-ATPase, Hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 1  ? 
P  N N 2  ? 
Q  N N 3  ? 
R  N N 4  ? 
S  N N 5  ? 
T  N N 6  ? 
U  N N 7  ? 
V  N N 8  ? 
W  N N 9  ? 
X  N N 10 ? 
Y  N N 11 ? 
Z  N N 12 ? 
AA N N 13 ? 
BA N N 14 ? 
CA N N 15 ? 
DA N N 16 ? 
EA N N 17 ? 
FA N N 18 ? 
GA N N 19 ? 
HA N N 20 ? 
IA N N 21 ? 
JA N N 22 ? 
KA N N 21 ? 
LA N N 22 ? 
MA N N 21 ? 
NA N N 22 ? 
OA N N 21 ? 
PA N N 22 ? 
QA N N 21 ? 
RA N N 22 ? 
SA N N 23 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 LEU A  22  ? ALA A  31  ? LEU N 22  ALA N 31  1 ? 10 
HELX_P HELX_P2   AA2 ILE A  32  ? GLY A  36  ? ILE N 32  GLY N 36  5 ? 5  
HELX_P HELX_P3   AA3 ASP A  62  ? VAL A  66  ? ASP N 62  VAL N 66  5 ? 5  
HELX_P HELX_P4   AA4 MET A  83  ? GLY A  106 ? MET N 83  GLY N 106 1 ? 24 
HELX_P HELX_P5   AA5 PRO A  110 ? ASN A  128 ? PRO N 110 ASN N 128 1 ? 19 
HELX_P HELX_P6   AA6 LYS A  171 ? LYS A  185 ? LYS N 171 LYS N 185 1 ? 15 
HELX_P HELX_P7   AA7 THR A  190 ? SER A  207 ? THR N 190 SER N 207 1 ? 18 
HELX_P HELX_P8   AA8 THR A  231 ? ARG A  245 ? THR N 231 ARG N 245 1 ? 15 
HELX_P HELX_P9   AA9 LEU B  19  ? ALA B  30  ? LEU O 18  ALA O 29  1 ? 12 
HELX_P HELX_P10  AB1 MET B  79  ? GLN B  102 ? MET O 78  GLN O 101 1 ? 24 
HELX_P HELX_P11  AB2 PRO B  106 ? TYR B  121 ? PRO O 105 TYR O 120 1 ? 16 
HELX_P HELX_P12  AB3 ASN B  166 ? TYR B  178 ? ASN O 165 TYR O 177 1 ? 13 
HELX_P HELX_P13  AB4 GLU B  183 ? PHE B  199 ? GLU O 182 PHE O 198 1 ? 17 
HELX_P HELX_P14  AB5 THR B  222 ? ALA B  232 ? THR O 221 ALA O 231 1 ? 11 
HELX_P HELX_P15  AB6 LEU C  18  ? HIS C  30  ? LEU P 18  HIS P 30  1 ? 13 
HELX_P HELX_P16  AB7 ILE C  79  ? GLN C  102 ? ILE P 79  GLN P 102 1 ? 24 
HELX_P HELX_P17  AB8 PRO C  106 ? PHE C  124 ? PRO P 106 PHE P 124 1 ? 19 
HELX_P HELX_P18  AB9 ASN C  167 ? TYR C  179 ? ASN P 167 TYR P 179 1 ? 13 
HELX_P HELX_P19  AC1 THR C  185 ? MET C  201 ? THR P 185 MET P 201 1 ? 17 
HELX_P HELX_P20  AC2 LYS C  229 ? LYS C  246 ? LYS P 229 LYS P 246 1 ? 18 
HELX_P HELX_P21  AC3 LEU D  16  ? LYS D  28  ? LEU Q 16  LYS Q 28  1 ? 13 
HELX_P HELX_P22  AC4 LEU D  76  ? VAL D  98  ? LEU Q 76  VAL Q 98  1 ? 23 
HELX_P HELX_P23  AC5 THR D  103 ? TYR D  118 ? THR Q 103 TYR Q 118 1 ? 16 
HELX_P HELX_P24  AC6 GLY D  164 ? TYR D  176 ? GLY Q 164 TYR Q 176 1 ? 13 
HELX_P HELX_P25  AC7 THR D  183 ? LEU D  196 ? THR Q 183 LEU Q 196 1 ? 14 
HELX_P HELX_P26  AC8 ASN D  221 ? ASN D  239 ? ASN Q 221 ASN Q 239 1 ? 19 
HELX_P HELX_P27  AC9 LEU E  21  ? ALA E  30  ? LEU R 21  ALA R 30  1 ? 10 
HELX_P HELX_P28  AD1 ILE E  31  ? GLY E  34  ? ILE R 31  GLY R 34  5 ? 4  
HELX_P HELX_P29  AD2 GLU E  60  ? ILE E  64  ? GLU R 60  ILE R 64  5 ? 5  
HELX_P HELX_P30  AD3 LEU E  81  ? TYR E  103 ? LEU R 81  TYR R 103 1 ? 23 
HELX_P HELX_P31  AD4 THR E  108 ? ALA E  120 ? THR R 108 ALA R 120 1 ? 13 
HELX_P HELX_P32  AD5 ALA E  173 ? GLU E  183 ? ALA R 173 GLU R 183 1 ? 11 
HELX_P HELX_P33  AD6 THR E  190 ? MET E  206 ? THR R 190 MET R 206 1 ? 17 
HELX_P HELX_P34  AD7 LYS E  231 ? LYS E  239 ? LYS R 231 LYS R 239 1 ? 9  
HELX_P HELX_P35  AD8 ILE F  19  ? GLY F  32  ? ILE S 19  GLY S 32  1 ? 14 
HELX_P HELX_P36  AD9 LEU F  77  ? PHE F  99  ? LEU S 77  PHE S 99  1 ? 23 
HELX_P HELX_P37  AE1 PRO F  104 ? THR F  116 ? PRO S 104 THR S 116 1 ? 13 
HELX_P HELX_P38  AE2 GLN F  117 ? GLN F  121 ? GLN S 117 GLN S 121 5 ? 5  
HELX_P HELX_P39  AE3 ARG F  164 ? HIS F  175 ? ARG S 164 HIS S 175 1 ? 12 
HELX_P HELX_P40  AE4 HIS F  175 ? MET F  180 ? HIS S 175 MET S 180 1 ? 6  
HELX_P HELX_P41  AE5 ASN F  183 ? GLU F  197 ? ASN S 183 GLU S 197 1 ? 15 
HELX_P HELX_P42  AE6 VAL F  229 ? GLU F  234 ? VAL S 229 GLU S 234 1 ? 6  
HELX_P HELX_P43  AE7 VAL G  21  ? ASN G  33  ? VAL T 20  ASN T 32  1 ? 13 
HELX_P HELX_P44  AE8 LEU G  81  ? GLY G  104 ? LEU T 80  GLY T 103 1 ? 24 
HELX_P HELX_P45  AE9 PRO G  108 ? ALA G  122 ? PRO T 107 ALA T 121 1 ? 15 
HELX_P HELX_P46  AF1 TYR G  123 ? LEU G  125 ? TYR T 122 LEU T 124 5 ? 3  
HELX_P HELX_P47  AF2 ALA G  169 ? LEU G  180 ? ALA T 168 LEU T 179 1 ? 12 
HELX_P HELX_P48  AF3 THR G  186 ? HIS G  202 ? THR T 185 HIS T 201 1 ? 17 
HELX_P HELX_P49  AF4 PRO G  229 ? GLU G  246 ? PRO T 228 GLU T 245 1 ? 18 
HELX_P HELX_P50  AF5 PHE H  85  ? ASN H  108 ? PHE U 57  ASN U 80  1 ? 24 
HELX_P HELX_P51  AF6 THR H  112 ? SER H  126 ? THR U 84  SER U 98  1 ? 15 
HELX_P HELX_P52  AF7 ALA H  169 ? VAL H  181 ? ALA U 141 VAL U 153 1 ? 13 
HELX_P HELX_P53  AF8 SER H  195 ? ASP H  214 ? SER U 167 ASP U 186 1 ? 20 
HELX_P HELX_P54  AF9 GLU I  49  ? GLN I  65  ? GLU V 49  GLN V 65  1 ? 17 
HELX_P HELX_P55  AG1 LEU I  66  ? GLY I  72  ? LEU V 66  GLY V 72  1 ? 7  
HELX_P HELX_P56  AG2 SER I  76  ? SER I  94  ? SER V 76  SER V 94  1 ? 19 
HELX_P HELX_P57  AG3 TYR I  134 ? TYR I  147 ? TYR V 134 TYR V 147 1 ? 14 
HELX_P HELX_P58  AG4 SER I  152 ? PHE I  171 ? SER V 152 PHE V 171 1 ? 20 
HELX_P HELX_P59  AG5 LEU J  56  ? GLU J  78  ? LEU W 56  GLU W 78  1 ? 23 
HELX_P HELX_P60  AG6 LYS J  83  ? GLU J  97  ? LYS W 83  GLU W 97  1 ? 15 
HELX_P HELX_P61  AG7 CYS J  142 ? TRP J  154 ? CYS W 142 TRP W 154 1 ? 13 
HELX_P HELX_P62  AG8 ASP J  159 ? ARG J  177 ? ASP W 159 ARG W 177 1 ? 19 
HELX_P HELX_P63  AG9 TYR K  102 ? LEU K  121 ? TYR X 57  LEU X 76  1 ? 20 
HELX_P HELX_P64  AH1 SER K  129 ? LYS K  147 ? SER X 84  LYS X 102 1 ? 19 
HELX_P HELX_P65  AH2 THR K  184 ? TYR K  189 ? THR X 139 TYR X 144 5 ? 6  
HELX_P HELX_P66  AH3 ALA K  191 ? GLU K  200 ? ALA X 146 GLU X 155 1 ? 10 
HELX_P HELX_P67  AH4 SER K  206 ? ASP K  225 ? SER X 161 ASP X 180 1 ? 20 
HELX_P HELX_P68  AH5 TRP K  254 ? MET K  259 ? TRP X 209 MET X 214 5 ? 6  
HELX_P HELX_P69  AH6 GLY L  107 ? ASN L  129 ? GLY Y 48  ASN Y 70  1 ? 23 
HELX_P HELX_P70  AH7 SER L  134 ? GLN L  148 ? SER Y 75  GLN Y 89  1 ? 15 
HELX_P HELX_P71  AH8 GLY L  190 ? ARG L  200 ? GLY Y 131 ARG Y 141 1 ? 11 
HELX_P HELX_P72  AH9 GLU L  207 ? ASP L  226 ? GLU Y 148 ASP Y 167 1 ? 20 
HELX_P HELX_P73  AI1 VAL L  251 ? SER L  259 ? VAL Y 192 SER Y 200 1 ? 9  
HELX_P HELX_P74  AI2 SER M  82  ? ASN M  105 ? SER Z 48  ASN Z 71  1 ? 24 
HELX_P HELX_P75  AI3 LEU M  109 ? TYR M  124 ? LEU Z 75  TYR Z 90  1 ? 16 
HELX_P HELX_P76  AI4 GLY M  165 ? TYR M  168 ? GLY Z 131 TYR Z 134 5 ? 4  
HELX_P HELX_P77  AI5 ILE M  169 ? TYR M  177 ? ILE Z 135 TYR Z 143 1 ? 9  
HELX_P HELX_P78  AI6 THR M  182 ? ASP M  201 ? THR Z 148 ASP Z 167 1 ? 20 
HELX_P HELX_P79  AI7 THR N  91  ? GLY N  114 ? THR 8 48  GLY 8 71  1 ? 24 
HELX_P HELX_P80  AI8 ARG N  118 ? PHE N  131 ? ARG 8 75  PHE 8 88  1 ? 14 
HELX_P HELX_P81  AI9 ARG N  132 ? GLN N  134 ? ARG 8 89  GLN 8 91  5 ? 3  
HELX_P HELX_P82  AJ1 GLY N  173 ? PHE N  185 ? GLY 8 130 PHE 8 142 1 ? 13 
HELX_P HELX_P83  AJ2 GLU N  190 ? ASN N  208 ? GLU 8 147 ASN 8 165 1 ? 19 
HELX_P HELX_P84  AJ3 LEU O  22  ? ASN O  33  ? LEU A 22  ASN A 33  1 ? 12 
HELX_P HELX_P85  AJ4 MET O  83  ? GLY O  106 ? MET A 83  GLY A 106 1 ? 24 
HELX_P HELX_P86  AJ5 PRO O  110 ? ASN O  128 ? PRO A 110 ASN A 128 1 ? 19 
HELX_P HELX_P87  AJ6 LYS O  171 ? LYS O  185 ? LYS A 171 LYS A 185 1 ? 15 
HELX_P HELX_P88  AJ7 THR O  190 ? SER O  207 ? THR A 190 SER A 207 1 ? 18 
HELX_P HELX_P89  AJ8 THR O  231 ? ARG O  245 ? THR A 231 ARG A 245 1 ? 15 
HELX_P HELX_P90  AJ9 LEU P  19  ? ALA P  30  ? LEU B 18  ALA B 29  1 ? 12 
HELX_P HELX_P91  AK1 MET P  79  ? GLN P  102 ? MET B 78  GLN B 101 1 ? 24 
HELX_P HELX_P92  AK2 PRO P  106 ? TYR P  121 ? PRO B 105 TYR B 120 1 ? 16 
HELX_P HELX_P93  AK3 ASN P  166 ? TYR P  178 ? ASN B 165 TYR B 177 1 ? 13 
HELX_P HELX_P94  AK4 GLU P  183 ? GLU P  197 ? GLU B 182 GLU B 196 1 ? 15 
HELX_P HELX_P95  AK5 THR P  222 ? LEU P  230 ? THR B 221 LEU B 229 1 ? 9  
HELX_P HELX_P96  AK6 LEU Q  18  ? GLY Q  29  ? LEU C 18  GLY C 29  1 ? 12 
HELX_P HELX_P97  AK7 ILE Q  79  ? GLN Q  102 ? ILE C 79  GLN C 102 1 ? 24 
HELX_P HELX_P98  AK8 PRO Q  106 ? THR Q  122 ? PRO C 106 THR C 122 1 ? 17 
HELX_P HELX_P99  AK9 ASN Q  167 ? TYR Q  179 ? ASN C 167 TYR C 179 1 ? 13 
HELX_P HELX_P100 AL1 THR Q  185 ? MET Q  201 ? THR C 185 MET C 201 1 ? 17 
HELX_P HELX_P101 AL2 LYS Q  229 ? ALA Q  245 ? LYS C 229 ALA C 245 1 ? 17 
HELX_P HELX_P102 AL3 LEU R  16  ? LYS R  28  ? LEU D 16  LYS D 28  1 ? 13 
HELX_P HELX_P103 AL4 LEU R  76  ? VAL R  98  ? LEU D 76  VAL D 98  1 ? 23 
HELX_P HELX_P104 AL5 THR R  103 ? TYR R  118 ? THR D 103 TYR D 118 1 ? 16 
HELX_P HELX_P105 AL6 GLY R  164 ? TYR R  176 ? GLY D 164 TYR D 176 1 ? 13 
HELX_P HELX_P106 AL7 THR R  183 ? LEU R  196 ? THR D 183 LEU D 196 1 ? 14 
HELX_P HELX_P107 AL8 ASN R  221 ? LYS R  236 ? ASN D 221 LYS D 236 1 ? 16 
HELX_P HELX_P108 AL9 LEU S  21  ? ALA S  30  ? LEU E 21  ALA E 30  1 ? 10 
HELX_P HELX_P109 AM1 LEU S  81  ? TYR S  103 ? LEU E 81  TYR E 103 1 ? 23 
HELX_P HELX_P110 AM2 THR S  108 ? ASN S  118 ? THR E 108 ASN E 118 1 ? 11 
HELX_P HELX_P111 AM3 ALA S  173 ? TYR S  185 ? ALA E 173 TYR E 185 1 ? 13 
HELX_P HELX_P112 AM4 THR S  190 ? VAL S  205 ? THR E 190 VAL E 205 1 ? 16 
HELX_P HELX_P113 AM5 THR S  230 ? ILE S  241 ? THR E 230 ILE E 241 1 ? 12 
HELX_P HELX_P114 AM6 ILE T  19  ? GLN T  31  ? ILE F 19  GLN F 31  1 ? 13 
HELX_P HELX_P115 AM7 LEU T  77  ? ASP T  100 ? LEU F 77  ASP F 100 1 ? 24 
HELX_P HELX_P116 AM8 PRO T  104 ? ILE T  118 ? PRO F 104 ILE F 118 1 ? 15 
HELX_P HELX_P117 AM9 PRO T  119 ? GLN T  121 ? PRO F 119 GLN F 121 5 ? 3  
HELX_P HELX_P118 AN1 ARG T  164 ? HIS T  175 ? ARG F 164 HIS F 175 1 ? 12 
HELX_P HELX_P119 AN2 SER T  177 ? CYS T  182 ? SER F 177 CYS F 182 5 ? 6  
HELX_P HELX_P120 AN3 ASN T  183 ? ARG T  196 ? ASN F 183 ARG F 196 1 ? 14 
HELX_P HELX_P121 AN4 VAL T  229 ? GLU T  234 ? VAL F 229 GLU F 234 1 ? 6  
HELX_P HELX_P122 AN5 VAL U  21  ? GLU U  32  ? VAL G 20  GLU G 31  1 ? 12 
HELX_P HELX_P123 AN6 LEU U  81  ? GLY U  104 ? LEU G 80  GLY G 103 1 ? 24 
HELX_P HELX_P124 AN7 PRO U  108 ? ALA U  122 ? PRO G 107 ALA G 121 1 ? 15 
HELX_P HELX_P125 AN8 ALA U  169 ? LYS U  179 ? ALA G 168 LYS G 178 1 ? 11 
HELX_P HELX_P126 AN9 THR U  186 ? HIS U  202 ? THR G 185 HIS G 201 1 ? 17 
HELX_P HELX_P127 AO1 PRO U  229 ? GLU U  246 ? PRO G 228 GLU G 245 1 ? 18 
HELX_P HELX_P128 AO2 PHE V  85  ? ASN V  108 ? PHE 1 57  ASN 1 80  1 ? 24 
HELX_P HELX_P129 AO3 THR V  112 ? ARG V  127 ? THR 1 84  ARG 1 99  1 ? 16 
HELX_P HELX_P130 AO4 ALA V  169 ? VAL V  181 ? ALA 1 141 VAL 1 153 1 ? 13 
HELX_P HELX_P131 AO5 SER V  195 ? ASP V  214 ? SER 1 167 ASP 1 186 1 ? 20 
HELX_P HELX_P132 AO6 GLU W  49  ? GLY W  72  ? GLU 2 49  GLY 2 72  1 ? 24 
HELX_P HELX_P133 AO7 SER W  76  ? CYS W  91  ? SER 2 76  CYS 2 91  1 ? 16 
HELX_P HELX_P134 AO8 GLY W  135 ? TYR W  147 ? GLY 2 135 TYR 2 147 1 ? 13 
HELX_P HELX_P135 AO9 SER W  152 ? ARG W  170 ? SER 2 152 ARG 2 170 1 ? 19 
HELX_P HELX_P136 AP1 LEU X  56  ? LEU X  76  ? LEU 3 56  LEU 3 76  1 ? 21 
HELX_P HELX_P137 AP2 TYR X  85  ? LYS X  98  ? TYR 3 85  LYS 3 98  1 ? 14 
HELX_P HELX_P138 AP3 CYS X  142 ? SER X  152 ? CYS 3 142 SER 3 152 1 ? 11 
HELX_P HELX_P139 AP4 ASP X  159 ? ARG X  177 ? ASP 3 159 ARG 3 177 1 ? 19 
HELX_P HELX_P140 AP5 TYR Y  102 ? GLY Y  123 ? TYR 4 57  GLY 4 78  1 ? 22 
HELX_P HELX_P141 AP6 SER Y  129 ? ARG Y  145 ? SER 4 84  ARG 4 100 1 ? 17 
HELX_P HELX_P142 AP7 GLY Y  185 ? TYR Y  189 ? GLY 4 140 TYR 4 144 5 ? 5  
HELX_P HELX_P143 AP8 ALA Y  191 ? GLN Y  202 ? ALA 4 146 GLN 4 157 1 ? 12 
HELX_P HELX_P144 AP9 SER Y  206 ? ARG Y  216 ? SER 4 161 ARG 4 171 1 ? 11 
HELX_P HELX_P145 AQ1 CYS Y  217 ? ASP Y  225 ? CYS 4 172 ASP 4 180 1 ? 9  
HELX_P HELX_P146 AQ2 TRP Y  254 ? HIS Y  258 ? TRP 4 209 HIS 4 213 5 ? 5  
HELX_P HELX_P147 AQ3 GLY Z  107 ? LYS Z  130 ? GLY 5 48  LYS 5 71  1 ? 24 
HELX_P HELX_P148 AQ4 SER Z  134 ? GLN Z  148 ? SER 5 75  GLN 5 89  1 ? 15 
HELX_P HELX_P149 AQ5 GLY Z  190 ? TYR Z  202 ? GLY 5 131 TYR 5 143 1 ? 13 
HELX_P HELX_P150 AQ6 GLU Z  207 ? ASP Z  226 ? GLU 5 148 ASP 5 167 1 ? 20 
HELX_P HELX_P151 AQ7 ASN Z  250 ? GLY Z  260 ? ASN 5 191 GLY 5 201 1 ? 11 
HELX_P HELX_P152 AQ8 SER AA 82  ? ASN AA 105 ? SER 6 48  ASN 6 71  1 ? 24 
HELX_P HELX_P153 AQ9 LEU AA 109 ? TYR AA 124 ? LEU 6 75  TYR 6 90  1 ? 16 
HELX_P HELX_P154 AR1 GLY AA 165 ? TYR AA 170 ? GLY 6 131 TYR 6 136 5 ? 6  
HELX_P HELX_P155 AR2 GLY AA 171 ? TYR AA 177 ? GLY 6 137 TYR 6 143 1 ? 7  
HELX_P HELX_P156 AR3 THR AA 182 ? ASP AA 201 ? THR 6 148 ASP 6 167 1 ? 20 
HELX_P HELX_P157 AR4 THR BA 91  ? GLY BA 114 ? THR 7 48  GLY 7 71  1 ? 24 
HELX_P HELX_P158 AR5 ARG BA 118 ? ARG BA 132 ? ARG 7 75  ARG 7 89  1 ? 15 
HELX_P HELX_P159 AR6 GLY BA 173 ? PHE BA 185 ? GLY 7 130 PHE 7 142 1 ? 13 
HELX_P HELX_P160 AR7 GLU BA 190 ? ASP BA 209 ? GLU 7 147 ASP 7 166 1 ? 20 
HELX_P HELX_P161 AR8 SER CA 39  ? LEU CA 62  ? SER H 39  LEU H 62  1 ? 24 
HELX_P HELX_P162 AR9 PRO CA 74  ? GLN CA 88  ? PRO H 74  GLN H 88  1 ? 15 
HELX_P HELX_P163 AS1 VAL CA 161 ? VAL CA 166 ? VAL H 161 VAL H 166 5 ? 6  
HELX_P HELX_P164 AS2 LYS CA 181 ? GLU CA 192 ? LYS H 181 GLU H 192 1 ? 12 
HELX_P HELX_P165 AS3 GLU CA 192 ? HIS CA 197 ? GLU H 192 HIS H 197 1 ? 6  
HELX_P HELX_P166 AS4 PRO CA 198 ? GLY CA 205 ? PRO H 198 GLY H 205 1 ? 8  
HELX_P HELX_P167 AS5 THR CA 223 ? THR CA 233 ? THR H 223 THR H 233 1 ? 11 
HELX_P HELX_P168 AS6 ILE CA 241 ? VAL CA 246 ? ILE H 241 VAL H 246 5 ? 6  
HELX_P HELX_P169 AS7 GLY CA 251 ? LYS CA 267 ? GLY H 251 LYS H 267 1 ? 17 
HELX_P HELX_P170 AS8 ASP CA 292 ? LEU CA 306 ? ASP H 292 LEU H 306 1 ? 15 
HELX_P HELX_P171 AS9 ARG CA 323 ? LEU CA 327 ? ARG H 323 LEU H 327 5 ? 5  
HELX_P HELX_P172 AT1 ASP CA 328 ? ARG CA 333 ? ASP H 328 ARG H 333 1 ? 6  
HELX_P HELX_P173 AT2 ASP CA 347 ? ARG CA 360 ? ASP H 347 ARG H 360 1 ? 14 
HELX_P HELX_P174 AT3 ARG CA 369 ? LEU CA 376 ? ARG H 369 LEU H 376 1 ? 8  
HELX_P HELX_P175 AT4 THR CA 381 ? ALA CA 399 ? THR H 381 ALA H 399 1 ? 19 
HELX_P HELX_P176 AT5 THR CA 405 ? LYS CA 422 ? THR H 405 LYS H 422 1 ? 18 
HELX_P HELX_P177 AT6 ALA CA 425 ? MET CA 430 ? ALA H 425 MET H 430 1 ? 6  
HELX_P HELX_P178 AT7 GLN DA 57  ? MET DA 85  ? GLN I 57  MET I 85  1 ? 29 
HELX_P HELX_P179 AT8 PRO DA 87  ? GLY DA 104 ? PRO I 87  GLY I 104 1 ? 18 
HELX_P HELX_P180 AT9 ASP DA 140 ? LEU DA 144 ? ASP I 140 LEU I 144 5 ? 5  
HELX_P HELX_P181 AU1 LEU DA 170 ? LYS DA 175 ? LEU I 170 LYS I 175 1 ? 6  
HELX_P HELX_P182 AU2 GLN DA 193 ? VAL DA 201 ? GLN I 193 VAL I 201 1 ? 9  
HELX_P HELX_P183 AU3 VAL DA 201 ? HIS DA 207 ? VAL I 201 HIS I 207 1 ? 7  
HELX_P HELX_P184 AU4 PRO DA 208 ? GLY DA 215 ? PRO I 208 GLY I 215 1 ? 8  
HELX_P HELX_P185 AU5 GLY DA 231 ? SER DA 244 ? GLY I 231 SER I 244 1 ? 14 
HELX_P HELX_P186 AU6 SER DA 253 ? ILE DA 256 ? SER I 253 ILE I 256 5 ? 4  
HELX_P HELX_P187 AU7 GLY DA 261 ? HIS DA 277 ? GLY I 261 HIS I 277 1 ? 17 
HELX_P HELX_P188 AU8 GLU DA 286 ? GLY DA 291 ? GLU I 286 GLY I 291 5 ? 6  
HELX_P HELX_P189 AU9 GLY DA 301 ? ASP DA 317 ? GLY I 301 ASP I 317 1 ? 17 
HELX_P HELX_P190 AV1 ARG DA 333 ? LEU DA 337 ? ARG I 333 LEU I 337 5 ? 5  
HELX_P HELX_P191 AV2 ASP DA 338 ? ARG DA 343 ? ASP I 338 ARG I 343 5 ? 6  
HELX_P HELX_P192 AV3 ASP DA 357 ? THR DA 369 ? ASP I 357 THR I 369 1 ? 13 
HELX_P HELX_P193 AV4 SER DA 370 ? MET DA 372 ? SER I 370 MET I 372 5 ? 3  
HELX_P HELX_P194 AV5 THR DA 379 ? LYS DA 387 ? THR I 379 LYS I 387 1 ? 9  
HELX_P HELX_P195 AV6 SER DA 391 ? GLU DA 409 ? SER I 391 GLU I 409 1 ? 19 
HELX_P HELX_P196 AV7 GLU DA 417 ? GLU DA 432 ? GLU I 417 GLU I 432 1 ? 16 
HELX_P HELX_P197 AV8 LEU EA 27  ? GLY EA 31  ? LEU K 27  GLY K 31  1 ? 5  
HELX_P HELX_P198 AV9 PRO EA 32  ? LYS EA 80  ? PRO K 32  LYS K 80  1 ? 49 
HELX_P HELX_P199 AW1 ARG EA 81  ? SER EA 84  ? ARG K 81  SER K 84  5 ? 4  
HELX_P HELX_P200 AW2 MET EA 170 ? VAL EA 181 ? MET K 170 VAL K 181 1 ? 12 
HELX_P HELX_P201 AW3 VAL EA 181 ? HIS EA 187 ? VAL K 181 HIS K 187 1 ? 7  
HELX_P HELX_P202 AW4 PHE EA 188 ? GLY EA 195 ? PHE K 188 GLY K 195 1 ? 8  
HELX_P HELX_P203 AW5 GLY EA 211 ? ALA EA 220 ? GLY K 211 ALA K 220 1 ? 10 
HELX_P HELX_P204 AW6 VAL EA 231 ? VAL EA 236 ? VAL K 231 VAL K 236 5 ? 6  
HELX_P HELX_P205 AW7 GLY EA 241 ? ASN EA 257 ? GLY K 241 ASN K 257 1 ? 17 
HELX_P HELX_P206 AW8 THR EA 279 ? MET EA 296 ? THR K 279 MET K 296 1 ? 18 
HELX_P HELX_P207 AW9 ASP EA 318 ? ARG EA 323 ? ASP K 318 ARG K 323 5 ? 6  
HELX_P HELX_P208 AX1 ASP EA 337 ? LYS EA 351 ? ASP K 337 LYS K 351 1 ? 15 
HELX_P HELX_P209 AX2 ASP EA 359 ? ARG EA 366 ? ASP K 359 ARG K 366 1 ? 8  
HELX_P HELX_P210 AX3 SER EA 371 ? ASN EA 390 ? SER K 371 ASN K 390 1 ? 20 
HELX_P HELX_P211 AX4 LYS EA 397 ? ILE EA 407 ? LYS K 397 ILE K 407 1 ? 11 
HELX_P HELX_P212 AX5 LYS EA 408 ? GLU EA 411 ? LYS K 408 GLU K 411 5 ? 4  
HELX_P HELX_P213 AX6 ASP FA 6   ? LEU FA 50  ? ASP L 6   LEU L 50  1 ? 45 
HELX_P HELX_P214 AX7 ASP FA 116 ? GLU FA 125 ? ASP L 116 GLU L 125 1 ? 10 
HELX_P HELX_P215 AX8 SER FA 139 ? GLU FA 150 ? SER L 139 GLU L 150 1 ? 12 
HELX_P HELX_P216 AX9 GLU FA 150 ? ASN FA 155 ? GLU L 150 ASN L 155 1 ? 6  
HELX_P HELX_P217 AY1 PRO FA 156 ? GLY FA 163 ? PRO L 156 GLY L 163 1 ? 8  
HELX_P HELX_P218 AY2 GLY FA 179 ? LEU FA 191 ? GLY L 179 LEU L 191 1 ? 13 
HELX_P HELX_P219 AY3 GLU FA 210 ? HIS FA 225 ? GLU L 210 HIS L 225 1 ? 16 
HELX_P HELX_P220 AY4 ILE FA 235 ? GLY FA 239 ? ILE L 235 GLY L 239 5 ? 5  
HELX_P HELX_P221 AY5 THR FA 247 ? GLY FA 266 ? THR L 247 GLY L 266 1 ? 20 
HELX_P HELX_P222 AY6 ASN FA 305 ? GLY FA 318 ? ASN L 305 GLY L 318 1 ? 14 
HELX_P HELX_P223 AY7 ASP FA 327 ? SER FA 335 ? ASP L 327 SER L 335 1 ? 9  
HELX_P HELX_P224 AY8 ASN FA 339 ? ASP FA 358 ? ASN L 339 ASP L 358 1 ? 20 
HELX_P HELX_P225 AY9 GLU FA 365 ? GLU FA 381 ? GLU L 365 GLU L 381 1 ? 17 
HELX_P HELX_P226 AZ1 GLY GA 30  ? MET GA 36  ? GLY M 30  MET M 36  1 ? 7  
HELX_P HELX_P227 AZ2 SER GA 37  ? ASP GA 49  ? SER M 37  ASP M 49  1 ? 13 
HELX_P HELX_P228 AZ3 GLU GA 51  ? LYS GA 84  ? GLU M 51  LYS M 84  1 ? 34 
HELX_P HELX_P229 AZ4 ASN GA 110 ? LYS GA 120 ? ASN M 110 LYS M 120 1 ? 11 
HELX_P HELX_P230 AZ5 ASP GA 169 ? MET GA 175 ? ASP M 169 MET M 175 1 ? 7  
HELX_P HELX_P231 AZ6 GLN GA 184 ? ILE GA 188 ? GLN M 184 ILE M 188 5 ? 5  
HELX_P HELX_P232 AZ7 LEU GA 191 ? VAL GA 203 ? LEU M 191 VAL M 203 1 ? 13 
HELX_P HELX_P233 AZ8 LEU GA 204 ? ASN GA 207 ? LEU M 204 ASN M 207 5 ? 4  
HELX_P HELX_P234 AZ9 HIS GA 208 ? GLY GA 216 ? HIS M 208 GLY M 216 1 ? 9  
HELX_P HELX_P235 BA1 GLY GA 232 ? THR GA 244 ? GLY M 232 THR M 244 1 ? 13 
HELX_P HELX_P236 BA2 PRO GA 254 ? VAL GA 257 ? PRO M 254 VAL M 257 5 ? 4  
HELX_P HELX_P237 BA3 GLY GA 262 ? LYS GA 278 ? GLY M 262 LYS M 278 1 ? 17 
HELX_P HELX_P238 BA4 LEU GA 288 ? GLY GA 292 ? LEU M 288 GLY M 292 5 ? 5  
HELX_P HELX_P239 BA5 GLU GA 305 ? LEU GA 314 ? GLU M 305 LEU M 314 1 ? 10 
HELX_P HELX_P240 BA6 ARG GA 334 ? LEU GA 338 ? ARG M 334 LEU M 338 5 ? 5  
HELX_P HELX_P241 BA7 ASP GA 339 ? LEU GA 343 ? ASP M 339 LEU M 343 5 ? 5  
HELX_P HELX_P242 BA8 ASN GA 358 ? ARG GA 371 ? ASN M 358 ARG M 371 1 ? 14 
HELX_P HELX_P243 BA9 ASN GA 380 ? THR GA 388 ? ASN M 380 THR M 388 1 ? 9  
HELX_P HELX_P244 BB1 ASN GA 392 ? GLY GA 411 ? ASN M 392 GLY M 411 1 ? 20 
HELX_P HELX_P245 BB2 THR GA 416 ? GLN GA 428 ? THR M 416 GLN M 428 1 ? 13 
HELX_P HELX_P246 BB3 GLY HA 14  ? LEU HA 66  ? GLY J 14  LEU J 66  1 ? 53 
HELX_P HELX_P247 BB4 ASP HA 132 ? LYS HA 142 ? ASP J 132 LYS J 142 1 ? 11 
HELX_P HELX_P248 BB5 ASP HA 155 ? ILE HA 165 ? ASP J 155 ILE J 165 1 ? 11 
HELX_P HELX_P249 BB6 ILE HA 165 ? HIS HA 171 ? ILE J 165 HIS J 171 1 ? 7  
HELX_P HELX_P250 BB7 PRO HA 172 ? GLY HA 179 ? PRO J 172 GLY J 179 1 ? 8  
HELX_P HELX_P251 BB8 GLY HA 195 ? ASP HA 208 ? GLY J 195 ASP J 208 1 ? 14 
HELX_P HELX_P252 BB9 SER HA 217 ? GLY HA 225 ? SER J 217 GLY J 225 1 ? 9  
HELX_P HELX_P253 BC1 VAL HA 231 ? HIS HA 241 ? VAL J 231 HIS J 241 1 ? 11 
HELX_P HELX_P254 BC2 GLY HA 255 ? GLU HA 260 ? GLY J 255 GLU J 260 5 ? 6  
HELX_P HELX_P255 BC3 SER HA 267 ? THR HA 272 ? SER J 267 THR J 272 1 ? 6  
HELX_P HELX_P256 BC4 THR HA 272 ? LEU HA 277 ? THR J 272 LEU J 277 1 ? 6  
HELX_P HELX_P257 BC5 LEU HA 280 ? ALA HA 285 ? LEU J 280 ALA J 285 5 ? 6  
HELX_P HELX_P258 BC6 ASP HA 302 ? LEU HA 306 ? ASP J 302 LEU J 306 5 ? 5  
HELX_P HELX_P259 BC7 ASN HA 321 ? ARG HA 334 ? ASN J 321 ARG J 334 1 ? 14 
HELX_P HELX_P260 BC8 ASN HA 343 ? MET HA 351 ? ASN J 343 MET J 351 1 ? 9  
HELX_P HELX_P261 BC9 GLY HA 356 ? GLU HA 373 ? GLY J 356 GLU J 373 1 ? 18 
HELX_P HELX_P262 BD1 THR HA 379 ? LYS HA 397 ? THR J 379 LYS J 397 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? CA THR 223 OG1 ? ? ? 1_555 JA MG . MG ? ? H THR 223 H MG 502 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc2  metalc ? ? DA THR 233 OG1 ? ? ? 1_555 LA MG . MG ? ? I THR 233 I MG 502 1_555 ? ? ? ? ? ? ? 1.910 ? 
metalc3  metalc ? ? EA THR 213 OG1 ? ? ? 1_555 NA MG . MG ? ? K THR 213 K MG 502 1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc4  metalc ? ? FA THR 181 OG1 ? ? ? 1_555 PA MG . MG ? ? L THR 181 L MG 402 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc5  metalc ? ? GA THR 234 OG1 ? ? ? 1_555 RA MG . MG ? ? M THR 234 M MG 502 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc6  metalc ? ? IA ATP .   O2G ? ? ? 1_555 JA MG . MG ? ? H ATP 501 H MG 502 1_555 ? ? ? ? ? ? ? 1.788 ? 
metalc7  metalc ? ? IA ATP .   O1B ? ? ? 1_555 JA MG . MG ? ? H ATP 501 H MG 502 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc8  metalc ? ? KA ATP .   O1G ? ? ? 1_555 LA MG . MG ? ? I ATP 501 I MG 502 1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc9  metalc ? ? KA ATP .   O2B ? ? ? 1_555 LA MG . MG ? ? I ATP 501 I MG 502 1_555 ? ? ? ? ? ? ? 1.856 ? 
metalc10 metalc ? ? MA ATP .   O2G ? ? ? 1_555 NA MG . MG ? ? K ATP 501 K MG 502 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc11 metalc ? ? MA ATP .   O2B ? ? ? 1_555 NA MG . MG ? ? K ATP 501 K MG 502 1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc12 metalc ? ? OA ATP .   O2G ? ? ? 1_555 PA MG . MG ? ? L ATP 401 L MG 402 1_555 ? ? ? ? ? ? ? 1.818 ? 
metalc13 metalc ? ? OA ATP .   O2B ? ? ? 1_555 PA MG . MG ? ? L ATP 401 L MG 402 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc14 metalc ? ? QA ATP .   O2G ? ? ? 1_555 RA MG . MG ? ? M ATP 501 M MG 502 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc15 metalc ? ? QA ATP .   O2B ? ? ? 1_555 RA MG . MG ? ? M ATP 501 M MG 502 1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc16 metalc ? ? QA ATP .   O3B ? ? ? 1_555 RA MG . MG ? ? M ATP 501 M MG 502 1_555 ? ? ? ? ? ? ? 2.807 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ARG 230 BA . ? ARG 187 7 PRO 231 BA ? PRO 188 7 1 1.74  
2  GLN 91  CA . ? GLN 91  H PRO 92  CA ? PRO 92  H 1 -2.52 
3  THR 105 DA . ? THR 105 I PRO 106 DA ? PRO 106 I 1 2.30  
4  ALA 278 DA . ? ALA 278 I PRO 279 DA ? PRO 279 I 1 0.12  
5  ILE 85  EA . ? ILE 85  K PRO 86  EA ? PRO 86  K 1 2.30  
6  ALA 258 EA . ? ALA 258 K PRO 259 EA ? PRO 259 K 1 0.56  
7  GLN 226 FA . ? GLN 226 L PRO 227 FA ? PRO 227 L 1 8.31  
8  LEU 86  GA . ? LEU 86  M PRO 87  GA ? PRO 87  M 1 2.56  
9  ALA 279 GA . ? ALA 279 M PRO 280 GA ? PRO 280 M 1 2.03  
10 ALA 242 HA . ? ALA 242 J PRO 243 HA ? PRO 243 J 1 7.61  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software H ATP 501 ? 17 'binding site for residue ATP H 501' 
AC2 Software H MG  502 ? 2  'binding site for residue MG H 502'  
AC3 Software I ATP 501 ? 18 'binding site for residue ATP I 501' 
AC4 Software I MG  502 ? 2  'binding site for residue MG I 502'  
AC5 Software K ATP 501 ? 18 'binding site for residue ATP K 501' 
AC6 Software K MG  502 ? 4  'binding site for residue MG K 502'  
AC7 Software L ATP 401 ? 18 'binding site for residue ATP L 401' 
AC8 Software L MG  402 ? 2  'binding site for residue MG L 402'  
AC9 Software M ATP 501 ? 20 'binding site for residue ATP M 501' 
AD1 Software M MG  502 ? 2  'binding site for residue MG M 502'  
AD2 Software J ADP 501 ? 13 'binding site for residue ADP J 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 17 ASP CA 176 ? ASP H 176 . ? 1_555 ? 
2   AC1 17 GLY CA 178 ? GLY H 178 . ? 1_555 ? 
3   AC1 17 GLY CA 219 ? GLY H 219 . ? 1_555 ? 
4   AC1 17 THR CA 220 ? THR H 220 . ? 1_555 ? 
5   AC1 17 GLY CA 221 ? GLY H 221 . ? 1_555 ? 
6   AC1 17 LYS CA 222 ? LYS H 222 . ? 1_555 ? 
7   AC1 17 THR CA 223 ? THR H 223 . ? 1_555 ? 
8   AC1 17 LEU CA 224 ? LEU H 224 . ? 1_555 ? 
9   AC1 17 ASN CA 322 ? ASN H 322 . ? 1_555 ? 
10  AC1 17 ILE CA 354 ? ILE H 354 . ? 1_555 ? 
11  AC1 17 HIS CA 358 ? HIS H 358 . ? 1_555 ? 
12  AC1 17 GLY CA 382 ? GLY H 382 . ? 1_555 ? 
13  AC1 17 ALA CA 383 ? ALA H 383 . ? 1_555 ? 
14  AC1 17 MG  JA .   ? MG  H 502 . ? 1_555 ? 
15  AC1 17 ASP DA 317 ? ASP I 317 . ? 1_555 ? 
16  AC1 17 ARG DA 343 ? ARG I 343 . ? 1_555 ? 
17  AC1 17 ARG DA 346 ? ARG I 346 . ? 1_555 ? 
18  AC2 2  THR CA 223 ? THR H 223 . ? 1_555 ? 
19  AC2 2  ATP IA .   ? ATP H 501 . ? 1_555 ? 
20  AC3 18 ASP DA 186 ? ASP I 186 . ? 1_555 ? 
21  AC3 18 GLY DA 188 ? GLY I 188 . ? 1_555 ? 
22  AC3 18 LEU DA 190 ? LEU I 190 . ? 1_555 ? 
23  AC3 18 PRO DA 228 ? PRO I 228 . ? 1_555 ? 
24  AC3 18 GLY DA 229 ? GLY I 229 . ? 1_555 ? 
25  AC3 18 THR DA 230 ? THR I 230 . ? 1_555 ? 
26  AC3 18 GLY DA 231 ? GLY I 231 . ? 1_555 ? 
27  AC3 18 LYS DA 232 ? LYS I 232 . ? 1_555 ? 
28  AC3 18 THR DA 233 ? THR I 233 . ? 1_555 ? 
29  AC3 18 LEU DA 234 ? LEU I 234 . ? 1_555 ? 
30  AC3 18 ILE DA 364 ? ILE I 364 . ? 1_555 ? 
31  AC3 18 HIS DA 368 ? HIS I 368 . ? 1_555 ? 
32  AC3 18 GLY DA 392 ? GLY I 392 . ? 1_555 ? 
33  AC3 18 ALA DA 393 ? ALA I 393 . ? 1_555 ? 
34  AC3 18 LYS DA 396 ? LYS I 396 . ? 1_555 ? 
35  AC3 18 MG  LA .   ? MG  I 502 . ? 1_555 ? 
36  AC3 18 ARG HA 307 ? ARG J 307 . ? 1_555 ? 
37  AC3 18 ARG HA 310 ? ARG J 310 . ? 1_555 ? 
38  AC4 2  THR DA 233 ? THR I 233 . ? 1_555 ? 
39  AC4 2  ATP KA .   ? ATP I 501 . ? 1_555 ? 
40  AC5 18 ASP EA 166 ? ASP K 166 . ? 1_555 ? 
41  AC5 18 ILE EA 167 ? ILE K 167 . ? 1_555 ? 
42  AC5 18 GLY EA 168 ? GLY K 168 . ? 1_555 ? 
43  AC5 18 PRO EA 208 ? PRO K 208 . ? 1_555 ? 
44  AC5 18 GLY EA 209 ? GLY K 209 . ? 1_555 ? 
45  AC5 18 CYS EA 210 ? CYS K 210 . ? 1_555 ? 
46  AC5 18 GLY EA 211 ? GLY K 211 . ? 1_555 ? 
47  AC5 18 LYS EA 212 ? LYS K 212 . ? 1_555 ? 
48  AC5 18 THR EA 213 ? THR K 213 . ? 1_555 ? 
49  AC5 18 MET EA 214 ? MET K 214 . ? 1_555 ? 
50  AC5 18 ASN EA 312 ? ASN K 312 . ? 1_555 ? 
51  AC5 18 ILE EA 344 ? ILE K 344 . ? 1_555 ? 
52  AC5 18 GLY EA 372 ? GLY K 372 . ? 1_555 ? 
53  AC5 18 ALA EA 373 ? ALA K 373 . ? 1_555 ? 
54  AC5 18 ASN EA 376 ? ASN K 376 . ? 1_555 ? 
55  AC5 18 MG  NA .   ? MG  K 502 . ? 1_555 ? 
56  AC5 18 ARG FA 291 ? ARG L 291 . ? 1_555 ? 
57  AC5 18 ARG FA 294 ? ARG L 294 . ? 1_555 ? 
58  AC6 4  THR EA 213 ? THR K 213 . ? 1_555 ? 
59  AC6 4  ASP EA 265 ? ASP K 265 . ? 1_555 ? 
60  AC6 4  ATP MA .   ? ATP K 501 . ? 1_555 ? 
61  AC6 4  ASP FA 265 ? ASP L 265 . ? 1_555 ? 
62  AC7 18 GLY FA 136 ? GLY L 136 . ? 1_555 ? 
63  AC7 18 PRO FA 176 ? PRO L 176 . ? 1_555 ? 
64  AC7 18 GLY FA 177 ? GLY L 177 . ? 1_555 ? 
65  AC7 18 THR FA 178 ? THR L 178 . ? 1_555 ? 
66  AC7 18 GLY FA 179 ? GLY L 179 . ? 1_555 ? 
67  AC7 18 LYS FA 180 ? LYS L 180 . ? 1_555 ? 
68  AC7 18 THR FA 181 ? THR L 181 . ? 1_555 ? 
69  AC7 18 LEU FA 182 ? LEU L 182 . ? 1_555 ? 
70  AC7 18 GLU FA 234 ? GLU L 234 . ? 1_555 ? 
71  AC7 18 ASN FA 280 ? ASN L 280 . ? 1_555 ? 
72  AC7 18 ILE FA 312 ? ILE L 312 . ? 1_555 ? 
73  AC7 18 HIS FA 316 ? HIS L 316 . ? 1_555 ? 
74  AC7 18 GLY FA 340 ? GLY L 340 . ? 1_555 ? 
75  AC7 18 ALA FA 341 ? ALA L 341 . ? 1_555 ? 
76  AC7 18 ARG FA 344 ? ARG L 344 . ? 1_555 ? 
77  AC7 18 MG  PA .   ? MG  L 402 . ? 1_555 ? 
78  AC7 18 ARG GA 344 ? ARG M 344 . ? 1_555 ? 
79  AC7 18 ARG GA 347 ? ARG M 347 . ? 1_555 ? 
80  AC8 2  THR FA 181 ? THR L 181 . ? 1_555 ? 
81  AC8 2  ATP OA .   ? ATP L 401 . ? 1_555 ? 
82  AC9 20 ARG CA 333 ? ARG H 333 . ? 1_555 ? 
83  AC9 20 ARG CA 336 ? ARG H 336 . ? 1_555 ? 
84  AC9 20 ILE GA 188 ? ILE M 188 . ? 1_555 ? 
85  AC9 20 GLY GA 189 ? GLY M 189 . ? 1_555 ? 
86  AC9 20 LEU GA 191 ? LEU M 191 . ? 1_555 ? 
87  AC9 20 PRO GA 229 ? PRO M 229 . ? 1_555 ? 
88  AC9 20 GLY GA 230 ? GLY M 230 . ? 1_555 ? 
89  AC9 20 THR GA 231 ? THR M 231 . ? 1_555 ? 
90  AC9 20 GLY GA 232 ? GLY M 232 . ? 1_555 ? 
91  AC9 20 LYS GA 233 ? LYS M 233 . ? 1_555 ? 
92  AC9 20 THR GA 234 ? THR M 234 . ? 1_555 ? 
93  AC9 20 LEU GA 235 ? LEU M 235 . ? 1_555 ? 
94  AC9 20 ARG GA 238 ? ARG M 238 . ? 1_555 ? 
95  AC9 20 ASN GA 333 ? ASN M 333 . ? 1_555 ? 
96  AC9 20 ILE GA 365 ? ILE M 365 . ? 1_555 ? 
97  AC9 20 HIS GA 369 ? HIS M 369 . ? 1_555 ? 
98  AC9 20 GLY GA 393 ? GLY M 393 . ? 1_555 ? 
99  AC9 20 ALA GA 394 ? ALA M 394 . ? 1_555 ? 
100 AC9 20 LYS GA 397 ? LYS M 397 . ? 1_555 ? 
101 AC9 20 MG  RA .   ? MG  M 502 . ? 1_555 ? 
102 AD1 2  THR GA 234 ? THR M 234 . ? 1_555 ? 
103 AD1 2  ATP QA .   ? ATP M 501 . ? 1_555 ? 
104 AD2 13 MET HA 150 ? MET J 150 . ? 1_555 ? 
105 AD2 13 GLY HA 152 ? GLY J 152 . ? 1_555 ? 
106 AD2 13 PRO HA 192 ? PRO J 192 . ? 1_555 ? 
107 AD2 13 GLY HA 193 ? GLY J 193 . ? 1_555 ? 
108 AD2 13 THR HA 194 ? THR J 194 . ? 1_555 ? 
109 AD2 13 GLY HA 195 ? GLY J 195 . ? 1_555 ? 
110 AD2 13 LYS HA 196 ? LYS J 196 . ? 1_555 ? 
111 AD2 13 THR HA 197 ? THR J 197 . ? 1_555 ? 
112 AD2 13 LEU HA 198 ? LEU J 198 . ? 1_555 ? 
113 AD2 13 ILE HA 328 ? ILE J 328 . ? 1_555 ? 
114 AD2 13 HIS HA 332 ? HIS J 332 . ? 1_555 ? 
115 AD2 13 GLY HA 356 ? GLY J 356 . ? 1_555 ? 
116 AD2 13 ALA HA 357 ? ALA J 357 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5L4G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N      . SER A  1  2   ? 338.362 234.192 261.537 1.00 215.10 ? 2   SER N N      1 
ATOM   2      C  CA     . SER A  1  2   ? 337.318 234.437 262.527 1.00 233.11 ? 2   SER N CA     1 
ATOM   3      C  C      . SER A  1  2   ? 337.917 234.446 263.939 1.00 255.02 ? 2   SER N C      1 
ATOM   4      O  O      . SER A  1  2   ? 339.045 234.901 264.136 1.00 275.50 ? 2   SER N O      1 
ATOM   5      C  CB     . SER A  1  2   ? 336.212 233.382 262.399 1.00 233.86 ? 2   SER N CB     1 
ATOM   6      O  OG     . SER A  1  2   ? 336.736 232.074 262.547 1.00 237.65 ? 2   SER N OG     1 
ATOM   7      H  HA     . SER A  1  2   ? 336.924 235.308 262.363 1.00 185.93 ? 2   SER N HA     1 
ATOM   8      H  HB2    . SER A  1  2   ? 335.549 233.536 263.091 1.00 186.79 ? 2   SER N HB2    1 
ATOM   9      H  HB3    . SER A  1  2   ? 335.801 233.461 261.524 1.00 186.79 ? 2   SER N HB3    1 
ATOM   10     H  HG     . SER A  1  2   ? 337.543 232.060 262.313 1.00 189.70 ? 2   SER N HG     1 
ATOM   11     N  N      . ARG A  1  3   ? 337.153 233.955 264.921 1.00 314.49 ? 3   ARG N N      1 
ATOM   12     C  CA     . ARG A  1  3   ? 337.616 233.837 266.297 1.00 297.23 ? 3   ARG N CA     1 
ATOM   13     C  C      . ARG A  1  3   ? 338.032 235.187 266.868 1.00 292.66 ? 3   ARG N C      1 
ATOM   14     O  O      . ARG A  1  3   ? 339.221 235.525 266.883 1.00 275.01 ? 3   ARG N O      1 
ATOM   15     C  CB     . ARG A  1  3   ? 338.774 232.838 266.391 1.00 297.57 ? 3   ARG N CB     1 
ATOM   16     C  CG     . ARG A  1  3   ? 338.415 231.441 265.900 1.00 290.72 ? 3   ARG N CG     1 
ATOM   17     C  CD     . ARG A  1  3   ? 339.428 230.389 266.337 1.00 287.91 ? 3   ARG N CD     1 
ATOM   18     N  NE     . ARG A  1  3   ? 339.479 230.242 267.789 1.00 285.99 ? 3   ARG N NE     1 
ATOM   19     C  CZ     . ARG A  1  3   ? 340.021 229.206 268.422 1.00 287.24 ? 3   ARG N CZ     1 
ATOM   20     N  NH1    . ARG A  1  3   ? 340.558 228.203 267.739 1.00 283.72 ? 3   ARG N NH1    1 
ATOM   21     N  NH2    . ARG A  1  3   ? 340.018 229.167 269.747 1.00 291.07 ? 3   ARG N NH2    1 
ATOM   22     H  H      . ARG A  1  3   ? 336.346 233.680 264.806 1.00 228.12 ? 3   ARG N H      1 
ATOM   23     H  HA     . ARG A  1  3   ? 336.889 233.497 266.841 1.00 210.41 ? 3   ARG N HA     1 
ATOM   24     H  HB2    . ARG A  1  3   ? 339.512 233.163 265.851 1.00 209.67 ? 3   ARG N HB2    1 
ATOM   25     H  HB3    . ARG A  1  3   ? 339.051 232.766 267.317 1.00 209.67 ? 3   ARG N HB3    1 
ATOM   26     H  HG2    . ARG A  1  3   ? 337.549 231.192 266.259 1.00 202.42 ? 3   ARG N HG2    1 
ATOM   27     H  HG3    . ARG A  1  3   ? 338.384 231.444 264.930 1.00 202.42 ? 3   ARG N HG3    1 
ATOM   28     H  HD2    . ARG A  1  3   ? 339.181 229.532 265.955 1.00 198.51 ? 3   ARG N HD2    1 
ATOM   29     H  HD3    . ARG A  1  3   ? 340.310 230.650 266.029 1.00 198.51 ? 3   ARG N HD3    1 
ATOM   30     H  HE     . ARG A  1  3   ? 339.135 230.868 268.267 1.00 196.31 ? 3   ARG N HE     1 
ATOM   31     H  HH11   . ARG A  1  3   ? 340.563 228.222 266.880 1.00 192.43 ? 3   ARG N HH11   1 
ATOM   32     H  HH12   . ARG A  1  3   ? 340.905 227.536 268.157 1.00 192.43 ? 3   ARG N HH12   1 
ATOM   33     H  HH21   . ARG A  1  3   ? 339.670 229.813 270.195 1.00 200.30 ? 3   ARG N HH21   1 
ATOM   34     H  HH22   . ARG A  1  3   ? 340.366 228.497 270.158 1.00 200.30 ? 3   ARG N HH22   1 
ATOM   35     N  N      . GLY A  1  4   ? 337.060 235.958 267.345 1.00 188.23 ? 4   GLY N N      1 
ATOM   36     C  CA     . GLY A  1  4   ? 337.337 237.246 267.957 1.00 184.06 ? 4   GLY N CA     1 
ATOM   37     C  C      . GLY A  1  4   ? 337.807 238.291 266.972 1.00 166.84 ? 4   GLY N C      1 
ATOM   38     O  O      . GLY A  1  4   ? 338.723 239.065 267.284 1.00 151.25 ? 4   GLY N O      1 
ATOM   39     H  H      . GLY A  1  4   ? 336.225 235.753 267.325 1.00 154.78 ? 4   GLY N H      1 
ATOM   40     H  HA2    . GLY A  1  4   ? 336.533 237.574 268.389 1.00 150.93 ? 4   GLY N HA2    1 
ATOM   41     H  HA3    . GLY A  1  4   ? 338.023 237.137 268.634 1.00 150.93 ? 4   GLY N HA3    1 
ATOM   42     N  N      . SER A  1  5   ? 337.195 238.344 265.792 1.00 176.52 ? 5   SER N N      1 
ATOM   43     C  CA     . SER A  1  5   ? 337.616 239.248 264.733 1.00 174.71 ? 5   SER N CA     1 
ATOM   44     C  C      . SER A  1  5   ? 336.516 240.250 264.417 1.00 165.25 ? 5   SER N C      1 
ATOM   45     O  O      . SER A  1  5   ? 335.331 239.903 264.369 1.00 133.44 ? 5   SER N O      1 
ATOM   46     C  CB     . SER A  1  5   ? 337.983 238.477 263.464 1.00 176.97 ? 5   SER N CB     1 
ATOM   47     O  OG     . SER A  1  5   ? 336.876 237.736 262.983 1.00 174.98 ? 5   SER N OG     1 
ATOM   48     H  H      . SER A  1  5   ? 336.520 237.855 265.579 1.00 158.41 ? 5   SER N H      1 
ATOM   49     H  HA     . SER A  1  5   ? 338.399 239.740 265.026 1.00 156.86 ? 5   SER N HA     1 
ATOM   50     H  HB2    . SER A  1  5   ? 338.261 239.107 262.781 1.00 158.74 ? 5   SER N HB2    1 
ATOM   51     H  HB3    . SER A  1  5   ? 338.708 237.865 263.665 1.00 158.74 ? 5   SER N HB3    1 
ATOM   52     H  HG     . SER A  1  5   ? 337.091 237.318 262.287 1.00 157.06 ? 5   SER N HG     1 
ATOM   53     N  N      . SER A  1  6   ? 336.927 241.494 264.204 1.00 182.94 ? 6   SER N N      1 
ATOM   54     C  CA     . SER A  1  6   ? 336.037 242.532 263.719 1.00 180.63 ? 6   SER N CA     1 
ATOM   55     C  C      . SER A  1  6   ? 335.921 242.436 262.203 1.00 176.84 ? 6   SER N C      1 
ATOM   56     O  O      . SER A  1  6   ? 336.855 242.019 261.514 1.00 167.10 ? 6   SER N O      1 
ATOM   57     C  CB     . SER A  1  6   ? 336.569 243.906 264.126 1.00 182.96 ? 6   SER N CB     1 
ATOM   58     O  OG     . SER A  1  6   ? 335.592 244.917 263.971 1.00 183.40 ? 6   SER N OG     1 
ATOM   59     H  H      . SER A  1  6   ? 337.733 241.763 264.335 1.00 162.83 ? 6   SER N H      1 
ATOM   60     H  HA     . SER A  1  6   ? 335.155 242.413 264.106 1.00 161.39 ? 6   SER N HA     1 
ATOM   61     H  HB2    . SER A  1  6   ? 336.839 243.873 265.057 1.00 163.92 ? 6   SER N HB2    1 
ATOM   62     H  HB3    . SER A  1  6   ? 337.334 244.122 263.570 1.00 163.92 ? 6   SER N HB3    1 
ATOM   63     H  HG     . SER A  1  6   ? 335.909 245.660 264.201 1.00 165.20 ? 6   SER N HG     1 
ATOM   64     N  N      . ALA A  1  7   ? 334.755 242.818 261.682 1.00 137.98 ? 7   ALA N N      1 
ATOM   65     C  CA     . ALA A  1  7   ? 334.525 242.767 260.236 1.00 128.57 ? 7   ALA N CA     1 
ATOM   66     C  C      . ALA A  1  7   ? 333.348 243.697 259.915 1.00 131.26 ? 7   ALA N C      1 
ATOM   67     O  O      . ALA A  1  7   ? 332.197 243.261 259.865 1.00 132.17 ? 7   ALA N O      1 
ATOM   68     C  CB     . ALA A  1  7   ? 334.266 241.351 259.760 1.00 107.68 ? 7   ALA N CB     1 
ATOM   69     H  H      . ALA A  1  7   ? 334.086 243.109 262.138 1.00 141.26 ? 7   ALA N H      1 
ATOM   70     H  HA     . ALA A  1  7   ? 335.311 243.102 259.775 1.00 132.04 ? 7   ALA N HA     1 
ATOM   71     H  HB1    . ALA A  1  7   ? 334.120 241.362 258.801 1.00 110.78 ? 7   ALA N HB1    1 
ATOM   72     H  HB2    . ALA A  1  7   ? 335.037 240.801 259.971 1.00 110.78 ? 7   ALA N HB2    1 
ATOM   73     H  HB3    . ALA A  1  7   ? 333.480 241.006 260.211 1.00 110.78 ? 7   ALA N HB3    1 
ATOM   74     N  N      . GLY A  1  8   ? 333.660 244.966 259.699 1.00 152.33 ? 8   GLY N N      1 
ATOM   75     C  CA     . GLY A  1  8   ? 332.662 245.945 259.305 1.00 146.39 ? 8   GLY N CA     1 
ATOM   76     C  C      . GLY A  1  8   ? 332.133 246.723 260.504 1.00 130.84 ? 8   GLY N C      1 
ATOM   77     O  O      . GLY A  1  8   ? 332.908 247.204 261.335 1.00 126.01 ? 8   GLY N O      1 
ATOM   78     H  H      . GLY A  1  8   ? 334.454 245.288 259.775 1.00 139.70 ? 8   GLY N H      1 
ATOM   79     H  HA2    . GLY A  1  8   ? 333.052 246.572 258.676 1.00 134.56 ? 8   GLY N HA2    1 
ATOM   80     H  HA3    . GLY A  1  8   ? 331.918 245.496 258.874 1.00 134.56 ? 8   GLY N HA3    1 
ATOM   81     N  N      . PHE A  1  9   ? 330.809 246.852 260.584 1.00 105.85 ? 9   PHE N N      1 
ATOM   82     C  CA     . PHE A  1  9   ? 330.156 247.629 261.629 1.00 109.14 ? 9   PHE N CA     1 
ATOM   83     C  C      . PHE A  1  9   ? 329.552 246.736 262.702 1.00 119.39 ? 9   PHE N C      1 
ATOM   84     O  O      . PHE A  1  9   ? 328.524 247.073 263.298 1.00 145.61 ? 9   PHE N O      1 
ATOM   85     C  CB     . PHE A  1  9   ? 329.102 248.536 261.003 1.00 101.53 ? 9   PHE N CB     1 
ATOM   86     C  CG     . PHE A  1  9   ? 329.694 249.576 260.117 1.00 112.62 ? 9   PHE N CG     1 
ATOM   87     C  CD1    . PHE A  1  9   ? 330.501 250.556 260.655 1.00 130.69 ? 9   PHE N CD1    1 
ATOM   88     C  CD2    . PHE A  1  9   ? 329.483 249.557 258.751 1.00 114.07 ? 9   PHE N CD2    1 
ATOM   89     C  CE1    . PHE A  1  9   ? 331.075 251.512 259.859 1.00 143.68 ? 9   PHE N CE1    1 
ATOM   90     C  CE2    . PHE A  1  9   ? 330.060 250.514 257.942 1.00 129.21 ? 9   PHE N CE2    1 
ATOM   91     C  CZ     . PHE A  1  9   ? 330.858 251.494 258.499 1.00 142.63 ? 9   PHE N CZ     1 
ATOM   92     H  H      . PHE A  1  9   ? 330.259 246.490 260.031 1.00 104.31 ? 9   PHE N H      1 
ATOM   93     H  HA     . PHE A  1  9   ? 330.817 248.196 262.056 1.00 108.06 ? 9   PHE N HA     1 
ATOM   94     H  HB2    . PHE A  1  9   ? 328.496 247.997 260.471 1.00 101.21 ? 9   PHE N HB2    1 
ATOM   95     H  HB3    . PHE A  1  9   ? 328.612 248.987 261.710 1.00 101.21 ? 9   PHE N HB3    1 
ATOM   96     H  HD1    . PHE A  1  9   ? 330.654 250.572 261.573 1.00 130.39 ? 9   PHE N HD1    1 
ATOM   97     H  HD2    . PHE A  1  9   ? 328.948 248.896 258.375 1.00 114.01 ? 9   PHE N HD2    1 
ATOM   98     H  HE1    . PHE A  1  9   ? 331.612 252.171 260.235 1.00 143.45 ? 9   PHE N HE1    1 
ATOM   99     H  HE2    . PHE A  1  9   ? 329.909 250.501 257.024 1.00 129.22 ? 9   PHE N HE2    1 
ATOM   100    H  HZ     . PHE A  1  9   ? 331.244 252.144 257.957 1.00 142.56 ? 9   PHE N HZ     1 
ATOM   101    N  N      . ASP A  1  10  ? 330.201 245.613 262.971 1.00 91.90  ? 10  ASP N N      1 
ATOM   102    C  CA     . ASP A  1  10  ? 329.685 244.614 263.890 1.00 101.18 ? 10  ASP N CA     1 
ATOM   103    C  C      . ASP A  1  10  ? 330.030 244.890 265.351 1.00 88.20  ? 10  ASP N C      1 
ATOM   104    O  O      . ASP A  1  10  ? 329.512 244.193 266.229 1.00 87.02  ? 10  ASP N O      1 
ATOM   105    C  CB     . ASP A  1  10  ? 330.195 243.226 263.476 1.00 128.06 ? 10  ASP N CB     1 
ATOM   106    C  CG     . ASP A  1  10  ? 331.673 243.220 263.148 1.00 153.37 ? 10  ASP N CG     1 
ATOM   107    O  OD1    . ASP A  1  10  ? 332.242 244.321 262.988 1.00 164.86 ? 10  ASP N OD1    1 
ATOM   108    O  OD2    . ASP A  1  10  ? 332.257 242.118 263.033 1.00 163.33 ? 10  ASP N OD2    1 
ATOM   109    H  H      . ASP A  1  10  ? 330.960 245.403 262.626 1.00 87.29  ? 10  ASP N H      1 
ATOM   110    H  HA     . ASP A  1  10  ? 328.718 244.603 263.818 1.00 96.40  ? 10  ASP N HA     1 
ATOM   111    H  HB2    . ASP A  1  10  ? 330.047 242.604 264.205 1.00 122.62 ? 10  ASP N HB2    1 
ATOM   112    H  HB3    . ASP A  1  10  ? 329.712 242.934 262.687 1.00 122.62 ? 10  ASP N HB3    1 
ATOM   113    N  N      . ARG A  1  11  ? 330.882 245.876 265.644 1.00 88.81  ? 11  ARG N N      1 
ATOM   114    C  CA     . ARG A  1  11  ? 331.131 246.295 267.020 1.00 87.09  ? 11  ARG N CA     1 
ATOM   115    C  C      . ARG A  1  11  ? 330.487 247.632 267.350 1.00 87.92  ? 11  ARG N C      1 
ATOM   116    O  O      . ARG A  1  11  ? 330.907 248.289 268.307 1.00 104.67 ? 11  ARG N O      1 
ATOM   117    C  CB     . ARG A  1  11  ? 332.627 246.393 267.324 1.00 89.12  ? 11  ARG N CB     1 
ATOM   118    C  CG     . ARG A  1  11  ? 333.432 245.158 267.042 1.00 96.39  ? 11  ARG N CG     1 
ATOM   119    C  CD     . ARG A  1  11  ? 332.942 243.970 267.837 1.00 104.75 ? 11  ARG N CD     1 
ATOM   120    N  NE     . ARG A  1  11  ? 333.615 242.760 267.379 1.00 118.39 ? 11  ARG N NE     1 
ATOM   121    C  CZ     . ARG A  1  11  ? 334.596 242.143 268.024 1.00 122.41 ? 11  ARG N CZ     1 
ATOM   122    N  NH1    . ARG A  1  11  ? 335.037 242.593 269.194 1.00 126.18 ? 11  ARG N NH1    1 
ATOM   123    N  NH2    . ARG A  1  11  ? 335.135 241.052 267.494 1.00 122.47 ? 11  ARG N NH2    1 
ATOM   124    H  H      . ARG A  1  11  ? 331.329 246.319 265.058 1.00 89.66  ? 11  ARG N H      1 
ATOM   125    H  HA     . ARG A  1  11  ? 330.753 245.631 267.618 1.00 87.82  ? 11  ARG N HA     1 
ATOM   126    H  HB2    . ARG A  1  11  ? 333.002 247.111 266.790 1.00 89.16  ? 11  ARG N HB2    1 
ATOM   127    H  HB3    . ARG A  1  11  ? 332.735 246.600 268.265 1.00 89.16  ? 11  ARG N HB3    1 
ATOM   128    H  HG2    . ARG A  1  11  ? 333.362 244.940 266.100 1.00 95.68  ? 11  ARG N HG2    1 
ATOM   129    H  HG3    . ARG A  1  11  ? 334.358 245.320 267.280 1.00 95.68  ? 11  ARG N HG3    1 
ATOM   130    H  HD2    . ARG A  1  11  ? 333.146 244.101 268.777 1.00 103.78 ? 11  ARG N HD2    1 
ATOM   131    H  HD3    . ARG A  1  11  ? 331.987 243.862 267.707 1.00 103.78 ? 11  ARG N HD3    1 
ATOM   132    H  HE     . ARG A  1  11  ? 333.355 242.421 266.633 1.00 116.73 ? 11  ARG N HE     1 
ATOM   133    H  HH11   . ARG A  1  11  ? 334.692 243.301 269.540 1.00 123.54 ? 11  ARG N HH11   1 
ATOM   134    H  HH12   . ARG A  1  11  ? 335.671 242.180 269.602 1.00 123.54 ? 11  ARG N HH12   1 
ATOM   135    H  HH21   . ARG A  1  11  ? 334.850 240.755 266.739 1.00 119.42 ? 11  ARG N HH21   1 
ATOM   136    H  HH22   . ARG A  1  11  ? 335.767 240.640 267.908 1.00 119.42 ? 11  ARG N HH22   1 
ATOM   137    N  N      . HIS A  1  12  ? 329.492 248.062 266.583 1.00 74.71  ? 12  HIS N N      1 
ATOM   138    C  CA     . HIS A  1  12  ? 328.855 249.342 266.864 1.00 72.95  ? 12  HIS N CA     1 
ATOM   139    C  C      . HIS A  1  12  ? 327.348 249.180 266.882 1.00 69.62  ? 12  HIS N C      1 
ATOM   140    O  O      . HIS A  1  12  ? 326.677 249.664 267.797 1.00 70.86  ? 12  HIS N O      1 
ATOM   141    C  CB     . HIS A  1  12  ? 329.292 250.384 265.840 1.00 74.83  ? 12  HIS N CB     1 
ATOM   142    C  CG     . HIS A  1  12  ? 330.777 250.477 265.688 1.00 78.47  ? 12  HIS N CG     1 
ATOM   143    N  ND1    . HIS A  1  12  ? 331.558 251.284 266.488 1.00 79.84  ? 12  HIS N ND1    1 
ATOM   144    C  CD2    . HIS A  1  12  ? 331.629 249.845 264.845 1.00 81.32  ? 12  HIS N CD2    1 
ATOM   145    C  CE1    . HIS A  1  12  ? 332.826 251.154 266.140 1.00 87.19  ? 12  HIS N CE1    1 
ATOM   146    N  NE2    . HIS A  1  12  ? 332.897 250.287 265.143 1.00 86.50  ? 12  HIS N NE2    1 
ATOM   147    H  H      . HIS A  1  12  ? 329.171 247.640 265.906 1.00 69.92  ? 12  HIS N H      1 
ATOM   148    H  HA     . HIS A  1  12  ? 329.134 249.648 267.741 1.00 68.78  ? 12  HIS N HA     1 
ATOM   149    H  HB2    . HIS A  1  12  ? 328.918 250.152 264.976 1.00 70.86  ? 12  HIS N HB2    1 
ATOM   150    H  HB3    . HIS A  1  12  ? 328.966 251.254 266.119 1.00 70.86  ? 12  HIS N HB3    1 
ATOM   151    H  HD1    . HIS A  1  12  ? 331.265 251.794 267.116 1.00 75.08  ? 12  HIS N HD1    1 
ATOM   152    H  HD2    . HIS A  1  12  ? 331.399 249.232 264.185 1.00 76.28  ? 12  HIS N HD2    1 
ATOM   153    H  HE1    . HIS A  1  12  ? 333.546 251.598 266.526 1.00 81.86  ? 12  HIS N HE1    1 
ATOM   154    N  N      . ILE A  1  13  ? 326.813 248.495 265.879 1.00 56.17  ? 13  ILE N N      1 
ATOM   155    C  CA     . ILE A  1  13  ? 325.395 248.137 265.838 1.00 53.37  ? 13  ILE N CA     1 
ATOM   156    C  C      . ILE A  1  13  ? 325.292 246.648 266.117 1.00 53.17  ? 13  ILE N C      1 
ATOM   157    O  O      . ILE A  1  13  ? 326.308 245.977 266.330 1.00 75.19  ? 13  ILE N O      1 
ATOM   158    C  CB     . ILE A  1  13  ? 324.741 248.498 264.498 1.00 53.37  ? 13  ILE N CB     1 
ATOM   159    C  CG1    . ILE A  1  13  ? 325.579 247.913 263.358 1.00 56.24  ? 13  ILE N CG1    1 
ATOM   160    C  CG2    . ILE A  1  13  ? 324.542 250.010 264.393 1.00 65.75  ? 13  ILE N CG2    1 
ATOM   161    C  CD1    . ILE A  1  13  ? 325.120 248.268 261.991 1.00 56.84  ? 13  ILE N CD1    1 
ATOM   162    H  H      . ILE A  1  13  ? 327.257 248.220 265.195 1.00 64.70  ? 13  ILE N H      1 
ATOM   163    H  HA     . ILE A  1  13  ? 324.925 248.611 266.542 1.00 62.38  ? 13  ILE N HA     1 
ATOM   164    H  HB     . ILE A  1  13  ? 323.866 248.080 264.469 1.00 62.85  ? 13  ILE N HB     1 
ATOM   165    H  HG12   . ILE A  1  13  ? 326.491 248.231 263.452 1.00 65.30  ? 13  ILE N HG12   1 
ATOM   166    H  HG13   . ILE A  1  13  ? 325.564 246.946 263.430 1.00 65.30  ? 13  ILE N HG13   1 
ATOM   167    H  HG21   . ILE A  1  13  ? 324.129 250.216 263.540 1.00 75.73  ? 13  ILE N HG21   1 
ATOM   168    H  HG22   . ILE A  1  13  ? 323.969 250.304 265.118 1.00 75.73  ? 13  ILE N HG22   1 
ATOM   169    H  HG23   . ILE A  1  13  ? 325.406 250.447 264.456 1.00 75.73  ? 13  ILE N HG23   1 
ATOM   170    H  HD11   . ILE A  1  13  ? 325.711 247.853 261.342 1.00 66.27  ? 13  ILE N HD11   1 
ATOM   171    H  HD12   . ILE A  1  13  ? 324.214 247.944 261.868 1.00 66.27  ? 13  ILE N HD12   1 
ATOM   172    H  HD13   . ILE A  1  13  ? 325.143 249.232 261.891 1.00 66.27  ? 13  ILE N HD13   1 
ATOM   173    N  N      . THR A  1  14  ? 324.077 246.113 266.086 1.00 89.48  ? 14  THR N N      1 
ATOM   174    C  CA     . THR A  1  14  ? 323.782 244.800 266.656 1.00 90.41  ? 14  THR N CA     1 
ATOM   175    C  C      . THR A  1  14  ? 323.700 243.692 265.606 1.00 93.14  ? 14  THR N C      1 
ATOM   176    O  O      . THR A  1  14  ? 322.853 242.801 265.702 1.00 93.51  ? 14  THR N O      1 
ATOM   177    C  CB     . THR A  1  14  ? 322.486 244.892 267.451 1.00 106.78 ? 14  THR N CB     1 
ATOM   178    O  OG1    . THR A  1  14  ? 321.425 245.293 266.580 1.00 138.68 ? 14  THR N OG1    1 
ATOM   179    C  CG2    . THR A  1  14  ? 322.620 245.923 268.572 1.00 91.28  ? 14  THR N CG2    1 
ATOM   180    H  H      . THR A  1  14  ? 323.393 246.498 265.734 1.00 74.16  ? 14  THR N H      1 
ATOM   181    H  HA     . THR A  1  14  ? 324.491 244.565 267.275 1.00 74.76  ? 14  THR N HA     1 
ATOM   182    H  HB     . THR A  1  14  ? 322.280 244.029 267.844 1.00 91.61  ? 14  THR N HB     1 
ATOM   183    H  HG1    . THR A  1  14  ? 320.705 245.346 267.009 1.00 124.11 ? 14  THR N HG1    1 
ATOM   184    H  HG21   . THR A  1  14  ? 321.792 245.976 269.075 1.00 76.26  ? 14  THR N HG21   1 
ATOM   185    H  HG22   . THR A  1  14  ? 323.337 245.668 269.173 1.00 76.26  ? 14  THR N HG22   1 
ATOM   186    H  HG23   . THR A  1  14  ? 322.818 246.795 268.198 1.00 76.26  ? 14  THR N HG23   1 
ATOM   187    N  N      . ILE A  1  15  ? 324.586 243.705 264.604 1.00 55.01  ? 15  ILE N N      1 
ATOM   188    C  CA     . ILE A  1  15  ? 324.629 242.681 263.559 1.00 56.92  ? 15  ILE N CA     1 
ATOM   189    C  C      . ILE A  1  15  ? 325.588 241.573 263.975 1.00 59.22  ? 15  ILE N C      1 
ATOM   190    O  O      . ILE A  1  15  ? 326.387 241.752 264.897 1.00 59.85  ? 15  ILE N O      1 
ATOM   191    C  CB     . ILE A  1  15  ? 325.050 243.296 262.216 1.00 58.91  ? 15  ILE N CB     1 
ATOM   192    C  CG1    . ILE A  1  15  ? 326.435 243.941 262.356 1.00 61.08  ? 15  ILE N CG1    1 
ATOM   193    C  CG2    . ILE A  1  15  ? 324.025 244.329 261.776 1.00 56.92  ? 15  ILE N CG2    1 
ATOM   194    C  CD1    . ILE A  1  15  ? 327.053 244.416 261.063 1.00 87.18  ? 15  ILE N CD1    1 
ATOM   195    H  H      . ILE A  1  15  ? 325.187 244.313 264.509 1.00 62.72  ? 15  ILE N H      1 
ATOM   196    H  HA     . ILE A  1  15  ? 323.745 242.295 263.453 1.00 64.35  ? 15  ILE N HA     1 
ATOM   197    H  HB     . ILE A  1  15  ? 325.096 242.594 261.549 1.00 66.45  ? 15  ILE N HB     1 
ATOM   198    H  HG12   . ILE A  1  15  ? 326.359 244.710 262.943 1.00 68.26  ? 15  ILE N HG12   1 
ATOM   199    H  HG13   . ILE A  1  15  ? 327.039 243.292 262.748 1.00 68.26  ? 15  ILE N HG13   1 
ATOM   200    H  HG21   . ILE A  1  15  ? 324.304 244.709 260.928 1.00 65.23  ? 15  ILE N HG21   1 
ATOM   201    H  HG22   . ILE A  1  15  ? 323.163 243.896 261.678 1.00 65.23  ? 15  ILE N HG22   1 
ATOM   202    H  HG23   . ILE A  1  15  ? 323.970 245.026 262.449 1.00 65.23  ? 15  ILE N HG23   1 
ATOM   203    H  HD11   . ILE A  1  15  ? 327.921 244.806 261.254 1.00 94.33  ? 15  ILE N HD11   1 
ATOM   204    H  HD12   . ILE A  1  15  ? 327.155 243.659 260.465 1.00 94.33  ? 15  ILE N HD12   1 
ATOM   205    H  HD13   . ILE A  1  15  ? 326.472 245.081 260.661 1.00 94.33  ? 15  ILE N HD13   1 
ATOM   206    N  N      . PHE A  1  16  ? 325.535 240.426 263.302 1.00 56.19  ? 16  PHE N N      1 
ATOM   207    C  CA     . PHE A  1  16  ? 326.401 239.322 263.693 1.00 58.71  ? 16  PHE N CA     1 
ATOM   208    C  C      . PHE A  1  16  ? 327.855 239.614 263.346 1.00 61.96  ? 16  PHE N C      1 
ATOM   209    O  O      . PHE A  1  16  ? 328.162 240.427 262.471 1.00 62.82  ? 16  PHE N O      1 
ATOM   210    C  CB     . PHE A  1  16  ? 325.980 238.018 263.025 1.00 60.19  ? 16  PHE N CB     1 
ATOM   211    C  CG     . PHE A  1  16  ? 324.849 237.327 263.714 1.00 57.99  ? 16  PHE N CG     1 
ATOM   212    C  CD1    . PHE A  1  16  ? 325.001 236.836 265.002 1.00 57.51  ? 16  PHE N CD1    1 
ATOM   213    C  CD2    . PHE A  1  16  ? 323.634 237.157 263.076 1.00 56.70  ? 16  PHE N CD2    1 
ATOM   214    C  CE1    . PHE A  1  16  ? 323.953 236.201 265.646 1.00 55.71  ? 16  PHE N CE1    1 
ATOM   215    C  CE2    . PHE A  1  16  ? 322.582 236.518 263.712 1.00 54.92  ? 16  PHE N CE2    1 
ATOM   216    C  CZ     . PHE A  1  16  ? 322.743 236.039 264.998 1.00 54.42  ? 16  PHE N CZ     1 
ATOM   217    H  H      . PHE A  1  16  ? 325.020 240.265 262.632 1.00 67.16  ? 16  PHE N H      1 
ATOM   218    H  HA     . PHE A  1  16  ? 326.341 239.200 264.654 1.00 68.89  ? 16  PHE N HA     1 
ATOM   219    H  HB2    . PHE A  1  16  ? 325.701 238.209 262.116 1.00 70.11  ? 16  PHE N HB2    1 
ATOM   220    H  HB3    . PHE A  1  16  ? 326.737 237.412 263.017 1.00 70.11  ? 16  PHE N HB3    1 
ATOM   221    H  HD1    . PHE A  1  16  ? 325.813 236.945 265.442 1.00 67.26  ? 16  PHE N HD1    1 
ATOM   222    H  HD2    . PHE A  1  16  ? 323.520 237.480 262.212 1.00 67.28  ? 16  PHE N HD2    1 
ATOM   223    H  HE1    . PHE A  1  16  ? 324.065 235.877 266.510 1.00 65.62  ? 16  PHE N HE1    1 
ATOM   224    H  HE2    . PHE A  1  16  ? 321.769 236.412 263.274 1.00 65.65  ? 16  PHE N HE2    1 
ATOM   225    H  HZ     . PHE A  1  16  ? 322.039 235.609 265.426 1.00 64.82  ? 16  PHE N HZ     1 
ATOM   226    N  N      . SER A  1  17  ? 328.755 238.926 264.046 1.00 103.82 ? 17  SER N N      1 
ATOM   227    C  CA     . SER A  1  17  ? 330.184 238.981 263.779 1.00 105.86 ? 17  SER N CA     1 
ATOM   228    C  C      . SER A  1  17  ? 330.656 237.674 263.159 1.00 109.38 ? 17  SER N C      1 
ATOM   229    O  O      . SER A  1  17  ? 329.976 236.648 263.251 1.00 120.42 ? 17  SER N O      1 
ATOM   230    C  CB     . SER A  1  17  ? 330.984 239.249 265.061 1.00 128.43 ? 17  SER N CB     1 
ATOM   231    O  OG     . SER A  1  17  ? 330.628 240.487 265.642 1.00 148.82 ? 17  SER N OG     1 
ATOM   232    H  H      . SER A  1  17  ? 328.552 238.405 264.700 1.00 93.45  ? 17  SER N H      1 
ATOM   233    H  HA     . SER A  1  17  ? 330.365 239.699 263.152 1.00 94.89  ? 17  SER N HA     1 
ATOM   234    H  HB2    . SER A  1  17  ? 330.802 238.539 265.697 1.00 117.08 ? 17  SER N HB2    1 
ATOM   235    H  HB3    . SER A  1  17  ? 331.929 239.264 264.844 1.00 117.08 ? 17  SER N HB3    1 
ATOM   236    H  HG     . SER A  1  17  ? 331.075 240.615 266.341 1.00 138.05 ? 17  SER N HG     1 
ATOM   237    N  N      . PRO A  1  18  ? 331.830 237.672 262.527 1.00 75.25  ? 18  PRO N N      1 
ATOM   238    C  CA     . PRO A  1  18  ? 332.248 236.474 261.781 1.00 79.02  ? 18  PRO N CA     1 
ATOM   239    C  C      . PRO A  1  18  ? 332.322 235.206 262.621 1.00 112.07 ? 18  PRO N C      1 
ATOM   240    O  O      . PRO A  1  18  ? 332.145 234.112 262.069 1.00 82.73  ? 18  PRO N O      1 
ATOM   241    C  CB     . PRO A  1  18  ? 333.619 236.880 261.223 1.00 82.88  ? 18  PRO N CB     1 
ATOM   242    C  CG     . PRO A  1  18  ? 333.542 238.375 261.110 1.00 80.69  ? 18  PRO N CG     1 
ATOM   243    C  CD     . PRO A  1  18  ? 332.772 238.792 262.330 1.00 76.54  ? 18  PRO N CD     1 
ATOM   244    H  HA     . PRO A  1  18  ? 331.642 236.321 261.039 1.00 85.41  ? 18  PRO N HA     1 
ATOM   245    H  HB2    . PRO A  1  18  ? 334.318 236.616 261.842 1.00 88.82  ? 18  PRO N HB2    1 
ATOM   246    H  HB3    . PRO A  1  18  ? 333.754 236.474 260.353 1.00 88.82  ? 18  PRO N HB3    1 
ATOM   247    H  HG2    . PRO A  1  18  ? 334.435 238.753 261.118 1.00 87.28  ? 18  PRO N HG2    1 
ATOM   248    H  HG3    . PRO A  1  18  ? 333.067 238.621 260.301 1.00 87.28  ? 18  PRO N HG3    1 
ATOM   249    H  HD2    . PRO A  1  18  ? 333.365 238.875 263.094 1.00 83.57  ? 18  PRO N HD2    1 
ATOM   250    H  HD3    . PRO A  1  18  ? 332.289 239.616 262.162 1.00 83.57  ? 18  PRO N HD3    1 
ATOM   251    N  N      . GLU A  1  19  ? 332.571 235.298 263.927 1.00 106.70 ? 19  GLU N N      1 
ATOM   252    C  CA     . GLU A  1  19  ? 332.631 234.089 264.741 1.00 112.39 ? 19  GLU N CA     1 
ATOM   253    C  C      . GLU A  1  19  ? 331.267 233.644 265.248 1.00 106.47 ? 19  GLU N C      1 
ATOM   254    O  O      . GLU A  1  19  ? 331.106 232.467 265.588 1.00 107.90 ? 19  GLU N O      1 
ATOM   255    C  CB     . GLU A  1  19  ? 333.578 234.271 265.935 1.00 144.56 ? 19  GLU N CB     1 
ATOM   256    C  CG     . GLU A  1  19  ? 333.003 235.040 267.110 1.00 173.59 ? 19  GLU N CG     1 
ATOM   257    C  CD     . GLU A  1  19  ? 332.749 236.486 266.776 1.00 195.33 ? 19  GLU N CD     1 
ATOM   258    O  OE1    . GLU A  1  19  ? 333.432 237.021 265.875 1.00 192.48 ? 19  GLU N OE1    1 
ATOM   259    O  OE2    . GLU A  1  19  ? 331.854 237.076 267.408 1.00 214.91 ? 19  GLU N OE2    1 
ATOM   260    H  H      . GLU A  1  19  ? 332.705 236.031 264.356 1.00 117.80 ? 19  GLU N H      1 
ATOM   261    H  HA     . GLU A  1  19  ? 332.987 233.371 264.195 1.00 122.88 ? 19  GLU N HA     1 
ATOM   262    H  HB2    . GLU A  1  19  ? 333.835 233.394 266.260 1.00 154.54 ? 19  GLU N HB2    1 
ATOM   263    H  HB3    . GLU A  1  19  ? 334.366 234.748 265.633 1.00 154.54 ? 19  GLU N HB3    1 
ATOM   264    H  HG2    . GLU A  1  19  ? 332.159 234.638 267.370 1.00 184.07 ? 19  GLU N HG2    1 
ATOM   265    H  HG3    . GLU A  1  19  ? 333.630 235.007 267.849 1.00 184.07 ? 19  GLU N HG3    1 
ATOM   266    N  N      . GLY A  1  20  ? 330.285 234.539 265.310 1.00 102.11 ? 20  GLY N N      1 
ATOM   267    C  CA     . GLY A  1  20  ? 328.931 234.171 265.691 1.00 84.52  ? 20  GLY N CA     1 
ATOM   268    C  C      . GLY A  1  20  ? 328.325 234.961 266.831 1.00 85.00  ? 20  GLY N C      1 
ATOM   269    O  O      . GLY A  1  20  ? 327.144 234.745 267.134 1.00 92.83  ? 20  GLY N O      1 
ATOM   270    H  H      . GLY A  1  20  ? 330.382 235.375 265.134 1.00 94.39  ? 20  GLY N H      1 
ATOM   271    H  HA2    . GLY A  1  20  ? 328.352 234.276 264.919 1.00 77.25  ? 20  GLY N HA2    1 
ATOM   272    H  HA3    . GLY A  1  20  ? 328.922 233.235 265.943 1.00 77.25  ? 20  GLY N HA3    1 
ATOM   273    N  N      . ARG A  1  21  ? 329.044 235.858 267.493 1.00 106.05 ? 21  ARG N N      1 
ATOM   274    C  CA     . ARG A  1  21  ? 328.499 236.553 268.652 1.00 116.27 ? 21  ARG N CA     1 
ATOM   275    C  C      . ARG A  1  21  ? 327.972 237.935 268.276 1.00 102.34 ? 21  ARG N C      1 
ATOM   276    O  O      . ARG A  1  21  ? 328.143 238.418 267.152 1.00 110.28 ? 21  ARG N O      1 
ATOM   277    C  CB     . ARG A  1  21  ? 329.554 236.665 269.765 1.00 135.96 ? 21  ARG N CB     1 
ATOM   278    C  CG     . ARG A  1  21  ? 329.842 235.366 270.539 1.00 155.55 ? 21  ARG N CG     1 
ATOM   279    C  CD     . ARG A  1  21  ? 328.596 234.481 270.779 1.00 153.21 ? 21  ARG N CD     1 
ATOM   280    N  NE     . ARG A  1  21  ? 327.482 235.194 271.411 1.00 130.74 ? 21  ARG N NE     1 
ATOM   281    C  CZ     . ARG A  1  21  ? 326.328 234.633 271.780 1.00 101.59 ? 21  ARG N CZ     1 
ATOM   282    N  NH1    . ARG A  1  21  ? 326.101 233.335 271.599 1.00 103.29 ? 21  ARG N NH1    1 
ATOM   283    N  NH2    . ARG A  1  21  ? 325.385 235.378 272.342 1.00 104.06 ? 21  ARG N NH2    1 
ATOM   284    H  H      . ARG A  1  21  ? 329.850 236.082 267.293 1.00 97.48  ? 21  ARG N H      1 
ATOM   285    H  HA     . ARG A  1  21  ? 327.755 236.039 269.001 1.00 108.11 ? 21  ARG N HA     1 
ATOM   286    H  HB2    . ARG A  1  21  ? 330.389 236.958 269.368 1.00 127.22 ? 21  ARG N HB2    1 
ATOM   287    H  HB3    . ARG A  1  21  ? 329.253 237.326 270.408 1.00 127.22 ? 21  ARG N HB3    1 
ATOM   288    H  HG2    . ARG A  1  21  ? 330.485 234.841 270.037 1.00 146.06 ? 21  ARG N HG2    1 
ATOM   289    H  HG3    . ARG A  1  21  ? 330.213 235.596 271.406 1.00 146.06 ? 21  ARG N HG3    1 
ATOM   290    H  HD2    . ARG A  1  21  ? 328.284 234.140 269.926 1.00 143.92 ? 21  ARG N HD2    1 
ATOM   291    H  HD3    . ARG A  1  21  ? 328.843 233.743 271.358 1.00 143.92 ? 21  ARG N HD3    1 
ATOM   292    H  HE     . ARG A  1  21  ? 327.580 236.036 271.555 1.00 122.20 ? 21  ARG N HE     1 
ATOM   293    H  HH11   . ARG A  1  21  ? 326.703 232.839 271.235 1.00 94.61  ? 21  ARG N HH11   1 
ATOM   294    H  HH12   . ARG A  1  21  ? 325.352 232.991 271.844 1.00 94.61  ? 21  ARG N HH12   1 
ATOM   295    H  HH21   . ARG A  1  21  ? 325.518 236.218 272.467 1.00 96.44  ? 21  ARG N HH21   1 
ATOM   296    H  HH22   . ARG A  1  21  ? 324.641 235.020 272.583 1.00 96.44  ? 21  ARG N HH22   1 
ATOM   297    N  N      . LEU A  1  22  ? 327.291 238.555 269.244 1.00 71.38  ? 22  LEU N N      1 
ATOM   298    C  CA     . LEU A  1  22  ? 326.779 239.923 269.145 1.00 68.82  ? 22  LEU N CA     1 
ATOM   299    C  C      . LEU A  1  22  ? 327.508 240.759 270.179 1.00 69.10  ? 22  LEU N C      1 
ATOM   300    O  O      . LEU A  1  22  ? 327.272 240.603 271.380 1.00 68.31  ? 22  LEU N O      1 
ATOM   301    C  CB     . LEU A  1  22  ? 325.280 239.983 269.406 1.00 65.41  ? 22  LEU N CB     1 
ATOM   302    C  CG     . LEU A  1  22  ? 324.406 239.068 268.571 1.00 65.14  ? 22  LEU N CG     1 
ATOM   303    C  CD1    . LEU A  1  22  ? 322.957 239.288 268.922 1.00 61.90  ? 22  LEU N CD1    1 
ATOM   304    C  CD2    . LEU A  1  22  ? 324.645 239.356 267.114 1.00 82.00  ? 22  LEU N CD2    1 
ATOM   305    H  H      . LEU A  1  22  ? 327.106 238.185 269.999 1.00 65.73  ? 22  LEU N H      1 
ATOM   306    H  HA     . LEU A  1  22  ? 326.961 240.282 268.262 1.00 63.91  ? 22  LEU N HA     1 
ATOM   307    H  HB2    . LEU A  1  22  ? 325.125 239.756 270.337 1.00 61.15  ? 22  LEU N HB2    1 
ATOM   308    H  HB3    . LEU A  1  22  ? 324.980 240.892 269.245 1.00 61.15  ? 22  LEU N HB3    1 
ATOM   309    H  HG     . LEU A  1  22  ? 324.635 238.142 268.748 1.00 61.01  ? 22  LEU N HG     1 
ATOM   310    H  HD11   . LEU A  1  22  ? 322.408 238.698 268.382 1.00 58.43  ? 22  LEU N HD11   1 
ATOM   311    H  HD12   . LEU A  1  22  ? 322.828 239.092 269.863 1.00 58.43  ? 22  LEU N HD12   1 
ATOM   312    H  HD13   . LEU A  1  22  ? 322.726 240.213 268.742 1.00 58.43  ? 22  LEU N HD13   1 
ATOM   313    H  HD21   . LEU A  1  22  ? 324.085 238.770 266.581 1.00 78.01  ? 22  LEU N HD21   1 
ATOM   314    H  HD22   . LEU A  1  22  ? 324.419 240.282 266.935 1.00 78.01  ? 22  LEU N HD22   1 
ATOM   315    H  HD23   . LEU A  1  22  ? 325.580 239.198 266.910 1.00 78.01  ? 22  LEU N HD23   1 
ATOM   316    N  N      . TYR A  1  23  ? 328.371 241.662 269.726 1.00 72.97  ? 23  TYR N N      1 
ATOM   317    C  CA     . TYR A  1  23  ? 329.195 242.371 270.690 1.00 73.84  ? 23  TYR N CA     1 
ATOM   318    C  C      . TYR A  1  23  ? 328.472 243.546 271.326 1.00 102.23 ? 23  TYR N C      1 
ATOM   319    O  O      . TYR A  1  23  ? 328.829 243.939 272.442 1.00 105.31 ? 23  TYR N O      1 
ATOM   320    C  CB     . TYR A  1  23  ? 330.503 242.799 270.037 1.00 77.02  ? 23  TYR N CB     1 
ATOM   321    C  CG     . TYR A  1  23  ? 331.411 241.609 270.004 1.00 80.33  ? 23  TYR N CG     1 
ATOM   322    C  CD1    . TYR A  1  23  ? 331.242 240.628 269.043 1.00 81.39  ? 23  TYR N CD1    1 
ATOM   323    C  CD2    . TYR A  1  23  ? 332.376 241.413 270.981 1.00 82.55  ? 23  TYR N CD2    1 
ATOM   324    C  CE1    . TYR A  1  23  ? 332.032 239.510 269.021 1.00 122.65 ? 23  TYR N CE1    1 
ATOM   325    C  CE2    . TYR A  1  23  ? 333.180 240.287 270.970 1.00 128.73 ? 23  TYR N CE2    1 
ATOM   326    C  CZ     . TYR A  1  23  ? 333.000 239.333 269.983 1.00 114.49 ? 23  TYR N CZ     1 
ATOM   327    O  OH     . TYR A  1  23  ? 333.779 238.197 269.944 1.00 106.29 ? 23  TYR N OH     1 
ATOM   328    H  H      . TYR A  1  23  ? 328.495 241.874 268.902 1.00 68.21  ? 23  TYR N H      1 
ATOM   329    H  HA     . TYR A  1  23  ? 329.420 241.755 271.405 1.00 68.84  ? 23  TYR N HA     1 
ATOM   330    H  HB2    . TYR A  1  23  ? 330.338 243.096 269.129 1.00 71.64  ? 23  TYR N HB2    1 
ATOM   331    H  HB3    . TYR A  1  23  ? 330.921 243.500 270.561 1.00 71.64  ? 23  TYR N HB3    1 
ATOM   332    H  HD1    . TYR A  1  23  ? 330.588 240.737 268.390 1.00 75.01  ? 23  TYR N HD1    1 
ATOM   333    H  HD2    . TYR A  1  23  ? 332.493 242.054 271.645 1.00 75.67  ? 23  TYR N HD2    1 
ATOM   334    H  HE1    . TYR A  1  23  ? 331.911 238.868 268.359 1.00 115.48 ? 23  TYR N HE1    1 
ATOM   335    H  HE2    . TYR A  1  23  ? 333.834 240.170 271.622 1.00 121.04 ? 23  TYR N HE2    1 
ATOM   336    H  HH     . TYR A  1  23  ? 334.329 238.204 270.579 1.00 97.63  ? 23  TYR N HH     1 
ATOM   337    N  N      . GLN A  1  24  ? 327.444 244.083 270.678 1.00 64.65  ? 24  GLN N N      1 
ATOM   338    C  CA     . GLN A  1  24  ? 326.662 245.109 271.350 1.00 62.09  ? 24  GLN N CA     1 
ATOM   339    C  C      . GLN A  1  24  ? 325.803 244.558 272.471 1.00 89.54  ? 24  GLN N C      1 
ATOM   340    O  O      . GLN A  1  24  ? 325.235 245.347 273.227 1.00 100.76 ? 24  GLN N O      1 
ATOM   341    C  CB     . GLN A  1  24  ? 325.756 245.839 270.366 1.00 60.36  ? 24  GLN N CB     1 
ATOM   342    C  CG     . GLN A  1  24  ? 326.475 246.831 269.486 1.00 62.02  ? 24  GLN N CG     1 
ATOM   343    C  CD     . GLN A  1  24  ? 327.319 247.823 270.276 1.00 63.22  ? 24  GLN N CD     1 
ATOM   344    O  OE1    . GLN A  1  24  ? 328.388 248.226 269.827 1.00 62.34  ? 24  GLN N OE1    1 
ATOM   345    N  NE2    . GLN A  1  24  ? 326.840 248.222 271.452 1.00 65.52  ? 24  GLN N NE2    1 
ATOM   346    H  H      . GLN A  1  24  ? 327.187 243.881 269.882 1.00 62.11  ? 24  GLN N H      1 
ATOM   347    H  HA     . GLN A  1  24  ? 327.268 245.761 271.734 1.00 60.14  ? 24  GLN N HA     1 
ATOM   348    H  HB2    . GLN A  1  24  ? 325.332 245.185 269.789 1.00 59.14  ? 24  GLN N HB2    1 
ATOM   349    H  HB3    . GLN A  1  24  ? 325.080 246.323 270.865 1.00 59.14  ? 24  GLN N HB3    1 
ATOM   350    H  HG2    . GLN A  1  24  ? 327.065 246.349 268.885 1.00 60.90  ? 24  GLN N HG2    1 
ATOM   351    H  HG3    . GLN A  1  24  ? 325.821 247.333 268.977 1.00 60.90  ? 24  GLN N HG3    1 
ATOM   352    H  HE21   . GLN A  1  24  ? 326.085 247.920 271.733 1.00 64.42  ? 24  GLN N HE21   1 
ATOM   353    H  HE22   . GLN A  1  24  ? 327.285 248.782 271.930 1.00 64.42  ? 24  GLN N HE22   1 
ATOM   354    N  N      . VAL A  1  25  ? 325.671 243.242 272.591 1.00 52.54  ? 25  VAL N N      1 
ATOM   355    C  CA     . VAL A  1  25  ? 324.970 242.651 273.716 1.00 51.22  ? 25  VAL N CA     1 
ATOM   356    C  C      . VAL A  1  25  ? 325.943 242.162 274.781 1.00 53.44  ? 25  VAL N C      1 
ATOM   357    O  O      . VAL A  1  25  ? 325.728 242.394 275.969 1.00 52.72  ? 25  VAL N O      1 
ATOM   358    C  CB     . VAL A  1  25  ? 324.031 241.527 273.242 1.00 50.39  ? 25  VAL N CB     1 
ATOM   359    C  CG1    . VAL A  1  25  ? 323.265 240.960 274.419 1.00 49.13  ? 25  VAL N CG1    1 
ATOM   360    C  CG2    . VAL A  1  25  ? 323.050 242.086 272.237 1.00 48.48  ? 25  VAL N CG2    1 
ATOM   361    H  H      . VAL A  1  25  ? 325.982 242.669 272.029 1.00 58.35  ? 25  VAL N H      1 
ATOM   362    H  HA     . VAL A  1  25  ? 324.418 243.336 274.123 1.00 56.99  ? 25  VAL N HA     1 
ATOM   363    H  HB     . VAL A  1  25  ? 324.544 240.817 272.825 1.00 56.26  ? 25  VAL N HB     1 
ATOM   364    H  HG11   . VAL A  1  25  ? 322.679 240.255 274.104 1.00 54.98  ? 25  VAL N HG11   1 
ATOM   365    H  HG12   . VAL A  1  25  ? 323.897 240.604 275.064 1.00 54.98  ? 25  VAL N HG12   1 
ATOM   366    H  HG13   . VAL A  1  25  ? 322.742 241.669 274.826 1.00 54.98  ? 25  VAL N HG13   1 
ATOM   367    H  HG21   . VAL A  1  25  ? 322.461 241.374 271.942 1.00 55.07  ? 25  VAL N HG21   1 
ATOM   368    H  HG22   . VAL A  1  25  ? 322.534 242.791 272.658 1.00 55.07  ? 25  VAL N HG22   1 
ATOM   369    H  HG23   . VAL A  1  25  ? 323.543 242.443 271.481 1.00 55.07  ? 25  VAL N HG23   1 
ATOM   370    N  N      . GLU A  1  26  ? 327.032 241.496 274.390 1.00 80.36  ? 26  GLU N N      1 
ATOM   371    C  CA     . GLU A  1  26  ? 328.072 241.207 275.368 1.00 81.39  ? 26  GLU N CA     1 
ATOM   372    C  C      . GLU A  1  26  ? 328.409 242.466 276.147 1.00 79.61  ? 26  GLU N C      1 
ATOM   373    O  O      . GLU A  1  26  ? 328.675 242.417 277.352 1.00 88.84  ? 26  GLU N O      1 
ATOM   374    C  CB     . GLU A  1  26  ? 329.325 240.653 274.684 1.00 102.96 ? 26  GLU N CB     1 
ATOM   375    C  CG     . GLU A  1  26  ? 329.133 239.295 274.030 1.00 133.88 ? 26  GLU N CG     1 
ATOM   376    C  CD     . GLU A  1  26  ? 330.415 238.745 273.421 1.00 162.66 ? 26  GLU N CD     1 
ATOM   377    O  OE1    . GLU A  1  26  ? 331.506 239.229 273.796 1.00 186.42 ? 26  GLU N OE1    1 
ATOM   378    O  OE2    . GLU A  1  26  ? 330.330 237.824 272.572 1.00 162.51 ? 26  GLU N OE2    1 
ATOM   379    H  H      . GLU A  1  26  ? 327.187 241.212 273.594 1.00 72.76  ? 26  GLU N H      1 
ATOM   380    H  HA     . GLU A  1  26  ? 327.747 240.540 275.994 1.00 73.06  ? 26  GLU N HA     1 
ATOM   381    H  HB2    . GLU A  1  26  ? 329.602 241.276 273.993 1.00 93.95  ? 26  GLU N HB2    1 
ATOM   382    H  HB3    . GLU A  1  26  ? 330.028 240.565 275.346 1.00 93.95  ? 26  GLU N HB3    1 
ATOM   383    H  HG2    . GLU A  1  26  ? 328.824 238.663 274.699 1.00 124.56 ? 26  GLU N HG2    1 
ATOM   384    H  HG3    . GLU A  1  26  ? 328.475 239.375 273.322 1.00 124.56 ? 26  GLU N HG3    1 
ATOM   385    N  N      . TYR A  1  27  ? 328.367 243.614 275.469 1.00 63.86  ? 27  TYR N N      1 
ATOM   386    C  CA     . TYR A  1  27  ? 328.719 244.879 276.097 1.00 64.06  ? 27  TYR N CA     1 
ATOM   387    C  C      . TYR A  1  27  ? 327.658 245.355 277.076 1.00 61.48  ? 27  TYR N C      1 
ATOM   388    O  O      . TYR A  1  27  ? 327.993 245.952 278.106 1.00 62.21  ? 27  TYR N O      1 
ATOM   389    C  CB     . TYR A  1  27  ? 328.957 245.937 275.021 1.00 64.20  ? 27  TYR N CB     1 
ATOM   390    C  CG     . TYR A  1  27  ? 330.286 245.808 274.314 1.00 67.50  ? 27  TYR N CG     1 
ATOM   391    C  CD1    . TYR A  1  27  ? 331.188 244.801 274.649 1.00 70.28  ? 27  TYR N CD1    1 
ATOM   392    C  CD2    . TYR A  1  27  ? 330.646 246.706 273.320 1.00 73.04  ? 27  TYR N CD2    1 
ATOM   393    C  CE1    . TYR A  1  27  ? 332.401 244.689 274.012 1.00 73.58  ? 27  TYR N CE1    1 
ATOM   394    C  CE2    . TYR A  1  27  ? 331.860 246.605 272.675 1.00 77.30  ? 27  TYR N CE2    1 
ATOM   395    C  CZ     . TYR A  1  27  ? 332.733 245.594 273.022 1.00 84.54  ? 27  TYR N CZ     1 
ATOM   396    O  OH     . TYR A  1  27  ? 333.939 245.493 272.373 1.00 90.56  ? 27  TYR N OH     1 
ATOM   397    H  H      . TYR A  1  27  ? 328.137 243.683 274.643 1.00 62.23  ? 27  TYR N H      1 
ATOM   398    H  HA     . TYR A  1  27  ? 329.547 244.764 276.590 1.00 62.58  ? 27  TYR N HA     1 
ATOM   399    H  HB2    . TYR A  1  27  ? 328.258 245.864 274.352 1.00 63.11  ? 27  TYR N HB2    1 
ATOM   400    H  HB3    . TYR A  1  27  ? 328.926 246.814 275.434 1.00 63.11  ? 27  TYR N HB3    1 
ATOM   401    H  HD1    . TYR A  1  27  ? 330.965 244.191 275.314 1.00 67.84  ? 27  TYR N HD1    1 
ATOM   402    H  HD2    . TYR A  1  27  ? 330.058 247.387 273.086 1.00 71.67  ? 27  TYR N HD2    1 
ATOM   403    H  HE1    . TYR A  1  27  ? 332.991 244.008 274.243 1.00 70.62  ? 27  TYR N HE1    1 
ATOM   404    H  HE2    . TYR A  1  27  ? 332.087 247.211 272.007 1.00 75.43  ? 27  TYR N HE2    1 
ATOM   405    H  HH     . TYR A  1  27  ? 334.009 246.104 271.800 1.00 87.37  ? 27  TYR N HH     1 
ATOM   406    N  N      . ALA A  1  28  ? 326.383 245.117 276.786 1.00 75.18  ? 28  ALA N N      1 
ATOM   407    C  CA     . ALA A  1  28  ? 325.352 245.577 277.705 1.00 78.73  ? 28  ALA N CA     1 
ATOM   408    C  C      . ALA A  1  28  ? 325.470 244.916 279.072 1.00 79.05  ? 28  ALA N C      1 
ATOM   409    O  O      . ALA A  1  28  ? 325.008 245.486 280.064 1.00 94.99  ? 28  ALA N O      1 
ATOM   410    C  CB     . ALA A  1  28  ? 323.965 245.325 277.119 1.00 86.59  ? 28  ALA N CB     1 
ATOM   411    H  H      . ALA A  1  28  ? 326.096 244.705 276.088 1.00 62.06  ? 28  ALA N H      1 
ATOM   412    H  HA     . ALA A  1  28  ? 325.451 246.534 277.830 1.00 66.06  ? 28  ALA N HA     1 
ATOM   413    H  HB1    . ALA A  1  28  ? 323.296 245.640 277.747 1.00 74.54  ? 28  ALA N HB1    1 
ATOM   414    H  HB2    . ALA A  1  28  ? 323.885 245.806 276.281 1.00 74.54  ? 28  ALA N HB2    1 
ATOM   415    H  HB3    . ALA A  1  28  ? 323.856 244.374 276.967 1.00 74.54  ? 28  ALA N HB3    1 
ATOM   416    N  N      . PHE A  1  29  ? 326.073 243.731 279.156 1.00 72.35  ? 29  PHE N N      1 
ATOM   417    C  CA     . PHE A  1  29  ? 326.221 243.094 280.456 1.00 80.04  ? 29  PHE N CA     1 
ATOM   418    C  C      . PHE A  1  29  ? 327.291 243.776 281.289 1.00 94.46  ? 29  PHE N C      1 
ATOM   419    O  O      . PHE A  1  29  ? 327.155 243.891 282.511 1.00 119.86 ? 29  PHE N O      1 
ATOM   420    C  CB     . PHE A  1  29  ? 326.518 241.611 280.274 1.00 74.72  ? 29  PHE N CB     1 
ATOM   421    C  CG     . PHE A  1  29  ? 325.319 240.849 279.887 1.00 78.87  ? 29  PHE N CG     1 
ATOM   422    C  CD1    . PHE A  1  29  ? 325.100 240.496 278.571 1.00 85.72  ? 29  PHE N CD1    1 
ATOM   423    C  CD2    . PHE A  1  29  ? 324.363 240.549 280.834 1.00 70.33  ? 29  PHE N CD2    1 
ATOM   424    C  CE1    . PHE A  1  29  ? 323.962 239.816 278.215 1.00 84.33  ? 29  PHE N CE1    1 
ATOM   425    C  CE2    . PHE A  1  29  ? 323.235 239.869 280.494 1.00 70.26  ? 29  PHE N CE2    1 
ATOM   426    C  CZ     . PHE A  1  29  ? 323.019 239.509 279.177 1.00 76.79  ? 29  PHE N CZ     1 
ATOM   427    H  H      . PHE A  1  29  ? 326.396 243.288 278.494 1.00 69.40  ? 29  PHE N H      1 
ATOM   428    H  HA     . PHE A  1  29  ? 325.382 243.169 280.936 1.00 76.59  ? 29  PHE N HA     1 
ATOM   429    H  HB2    . PHE A  1  29  ? 327.183 241.503 279.576 1.00 70.67  ? 29  PHE N HB2    1 
ATOM   430    H  HB3    . PHE A  1  29  ? 326.850 241.248 281.110 1.00 70.67  ? 29  PHE N HB3    1 
ATOM   431    H  HD1    . PHE A  1  29  ? 325.733 240.709 277.924 1.00 82.24  ? 29  PHE N HD1    1 
ATOM   432    H  HD2    . PHE A  1  29  ? 324.501 240.794 281.721 1.00 66.80  ? 29  PHE N HD2    1 
ATOM   433    H  HE1    . PHE A  1  29  ? 323.823 239.569 277.329 1.00 81.18  ? 29  PHE N HE1    1 
ATOM   434    H  HE2    . PHE A  1  29  ? 322.602 239.663 281.143 1.00 67.07  ? 29  PHE N HE2    1 
ATOM   435    H  HZ     . PHE A  1  29  ? 322.250 239.041 278.942 1.00 73.80  ? 29  PHE N HZ     1 
ATOM   436    N  N      . LYS A  1  30  ? 328.351 244.259 280.651 1.00 81.72  ? 30  LYS N N      1 
ATOM   437    C  CA     . LYS A  1  30  ? 329.333 245.029 281.391 1.00 84.18  ? 30  LYS N CA     1 
ATOM   438    C  C      . LYS A  1  30  ? 328.764 246.342 281.906 1.00 82.64  ? 30  LYS N C      1 
ATOM   439    O  O      . LYS A  1  30  ? 329.430 247.009 282.707 1.00 84.69  ? 30  LYS N O      1 
ATOM   440    C  CB     . LYS A  1  30  ? 330.548 245.299 280.516 1.00 86.73  ? 30  LYS N CB     1 
ATOM   441    C  CG     . LYS A  1  30  ? 331.249 244.041 280.052 1.00 105.13 ? 30  LYS N CG     1 
ATOM   442    C  CD     . LYS A  1  30  ? 332.354 244.382 279.073 1.00 111.66 ? 30  LYS N CD     1 
ATOM   443    C  CE     . LYS A  1  30  ? 332.959 243.142 278.422 1.00 119.60 ? 30  LYS N CE     1 
ATOM   444    N  NZ     . LYS A  1  30  ? 332.048 242.464 277.452 1.00 117.92 ? 30  LYS N NZ     1 
ATOM   445    H  H      . LYS A  1  30  ? 328.520 244.157 279.814 1.00 65.10  ? 30  LYS N H      1 
ATOM   446    H  HA     . LYS A  1  30  ? 329.626 244.511 282.156 1.00 67.19  ? 30  LYS N HA     1 
ATOM   447    H  HB2    . LYS A  1  30  ? 330.265 245.790 279.728 1.00 69.41  ? 30  LYS N HB2    1 
ATOM   448    H  HB3    . LYS A  1  30  ? 331.187 245.827 281.021 1.00 69.41  ? 30  LYS N HB3    1 
ATOM   449    H  HG2    . LYS A  1  30  ? 331.642 243.590 280.815 1.00 87.15  ? 30  LYS N HG2    1 
ATOM   450    H  HG3    . LYS A  1  30  ? 330.611 243.462 279.606 1.00 87.15  ? 30  LYS N HG3    1 
ATOM   451    H  HD2    . LYS A  1  30  ? 331.992 244.944 278.370 1.00 93.44  ? 30  LYS N HD2    1 
ATOM   452    H  HD3    . LYS A  1  30  ? 333.061 244.850 279.544 1.00 93.44  ? 30  LYS N HD3    1 
ATOM   453    H  HE2    . LYS A  1  30  ? 333.762 243.401 277.943 1.00 100.77 ? 30  LYS N HE2    1 
ATOM   454    H  HE3    . LYS A  1  30  ? 333.183 242.502 279.116 1.00 100.77 ? 30  LYS N HE3    1 
ATOM   455    H  HZ1    . LYS A  1  30  ? 332.451 241.751 277.104 1.00 99.49  ? 30  LYS N HZ1    1 
ATOM   456    H  HZ2    . LYS A  1  30  ? 331.304 242.204 277.865 1.00 99.49  ? 30  LYS N HZ2    1 
ATOM   457    H  HZ3    . LYS A  1  30  ? 331.833 243.024 276.795 1.00 99.49  ? 30  LYS N HZ3    1 
ATOM   458    N  N      . ALA A  1  31  ? 327.560 246.725 281.475 1.00 107.18 ? 31  ALA N N      1 
ATOM   459    C  CA     . ALA A  1  31  ? 326.902 247.908 282.010 1.00 116.36 ? 31  ALA N CA     1 
ATOM   460    C  C      . ALA A  1  31  ? 326.103 247.614 283.270 1.00 99.78  ? 31  ALA N C      1 
ATOM   461    O  O      . ALA A  1  31  ? 325.791 248.545 284.021 1.00 109.84 ? 31  ALA N O      1 
ATOM   462    C  CB     . ALA A  1  31  ? 325.973 248.526 280.962 1.00 123.43 ? 31  ALA N CB     1 
ATOM   463    H  H      . ALA A  1  31  ? 327.107 246.313 280.872 1.00 88.92  ? 31  ALA N H      1 
ATOM   464    H  HA     . ALA A  1  31  ? 327.577 248.568 282.234 1.00 98.64  ? 31  ALA N HA     1 
ATOM   465    H  HB1    . ALA A  1  31  ? 325.547 249.311 281.341 1.00 106.51 ? 31  ALA N HB1    1 
ATOM   466    H  HB2    . ALA A  1  31  ? 326.497 248.776 280.185 1.00 106.51 ? 31  ALA N HB2    1 
ATOM   467    H  HB3    . ALA A  1  31  ? 325.301 247.873 280.712 1.00 106.51 ? 31  ALA N HB3    1 
ATOM   468    N  N      . ILE A  1  32  ? 325.761 246.348 283.516 1.00 78.31  ? 32  ILE N N      1 
ATOM   469    C  CA     . ILE A  1  32  ? 325.145 245.983 284.784 1.00 79.76  ? 32  ILE N CA     1 
ATOM   470    C  C      . ILE A  1  32  ? 326.144 246.161 285.925 1.00 80.54  ? 32  ILE N C      1 
ATOM   471    O  O      . ILE A  1  32  ? 325.804 246.667 287.000 1.00 80.73  ? 32  ILE N O      1 
ATOM   472    C  CB     . ILE A  1  32  ? 324.603 244.544 284.714 1.00 99.38  ? 32  ILE N CB     1 
ATOM   473    C  CG1    . ILE A  1  32  ? 323.581 244.415 283.577 1.00 125.81 ? 32  ILE N CG1    1 
ATOM   474    C  CG2    . ILE A  1  32  ? 323.953 244.152 286.031 1.00 102.11 ? 32  ILE N CG2    1 
ATOM   475    C  CD1    . ILE A  1  32  ? 323.199 242.983 283.247 1.00 150.35 ? 32  ILE N CD1    1 
ATOM   476    H  H      . ILE A  1  32  ? 325.874 245.693 282.971 1.00 69.78  ? 32  ILE N H      1 
ATOM   477    H  HA     . ILE A  1  32  ? 324.395 246.575 284.951 1.00 71.14  ? 32  ILE N HA     1 
ATOM   478    H  HB     . ILE A  1  32  ? 325.342 243.940 284.539 1.00 90.59  ? 32  ILE N HB     1 
ATOM   479    H  HG12   . ILE A  1  32  ? 322.772 244.887 283.830 1.00 117.67 ? 32  ILE N HG12   1 
ATOM   480    H  HG13   . ILE A  1  32  ? 323.956 244.814 282.775 1.00 117.67 ? 32  ILE N HG13   1 
ATOM   481    H  HG21   . ILE A  1  32  ? 323.621 243.244 285.961 1.00 93.21  ? 32  ILE N HG21   1 
ATOM   482    H  HG22   . ILE A  1  32  ? 324.615 244.209 286.738 1.00 93.21  ? 32  ILE N HG22   1 
ATOM   483    H  HG23   . ILE A  1  32  ? 323.220 244.760 286.214 1.00 93.21  ? 32  ILE N HG23   1 
ATOM   484    H  HD11   . ILE A  1  32  ? 322.553 242.988 282.522 1.00 142.00 ? 32  ILE N HD11   1 
ATOM   485    H  HD12   . ILE A  1  32  ? 323.994 242.498 282.978 1.00 142.00 ? 32  ILE N HD12   1 
ATOM   486    H  HD13   . ILE A  1  32  ? 322.809 242.572 284.034 1.00 142.00 ? 32  ILE N HD13   1 
ATOM   487    N  N      . ASN A  1  33  ? 327.398 245.766 285.706 1.00 74.27  ? 33  ASN N N      1 
ATOM   488    C  CA     . ASN A  1  33  ? 328.437 245.956 286.710 1.00 84.87  ? 33  ASN N CA     1 
ATOM   489    C  C      . ASN A  1  33  ? 328.866 247.407 286.829 1.00 79.26  ? 33  ASN N C      1 
ATOM   490    O  O      . ASN A  1  33  ? 329.654 247.729 287.721 1.00 80.78  ? 33  ASN N O      1 
ATOM   491    C  CB     . ASN A  1  33  ? 329.659 245.098 286.381 1.00 110.56 ? 33  ASN N CB     1 
ATOM   492    C  CG     . ASN A  1  33  ? 329.284 243.734 285.841 1.00 132.41 ? 33  ASN N CG     1 
ATOM   493    O  OD1    . ASN A  1  33  ? 328.430 243.041 286.396 1.00 141.56 ? 33  ASN N OD1    1 
ATOM   494    N  ND2    . ASN A  1  33  ? 329.912 243.350 284.737 1.00 142.36 ? 33  ASN N ND2    1 
ATOM   495    H  H      . ASN A  1  33  ? 327.670 245.385 284.985 1.00 71.53  ? 33  ASN N H      1 
ATOM   496    H  HA     . ASN A  1  33  ? 328.096 245.673 287.573 1.00 81.45  ? 33  ASN N HA     1 
ATOM   497    H  HB2    . ASN A  1  33  ? 330.193 245.551 285.710 1.00 106.36 ? 33  ASN N HB2    1 
ATOM   498    H  HB3    . ASN A  1  33  ? 330.181 244.968 287.189 1.00 106.36 ? 33  ASN N HB3    1 
ATOM   499    H  HD21   . ASN A  1  33  ? 329.737 242.584 284.387 1.00 137.84 ? 33  ASN N HD21   1 
ATOM   500    H  HD22   . ASN A  1  33  ? 330.495 243.866 284.371 1.00 137.84 ? 33  ASN N HD22   1 
ATOM   501    N  N      . GLN A  1  34  ? 328.392 248.282 285.944 1.00 121.70 ? 34  GLN N N      1 
ATOM   502    C  CA     . GLN A  1  34  ? 328.702 249.696 286.075 1.00 140.43 ? 34  GLN N CA     1 
ATOM   503    C  C      . GLN A  1  34  ? 328.125 250.246 287.371 1.00 140.66 ? 34  GLN N C      1 
ATOM   504    O  O      . GLN A  1  34  ? 328.820 250.918 288.142 1.00 142.44 ? 34  GLN N O      1 
ATOM   505    C  CB     . GLN A  1  34  ? 328.158 250.461 284.866 1.00 151.45 ? 34  GLN N CB     1 
ATOM   506    C  CG     . GLN A  1  34  ? 328.724 251.868 284.689 1.00 157.43 ? 34  GLN N CG     1 
ATOM   507    C  CD     . GLN A  1  34  ? 330.200 251.876 284.330 1.00 155.18 ? 34  GLN N CD     1 
ATOM   508    O  OE1    . GLN A  1  34  ? 330.605 251.328 283.302 1.00 154.13 ? 34  GLN N OE1    1 
ATOM   509    N  NE2    . GLN A  1  34  ? 331.011 252.506 285.174 1.00 156.52 ? 34  GLN N NE2    1 
ATOM   510    H  H      . GLN A  1  34  ? 327.896 248.083 285.270 1.00 97.31  ? 34  GLN N H      1 
ATOM   511    H  HA     . GLN A  1  34  ? 329.665 249.811 286.099 1.00 116.26 ? 34  GLN N HA     1 
ATOM   512    H  HB2    . GLN A  1  34  ? 328.367 249.959 284.063 1.00 128.01 ? 34  GLN N HB2    1 
ATOM   513    H  HB3    . GLN A  1  34  ? 327.196 250.542 284.959 1.00 128.01 ? 34  GLN N HB3    1 
ATOM   514    H  HG2    . GLN A  1  34  ? 328.240 252.315 283.977 1.00 134.14 ? 34  GLN N HG2    1 
ATOM   515    H  HG3    . GLN A  1  34  ? 328.616 252.357 285.520 1.00 134.14 ? 34  GLN N HG3    1 
ATOM   516    H  HE21   . GLN A  1  34  ? 330.690 252.881 285.879 1.00 132.19 ? 34  GLN N HE21   1 
ATOM   517    H  HE22   . GLN A  1  34  ? 331.855 252.539 285.016 1.00 132.19 ? 34  GLN N HE22   1 
ATOM   518    N  N      . GLY A  1  35  ? 326.857 249.933 287.645 1.00 102.79 ? 35  GLY N N      1 
ATOM   519    C  CA     . GLY A  1  35  ? 326.155 250.516 288.775 1.00 111.51 ? 35  GLY N CA     1 
ATOM   520    C  C      . GLY A  1  35  ? 326.823 250.288 290.116 1.00 129.61 ? 35  GLY N C      1 
ATOM   521    O  O      . GLY A  1  35  ? 326.516 251.001 291.078 1.00 108.96 ? 35  GLY N O      1 
ATOM   522    H  H      . GLY A  1  35  ? 326.383 249.382 287.185 1.00 89.87  ? 35  GLY N H      1 
ATOM   523    H  HA2    . GLY A  1  35  ? 326.077 251.473 288.638 1.00 98.80  ? 35  GLY N HA2    1 
ATOM   524    H  HA3    . GLY A  1  35  ? 325.261 250.144 288.818 1.00 98.80  ? 35  GLY N HA3    1 
ATOM   525    N  N      . GLY A  1  36  ? 327.727 249.318 290.208 1.00 145.40 ? 36  GLY N N      1 
ATOM   526    C  CA     . GLY A  1  36  ? 328.361 249.041 291.485 1.00 81.47  ? 36  GLY N CA     1 
ATOM   527    C  C      . GLY A  1  36  ? 327.379 248.634 292.561 1.00 111.48 ? 36  GLY N C      1 
ATOM   528    O  O      . GLY A  1  36  ? 327.492 249.086 293.706 1.00 83.09  ? 36  GLY N O      1 
ATOM   529    H  H      . GLY A  1  36  ? 327.984 248.817 289.559 1.00 137.32 ? 36  GLY N H      1 
ATOM   530    H  HA2    . GLY A  1  36  ? 329.006 248.325 291.374 1.00 72.67  ? 36  GLY N HA2    1 
ATOM   531    H  HA3    . GLY A  1  36  ? 328.833 249.833 291.787 1.00 72.67  ? 36  GLY N HA3    1 
ATOM   532    N  N      . LEU A  1  37  ? 326.406 247.797 292.218 1.00 116.08 ? 37  LEU N N      1 
ATOM   533    C  CA     . LEU A  1  37  ? 325.421 247.305 293.167 1.00 123.48 ? 37  LEU N CA     1 
ATOM   534    C  C      . LEU A  1  37  ? 325.298 245.800 293.024 1.00 128.92 ? 37  LEU N C      1 
ATOM   535    O  O      . LEU A  1  37  ? 325.589 245.230 291.972 1.00 118.63 ? 37  LEU N O      1 
ATOM   536    C  CB     . LEU A  1  37  ? 324.049 247.945 292.950 1.00 137.47 ? 37  LEU N CB     1 
ATOM   537    C  CG     . LEU A  1  37  ? 323.987 249.451 293.175 1.00 146.18 ? 37  LEU N CG     1 
ATOM   538    C  CD1    . LEU A  1  37  ? 322.691 249.985 292.601 1.00 169.14 ? 37  LEU N CD1    1 
ATOM   539    C  CD2    . LEU A  1  37  ? 324.114 249.770 294.660 1.00 131.82 ? 37  LEU N CD2    1 
ATOM   540    H  H      . LEU A  1  37  ? 326.295 247.494 291.421 1.00 113.87 ? 37  LEU N H      1 
ATOM   541    H  HA     . LEU A  1  37  ? 325.714 247.505 294.070 1.00 121.35 ? 37  LEU N HA     1 
ATOM   542    H  HB2    . LEU A  1  37  ? 323.772 247.775 292.036 1.00 136.22 ? 37  LEU N HB2    1 
ATOM   543    H  HB3    . LEU A  1  37  ? 323.418 247.533 293.562 1.00 136.22 ? 37  LEU N HB3    1 
ATOM   544    H  HG     . LEU A  1  37  ? 324.725 249.874 292.708 1.00 145.29 ? 37  LEU N HG     1 
ATOM   545    H  HD11   . LEU A  1  37  ? 322.655 250.944 292.745 1.00 169.13 ? 37  LEU N HD11   1 
ATOM   546    H  HD12   . LEU A  1  37  ? 322.664 249.792 291.651 1.00 169.13 ? 37  LEU N HD12   1 
ATOM   547    H  HD13   . LEU A  1  37  ? 321.947 249.554 293.048 1.00 169.13 ? 37  LEU N HD13   1 
ATOM   548    H  HD21   . LEU A  1  37  ? 324.072 250.732 294.780 1.00 130.55 ? 37  LEU N HD21   1 
ATOM   549    H  HD22   . LEU A  1  37  ? 323.384 249.345 295.137 1.00 130.55 ? 37  LEU N HD22   1 
ATOM   550    H  HD23   . LEU A  1  37  ? 324.963 249.432 294.984 1.00 130.55 ? 37  LEU N HD23   1 
ATOM   551    N  N      . THR A  1  38  ? 324.851 245.161 294.098 1.00 134.45 ? 38  THR N N      1 
ATOM   552    C  CA     . THR A  1  38  ? 324.635 243.725 294.083 1.00 131.33 ? 38  THR N CA     1 
ATOM   553    C  C      . THR A  1  38  ? 323.338 243.412 294.804 1.00 120.53 ? 38  THR N C      1 
ATOM   554    O  O      . THR A  1  38  ? 323.013 244.027 295.824 1.00 97.66  ? 38  THR N O      1 
ATOM   555    C  CB     . THR A  1  38  ? 325.798 242.963 294.730 1.00 134.61 ? 38  THR N CB     1 
ATOM   556    O  OG1    . THR A  1  38  ? 327.019 243.292 294.051 1.00 141.31 ? 38  THR N OG1    1 
ATOM   557    C  CG2    . THR A  1  38  ? 325.563 241.458 294.636 1.00 128.95 ? 38  THR N CG2    1 
ATOM   558    H  H      . THR A  1  38  ? 324.665 245.538 294.848 1.00 130.86 ? 38  THR N H      1 
ATOM   559    H  HA     . THR A  1  38  ? 324.551 243.425 293.165 1.00 127.41 ? 38  THR N HA     1 
ATOM   560    H  HB     . THR A  1  38  ? 325.869 243.208 295.666 1.00 129.71 ? 38  THR N HB     1 
ATOM   561    H  HG1    . THR A  1  38  ? 327.662 242.878 294.400 1.00 136.09 ? 38  THR N HG1    1 
ATOM   562    H  HG21   . THR A  1  38  ? 326.302 240.981 295.047 1.00 123.70 ? 38  THR N HG21   1 
ATOM   563    H  HG22   . THR A  1  38  ? 324.742 241.221 295.095 1.00 123.70 ? 38  THR N HG22   1 
ATOM   564    H  HG23   . THR A  1  38  ? 325.494 241.190 293.706 1.00 123.70 ? 38  THR N HG23   1 
ATOM   565    N  N      . SER A  1  39  ? 322.607 242.445 294.262 1.00 92.18  ? 39  SER N N      1 
ATOM   566    C  CA     . SER A  1  39  ? 321.288 242.099 294.763 1.00 89.10  ? 39  SER N CA     1 
ATOM   567    C  C      . SER A  1  39  ? 321.148 240.592 294.754 1.00 72.91  ? 39  SER N C      1 
ATOM   568    O  O      . SER A  1  39  ? 321.406 239.944 293.737 1.00 66.88  ? 39  SER N O      1 
ATOM   569    C  CB     . SER A  1  39  ? 320.185 242.725 293.909 1.00 100.14 ? 39  SER N CB     1 
ATOM   570    O  OG     . SER A  1  39  ? 320.474 244.081 293.623 1.00 108.52 ? 39  SER N OG     1 
ATOM   571    H  H      . SER A  1  39  ? 322.859 241.968 293.593 1.00 96.72  ? 39  SER N H      1 
ATOM   572    H  HA     . SER A  1  39  ? 321.192 242.415 295.675 1.00 94.01  ? 39  SER N HA     1 
ATOM   573    H  HB2    . SER A  1  39  ? 320.116 242.235 293.075 1.00 105.98 ? 39  SER N HB2    1 
ATOM   574    H  HB3    . SER A  1  39  ? 319.346 242.676 294.393 1.00 105.98 ? 39  SER N HB3    1 
ATOM   575    H  HG     . SER A  1  39  ? 319.861 244.413 293.154 1.00 114.71 ? 39  SER N HG     1 
ATOM   576    N  N      . VAL A  1  40  ? 320.744 240.050 295.890 1.00 56.85  ? 40  VAL N N      1 
ATOM   577    C  CA     . VAL A  1  40  ? 320.504 238.625 296.043 1.00 58.01  ? 40  VAL N CA     1 
ATOM   578    C  C      . VAL A  1  40  ? 319.004 238.423 296.135 1.00 55.70  ? 40  VAL N C      1 
ATOM   579    O  O      . VAL A  1  40  ? 318.266 239.289 296.613 1.00 54.56  ? 40  VAL N O      1 
ATOM   580    C  CB     . VAL A  1  40  ? 321.217 238.057 297.287 1.00 62.35  ? 40  VAL N CB     1 
ATOM   581    C  CG1    . VAL A  1  40  ? 321.018 236.550 297.384 1.00 63.95  ? 40  VAL N CG1    1 
ATOM   582    C  CG2    . VAL A  1  40  ? 322.701 238.410 297.254 1.00 64.88  ? 40  VAL N CG2    1 
ATOM   583    H  H      . VAL A  1  40  ? 320.597 240.500 296.608 1.00 65.54  ? 40  VAL N H      1 
ATOM   584    H  HA     . VAL A  1  40  ? 320.831 238.156 295.259 1.00 66.29  ? 40  VAL N HA     1 
ATOM   585    H  HB     . VAL A  1  40  ? 320.832 238.460 298.081 1.00 69.74  ? 40  VAL N HB     1 
ATOM   586    H  HG11   . VAL A  1  40  ? 321.476 236.222 298.173 1.00 70.88  ? 40  VAL N HG11   1 
ATOM   587    H  HG12   . VAL A  1  40  ? 320.069 236.360 297.449 1.00 70.88  ? 40  VAL N HG12   1 
ATOM   588    H  HG13   . VAL A  1  40  ? 321.386 236.132 296.590 1.00 70.88  ? 40  VAL N HG13   1 
ATOM   589    H  HG21   . VAL A  1  40  ? 323.130 238.044 298.043 1.00 71.68  ? 40  VAL N HG21   1 
ATOM   590    H  HG22   . VAL A  1  40  ? 323.098 238.029 296.454 1.00 71.68  ? 40  VAL N HG22   1 
ATOM   591    H  HG23   . VAL A  1  40  ? 322.795 239.375 297.243 1.00 71.68  ? 40  VAL N HG23   1 
ATOM   592    N  N      . ALA A  1  41  ? 318.552 237.273 295.667 1.00 58.11  ? 41  ALA N N      1 
ATOM   593    C  CA     . ALA A  1  41  ? 317.150 236.914 295.826 1.00 56.50  ? 41  ALA N CA     1 
ATOM   594    C  C      . ALA A  1  41  ? 317.087 235.412 296.036 1.00 58.68  ? 41  ALA N C      1 
ATOM   595    O  O      . ALA A  1  41  ? 317.541 234.645 295.182 1.00 58.86  ? 41  ALA N O      1 
ATOM   596    C  CB     . ALA A  1  41  ? 316.324 237.345 294.617 1.00 52.69  ? 41  ALA N CB     1 
ATOM   597    H  H      . ALA A  1  41  ? 319.028 236.686 295.258 1.00 64.04  ? 41  ALA N H      1 
ATOM   598    H  HA     . ALA A  1  41  ? 316.792 237.351 296.615 1.00 62.90  ? 41  ALA N HA     1 
ATOM   599    H  HB1    . ALA A  1  41  ? 315.399 237.090 294.759 1.00 59.93  ? 41  ALA N HB1    1 
ATOM   600    H  HB2    . ALA A  1  41  ? 316.390 238.308 294.516 1.00 59.93  ? 41  ALA N HB2    1 
ATOM   601    H  HB3    . ALA A  1  41  ? 316.671 236.905 293.825 1.00 59.93  ? 41  ALA N HB3    1 
ATOM   602    N  N      . VAL A  1  42  ? 316.547 235.003 297.178 1.00 66.30  ? 42  VAL N N      1 
ATOM   603    C  CA     . VAL A  1  42  ? 316.533 233.606 297.582 1.00 69.08  ? 42  VAL N CA     1 
ATOM   604    C  C      . VAL A  1  42  ? 315.089 233.176 297.760 1.00 67.88  ? 42  VAL N C      1 
ATOM   605    O  O      . VAL A  1  42  ? 314.258 233.931 298.274 1.00 66.58  ? 42  VAL N O      1 
ATOM   606    C  CB     . VAL A  1  42  ? 317.330 233.363 298.880 1.00 73.29  ? 42  VAL N CB     1 
ATOM   607    C  CG1    . VAL A  1  42  ? 317.393 231.870 299.177 1.00 76.52  ? 42  VAL N CG1    1 
ATOM   608    C  CG2    . VAL A  1  42  ? 318.738 233.940 298.777 1.00 75.35  ? 42  VAL N CG2    1 
ATOM   609    H  H      . VAL A  1  42  ? 316.174 235.529 297.748 1.00 66.23  ? 42  VAL N H      1 
ATOM   610    H  HA     . VAL A  1  42  ? 316.927 233.067 296.879 1.00 68.39  ? 42  VAL N HA     1 
ATOM   611    H  HB     . VAL A  1  42  ? 316.877 233.800 299.618 1.00 71.78  ? 42  VAL N HB     1 
ATOM   612    H  HG11   . VAL A  1  42  ? 317.896 231.733 299.995 1.00 74.32  ? 42  VAL N HG11   1 
ATOM   613    H  HG12   . VAL A  1  42  ? 316.490 231.532 299.283 1.00 74.32  ? 42  VAL N HG12   1 
ATOM   614    H  HG13   . VAL A  1  42  ? 317.831 231.420 298.439 1.00 74.32  ? 42  VAL N HG13   1 
ATOM   615    H  HG21   . VAL A  1  42  ? 319.210 233.770 299.608 1.00 73.42  ? 42  VAL N HG21   1 
ATOM   616    H  HG22   . VAL A  1  42  ? 319.201 233.513 298.040 1.00 73.42  ? 42  VAL N HG22   1 
ATOM   617    H  HG23   . VAL A  1  42  ? 318.676 234.895 298.621 1.00 73.42  ? 42  VAL N HG23   1 
ATOM   618    N  N      . ARG A  1  43  ? 314.803 231.956 297.341 1.00 80.57  ? 43  ARG N N      1 
ATOM   619    C  CA     . ARG A  1  43  ? 313.462 231.408 297.391 1.00 81.45  ? 43  ARG N CA     1 
ATOM   620    C  C      . ARG A  1  43  ? 313.329 230.441 298.552 1.00 107.81 ? 43  ARG N C      1 
ATOM   621    O  O      . ARG A  1  43  ? 314.274 229.718 298.884 1.00 125.19 ? 43  ARG N O      1 
ATOM   622    C  CB     . ARG A  1  43  ? 313.146 230.703 296.083 1.00 81.76  ? 43  ARG N CB     1 
ATOM   623    C  CG     . ARG A  1  43  ? 311.708 230.349 295.953 1.00 92.41  ? 43  ARG N CG     1 
ATOM   624    C  CD     . ARG A  1  43  ? 311.437 229.809 294.591 1.00 109.92 ? 43  ARG N CD     1 
ATOM   625    N  NE     . ARG A  1  43  ? 311.692 228.378 294.536 1.00 121.38 ? 43  ARG N NE     1 
ATOM   626    C  CZ     . ARG A  1  43  ? 311.689 227.670 293.413 1.00 109.65 ? 43  ARG N CZ     1 
ATOM   627    N  NH1    . ARG A  1  43  ? 311.449 228.268 292.252 1.00 105.29 ? 43  ARG N NH1    1 
ATOM   628    N  NH2    . ARG A  1  43  ? 311.927 226.367 293.452 1.00 102.04 ? 43  ARG N NH2    1 
ATOM   629    H  H      . ARG A  1  43  ? 315.384 231.412 297.014 1.00 68.70  ? 43  ARG N H      1 
ATOM   630    H  HA     . ARG A  1  43  ? 312.824 232.128 297.515 1.00 69.95  ? 43  ARG N HA     1 
ATOM   631    H  HB2    . ARG A  1  43  ? 313.379 231.287 295.344 1.00 70.47  ? 43  ARG N HB2    1 
ATOM   632    H  HB3    . ARG A  1  43  ? 313.662 229.883 296.033 1.00 70.47  ? 43  ARG N HB3    1 
ATOM   633    H  HG2    . ARG A  1  43  ? 311.481 229.668 296.606 1.00 81.64  ? 43  ARG N HG2    1 
ATOM   634    H  HG3    . ARG A  1  43  ? 311.165 231.142 296.085 1.00 81.64  ? 43  ARG N HG3    1 
ATOM   635    H  HD2    . ARG A  1  43  ? 310.506 229.962 294.363 1.00 99.38  ? 43  ARG N HD2    1 
ATOM   636    H  HD3    . ARG A  1  43  ? 312.017 230.248 293.949 1.00 99.38  ? 43  ARG N HD3    1 
ATOM   637    H  HE     . ARG A  1  43  ? 311.760 227.953 295.280 1.00 110.17 ? 43  ARG N HE     1 
ATOM   638    H  HH11   . ARG A  1  43  ? 311.294 229.113 292.228 1.00 94.66  ? 43  ARG N HH11   1 
ATOM   639    H  HH12   . ARG A  1  43  ? 311.448 227.810 291.525 1.00 94.66  ? 43  ARG N HH12   1 
ATOM   640    H  HH21   . ARG A  1  43  ? 312.084 225.981 294.204 1.00 90.14  ? 43  ARG N HH21   1 
ATOM   641    H  HH22   . ARG A  1  43  ? 311.928 225.908 292.725 1.00 90.14  ? 43  ARG N HH22   1 
ATOM   642    N  N      . GLY A  1  44  ? 312.145 230.427 299.167 1.00 144.01 ? 44  GLY N N      1 
ATOM   643    C  CA     . GLY A  1  44  ? 311.849 229.543 300.273 1.00 137.39 ? 44  GLY N CA     1 
ATOM   644    C  C      . GLY A  1  44  ? 310.667 228.637 299.970 1.00 120.54 ? 44  GLY N C      1 
ATOM   645    O  O      . GLY A  1  44  ? 310.100 228.657 298.876 1.00 119.53 ? 44  GLY N O      1 
ATOM   646    H  H      . GLY A  1  44  ? 311.487 230.936 298.949 1.00 129.96 ? 44  GLY N H      1 
ATOM   647    H  HA2    . GLY A  1  44  ? 312.623 228.990 300.463 1.00 122.82 ? 44  GLY N HA2    1 
ATOM   648    H  HA3    . GLY A  1  44  ? 311.643 230.068 301.062 1.00 122.82 ? 44  GLY N HA3    1 
ATOM   649    N  N      . LYS A  1  45  ? 310.322 227.841 300.962 1.00 113.03 ? 45  LYS N N      1 
ATOM   650    C  CA     . LYS A  1  45  ? 309.196 226.918 300.868 1.00 115.38 ? 45  LYS N CA     1 
ATOM   651    C  C      . LYS A  1  45  ? 307.878 227.591 301.214 1.00 120.58 ? 45  LYS N C      1 
ATOM   652    O  O      . LYS A  1  45  ? 306.826 226.943 301.158 1.00 138.51 ? 45  LYS N O      1 
ATOM   653    C  CB     . LYS A  1  45  ? 309.412 225.704 301.786 1.00 127.12 ? 45  LYS N CB     1 
ATOM   654    C  CG     . LYS A  1  45  ? 310.748 224.972 301.567 1.00 150.66 ? 45  LYS N CG     1 
ATOM   655    C  CD     . LYS A  1  45  ? 310.909 223.730 302.465 1.00 160.90 ? 45  LYS N CD     1 
ATOM   656    C  CE     . LYS A  1  45  ? 312.377 223.261 302.631 1.00 148.12 ? 45  LYS N CE     1 
ATOM   657    N  NZ     . LYS A  1  45  ? 313.115 222.855 301.388 1.00 127.88 ? 45  LYS N NZ     1 
ATOM   658    H  H      . LYS A  1  45  ? 310.730 227.813 301.719 1.00 103.22 ? 45  LYS N H      1 
ATOM   659    H  HA     . LYS A  1  45  ? 309.134 226.593 299.956 1.00 105.71 ? 45  LYS N HA     1 
ATOM   660    H  HB2    . LYS A  1  45  ? 309.389 226.004 302.709 1.00 116.60 ? 45  LYS N HB2    1 
ATOM   661    H  HB3    . LYS A  1  45  ? 308.698 225.066 301.631 1.00 116.60 ? 45  LYS N HB3    1 
ATOM   662    H  HG2    . LYS A  1  45  ? 310.800 224.683 300.643 1.00 139.29 ? 45  LYS N HG2    1 
ATOM   663    H  HG3    . LYS A  1  45  ? 311.477 225.581 301.766 1.00 139.29 ? 45  LYS N HG3    1 
ATOM   664    H  HD2    . LYS A  1  45  ? 310.562 223.935 303.347 1.00 148.65 ? 45  LYS N HD2    1 
ATOM   665    H  HD3    . LYS A  1  45  ? 310.406 222.997 302.076 1.00 148.65 ? 45  LYS N HD3    1 
ATOM   666    H  HE2    . LYS A  1  45  ? 312.880 223.985 303.036 1.00 134.93 ? 45  LYS N HE2    1 
ATOM   667    H  HE3    . LYS A  1  45  ? 312.383 222.496 303.228 1.00 134.93 ? 45  LYS N HE3    1 
ATOM   668    H  HZ1    . LYS A  1  45  ? 313.943 222.605 301.595 1.00 114.52 ? 45  LYS N HZ1    1 
ATOM   669    H  HZ2    . LYS A  1  45  ? 312.697 222.174 300.996 1.00 114.52 ? 45  LYS N HZ2    1 
ATOM   670    H  HZ3    . LYS A  1  45  ? 313.152 223.539 300.820 1.00 114.52 ? 45  LYS N HZ3    1 
ATOM   671    N  N      . ASP A  1  46  ? 307.919 228.877 301.562 1.00 120.29 ? 46  ASP N N      1 
ATOM   672    C  CA     . ASP A  1  46  ? 306.713 229.620 301.903 1.00 124.48 ? 46  ASP N CA     1 
ATOM   673    C  C      . ASP A  1  46  ? 306.893 231.108 301.642 1.00 116.11 ? 46  ASP N C      1 
ATOM   674    O  O      . ASP A  1  46  ? 306.012 231.891 302.018 1.00 115.26 ? 46  ASP N O      1 
ATOM   675    C  CB     . ASP A  1  46  ? 306.353 229.421 303.370 1.00 147.57 ? 46  ASP N CB     1 
ATOM   676    C  CG     . ASP A  1  46  ? 307.399 230.001 304.300 1.00 174.68 ? 46  ASP N CG     1 
ATOM   677    O  OD1    . ASP A  1  46  ? 307.216 231.149 304.763 1.00 179.48 ? 46  ASP N OD1    1 
ATOM   678    O  OD2    . ASP A  1  46  ? 308.414 229.317 304.552 1.00 193.09 ? 46  ASP N OD2    1 
ATOM   679    H  H      . ASP A  1  46  ? 308.641 229.342 301.608 1.00 109.54 ? 46  ASP N H      1 
ATOM   680    H  HA     . ASP A  1  46  ? 305.975 229.302 301.361 1.00 114.42 ? 46  ASP N HA     1 
ATOM   681    H  HB2    . ASP A  1  46  ? 305.508 229.863 303.552 1.00 137.17 ? 46  ASP N HB2    1 
ATOM   682    H  HB3    . ASP A  1  46  ? 306.279 228.472 303.553 1.00 137.17 ? 46  ASP N HB3    1 
ATOM   683    N  N      . CYS A  1  47  ? 308.001 231.526 301.041 1.00 86.74  ? 47  CYS N N      1 
ATOM   684    C  CA     . CYS A  1  47  ? 308.254 232.936 300.803 1.00 87.56  ? 47  CYS N CA     1 
ATOM   685    C  C      . CYS A  1  47  ? 309.406 233.055 299.819 1.00 82.66  ? 47  CYS N C      1 
ATOM   686    O  O      . CYS A  1  47  ? 310.130 232.095 299.548 1.00 84.21  ? 47  CYS N O      1 
ATOM   687    C  CB     . CYS A  1  47  ? 308.575 233.682 302.100 1.00 115.35 ? 47  CYS N CB     1 
ATOM   688    S  SG     . CYS A  1  47  ? 310.176 233.245 302.814 1.00 131.58 ? 47  CYS N SG     1 
ATOM   689    H  H      . CYS A  1  47  ? 308.626 231.006 300.761 1.00 83.26  ? 47  CYS N H      1 
ATOM   690    H  HA     . CYS A  1  47  ? 307.468 233.341 300.404 1.00 84.56  ? 47  CYS N HA     1 
ATOM   691    H  HB2    . CYS A  1  47  ? 308.580 234.635 301.919 1.00 112.11 ? 47  CYS N HB2    1 
ATOM   692    H  HB3    . CYS A  1  47  ? 307.891 233.476 302.756 1.00 112.11 ? 47  CYS N HB3    1 
ATOM   693    H  HG     . CYS A  1  47  ? 310.339 233.876 303.821 1.00 127.31 ? 47  CYS N HG     1 
ATOM   694    N  N      . ALA A  1  48  ? 309.558 234.261 299.294 1.00 59.61  ? 48  ALA N N      1 
ATOM   695    C  CA     . ALA A  1  48  ? 310.654 234.634 298.423 1.00 58.44  ? 48  ALA N CA     1 
ATOM   696    C  C      . ALA A  1  48  ? 311.189 235.958 298.934 1.00 58.33  ? 48  ALA N C      1 
ATOM   697    O  O      . ALA A  1  48  ? 310.452 236.756 299.517 1.00 57.76  ? 48  ALA N O      1 
ATOM   698    C  CB     . ALA A  1  48  ? 310.204 234.757 296.965 1.00 55.11  ? 48  ALA N CB     1 
ATOM   699    H  H      . ALA A  1  48  ? 309.011 234.909 299.437 1.00 64.95  ? 48  ALA N H      1 
ATOM   700    H  HA     . ALA A  1  48  ? 311.358 233.969 298.478 1.00 63.68  ? 48  ALA N HA     1 
ATOM   701    H  HB1    . ALA A  1  48  ? 310.966 235.007 296.420 1.00 60.96  ? 48  ALA N HB1    1 
ATOM   702    H  HB2    . ALA A  1  48  ? 309.852 233.902 296.671 1.00 60.96  ? 48  ALA N HB2    1 
ATOM   703    H  HB3    . ALA A  1  48  ? 309.515 235.437 296.904 1.00 60.96  ? 48  ALA N HB3    1 
ATOM   704    N  N      . VAL A  1  49  ? 312.476 236.193 298.735 1.00 58.31  ? 49  VAL N N      1 
ATOM   705    C  CA     . VAL A  1  49  ? 313.116 237.324 299.382 1.00 59.13  ? 49  VAL N CA     1 
ATOM   706    C  C      . VAL A  1  49  ? 314.012 238.052 298.397 1.00 57.45  ? 49  VAL N C      1 
ATOM   707    O  O      . VAL A  1  49  ? 314.514 237.482 297.425 1.00 56.78  ? 49  VAL N O      1 
ATOM   708    C  CB     . VAL A  1  49  ? 313.911 236.873 300.624 1.00 63.27  ? 49  VAL N CB     1 
ATOM   709    C  CG1    . VAL A  1  49  ? 314.368 238.079 301.428 1.00 64.43  ? 49  VAL N CG1    1 
ATOM   710    C  CG2    . VAL A  1  49  ? 313.048 235.963 301.483 1.00 77.78  ? 49  VAL N CG2    1 
ATOM   711    H  H      . VAL A  1  49  ? 312.994 235.720 298.238 1.00 64.16  ? 49  VAL N H      1 
ATOM   712    H  HA     . VAL A  1  49  ? 312.432 237.945 299.677 1.00 64.90  ? 49  VAL N HA     1 
ATOM   713    H  HB     . VAL A  1  49  ? 314.695 236.376 300.342 1.00 68.19  ? 49  VAL N HB     1 
ATOM   714    H  HG11   . VAL A  1  49  ? 314.865 237.771 302.202 1.00 69.32  ? 49  VAL N HG11   1 
ATOM   715    H  HG12   . VAL A  1  49  ? 314.935 238.633 300.869 1.00 69.32  ? 49  VAL N HG12   1 
ATOM   716    H  HG13   . VAL A  1  49  ? 313.589 238.582 301.712 1.00 69.32  ? 49  VAL N HG13   1 
ATOM   717    H  HG21   . VAL A  1  49  ? 313.558 235.686 302.260 1.00 82.52  ? 49  VAL N HG21   1 
ATOM   718    H  HG22   . VAL A  1  49  ? 312.257 236.451 301.763 1.00 82.52  ? 49  VAL N HG22   1 
ATOM   719    H  HG23   . VAL A  1  49  ? 312.791 235.187 300.962 1.00 82.52  ? 49  VAL N HG23   1 
ATOM   720    N  N      . ILE A  1  50  ? 314.186 239.337 298.659 1.00 56.93  ? 50  ILE N N      1 
ATOM   721    C  CA     . ILE A  1  50  ? 315.173 240.171 297.997 1.00 56.20  ? 50  ILE N CA     1 
ATOM   722    C  C      . ILE A  1  50  ? 315.946 240.908 299.078 1.00 58.90  ? 50  ILE N C      1 
ATOM   723    O  O      . ILE A  1  50  ? 315.402 241.259 300.129 1.00 80.17  ? 50  ILE N O      1 
ATOM   724    C  CB     . ILE A  1  50  ? 314.520 241.177 297.035 1.00 52.76  ? 50  ILE N CB     1 
ATOM   725    C  CG1    . ILE A  1  50  ? 313.788 240.449 295.914 1.00 50.32  ? 50  ILE N CG1    1 
ATOM   726    C  CG2    . ILE A  1  50  ? 315.570 242.117 296.469 1.00 52.53  ? 50  ILE N CG2    1 
ATOM   727    C  CD1    . ILE A  1  50  ? 312.881 241.362 295.128 1.00 47.28  ? 50  ILE N CD1    1 
ATOM   728    H  H      . ILE A  1  50  ? 313.723 239.766 299.243 1.00 63.14  ? 50  ILE N H      1 
ATOM   729    H  HA     . ILE A  1  50  ? 315.790 239.614 297.496 1.00 62.43  ? 50  ILE N HA     1 
ATOM   730    H  HB     . ILE A  1  50  ? 313.875 241.703 297.532 1.00 59.84  ? 50  ILE N HB     1 
ATOM   731    H  HG12   . ILE A  1  50  ? 314.440 240.074 295.301 1.00 57.78  ? 50  ILE N HG12   1 
ATOM   732    H  HG13   . ILE A  1  50  ? 313.245 239.742 296.296 1.00 57.78  ? 50  ILE N HG13   1 
ATOM   733    H  HG21   . ILE A  1  50  ? 315.140 242.743 295.865 1.00 59.60  ? 50  ILE N HG21   1 
ATOM   734    H  HG22   . ILE A  1  50  ? 315.991 242.596 297.199 1.00 59.60  ? 50  ILE N HG22   1 
ATOM   735    H  HG23   . ILE A  1  50  ? 316.233 241.596 295.989 1.00 59.60  ? 50  ILE N HG23   1 
ATOM   736    H  HD11   . ILE A  1  50  ? 312.443 240.848 294.432 1.00 55.59  ? 50  ILE N HD11   1 
ATOM   737    H  HD12   . ILE A  1  50  ? 312.219 241.740 295.728 1.00 55.59  ? 50  ILE N HD12   1 
ATOM   738    H  HD13   . ILE A  1  50  ? 313.413 242.071 294.733 1.00 55.59  ? 50  ILE N HD13   1 
ATOM   739    N  N      . VAL A  1  51  ? 317.220 241.154 298.816 1.00 60.80  ? 51  VAL N N      1 
ATOM   740    C  CA     . VAL A  1  51  ? 318.024 242.005 299.677 1.00 63.36  ? 51  VAL N CA     1 
ATOM   741    C  C      . VAL A  1  51  ? 318.995 242.766 298.788 1.00 70.76  ? 51  VAL N C      1 
ATOM   742    O  O      . VAL A  1  51  ? 319.616 242.181 297.894 1.00 62.10  ? 51  VAL N O      1 
ATOM   743    C  CB     . VAL A  1  51  ? 318.757 241.188 300.763 1.00 88.49  ? 51  VAL N CB     1 
ATOM   744    C  CG1    . VAL A  1  51  ? 319.735 240.197 300.143 1.00 83.65  ? 51  VAL N CG1    1 
ATOM   745    C  CG2    . VAL A  1  51  ? 319.458 242.109 301.759 1.00 95.89  ? 51  VAL N CG2    1 
ATOM   746    H  H      . VAL A  1  51  ? 317.646 240.837 298.140 1.00 65.55  ? 51  VAL N H      1 
ATOM   747    H  HA     . VAL A  1  51  ? 317.448 242.648 300.118 1.00 67.76  ? 51  VAL N HA     1 
ATOM   748    H  HB     . VAL A  1  51  ? 318.098 240.675 301.256 1.00 91.98  ? 51  VAL N HB     1 
ATOM   749    H  HG11   . VAL A  1  51  ? 320.176 239.704 300.853 1.00 86.55  ? 51  VAL N HG11   1 
ATOM   750    H  HG12   . VAL A  1  51  ? 319.246 239.587 299.570 1.00 86.55  ? 51  VAL N HG12   1 
ATOM   751    H  HG13   . VAL A  1  51  ? 320.392 240.685 299.623 1.00 86.55  ? 51  VAL N HG13   1 
ATOM   752    H  HG21   . VAL A  1  51  ? 319.908 241.567 302.426 1.00 99.03  ? 51  VAL N HG21   1 
ATOM   753    H  HG22   . VAL A  1  51  ? 320.105 242.653 301.283 1.00 99.03  ? 51  VAL N HG22   1 
ATOM   754    H  HG23   . VAL A  1  51  ? 318.796 242.676 302.184 1.00 99.03  ? 51  VAL N HG23   1 
ATOM   755    N  N      . THR A  1  52  ? 319.106 244.071 299.016 1.00 90.35  ? 52  THR N N      1 
ATOM   756    C  CA     . THR A  1  52  ? 319.842 244.956 298.129 1.00 102.23 ? 52  THR N CA     1 
ATOM   757    C  C      . THR A  1  52  ? 320.776 245.836 298.939 1.00 104.87 ? 52  THR N C      1 
ATOM   758    O  O      . THR A  1  52  ? 320.571 246.067 300.132 1.00 119.10 ? 52  THR N O      1 
ATOM   759    C  CB     . THR A  1  52  ? 318.895 245.852 297.321 1.00 114.42 ? 52  THR N CB     1 
ATOM   760    O  OG1    . THR A  1  52  ? 317.776 245.082 296.866 1.00 135.96 ? 52  THR N OG1    1 
ATOM   761    C  CG2    . THR A  1  52  ? 319.615 246.460 296.121 1.00 106.33 ? 52  THR N CG2    1 
ATOM   762    H  H      . THR A  1  52  ? 318.757 244.472 299.692 1.00 84.51  ? 52  THR N H      1 
ATOM   763    H  HA     . THR A  1  52  ? 320.372 244.430 297.511 1.00 96.57  ? 52  THR N HA     1 
ATOM   764    H  HB     . THR A  1  52  ? 318.579 246.575 297.884 1.00 109.67 ? 52  THR N HB     1 
ATOM   765    H  HG1    . THR A  1  52  ? 317.254 245.568 296.423 1.00 131.61 ? 52  THR N HG1    1 
ATOM   766    H  HG21   . THR A  1  52  ? 319.005 247.023 295.619 1.00 101.76 ? 52  THR N HG21   1 
ATOM   767    H  HG22   . THR A  1  52  ? 320.365 246.996 296.422 1.00 101.76 ? 52  THR N HG22   1 
ATOM   768    H  HG23   . THR A  1  52  ? 319.944 245.755 295.541 1.00 101.76 ? 52  THR N HG23   1 
ATOM   769    N  N      . GLN A  1  53  ? 321.804 246.333 298.267 1.00 107.89 ? 53  GLN N N      1 
ATOM   770    C  CA     . GLN A  1  53  ? 322.636 247.383 298.828 1.00 111.91 ? 53  GLN N CA     1 
ATOM   771    C  C      . GLN A  1  53  ? 321.996 248.745 298.598 1.00 104.33 ? 53  GLN N C      1 
ATOM   772    O  O      . GLN A  1  53  ? 321.559 249.060 297.487 1.00 97.16  ? 53  GLN N O      1 
ATOM   773    C  CB     . GLN A  1  53  ? 324.021 247.356 298.201 1.00 118.77 ? 53  GLN N CB     1 
ATOM   774    C  CG     . GLN A  1  53  ? 324.789 246.112 298.495 1.00 127.85 ? 53  GLN N CG     1 
ATOM   775    C  CD     . GLN A  1  53  ? 326.232 246.272 298.118 1.00 144.10 ? 53  GLN N CD     1 
ATOM   776    O  OE1    . GLN A  1  53  ? 327.070 246.596 298.958 1.00 165.52 ? 53  GLN N OE1    1 
ATOM   777    N  NE2    . GLN A  1  53  ? 326.532 246.080 296.839 1.00 140.09 ? 53  GLN N NE2    1 
ATOM   778    H  H      . GLN A  1  53  ? 322.041 246.078 297.480 1.00 106.49 ? 53  GLN N H      1 
ATOM   779    H  HA     . GLN A  1  53  ? 322.729 247.245 299.783 1.00 110.24 ? 53  GLN N HA     1 
ATOM   780    H  HB2    . GLN A  1  53  ? 323.929 247.427 297.238 1.00 116.63 ? 53  GLN N HB2    1 
ATOM   781    H  HB3    . GLN A  1  53  ? 324.532 248.108 298.539 1.00 116.63 ? 53  GLN N HB3    1 
ATOM   782    H  HG2    . GLN A  1  53  ? 324.740 245.921 299.445 1.00 124.90 ? 53  GLN N HG2    1 
ATOM   783    H  HG3    . GLN A  1  53  ? 324.418 245.376 297.983 1.00 124.90 ? 53  GLN N HG3    1 
ATOM   784    H  HE21   . GLN A  1  53  ? 325.912 245.875 296.279 1.00 136.77 ? 53  GLN N HE21   1 
ATOM   785    H  HE22   . GLN A  1  53  ? 327.345 246.159 296.571 1.00 136.77 ? 53  GLN N HE22   1 
ATOM   786    N  N      . LYS A  1  54  ? 321.945 249.545 299.653 1.00 114.78 ? 54  LYS N N      1 
ATOM   787    C  CA     . LYS A  1  54  ? 321.509 250.932 299.591 1.00 116.06 ? 54  LYS N CA     1 
ATOM   788    C  C      . LYS A  1  54  ? 322.736 251.796 299.841 1.00 132.44 ? 54  LYS N C      1 
ATOM   789    O  O      . LYS A  1  54  ? 323.374 251.680 300.892 1.00 144.34 ? 54  LYS N O      1 
ATOM   790    C  CB     . LYS A  1  54  ? 320.415 251.197 300.629 1.00 122.22 ? 54  LYS N CB     1 
ATOM   791    C  CG     . LYS A  1  54  ? 319.711 252.545 300.517 1.00 130.56 ? 54  LYS N CG     1 
ATOM   792    C  CD     . LYS A  1  54  ? 318.986 252.902 301.818 1.00 139.83 ? 54  LYS N CD     1 
ATOM   793    C  CE     . LYS A  1  54  ? 317.729 252.062 302.042 1.00 141.71 ? 54  LYS N CE     1 
ATOM   794    N  NZ     . LYS A  1  54  ? 317.060 252.364 303.347 1.00 140.67 ? 54  LYS N NZ     1 
ATOM   795    H  H      . LYS A  1  54  ? 322.167 249.297 300.446 1.00 107.46 ? 54  LYS N H      1 
ATOM   796    H  HA     . LYS A  1  54  ? 321.160 251.129 298.708 1.00 109.30 ? 54  LYS N HA     1 
ATOM   797    H  HB2    . LYS A  1  54  ? 319.737 250.509 300.543 1.00 115.69 ? 54  LYS N HB2    1 
ATOM   798    H  HB3    . LYS A  1  54  ? 320.813 251.150 301.512 1.00 115.69 ? 54  LYS N HB3    1 
ATOM   799    H  HG2    . LYS A  1  54  ? 320.368 253.235 300.334 1.00 124.68 ? 54  LYS N HG2    1 
ATOM   800    H  HG3    . LYS A  1  54  ? 319.056 252.506 299.803 1.00 124.68 ? 54  LYS N HG3    1 
ATOM   801    H  HD2    . LYS A  1  54  ? 319.585 252.751 302.566 1.00 133.93 ? 54  LYS N HD2    1 
ATOM   802    H  HD3    . LYS A  1  54  ? 318.722 253.835 301.787 1.00 133.93 ? 54  LYS N HD3    1 
ATOM   803    H  HE2    . LYS A  1  54  ? 317.095 252.244 301.331 1.00 136.11 ? 54  LYS N HE2    1 
ATOM   804    H  HE3    . LYS A  1  54  ? 317.971 251.123 302.039 1.00 136.11 ? 54  LYS N HE3    1 
ATOM   805    H  HZ1    . LYS A  1  54  ? 316.334 251.857 303.441 1.00 135.00 ? 54  LYS N HZ1    1 
ATOM   806    H  HZ2    . LYS A  1  54  ? 317.618 252.199 304.020 1.00 135.00 ? 54  LYS N HZ2    1 
ATOM   807    H  HZ3    . LYS A  1  54  ? 316.819 253.221 303.374 1.00 135.00 ? 54  LYS N HZ3    1 
ATOM   808    N  N      . LYS A  1  55  ? 323.082 252.640 298.872 1.00 112.67 ? 55  LYS N N      1 
ATOM   809    C  CA     . LYS A  1  55  ? 324.268 253.490 298.961 1.00 111.22 ? 55  LYS N CA     1 
ATOM   810    C  C      . LYS A  1  55  ? 323.867 254.939 298.746 1.00 104.86 ? 55  LYS N C      1 
ATOM   811    O  O      . LYS A  1  55  ? 323.504 255.330 297.632 1.00 97.11  ? 55  LYS N O      1 
ATOM   812    C  CB     . LYS A  1  55  ? 325.315 253.088 297.934 1.00 108.32 ? 55  LYS N CB     1 
ATOM   813    C  CG     . LYS A  1  55  ? 325.753 251.662 298.027 1.00 120.29 ? 55  LYS N CG     1 
ATOM   814    C  CD     . LYS A  1  55  ? 326.911 251.436 297.089 1.00 141.63 ? 55  LYS N CD     1 
ATOM   815    C  CE     . LYS A  1  55  ? 327.547 250.085 297.310 1.00 155.60 ? 55  LYS N CE     1 
ATOM   816    N  NZ     . LYS A  1  55  ? 328.765 249.906 296.472 1.00 159.90 ? 55  LYS N NZ     1 
ATOM   817    H  H      . LYS A  1  55  ? 322.640 252.741 298.141 1.00 111.94 ? 55  LYS N H      1 
ATOM   818    H  HA     . LYS A  1  55  ? 324.658 253.408 299.846 1.00 110.10 ? 55  LYS N HA     1 
ATOM   819    H  HB2    . LYS A  1  55  ? 324.949 253.226 297.046 1.00 106.94 ? 55  LYS N HB2    1 
ATOM   820    H  HB3    . LYS A  1  55  ? 326.100 253.645 298.055 1.00 106.94 ? 55  LYS N HB3    1 
ATOM   821    H  HG2    . LYS A  1  55  ? 326.043 251.467 298.932 1.00 118.34 ? 55  LYS N HG2    1 
ATOM   822    H  HG3    . LYS A  1  55  ? 325.024 251.078 297.767 1.00 118.34 ? 55  LYS N HG3    1 
ATOM   823    H  HD2    . LYS A  1  55  ? 326.593 251.477 296.174 1.00 139.35 ? 55  LYS N HD2    1 
ATOM   824    H  HD3    . LYS A  1  55  ? 327.584 252.118 297.242 1.00 139.35 ? 55  LYS N HD3    1 
ATOM   825    H  HE2    . LYS A  1  55  ? 327.805 250.001 298.241 1.00 152.60 ? 55  LYS N HE2    1 
ATOM   826    H  HE3    . LYS A  1  55  ? 326.912 249.391 297.074 1.00 152.60 ? 55  LYS N HE3    1 
ATOM   827    H  HZ1    . LYS A  1  55  ? 328.554 249.975 295.610 1.00 156.50 ? 55  LYS N HZ1    1 
ATOM   828    H  HZ2    . LYS A  1  55  ? 329.218 250.671 296.427 1.00 156.50 ? 55  LYS N HZ2    1 
ATOM   829    H  HZ3    . LYS A  1  55  ? 329.120 249.104 296.620 1.00 156.50 ? 55  LYS N HZ3    1 
ATOM   830    N  N      . VAL A  1  56  ? 323.950 255.738 299.800 1.00 129.84 ? 56  VAL N N      1 
ATOM   831    C  CA     . VAL A  1  56  ? 323.728 257.174 299.673 1.00 138.32 ? 56  VAL N CA     1 
ATOM   832    C  C      . VAL A  1  56  ? 325.083 257.855 299.818 1.00 159.77 ? 56  VAL N C      1 
ATOM   833    O  O      . VAL A  1  56  ? 325.608 257.972 300.935 1.00 172.16 ? 56  VAL N O      1 
ATOM   834    C  CB     . VAL A  1  56  ? 322.703 257.689 300.691 1.00 130.63 ? 56  VAL N CB     1 
ATOM   835    C  CG1    . VAL A  1  56  ? 321.310 257.241 300.283 1.00 121.42 ? 56  VAL N CG1    1 
ATOM   836    C  CG2    . VAL A  1  56  ? 323.031 257.215 302.104 1.00 131.46 ? 56  VAL N CG2    1 
ATOM   837    H  H      . VAL A  1  56  ? 324.132 255.476 300.599 1.00 119.89 ? 56  VAL N H      1 
ATOM   838    H  HA     . VAL A  1  56  ? 323.390 257.365 298.784 1.00 128.79 ? 56  VAL N HA     1 
ATOM   839    H  HB     . VAL A  1  56  ? 322.718 258.659 300.690 1.00 121.33 ? 56  VAL N HB     1 
ATOM   840    H  HG11   . VAL A  1  56  ? 320.670 257.571 300.933 1.00 112.79 ? 56  VAL N HG11   1 
ATOM   841    H  HG12   . VAL A  1  56  ? 321.107 257.601 299.406 1.00 112.79 ? 56  VAL N HG12   1 
ATOM   842    H  HG13   . VAL A  1  56  ? 321.285 256.272 300.258 1.00 112.79 ? 56  VAL N HG13   1 
ATOM   843    H  HG21   . VAL A  1  56  ? 322.363 257.561 302.716 1.00 121.47 ? 56  VAL N HG21   1 
ATOM   844    H  HG22   . VAL A  1  56  ? 323.026 256.246 302.120 1.00 121.47 ? 56  VAL N HG22   1 
ATOM   845    H  HG23   . VAL A  1  56  ? 323.909 257.546 302.351 1.00 121.47 ? 56  VAL N HG23   1 
ATOM   846    N  N      . PRO A  1  57  ? 325.703 258.275 298.717 1.00 148.60 ? 57  PRO N N      1 
ATOM   847    C  CA     . PRO A  1  57  ? 326.987 258.981 298.827 1.00 161.48 ? 57  PRO N CA     1 
ATOM   848    C  C      . PRO A  1  57  ? 326.952 260.182 299.761 1.00 165.03 ? 57  PRO N C      1 
ATOM   849    O  O      . PRO A  1  57  ? 327.906 260.389 300.523 1.00 165.48 ? 57  PRO N O      1 
ATOM   850    C  CB     . PRO A  1  57  ? 327.265 259.380 297.372 1.00 140.42 ? 57  PRO N CB     1 
ATOM   851    C  CG     . PRO A  1  57  ? 326.623 258.284 296.575 1.00 116.96 ? 57  PRO N CG     1 
ATOM   852    C  CD     . PRO A  1  57  ? 325.383 257.915 297.325 1.00 122.93 ? 57  PRO N CD     1 
ATOM   853    H  HA     . PRO A  1  57  ? 327.678 258.369 299.125 1.00 132.89 ? 57  PRO N HA     1 
ATOM   854    H  HB2    . PRO A  1  57  ? 326.854 260.237 297.179 1.00 112.23 ? 57  PRO N HB2    1 
ATOM   855    H  HB3    . PRO A  1  57  ? 328.222 259.409 297.215 1.00 112.23 ? 57  PRO N HB3    1 
ATOM   856    H  HG2    . PRO A  1  57  ? 326.402 258.613 295.690 1.00 89.12  ? 57  PRO N HG2    1 
ATOM   857    H  HG3    . PRO A  1  57  ? 327.226 257.527 296.518 1.00 89.12  ? 57  PRO N HG3    1 
ATOM   858    H  HD2    . PRO A  1  57  ? 324.628 258.435 297.007 1.00 95.36  ? 57  PRO N HD2    1 
ATOM   859    H  HD3    . PRO A  1  57  ? 325.215 256.963 297.253 1.00 95.36  ? 57  PRO N HD3    1 
ATOM   860    N  N      . ASP A  1  58  ? 325.881 260.972 299.736 1.00 196.92 ? 58  ASP N N      1 
ATOM   861    C  CA     . ASP A  1  58  ? 325.774 262.177 300.548 1.00 192.16 ? 58  ASP N CA     1 
ATOM   862    C  C      . ASP A  1  58  ? 324.770 261.980 301.673 1.00 172.24 ? 58  ASP N C      1 
ATOM   863    O  O      . ASP A  1  58  ? 324.065 260.972 301.749 1.00 157.44 ? 58  ASP N O      1 
ATOM   864    C  CB     . ASP A  1  58  ? 325.338 263.382 299.706 1.00 206.44 ? 58  ASP N CB     1 
ATOM   865    C  CG     . ASP A  1  58  ? 326.282 263.675 298.563 1.00 201.06 ? 58  ASP N CG     1 
ATOM   866    O  OD1    . ASP A  1  58  ? 326.011 263.216 297.434 1.00 186.83 ? 58  ASP N OD1    1 
ATOM   867    O  OD2    . ASP A  1  58  ? 327.288 264.377 298.791 1.00 205.78 ? 58  ASP N OD2    1 
ATOM   868    H  H      . ASP A  1  58  ? 325.190 260.826 299.246 1.00 189.65 ? 58  ASP N H      1 
ATOM   869    H  HA     . ASP A  1  58  ? 326.638 262.377 300.942 1.00 184.86 ? 58  ASP N HA     1 
ATOM   870    H  HB2    . ASP A  1  58  ? 324.461 263.204 299.331 1.00 199.78 ? 58  ASP N HB2    1 
ATOM   871    H  HB3    . ASP A  1  58  ? 325.302 264.167 300.273 1.00 199.78 ? 58  ASP N HB3    1 
ATOM   872    N  N      . LYS A  1  59  ? 324.718 262.977 302.554 1.00 177.92 ? 59  LYS N N      1 
ATOM   873    C  CA     . LYS A  1  59  ? 323.581 263.165 303.441 1.00 170.57 ? 59  LYS N CA     1 
ATOM   874    C  C      . LYS A  1  59  ? 322.575 264.156 302.873 1.00 165.64 ? 59  LYS N C      1 
ATOM   875    O  O      . LYS A  1  59  ? 321.484 264.300 303.434 1.00 157.13 ? 59  LYS N O      1 
ATOM   876    C  CB     . LYS A  1  59  ? 324.054 263.634 304.824 1.00 156.99 ? 59  LYS N CB     1 
ATOM   877    C  CG     . LYS A  1  59  ? 324.732 264.999 304.836 1.00 153.30 ? 59  LYS N CG     1 
ATOM   878    C  CD     . LYS A  1  59  ? 324.761 265.601 306.238 1.00 158.16 ? 59  LYS N CD     1 
ATOM   879    C  CE     . LYS A  1  59  ? 325.025 267.102 306.197 1.00 167.03 ? 59  LYS N CE     1 
ATOM   880    N  NZ     . LYS A  1  59  ? 325.059 267.725 307.551 1.00 178.00 ? 59  LYS N NZ     1 
ATOM   881    H  H      . LYS A  1  59  ? 325.339 263.563 302.656 1.00 142.29 ? 59  LYS N H      1 
ATOM   882    H  HA     . LYS A  1  59  ? 323.129 262.314 303.554 1.00 135.18 ? 59  LYS N HA     1 
ATOM   883    H  HB2    . LYS A  1  59  ? 323.285 263.683 305.413 1.00 120.91 ? 59  LYS N HB2    1 
ATOM   884    H  HB3    . LYS A  1  59  ? 324.689 262.987 305.169 1.00 120.91 ? 59  LYS N HB3    1 
ATOM   885    H  HG2    . LYS A  1  59  ? 325.647 264.904 304.528 1.00 116.88 ? 59  LYS N HG2    1 
ATOM   886    H  HG3    . LYS A  1  59  ? 324.244 265.604 304.256 1.00 116.88 ? 59  LYS N HG3    1 
ATOM   887    H  HD2    . LYS A  1  59  ? 323.903 265.455 306.667 1.00 121.17 ? 59  LYS N HD2    1 
ATOM   888    H  HD3    . LYS A  1  59  ? 325.469 265.182 306.752 1.00 121.17 ? 59  LYS N HD3    1 
ATOM   889    H  HE2    . LYS A  1  59  ? 325.883 267.259 305.774 1.00 129.91 ? 59  LYS N HE2    1 
ATOM   890    H  HE3    . LYS A  1  59  ? 324.320 267.532 305.688 1.00 129.91 ? 59  LYS N HE3    1 
ATOM   891    H  HZ1    . LYS A  1  59  ? 325.215 268.599 307.480 1.00 140.32 ? 59  LYS N HZ1    1 
ATOM   892    H  HZ2    . LYS A  1  59  ? 324.278 267.604 307.962 1.00 140.32 ? 59  LYS N HZ2    1 
ATOM   893    H  HZ3    . LYS A  1  59  ? 325.704 267.355 308.041 1.00 140.32 ? 59  LYS N HZ3    1 
ATOM   894    N  N      . LEU A  1  60  ? 322.923 264.842 301.781 1.00 155.59 ? 60  LEU N N      1 
ATOM   895    C  CA     . LEU A  1  60  ? 321.962 265.675 301.064 1.00 145.12 ? 60  LEU N CA     1 
ATOM   896    C  C      . LEU A  1  60  ? 320.940 264.807 300.341 1.00 138.59 ? 60  LEU N C      1 
ATOM   897    O  O      . LEU A  1  60  ? 319.725 264.960 300.523 1.00 134.29 ? 60  LEU N O      1 
ATOM   898    C  CB     . LEU A  1  60  ? 322.701 266.571 300.066 1.00 140.15 ? 60  LEU N CB     1 
ATOM   899    C  CG     . LEU A  1  60  ? 323.864 267.396 300.616 1.00 137.52 ? 60  LEU N CG     1 
ATOM   900    C  CD1    . LEU A  1  60  ? 324.575 268.129 299.485 1.00 137.70 ? 60  LEU N CD1    1 
ATOM   901    C  CD2    . LEU A  1  60  ? 323.362 268.364 301.675 1.00 141.05 ? 60  LEU N CD2    1 
ATOM   902    H  H      . LEU A  1  60  ? 323.711 264.840 301.437 1.00 136.56 ? 60  LEU N H      1 
ATOM   903    H  HA     . LEU A  1  60  ? 321.491 266.241 301.696 1.00 126.74 ? 60  LEU N HA     1 
ATOM   904    H  HB2    . LEU A  1  60  ? 323.058 266.009 299.361 1.00 121.77 ? 60  LEU N HB2    1 
ATOM   905    H  HB3    . LEU A  1  60  ? 322.062 267.194 299.687 1.00 121.77 ? 60  LEU N HB3    1 
ATOM   906    H  HG     . LEU A  1  60  ? 324.503 266.800 301.036 1.00 118.42 ? 60  LEU N HG     1 
ATOM   907    H  HD11   . LEU A  1  60  ? 325.307 268.645 299.855 1.00 118.66 ? 60  LEU N HD11   1 
ATOM   908    H  HD12   . LEU A  1  60  ? 324.915 267.477 298.853 1.00 118.66 ? 60  LEU N HD12   1 
ATOM   909    H  HD13   . LEU A  1  60  ? 323.943 268.718 299.045 1.00 118.66 ? 60  LEU N HD13   1 
ATOM   910    H  HD21   . LEU A  1  60  ? 324.111 268.879 302.012 1.00 121.76 ? 60  LEU N HD21   1 
ATOM   911    H  HD22   . LEU A  1  60  ? 322.706 268.957 301.275 1.00 121.76 ? 60  LEU N HD22   1 
ATOM   912    H  HD23   . LEU A  1  60  ? 322.955 267.859 302.396 1.00 121.76 ? 60  LEU N HD23   1 
ATOM   913    N  N      . LEU A  1  61  ? 321.427 263.905 299.494 1.00 127.78 ? 61  LEU N N      1 
ATOM   914    C  CA     . LEU A  1  61  ? 320.608 262.883 298.856 1.00 113.37 ? 61  LEU N CA     1 
ATOM   915    C  C      . LEU A  1  61  ? 319.689 262.220 299.873 1.00 113.04 ? 61  LEU N C      1 
ATOM   916    O  O      . LEU A  1  61  ? 320.155 261.652 300.862 1.00 115.35 ? 61  LEU N O      1 
ATOM   917    C  CB     . LEU A  1  61  ? 321.546 261.855 298.213 1.00 111.72 ? 61  LEU N CB     1 
ATOM   918    C  CG     . LEU A  1  61  ? 321.028 260.714 297.338 1.00 129.69 ? 61  LEU N CG     1 
ATOM   919    C  CD1    . LEU A  1  61  ? 320.314 261.269 296.134 1.00 123.26 ? 61  LEU N CD1    1 
ATOM   920    C  CD2    . LEU A  1  61  ? 322.174 259.807 296.890 1.00 128.17 ? 61  LEU N CD2    1 
ATOM   921    H  H      . LEU A  1  61  ? 322.256 263.865 299.268 1.00 105.50 ? 61  LEU N H      1 
ATOM   922    H  HA     . LEU A  1  61  ? 320.064 263.286 298.161 1.00 91.50  ? 61  LEU N HA     1 
ATOM   923    H  HB2    . LEU A  1  61  ? 322.173 262.350 297.662 1.00 89.52  ? 61  LEU N HB2    1 
ATOM   924    H  HB3    . LEU A  1  61  ? 322.040 261.434 298.934 1.00 89.52  ? 61  LEU N HB3    1 
ATOM   925    H  HG     . LEU A  1  61  ? 320.398 260.180 297.847 1.00 107.80 ? 61  LEU N HG     1 
ATOM   926    H  HD11   . LEU A  1  61  ? 319.992 260.533 295.591 1.00 102.10 ? 61  LEU N HD11   1 
ATOM   927    H  HD12   . LEU A  1  61  ? 319.567 261.812 296.432 1.00 102.10 ? 61  LEU N HD12   1 
ATOM   928    H  HD13   . LEU A  1  61  ? 320.934 261.812 295.622 1.00 102.10 ? 61  LEU N HD13   1 
ATOM   929    H  HD21   . LEU A  1  61  ? 321.815 259.094 296.338 1.00 105.79 ? 61  LEU N HD21   1 
ATOM   930    H  HD22   . LEU A  1  61  ? 322.811 260.331 296.380 1.00 105.79 ? 61  LEU N HD22   1 
ATOM   931    H  HD23   . LEU A  1  61  ? 322.605 259.433 297.674 1.00 105.79 ? 61  LEU N HD23   1 
ATOM   932    N  N      . ASP A  1  62  ? 318.381 262.297 299.642 1.00 87.31  ? 62  ASP N N      1 
ATOM   933    C  CA     . ASP A  1  62  ? 317.444 261.628 300.534 1.00 105.32 ? 62  ASP N CA     1 
ATOM   934    C  C      . ASP A  1  62  ? 317.567 260.117 300.386 1.00 97.43  ? 62  ASP N C      1 
ATOM   935    O  O      . ASP A  1  62  ? 317.652 259.585 299.277 1.00 108.65 ? 62  ASP N O      1 
ATOM   936    C  CB     . ASP A  1  62  ? 316.005 262.063 300.256 1.00 85.08  ? 62  ASP N CB     1 
ATOM   937    C  CG     . ASP A  1  62  ? 314.988 261.245 301.040 1.00 84.39  ? 62  ASP N CG     1 
ATOM   938    O  OD1    . ASP A  1  62  ? 314.978 261.339 302.287 1.00 87.68  ? 62  ASP N OD1    1 
ATOM   939    O  OD2    . ASP A  1  62  ? 314.197 260.510 300.409 1.00 80.80  ? 62  ASP N OD2    1 
ATOM   940    H  H      . ASP A  1  62  ? 318.017 262.723 298.989 1.00 86.36  ? 62  ASP N H      1 
ATOM   941    H  HA     . ASP A  1  62  ? 317.657 261.860 301.452 1.00 104.39 ? 62  ASP N HA     1 
ATOM   942    H  HB2    . ASP A  1  62  ? 315.901 262.994 300.509 1.00 84.85  ? 62  ASP N HB2    1 
ATOM   943    H  HB3    . ASP A  1  62  ? 315.817 261.952 299.311 1.00 84.85  ? 62  ASP N HB3    1 
ATOM   944    N  N      . SER A  1  63  ? 317.570 259.423 301.522 1.00 145.69 ? 63  SER N N      1 
ATOM   945    C  CA     . SER A  1  63  ? 317.839 257.992 301.541 1.00 133.82 ? 63  SER N CA     1 
ATOM   946    C  C      . SER A  1  63  ? 316.656 257.160 301.083 1.00 150.87 ? 63  SER N C      1 
ATOM   947    O  O      . SER A  1  63  ? 316.832 255.983 300.751 1.00 155.45 ? 63  SER N O      1 
ATOM   948    C  CB     . SER A  1  63  ? 318.221 257.555 302.954 1.00 128.00 ? 63  SER N CB     1 
ATOM   949    O  OG     . SER A  1  63  ? 317.206 257.938 303.870 1.00 125.05 ? 63  SER N OG     1 
ATOM   950    H  H      . SER A  1  63  ? 317.418 259.761 302.298 1.00 142.47 ? 63  SER N H      1 
ATOM   951    H  HA     . SER A  1  63  ? 318.587 257.801 300.953 1.00 130.26 ? 63  SER N HA     1 
ATOM   952    H  HB2    . SER A  1  63  ? 318.321 256.591 302.973 1.00 123.76 ? 63  SER N HB2    1 
ATOM   953    H  HB3    . SER A  1  63  ? 319.055 257.983 303.205 1.00 123.76 ? 63  SER N HB3    1 
ATOM   954    H  HG     . SER A  1  63  ? 317.416 257.698 304.647 1.00 121.00 ? 63  SER N HG     1 
ATOM   955    N  N      . SER A  1  64  ? 315.460 257.733 301.073 1.00 129.13 ? 64  SER N N      1 
ATOM   956    C  CA     . SER A  1  64  ? 314.249 256.976 300.823 1.00 112.08 ? 64  SER N CA     1 
ATOM   957    C  C      . SER A  1  64  ? 313.818 257.010 299.367 1.00 98.93  ? 64  SER N C      1 
ATOM   958    O  O      . SER A  1  64  ? 312.883 256.294 298.999 1.00 97.98  ? 64  SER N O      1 
ATOM   959    C  CB     . SER A  1  64  ? 313.130 257.514 301.711 1.00 107.00 ? 64  SER N CB     1 
ATOM   960    O  OG     . SER A  1  64  ? 313.675 257.957 302.944 1.00 113.78 ? 64  SER N OG     1 
ATOM   961    H  H      . SER A  1  64  ? 315.325 258.571 301.211 1.00 120.64 ? 64  SER N H      1 
ATOM   962    H  HA     . SER A  1  64  ? 314.403 256.049 301.066 1.00 104.02 ? 64  SER N HA     1 
ATOM   963    H  HB2    . SER A  1  64  ? 312.700 258.261 301.265 1.00 99.19  ? 64  SER N HB2    1 
ATOM   964    H  HB3    . SER A  1  64  ? 312.488 256.808 301.880 1.00 99.19  ? 64  SER N HB3    1 
ATOM   965    H  HG     . SER A  1  64  ? 313.064 258.255 303.438 1.00 105.45 ? 64  SER N HG     1 
ATOM   966    N  N      . THR A  1  65  ? 314.470 257.813 298.533 1.00 82.40  ? 65  THR N N      1 
ATOM   967    C  CA     . THR A  1  65  ? 314.140 257.912 297.119 1.00 80.40  ? 65  THR N CA     1 
ATOM   968    C  C      . THR A  1  65  ? 315.333 257.515 296.260 1.00 77.98  ? 65  THR N C      1 
ATOM   969    O  O      . THR A  1  65  ? 315.512 258.011 295.144 1.00 77.09  ? 65  THR N O      1 
ATOM   970    C  CB     . THR A  1  65  ? 313.650 259.316 296.774 1.00 90.30  ? 65  THR N CB     1 
ATOM   971    O  OG1    . THR A  1  65  ? 314.661 260.275 297.103 1.00 113.73 ? 65  THR N OG1    1 
ATOM   972    C  CG2    . THR A  1  65  ? 312.381 259.627 297.559 1.00 85.29  ? 65  THR N CG2    1 
ATOM   973    H  H      . THR A  1  65  ? 315.121 258.322 298.770 1.00 86.93  ? 65  THR N H      1 
ATOM   974    H  HA     . THR A  1  65  ? 313.419 257.293 296.925 1.00 85.47  ? 65  THR N HA     1 
ATOM   975    H  HB     . THR A  1  65  ? 313.449 259.368 295.827 1.00 95.85  ? 65  THR N HB     1 
ATOM   976    H  HG1    . THR A  1  65  ? 314.835 260.238 297.924 1.00 118.95 ? 65  THR N HG1    1 
ATOM   977    H  HG21   . THR A  1  65  ? 312.067 260.519 297.342 1.00 91.13  ? 65  THR N HG21   1 
ATOM   978    H  HG22   . THR A  1  65  ? 311.688 258.986 297.335 1.00 91.13  ? 65  THR N HG22   1 
ATOM   979    H  HG23   . THR A  1  65  ? 312.560 259.579 298.511 1.00 91.13  ? 65  THR N HG23   1 
ATOM   980    N  N      . VAL A  1  66  ? 316.166 256.625 296.797 1.00 90.51  ? 66  VAL N N      1 
ATOM   981    C  CA     . VAL A  1  66  ? 317.207 255.951 296.032 1.00 101.25 ? 66  VAL N CA     1 
ATOM   982    C  C      . VAL A  1  66  ? 316.808 254.529 295.686 1.00 117.32 ? 66  VAL N C      1 
ATOM   983    O  O      . VAL A  1  66  ? 317.422 253.920 294.795 1.00 132.76 ? 66  VAL N O      1 
ATOM   984    C  CB     . VAL A  1  66  ? 318.538 255.930 296.811 1.00 94.39  ? 66  VAL N CB     1 
ATOM   985    C  CG1    . VAL A  1  66  ? 319.147 257.319 296.848 1.00 98.49  ? 66  VAL N CG1    1 
ATOM   986    C  CG2    . VAL A  1  66  ? 318.315 255.405 298.232 1.00 90.97  ? 66  VAL N CG2    1 
ATOM   987    H  H      . VAL A  1  66  ? 316.145 256.392 297.624 1.00 86.23  ? 66  VAL N H      1 
ATOM   988    H  HA     . VAL A  1  66  ? 317.352 256.432 295.202 1.00 96.65  ? 66  VAL N HA     1 
ATOM   989    H  HB     . VAL A  1  66  ? 319.162 255.337 296.363 1.00 89.03  ? 66  VAL N HB     1 
ATOM   990    H  HG11   . VAL A  1  66  ? 319.982 257.285 297.341 1.00 93.12  ? 66  VAL N HG11   1 
ATOM   991    H  HG12   . VAL A  1  66  ? 319.312 257.615 295.939 1.00 93.12  ? 66  VAL N HG12   1 
ATOM   992    H  HG13   . VAL A  1  66  ? 318.528 257.924 297.286 1.00 93.12  ? 66  VAL N HG13   1 
ATOM   993    H  HG21   . VAL A  1  66  ? 319.163 255.400 298.703 1.00 85.19  ? 66  VAL N HG21   1 
ATOM   994    H  HG22   . VAL A  1  66  ? 317.686 255.986 298.687 1.00 85.19  ? 66  VAL N HG22   1 
ATOM   995    H  HG23   . VAL A  1  66  ? 317.958 254.504 298.182 1.00 85.19  ? 66  VAL N HG23   1 
ATOM   996    N  N      . THR A  1  67  ? 315.769 254.004 296.331 1.00 131.50 ? 67  THR N N      1 
ATOM   997    C  CA     . THR A  1  67  ? 315.493 252.577 296.424 1.00 124.64 ? 67  THR N CA     1 
ATOM   998    C  C      . THR A  1  67  ? 315.558 251.834 295.098 1.00 90.88  ? 67  THR N C      1 
ATOM   999    O  O      . THR A  1  67  ? 315.433 252.422 294.020 1.00 89.95  ? 67  THR N O      1 
ATOM   1000   C  CB     . THR A  1  67  ? 314.111 252.363 297.043 1.00 138.78 ? 67  THR N CB     1 
ATOM   1001   O  OG1    . THR A  1  67  ? 313.113 252.982 296.221 1.00 146.01 ? 67  THR N OG1    1 
ATOM   1002   C  CG2    . THR A  1  67  ? 314.059 252.963 298.441 1.00 144.91 ? 67  THR N CG2    1 
ATOM   1003   H  H      . THR A  1  67  ? 315.183 254.482 296.740 1.00 119.88 ? 67  THR N H      1 
ATOM   1004   H  HA     . THR A  1  67  ? 316.147 252.175 297.018 1.00 112.82 ? 67  THR N HA     1 
ATOM   1005   H  HB     . THR A  1  67  ? 313.931 251.412 297.110 1.00 127.29 ? 67  THR N HB     1 
ATOM   1006   H  HG1    . THR A  1  67  ? 312.352 252.867 296.558 1.00 135.25 ? 67  THR N HG1    1 
ATOM   1007   H  HG21   . THR A  1  67  ? 313.181 252.824 298.829 1.00 133.17 ? 67  THR N HG21   1 
ATOM   1008   H  HG22   . THR A  1  67  ? 314.724 252.541 299.008 1.00 133.17 ? 67  THR N HG22   1 
ATOM   1009   H  HG23   . THR A  1  67  ? 314.239 253.915 298.400 1.00 133.17 ? 67  THR N HG23   1 
ATOM   1010   N  N      . HIS A  1  68  ? 315.749 250.521 295.199 1.00 81.92  ? 68  HIS N N      1 
ATOM   1011   C  CA     . HIS A  1  68  ? 315.762 249.625 294.061 1.00 68.75  ? 68  HIS N CA     1 
ATOM   1012   C  C      . HIS A  1  68  ? 314.677 248.573 294.144 1.00 76.90  ? 68  HIS N C      1 
ATOM   1013   O  O      . HIS A  1  68  ? 314.519 247.789 293.203 1.00 82.68  ? 68  HIS N O      1 
ATOM   1014   C  CB     . HIS A  1  68  ? 317.123 248.943 293.948 1.00 70.17  ? 68  HIS N CB     1 
ATOM   1015   C  CG     . HIS A  1  68  ? 318.204 249.866 293.506 1.00 71.31  ? 68  HIS N CG     1 
ATOM   1016   N  ND1    . HIS A  1  68  ? 318.195 250.472 292.269 1.00 69.57  ? 68  HIS N ND1    1 
ATOM   1017   C  CD2    . HIS A  1  68  ? 319.312 250.313 294.139 1.00 90.84  ? 68  HIS N CD2    1 
ATOM   1018   C  CE1    . HIS A  1  68  ? 319.261 251.244 292.151 1.00 89.97  ? 68  HIS N CE1    1 
ATOM   1019   N  NE2    . HIS A  1  68  ? 319.955 251.166 293.273 1.00 95.11  ? 68  HIS N NE2    1 
ATOM   1020   H  H      . HIS A  1  68  ? 315.878 250.117 295.947 1.00 75.13  ? 68  HIS N H      1 
ATOM   1021   H  HA     . HIS A  1  68  ? 315.617 250.141 293.252 1.00 62.04  ? 68  HIS N HA     1 
ATOM   1022   H  HB2    . HIS A  1  68  ? 317.369 248.588 294.817 1.00 62.77  ? 68  HIS N HB2    1 
ATOM   1023   H  HB3    . HIS A  1  68  ? 317.061 248.223 293.302 1.00 62.77  ? 68  HIS N HB3    1 
ATOM   1024   H  HD1    . HIS A  1  68  ? 317.593 250.361 291.665 1.00 62.52  ? 68  HIS N HD1    1 
ATOM   1025   H  HD2    . HIS A  1  68  ? 319.590 250.083 294.996 1.00 82.80  ? 68  HIS N HD2    1 
ATOM   1026   H  HE1    . HIS A  1  68  ? 319.484 251.754 291.407 1.00 82.69  ? 68  HIS N HE1    1 
ATOM   1027   N  N      . LEU A  1  69  ? 313.939 248.522 295.240 1.00 60.53  ? 69  LEU N N      1 
ATOM   1028   C  CA     . LEU A  1  69  ? 312.746 247.698 295.320 1.00 60.27  ? 69  LEU N CA     1 
ATOM   1029   C  C      . LEU A  1  69  ? 311.571 248.496 294.783 1.00 62.24  ? 69  LEU N C      1 
ATOM   1030   O  O      . LEU A  1  69  ? 311.273 249.588 295.279 1.00 70.54  ? 69  LEU N O      1 
ATOM   1031   C  CB     . LEU A  1  69  ? 312.498 247.251 296.754 1.00 62.50  ? 69  LEU N CB     1 
ATOM   1032   C  CG     . LEU A  1  69  ? 313.702 246.469 297.260 1.00 89.05  ? 69  LEU N CG     1 
ATOM   1033   C  CD1    . LEU A  1  69  ? 313.596 246.251 298.750 1.00 114.24 ? 69  LEU N CD1    1 
ATOM   1034   C  CD2    . LEU A  1  69  ? 313.807 245.148 296.507 1.00 85.49  ? 69  LEU N CD2    1 
ATOM   1035   H  H      . LEU A  1  69  ? 314.111 248.960 295.960 1.00 59.69  ? 69  LEU N H      1 
ATOM   1036   H  HA     . LEU A  1  69  ? 312.860 246.909 294.767 1.00 59.68  ? 69  LEU N HA     1 
ATOM   1037   H  HB2    . LEU A  1  69  ? 312.372 248.029 297.321 1.00 61.53  ? 69  LEU N HB2    1 
ATOM   1038   H  HB3    . LEU A  1  69  ? 311.718 246.675 296.786 1.00 61.53  ? 69  LEU N HB3    1 
ATOM   1039   H  HG     . LEU A  1  69  ? 314.508 246.980 297.087 1.00 87.27  ? 69  LEU N HG     1 
ATOM   1040   H  HD11   . LEU A  1  69  ? 314.371 245.752 299.051 1.00 112.04 ? 69  LEU N HD11   1 
ATOM   1041   H  HD12   . LEU A  1  69  ? 313.564 247.114 299.193 1.00 112.04 ? 69  LEU N HD12   1 
ATOM   1042   H  HD13   . LEU A  1  69  ? 312.787 245.751 298.939 1.00 112.04 ? 69  LEU N HD13   1 
ATOM   1043   H  HD21   . LEU A  1  69  ? 314.577 244.658 296.837 1.00 83.52  ? 69  LEU N HD21   1 
ATOM   1044   H  HD22   . LEU A  1  69  ? 312.998 244.635 296.657 1.00 83.52  ? 69  LEU N HD22   1 
ATOM   1045   H  HD23   . LEU A  1  69  ? 313.912 245.333 295.561 1.00 83.52  ? 69  LEU N HD23   1 
ATOM   1046   N  N      . PHE A  1  70  ? 310.930 247.964 293.754 1.00 60.85  ? 70  PHE N N      1 
ATOM   1047   C  CA     . PHE A  1  70  ? 309.724 248.548 293.203 1.00 61.10  ? 70  PHE N CA     1 
ATOM   1048   C  C      . PHE A  1  70  ? 308.601 247.533 293.263 1.00 60.74  ? 70  PHE N C      1 
ATOM   1049   O  O      . PHE A  1  70  ? 308.787 246.356 292.936 1.00 59.61  ? 70  PHE N O      1 
ATOM   1050   C  CB     . PHE A  1  70  ? 309.890 248.977 291.758 1.00 60.08  ? 70  PHE N CB     1 
ATOM   1051   C  CG     . PHE A  1  70  ? 311.004 249.935 291.522 1.00 58.72  ? 70  PHE N CG     1 
ATOM   1052   C  CD1    . PHE A  1  70  ? 310.805 251.296 291.667 1.00 60.51  ? 70  PHE N CD1    1 
ATOM   1053   C  CD2    . PHE A  1  70  ? 312.241 249.481 291.114 1.00 57.49  ? 70  PHE N CD2    1 
ATOM   1054   C  CE1    . PHE A  1  70  ? 311.829 252.187 291.427 1.00 73.35  ? 70  PHE N CE1    1 
ATOM   1055   C  CE2    . PHE A  1  70  ? 313.268 250.362 290.873 1.00 71.09  ? 70  PHE N CE2    1 
ATOM   1056   C  CZ     . PHE A  1  70  ? 313.063 251.719 291.028 1.00 79.93  ? 70  PHE N CZ     1 
ATOM   1057   H  H      . PHE A  1  70  ? 311.182 247.247 293.350 1.00 58.20  ? 70  PHE N H      1 
ATOM   1058   H  HA     . PHE A  1  70  ? 309.469 249.323 293.727 1.00 59.16  ? 70  PHE N HA     1 
ATOM   1059   H  HB2    . PHE A  1  70  ? 310.060 248.189 291.218 1.00 58.51  ? 70  PHE N HB2    1 
ATOM   1060   H  HB3    . PHE A  1  70  ? 309.069 249.402 291.464 1.00 58.51  ? 70  PHE N HB3    1 
ATOM   1061   H  HD1    . PHE A  1  70  ? 309.973 251.614 291.933 1.00 59.13  ? 70  PHE N HD1    1 
ATOM   1062   H  HD2    . PHE A  1  70  ? 312.383 248.568 291.006 1.00 55.32  ? 70  PHE N HD2    1 
ATOM   1063   H  HE1    . PHE A  1  70  ? 311.688 253.100 291.534 1.00 71.84  ? 70  PHE N HE1    1 
ATOM   1064   H  HE2    . PHE A  1  70  ? 314.100 250.045 290.606 1.00 68.79  ? 70  PHE N HE2    1 
ATOM   1065   H  HZ     . PHE A  1  70  ? 313.759 252.316 290.869 1.00 77.97  ? 70  PHE N HZ     1 
ATOM   1066   N  N      . LYS A  1  71  ? 307.436 248.010 293.663 1.00 77.71  ? 71  LYS N N      1 
ATOM   1067   C  CA     . LYS A  1  71  ? 306.208 247.241 293.571 1.00 77.95  ? 71  LYS N CA     1 
ATOM   1068   C  C      . LYS A  1  71  ? 305.730 247.282 292.120 1.00 75.92  ? 71  LYS N C      1 
ATOM   1069   O  O      . LYS A  1  71  ? 305.347 248.344 291.623 1.00 83.32  ? 71  LYS N O      1 
ATOM   1070   C  CB     . LYS A  1  71  ? 305.198 247.845 294.541 1.00 80.90  ? 71  LYS N CB     1 
ATOM   1071   C  CG     . LYS A  1  71  ? 304.047 246.960 294.921 1.00 94.48  ? 71  LYS N CG     1 
ATOM   1072   C  CD     . LYS A  1  71  ? 303.327 247.469 296.168 1.00 112.45 ? 71  LYS N CD     1 
ATOM   1073   C  CE     . LYS A  1  71  ? 302.335 248.582 295.851 1.00 126.70 ? 71  LYS N CE     1 
ATOM   1074   N  NZ     . LYS A  1  71  ? 302.974 249.914 295.655 1.00 136.16 ? 71  LYS N NZ     1 
ATOM   1075   H  H      . LYS A  1  71  ? 307.328 248.794 293.999 1.00 74.10  ? 71  LYS N H      1 
ATOM   1076   H  HA     . LYS A  1  71  ? 306.374 246.319 293.823 1.00 74.60  ? 71  LYS N HA     1 
ATOM   1077   H  HB2    . LYS A  1  71  ? 305.663 248.083 295.358 1.00 77.81  ? 71  LYS N HB2    1 
ATOM   1078   H  HB3    . LYS A  1  71  ? 304.827 248.645 294.136 1.00 77.81  ? 71  LYS N HB3    1 
ATOM   1079   H  HG2    . LYS A  1  71  ? 303.408 246.935 294.192 1.00 91.48  ? 71  LYS N HG2    1 
ATOM   1080   H  HG3    . LYS A  1  71  ? 304.378 246.067 295.106 1.00 91.48  ? 71  LYS N HG3    1 
ATOM   1081   H  HD2    . LYS A  1  71  ? 302.837 246.737 296.574 1.00 109.51 ? 71  LYS N HD2    1 
ATOM   1082   H  HD3    . LYS A  1  71  ? 303.982 247.819 296.793 1.00 109.51 ? 71  LYS N HD3    1 
ATOM   1083   H  HE2    . LYS A  1  71  ? 301.862 248.357 295.035 1.00 124.38 ? 71  LYS N HE2    1 
ATOM   1084   H  HE3    . LYS A  1  71  ? 301.706 248.660 296.585 1.00 124.38 ? 71  LYS N HE3    1 
ATOM   1085   H  HZ1    . LYS A  1  71  ? 302.353 250.525 295.473 1.00 133.96 ? 71  LYS N HZ1    1 
ATOM   1086   H  HZ2    . LYS A  1  71  ? 303.409 250.154 296.393 1.00 133.96 ? 71  LYS N HZ2    1 
ATOM   1087   H  HZ3    . LYS A  1  71  ? 303.551 249.877 294.978 1.00 133.96 ? 71  LYS N HZ3    1 
ATOM   1088   N  N      . ILE A  1  72  ? 305.786 246.146 291.417 1.00 51.89  ? 72  ILE N N      1 
ATOM   1089   C  CA     . ILE A  1  72  ? 305.298 246.109 290.038 1.00 50.05  ? 72  ILE N CA     1 
ATOM   1090   C  C      . ILE A  1  72  ? 303.773 246.072 290.015 1.00 58.12  ? 72  ILE N C      1 
ATOM   1091   O  O      . ILE A  1  72  ? 303.133 246.785 289.233 1.00 81.46  ? 72  ILE N O      1 
ATOM   1092   C  CB     . ILE A  1  72  ? 305.895 244.918 289.257 1.00 48.58  ? 72  ILE N CB     1 
ATOM   1093   C  CG1    . ILE A  1  72  ? 307.430 244.969 289.224 1.00 48.55  ? 72  ILE N CG1    1 
ATOM   1094   C  CG2    . ILE A  1  72  ? 305.354 244.894 287.829 1.00 46.98  ? 72  ILE N CG2    1 
ATOM   1095   C  CD1    . ILE A  1  72  ? 308.013 246.101 288.394 1.00 53.45  ? 72  ILE N CD1    1 
ATOM   1096   H  H      . ILE A  1  72  ? 306.096 245.399 291.710 1.00 51.90  ? 72  ILE N H      1 
ATOM   1097   H  HA     . ILE A  1  72  ? 305.578 246.922 289.590 1.00 50.49  ? 72  ILE N HA     1 
ATOM   1098   H  HB     . ILE A  1  72  ? 305.626 244.097 289.700 1.00 48.69  ? 72  ILE N HB     1 
ATOM   1099   H  HG12   . ILE A  1  72  ? 307.756 245.073 290.132 1.00 48.16  ? 72  ILE N HG12   1 
ATOM   1100   H  HG13   . ILE A  1  72  ? 307.759 244.135 288.854 1.00 48.16  ? 72  ILE N HG13   1 
ATOM   1101   H  HG21   . ILE A  1  72  ? 305.741 244.139 287.358 1.00 47.53  ? 72  ILE N HG21   1 
ATOM   1102   H  HG22   . ILE A  1  72  ? 304.388 244.806 287.858 1.00 47.53  ? 72  ILE N HG22   1 
ATOM   1103   H  HG23   . ILE A  1  72  ? 305.598 245.721 287.385 1.00 47.53  ? 72  ILE N HG23   1 
ATOM   1104   H  HD11   . ILE A  1  72  ? 308.981 246.053 288.432 1.00 53.31  ? 72  ILE N HD11   1 
ATOM   1105   H  HD12   . ILE A  1  72  ? 307.712 246.007 287.477 1.00 53.31  ? 72  ILE N HD12   1 
ATOM   1106   H  HD13   . ILE A  1  72  ? 307.708 246.947 288.758 1.00 53.31  ? 72  ILE N HD13   1 
ATOM   1107   N  N      . THR A  1  73  ? 303.176 245.220 290.841 1.00 63.93  ? 73  THR N N      1 
ATOM   1108   C  CA     . THR A  1  73  ? 301.735 245.241 291.096 1.00 67.88  ? 73  THR N CA     1 
ATOM   1109   C  C      . THR A  1  73  ? 301.551 244.940 292.579 1.00 74.06  ? 73  THR N C      1 
ATOM   1110   O  O      . THR A  1  73  ? 302.470 245.100 293.384 1.00 68.49  ? 73  THR N O      1 
ATOM   1111   C  CB     . THR A  1  73  ? 300.983 244.260 290.178 1.00 82.40  ? 73  THR N CB     1 
ATOM   1112   O  OG1    . THR A  1  73  ? 301.789 243.098 289.942 1.00 87.52  ? 73  THR N OG1    1 
ATOM   1113   C  CG2    . THR A  1  73  ? 300.617 244.928 288.858 1.00 90.56  ? 73  THR N CG2    1 
ATOM   1114   H  H      . THR A  1  73  ? 303.591 244.607 291.278 1.00 67.70  ? 73  THR N H      1 
ATOM   1115   H  HA     . THR A  1  73  ? 301.395 246.133 290.925 1.00 72.05  ? 73  THR N HA     1 
ATOM   1116   H  HB     . THR A  1  73  ? 300.161 243.988 290.614 1.00 86.74  ? 73  THR N HB     1 
ATOM   1117   H  HG1    . THR A  1  73  ? 301.380 242.562 289.441 1.00 91.37  ? 73  THR N HG1    1 
ATOM   1118   H  HG21   . THR A  1  73  ? 300.144 244.301 288.289 1.00 95.41  ? 73  THR N HG21   1 
ATOM   1119   H  HG22   . THR A  1  73  ? 300.047 245.696 289.022 1.00 95.41  ? 73  THR N HG22   1 
ATOM   1120   H  HG23   . THR A  1  73  ? 301.420 245.224 288.402 1.00 95.41  ? 73  THR N HG23   1 
ATOM   1121   N  N      . GLU A  1  74  ? 300.360 244.500 292.973 1.00 97.03  ? 74  GLU N N      1 
ATOM   1122   C  CA     . GLU A  1  74  ? 300.159 244.176 294.377 1.00 100.05 ? 74  GLU N CA     1 
ATOM   1123   C  C      . GLU A  1  74  ? 300.897 242.909 294.771 1.00 98.54  ? 74  GLU N C      1 
ATOM   1124   O  O      . GLU A  1  74  ? 301.304 242.771 295.931 1.00 104.21 ? 74  GLU N O      1 
ATOM   1125   C  CB     . GLU A  1  74  ? 298.668 244.033 294.688 1.00 129.89 ? 74  GLU N CB     1 
ATOM   1126   C  CG     . GLU A  1  74  ? 297.917 245.351 294.719 1.00 157.68 ? 74  GLU N CG     1 
ATOM   1127   C  CD     . GLU A  1  74  ? 298.588 246.383 295.610 1.00 173.27 ? 74  GLU N CD     1 
ATOM   1128   O  OE1    . GLU A  1  74  ? 299.238 247.302 295.065 1.00 190.59 ? 74  GLU N OE1    1 
ATOM   1129   O  OE2    . GLU A  1  74  ? 298.474 246.266 296.850 1.00 167.13 ? 74  GLU N OE2    1 
ATOM   1130   H  H      . GLU A  1  74  ? 299.675 244.384 292.466 1.00 97.48  ? 74  GLU N H      1 
ATOM   1131   H  HA     . GLU A  1  74  ? 300.507 244.902 294.918 1.00 100.19 ? 74  GLU N HA     1 
ATOM   1132   H  HB2    . GLU A  1  74  ? 298.259 243.475 294.008 1.00 130.38 ? 74  GLU N HB2    1 
ATOM   1133   H  HB3    . GLU A  1  74  ? 298.569 243.615 295.558 1.00 130.38 ? 74  GLU N HB3    1 
ATOM   1134   H  HG2    . GLU A  1  74  ? 297.874 245.713 293.820 1.00 158.68 ? 74  GLU N HG2    1 
ATOM   1135   H  HG3    . GLU A  1  74  ? 297.021 245.197 295.059 1.00 158.68 ? 74  GLU N HG3    1 
ATOM   1136   N  N      . ASN A  1  75  ? 301.093 241.983 293.834 1.00 73.45  ? 75  ASN N N      1 
ATOM   1137   C  CA     . ASN A  1  75  ? 301.664 240.681 294.154 1.00 72.02  ? 75  ASN N CA     1 
ATOM   1138   C  C      . ASN A  1  75  ? 302.998 240.423 293.474 1.00 70.41  ? 75  ASN N C      1 
ATOM   1139   O  O      . ASN A  1  75  ? 303.456 239.275 293.468 1.00 71.18  ? 75  ASN N O      1 
ATOM   1140   C  CB     . ASN A  1  75  ? 300.684 239.573 293.774 1.00 84.14  ? 75  ASN N CB     1 
ATOM   1141   C  CG     . ASN A  1  75  ? 299.330 239.755 294.409 1.00 108.86 ? 75  ASN N CG     1 
ATOM   1142   O  OD1    . ASN A  1  75  ? 299.124 239.399 295.569 1.00 112.71 ? 75  ASN N OD1    1 
ATOM   1143   N  ND2    . ASN A  1  75  ? 298.394 240.315 293.653 1.00 133.28 ? 75  ASN N ND2    1 
ATOM   1144   H  H      . ASN A  1  75  ? 300.901 242.087 293.002 1.00 74.92  ? 75  ASN N H      1 
ATOM   1145   H  HA     . ASN A  1  75  ? 301.808 240.633 295.112 1.00 72.89  ? 75  ASN N HA     1 
ATOM   1146   H  HB2    . ASN A  1  75  ? 300.567 239.571 292.811 1.00 85.10  ? 75  ASN N HB2    1 
ATOM   1147   H  HB3    . ASN A  1  75  ? 301.041 238.720 294.067 1.00 85.10  ? 75  ASN N HB3    1 
ATOM   1148   H  HD21   . ASN A  1  75  ? 297.604 240.441 293.968 1.00 135.17 ? 75  ASN N HD21   1 
ATOM   1149   H  HD22   . ASN A  1  75  ? 298.577 240.552 292.847 1.00 135.17 ? 75  ASN N HD22   1 
ATOM   1150   N  N      . ILE A  1  76  ? 303.640 241.441 292.906 1.00 56.96  ? 76  ILE N N      1 
ATOM   1151   C  CA     . ILE A  1  76  ? 304.843 241.209 292.111 1.00 55.27  ? 76  ILE N CA     1 
ATOM   1152   C  C      . ILE A  1  76  ? 305.893 242.278 292.381 1.00 54.05  ? 76  ILE N C      1 
ATOM   1153   O  O      . ILE A  1  76  ? 305.863 243.358 291.783 1.00 58.29  ? 76  ILE N O      1 
ATOM   1154   C  CB     . ILE A  1  76  ? 304.493 241.159 290.613 1.00 59.30  ? 76  ILE N CB     1 
ATOM   1155   C  CG1    . ILE A  1  76  ? 303.374 240.138 290.383 1.00 61.23  ? 76  ILE N CG1    1 
ATOM   1156   C  CG2    . ILE A  1  76  ? 305.734 240.818 289.802 1.00 73.08  ? 76  ILE N CG2    1 
ATOM   1157   C  CD1    . ILE A  1  76  ? 303.083 239.827 288.932 1.00 67.37  ? 76  ILE N CD1    1 
ATOM   1158   H  H      . ILE A  1  76  ? 303.404 242.266 292.964 1.00 54.60  ? 76  ILE N H      1 
ATOM   1159   H  HA     . ILE A  1  76  ? 305.222 240.351 292.357 1.00 52.60  ? 76  ILE N HA     1 
ATOM   1160   H  HB     . ILE A  1  76  ? 304.175 242.034 290.339 1.00 57.04  ? 76  ILE N HB     1 
ATOM   1161   H  HG12   . ILE A  1  76  ? 303.620 239.306 290.817 1.00 59.10  ? 76  ILE N HG12   1 
ATOM   1162   H  HG13   . ILE A  1  76  ? 302.557 240.481 290.778 1.00 59.10  ? 76  ILE N HG13   1 
ATOM   1163   H  HG21   . ILE A  1  76  ? 305.498 240.790 288.861 1.00 70.47  ? 76  ILE N HG21   1 
ATOM   1164   H  HG22   . ILE A  1  76  ? 306.407 241.499 289.954 1.00 70.47  ? 76  ILE N HG22   1 
ATOM   1165   H  HG23   . ILE A  1  76  ? 306.068 239.952 290.085 1.00 70.47  ? 76  ILE N HG23   1 
ATOM   1166   H  HD11   . ILE A  1  76  ? 302.365 239.176 288.887 1.00 65.52  ? 76  ILE N HD11   1 
ATOM   1167   H  HD12   . ILE A  1  76  ? 302.817 240.644 288.481 1.00 65.52  ? 76  ILE N HD12   1 
ATOM   1168   H  HD13   . ILE A  1  76  ? 303.883 239.466 288.520 1.00 65.52  ? 76  ILE N HD13   1 
ATOM   1169   N  N      . GLY A  1  77  ? 306.839 241.979 293.277 1.00 48.59  ? 77  GLY N N      1 
ATOM   1170   C  CA     . GLY A  1  77  ? 307.956 242.867 293.504 1.00 49.11  ? 77  GLY N CA     1 
ATOM   1171   C  C      . GLY A  1  77  ? 309.137 242.552 292.603 1.00 48.74  ? 77  GLY N C      1 
ATOM   1172   O  O      . GLY A  1  77  ? 309.254 241.458 292.056 1.00 55.29  ? 77  GLY N O      1 
ATOM   1173   H  H      . GLY A  1  77  ? 306.848 241.267 293.759 1.00 50.51  ? 77  GLY N H      1 
ATOM   1174   H  HA2    . GLY A  1  77  ? 307.680 243.782 293.342 1.00 50.82  ? 77  GLY N HA2    1 
ATOM   1175   H  HA3    . GLY A  1  77  ? 308.246 242.792 294.427 1.00 50.82  ? 77  GLY N HA3    1 
ATOM   1176   N  N      . CYS A  1  78  ? 310.025 243.534 292.447 1.00 63.87  ? 78  CYS N N      1 
ATOM   1177   C  CA     . CYS A  1  78  ? 311.229 243.341 291.657 1.00 61.78  ? 78  CYS N CA     1 
ATOM   1178   C  C      . CYS A  1  78  ? 312.416 243.991 292.358 1.00 67.92  ? 78  CYS N C      1 
ATOM   1179   O  O      . CYS A  1  78  ? 312.294 244.545 293.457 1.00 73.58  ? 78  CYS N O      1 
ATOM   1180   C  CB     . CYS A  1  78  ? 311.069 243.922 290.252 1.00 63.93  ? 78  CYS N CB     1 
ATOM   1181   S  SG     . CYS A  1  78  ? 311.518 245.655 290.174 1.00 64.86  ? 78  CYS N SG     1 
ATOM   1182   H  H      . CYS A  1  78  ? 309.949 244.320 292.789 1.00 67.53  ? 78  CYS N H      1 
ATOM   1183   H  HA     . CYS A  1  78  ? 311.407 242.391 291.574 1.00 65.11  ? 78  CYS N HA     1 
ATOM   1184   H  HB2    . CYS A  1  78  ? 311.641 243.435 289.640 1.00 67.79  ? 78  CYS N HB2    1 
ATOM   1185   H  HB3    . CYS A  1  78  ? 310.142 243.840 289.978 1.00 67.79  ? 78  CYS N HB3    1 
ATOM   1186   H  HG     . CYS A  1  78  ? 311.370 246.047 289.050 1.00 69.03  ? 78  CYS N HG     1 
ATOM   1187   N  N      . VAL A  1  79  ? 313.579 243.925 291.709 1.00 49.04  ? 79  VAL N N      1 
ATOM   1188   C  CA     . VAL A  1  79  ? 314.759 244.660 292.157 1.00 51.13  ? 79  VAL N CA     1 
ATOM   1189   C  C      . VAL A  1  79  ? 315.648 244.959 290.955 1.00 50.51  ? 79  VAL N C      1 
ATOM   1190   O  O      . VAL A  1  79  ? 316.127 244.047 290.273 1.00 48.06  ? 79  VAL N O      1 
ATOM   1191   C  CB     . VAL A  1  79  ? 315.536 243.893 293.240 1.00 51.74  ? 79  VAL N CB     1 
ATOM   1192   C  CG1    . VAL A  1  79  ? 315.975 242.520 292.743 1.00 63.55  ? 79  VAL N CG1    1 
ATOM   1193   C  CG2    . VAL A  1  79  ? 316.734 244.703 293.699 1.00 53.80  ? 79  VAL N CG2    1 
ATOM   1194   H  H      . VAL A  1  79  ? 313.710 243.456 291.000 1.00 53.09  ? 79  VAL N H      1 
ATOM   1195   H  HA     . VAL A  1  79  ? 314.476 245.506 292.536 1.00 54.80  ? 79  VAL N HA     1 
ATOM   1196   H  HB     . VAL A  1  79  ? 314.956 243.760 294.007 1.00 54.62  ? 79  VAL N HB     1 
ATOM   1197   H  HG11   . VAL A  1  79  ? 316.460 242.068 293.451 1.00 65.97  ? 79  VAL N HG11   1 
ATOM   1198   H  HG12   . VAL A  1  79  ? 315.188 242.006 292.500 1.00 65.97  ? 79  VAL N HG12   1 
ATOM   1199   H  HG13   . VAL A  1  79  ? 316.548 242.633 291.969 1.00 65.97  ? 79  VAL N HG13   1 
ATOM   1200   H  HG21   . VAL A  1  79  ? 317.210 244.204 294.381 1.00 56.30  ? 79  VAL N HG21   1 
ATOM   1201   H  HG22   . VAL A  1  79  ? 317.316 244.863 292.939 1.00 56.30  ? 79  VAL N HG22   1 
ATOM   1202   H  HG23   . VAL A  1  79  ? 316.424 245.547 294.062 1.00 56.30  ? 79  VAL N HG23   1 
ATOM   1203   N  N      . MET A  1  80  ? 315.893 246.240 290.707 1.00 62.95  ? 80  MET N N      1 
ATOM   1204   C  CA     . MET A  1  80  ? 316.571 246.687 289.502 1.00 61.77  ? 80  MET N CA     1 
ATOM   1205   C  C      . MET A  1  80  ? 318.050 246.891 289.770 1.00 69.01  ? 80  MET N C      1 
ATOM   1206   O  O      . MET A  1  80  ? 318.428 247.558 290.736 1.00 74.07  ? 80  MET N O      1 
ATOM   1207   C  CB     . MET A  1  80  ? 315.947 247.985 288.992 1.00 76.81  ? 80  MET N CB     1 
ATOM   1208   C  CG     . MET A  1  80  ? 314.505 247.822 288.586 1.00 86.05  ? 80  MET N CG     1 
ATOM   1209   S  SD     . MET A  1  80  ? 314.291 246.475 287.406 1.00 92.02  ? 80  MET N SD     1 
ATOM   1210   C  CE     . MET A  1  80  ? 315.300 247.055 286.045 1.00 107.19 ? 80  MET N CE     1 
ATOM   1211   H  H      . MET A  1  80  ? 315.670 246.881 291.235 1.00 63.20  ? 80  MET N H      1 
ATOM   1212   H  HA     . MET A  1  80  ? 316.466 246.013 288.812 1.00 62.14  ? 80  MET N HA     1 
ATOM   1213   H  HB2    . MET A  1  80  ? 315.986 248.651 289.696 1.00 77.88  ? 80  MET N HB2    1 
ATOM   1214   H  HB3    . MET A  1  80  ? 316.444 248.291 288.218 1.00 77.88  ? 80  MET N HB3    1 
ATOM   1215   H  HG2    . MET A  1  80  ? 313.973 247.624 289.372 1.00 87.73  ? 80  MET N HG2    1 
ATOM   1216   H  HG3    . MET A  1  80  ? 314.197 248.642 288.170 1.00 87.73  ? 80  MET N HG3    1 
ATOM   1217   H  HE1    . MET A  1  80  ? 315.268 246.403 285.327 1.00 108.89 ? 80  MET N HE1    1 
ATOM   1218   H  HE2    . MET A  1  80  ? 314.953 247.906 285.735 1.00 108.89 ? 80  MET N HE2    1 
ATOM   1219   H  HE3    . MET A  1  80  ? 316.214 247.163 286.353 1.00 108.89 ? 80  MET N HE3    1 
ATOM   1220   N  N      . THR A  1  81  ? 318.879 246.336 288.896 1.00 90.16  ? 81  THR N N      1 
ATOM   1221   C  CA     . THR A  1  81  ? 320.323 246.368 289.051 1.00 115.04 ? 81  THR N CA     1 
ATOM   1222   C  C      . THR A  1  81  ? 320.956 246.971 287.805 1.00 110.94 ? 81  THR N C      1 
ATOM   1223   O  O      . THR A  1  81  ? 320.710 246.505 286.687 1.00 97.67  ? 81  THR N O      1 
ATOM   1224   C  CB     . THR A  1  81  ? 320.862 244.956 289.291 1.00 139.07 ? 81  THR N CB     1 
ATOM   1225   O  OG1    . THR A  1  81  ? 319.912 244.211 290.066 1.00 148.62 ? 81  THR N OG1    1 
ATOM   1226   C  CG2    . THR A  1  81  ? 322.185 245.014 290.035 1.00 157.09 ? 81  THR N CG2    1 
ATOM   1227   H  H      . THR A  1  81  ? 318.620 245.924 288.187 1.00 84.42  ? 81  THR N H      1 
ATOM   1228   H  HA     . THR A  1  81  ? 320.555 246.921 289.814 1.00 108.65 ? 81  THR N HA     1 
ATOM   1229   H  HB     . THR A  1  81  ? 321.005 244.514 288.440 1.00 131.99 ? 81  THR N HB     1 
ATOM   1230   H  HG1    . THR A  1  81  ? 320.199 243.434 290.203 1.00 141.56 ? 81  THR N HG1    1 
ATOM   1231   H  HG21   . THR A  1  81  ? 322.521 244.116 290.184 1.00 149.26 ? 81  THR N HG21   1 
ATOM   1232   H  HG22   . THR A  1  81  ? 322.836 245.512 289.516 1.00 149.26 ? 81  THR N HG22   1 
ATOM   1233   H  HG23   . THR A  1  81  ? 322.064 245.451 290.892 1.00 149.26 ? 81  THR N HG23   1 
ATOM   1234   N  N      . GLY A  1  82  ? 321.761 248.017 287.998 1.00 85.92  ? 82  GLY N N      1 
ATOM   1235   C  CA     . GLY A  1  82  ? 322.664 248.499 286.973 1.00 92.52  ? 82  GLY N CA     1 
ATOM   1236   C  C      . GLY A  1  82  ? 322.388 249.951 286.621 1.00 91.42  ? 82  GLY N C      1 
ATOM   1237   O  O      . GLY A  1  82  ? 322.093 250.773 287.495 1.00 99.83  ? 82  GLY N O      1 
ATOM   1238   H  H      . GLY A  1  82  ? 321.797 248.467 288.730 1.00 99.35  ? 82  GLY N H      1 
ATOM   1239   H  HA2    . GLY A  1  82  ? 323.579 248.425 287.285 1.00 105.91 ? 82  GLY N HA2    1 
ATOM   1240   H  HA3    . GLY A  1  82  ? 322.564 247.961 286.172 1.00 105.91 ? 82  GLY N HA3    1 
ATOM   1241   N  N      . MET A  1  83  ? 322.490 250.253 285.330 1.00 86.86  ? 83  MET N N      1 
ATOM   1242   C  CA     . MET A  1  83  ? 322.352 251.607 284.813 1.00 84.17  ? 83  MET N CA     1 
ATOM   1243   C  C      . MET A  1  83  ? 321.004 252.178 285.230 1.00 66.41  ? 83  MET N C      1 
ATOM   1244   O  O      . MET A  1  83  ? 319.965 251.739 284.732 1.00 64.64  ? 83  MET N O      1 
ATOM   1245   C  CB     . MET A  1  83  ? 322.507 251.576 283.291 1.00 98.41  ? 83  MET N CB     1 
ATOM   1246   C  CG     . MET A  1  83  ? 322.737 252.915 282.643 1.00 117.29 ? 83  MET N CG     1 
ATOM   1247   S  SD     . MET A  1  83  ? 323.168 252.735 280.897 1.00 120.11 ? 83  MET N SD     1 
ATOM   1248   C  CE     . MET A  1  83  ? 323.139 254.454 280.397 1.00 154.56 ? 83  MET N CE     1 
ATOM   1249   H  H      . MET A  1  83  ? 322.644 249.670 284.716 1.00 89.02  ? 83  MET N H      1 
ATOM   1250   H  HA     . MET A  1  83  ? 323.059 252.161 285.178 1.00 86.83  ? 83  MET N HA     1 
ATOM   1251   H  HB2    . MET A  1  83  ? 323.264 251.011 283.070 1.00 101.30 ? 83  MET N HB2    1 
ATOM   1252   H  HB3    . MET A  1  83  ? 321.700 251.200 282.906 1.00 101.30 ? 83  MET N HB3    1 
ATOM   1253   H  HG2    . MET A  1  83  ? 321.926 253.444 282.703 1.00 120.53 ? 83  MET N HG2    1 
ATOM   1254   H  HG3    . MET A  1  83  ? 323.468 253.367 283.092 1.00 120.53 ? 83  MET N HG3    1 
ATOM   1255   H  HE1    . MET A  1  83  ? 323.359 254.512 279.454 1.00 158.40 ? 83  MET N HE1    1 
ATOM   1256   H  HE2    . MET A  1  83  ? 322.252 254.813 280.554 1.00 158.40 ? 83  MET N HE2    1 
ATOM   1257   H  HE3    . MET A  1  83  ? 323.792 254.945 280.920 1.00 158.40 ? 83  MET N HE3    1 
ATOM   1258   N  N      . THR A  1  84  ? 321.001 253.155 286.140 1.00 85.28  ? 84  THR N N      1 
ATOM   1259   C  CA     . THR A  1  84  ? 319.770 253.471 286.863 1.00 85.24  ? 84  THR N CA     1 
ATOM   1260   C  C      . THR A  1  84  ? 318.713 254.094 285.961 1.00 80.59  ? 84  THR N C      1 
ATOM   1261   O  O      . THR A  1  84  ? 317.519 253.865 286.173 1.00 79.88  ? 84  THR N O      1 
ATOM   1262   C  CB     . THR A  1  84  ? 320.057 254.401 288.040 1.00 90.16  ? 84  THR N CB     1 
ATOM   1263   O  OG1    . THR A  1  84  ? 321.131 253.866 288.826 1.00 103.10 ? 84  THR N OG1    1 
ATOM   1264   C  CG2    . THR A  1  84  ? 318.813 254.531 288.922 1.00 78.01  ? 84  THR N CG2    1 
ATOM   1265   H  H      . THR A  1  84  ? 321.680 253.638 286.352 1.00 72.34  ? 84  THR N H      1 
ATOM   1266   H  HA     . THR A  1  84  ? 319.402 252.648 287.221 1.00 72.72  ? 84  THR N HA     1 
ATOM   1267   H  HB     . THR A  1  84  ? 320.299 255.281 287.711 1.00 77.46  ? 84  THR N HB     1 
ATOM   1268   H  HG1    . THR A  1  84  ? 321.293 254.374 289.475 1.00 89.66  ? 84  THR N HG1    1 
ATOM   1269   H  HG21   . THR A  1  84  ? 318.997 255.122 289.669 1.00 65.63  ? 84  THR N HG21   1 
ATOM   1270   H  HG22   . THR A  1  84  ? 318.077 254.895 288.406 1.00 65.63  ? 84  THR N HG22   1 
ATOM   1271   H  HG23   . THR A  1  84  ? 318.558 253.660 289.265 1.00 65.63  ? 84  THR N HG23   1 
ATOM   1272   N  N      . ALA A  1  85  ? 319.118 254.887 284.968 1.00 86.61  ? 85  ALA N N      1 
ATOM   1273   C  CA     . ALA A  1  85  ? 318.139 255.477 284.061 1.00 89.09  ? 85  ALA N CA     1 
ATOM   1274   C  C      . ALA A  1  85  ? 317.334 254.395 283.349 1.00 77.85  ? 85  ALA N C      1 
ATOM   1275   O  O      . ALA A  1  85  ? 316.103 254.480 283.250 1.00 71.83  ? 85  ALA N O      1 
ATOM   1276   C  CB     . ALA A  1  85  ? 318.839 256.388 283.049 1.00 92.65  ? 85  ALA N CB     1 
ATOM   1277   H  H      . ALA A  1  85  ? 319.935 255.094 284.801 1.00 78.75  ? 85  ALA N H      1 
ATOM   1278   H  HA     . ALA A  1  85  ? 317.520 256.020 284.575 1.00 81.90  ? 85  ALA N HA     1 
ATOM   1279   H  HB1    . ALA A  1  85  ? 318.173 256.770 282.456 1.00 85.56  ? 85  ALA N HB1    1 
ATOM   1280   H  HB2    . ALA A  1  85  ? 319.301 257.094 283.528 1.00 85.56  ? 85  ALA N HB2    1 
ATOM   1281   H  HB3    . ALA A  1  85  ? 319.474 255.862 282.539 1.00 85.56  ? 85  ALA N HB3    1 
ATOM   1282   N  N      . ASP A  1  86  ? 318.021 253.359 282.848 1.00 72.84  ? 86  ASP N N      1 
ATOM   1283   C  CA     . ASP A  1  86  ? 317.332 252.252 282.189 1.00 71.51  ? 86  ASP N CA     1 
ATOM   1284   C  C      . ASP A  1  86  ? 316.434 251.491 283.153 1.00 65.71  ? 86  ASP N C      1 
ATOM   1285   O  O      . ASP A  1  86  ? 315.377 250.986 282.752 1.00 68.12  ? 86  ASP N O      1 
ATOM   1286   C  CB     . ASP A  1  86  ? 318.339 251.288 281.567 1.00 91.47  ? 86  ASP N CB     1 
ATOM   1287   C  CG     . ASP A  1  86  ? 318.973 251.835 280.310 1.00 118.50 ? 86  ASP N CG     1 
ATOM   1288   O  OD1    . ASP A  1  86  ? 318.972 251.124 279.284 1.00 110.26 ? 86  ASP N OD1    1 
ATOM   1289   O  OD2    . ASP A  1  86  ? 319.473 252.978 280.351 1.00 148.32 ? 86  ASP N OD2    1 
ATOM   1290   H  H      . ASP A  1  86  ? 318.877 253.278 282.879 1.00 74.80  ? 86  ASP N H      1 
ATOM   1291   H  HA     . ASP A  1  86  ? 316.776 252.606 281.477 1.00 73.61  ? 86  ASP N HA     1 
ATOM   1292   H  HB2    . ASP A  1  86  ? 319.046 251.113 282.208 1.00 93.08  ? 86  ASP N HB2    1 
ATOM   1293   H  HB3    . ASP A  1  86  ? 317.886 250.461 281.339 1.00 93.08  ? 86  ASP N HB3    1 
ATOM   1294   N  N      . SER A  1  87  ? 316.842 251.374 284.414 1.00 58.85  ? 87  SER N N      1 
ATOM   1295   C  CA     . SER A  1  87  ? 316.025 250.700 285.410 1.00 55.39  ? 87  SER N CA     1 
ATOM   1296   C  C      . SER A  1  87  ? 314.621 251.281 285.382 1.00 55.17  ? 87  SER N C      1 
ATOM   1297   O  O      . SER A  1  87  ? 313.680 250.619 284.936 1.00 58.31  ? 87  SER N O      1 
ATOM   1298   C  CB     . SER A  1  87  ? 316.637 250.839 286.808 1.00 70.80  ? 87  SER N CB     1 
ATOM   1299   O  OG     . SER A  1  87  ? 317.933 250.264 286.873 1.00 88.91  ? 87  SER N OG     1 
ATOM   1300   H  H      . SER A  1  87  ? 317.588 251.678 284.716 1.00 59.52  ? 87  SER N H      1 
ATOM   1301   H  HA     . SER A  1  87  ? 315.969 249.756 285.194 1.00 56.02  ? 87  SER N HA     1 
ATOM   1302   H  HB2    . SER A  1  87  ? 316.702 251.782 287.029 1.00 70.95  ? 87  SER N HB2    1 
ATOM   1303   H  HB3    . SER A  1  87  ? 316.063 250.390 287.447 1.00 70.95  ? 87  SER N HB3    1 
ATOM   1304   H  HG     . SER A  1  87  ? 318.248 250.352 287.647 1.00 88.40  ? 87  SER N HG     1 
ATOM   1305   N  N      . ARG A  1  88  ? 314.477 252.525 285.836 1.00 91.67  ? 88  ARG N N      1 
ATOM   1306   C  CA     . ARG A  1  88  ? 313.158 253.138 285.906 1.00 92.20  ? 88  ARG N CA     1 
ATOM   1307   C  C      . ARG A  1  88  ? 312.418 253.040 284.585 1.00 90.47  ? 88  ARG N C      1 
ATOM   1308   O  O      . ARG A  1  88  ? 311.191 252.900 284.573 1.00 93.20  ? 88  ARG N O      1 
ATOM   1309   C  CB     . ARG A  1  88  ? 313.271 254.600 286.318 1.00 95.08  ? 88  ARG N CB     1 
ATOM   1310   C  CG     . ARG A  1  88  ? 313.667 254.757 287.749 1.00 111.25 ? 88  ARG N CG     1 
ATOM   1311   C  CD     . ARG A  1  88  ? 313.924 256.195 288.125 1.00 145.67 ? 88  ARG N CD     1 
ATOM   1312   N  NE     . ARG A  1  88  ? 314.966 256.233 289.141 1.00 174.26 ? 88  ARG N NE     1 
ATOM   1313   C  CZ     . ARG A  1  88  ? 314.803 255.777 290.378 1.00 190.05 ? 88  ARG N CZ     1 
ATOM   1314   N  NH1    . ARG A  1  88  ? 313.636 255.261 290.748 1.00 196.13 ? 88  ARG N NH1    1 
ATOM   1315   N  NH2    . ARG A  1  88  ? 315.804 255.830 291.245 1.00 195.19 ? 88  ARG N NH2    1 
ATOM   1316   H  H      . ARG A  1  88  ? 315.120 253.028 286.107 1.00 76.15  ? 88  ARG N H      1 
ATOM   1317   H  HA     . ARG A  1  88  ? 312.631 252.677 286.578 1.00 77.27  ? 88  ARG N HA     1 
ATOM   1318   H  HB2    . ARG A  1  88  ? 313.944 255.034 285.770 1.00 80.31  ? 88  ARG N HB2    1 
ATOM   1319   H  HB3    . ARG A  1  88  ? 312.412 255.033 286.195 1.00 80.31  ? 88  ARG N HB3    1 
ATOM   1320   H  HG2    . ARG A  1  88  ? 312.953 254.421 288.313 1.00 96.08  ? 88  ARG N HG2    1 
ATOM   1321   H  HG3    . ARG A  1  88  ? 314.481 254.254 287.909 1.00 96.08  ? 88  ARG N HG3    1 
ATOM   1322   H  HD2    . ARG A  1  88  ? 314.228 256.689 287.347 1.00 130.59 ? 88  ARG N HD2    1 
ATOM   1323   H  HD3    . ARG A  1  88  ? 313.117 256.589 288.490 1.00 130.59 ? 88  ARG N HD3    1 
ATOM   1324   H  HE     . ARG A  1  88  ? 315.760 256.456 288.896 1.00 158.59 ? 88  ARG N HE     1 
ATOM   1325   H  HH11   . ARG A  1  88  ? 312.987 255.221 290.186 1.00 180.41 ? 88  ARG N HH11   1 
ATOM   1326   H  HH12   . ARG A  1  88  ? 313.531 254.967 291.549 1.00 180.41 ? 88  ARG N HH12   1 
ATOM   1327   H  HH21   . ARG A  1  88  ? 316.560 256.166 291.010 1.00 178.65 ? 88  ARG N HH21   1 
ATOM   1328   H  HH22   . ARG A  1  88  ? 315.694 255.540 292.047 1.00 178.65 ? 88  ARG N HH22   1 
ATOM   1329   N  N      . SER A  1  89  ? 313.132 253.110 283.464 1.00 79.27  ? 89  SER N N      1 
ATOM   1330   C  CA     . SER A  1  89  ? 312.447 253.036 282.181 1.00 87.59  ? 89  SER N CA     1 
ATOM   1331   C  C      . SER A  1  89  ? 311.818 251.664 281.975 1.00 99.63  ? 89  SER N C      1 
ATOM   1332   O  O      . SER A  1  89  ? 310.694 251.564 281.471 1.00 117.26 ? 89  SER N O      1 
ATOM   1333   C  CB     . SER A  1  89  ? 313.402 253.360 281.035 1.00 98.10  ? 89  SER N CB     1 
ATOM   1334   O  OG     . SER A  1  89  ? 312.712 253.291 279.796 1.00 105.11 ? 89  SER N OG     1 
ATOM   1335   H  H      . SER A  1  89  ? 313.987 253.197 283.419 1.00 72.32  ? 89  SER N H      1 
ATOM   1336   H  HA     . SER A  1  89  ? 311.735 253.694 282.169 1.00 81.08  ? 89  SER N HA     1 
ATOM   1337   H  HB2    . SER A  1  89  ? 313.752 254.257 281.156 1.00 91.52  ? 89  SER N HB2    1 
ATOM   1338   H  HB3    . SER A  1  89  ? 314.127 252.716 281.033 1.00 91.52  ? 89  SER N HB3    1 
ATOM   1339   H  HG     . SER A  1  89  ? 313.237 253.470 279.165 1.00 98.94  ? 89  SER N HG     1 
ATOM   1340   N  N      . GLN A  1  90  ? 312.517 250.594 282.360 1.00 60.44  ? 90  GLN N N      1 
ATOM   1341   C  CA     . GLN A  1  90  ? 311.938 249.272 282.185 1.00 47.16  ? 90  GLN N CA     1 
ATOM   1342   C  C      . GLN A  1  90  ? 310.930 248.920 283.273 1.00 46.94  ? 90  GLN N C      1 
ATOM   1343   O  O      . GLN A  1  90  ? 310.084 248.052 283.050 1.00 46.09  ? 90  GLN N O      1 
ATOM   1344   C  CB     . GLN A  1  90  ? 313.017 248.191 282.134 1.00 47.88  ? 90  GLN N CB     1 
ATOM   1345   C  CG     . GLN A  1  90  ? 312.423 246.841 281.778 1.00 64.86  ? 90  GLN N CG     1 
ATOM   1346   C  CD     . GLN A  1  90  ? 313.457 245.810 281.402 1.00 96.19  ? 90  GLN N CD     1 
ATOM   1347   O  OE1    . GLN A  1  90  ? 313.873 245.000 282.231 1.00 135.64 ? 90  GLN N OE1    1 
ATOM   1348   N  NE2    . GLN A  1  90  ? 313.866 245.819 280.137 1.00 100.07 ? 90  GLN N NE2    1 
ATOM   1349   H  H      . GLN A  1  90  ? 313.301 250.609 282.713 1.00 57.61  ? 90  GLN N H      1 
ATOM   1350   H  HA     . GLN A  1  90  ? 311.468 249.253 281.337 1.00 44.26  ? 90  GLN N HA     1 
ATOM   1351   H  HB2    . GLN A  1  90  ? 313.673 248.424 281.459 1.00 44.35  ? 90  GLN N HB2    1 
ATOM   1352   H  HB3    . GLN A  1  90  ? 313.440 248.119 283.004 1.00 44.35  ? 90  GLN N HB3    1 
ATOM   1353   H  HG2    . GLN A  1  90  ? 311.931 246.503 282.542 1.00 61.26  ? 90  GLN N HG2    1 
ATOM   1354   H  HG3    . GLN A  1  90  ? 311.825 246.951 281.023 1.00 61.26  ? 90  GLN N HG3    1 
ATOM   1355   H  HE21   . GLN A  1  90  ? 313.542 246.392 279.584 1.00 95.94  ? 90  GLN N HE21   1 
ATOM   1356   H  HE22   . GLN A  1  90  ? 314.455 245.251 279.872 1.00 95.94  ? 90  GLN N HE22   1 
ATOM   1357   N  N      . VAL A  1  91  ? 310.996 249.554 284.442 1.00 39.12  ? 91  VAL N N      1 
ATOM   1358   C  CA     . VAL A  1  91  ? 309.952 249.328 285.435 1.00 39.10  ? 91  VAL N CA     1 
ATOM   1359   C  C      . VAL A  1  91  ? 308.684 250.043 285.028 1.00 38.32  ? 91  VAL N C      1 
ATOM   1360   O  O      . VAL A  1  91  ? 307.583 249.584 285.339 1.00 39.02  ? 91  VAL N O      1 
ATOM   1361   C  CB     . VAL A  1  91  ? 310.388 249.775 286.835 1.00 40.74  ? 91  VAL N CB     1 
ATOM   1362   C  CG1    . VAL A  1  91  ? 309.166 249.919 287.760 1.00 40.96  ? 91  VAL N CG1    1 
ATOM   1363   C  CG2    . VAL A  1  91  ? 311.371 248.780 287.401 1.00 47.13  ? 91  VAL N CG2    1 
ATOM   1364   H  H      . VAL A  1  91  ? 311.615 250.103 284.679 1.00 44.94  ? 91  VAL N H      1 
ATOM   1365   H  HA     . VAL A  1  91  ? 309.757 248.379 285.473 1.00 45.05  ? 91  VAL N HA     1 
ATOM   1366   H  HB     . VAL A  1  91  ? 310.828 250.637 286.774 1.00 46.38  ? 91  VAL N HB     1 
ATOM   1367   H  HG11   . VAL A  1  91  ? 309.467 250.202 288.638 1.00 46.87  ? 91  VAL N HG11   1 
ATOM   1368   H  HG12   . VAL A  1  91  ? 308.564 250.582 287.387 1.00 46.87  ? 91  VAL N HG12   1 
ATOM   1369   H  HG13   . VAL A  1  91  ? 308.716 249.062 287.824 1.00 46.87  ? 91  VAL N HG13   1 
ATOM   1370   H  HG21   . VAL A  1  91  ? 311.641 249.072 288.286 1.00 52.09  ? 91  VAL N HG21   1 
ATOM   1371   H  HG22   . VAL A  1  91  ? 310.944 247.911 287.455 1.00 52.09  ? 91  VAL N HG22   1 
ATOM   1372   H  HG23   . VAL A  1  91  ? 312.145 248.734 286.818 1.00 52.09  ? 91  VAL N HG23   1 
ATOM   1373   N  N      . GLN A  1  92  ? 308.806 251.195 284.377 1.00 72.37  ? 92  GLN N N      1 
ATOM   1374   C  CA     . GLN A  1  92  ? 307.626 251.840 283.833 1.00 72.46  ? 92  GLN N CA     1 
ATOM   1375   C  C      . GLN A  1  92  ? 306.906 250.896 282.885 1.00 70.61  ? 92  GLN N C      1 
ATOM   1376   O  O      . GLN A  1  92  ? 305.685 250.730 282.952 1.00 70.75  ? 92  GLN N O      1 
ATOM   1377   C  CB     . GLN A  1  92  ? 308.018 253.125 283.110 1.00 97.39  ? 92  GLN N CB     1 
ATOM   1378   C  CG     . GLN A  1  92  ? 306.825 253.956 282.747 1.00 113.82 ? 92  GLN N CG     1 
ATOM   1379   C  CD     . GLN A  1  92  ? 306.026 254.317 283.973 1.00 128.21 ? 92  GLN N CD     1 
ATOM   1380   O  OE1    . GLN A  1  92  ? 304.938 253.789 284.198 1.00 147.96 ? 92  GLN N OE1    1 
ATOM   1381   N  NE2    . GLN A  1  92  ? 306.578 255.201 284.791 1.00 124.51 ? 92  GLN N NE2    1 
ATOM   1382   H  H      . GLN A  1  92  ? 309.545 251.613 284.241 1.00 61.73  ? 92  GLN N H      1 
ATOM   1383   H  HA     . GLN A  1  92  ? 307.021 252.068 284.556 1.00 62.41  ? 92  GLN N HA     1 
ATOM   1384   H  HB2    . GLN A  1  92  ? 308.590 253.654 283.688 1.00 87.58  ? 92  GLN N HB2    1 
ATOM   1385   H  HB3    . GLN A  1  92  ? 308.488 252.898 282.292 1.00 87.58  ? 92  GLN N HB3    1 
ATOM   1386   H  HG2    . GLN A  1  92  ? 307.121 254.776 282.323 1.00 104.58 ? 92  GLN N HG2    1 
ATOM   1387   H  HG3    . GLN A  1  92  ? 306.253 253.453 282.147 1.00 104.58 ? 92  GLN N HG3    1 
ATOM   1388   H  HE21   . GLN A  1  92  ? 307.349 255.533 284.608 1.00 115.23 ? 92  GLN N HE21   1 
ATOM   1389   H  HE22   . GLN A  1  92  ? 306.164 255.442 285.506 1.00 115.23 ? 92  GLN N HE22   1 
ATOM   1390   N  N      . ARG A  1  93  ? 307.667 250.250 282.002 1.00 55.13  ? 93  ARG N N      1 
ATOM   1391   C  CA     . ARG A  1  93  ? 307.082 249.366 281.009 1.00 53.94  ? 93  ARG N CA     1 
ATOM   1392   C  C      . ARG A  1  93  ? 306.568 248.075 281.646 1.00 54.37  ? 93  ARG N C      1 
ATOM   1393   O  O      . ARG A  1  93  ? 305.564 247.519 281.190 1.00 54.23  ? 93  ARG N O      1 
ATOM   1394   C  CB     . ARG A  1  93  ? 308.123 249.095 279.916 1.00 53.28  ? 93  ARG N CB     1 
ATOM   1395   C  CG     . ARG A  1  93  ? 307.693 248.218 278.723 1.00 62.89  ? 93  ARG N CG     1 
ATOM   1396   C  CD     . ARG A  1  93  ? 306.805 248.922 277.680 1.00 84.44  ? 93  ARG N CD     1 
ATOM   1397   N  NE     . ARG A  1  93  ? 306.313 247.969 276.678 1.00 114.03 ? 93  ARG N NE     1 
ATOM   1398   C  CZ     . ARG A  1  93  ? 305.048 247.852 276.275 1.00 151.80 ? 93  ARG N CZ     1 
ATOM   1399   N  NH1    . ARG A  1  93  ? 304.096 248.650 276.746 1.00 176.95 ? 93  ARG N NH1    1 
ATOM   1400   N  NH2    . ARG A  1  93  ? 304.728 246.937 275.367 1.00 167.26 ? 93  ARG N NH2    1 
ATOM   1401   H  H      . ARG A  1  93  ? 308.523 250.309 281.962 1.00 52.74  ? 93  ARG N H      1 
ATOM   1402   H  HA     . ARG A  1  93  ? 306.327 249.814 280.597 1.00 51.69  ? 93  ARG N HA     1 
ATOM   1403   H  HB2    . ARG A  1  93  ? 308.405 249.949 279.552 1.00 50.80  ? 93  ARG N HB2    1 
ATOM   1404   H  HB3    . ARG A  1  93  ? 308.885 248.659 280.329 1.00 50.80  ? 93  ARG N HB3    1 
ATOM   1405   H  HG2    . ARG A  1  93  ? 308.490 247.907 278.266 1.00 60.50  ? 93  ARG N HG2    1 
ATOM   1406   H  HG3    . ARG A  1  93  ? 307.196 247.458 279.064 1.00 60.50  ? 93  ARG N HG3    1 
ATOM   1407   H  HD2    . ARG A  1  93  ? 306.040 249.320 278.124 1.00 82.61  ? 93  ARG N HD2    1 
ATOM   1408   H  HD3    . ARG A  1  93  ? 307.323 249.604 277.224 1.00 82.61  ? 93  ARG N HD3    1 
ATOM   1409   H  HE     . ARG A  1  93  ? 306.890 247.441 276.321 1.00 112.24 ? 93  ARG N HE     1 
ATOM   1410   H  HH11   . ARG A  1  93  ? 304.287 249.246 277.335 1.00 175.94 ? 93  ARG N HH11   1 
ATOM   1411   H  HH12   . ARG A  1  93  ? 303.286 248.563 276.469 1.00 175.94 ? 93  ARG N HH12   1 
ATOM   1412   H  HH21   . ARG A  1  93  ? 305.335 246.418 275.047 1.00 165.82 ? 93  ARG N HH21   1 
ATOM   1413   H  HH22   . ARG A  1  93  ? 303.915 246.866 275.096 1.00 165.82 ? 93  ARG N HH22   1 
ATOM   1414   N  N      . ALA A  1  94  ? 307.222 247.589 282.701 1.00 53.77  ? 94  ALA N N      1 
ATOM   1415   C  CA     . ALA A  1  94  ? 306.718 246.413 283.406 1.00 54.84  ? 94  ALA N CA     1 
ATOM   1416   C  C      . ALA A  1  94  ? 305.337 246.681 283.982 1.00 55.74  ? 94  ALA N C      1 
ATOM   1417   O  O      . ALA A  1  94  ? 304.357 246.018 283.618 1.00 76.18  ? 94  ALA N O      1 
ATOM   1418   C  CB     . ALA A  1  94  ? 307.682 246.002 284.523 1.00 60.65  ? 94  ALA N CB     1 
ATOM   1419   H  H      . ALA A  1  94  ? 307.949 247.917 283.024 1.00 49.82  ? 94  ALA N H      1 
ATOM   1420   H  HA     . ALA A  1  94  ? 306.647 245.674 282.782 1.00 50.66  ? 94  ALA N HA     1 
ATOM   1421   H  HB1    . ALA A  1  94  ? 307.327 245.221 284.975 1.00 55.88  ? 94  ALA N HB1    1 
ATOM   1422   H  HB2    . ALA A  1  94  ? 308.546 245.795 284.133 1.00 55.88  ? 94  ALA N HB2    1 
ATOM   1423   H  HB3    . ALA A  1  94  ? 307.770 246.737 285.150 1.00 55.88  ? 94  ALA N HB3    1 
ATOM   1424   N  N      . ARG A  1  95  ? 305.247 247.647 284.900 1.00 49.28  ? 95  ARG N N      1 
ATOM   1425   C  CA     . ARG A  1  95  ? 303.978 248.036 285.494 1.00 50.74  ? 95  ARG N CA     1 
ATOM   1426   C  C      . ARG A  1  95  ? 302.902 248.115 284.427 1.00 56.12  ? 95  ARG N C      1 
ATOM   1427   O  O      . ARG A  1  95  ? 301.793 247.599 284.594 1.00 71.00  ? 95  ARG N O      1 
ATOM   1428   C  CB     . ARG A  1  95  ? 304.120 249.387 286.199 1.00 52.16  ? 95  ARG N CB     1 
ATOM   1429   C  CG     . ARG A  1  95  ? 304.757 249.306 287.557 1.00 53.98  ? 95  ARG N CG     1 
ATOM   1430   C  CD     . ARG A  1  95  ? 305.103 250.676 288.062 1.00 55.88  ? 95  ARG N CD     1 
ATOM   1431   N  NE     . ARG A  1  95  ? 305.684 250.605 289.392 1.00 58.03  ? 95  ARG N NE     1 
ATOM   1432   C  CZ     . ARG A  1  95  ? 306.462 251.544 289.916 1.00 73.50  ? 95  ARG N CZ     1 
ATOM   1433   N  NH1    . ARG A  1  95  ? 306.769 252.630 289.218 1.00 76.62  ? 95  ARG N NH1    1 
ATOM   1434   N  NH2    . ARG A  1  95  ? 306.943 251.392 291.143 1.00 83.93  ? 95  ARG N NH2    1 
ATOM   1435   H  H      . ARG A  1  95  ? 305.919 248.096 285.195 1.00 48.98  ? 95  ARG N H      1 
ATOM   1436   H  HA     . ARG A  1  95  ? 303.711 247.373 286.151 1.00 50.82  ? 95  ARG N HA     1 
ATOM   1437   H  HB2    . ARG A  1  95  ? 304.668 249.969 285.649 1.00 52.37  ? 95  ARG N HB2    1 
ATOM   1438   H  HB3    . ARG A  1  95  ? 303.238 249.775 286.309 1.00 52.37  ? 95  ARG N HB3    1 
ATOM   1439   H  HG2    . ARG A  1  95  ? 304.137 248.897 288.181 1.00 53.74  ? 95  ARG N HG2    1 
ATOM   1440   H  HG3    . ARG A  1  95  ? 305.573 248.785 287.500 1.00 53.74  ? 95  ARG N HG3    1 
ATOM   1441   H  HD2    . ARG A  1  95  ? 305.750 251.085 287.467 1.00 55.72  ? 95  ARG N HD2    1 
ATOM   1442   H  HD3    . ARG A  1  95  ? 304.298 251.215 288.109 1.00 55.72  ? 95  ARG N HD3    1 
ATOM   1443   H  HE     . ARG A  1  95  ? 305.541 249.895 289.856 1.00 57.42  ? 95  ARG N HE     1 
ATOM   1444   H  HH11   . ARG A  1  95  ? 306.458 252.732 288.422 1.00 76.09  ? 95  ARG N HH11   1 
ATOM   1445   H  HH12   . ARG A  1  95  ? 307.275 253.234 289.562 1.00 76.09  ? 95  ARG N HH12   1 
ATOM   1446   H  HH21   . ARG A  1  95  ? 306.748 250.688 291.597 1.00 82.71  ? 95  ARG N HH21   1 
ATOM   1447   H  HH22   . ARG A  1  95  ? 307.450 251.997 291.484 1.00 82.71  ? 95  ARG N HH22   1 
ATOM   1448   N  N      . TYR A  1  96  ? 303.233 248.751 283.308 1.00 63.87  ? 96  TYR N N      1 
ATOM   1449   C  CA     . TYR A  1  96  ? 302.230 248.990 282.283 1.00 66.87  ? 96  TYR N CA     1 
ATOM   1450   C  C      . TYR A  1  96  ? 301.666 247.681 281.734 1.00 77.80  ? 96  TYR N C      1 
ATOM   1451   O  O      . TYR A  1  96  ? 300.444 247.521 281.639 1.00 105.53 ? 96  TYR N O      1 
ATOM   1452   C  CB     . TYR A  1  96  ? 302.812 249.841 281.164 1.00 66.34  ? 96  TYR N CB     1 
ATOM   1453   C  CG     . TYR A  1  96  ? 301.835 250.014 280.045 1.00 60.26  ? 96  TYR N CG     1 
ATOM   1454   C  CD1    . TYR A  1  96  ? 301.692 249.036 279.078 1.00 67.25  ? 96  TYR N CD1    1 
ATOM   1455   C  CD2    . TYR A  1  96  ? 301.033 251.138 279.968 1.00 60.92  ? 96  TYR N CD2    1 
ATOM   1456   C  CE1    . TYR A  1  96  ? 300.791 249.169 278.062 1.00 89.63  ? 96  TYR N CE1    1 
ATOM   1457   C  CE2    . TYR A  1  96  ? 300.124 251.288 278.947 1.00 90.25  ? 96  TYR N CE2    1 
ATOM   1458   C  CZ     . TYR A  1  96  ? 300.008 250.296 277.993 1.00 104.95 ? 96  TYR N CZ     1 
ATOM   1459   O  OH     . TYR A  1  96  ? 299.105 250.426 276.964 1.00 130.90 ? 96  TYR N OH     1 
ATOM   1460   H  H      . TYR A  1  96  ? 304.018 249.049 283.121 1.00 59.18  ? 96  TYR N H      1 
ATOM   1461   H  HA     . TYR A  1  96  ? 301.494 249.485 282.677 1.00 62.66  ? 96  TYR N HA     1 
ATOM   1462   H  HB2    . TYR A  1  96  ? 303.035 250.719 281.512 1.00 62.29  ? 96  TYR N HB2    1 
ATOM   1463   H  HB3    . TYR A  1  96  ? 303.605 249.408 280.811 1.00 62.29  ? 96  TYR N HB3    1 
ATOM   1464   H  HD1    . TYR A  1  96  ? 302.220 248.271 279.122 1.00 63.60  ? 96  TYR N HD1    1 
ATOM   1465   H  HD2    . TYR A  1  96  ? 301.114 251.804 280.613 1.00 57.75  ? 96  TYR N HD2    1 
ATOM   1466   H  HE1    . TYR A  1  96  ? 300.711 248.504 277.416 1.00 86.35  ? 96  TYR N HE1    1 
ATOM   1467   H  HE2    . TYR A  1  96  ? 299.593 252.050 278.900 1.00 87.45  ? 96  TYR N HE2    1 
ATOM   1468   H  HH     . TYR A  1  96  ? 298.691 251.153 277.035 1.00 128.39 ? 96  TYR N HH     1 
ATOM   1469   N  N      . GLU A  1  97  ? 302.528 246.738 281.339 1.00 62.14  ? 97  GLU N N      1 
ATOM   1470   C  CA     . GLU A  1  97  ? 302.001 245.485 280.810 1.00 62.72  ? 97  GLU N CA     1 
ATOM   1471   C  C      . GLU A  1  97  ? 301.221 244.738 281.886 1.00 64.95  ? 97  GLU N C      1 
ATOM   1472   O  O      . GLU A  1  97  ? 300.050 244.392 281.692 1.00 77.16  ? 97  GLU N O      1 
ATOM   1473   C  CB     . GLU A  1  97  ? 303.117 244.600 280.234 1.00 62.66  ? 97  GLU N CB     1 
ATOM   1474   C  CG     . GLU A  1  97  ? 302.708 243.111 279.920 1.00 110.23 ? 97  GLU N CG     1 
ATOM   1475   C  CD     . GLU A  1  97  ? 301.917 242.901 278.619 1.00 124.69 ? 97  GLU N CD     1 
ATOM   1476   O  OE1    . GLU A  1  97  ? 301.862 243.831 277.775 1.00 177.13 ? 97  GLU N OE1    1 
ATOM   1477   O  OE2    . GLU A  1  97  ? 301.371 241.770 278.446 1.00 64.76  ? 97  GLU N OE2    1 
ATOM   1478   H  H      . GLU A  1  97  ? 303.386 246.798 281.365 1.00 62.59  ? 97  GLU N H      1 
ATOM   1479   H  HA     . GLU A  1  97  ? 301.386 245.688 280.088 1.00 63.09  ? 97  GLU N HA     1 
ATOM   1480   H  HB2    . GLU A  1  97  ? 303.427 244.997 279.405 1.00 62.57  ? 97  GLU N HB2    1 
ATOM   1481   H  HB3    . GLU A  1  97  ? 303.847 244.572 280.873 1.00 62.57  ? 97  GLU N HB3    1 
ATOM   1482   H  HG2    . GLU A  1  97  ? 303.516 242.578 279.858 1.00 109.92 ? 97  GLU N HG2    1 
ATOM   1483   H  HG3    . GLU A  1  97  ? 302.160 242.784 280.650 1.00 109.92 ? 97  GLU N HG3    1 
ATOM   1484   N  N      . ALA A  1  98  ? 301.843 244.495 283.042 1.00 40.04  ? 98  ALA N N      1 
ATOM   1485   C  CA     . ALA A  1  98  ? 301.183 243.701 284.073 1.00 39.47  ? 98  ALA N CA     1 
ATOM   1486   C  C      . ALA A  1  98  ? 299.863 244.310 284.522 1.00 40.26  ? 98  ALA N C      1 
ATOM   1487   O  O      . ALA A  1  98  ? 299.048 243.603 285.124 1.00 45.01  ? 98  ALA N O      1 
ATOM   1488   C  CB     . ALA A  1  98  ? 302.077 243.526 285.297 1.00 65.72  ? 98  ALA N CB     1 
ATOM   1489   H  H      . ALA A  1  98  ? 302.630 244.773 283.249 1.00 45.88  ? 98  ALA N H      1 
ATOM   1490   H  HA     . ALA A  1  98  ? 300.995 242.820 283.714 1.00 45.15  ? 98  ALA N HA     1 
ATOM   1491   H  HB1    . ALA A  1  98  ? 301.605 242.995 285.958 1.00 70.91  ? 98  ALA N HB1    1 
ATOM   1492   H  HB2    . ALA A  1  98  ? 302.892 243.074 285.030 1.00 70.91  ? 98  ALA N HB2    1 
ATOM   1493   H  HB3    . ALA A  1  98  ? 302.286 244.399 285.663 1.00 70.91  ? 98  ALA N HB3    1 
ATOM   1494   N  N      . ALA A  1  99  ? 299.637 245.597 284.265 1.00 54.14  ? 99  ALA N N      1 
ATOM   1495   C  CA     . ALA A  1  99  ? 298.323 246.184 284.494 1.00 55.00  ? 99  ALA N CA     1 
ATOM   1496   C  C      . ALA A  1  99  ? 297.441 246.052 283.259 1.00 54.25  ? 99  ALA N C      1 
ATOM   1497   O  O      . ALA A  1  99  ? 296.235 245.808 283.373 1.00 55.43  ? 99  ALA N O      1 
ATOM   1498   C  CB     . ALA A  1  99  ? 298.461 247.652 284.891 1.00 60.50  ? 99  ALA N CB     1 
ATOM   1499   H  H      . ALA A  1  99  ? 300.224 246.146 283.960 1.00 47.25  ? 99  ALA N H      1 
ATOM   1500   H  HA     . ALA A  1  99  ? 297.890 245.714 285.224 1.00 48.56  ? 99  ALA N HA     1 
ATOM   1501   H  HB1    . ALA A  1  99  ? 297.577 248.023 285.038 1.00 54.28  ? 99  ALA N HB1    1 
ATOM   1502   H  HB2    . ALA A  1  99  ? 298.985 247.711 285.704 1.00 54.28  ? 99  ALA N HB2    1 
ATOM   1503   H  HB3    . ALA A  1  99  ? 298.906 248.132 284.174 1.00 54.28  ? 99  ALA N HB3    1 
ATOM   1504   N  N      . ASN A  1  100 ? 298.037 246.220 282.077 1.00 53.10  ? 100 ASN N N      1 
ATOM   1505   C  CA     . ASN A  1  100 ? 297.329 245.921 280.844 1.00 52.19  ? 100 ASN N CA     1 
ATOM   1506   C  C      . ASN A  1  100 ? 296.834 244.479 280.844 1.00 54.05  ? 100 ASN N C      1 
ATOM   1507   O  O      . ASN A  1  100 ? 295.702 244.205 280.437 1.00 77.02  ? 100 ASN N O      1 
ATOM   1508   C  CB     . ASN A  1  100 ? 298.240 246.172 279.646 1.00 66.24  ? 100 ASN N CB     1 
ATOM   1509   C  CG     . ASN A  1  100 ? 297.500 246.124 278.330 1.00 66.42  ? 100 ASN N CG     1 
ATOM   1510   O  OD1    . ASN A  1  100 ? 297.486 245.099 277.641 1.00 49.28  ? 100 ASN N OD1    1 
ATOM   1511   N  ND2    . ASN A  1  100 ? 296.885 247.245 277.970 1.00 73.80  ? 100 ASN N ND2    1 
ATOM   1512   H  H      . ASN A  1  100 ? 298.842 246.504 281.968 1.00 50.48  ? 100 ASN N H      1 
ATOM   1513   H  HA     . ASN A  1  100 ? 296.558 246.505 280.768 1.00 49.83  ? 100 ASN N HA     1 
ATOM   1514   H  HB2    . ASN A  1  100 ? 298.641 247.050 279.733 1.00 63.84  ? 100 ASN N HB2    1 
ATOM   1515   H  HB3    . ASN A  1  100 ? 298.931 245.491 279.627 1.00 63.84  ? 100 ASN N HB3    1 
ATOM   1516   H  HD21   . ASN A  1  100 ? 296.448 247.277 277.230 1.00 72.13  ? 100 ASN N HD21   1 
ATOM   1517   H  HD22   . ASN A  1  100 ? 296.924 247.939 278.476 1.00 72.13  ? 100 ASN N HD22   1 
ATOM   1518   N  N      . TRP A  1  101 ? 297.673 243.544 281.294 1.00 37.42  ? 101 TRP N N      1 
ATOM   1519   C  CA     . TRP A  1  101 ? 297.259 242.148 281.380 1.00 38.18  ? 101 TRP N CA     1 
ATOM   1520   C  C      . TRP A  1  101 ? 295.934 242.019 282.114 1.00 39.24  ? 101 TRP N C      1 
ATOM   1521   O  O      . TRP A  1  101 ? 294.991 241.385 281.627 1.00 40.10  ? 101 TRP N O      1 
ATOM   1522   C  CB     . TRP A  1  101 ? 298.330 241.311 282.089 1.00 38.22  ? 101 TRP N CB     1 
ATOM   1523   C  CG     . TRP A  1  101 ? 297.952 239.854 282.342 1.00 39.38  ? 101 TRP N CG     1 
ATOM   1524   C  CD1    . TRP A  1  101 ? 297.155 239.355 283.343 1.00 40.52  ? 101 TRP N CD1    1 
ATOM   1525   C  CD2    . TRP A  1  101 ? 298.388 238.728 281.588 1.00 39.83  ? 101 TRP N CD2    1 
ATOM   1526   N  NE1    . TRP A  1  101 ? 297.076 237.988 283.242 1.00 41.66  ? 101 TRP N NE1    1 
ATOM   1527   C  CE2    . TRP A  1  101 ? 297.819 237.579 282.171 1.00 41.29  ? 101 TRP N CE2    1 
ATOM   1528   C  CE3    . TRP A  1  101 ? 299.203 238.581 280.466 1.00 39.39  ? 101 TRP N CE3    1 
ATOM   1529   C  CZ2    . TRP A  1  101 ? 298.034 236.309 281.672 1.00 42.37  ? 101 TRP N CZ2    1 
ATOM   1530   C  CZ3    . TRP A  1  101 ? 299.418 237.321 279.976 1.00 44.27  ? 101 TRP N CZ3    1 
ATOM   1531   C  CH2    . TRP A  1  101 ? 298.834 236.196 280.577 1.00 45.32  ? 101 TRP N CH2    1 
ATOM   1532   H  H      . TRP A  1  101 ? 298.480 243.693 281.553 1.00 45.17  ? 101 TRP N H      1 
ATOM   1533   H  HA     . TRP A  1  101 ? 297.144 241.795 280.484 1.00 45.68  ? 101 TRP N HA     1 
ATOM   1534   H  HB2    . TRP A  1  101 ? 299.133 241.314 281.545 1.00 45.14  ? 101 TRP N HB2    1 
ATOM   1535   H  HB3    . TRP A  1  101 ? 298.518 241.717 282.949 1.00 45.14  ? 101 TRP N HB3    1 
ATOM   1536   H  HD1    . TRP A  1  101 ? 296.736 239.868 283.996 1.00 47.07  ? 101 TRP N HD1    1 
ATOM   1537   H  HE1    . TRP A  1  101 ? 296.624 237.473 283.762 1.00 47.85  ? 101 TRP N HE1    1 
ATOM   1538   H  HE3    . TRP A  1  101 ? 299.592 239.322 280.060 1.00 45.50  ? 101 TRP N HE3    1 
ATOM   1539   H  HZ2    . TRP A  1  101 ? 297.651 235.561 282.070 1.00 47.99  ? 101 TRP N HZ2    1 
ATOM   1540   H  HZ3    . TRP A  1  101 ? 299.959 237.209 279.228 1.00 50.00  ? 101 TRP N HZ3    1 
ATOM   1541   H  HH2    . TRP A  1  101 ? 299.000 235.353 280.221 1.00 50.80  ? 101 TRP N HH2    1 
ATOM   1542   N  N      . LYS A  1  102 ? 295.850 242.596 283.302 1.00 46.79  ? 102 LYS N N      1 
ATOM   1543   C  CA     . LYS A  1  102 ? 294.653 242.380 284.081 1.00 48.09  ? 102 LYS N CA     1 
ATOM   1544   C  C      . LYS A  1  102 ? 293.446 242.936 283.374 1.00 48.64  ? 102 LYS N C      1 
ATOM   1545   O  O      . LYS A  1  102 ? 292.323 242.515 283.660 1.00 49.99  ? 102 LYS N O      1 
ATOM   1546   C  CB     . LYS A  1  102 ? 294.771 243.027 285.438 1.00 48.49  ? 102 LYS N CB     1 
ATOM   1547   C  CG     . LYS A  1  102 ? 293.814 242.434 286.405 1.00 50.10  ? 102 LYS N CG     1 
ATOM   1548   C  CD     . LYS A  1  102 ? 294.252 242.821 287.782 1.00 53.10  ? 102 LYS N CD     1 
ATOM   1549   C  CE     . LYS A  1  102 ? 293.447 242.164 288.877 1.00 79.54  ? 102 LYS N CE     1 
ATOM   1550   N  NZ     . LYS A  1  102 ? 293.945 242.669 290.188 1.00 108.37 ? 102 LYS N NZ     1 
ATOM   1551   H  H      . LYS A  1  102 ? 296.447 243.097 283.666 1.00 47.22  ? 102 LYS N H      1 
ATOM   1552   H  HA     . LYS A  1  102 ? 294.520 241.428 284.208 1.00 48.66  ? 102 LYS N HA     1 
ATOM   1553   H  HB2    . LYS A  1  102 ? 295.669 242.895 285.779 1.00 49.01  ? 102 LYS N HB2    1 
ATOM   1554   H  HB3    . LYS A  1  102 ? 294.577 243.974 285.359 1.00 49.01  ? 102 LYS N HB3    1 
ATOM   1555   H  HG2    . LYS A  1  102 ? 292.923 242.785 286.248 1.00 50.57  ? 102 LYS N HG2    1 
ATOM   1556   H  HG3    . LYS A  1  102 ? 293.824 241.467 286.332 1.00 50.57  ? 102 LYS N HG3    1 
ATOM   1557   H  HD2    . LYS A  1  102 ? 295.179 242.564 287.899 1.00 53.36  ? 102 LYS N HD2    1 
ATOM   1558   H  HD3    . LYS A  1  102 ? 294.161 243.782 287.881 1.00 53.36  ? 102 LYS N HD3    1 
ATOM   1559   H  HE2    . LYS A  1  102 ? 292.510 242.399 288.785 1.00 79.67  ? 102 LYS N HE2    1 
ATOM   1560   H  HE3    . LYS A  1  102 ? 293.567 241.202 288.844 1.00 79.67  ? 102 LYS N HE3    1 
ATOM   1561   H  HZ1    . LYS A  1  102 ? 293.484 242.295 290.852 1.00 108.28 ? 102 LYS N HZ1    1 
ATOM   1562   H  HZ2    . LYS A  1  102 ? 294.806 242.467 290.284 1.00 108.28 ? 102 LYS N HZ2    1 
ATOM   1563   H  HZ3    . LYS A  1  102 ? 293.848 243.552 290.230 1.00 108.28 ? 102 LYS N HZ3    1 
ATOM   1564   N  N      . TYR A  1  103 ? 293.660 243.865 282.451 1.00 48.40  ? 103 TYR N N      1 
ATOM   1565   C  CA     . TYR A  1  103 ? 292.557 244.503 281.753 1.00 49.20  ? 103 TYR N CA     1 
ATOM   1566   C  C      . TYR A  1  103 ? 292.011 243.642 280.623 1.00 49.72  ? 103 TYR N C      1 
ATOM   1567   O  O      . TYR A  1  103 ? 290.826 243.742 280.287 1.00 56.39  ? 103 TYR N O      1 
ATOM   1568   C  CB     . TYR A  1  103 ? 293.016 245.847 281.202 1.00 48.57  ? 103 TYR N CB     1 
ATOM   1569   C  CG     . TYR A  1  103 ? 291.927 246.582 280.495 1.00 49.69  ? 103 TYR N CG     1 
ATOM   1570   C  CD1    . TYR A  1  103 ? 290.639 246.561 280.985 1.00 51.30  ? 103 TYR N CD1    1 
ATOM   1571   C  CD2    . TYR A  1  103 ? 292.181 247.297 279.346 1.00 49.44  ? 103 TYR N CD2    1 
ATOM   1572   C  CE1    . TYR A  1  103 ? 289.637 247.221 280.358 1.00 52.66  ? 103 TYR N CE1    1 
ATOM   1573   C  CE2    . TYR A  1  103 ? 291.179 247.969 278.706 1.00 50.80  ? 103 TYR N CE2    1 
ATOM   1574   C  CZ     . TYR A  1  103 ? 289.903 247.927 279.219 1.00 63.39  ? 103 TYR N CZ     1 
ATOM   1575   O  OH     . TYR A  1  103 ? 288.878 248.599 278.592 1.00 64.56  ? 103 TYR N OH     1 
ATOM   1576   H  H      . TYR A  1  103 ? 294.438 244.143 282.210 1.00 49.24  ? 103 TYR N H      1 
ATOM   1577   H  HA     . TYR A  1  103 ? 291.837 244.665 282.382 1.00 50.51  ? 103 TYR N HA     1 
ATOM   1578   H  HB2    . TYR A  1  103 ? 293.324 246.401 281.936 1.00 50.13  ? 103 TYR N HB2    1 
ATOM   1579   H  HB3    . TYR A  1  103 ? 293.737 245.700 280.571 1.00 50.13  ? 103 TYR N HB3    1 
ATOM   1580   H  HD1    . TYR A  1  103 ? 290.455 246.082 281.760 1.00 53.51  ? 103 TYR N HD1    1 
ATOM   1581   H  HD2    . TYR A  1  103 ? 293.044 247.323 279.002 1.00 51.65  ? 103 TYR N HD2    1 
ATOM   1582   H  HE1    . TYR A  1  103 ? 288.774 247.197 280.703 1.00 55.25  ? 103 TYR N HE1    1 
ATOM   1583   H  HE2    . TYR A  1  103 ? 291.358 248.450 277.931 1.00 53.39  ? 103 TYR N HE2    1 
ATOM   1584   H  HH     . TYR A  1  103 ? 289.168 248.992 277.909 1.00 67.68  ? 103 TYR N HH     1 
ATOM   1585   N  N      . LYS A  1  104 ? 292.850 242.809 280.019 1.00 43.99  ? 104 LYS N N      1 
ATOM   1586   C  CA     . LYS A  1  104 ? 292.459 242.024 278.864 1.00 44.65  ? 104 LYS N CA     1 
ATOM   1587   C  C      . LYS A  1  104 ? 292.119 240.587 279.199 1.00 45.68  ? 104 LYS N C      1 
ATOM   1588   O  O      . LYS A  1  104 ? 291.720 239.849 278.301 1.00 46.61  ? 104 LYS N O      1 
ATOM   1589   C  CB     . LYS A  1  104 ? 293.566 242.014 277.824 1.00 43.64  ? 104 LYS N CB     1 
ATOM   1590   C  CG     . LYS A  1  104 ? 293.939 243.361 277.280 1.00 42.94  ? 104 LYS N CG     1 
ATOM   1591   C  CD     . LYS A  1  104 ? 295.151 243.221 276.374 1.00 42.05  ? 104 LYS N CD     1 
ATOM   1592   C  CE     . LYS A  1  104 ? 294.875 242.208 275.261 1.00 71.54  ? 104 LYS N CE     1 
ATOM   1593   N  NZ     . LYS A  1  104 ? 295.931 242.130 274.226 1.00 111.35 ? 104 LYS N NZ     1 
ATOM   1594   H  H      . LYS A  1  104 ? 293.663 242.681 280.266 1.00 50.02  ? 104 LYS N H      1 
ATOM   1595   H  HA     . LYS A  1  104 ? 291.675 242.429 278.461 1.00 50.68  ? 104 LYS N HA     1 
ATOM   1596   H  HB2    . LYS A  1  104 ? 294.361 241.630 278.225 1.00 49.51  ? 104 LYS N HB2    1 
ATOM   1597   H  HB3    . LYS A  1  104 ? 293.282 241.465 277.077 1.00 49.51  ? 104 LYS N HB3    1 
ATOM   1598   H  HG2    . LYS A  1  104 ? 293.203 243.719 276.760 1.00 49.10  ? 104 LYS N HG2    1 
ATOM   1599   H  HG3    . LYS A  1  104 ? 294.165 243.957 278.010 1.00 49.10  ? 104 LYS N HG3    1 
ATOM   1600   H  HD2    . LYS A  1  104 ? 295.350 244.078 275.967 1.00 47.98  ? 104 LYS N HD2    1 
ATOM   1601   H  HD3    . LYS A  1  104 ? 295.908 242.907 276.893 1.00 47.98  ? 104 LYS N HD3    1 
ATOM   1602   H  HE2    . LYS A  1  104 ? 294.786 241.327 275.658 1.00 77.36  ? 104 LYS N HE2    1 
ATOM   1603   H  HE3    . LYS A  1  104 ? 294.047 242.451 274.818 1.00 77.36  ? 104 LYS N HE3    1 
ATOM   1604   H  HZ1    . LYS A  1  104 ? 295.711 241.525 273.612 1.00 116.98 ? 104 LYS N HZ1    1 
ATOM   1605   H  HZ2    . LYS A  1  104 ? 296.029 242.921 273.832 1.00 116.98 ? 104 LYS N HZ2    1 
ATOM   1606   H  HZ3    . LYS A  1  104 ? 296.705 241.894 274.599 1.00 116.98 ? 104 LYS N HZ3    1 
ATOM   1607   N  N      . TYR A  1  105 ? 292.308 240.160 280.442 1.00 34.03  ? 105 TYR N N      1 
ATOM   1608   C  CA     . TYR A  1  105 ? 292.016 238.783 280.827 1.00 34.37  ? 105 TYR N CA     1 
ATOM   1609   C  C      . TYR A  1  105 ? 291.311 238.643 282.157 1.00 34.72  ? 105 TYR N C      1 
ATOM   1610   O  O      . TYR A  1  105 ? 290.713 237.590 282.403 1.00 36.35  ? 105 TYR N O      1 
ATOM   1611   C  CB     . TYR A  1  105 ? 293.303 237.962 280.860 1.00 34.90  ? 105 TYR N CB     1 
ATOM   1612   C  CG     . TYR A  1  105 ? 293.996 238.021 279.544 1.00 34.92  ? 105 TYR N CG     1 
ATOM   1613   C  CD1    . TYR A  1  105 ? 293.357 237.578 278.406 1.00 34.79  ? 105 TYR N CD1    1 
ATOM   1614   C  CD2    . TYR A  1  105 ? 295.264 238.540 279.427 1.00 35.07  ? 105 TYR N CD2    1 
ATOM   1615   C  CE1    . TYR A  1  105 ? 293.944 237.642 277.200 1.00 34.81  ? 105 TYR N CE1    1 
ATOM   1616   C  CE2    . TYR A  1  105 ? 295.876 238.608 278.213 1.00 35.09  ? 105 TYR N CE2    1 
ATOM   1617   C  CZ     . TYR A  1  105 ? 295.207 238.160 277.095 1.00 34.96  ? 105 TYR N CZ     1 
ATOM   1618   O  OH     . TYR A  1  105 ? 295.788 238.214 275.851 1.00 39.01  ? 105 TYR N OH     1 
ATOM   1619   H  H      . TYR A  1  105 ? 292.604 240.648 281.085 1.00 51.22  ? 105 TYR N H      1 
ATOM   1620   H  HA     . TYR A  1  105 ? 291.440 238.393 280.151 1.00 52.19  ? 105 TYR N HA     1 
ATOM   1621   H  HB2    . TYR A  1  105 ? 293.898 238.321 281.537 1.00 51.10  ? 105 TYR N HB2    1 
ATOM   1622   H  HB3    . TYR A  1  105 ? 293.090 237.035 281.054 1.00 51.10  ? 105 TYR N HB3    1 
ATOM   1623   H  HD1    . TYR A  1  105 ? 292.496 237.233 278.474 1.00 51.51  ? 105 TYR N HD1    1 
ATOM   1624   H  HD2    . TYR A  1  105 ? 295.707 238.848 280.185 1.00 48.74  ? 105 TYR N HD2    1 
ATOM   1625   H  HE1    . TYR A  1  105 ? 293.497 237.337 276.444 1.00 51.09  ? 105 TYR N HE1    1 
ATOM   1626   H  HE2    . TYR A  1  105 ? 296.734 238.960 278.139 1.00 48.29  ? 105 TYR N HE2    1 
ATOM   1627   H  HH     . TYR A  1  105 ? 296.557 238.548 275.907 1.00 56.98  ? 105 TYR N HH     1 
ATOM   1628   N  N      . GLY A  1  106 ? 291.361 239.637 283.027 1.00 62.56  ? 106 GLY N N      1 
ATOM   1629   C  CA     . GLY A  1  106 ? 290.517 239.658 284.196 1.00 63.80  ? 106 GLY N CA     1 
ATOM   1630   C  C      . GLY A  1  106 ? 291.126 239.106 285.463 1.00 64.86  ? 106 GLY N C      1 
ATOM   1631   O  O      . GLY A  1  106 ? 290.408 238.977 286.456 1.00 65.95  ? 106 GLY N O      1 
ATOM   1632   H  H      . GLY A  1  106 ? 291.883 240.317 282.959 1.00 58.35  ? 106 GLY N H      1 
ATOM   1633   H  HA2    . GLY A  1  106 ? 290.252 240.575 284.371 1.00 59.65  ? 106 GLY N HA2    1 
ATOM   1634   H  HA3    . GLY A  1  106 ? 289.714 239.148 284.008 1.00 59.65  ? 106 GLY N HA3    1 
ATOM   1635   N  N      . TYR A  1  107 ? 292.407 238.758 285.473 1.00 44.20  ? 107 TYR N N      1 
ATOM   1636   C  CA     . TYR A  1  107 ? 292.984 238.205 286.685 1.00 44.88  ? 107 TYR N CA     1 
ATOM   1637   C  C      . TYR A  1  107 ? 294.452 238.583 286.791 1.00 45.54  ? 107 TYR N C      1 
ATOM   1638   O  O      . TYR A  1  107 ? 295.115 238.871 285.794 1.00 51.53  ? 107 TYR N O      1 
ATOM   1639   C  CB     . TYR A  1  107 ? 292.828 236.685 286.737 1.00 46.44  ? 107 TYR N CB     1 
ATOM   1640   C  CG     . TYR A  1  107 ? 293.615 235.925 285.700 1.00 45.92  ? 107 TYR N CG     1 
ATOM   1641   C  CD1    . TYR A  1  107 ? 293.111 235.728 284.427 1.00 45.87  ? 107 TYR N CD1    1 
ATOM   1642   C  CD2    . TYR A  1  107 ? 294.850 235.381 286.002 1.00 45.84  ? 107 TYR N CD2    1 
ATOM   1643   C  CE1    . TYR A  1  107 ? 293.821 235.022 283.484 1.00 45.71  ? 107 TYR N CE1    1 
ATOM   1644   C  CE2    . TYR A  1  107 ? 295.567 234.675 285.064 1.00 45.71  ? 107 TYR N CE2    1 
ATOM   1645   C  CZ     . TYR A  1  107 ? 295.046 234.496 283.808 1.00 45.63  ? 107 TYR N CZ     1 
ATOM   1646   O  OH     . TYR A  1  107 ? 295.748 233.789 282.864 1.00 45.78  ? 107 TYR N OH     1 
ATOM   1647   H  H      . TYR A  1  107 ? 292.950 238.831 284.809 1.00 52.83  ? 107 TYR N H      1 
ATOM   1648   H  HA     . TYR A  1  107 ? 292.523 238.579 287.453 1.00 53.05  ? 107 TYR N HA     1 
ATOM   1649   H  HB2    . TYR A  1  107 ? 293.117 236.375 287.609 1.00 54.22  ? 107 TYR N HB2    1 
ATOM   1650   H  HB3    . TYR A  1  107 ? 291.891 236.468 286.610 1.00 54.22  ? 107 TYR N HB3    1 
ATOM   1651   H  HD1    . TYR A  1  107 ? 292.280 236.080 284.205 1.00 53.60  ? 107 TYR N HD1    1 
ATOM   1652   H  HD2    . TYR A  1  107 ? 295.205 235.499 286.854 1.00 52.81  ? 107 TYR N HD2    1 
ATOM   1653   H  HE1    . TYR A  1  107 ? 293.471 234.899 282.631 1.00 53.16  ? 107 TYR N HE1    1 
ATOM   1654   H  HE2    . TYR A  1  107 ? 296.397 234.317 285.282 1.00 52.39  ? 107 TYR N HE2    1 
ATOM   1655   H  HH     . TYR A  1  107 ? 296.476 233.524 283.187 1.00 52.41  ? 107 TYR N HH     1 
ATOM   1656   N  N      . GLU A  1  108 ? 294.947 238.587 288.023 1.00 45.38  ? 108 GLU N N      1 
ATOM   1657   C  CA     . GLU A  1  108 ? 296.312 239.014 288.243 1.00 44.39  ? 108 GLU N CA     1 
ATOM   1658   C  C      . GLU A  1  108 ? 297.251 238.163 287.407 1.00 43.88  ? 108 GLU N C      1 
ATOM   1659   O  O      . GLU A  1  108 ? 297.079 236.948 287.283 1.00 44.99  ? 108 GLU N O      1 
ATOM   1660   C  CB     . GLU A  1  108 ? 296.682 238.928 289.726 1.00 61.49  ? 108 GLU N CB     1 
ATOM   1661   C  CG     . GLU A  1  108 ? 298.013 239.599 290.072 1.00 103.98 ? 108 GLU N CG     1 
ATOM   1662   C  CD     . GLU A  1  108 ? 298.173 240.973 289.440 1.00 140.32 ? 108 GLU N CD     1 
ATOM   1663   O  OE1    . GLU A  1  108 ? 298.311 241.048 288.200 1.00 151.33 ? 108 GLU N OE1    1 
ATOM   1664   O  OE2    . GLU A  1  108 ? 298.164 241.976 290.186 1.00 157.87 ? 108 GLU N OE2    1 
ATOM   1665   H  H      . GLU A  1  108 ? 294.520 238.351 288.731 1.00 51.62  ? 108 GLU N H      1 
ATOM   1666   H  HA     . GLU A  1  108 ? 296.407 239.937 287.960 1.00 50.35  ? 108 GLU N HA     1 
ATOM   1667   H  HB2    . GLU A  1  108 ? 295.988 239.360 290.248 1.00 67.08  ? 108 GLU N HB2    1 
ATOM   1668   H  HB3    . GLU A  1  108 ? 296.748 237.993 289.978 1.00 67.08  ? 108 GLU N HB3    1 
ATOM   1669   H  HG2    . GLU A  1  108 ? 298.071 239.705 291.034 1.00 109.31 ? 108 GLU N HG2    1 
ATOM   1670   H  HG3    . GLU A  1  108 ? 298.739 239.039 289.756 1.00 109.31 ? 108 GLU N HG3    1 
ATOM   1671   N  N      . ILE A  1  109 ? 298.241 238.823 286.817 1.00 43.38  ? 109 ILE N N      1 
ATOM   1672   C  CA     . ILE A  1  109 ? 299.191 238.192 285.901 1.00 42.96  ? 109 ILE N CA     1 
ATOM   1673   C  C      . ILE A  1  109 ? 300.106 237.222 286.649 1.00 44.18  ? 109 ILE N C      1 
ATOM   1674   O  O      . ILE A  1  109 ? 300.429 237.462 287.823 1.00 44.77  ? 109 ILE N O      1 
ATOM   1675   C  CB     . ILE A  1  109 ? 300.011 239.263 285.164 1.00 41.38  ? 109 ILE N CB     1 
ATOM   1676   C  CG1    . ILE A  1  109 ? 301.072 238.599 284.299 1.00 41.25  ? 109 ILE N CG1    1 
ATOM   1677   C  CG2    . ILE A  1  109 ? 300.630 240.273 286.145 1.00 41.16  ? 109 ILE N CG2    1 
ATOM   1678   C  CD1    . ILE A  1  109 ? 301.892 239.552 283.525 1.00 43.84  ? 109 ILE N CD1    1 
ATOM   1679   H  H      . ILE A  1  109 ? 298.389 239.662 286.933 1.00 48.04  ? 109 ILE N H      1 
ATOM   1680   H  HA     . ILE A  1  109 ? 298.698 237.685 285.237 1.00 47.30  ? 109 ILE N HA     1 
ATOM   1681   H  HB     . ILE A  1  109 ? 299.409 239.748 284.578 1.00 45.90  ? 109 ILE N HB     1 
ATOM   1682   H  HG12   . ILE A  1  109 ? 301.669 238.091 284.871 1.00 45.39  ? 109 ILE N HG12   1 
ATOM   1683   H  HG13   . ILE A  1  109 ? 300.635 238.004 283.669 1.00 45.39  ? 109 ILE N HG13   1 
ATOM   1684   H  HG21   . ILE A  1  109 ? 301.138 240.930 285.642 1.00 45.64  ? 109 ILE N HG21   1 
ATOM   1685   H  HG22   . ILE A  1  109 ? 299.919 240.711 286.638 1.00 45.64  ? 109 ILE N HG22   1 
ATOM   1686   H  HG23   . ILE A  1  109 ? 301.215 239.800 286.757 1.00 45.64  ? 109 ILE N HG23   1 
ATOM   1687   H  HD11   . ILE A  1  109 ? 302.542 239.057 283.001 1.00 48.12  ? 109 ILE N HD11   1 
ATOM   1688   H  HD12   . ILE A  1  109 ? 301.313 240.062 282.937 1.00 48.12  ? 109 ILE N HD12   1 
ATOM   1689   H  HD13   . ILE A  1  109 ? 302.348 240.148 284.139 1.00 48.12  ? 109 ILE N HD13   1 
ATOM   1690   N  N      . PRO A  1  110 ? 300.542 236.119 286.040 1.00 69.57  ? 110 PRO N N      1 
ATOM   1691   C  CA     . PRO A  1  110 ? 301.596 235.315 286.669 1.00 71.15  ? 110 PRO N CA     1 
ATOM   1692   C  C      . PRO A  1  110 ? 302.923 236.050 286.637 1.00 72.15  ? 110 PRO N C      1 
ATOM   1693   O  O      . PRO A  1  110 ? 303.179 236.894 285.781 1.00 101.98 ? 110 PRO N O      1 
ATOM   1694   C  CB     . PRO A  1  110 ? 301.659 234.045 285.811 1.00 74.08  ? 110 PRO N CB     1 
ATOM   1695   C  CG     . PRO A  1  110 ? 300.415 234.032 285.020 1.00 74.22  ? 110 PRO N CG     1 
ATOM   1696   C  CD     . PRO A  1  110 ? 300.039 235.470 284.815 1.00 70.85  ? 110 PRO N CD     1 
ATOM   1697   H  HA     . PRO A  1  110 ? 301.362 235.087 287.582 1.00 64.77  ? 110 PRO N HA     1 
ATOM   1698   H  HB2    . PRO A  1  110 ? 302.433 234.084 285.228 1.00 67.40  ? 110 PRO N HB2    1 
ATOM   1699   H  HB3    . PRO A  1  110 ? 301.704 233.266 286.387 1.00 67.40  ? 110 PRO N HB3    1 
ATOM   1700   H  HG2    . PRO A  1  110 ? 300.577 233.598 284.168 1.00 68.05  ? 110 PRO N HG2    1 
ATOM   1701   H  HG3    . PRO A  1  110 ? 299.722 233.566 285.513 1.00 68.05  ? 110 PRO N HG3    1 
ATOM   1702   H  HD2    . PRO A  1  110 ? 300.484 235.830 284.032 1.00 65.29  ? 110 PRO N HD2    1 
ATOM   1703   H  HD3    . PRO A  1  110 ? 299.075 235.563 284.753 1.00 65.29  ? 110 PRO N HD3    1 
ATOM   1704   N  N      . VAL A  1  111 ? 303.793 235.708 287.584 1.00 43.96  ? 111 VAL N N      1 
ATOM   1705   C  CA     . VAL A  1  111 ? 305.118 236.317 287.576 1.00 43.57  ? 111 VAL N CA     1 
ATOM   1706   C  C      . VAL A  1  111 ? 305.928 235.772 286.413 1.00 43.53  ? 111 VAL N C      1 
ATOM   1707   O  O      . VAL A  1  111 ? 306.730 236.488 285.799 1.00 42.52  ? 111 VAL N O      1 
ATOM   1708   C  CB     . VAL A  1  111 ? 305.838 236.088 288.909 1.00 59.73  ? 111 VAL N CB     1 
ATOM   1709   C  CG1    . VAL A  1  111 ? 307.142 236.878 288.918 1.00 55.54  ? 111 VAL N CG1    1 
ATOM   1710   C  CG2    . VAL A  1  111 ? 304.939 236.469 290.068 1.00 72.39  ? 111 VAL N CG2    1 
ATOM   1711   H  H      . VAL A  1  111 ? 303.649 235.147 288.220 1.00 48.56  ? 111 VAL N H      1 
ATOM   1712   H  HA     . VAL A  1  111 ? 305.023 237.275 287.450 1.00 47.92  ? 111 VAL N HA     1 
ATOM   1713   H  HB     . VAL A  1  111 ? 306.055 235.146 288.993 1.00 63.51  ? 111 VAL N HB     1 
ATOM   1714   H  HG11   . VAL A  1  111 ? 307.595 236.729 289.763 1.00 59.11  ? 111 VAL N HG11   1 
ATOM   1715   H  HG12   . VAL A  1  111 ? 307.701 236.573 288.185 1.00 59.11  ? 111 VAL N HG12   1 
ATOM   1716   H  HG13   . VAL A  1  111 ? 306.941 237.820 288.811 1.00 59.11  ? 111 VAL N HG13   1 
ATOM   1717   H  HG21   . VAL A  1  111 ? 305.415 236.316 290.899 1.00 76.39  ? 111 VAL N HG21   1 
ATOM   1718   H  HG22   . VAL A  1  111 ? 304.704 237.407 289.989 1.00 76.39  ? 111 VAL N HG22   1 
ATOM   1719   H  HG23   . VAL A  1  111 ? 304.138 235.923 290.039 1.00 76.39  ? 111 VAL N HG23   1 
ATOM   1720   N  N      . ASP A  1  112 ? 305.758 234.485 286.123 1.00 66.86  ? 112 ASP N N      1 
ATOM   1721   C  CA     . ASP A  1  112 ? 306.271 233.863 284.914 1.00 68.61  ? 112 ASP N CA     1 
ATOM   1722   C  C      . ASP A  1  112 ? 306.099 234.794 283.722 1.00 66.01  ? 112 ASP N C      1 
ATOM   1723   O  O      . ASP A  1  112 ? 307.072 235.369 283.219 1.00 64.19  ? 112 ASP N O      1 
ATOM   1724   C  CB     . ASP A  1  112 ? 305.533 232.539 284.692 1.00 87.06  ? 112 ASP N CB     1 
ATOM   1725   C  CG     . ASP A  1  112 ? 305.946 231.834 283.414 1.00 119.34 ? 112 ASP N CG     1 
ATOM   1726   O  OD1    . ASP A  1  112 ? 307.063 232.090 282.923 1.00 144.77 ? 112 ASP N OD1    1 
ATOM   1727   O  OD2    . ASP A  1  112 ? 305.149 231.014 282.905 1.00 129.39 ? 112 ASP N OD2    1 
ATOM   1728   H  H      . ASP A  1  112 ? 305.333 233.936 286.632 1.00 55.74  ? 112 ASP N H      1 
ATOM   1729   H  HA     . ASP A  1  112 ? 307.216 233.674 285.023 1.00 57.29  ? 112 ASP N HA     1 
ATOM   1730   H  HB2    . ASP A  1  112 ? 305.721 231.944 285.435 1.00 75.57  ? 112 ASP N HB2    1 
ATOM   1731   H  HB3    . ASP A  1  112 ? 304.580 232.714 284.642 1.00 75.57  ? 112 ASP N HB3    1 
ATOM   1732   N  N      . MET A  1  113 ? 304.847 234.974 283.296 1.00 54.01  ? 113 MET N N      1 
ATOM   1733   C  CA     . MET A  1  113 ? 304.561 235.695 282.058 1.00 47.12  ? 113 MET N CA     1 
ATOM   1734   C  C      . MET A  1  113 ? 305.089 237.121 282.098 1.00 45.59  ? 113 MET N C      1 
ATOM   1735   O  O      . MET A  1  113 ? 305.688 237.591 281.125 1.00 44.94  ? 113 MET N O      1 
ATOM   1736   C  CB     . MET A  1  113 ? 303.056 235.688 281.796 1.00 46.85  ? 113 MET N CB     1 
ATOM   1737   C  CG     . MET A  1  113 ? 302.490 234.296 281.618 1.00 57.41  ? 113 MET N CG     1 
ATOM   1738   S  SD     . MET A  1  113 ? 303.337 233.349 280.332 1.00 70.19  ? 113 MET N SD     1 
ATOM   1739   C  CE     . MET A  1  113 ? 303.045 234.364 278.886 1.00 72.30  ? 113 MET N CE     1 
ATOM   1740   H  H      . MET A  1  113 ? 304.147 234.689 283.707 1.00 52.34  ? 113 MET N H      1 
ATOM   1741   H  HA     . MET A  1  113 ? 304.988 235.228 281.324 1.00 45.96  ? 113 MET N HA     1 
ATOM   1742   H  HB2    . MET A  1  113 ? 302.603 236.101 282.549 1.00 46.20  ? 113 MET N HB2    1 
ATOM   1743   H  HB3    . MET A  1  113 ? 302.875 236.190 280.986 1.00 46.20  ? 113 MET N HB3    1 
ATOM   1744   H  HG2    . MET A  1  113 ? 302.577 233.810 282.453 1.00 56.50  ? 113 MET N HG2    1 
ATOM   1745   H  HG3    . MET A  1  113 ? 301.554 234.365 281.371 1.00 56.50  ? 113 MET N HG3    1 
ATOM   1746   H  HE1    . MET A  1  113 ? 303.463 233.946 278.118 1.00 71.57  ? 113 MET N HE1    1 
ATOM   1747   H  HE2    . MET A  1  113 ? 302.089 234.440 278.743 1.00 71.57  ? 113 MET N HE2    1 
ATOM   1748   H  HE3    . MET A  1  113 ? 303.428 235.243 279.035 1.00 71.57  ? 113 MET N HE3    1 
ATOM   1749   N  N      . LEU A  1  114 ? 304.855 237.837 283.201 1.00 44.02  ? 114 LEU N N      1 
ATOM   1750   C  CA     . LEU A  1  114 ? 305.281 239.231 283.272 1.00 42.29  ? 114 LEU N CA     1 
ATOM   1751   C  C      . LEU A  1  114 ? 306.688 239.353 282.725 1.00 42.36  ? 114 LEU N C      1 
ATOM   1752   O  O      . LEU A  1  114 ? 306.988 240.256 281.938 1.00 41.42  ? 114 LEU N O      1 
ATOM   1753   C  CB     . LEU A  1  114 ? 305.254 239.788 284.699 1.00 42.62  ? 114 LEU N CB     1 
ATOM   1754   C  CG     . LEU A  1  114 ? 305.960 241.151 284.792 1.00 41.92  ? 114 LEU N CG     1 
ATOM   1755   C  CD1    . LEU A  1  114 ? 305.356 242.152 283.796 1.00 40.61  ? 114 LEU N CD1    1 
ATOM   1756   C  CD2    . LEU A  1  114 ? 305.940 241.721 286.191 1.00 42.60  ? 114 LEU N CD2    1 
ATOM   1757   H  H      . LEU A  1  114 ? 304.459 237.544 283.906 1.00 45.06  ? 114 LEU N H      1 
ATOM   1758   H  HA     . LEU A  1  114 ? 304.693 239.774 282.723 1.00 43.61  ? 114 LEU N HA     1 
ATOM   1759   H  HB2    . LEU A  1  114 ? 304.332 239.905 284.979 1.00 43.90  ? 114 LEU N HB2    1 
ATOM   1760   H  HB3    . LEU A  1  114 ? 305.708 239.170 285.292 1.00 43.90  ? 114 LEU N HB3    1 
ATOM   1761   H  HG     . LEU A  1  114 ? 306.890 241.027 284.546 1.00 43.35  ? 114 LEU N HG     1 
ATOM   1762   H  HD11   . LEU A  1  114 ? 305.821 242.999 283.878 1.00 42.67  ? 114 LEU N HD11   1 
ATOM   1763   H  HD12   . LEU A  1  114 ? 305.459 241.804 282.897 1.00 42.67  ? 114 LEU N HD12   1 
ATOM   1764   H  HD13   . LEU A  1  114 ? 304.415 242.270 283.999 1.00 42.67  ? 114 LEU N HD13   1 
ATOM   1765   H  HD21   . LEU A  1  114 ? 306.397 242.577 286.190 1.00 43.96  ? 114 LEU N HD21   1 
ATOM   1766   H  HD22   . LEU A  1  114 ? 305.018 241.839 286.470 1.00 43.96  ? 114 LEU N HD22   1 
ATOM   1767   H  HD23   . LEU A  1  114 ? 306.391 241.106 286.790 1.00 43.96  ? 114 LEU N HD23   1 
ATOM   1768   N  N      . CYS A  1  115 ? 307.561 238.438 283.128 1.00 55.77  ? 115 CYS N N      1 
ATOM   1769   C  CA     . CYS A  1  115 ? 308.947 238.557 282.719 1.00 64.45  ? 115 CYS N CA     1 
ATOM   1770   C  C      . CYS A  1  115 ? 309.116 238.175 281.261 1.00 56.37  ? 115 CYS N C      1 
ATOM   1771   O  O      . CYS A  1  115 ? 309.858 238.838 280.527 1.00 54.78  ? 115 CYS N O      1 
ATOM   1772   C  CB     . CYS A  1  115 ? 309.833 237.695 283.607 1.00 83.21  ? 115 CYS N CB     1 
ATOM   1773   S  SG     . CYS A  1  115 ? 311.409 238.492 283.950 1.00 96.69  ? 115 CYS N SG     1 
ATOM   1774   H  H      . CYS A  1  115 ? 307.381 237.758 283.623 1.00 48.40  ? 115 CYS N H      1 
ATOM   1775   H  HA     . CYS A  1  115 ? 309.228 239.480 282.821 1.00 56.70  ? 115 CYS N HA     1 
ATOM   1776   H  HB2    . CYS A  1  115 ? 309.382 237.538 284.452 1.00 74.72  ? 115 CYS N HB2    1 
ATOM   1777   H  HB3    . CYS A  1  115 ? 310.010 236.853 283.160 1.00 74.72  ? 115 CYS N HB3    1 
ATOM   1778   H  HG     . CYS A  1  115 ? 312.066 237.774 284.651 1.00 87.82  ? 115 CYS N HG     1 
ATOM   1779   N  N      . LYS A  1  116 ? 308.436 237.113 280.829 1.00 48.05  ? 116 LYS N N      1 
ATOM   1780   C  CA     . LYS A  1  116 ? 308.382 236.782 279.415 1.00 48.11  ? 116 LYS N CA     1 
ATOM   1781   C  C      . LYS A  1  116 ? 308.171 238.030 278.572 1.00 46.55  ? 116 LYS N C      1 
ATOM   1782   O  O      . LYS A  1  116 ? 308.968 238.348 277.682 1.00 46.62  ? 116 LYS N O      1 
ATOM   1783   C  CB     . LYS A  1  116 ? 307.252 235.793 279.160 1.00 50.41  ? 116 LYS N CB     1 
ATOM   1784   C  CG     . LYS A  1  116 ? 307.345 235.140 277.821 1.00 53.27  ? 116 LYS N CG     1 
ATOM   1785   C  CD     . LYS A  1  116 ? 306.610 233.834 277.839 1.00 56.71  ? 116 LYS N CD     1 
ATOM   1786   C  CE     . LYS A  1  116 ? 306.654 233.167 276.487 1.00 58.49  ? 116 LYS N CE     1 
ATOM   1787   N  NZ     . LYS A  1  116 ? 305.788 231.959 276.442 1.00 68.85  ? 116 LYS N NZ     1 
ATOM   1788   H  H      . LYS A  1  116 ? 308.001 236.572 281.337 1.00 44.57  ? 116 LYS N H      1 
ATOM   1789   H  HA     . LYS A  1  116 ? 309.217 236.369 279.148 1.00 44.73  ? 116 LYS N HA     1 
ATOM   1790   H  HB2    . LYS A  1  116 ? 307.283 235.097 279.836 1.00 47.11  ? 116 LYS N HB2    1 
ATOM   1791   H  HB3    . LYS A  1  116 ? 306.404 236.262 279.206 1.00 47.11  ? 116 LYS N HB3    1 
ATOM   1792   H  HG2    . LYS A  1  116 ? 306.941 235.713 277.151 1.00 49.88  ? 116 LYS N HG2    1 
ATOM   1793   H  HG3    . LYS A  1  116 ? 308.276 234.968 277.607 1.00 49.88  ? 116 LYS N HG3    1 
ATOM   1794   H  HD2    . LYS A  1  116 ? 307.024 233.241 278.486 1.00 53.11  ? 116 LYS N HD2    1 
ATOM   1795   H  HD3    . LYS A  1  116 ? 305.681 233.991 278.072 1.00 53.11  ? 116 LYS N HD3    1 
ATOM   1796   H  HE2    . LYS A  1  116 ? 306.341 233.790 275.812 1.00 54.78  ? 116 LYS N HE2    1 
ATOM   1797   H  HE3    . LYS A  1  116 ? 307.565 232.894 276.294 1.00 54.78  ? 116 LYS N HE3    1 
ATOM   1798   H  HZ1    . LYS A  1  116 ? 305.831 231.584 275.637 1.00 64.99  ? 116 LYS N HZ1    1 
ATOM   1799   H  HZ2    . LYS A  1  116 ? 306.058 231.369 277.051 1.00 64.99  ? 116 LYS N HZ2    1 
ATOM   1800   H  HZ3    . LYS A  1  116 ? 304.944 232.184 276.612 1.00 64.99  ? 116 LYS N HZ3    1 
ATOM   1801   N  N      . ARG A  1  117 ? 307.098 238.762 278.861 1.00 63.11  ? 117 ARG N N      1 
ATOM   1802   C  CA     . ARG A  1  117 ? 306.766 239.927 278.058 1.00 59.95  ? 117 ARG N CA     1 
ATOM   1803   C  C      . ARG A  1  117 ? 307.781 241.051 278.240 1.00 57.41  ? 117 ARG N C      1 
ATOM   1804   O  O      . ARG A  1  117 ? 308.003 241.833 277.312 1.00 55.85  ? 117 ARG N O      1 
ATOM   1805   C  CB     . ARG A  1  117 ? 305.360 240.402 278.406 1.00 58.61  ? 117 ARG N CB     1 
ATOM   1806   C  CG     . ARG A  1  117 ? 304.880 241.551 277.563 1.00 67.48  ? 117 ARG N CG     1 
ATOM   1807   C  CD     . ARG A  1  117 ? 304.467 241.143 276.185 1.00 80.65  ? 117 ARG N CD     1 
ATOM   1808   N  NE     . ARG A  1  117 ? 304.055 242.338 275.456 1.00 104.61 ? 117 ARG N NE     1 
ATOM   1809   C  CZ     . ARG A  1  117 ? 304.366 242.605 274.194 1.00 147.46 ? 117 ARG N CZ     1 
ATOM   1810   N  NH1    . ARG A  1  117 ? 305.103 241.763 273.477 1.00 157.72 ? 117 ARG N NH1    1 
ATOM   1811   N  NH2    . ARG A  1  117 ? 303.941 243.735 273.645 1.00 179.27 ? 117 ARG N NH2    1 
ATOM   1812   H  H      . ARG A  1  117 ? 306.555 238.606 279.509 1.00 56.95  ? 117 ARG N H      1 
ATOM   1813   H  HA     . ARG A  1  117 ? 306.770 239.673 277.122 1.00 54.35  ? 117 ARG N HA     1 
ATOM   1814   H  HB2    . ARG A  1  117 ? 304.742 239.665 278.281 1.00 53.56  ? 117 ARG N HB2    1 
ATOM   1815   H  HB3    . ARG A  1  117 ? 305.348 240.688 279.332 1.00 53.56  ? 117 ARG N HB3    1 
ATOM   1816   H  HG2    . ARG A  1  117 ? 304.114 241.959 277.996 1.00 63.00  ? 117 ARG N HG2    1 
ATOM   1817   H  HG3    . ARG A  1  117 ? 305.597 242.200 277.480 1.00 63.00  ? 117 ARG N HG3    1 
ATOM   1818   H  HD2    . ARG A  1  117 ? 305.216 240.736 275.722 1.00 76.32  ? 117 ARG N HD2    1 
ATOM   1819   H  HD3    . ARG A  1  117 ? 303.716 240.531 276.233 1.00 76.32  ? 117 ARG N HD3    1 
ATOM   1820   H  HE     . ARG A  1  117 ? 303.575 242.913 275.877 1.00 100.81 ? 117 ARG N HE     1 
ATOM   1821   H  HH11   . ARG A  1  117 ? 305.384 241.031 273.829 1.00 153.63 ? 117 ARG N HH11   1 
ATOM   1822   H  HH12   . ARG A  1  117 ? 305.296 241.949 272.660 1.00 153.63 ? 117 ARG N HH12   1 
ATOM   1823   H  HH21   . ARG A  1  117 ? 303.463 244.282 274.104 1.00 176.03 ? 117 ARG N HH21   1 
ATOM   1824   H  HH22   . ARG A  1  117 ? 304.135 243.914 272.827 1.00 176.03 ? 117 ARG N HH22   1 
ATOM   1825   N  N      . ILE A  1  118 ? 308.407 241.157 279.413 1.00 44.74  ? 118 ILE N N      1 
ATOM   1826   C  CA     . ILE A  1  118 ? 309.436 242.175 279.589 1.00 44.72  ? 118 ILE N CA     1 
ATOM   1827   C  C      . ILE A  1  118 ? 310.684 241.792 278.825 1.00 45.64  ? 118 ILE N C      1 
ATOM   1828   O  O      . ILE A  1  118 ? 311.380 242.658 278.284 1.00 45.60  ? 118 ILE N O      1 
ATOM   1829   C  CB     . ILE A  1  118 ? 309.738 242.390 281.079 1.00 45.19  ? 118 ILE N CB     1 
ATOM   1830   C  CG1    . ILE A  1  118 ? 308.601 243.189 281.703 1.00 64.99  ? 118 ILE N CG1    1 
ATOM   1831   C  CG2    . ILE A  1  118 ? 311.062 243.121 281.276 1.00 45.81  ? 118 ILE N CG2    1 
ATOM   1832   C  CD1    . ILE A  1  118 ? 308.521 243.037 283.179 1.00 99.24  ? 118 ILE N CD1    1 
ATOM   1833   H  H      . ILE A  1  118 ? 308.258 240.665 280.103 1.00 42.12  ? 118 ILE N H      1 
ATOM   1834   H  HA     . ILE A  1  118 ? 309.112 243.014 279.227 1.00 42.03  ? 118 ILE N HA     1 
ATOM   1835   H  HB     . ILE A  1  118 ? 309.790 241.525 281.516 1.00 42.25  ? 118 ILE N HB     1 
ATOM   1836   H  HG12   . ILE A  1  118 ? 308.734 244.130 281.507 1.00 62.57  ? 118 ILE N HG12   1 
ATOM   1837   H  HG13   . ILE A  1  118 ? 307.760 242.888 281.326 1.00 62.57  ? 118 ILE N HG13   1 
ATOM   1838   H  HG21   . ILE A  1  118 ? 311.219 243.239 282.226 1.00 42.59  ? 118 ILE N HG21   1 
ATOM   1839   H  HG22   . ILE A  1  118 ? 311.776 242.592 280.886 1.00 42.59  ? 118 ILE N HG22   1 
ATOM   1840   H  HG23   . ILE A  1  118 ? 311.013 243.985 280.839 1.00 42.59  ? 118 ILE N HG23   1 
ATOM   1841   H  HD11   . ILE A  1  118 ? 307.780 243.568 283.511 1.00 96.58  ? 118 ILE N HD11   1 
ATOM   1842   H  HD12   . ILE A  1  118 ? 308.379 242.101 283.392 1.00 96.58  ? 118 ILE N HD12   1 
ATOM   1843   H  HD13   . ILE A  1  118 ? 309.352 243.343 283.573 1.00 96.58  ? 118 ILE N HD13   1 
ATOM   1844   N  N      . ALA A  1  119 ? 311.004 240.501 278.780 1.00 48.57  ? 119 ALA N N      1 
ATOM   1845   C  CA     . ALA A  1  119 ? 312.135 240.059 277.979 1.00 51.25  ? 119 ALA N CA     1 
ATOM   1846   C  C      . ALA A  1  119 ? 311.851 240.213 276.493 1.00 57.29  ? 119 ALA N C      1 
ATOM   1847   O  O      . ALA A  1  119 ? 312.757 240.536 275.715 1.00 66.92  ? 119 ALA N O      1 
ATOM   1848   C  CB     . ALA A  1  119 ? 312.473 238.607 278.299 1.00 68.86  ? 119 ALA N CB     1 
ATOM   1849   H  H      . ALA A  1  119 ? 310.589 239.873 279.197 1.00 45.83  ? 119 ALA N H      1 
ATOM   1850   H  HA     . ALA A  1  119 ? 312.908 240.603 278.196 1.00 48.08  ? 119 ALA N HA     1 
ATOM   1851   H  HB1    . ALA A  1  119 ? 313.228 238.332 277.756 1.00 65.05  ? 119 ALA N HB1    1 
ATOM   1852   H  HB2    . ALA A  1  119 ? 312.698 238.536 279.240 1.00 65.05  ? 119 ALA N HB2    1 
ATOM   1853   H  HB3    . ALA A  1  119 ? 311.702 238.053 278.100 1.00 65.05  ? 119 ALA N HB3    1 
ATOM   1854   N  N      . ASP A  1  120 ? 310.594 240.002 276.088 1.00 55.21  ? 120 ASP N N      1 
ATOM   1855   C  CA     . ASP A  1  120 ? 310.243 240.071 274.674 1.00 55.59  ? 120 ASP N CA     1 
ATOM   1856   C  C      . ASP A  1  120 ? 310.333 241.491 274.142 1.00 52.33  ? 120 ASP N C      1 
ATOM   1857   O  O      . ASP A  1  120 ? 310.637 241.688 272.962 1.00 52.95  ? 120 ASP N O      1 
ATOM   1858   C  CB     . ASP A  1  120 ? 308.838 239.517 274.453 1.00 96.34  ? 120 ASP N CB     1 
ATOM   1859   C  CG     . ASP A  1  120 ? 308.791 238.002 274.523 1.00 134.36 ? 120 ASP N CG     1 
ATOM   1860   O  OD1    . ASP A  1  120 ? 307.965 237.467 275.295 1.00 145.92 ? 120 ASP N OD1    1 
ATOM   1861   O  OD2    . ASP A  1  120 ? 309.573 237.352 273.793 1.00 154.73 ? 120 ASP N OD2    1 
ATOM   1862   H  H      . ASP A  1  120 ? 309.935 239.820 276.610 1.00 55.68  ? 120 ASP N H      1 
ATOM   1863   H  HA     . ASP A  1  120 ? 310.864 239.522 274.169 1.00 56.36  ? 120 ASP N HA     1 
ATOM   1864   H  HB2    . ASP A  1  120 ? 308.248 239.868 275.138 1.00 97.43  ? 120 ASP N HB2    1 
ATOM   1865   H  HB3    . ASP A  1  120 ? 308.526 239.787 273.575 1.00 97.43  ? 120 ASP N HB3    1 
ATOM   1866   N  N      . ILE A  1  121 ? 310.061 242.489 274.982 1.00 64.48  ? 121 ILE N N      1 
ATOM   1867   C  CA     . ILE A  1  121 ? 310.285 243.865 274.564 1.00 66.57  ? 121 ILE N CA     1 
ATOM   1868   C  C      . ILE A  1  121 ? 311.776 244.136 274.440 1.00 66.99  ? 121 ILE N C      1 
ATOM   1869   O  O      . ILE A  1  121 ? 312.215 244.864 273.541 1.00 76.15  ? 121 ILE N O      1 
ATOM   1870   C  CB     . ILE A  1  121 ? 309.616 244.849 275.543 1.00 80.39  ? 121 ILE N CB     1 
ATOM   1871   C  CG1    . ILE A  1  121 ? 308.127 244.531 275.704 1.00 94.87  ? 121 ILE N CG1    1 
ATOM   1872   C  CG2    . ILE A  1  121 ? 309.798 246.279 275.054 1.00 90.76  ? 121 ILE N CG2    1 
ATOM   1873   C  CD1    . ILE A  1  121 ? 307.320 244.617 274.427 1.00 103.00 ? 121 ILE N CD1    1 
ATOM   1874   H  H      . ILE A  1  121 ? 309.754 242.397 275.780 1.00 63.78  ? 121 ILE N H      1 
ATOM   1875   H  HA     . ILE A  1  121 ? 309.885 243.996 273.690 1.00 66.23  ? 121 ILE N HA     1 
ATOM   1876   H  HB     . ILE A  1  121 ? 310.046 244.763 276.408 1.00 80.44  ? 121 ILE N HB     1 
ATOM   1877   H  HG12   . ILE A  1  121 ? 308.040 243.627 276.046 1.00 95.29  ? 121 ILE N HG12   1 
ATOM   1878   H  HG13   . ILE A  1  121 ? 307.744 245.157 276.337 1.00 95.29  ? 121 ILE N HG13   1 
ATOM   1879   H  HG21   . ILE A  1  121 ? 309.371 246.883 275.682 1.00 91.18  ? 121 ILE N HG21   1 
ATOM   1880   H  HG22   . ILE A  1  121 ? 310.746 246.475 274.998 1.00 91.18  ? 121 ILE N HG22   1 
ATOM   1881   H  HG23   . ILE A  1  121 ? 309.389 246.368 274.179 1.00 91.18  ? 121 ILE N HG23   1 
ATOM   1882   H  HD11   . ILE A  1  121 ? 306.395 244.401 274.624 1.00 103.82 ? 121 ILE N HD11   1 
ATOM   1883   H  HD12   . ILE A  1  121 ? 307.381 245.519 274.076 1.00 103.82 ? 121 ILE N HD12   1 
ATOM   1884   H  HD13   . ILE A  1  121 ? 307.678 243.985 273.784 1.00 103.82 ? 121 ILE N HD13   1 
ATOM   1885   N  N      . SER A  1  122 ? 312.579 243.552 275.330 1.00 52.40  ? 122 SER N N      1 
ATOM   1886   C  CA     . SER A  1  122 ? 314.009 243.836 275.316 1.00 60.42  ? 122 SER N CA     1 
ATOM   1887   C  C      . SER A  1  122 ? 314.681 243.201 274.109 1.00 74.62  ? 122 SER N C      1 
ATOM   1888   O  O      . SER A  1  122 ? 315.564 243.806 273.493 1.00 89.48  ? 122 SER N O      1 
ATOM   1889   C  CB     . SER A  1  122 ? 314.663 243.346 276.605 1.00 75.64  ? 122 SER N CB     1 
ATOM   1890   O  OG     . SER A  1  122 ? 315.900 244.010 276.821 1.00 89.79  ? 122 SER N OG     1 
ATOM   1891   H  H      . SER A  1  122 ? 312.326 243.000 275.939 1.00 52.36  ? 122 SER N H      1 
ATOM   1892   H  HA     . SER A  1  122 ? 314.139 244.796 275.261 1.00 59.96  ? 122 SER N HA     1 
ATOM   1893   H  HB2    . SER A  1  122 ? 314.070 243.529 277.350 1.00 74.65  ? 122 SER N HB2    1 
ATOM   1894   H  HB3    . SER A  1  122 ? 314.823 242.392 276.535 1.00 74.65  ? 122 SER N HB3    1 
ATOM   1895   H  HG     . SER A  1  122 ? 316.254 243.734 277.532 1.00 88.50  ? 122 SER N HG     1 
ATOM   1896   N  N      . GLN A  1  123 ? 314.275 241.982 273.752 1.00 63.22  ? 123 GLN N N      1 
ATOM   1897   C  CA     . GLN A  1  123 ? 314.885 241.307 272.610 1.00 60.65  ? 123 GLN N CA     1 
ATOM   1898   C  C      . GLN A  1  123 ? 314.789 242.159 271.353 1.00 50.81  ? 123 GLN N C      1 
ATOM   1899   O  O      . GLN A  1  123 ? 315.729 242.208 270.552 1.00 52.46  ? 123 GLN N O      1 
ATOM   1900   C  CB     . GLN A  1  123 ? 314.212 239.953 272.391 1.00 54.49  ? 123 GLN N CB     1 
ATOM   1901   C  CG     . GLN A  1  123 ? 314.815 239.148 271.258 1.00 58.42  ? 123 GLN N CG     1 
ATOM   1902   C  CD     . GLN A  1  123 ? 314.186 239.461 269.917 1.00 61.21  ? 123 GLN N CD     1 
ATOM   1903   O  OE1    . GLN A  1  123 ? 313.255 240.260 269.825 1.00 63.51  ? 123 GLN N OE1    1 
ATOM   1904   N  NE2    . GLN A  1  123 ? 314.697 238.833 268.865 1.00 66.93  ? 123 GLN N NE2    1 
ATOM   1905   H  H      . GLN A  1  123 ? 313.658 241.532 274.148 1.00 60.92  ? 123 GLN N H      1 
ATOM   1906   H  HA     . GLN A  1  123 ? 315.823 241.150 272.798 1.00 58.04  ? 123 GLN N HA     1 
ATOM   1907   H  HB2    . GLN A  1  123 ? 314.293 239.429 273.203 1.00 51.71  ? 123 GLN N HB2    1 
ATOM   1908   H  HB3    . GLN A  1  123 ? 313.275 240.099 272.186 1.00 51.71  ? 123 GLN N HB3    1 
ATOM   1909   H  HG2    . GLN A  1  123 ? 315.763 239.347 271.199 1.00 55.26  ? 123 GLN N HG2    1 
ATOM   1910   H  HG3    . GLN A  1  123 ? 314.685 238.204 271.437 1.00 55.26  ? 123 GLN N HG3    1 
ATOM   1911   H  HE21   . GLN A  1  123 ? 315.350 238.284 268.968 1.00 63.90  ? 123 GLN N HE21   1 
ATOM   1912   H  HE22   . GLN A  1  123 ? 314.375 238.977 268.081 1.00 63.90  ? 123 GLN N HE22   1 
ATOM   1913   N  N      . VAL A  1  124 ? 313.657 242.837 271.164 1.00 55.17  ? 124 VAL N N      1 
ATOM   1914   C  CA     . VAL A  1  124 ? 313.435 243.639 269.965 1.00 59.84  ? 124 VAL N CA     1 
ATOM   1915   C  C      . VAL A  1  124 ? 314.563 244.630 269.758 1.00 56.52  ? 124 VAL N C      1 
ATOM   1916   O  O      . VAL A  1  124 ? 314.938 244.930 268.619 1.00 57.13  ? 124 VAL N O      1 
ATOM   1917   C  CB     . VAL A  1  124 ? 312.077 244.360 270.064 1.00 60.89  ? 124 VAL N CB     1 
ATOM   1918   C  CG1    . VAL A  1  124 ? 311.863 245.265 268.862 1.00 67.44  ? 124 VAL N CG1    1 
ATOM   1919   C  CG2    . VAL A  1  124 ? 310.955 243.341 270.192 1.00 58.23  ? 124 VAL N CG2    1 
ATOM   1920   H  H      . VAL A  1  124 ? 313.001 242.848 271.719 1.00 53.99  ? 124 VAL N H      1 
ATOM   1921   H  HA     . VAL A  1  124 ? 313.407 243.051 269.193 1.00 59.08  ? 124 VAL N HA     1 
ATOM   1922   H  HB     . VAL A  1  124 ? 312.071 244.913 270.860 1.00 60.78  ? 124 VAL N HB     1 
ATOM   1923   H  HG11   . VAL A  1  124 ? 311.004 245.706 268.948 1.00 67.74  ? 124 VAL N HG11   1 
ATOM   1924   H  HG12   . VAL A  1  124 ? 312.573 245.926 268.834 1.00 67.74  ? 124 VAL N HG12   1 
ATOM   1925   H  HG13   . VAL A  1  124 ? 311.880 244.727 268.055 1.00 67.74  ? 124 VAL N HG13   1 
ATOM   1926   H  HG21   . VAL A  1  124 ? 310.108 243.811 270.253 1.00 58.19  ? 124 VAL N HG21   1 
ATOM   1927   H  HG22   . VAL A  1  124 ? 310.959 242.767 269.410 1.00 58.19  ? 124 VAL N HG22   1 
ATOM   1928   H  HG23   . VAL A  1  124 ? 311.099 242.812 270.992 1.00 58.19  ? 124 VAL N HG23   1 
ATOM   1929   N  N      . TYR A  1  125 ? 315.101 245.176 270.847 1.00 76.91  ? 125 TYR N N      1 
ATOM   1930   C  CA     . TYR A  1  125 ? 316.237 246.077 270.734 1.00 81.93  ? 125 TYR N CA     1 
ATOM   1931   C  C      . TYR A  1  125 ? 317.488 245.346 270.268 1.00 89.77  ? 125 TYR N C      1 
ATOM   1932   O  O      . TYR A  1  125 ? 318.364 245.951 269.640 1.00 94.05  ? 125 TYR N O      1 
ATOM   1933   C  CB     . TYR A  1  125 ? 316.514 246.737 272.077 1.00 77.81  ? 125 TYR N CB     1 
ATOM   1934   C  CG     . TYR A  1  125 ? 315.378 247.539 272.645 1.00 72.99  ? 125 TYR N CG     1 
ATOM   1935   C  CD1    . TYR A  1  125 ? 315.332 247.811 273.996 1.00 72.00  ? 125 TYR N CD1    1 
ATOM   1936   C  CD2    . TYR A  1  125 ? 314.361 248.029 271.843 1.00 72.11  ? 125 TYR N CD2    1 
ATOM   1937   C  CE1    . TYR A  1  125 ? 314.315 248.541 274.542 1.00 70.41  ? 125 TYR N CE1    1 
ATOM   1938   C  CE2    . TYR A  1  125 ? 313.330 248.765 272.384 1.00 70.34  ? 125 TYR N CE2    1 
ATOM   1939   C  CZ     . TYR A  1  125 ? 313.316 249.022 273.741 1.00 75.71  ? 125 TYR N CZ     1 
ATOM   1940   O  OH     . TYR A  1  125 ? 312.306 249.760 274.321 1.00 89.47  ? 125 TYR N OH     1 
ATOM   1941   H  H      . TYR A  1  125 ? 314.829 245.042 271.651 1.00 65.60  ? 125 TYR N H      1 
ATOM   1942   H  HA     . TYR A  1  125 ? 316.033 246.772 270.089 1.00 70.48  ? 125 TYR N HA     1 
ATOM   1943   H  HB2    . TYR A  1  125 ? 316.732 246.045 272.720 1.00 66.31  ? 125 TYR N HB2    1 
ATOM   1944   H  HB3    . TYR A  1  125 ? 317.270 247.335 271.975 1.00 66.31  ? 125 TYR N HB3    1 
ATOM   1945   H  HD1    . TYR A  1  125 ? 316.009 247.491 274.548 1.00 60.99  ? 125 TYR N HD1    1 
ATOM   1946   H  HD2    . TYR A  1  125 ? 314.373 247.857 270.929 1.00 61.72  ? 125 TYR N HD2    1 
ATOM   1947   H  HE1    . TYR A  1  125 ? 314.304 248.715 275.455 1.00 59.88  ? 125 TYR N HE1    1 
ATOM   1948   H  HE2    . TYR A  1  125 ? 312.651 249.092 271.839 1.00 60.43  ? 125 TYR N HE2    1 
ATOM   1949   H  HH     . TYR A  1  125 ? 311.753 250.000 273.736 1.00 79.93  ? 125 TYR N HH     1 
ATOM   1950   N  N      . THR A  1  126 ? 317.602 244.058 270.578 1.00 61.90  ? 126 THR N N      1 
ATOM   1951   C  CA     . THR A  1  126 ? 318.783 243.319 270.165 1.00 60.71  ? 126 THR N CA     1 
ATOM   1952   C  C      . THR A  1  126 ? 318.801 243.121 268.658 1.00 63.25  ? 126 THR N C      1 
ATOM   1953   O  O      . THR A  1  126 ? 319.878 243.095 268.053 1.00 65.49  ? 126 THR N O      1 
ATOM   1954   C  CB     . THR A  1  126 ? 318.831 241.971 270.888 1.00 79.37  ? 126 THR N CB     1 
ATOM   1955   O  OG1    . THR A  1  126 ? 318.936 242.192 272.300 1.00 92.80  ? 126 THR N OG1    1 
ATOM   1956   C  CG2    . THR A  1  126 ? 320.020 241.152 270.430 1.00 86.17  ? 126 THR N CG2    1 
ATOM   1957   H  H      . THR A  1  126 ? 317.022 243.600 271.017 1.00 57.04  ? 126 THR N H      1 
ATOM   1958   H  HA     . THR A  1  126 ? 319.574 243.822 270.413 1.00 55.22  ? 126 THR N HA     1 
ATOM   1959   H  HB     . THR A  1  126 ? 318.021 241.472 270.698 1.00 73.37  ? 126 THR N HB     1 
ATOM   1960   H  HG1    . THR A  1  126 ? 318.963 241.456 272.704 1.00 86.68  ? 126 THR N HG1    1 
ATOM   1961   H  HG21   . THR A  1  126 ? 320.037 240.302 270.897 1.00 79.49  ? 126 THR N HG21   1 
ATOM   1962   H  HG22   . THR A  1  126 ? 319.961 240.987 269.476 1.00 79.49  ? 126 THR N HG22   1 
ATOM   1963   H  HG23   . THR A  1  126 ? 320.843 241.630 270.617 1.00 79.49  ? 126 THR N HG23   1 
ATOM   1964   N  N      . GLN A  1  127 ? 317.624 243.019 268.036 1.00 58.58  ? 127 GLN N N      1 
ATOM   1965   C  CA     . GLN A  1  127 ? 317.512 242.647 266.631 1.00 60.48  ? 127 GLN N CA     1 
ATOM   1966   C  C      . GLN A  1  127 ? 317.390 243.834 265.681 1.00 71.30  ? 127 GLN N C      1 
ATOM   1967   O  O      . GLN A  1  127 ? 317.697 243.684 264.494 1.00 81.94  ? 127 GLN N O      1 
ATOM   1968   C  CB     . GLN A  1  127 ? 316.303 241.735 266.432 1.00 61.44  ? 127 GLN N CB     1 
ATOM   1969   C  CG     . GLN A  1  127 ? 316.243 241.116 265.065 1.00 66.58  ? 127 GLN N CG     1 
ATOM   1970   C  CD     . GLN A  1  127 ? 315.200 240.027 264.970 1.00 88.38  ? 127 GLN N CD     1 
ATOM   1971   O  OE1    . GLN A  1  127 ? 314.249 239.981 265.754 1.00 97.60  ? 127 GLN N OE1    1 
ATOM   1972   N  NE2    . GLN A  1  127 ? 315.375 239.136 264.002 1.00 104.75 ? 127 GLN N NE2    1 
ATOM   1973   H  H      . GLN A  1  127 ? 316.867 243.164 268.416 1.00 59.59  ? 127 GLN N H      1 
ATOM   1974   H  HA     . GLN A  1  127 ? 318.304 242.148 266.378 1.00 61.52  ? 127 GLN N HA     1 
ATOM   1975   H  HB2    . GLN A  1  127 ? 316.342 241.017 267.083 1.00 62.64  ? 127 GLN N HB2    1 
ATOM   1976   H  HB3    . GLN A  1  127 ? 315.494 242.254 266.560 1.00 62.64  ? 127 GLN N HB3    1 
ATOM   1977   H  HG2    . GLN A  1  127 ? 316.021 241.802 264.416 1.00 67.68  ? 127 GLN N HG2    1 
ATOM   1978   H  HG3    . GLN A  1  127 ? 317.106 240.726 264.856 1.00 67.68  ? 127 GLN N HG3    1 
ATOM   1979   H  HE21   . GLN A  1  127 ? 316.052 239.201 263.476 1.00 105.55 ? 127 GLN N HE21   1 
ATOM   1980   H  HE22   . GLN A  1  127 ? 314.812 238.495 263.901 1.00 105.55 ? 127 GLN N HE22   1 
ATOM   1981   N  N      . ASN A  1  128 ? 316.941 244.991 266.158 1.00 80.48  ? 128 ASN N N      1 
ATOM   1982   C  CA     . ASN A  1  128 ? 316.992 246.216 265.371 1.00 79.81  ? 128 ASN N CA     1 
ATOM   1983   C  C      . ASN A  1  128 ? 318.309 246.937 265.615 1.00 72.88  ? 128 ASN N C      1 
ATOM   1984   O  O      . ASN A  1  128 ? 318.928 246.805 266.674 1.00 72.42  ? 128 ASN N O      1 
ATOM   1985   C  CB     . ASN A  1  128 ? 315.841 247.151 265.727 1.00 73.82  ? 128 ASN N CB     1 
ATOM   1986   C  CG     . ASN A  1  128 ? 314.495 246.533 265.474 1.00 69.15  ? 128 ASN N CG     1 
ATOM   1987   O  OD1    . ASN A  1  128 ? 314.395 245.375 265.071 1.00 70.80  ? 128 ASN N OD1    1 
ATOM   1988   N  ND2    . ASN A  1  128 ? 313.442 247.306 265.719 1.00 67.07  ? 128 ASN N ND2    1 
ATOM   1989   H  H      . ASN A  1  128 ? 316.600 245.092 266.941 1.00 69.92  ? 128 ASN N H      1 
ATOM   1990   H  HA     . ASN A  1  128 ? 316.930 245.998 264.428 1.00 69.63  ? 128 ASN N HA     1 
ATOM   1991   H  HB2    . ASN A  1  128 ? 315.896 247.376 266.669 1.00 64.27  ? 128 ASN N HB2    1 
ATOM   1992   H  HB3    . ASN A  1  128 ? 315.908 247.955 265.189 1.00 64.27  ? 128 ASN N HB3    1 
ATOM   1993   H  HD21   . ASN A  1  128 ? 312.647 247.003 265.592 1.00 58.35  ? 128 ASN N HD21   1 
ATOM   1994   H  HD22   . ASN A  1  128 ? 313.555 248.109 266.006 1.00 58.35  ? 128 ASN N HD22   1 
ATOM   1995   N  N      . ALA A  1  129 ? 318.723 247.727 264.632 1.00 52.58  ? 129 ALA N N      1 
ATOM   1996   C  CA     . ALA A  1  129 ? 319.989 248.438 264.697 1.00 54.18  ? 129 ALA N CA     1 
ATOM   1997   C  C      . ALA A  1  129 ? 319.825 249.904 265.077 1.00 61.13  ? 129 ALA N C      1 
ATOM   1998   O  O      . ALA A  1  129 ? 320.814 250.641 265.094 1.00 55.43  ? 129 ALA N O      1 
ATOM   1999   C  CB     . ALA A  1  129 ? 320.726 248.319 263.360 1.00 56.72  ? 129 ALA N CB     1 
ATOM   2000   H  H      . ALA A  1  129 ? 318.281 247.868 263.908 1.00 55.38  ? 129 ALA N H      1 
ATOM   2001   H  HA     . ALA A  1  129 ? 320.543 248.021 265.375 1.00 56.72  ? 129 ALA N HA     1 
ATOM   2002   H  HB1    . ALA A  1  129 ? 321.567 248.799 263.419 1.00 59.04  ? 129 ALA N HB1    1 
ATOM   2003   H  HB2    . ALA A  1  129 ? 320.891 247.382 263.173 1.00 59.04  ? 129 ALA N HB2    1 
ATOM   2004   H  HB3    . ALA A  1  129 ? 320.174 248.704 262.661 1.00 59.04  ? 129 ALA N HB3    1 
ATOM   2005   N  N      . GLU A  1  130 ? 318.612 250.346 265.395 1.00 76.99  ? 130 GLU N N      1 
ATOM   2006   C  CA     . GLU A  1  130 ? 318.394 251.751 265.704 1.00 75.94  ? 130 GLU N CA     1 
ATOM   2007   C  C      . GLU A  1  130 ? 318.631 252.084 267.160 1.00 74.23  ? 130 GLU N C      1 
ATOM   2008   O  O      . GLU A  1  130 ? 318.773 253.267 267.488 1.00 74.28  ? 130 GLU N O      1 
ATOM   2009   C  CB     . GLU A  1  130 ? 316.972 252.179 265.361 1.00 95.15  ? 130 GLU N CB     1 
ATOM   2010   C  CG     . GLU A  1  130 ? 316.559 251.845 263.971 1.00 137.18 ? 130 GLU N CG     1 
ATOM   2011   C  CD     . GLU A  1  130 ? 316.141 250.396 263.836 1.00 179.23 ? 130 GLU N CD     1 
ATOM   2012   O  OE1    . GLU A  1  130 ? 315.028 250.049 264.282 1.00 169.23 ? 130 GLU N OE1    1 
ATOM   2013   O  OE2    . GLU A  1  130 ? 316.938 249.598 263.300 1.00 218.98 ? 130 GLU N OE2    1 
ATOM   2014   H  H      . GLU A  1  130 ? 317.906 249.856 265.438 1.00 77.97  ? 130 GLU N H      1 
ATOM   2015   H  HA     . GLU A  1  130 ? 319.003 252.287 265.173 1.00 77.31  ? 130 GLU N HA     1 
ATOM   2016   H  HB2    . GLU A  1  130 ? 316.357 251.736 265.966 1.00 97.12  ? 130 GLU N HB2    1 
ATOM   2017   H  HB3    . GLU A  1  130 ? 316.901 253.141 265.467 1.00 97.12  ? 130 GLU N HB3    1 
ATOM   2018   H  HG2    . GLU A  1  130 ? 315.806 252.401 263.720 1.00 139.29 ? 130 GLU N HG2    1 
ATOM   2019   H  HG3    . GLU A  1  130 ? 317.305 252.001 263.371 1.00 139.29 ? 130 GLU N HG3    1 
ATOM   2020   N  N      . MET A  1  131 ? 318.653 251.089 268.041 1.00 104.33 ? 131 MET N N      1 
ATOM   2021   C  CA     . MET A  1  131 ? 318.891 251.354 269.449 1.00 107.70 ? 131 MET N CA     1 
ATOM   2022   C  C      . MET A  1  131 ? 319.714 250.227 270.050 1.00 113.36 ? 131 MET N C      1 
ATOM   2023   O  O      . MET A  1  131 ? 319.812 249.124 269.505 1.00 94.39  ? 131 MET N O      1 
ATOM   2024   C  CB     . MET A  1  131 ? 317.576 251.548 270.231 1.00 117.83 ? 131 MET N CB     1 
ATOM   2025   C  CG     . MET A  1  131 ? 316.690 250.314 270.377 1.00 117.83 ? 131 MET N CG     1 
ATOM   2026   S  SD     . MET A  1  131 ? 315.903 249.771 268.847 1.00 117.69 ? 131 MET N SD     1 
ATOM   2027   C  CE     . MET A  1  131 ? 314.830 251.152 268.465 1.00 130.60 ? 131 MET N CE     1 
ATOM   2028   H  H      . MET A  1  131 ? 318.533 250.259 267.849 1.00 96.73  ? 131 MET N H      1 
ATOM   2029   H  HA     . MET A  1  131 ? 319.398 252.178 269.524 1.00 99.95  ? 131 MET N HA     1 
ATOM   2030   H  HB2    . MET A  1  131 ? 317.796 251.852 271.126 1.00 110.52 ? 131 MET N HB2    1 
ATOM   2031   H  HB3    . MET A  1  131 ? 317.051 252.228 269.780 1.00 110.52 ? 131 MET N HB3    1 
ATOM   2032   H  HG2    . MET A  1  131 ? 317.233 249.580 270.706 1.00 110.52 ? 131 MET N HG2    1 
ATOM   2033   H  HG3    . MET A  1  131 ? 315.987 250.512 271.016 1.00 110.52 ? 131 MET N HG3    1 
ATOM   2034   H  HE1    . MET A  1  131 ? 314.350 250.961 267.644 1.00 124.27 ? 131 MET N HE1    1 
ATOM   2035   H  HE2    . MET A  1  131 ? 314.203 251.275 269.195 1.00 124.27 ? 131 MET N HE2    1 
ATOM   2036   H  HE3    . MET A  1  131 ? 315.371 251.950 268.355 1.00 124.27 ? 131 MET N HE3    1 
ATOM   2037   N  N      . ARG A  1  132 ? 320.338 250.561 271.159 1.00 109.09 ? 132 ARG N N      1 
ATOM   2038   C  CA     . ARG A  1  132 ? 321.080 249.681 272.044 1.00 53.55  ? 132 ARG N CA     1 
ATOM   2039   C  C      . ARG A  1  132 ? 320.118 248.956 272.978 1.00 51.69  ? 132 ARG N C      1 
ATOM   2040   O  O      . ARG A  1  132 ? 319.050 249.479 273.299 1.00 50.13  ? 132 ARG N O      1 
ATOM   2041   C  CB     . ARG A  1  132 ? 322.053 250.494 272.879 1.00 65.67  ? 132 ARG N CB     1 
ATOM   2042   C  CG     . ARG A  1  132 ? 321.371 251.624 273.653 1.00 76.22  ? 132 ARG N CG     1 
ATOM   2043   C  CD     . ARG A  1  132 ? 322.392 252.461 274.368 1.00 97.28  ? 132 ARG N CD     1 
ATOM   2044   N  NE     . ARG A  1  132 ? 321.797 253.564 275.117 1.00 55.53  ? 132 ARG N NE     1 
ATOM   2045   C  CZ     . ARG A  1  132 ? 321.433 253.496 276.393 1.00 54.91  ? 132 ARG N CZ     1 
ATOM   2046   N  NH1    . ARG A  1  132 ? 321.584 252.370 277.078 1.00 59.10  ? 132 ARG N NH1    1 
ATOM   2047   N  NH2    . ARG A  1  132 ? 320.917 254.560 276.992 1.00 54.86  ? 132 ARG N NH2    1 
ATOM   2048   H  H      . ARG A  1  132 ? 320.346 251.372 271.446 1.00 108.59 ? 132 ARG N H      1 
ATOM   2049   H  HA     . ARG A  1  132 ? 321.574 249.026 271.526 1.00 52.45  ? 132 ARG N HA     1 
ATOM   2050   H  HB2    . ARG A  1  132 ? 322.484 249.908 273.521 1.00 64.30  ? 132 ARG N HB2    1 
ATOM   2051   H  HB3    . ARG A  1  132 ? 322.717 250.890 272.293 1.00 64.30  ? 132 ARG N HB3    1 
ATOM   2052   H  HG2    . ARG A  1  132 ? 320.886 252.193 273.034 1.00 75.29  ? 132 ARG N HG2    1 
ATOM   2053   H  HG3    . ARG A  1  132 ? 320.767 251.247 274.311 1.00 75.29  ? 132 ARG N HG3    1 
ATOM   2054   H  HD2    . ARG A  1  132 ? 322.877 251.900 274.994 1.00 96.06  ? 132 ARG N HD2    1 
ATOM   2055   H  HD3    . ARG A  1  132 ? 323.005 252.837 273.716 1.00 96.06  ? 132 ARG N HD3    1 
ATOM   2056   H  HE     . ARG A  1  132 ? 321.673 254.308 274.704 1.00 54.69  ? 132 ARG N HE     1 
ATOM   2057   H  HH11   . ARG A  1  132 ? 321.923 251.677 276.697 1.00 57.78  ? 132 ARG N HH11   1 
ATOM   2058   H  HH12   . ARG A  1  132 ? 321.344 252.333 277.903 1.00 57.78  ? 132 ARG N HH12   1 
ATOM   2059   H  HH21   . ARG A  1  132 ? 320.813 255.292 276.553 1.00 54.30  ? 132 ARG N HH21   1 
ATOM   2060   H  HH22   . ARG A  1  132 ? 320.674 254.514 277.816 1.00 54.30  ? 132 ARG N HH22   1 
ATOM   2061   N  N      . PRO A  1  133 ? 320.469 247.764 273.453 1.00 50.87  ? 133 PRO N N      1 
ATOM   2062   C  CA     . PRO A  1  133 ? 319.635 247.149 274.490 1.00 59.90  ? 133 PRO N CA     1 
ATOM   2063   C  C      . PRO A  1  133 ? 319.668 247.986 275.755 1.00 54.99  ? 133 PRO N C      1 
ATOM   2064   O  O      . PRO A  1  133 ? 320.637 248.695 276.032 1.00 70.85  ? 133 PRO N O      1 
ATOM   2065   C  CB     . PRO A  1  133 ? 320.261 245.765 274.704 1.00 63.89  ? 133 PRO N CB     1 
ATOM   2066   C  CG     . PRO A  1  133 ? 321.583 245.795 274.046 1.00 52.87  ? 133 PRO N CG     1 
ATOM   2067   C  CD     . PRO A  1  133 ? 321.560 246.876 273.011 1.00 52.85  ? 133 PRO N CD     1 
ATOM   2068   H  HA     . PRO A  1  133 ? 318.720 247.052 274.183 1.00 59.57  ? 133 PRO N HA     1 
ATOM   2069   H  HB2    . PRO A  1  133 ? 320.359 245.598 275.654 1.00 62.90  ? 133 PRO N HB2    1 
ATOM   2070   H  HB3    . PRO A  1  133 ? 319.696 245.089 274.297 1.00 62.90  ? 133 PRO N HB3    1 
ATOM   2071   H  HG2    . PRO A  1  133 ? 322.265 245.983 274.711 1.00 51.45  ? 133 PRO N HG2    1 
ATOM   2072   H  HG3    . PRO A  1  133 ? 321.751 244.936 273.629 1.00 51.45  ? 133 PRO N HG3    1 
ATOM   2073   H  HD2    . PRO A  1  133 ? 322.403 247.356 273.005 1.00 51.88  ? 133 PRO N HD2    1 
ATOM   2074   H  HD3    . PRO A  1  133 ? 321.358 246.503 272.139 1.00 51.88  ? 133 PRO N HD3    1 
ATOM   2075   N  N      . LEU A  1  134 ? 318.576 247.933 276.510 1.00 71.76  ? 134 LEU N N      1 
ATOM   2076   C  CA     . LEU A  1  134 ? 318.583 248.567 277.816 1.00 84.28  ? 134 LEU N CA     1 
ATOM   2077   C  C      . LEU A  1  134 ? 319.661 247.920 278.675 1.00 103.54 ? 134 LEU N C      1 
ATOM   2078   O  O      . LEU A  1  134 ? 319.828 246.698 278.672 1.00 127.84 ? 134 LEU N O      1 
ATOM   2079   C  CB     . LEU A  1  134 ? 317.215 248.446 278.488 1.00 82.93  ? 134 LEU N CB     1 
ATOM   2080   C  CG     . LEU A  1  134 ? 316.064 249.267 277.889 1.00 80.05  ? 134 LEU N CG     1 
ATOM   2081   C  CD1    . LEU A  1  134 ? 314.749 249.043 278.652 1.00 76.33  ? 134 LEU N CD1    1 
ATOM   2082   C  CD2    . LEU A  1  134 ? 316.410 250.752 277.852 1.00 84.02  ? 134 LEU N CD2    1 
ATOM   2083   H  H      . LEU A  1  134 ? 317.838 247.547 276.295 1.00 68.70  ? 134 LEU N H      1 
ATOM   2084   H  HA     . LEU A  1  134 ? 318.794 249.509 277.716 1.00 81.19  ? 134 LEU N HA     1 
ATOM   2085   H  HB2    . LEU A  1  134 ? 316.946 247.514 278.458 1.00 80.23  ? 134 LEU N HB2    1 
ATOM   2086   H  HB3    . LEU A  1  134 ? 317.309 248.720 279.414 1.00 80.23  ? 134 LEU N HB3    1 
ATOM   2087   H  HG     . LEU A  1  134 ? 315.923 248.978 276.974 1.00 78.07  ? 134 LEU N HG     1 
ATOM   2088   H  HD11   . LEU A  1  134 ? 314.051 249.578 278.242 1.00 74.65  ? 134 LEU N HD11   1 
ATOM   2089   H  HD12   . LEU A  1  134 ? 314.515 248.102 278.606 1.00 74.65  ? 134 LEU N HD12   1 
ATOM   2090   H  HD13   . LEU A  1  134 ? 314.871 249.309 279.576 1.00 74.65  ? 134 LEU N HD13   1 
ATOM   2091   H  HD21   . LEU A  1  134 ? 315.665 251.241 277.469 1.00 82.27  ? 134 LEU N HD21   1 
ATOM   2092   H  HD22   . LEU A  1  134 ? 316.578 251.060 278.757 1.00 82.27  ? 134 LEU N HD22   1 
ATOM   2093   H  HD23   . LEU A  1  134 ? 317.203 250.878 277.307 1.00 82.27  ? 134 LEU N HD23   1 
ATOM   2094   N  N      . GLY A  1  135 ? 320.414 248.751 279.391 1.00 80.21  ? 135 GLY N N      1 
ATOM   2095   C  CA     . GLY A  1  135 ? 321.531 248.262 280.172 1.00 69.32  ? 135 GLY N CA     1 
ATOM   2096   C  C      . GLY A  1  135 ? 321.178 248.015 281.624 1.00 70.67  ? 135 GLY N C      1 
ATOM   2097   O  O      . GLY A  1  135 ? 321.769 248.622 282.523 1.00 88.61  ? 135 GLY N O      1 
ATOM   2098   H  H      . GLY A  1  135 ? 320.295 249.601 279.438 1.00 77.76  ? 135 GLY N H      1 
ATOM   2099   H  HA2    . GLY A  1  135 ? 321.850 247.429 279.790 1.00 66.16  ? 135 GLY N HA2    1 
ATOM   2100   H  HA3    . GLY A  1  135 ? 322.253 248.909 280.139 1.00 66.16  ? 135 GLY N HA3    1 
ATOM   2101   N  N      . CYS A  1  136 ? 320.224 247.120 281.869 1.00 99.17  ? 136 CYS N N      1 
ATOM   2102   C  CA     . CYS A  1  136 ? 319.771 246.835 283.224 1.00 112.81 ? 136 CYS N CA     1 
ATOM   2103   C  C      . CYS A  1  136 ? 319.348 245.375 283.309 1.00 114.93 ? 136 CYS N C      1 
ATOM   2104   O  O      . CYS A  1  136 ? 319.228 244.679 282.299 1.00 117.94 ? 136 CYS N O      1 
ATOM   2105   C  CB     . CYS A  1  136 ? 318.620 247.763 283.634 1.00 126.72 ? 136 CYS N CB     1 
ATOM   2106   S  SG     . CYS A  1  136 ? 316.971 247.193 283.143 1.00 120.29 ? 136 CYS N SG     1 
ATOM   2107   H  H      . CYS A  1  136 ? 319.821 246.662 281.263 1.00 90.33  ? 136 CYS N H      1 
ATOM   2108   H  HA     . CYS A  1  136 ? 320.506 246.973 283.841 1.00 103.83 ? 136 CYS N HA     1 
ATOM   2109   H  HB2    . CYS A  1  136 ? 318.624 247.852 284.600 1.00 118.38 ? 136 CYS N HB2    1 
ATOM   2110   H  HB3    . CYS A  1  136 ? 318.763 248.632 283.227 1.00 118.38 ? 136 CYS N HB3    1 
ATOM   2111   H  HG     . CYS A  1  136 ? 316.155 247.991 283.514 1.00 112.54 ? 136 CYS N HG     1 
ATOM   2112   N  N      . CYS A  1  137 ? 319.113 244.916 284.535 1.00 109.28 ? 137 CYS N N      1 
ATOM   2113   C  CA     . CYS A  1  137 ? 318.748 243.524 284.789 1.00 105.76 ? 137 CYS N CA     1 
ATOM   2114   C  C      . CYS A  1  137 ? 317.719 243.479 285.907 1.00 110.75 ? 137 CYS N C      1 
ATOM   2115   O  O      . CYS A  1  137 ? 318.031 243.784 287.063 1.00 122.41 ? 137 CYS N O      1 
ATOM   2116   C  CB     . CYS A  1  137 ? 319.969 242.686 285.154 1.00 114.44 ? 137 CYS N CB     1 
ATOM   2117   S  SG     . CYS A  1  137 ? 319.535 241.077 285.848 1.00 113.08 ? 137 CYS N SG     1 
ATOM   2118   H  H      . CYS A  1  137 ? 319.159 245.397 285.247 1.00 103.58 ? 137 CYS N H      1 
ATOM   2119   H  HA     . CYS A  1  137 ? 318.347 243.147 283.990 1.00 99.75  ? 137 CYS N HA     1 
ATOM   2120   H  HB2    . CYS A  1  137 ? 320.498 242.535 284.355 1.00 107.59 ? 137 CYS N HB2    1 
ATOM   2121   H  HB3    . CYS A  1  137 ? 320.495 243.165 285.814 1.00 107.59 ? 137 CYS N HB3    1 
ATOM   2122   H  HG     . CYS A  1  137 ? 318.893 240.464 285.041 1.00 105.77 ? 137 CYS N HG     1 
ATOM   2123   N  N      . MET A  1  138 ? 316.503 243.079 285.563 1.00 76.59  ? 138 MET N N      1 
ATOM   2124   C  CA     . MET A  1  138 ? 315.403 242.988 286.508 1.00 60.86  ? 138 MET N CA     1 
ATOM   2125   C  C      . MET A  1  138 ? 315.366 241.609 287.153 1.00 62.87  ? 138 MET N C      1 
ATOM   2126   O  O      . MET A  1  138 ? 315.760 240.607 286.550 1.00 64.21  ? 138 MET N O      1 
ATOM   2127   C  CB     . MET A  1  138 ? 314.088 243.271 285.781 1.00 62.72  ? 138 MET N CB     1 
ATOM   2128   C  CG     . MET A  1  138 ? 312.835 243.207 286.623 1.00 79.40  ? 138 MET N CG     1 
ATOM   2129   S  SD     . MET A  1  138 ? 311.415 243.724 285.641 1.00 80.98  ? 138 MET N SD     1 
ATOM   2130   C  CE     . MET A  1  138 ? 311.569 245.511 285.689 1.00 83.71  ? 138 MET N CE     1 
ATOM   2131   H  H      . MET A  1  138 ? 316.286 242.848 284.764 1.00 71.95  ? 138 MET N H      1 
ATOM   2132   H  HA     . MET A  1  138 ? 315.519 243.660 287.198 1.00 56.45  ? 138 MET N HA     1 
ATOM   2133   H  HB2    . MET A  1  138 ? 314.135 244.163 285.402 1.00 59.05  ? 138 MET N HB2    1 
ATOM   2134   H  HB3    . MET A  1  138 ? 313.988 242.622 285.067 1.00 59.05  ? 138 MET N HB3    1 
ATOM   2135   H  HG2    . MET A  1  138 ? 312.690 242.296 286.922 1.00 76.03  ? 138 MET N HG2    1 
ATOM   2136   H  HG3    . MET A  1  138 ? 312.922 243.806 287.381 1.00 76.03  ? 138 MET N HG3    1 
ATOM   2137   H  HE1    . MET A  1  138 ? 310.841 245.904 285.182 1.00 81.61  ? 138 MET N HE1    1 
ATOM   2138   H  HE2    . MET A  1  138 ? 311.527 245.806 286.612 1.00 81.61  ? 138 MET N HE2    1 
ATOM   2139   H  HE3    . MET A  1  138 ? 312.419 245.765 285.299 1.00 81.61  ? 138 MET N HE3    1 
ATOM   2140   N  N      . ILE A  1  139 ? 314.918 241.575 288.406 1.00 45.50  ? 139 ILE N N      1 
ATOM   2141   C  CA     . ILE A  1  139 ? 314.560 240.333 289.087 1.00 46.68  ? 139 ILE N CA     1 
ATOM   2142   C  C      . ILE A  1  139 ? 313.154 240.508 289.632 1.00 45.55  ? 139 ILE N C      1 
ATOM   2143   O  O      . ILE A  1  139 ? 312.899 241.438 290.401 1.00 45.58  ? 139 ILE N O      1 
ATOM   2144   C  CB     . ILE A  1  139 ? 315.528 239.969 290.223 1.00 49.54  ? 139 ILE N CB     1 
ATOM   2145   C  CG1    . ILE A  1  139 ? 316.958 239.880 289.688 1.00 50.93  ? 139 ILE N CG1    1 
ATOM   2146   C  CG2    . ILE A  1  139 ? 315.084 238.659 290.889 1.00 50.97  ? 139 ILE N CG2    1 
ATOM   2147   C  CD1    . ILE A  1  139 ? 317.984 239.533 290.741 1.00 54.13  ? 139 ILE N CD1    1 
ATOM   2148   H  H      . ILE A  1  139 ? 314.811 242.275 288.894 1.00 49.32  ? 139 ILE N H      1 
ATOM   2149   H  HA     . ILE A  1  139 ? 314.552 239.604 288.446 1.00 50.11  ? 139 ILE N HA     1 
ATOM   2150   H  HB     . ILE A  1  139 ? 315.496 240.674 290.889 1.00 52.21  ? 139 ILE N HB     1 
ATOM   2151   H  HG12   . ILE A  1  139 ? 316.992 239.195 289.002 1.00 53.09  ? 139 ILE N HG12   1 
ATOM   2152   H  HG13   . ILE A  1  139 ? 317.202 240.738 289.307 1.00 53.09  ? 139 ILE N HG13   1 
ATOM   2153   H  HG21   . ILE A  1  139 ? 315.703 238.442 291.603 1.00 53.25  ? 139 ILE N HG21   1 
ATOM   2154   H  HG22   . ILE A  1  139 ? 314.191 238.775 291.249 1.00 53.25  ? 139 ILE N HG22   1 
ATOM   2155   H  HG23   . ILE A  1  139 ? 315.084 237.952 290.225 1.00 53.25  ? 139 ILE N HG23   1 
ATOM   2156   H  HD11   . ILE A  1  139 ? 318.860 239.495 290.327 1.00 55.49  ? 139 ILE N HD11   1 
ATOM   2157   H  HD12   . ILE A  1  139 ? 317.972 240.215 291.430 1.00 55.49  ? 139 ILE N HD12   1 
ATOM   2158   H  HD13   . ILE A  1  139 ? 317.762 238.670 291.125 1.00 55.49  ? 139 ILE N HD13   1 
ATOM   2159   N  N      . LEU A  1  140 ? 312.250 239.623 289.235 1.00 46.94  ? 140 LEU N N      1 
ATOM   2160   C  CA     . LEU A  1  140 ? 310.884 239.617 289.732 1.00 46.25  ? 140 LEU N CA     1 
ATOM   2161   C  C      . LEU A  1  140 ? 310.702 238.494 290.742 1.00 61.15  ? 140 LEU N C      1 
ATOM   2162   O  O      . LEU A  1  140 ? 311.283 237.414 290.598 1.00 97.06  ? 140 LEU N O      1 
ATOM   2163   C  CB     . LEU A  1  140 ? 309.900 239.438 288.581 1.00 44.33  ? 140 LEU N CB     1 
ATOM   2164   C  CG     . LEU A  1  140 ? 309.920 240.547 287.542 1.00 42.45  ? 140 LEU N CG     1 
ATOM   2165   C  CD1    . LEU A  1  140 ? 309.187 240.079 286.310 1.00 41.22  ? 140 LEU N CD1    1 
ATOM   2166   C  CD2    . LEU A  1  140 ? 309.283 241.797 288.111 1.00 41.75  ? 140 LEU N CD2    1 
ATOM   2167   H  H      . LEU A  1  140 ? 312.409 239.000 288.664 1.00 48.94  ? 140 LEU N H      1 
ATOM   2168   H  HA     . LEU A  1  140 ? 310.695 240.461 290.171 1.00 48.68  ? 140 LEU N HA     1 
ATOM   2169   H  HB2    . LEU A  1  140 ? 310.106 238.606 288.126 1.00 47.30  ? 140 LEU N HB2    1 
ATOM   2170   H  HB3    . LEU A  1  140 ? 309.002 239.395 288.947 1.00 47.30  ? 140 LEU N HB3    1 
ATOM   2171   H  HG     . LEU A  1  140 ? 310.837 240.750 287.299 1.00 45.96  ? 140 LEU N HG     1 
ATOM   2172   H  HD11   . LEU A  1  140 ? 309.200 240.787 285.647 1.00 45.08  ? 140 LEU N HD11   1 
ATOM   2173   H  HD12   . LEU A  1  140 ? 309.631 239.290 285.961 1.00 45.08  ? 140 LEU N HD12   1 
ATOM   2174   H  HD13   . LEU A  1  140 ? 308.272 239.865 286.550 1.00 45.08  ? 140 LEU N HD13   1 
ATOM   2175   H  HD21   . LEU A  1  140 ? 309.303 242.495 287.438 1.00 45.75  ? 140 LEU N HD21   1 
ATOM   2176   H  HD22   . LEU A  1  140 ? 308.366 241.599 288.357 1.00 45.75  ? 140 LEU N HD22   1 
ATOM   2177   H  HD23   . LEU A  1  140 ? 309.783 242.077 288.894 1.00 45.75  ? 140 LEU N HD23   1 
ATOM   2178   N  N      . ILE A  1  141 ? 309.901 238.761 291.769 1.00 44.65  ? 141 ILE N N      1 
ATOM   2179   C  CA     . ILE A  1  141 ? 309.474 237.736 292.712 1.00 46.58  ? 141 ILE N CA     1 
ATOM   2180   C  C      . ILE A  1  141 ? 307.981 237.870 292.922 1.00 45.69  ? 141 ILE N C      1 
ATOM   2181   O  O      . ILE A  1  141 ? 307.407 238.956 292.794 1.00 44.22  ? 141 ILE N O      1 
ATOM   2182   C  CB     . ILE A  1  141 ? 310.179 237.832 294.072 1.00 49.08  ? 141 ILE N CB     1 
ATOM   2183   C  CG1    . ILE A  1  141 ? 309.844 239.178 294.729 1.00 48.63  ? 141 ILE N CG1    1 
ATOM   2184   C  CG2    . ILE A  1  141 ? 311.668 237.607 293.894 1.00 50.42  ? 141 ILE N CG2    1 
ATOM   2185   C  CD1    . ILE A  1  141 ? 310.193 239.255 296.173 1.00 62.24  ? 141 ILE N CD1    1 
ATOM   2186   H  H      . ILE A  1  141 ? 309.586 239.542 291.943 1.00 50.85  ? 141 ILE N H      1 
ATOM   2187   H  HA     . ILE A  1  141 ? 309.653 236.860 292.337 1.00 52.41  ? 141 ILE N HA     1 
ATOM   2188   H  HB     . ILE A  1  141 ? 309.834 237.126 294.640 1.00 54.35  ? 141 ILE N HB     1 
ATOM   2189   H  HG12   . ILE A  1  141 ? 310.333 239.879 294.270 1.00 54.30  ? 141 ILE N HG12   1 
ATOM   2190   H  HG13   . ILE A  1  141 ? 308.891 239.336 294.647 1.00 54.30  ? 141 ILE N HG13   1 
ATOM   2191   H  HG21   . ILE A  1  141 ? 312.101 237.669 294.760 1.00 55.07  ? 141 ILE N HG21   1 
ATOM   2192   H  HG22   . ILE A  1  141 ? 311.810 236.725 293.515 1.00 55.07  ? 141 ILE N HG22   1 
ATOM   2193   H  HG23   . ILE A  1  141 ? 312.020 238.285 293.297 1.00 55.07  ? 141 ILE N HG23   1 
ATOM   2194   H  HD11   . ILE A  1  141 ? 309.952 240.132 296.509 1.00 67.45  ? 141 ILE N HD11   1 
ATOM   2195   H  HD12   . ILE A  1  141 ? 309.703 238.570 296.653 1.00 67.45  ? 141 ILE N HD12   1 
ATOM   2196   H  HD13   . ILE A  1  141 ? 311.147 239.113 296.275 1.00 67.45  ? 141 ILE N HD13   1 
ATOM   2197   N  N      . GLY A  1  142 ? 307.365 236.768 293.300 1.00 97.12  ? 142 GLY N N      1 
ATOM   2198   C  CA     . GLY A  1  142 ? 305.952 236.785 293.573 1.00 96.36  ? 142 GLY N CA     1 
ATOM   2199   C  C      . GLY A  1  142 ? 305.449 235.386 293.815 1.00 97.31  ? 142 GLY N C      1 
ATOM   2200   O  O      . GLY A  1  142 ? 306.102 234.400 293.459 1.00 99.61  ? 142 GLY N O      1 
ATOM   2201   H  H      . GLY A  1  142 ? 307.743 236.002 293.404 1.00 85.37  ? 142 GLY N H      1 
ATOM   2202   H  HA2    . GLY A  1  142 ? 305.774 237.324 294.359 1.00 85.08  ? 142 GLY N HA2    1 
ATOM   2203   H  HA3    . GLY A  1  142 ? 305.474 237.164 292.818 1.00 85.08  ? 142 GLY N HA3    1 
ATOM   2204   N  N      . ILE A  1  143 ? 304.285 235.299 294.432 1.00 62.78  ? 143 ILE N N      1 
ATOM   2205   C  CA     . ILE A  1  143 ? 303.722 234.028 294.842 1.00 68.28  ? 143 ILE N CA     1 
ATOM   2206   C  C      . ILE A  1  143 ? 302.609 233.697 293.865 1.00 75.28  ? 143 ILE N C      1 
ATOM   2207   O  O      . ILE A  1  143 ? 301.596 234.405 293.803 1.00 79.02  ? 143 ILE N O      1 
ATOM   2208   C  CB     . ILE A  1  143 ? 303.210 234.087 296.285 1.00 80.16  ? 143 ILE N CB     1 
ATOM   2209   C  CG1    . ILE A  1  143 ? 304.320 234.587 297.216 1.00 100.28 ? 143 ILE N CG1    1 
ATOM   2210   C  CG2    . ILE A  1  143 ? 302.704 232.730 296.728 1.00 76.22  ? 143 ILE N CG2    1 
ATOM   2211   C  CD1    . ILE A  1  143 ? 305.570 233.733 297.208 1.00 114.51 ? 143 ILE N CD1    1 
ATOM   2212   H  H      . ILE A  1  143 ? 303.792 235.975 294.628 1.00 62.59  ? 143 ILE N H      1 
ATOM   2213   H  HA     . ILE A  1  143 ? 304.401 233.337 294.784 1.00 67.78  ? 143 ILE N HA     1 
ATOM   2214   H  HB     . ILE A  1  143 ? 302.473 234.716 296.322 1.00 79.54  ? 143 ILE N HB     1 
ATOM   2215   H  HG12   . ILE A  1  143 ? 304.573 235.483 296.944 1.00 99.21  ? 143 ILE N HG12   1 
ATOM   2216   H  HG13   . ILE A  1  143 ? 303.980 234.604 298.124 1.00 99.21  ? 143 ILE N HG13   1 
ATOM   2217   H  HG21   . ILE A  1  143 ? 302.386 232.796 297.642 1.00 75.22  ? 143 ILE N HG21   1 
ATOM   2218   H  HG22   . ILE A  1  143 ? 301.978 232.458 296.144 1.00 75.22  ? 143 ILE N HG22   1 
ATOM   2219   H  HG23   . ILE A  1  143 ? 303.430 232.090 296.675 1.00 75.22  ? 143 ILE N HG23   1 
ATOM   2220   H  HD11   . ILE A  1  143 ? 306.218 234.117 297.819 1.00 112.68 ? 143 ILE N HD11   1 
ATOM   2221   H  HD12   . ILE A  1  143 ? 305.340 232.834 297.490 1.00 112.68 ? 143 ILE N HD12   1 
ATOM   2222   H  HD13   . ILE A  1  143 ? 305.934 233.715 296.308 1.00 112.68 ? 143 ILE N HD13   1 
ATOM   2223   N  N      . ASP A  1  144 ? 302.809 232.651 293.076 1.00 123.84 ? 144 ASP N N      1 
ATOM   2224   C  CA     . ASP A  1  144 ? 301.702 232.080 292.334 1.00 129.93 ? 144 ASP N CA     1 
ATOM   2225   C  C      . ASP A  1  144 ? 300.898 231.167 293.248 1.00 161.74 ? 144 ASP N C      1 
ATOM   2226   O  O      . ASP A  1  144 ? 301.372 230.706 294.291 1.00 173.07 ? 144 ASP N O      1 
ATOM   2227   C  CB     . ASP A  1  144 ? 302.196 231.298 291.118 1.00 147.42 ? 144 ASP N CB     1 
ATOM   2228   C  CG     . ASP A  1  144 ? 303.007 232.152 290.163 1.00 181.92 ? 144 ASP N CG     1 
ATOM   2229   O  OD1    . ASP A  1  144 ? 302.480 232.512 289.088 1.00 208.59 ? 144 ASP N OD1    1 
ATOM   2230   O  OD2    . ASP A  1  144 ? 304.173 232.463 290.485 1.00 186.73 ? 144 ASP N OD2    1 
ATOM   2231   H  H      . ASP A  1  144 ? 303.565 232.260 292.956 1.00 110.52 ? 144 ASP N H      1 
ATOM   2232   H  HA     . ASP A  1  144 ? 301.121 232.792 292.024 1.00 116.95 ? 144 ASP N HA     1 
ATOM   2233   H  HB2    . ASP A  1  144 ? 302.758 230.567 291.419 1.00 134.23 ? 144 ASP N HB2    1 
ATOM   2234   H  HB3    . ASP A  1  144 ? 301.431 230.950 290.634 1.00 134.23 ? 144 ASP N HB3    1 
ATOM   2235   N  N      . GLU A  1  145 ? 299.668 230.904 292.840 1.00 194.81 ? 145 GLU N N      1 
ATOM   2236   C  CA     . GLU A  1  145 ? 298.766 230.054 293.601 1.00 193.86 ? 145 GLU N CA     1 
ATOM   2237   C  C      . GLU A  1  145 ? 298.693 228.650 293.035 1.00 173.30 ? 145 GLU N C      1 
ATOM   2238   O  O      . GLU A  1  145 ? 298.042 227.787 293.627 1.00 158.56 ? 145 GLU N O      1 
ATOM   2239   C  CB     . GLU A  1  145 ? 297.359 230.665 293.655 1.00 200.26 ? 145 GLU N CB     1 
ATOM   2240   C  CG     . GLU A  1  145 ? 296.690 230.910 292.301 1.00 196.62 ? 145 GLU N CG     1 
ATOM   2241   C  CD     . GLU A  1  145 ? 297.320 232.048 291.518 1.00 180.61 ? 145 GLU N CD     1 
ATOM   2242   O  OE1    . GLU A  1  145 ? 298.297 231.780 290.779 1.00 171.97 ? 145 GLU N OE1    1 
ATOM   2243   O  OE2    . GLU A  1  145 ? 296.847 233.201 291.658 1.00 177.24 ? 145 GLU N OE2    1 
ATOM   2244   H  H      . GLU A  1  145 ? 299.325 231.210 292.113 1.00 156.40 ? 145 GLU N H      1 
ATOM   2245   H  HA     . GLU A  1  145 ? 299.094 229.988 294.512 1.00 155.30 ? 145 GLU N HA     1 
ATOM   2246   H  HB2    . GLU A  1  145 ? 296.784 230.068 294.159 1.00 162.36 ? 145 GLU N HB2    1 
ATOM   2247   H  HB3    . GLU A  1  145 ? 297.414 231.520 294.110 1.00 162.36 ? 145 GLU N HB3    1 
ATOM   2248   H  HG2    . GLU A  1  145 ? 296.762 230.104 291.766 1.00 159.27 ? 145 GLU N HG2    1 
ATOM   2249   H  HG3    . GLU A  1  145 ? 295.757 231.128 292.447 1.00 159.27 ? 145 GLU N HG3    1 
ATOM   2250   N  N      . GLU A  1  146 ? 299.354 228.401 291.909 1.00 145.60 ? 146 GLU N N      1 
ATOM   2251   C  CA     . GLU A  1  146 ? 299.350 227.098 291.270 1.00 161.89 ? 146 GLU N CA     1 
ATOM   2252   C  C      . GLU A  1  146 ? 300.728 226.452 291.286 1.00 149.79 ? 146 GLU N C      1 
ATOM   2253   O  O      . GLU A  1  146 ? 300.936 225.445 290.603 1.00 152.10 ? 146 GLU N O      1 
ATOM   2254   C  CB     . GLU A  1  146 ? 298.828 227.236 289.837 1.00 190.53 ? 146 GLU N CB     1 
ATOM   2255   C  CG     . GLU A  1  146 ? 297.489 227.971 289.769 1.00 216.69 ? 146 GLU N CG     1 
ATOM   2256   C  CD     . GLU A  1  146 ? 296.936 228.100 288.360 1.00 223.39 ? 146 GLU N CD     1 
ATOM   2257   O  OE1    . GLU A  1  146 ? 296.581 227.064 287.756 1.00 228.87 ? 146 GLU N OE1    1 
ATOM   2258   O  OE2    . GLU A  1  146 ? 296.853 229.243 287.861 1.00 220.77 ? 146 GLU N OE2    1 
ATOM   2259   H  H      . GLU A  1  146 ? 299.822 228.988 291.490 1.00 143.04 ? 146 GLU N H      1 
ATOM   2260   H  HA     . GLU A  1  146 ? 298.744 226.515 291.752 1.00 158.96 ? 146 GLU N HA     1 
ATOM   2261   H  HB2    . GLU A  1  146 ? 299.473 227.736 289.312 1.00 188.08 ? 146 GLU N HB2    1 
ATOM   2262   H  HB3    . GLU A  1  146 ? 298.705 226.352 289.458 1.00 188.08 ? 146 GLU N HB3    1 
ATOM   2263   H  HG2    . GLU A  1  146 ? 296.839 227.487 290.301 1.00 214.96 ? 146 GLU N HG2    1 
ATOM   2264   H  HG3    . GLU A  1  146 ? 297.605 228.866 290.125 1.00 214.96 ? 146 GLU N HG3    1 
ATOM   2265   N  N      . GLN A  1  147 ? 301.671 226.995 292.057 1.00 149.50 ? 147 GLN N N      1 
ATOM   2266   C  CA     . GLN A  1  147 ? 303.019 226.440 292.093 1.00 142.51 ? 147 GLN N CA     1 
ATOM   2267   C  C      . GLN A  1  147 ? 303.929 227.092 293.133 1.00 129.49 ? 147 GLN N C      1 
ATOM   2268   O  O      . GLN A  1  147 ? 305.139 226.842 293.134 1.00 125.63 ? 147 GLN N O      1 
ATOM   2269   C  CB     . GLN A  1  147 ? 303.656 226.552 290.704 1.00 133.81 ? 147 GLN N CB     1 
ATOM   2270   C  CG     . GLN A  1  147 ? 303.535 227.925 290.058 1.00 138.31 ? 147 GLN N CG     1 
ATOM   2271   C  CD     . GLN A  1  147 ? 304.201 227.980 288.694 1.00 157.08 ? 147 GLN N CD     1 
ATOM   2272   O  OE1    . GLN A  1  147 ? 304.560 226.949 288.125 1.00 162.67 ? 147 GLN N OE1    1 
ATOM   2273   N  NE2    . GLN A  1  147 ? 304.370 229.186 288.163 1.00 168.05 ? 147 GLN N NE2    1 
ATOM   2274   H  H      . GLN A  1  147 ? 301.555 227.680 292.564 1.00 147.19 ? 147 GLN N H      1 
ATOM   2275   H  HA     . GLN A  1  147 ? 302.957 225.497 292.312 1.00 139.48 ? 147 GLN N HA     1 
ATOM   2276   H  HB2    . GLN A  1  147 ? 304.601 226.345 290.780 1.00 130.86 ? 147 GLN N HB2    1 
ATOM   2277   H  HB3    . GLN A  1  147 ? 303.228 225.911 290.115 1.00 130.86 ? 147 GLN N HB3    1 
ATOM   2278   H  HG2    . GLN A  1  147 ? 302.596 228.141 289.944 1.00 136.07 ? 147 GLN N HG2    1 
ATOM   2279   H  HG3    . GLN A  1  147 ? 303.961 228.583 290.629 1.00 136.07 ? 147 GLN N HG3    1 
ATOM   2280   H  HE21   . GLN A  1  147 ? 304.108 229.885 288.590 1.00 166.34 ? 147 GLN N HE21   1 
ATOM   2281   H  HE22   . GLN A  1  147 ? 304.743 229.268 287.392 1.00 166.34 ? 147 GLN N HE22   1 
ATOM   2282   N  N      . GLY A  1  148 ? 303.380 227.923 294.018 1.00 125.87 ? 148 GLY N N      1 
ATOM   2283   C  CA     . GLY A  1  148 ? 304.144 228.462 295.121 1.00 124.85 ? 148 GLY N CA     1 
ATOM   2284   C  C      . GLY A  1  148 ? 304.955 229.699 294.775 1.00 135.42 ? 148 GLY N C      1 
ATOM   2285   O  O      . GLY A  1  148 ? 304.650 230.429 293.828 1.00 152.30 ? 148 GLY N O      1 
ATOM   2286   H  H      . GLY A  1  148 ? 302.561 228.186 293.995 1.00 118.88 ? 148 GLY N H      1 
ATOM   2287   H  HA2    . GLY A  1  148 ? 303.539 228.691 295.843 1.00 117.54 ? 148 GLY N HA2    1 
ATOM   2288   H  HA3    . GLY A  1  148 ? 304.756 227.782 295.444 1.00 117.54 ? 148 GLY N HA3    1 
ATOM   2289   N  N      . PRO A  1  149 ? 306.003 229.966 295.559 1.00 75.01  ? 149 PRO N N      1 
ATOM   2290   C  CA     . PRO A  1  149 ? 306.841 231.151 295.311 1.00 67.65  ? 149 PRO N CA     1 
ATOM   2291   C  C      . PRO A  1  149 ? 307.736 230.991 294.089 1.00 67.29  ? 149 PRO N C      1 
ATOM   2292   O  O      . PRO A  1  149 ? 308.280 229.913 293.834 1.00 69.77  ? 149 PRO N O      1 
ATOM   2293   C  CB     . PRO A  1  149 ? 307.678 231.266 296.593 1.00 68.08  ? 149 PRO N CB     1 
ATOM   2294   C  CG     . PRO A  1  149 ? 306.952 230.452 297.619 1.00 76.03  ? 149 PRO N CG     1 
ATOM   2295   C  CD     . PRO A  1  149 ? 306.293 229.349 296.863 1.00 84.80  ? 149 PRO N CD     1 
ATOM   2296   H  HA     . PRO A  1  149 ? 306.291 231.943 295.211 1.00 70.95  ? 149 PRO N HA     1 
ATOM   2297   H  HB2    . PRO A  1  149 ? 308.566 230.906 296.436 1.00 70.78  ? 149 PRO N HB2    1 
ATOM   2298   H  HB3    . PRO A  1  149 ? 307.729 232.195 296.867 1.00 70.78  ? 149 PRO N HB3    1 
ATOM   2299   H  HG2    . PRO A  1  149 ? 307.587 230.095 298.260 1.00 78.47  ? 149 PRO N HG2    1 
ATOM   2300   H  HG3    . PRO A  1  149 ? 306.291 231.004 298.064 1.00 78.47  ? 149 PRO N HG3    1 
ATOM   2301   H  HD2    . PRO A  1  149 ? 306.901 228.600 296.756 1.00 87.26  ? 149 PRO N HD2    1 
ATOM   2302   H  HD3    . PRO A  1  149 ? 305.470 229.081 297.302 1.00 87.26  ? 149 PRO N HD3    1 
ATOM   2303   N  N      . GLN A  1  150 ? 307.905 232.091 293.345 1.00 79.19  ? 150 GLN N N      1 
ATOM   2304   C  CA     . GLN A  1  150 ? 308.632 232.086 292.079 1.00 78.55  ? 150 GLN N CA     1 
ATOM   2305   C  C      . GLN A  1  150 ? 309.635 233.228 292.029 1.00 75.56  ? 150 GLN N C      1 
ATOM   2306   O  O      . GLN A  1  150 ? 309.403 234.307 292.582 1.00 73.50  ? 150 GLN N O      1 
ATOM   2307   C  CB     . GLN A  1  150 ? 307.686 232.214 290.868 1.00 78.24  ? 150 GLN N CB     1 
ATOM   2308   C  CG     . GLN A  1  150 ? 306.849 230.973 290.543 1.00 92.24  ? 150 GLN N CG     1 
ATOM   2309   C  CD     . GLN A  1  150 ? 307.679 229.758 290.139 1.00 110.11 ? 150 GLN N CD     1 
ATOM   2310   O  OE1    . GLN A  1  150 ? 307.517 228.672 290.697 1.00 123.61 ? 150 GLN N OE1    1 
ATOM   2311   N  NE2    . GLN A  1  150 ? 308.550 229.928 289.152 1.00 116.86 ? 150 GLN N NE2    1 
ATOM   2312   H  H      . GLN A  1  150 ? 307.600 232.866 293.561 1.00 76.87  ? 150 GLN N H      1 
ATOM   2313   H  HA     . GLN A  1  150 ? 309.119 231.251 291.996 1.00 76.22  ? 150 GLN N HA     1 
ATOM   2314   H  HB2    . GLN A  1  150 ? 307.070 232.943 291.037 1.00 76.58  ? 150 GLN N HB2    1 
ATOM   2315   H  HB3    . GLN A  1  150 ? 308.219 232.417 290.084 1.00 76.58  ? 150 GLN N HB3    1 
ATOM   2316   H  HG2    . GLN A  1  150 ? 306.332 230.731 291.328 1.00 90.50  ? 150 GLN N HG2    1 
ATOM   2317   H  HG3    . GLN A  1  150 ? 306.252 231.183 289.808 1.00 90.50  ? 150 GLN N HG3    1 
ATOM   2318   H  HE21   . GLN A  1  150 ? 308.626 230.696 288.773 1.00 114.34 ? 150 GLN N HE21   1 
ATOM   2319   H  HE22   . GLN A  1  150 ? 309.039 229.270 288.892 1.00 114.34 ? 150 GLN N HE22   1 
ATOM   2320   N  N      . VAL A  1  151 ? 310.749 232.978 291.341 1.00 57.58  ? 151 VAL N N      1 
ATOM   2321   C  CA     . VAL A  1  151 ? 311.787 233.978 291.115 1.00 55.66  ? 151 VAL N CA     1 
ATOM   2322   C  C      . VAL A  1  151 ? 312.186 233.921 289.648 1.00 59.13  ? 151 VAL N C      1 
ATOM   2323   O  O      . VAL A  1  151 ? 312.608 232.868 289.158 1.00 66.90  ? 151 VAL N O      1 
ATOM   2324   C  CB     . VAL A  1  151 ? 313.018 233.754 292.006 1.00 57.21  ? 151 VAL N CB     1 
ATOM   2325   C  CG1    . VAL A  1  151 ? 314.069 234.814 291.729 1.00 56.09  ? 151 VAL N CG1    1 
ATOM   2326   C  CG2    . VAL A  1  151 ? 312.624 233.775 293.465 1.00 58.39  ? 151 VAL N CG2    1 
ATOM   2327   H  H      . VAL A  1  151 ? 310.929 232.215 290.988 1.00 58.90  ? 151 VAL N H      1 
ATOM   2328   H  HA     . VAL A  1  151 ? 311.430 234.861 291.301 1.00 56.97  ? 151 VAL N HA     1 
ATOM   2329   H  HB     . VAL A  1  151 ? 313.402 232.886 291.808 1.00 57.73  ? 151 VAL N HB     1 
ATOM   2330   H  HG11   . VAL A  1  151 ? 314.836 234.654 292.301 1.00 56.62  ? 151 VAL N HG11   1 
ATOM   2331   H  HG12   . VAL A  1  151 ? 314.333 234.759 290.797 1.00 56.62  ? 151 VAL N HG12   1 
ATOM   2332   H  HG13   . VAL A  1  151 ? 313.692 235.688 291.915 1.00 56.62  ? 151 VAL N HG13   1 
ATOM   2333   H  HG21   . VAL A  1  151 ? 313.415 233.632 294.007 1.00 58.75  ? 151 VAL N HG21   1 
ATOM   2334   H  HG22   . VAL A  1  151 ? 312.231 234.638 293.673 1.00 58.75  ? 151 VAL N HG22   1 
ATOM   2335   H  HG23   . VAL A  1  151 ? 311.979 233.070 293.627 1.00 58.75  ? 151 VAL N HG23   1 
ATOM   2336   N  N      . TYR A  1  152 ? 312.066 235.048 288.954 1.00 54.49  ? 152 TYR N N      1 
ATOM   2337   C  CA     . TYR A  1  152 ? 312.545 235.179 287.590 1.00 53.39  ? 152 TYR N CA     1 
ATOM   2338   C  C      . TYR A  1  152 ? 313.502 236.355 287.467 1.00 52.74  ? 152 TYR N C      1 
ATOM   2339   O  O      . TYR A  1  152 ? 313.511 237.271 288.293 1.00 53.04  ? 152 TYR N O      1 
ATOM   2340   C  CB     . TYR A  1  152 ? 311.374 235.328 286.630 1.00 51.21  ? 152 TYR N CB     1 
ATOM   2341   C  CG     . TYR A  1  152 ? 310.682 234.022 286.470 1.00 52.34  ? 152 TYR N CG     1 
ATOM   2342   C  CD1    . TYR A  1  152 ? 309.538 233.737 287.187 1.00 52.49  ? 152 TYR N CD1    1 
ATOM   2343   C  CD2    . TYR A  1  152 ? 311.208 233.047 285.646 1.00 53.64  ? 152 TYR N CD2    1 
ATOM   2344   C  CE1    . TYR A  1  152 ? 308.912 232.527 287.060 1.00 53.84  ? 152 TYR N CE1    1 
ATOM   2345   C  CE2    . TYR A  1  152 ? 310.596 231.836 285.506 1.00 55.05  ? 152 TYR N CE2    1 
ATOM   2346   C  CZ     . TYR A  1  152 ? 309.445 231.573 286.218 1.00 55.16  ? 152 TYR N CZ     1 
ATOM   2347   O  OH     . TYR A  1  152 ? 308.825 230.349 286.087 1.00 78.73  ? 152 TYR N OH     1 
ATOM   2348   H  H      . TYR A  1  152 ? 311.702 235.764 289.262 1.00 52.12  ? 152 TYR N H      1 
ATOM   2349   H  HA     . TYR A  1  152 ? 313.028 234.374 287.348 1.00 51.15  ? 152 TYR N HA     1 
ATOM   2350   H  HB2    . TYR A  1  152 ? 310.742 235.972 286.986 1.00 49.67  ? 152 TYR N HB2    1 
ATOM   2351   H  HB3    . TYR A  1  152 ? 311.700 235.614 285.762 1.00 49.67  ? 152 TYR N HB3    1 
ATOM   2352   H  HD1    . TYR A  1  152 ? 309.179 234.381 287.753 1.00 50.99  ? 152 TYR N HD1    1 
ATOM   2353   H  HD2    . TYR A  1  152 ? 311.984 233.226 285.165 1.00 51.52  ? 152 TYR N HD2    1 
ATOM   2354   H  HE1    . TYR A  1  152 ? 308.136 232.348 287.540 1.00 52.16  ? 152 TYR N HE1    1 
ATOM   2355   H  HE2    . TYR A  1  152 ? 310.955 231.191 284.940 1.00 52.74  ? 152 TYR N HE2    1 
ATOM   2356   H  HH     . TYR A  1  152 ? 309.252 229.867 285.548 1.00 76.43  ? 152 TYR N HH     1 
ATOM   2357   N  N      . LYS A  1  153 ? 314.315 236.313 286.413 1.00 60.22  ? 153 LYS N N      1 
ATOM   2358   C  CA     . LYS A  1  153 ? 315.427 237.247 286.257 1.00 58.36  ? 153 LYS N CA     1 
ATOM   2359   C  C      . LYS A  1  153 ? 315.753 237.362 284.777 1.00 58.79  ? 153 LYS N C      1 
ATOM   2360   O  O      . LYS A  1  153 ? 316.329 236.435 284.208 1.00 65.95  ? 153 LYS N O      1 
ATOM   2361   C  CB     . LYS A  1  153 ? 316.638 236.755 287.044 1.00 60.02  ? 153 LYS N CB     1 
ATOM   2362   C  CG     . LYS A  1  153 ? 317.991 237.304 286.599 1.00 59.39  ? 153 LYS N CG     1 
ATOM   2363   C  CD     . LYS A  1  153 ? 319.103 236.457 287.189 1.00 62.77  ? 153 LYS N CD     1 
ATOM   2364   C  CE     . LYS A  1  153 ? 320.488 237.060 286.991 1.00 81.20  ? 153 LYS N CE     1 
ATOM   2365   N  NZ     . LYS A  1  153 ? 320.978 237.063 285.577 1.00 82.28  ? 153 LYS N NZ     1 
ATOM   2366   H  H      . LYS A  1  153 ? 314.242 235.747 285.769 1.00 55.71  ? 153 LYS N H      1 
ATOM   2367   H  HA     . LYS A  1  153 ? 315.171 238.121 286.590 1.00 53.75  ? 153 LYS N HA     1 
ATOM   2368   H  HB2    . LYS A  1  153 ? 316.517 237.002 287.974 1.00 54.57  ? 153 LYS N HB2    1 
ATOM   2369   H  HB3    . LYS A  1  153 ? 316.678 235.789 286.969 1.00 54.57  ? 153 LYS N HB3    1 
ATOM   2370   H  HG2    . LYS A  1  153 ? 318.056 237.269 285.632 1.00 53.64  ? 153 LYS N HG2    1 
ATOM   2371   H  HG3    . LYS A  1  153 ? 318.094 238.215 286.916 1.00 53.64  ? 153 LYS N HG3    1 
ATOM   2372   H  HD2    . LYS A  1  153 ? 318.953 236.362 288.143 1.00 56.11  ? 153 LYS N HD2    1 
ATOM   2373   H  HD3    . LYS A  1  153 ? 319.093 235.585 286.765 1.00 56.11  ? 153 LYS N HD3    1 
ATOM   2374   H  HE2    . LYS A  1  153 ? 320.471 237.981 287.296 1.00 74.18  ? 153 LYS N HE2    1 
ATOM   2375   H  HE3    . LYS A  1  153 ? 321.124 236.554 287.520 1.00 74.18  ? 153 LYS N HE3    1 
ATOM   2376   H  HZ1    . LYS A  1  153 ? 321.789 237.427 285.538 1.00 75.33  ? 153 LYS N HZ1    1 
ATOM   2377   H  HZ2    . LYS A  1  153 ? 321.021 236.229 285.269 1.00 75.33  ? 153 LYS N HZ2    1 
ATOM   2378   H  HZ3    . LYS A  1  153 ? 320.424 237.533 285.064 1.00 75.33  ? 153 LYS N HZ3    1 
ATOM   2379   N  N      . CYS A  1  154 ? 315.416 238.492 284.164 1.00 71.89  ? 154 CYS N N      1 
ATOM   2380   C  CA     . CYS A  1  154 ? 315.647 238.682 282.738 1.00 71.69  ? 154 CYS N CA     1 
ATOM   2381   C  C      . CYS A  1  154 ? 316.909 239.499 282.492 1.00 81.44  ? 154 CYS N C      1 
ATOM   2382   O  O      . CYS A  1  154 ? 317.416 240.193 283.374 1.00 87.74  ? 154 CYS N O      1 
ATOM   2383   C  CB     . CYS A  1  154 ? 314.447 239.358 282.063 1.00 69.76  ? 154 CYS N CB     1 
ATOM   2384   S  SG     . CYS A  1  154 ? 313.803 240.840 282.877 1.00 82.29  ? 154 CYS N SG     1 
ATOM   2385   H  H      . CYS A  1  154 ? 315.052 239.166 284.554 1.00 65.79  ? 154 CYS N H      1 
ATOM   2386   H  HA     . CYS A  1  154 ? 315.770 237.814 282.323 1.00 65.81  ? 154 CYS N HA     1 
ATOM   2387   H  HB2    . CYS A  1  154 ? 314.707 239.613 281.164 1.00 64.69  ? 154 CYS N HB2    1 
ATOM   2388   H  HB3    . CYS A  1  154 ? 313.721 238.715 282.017 1.00 64.69  ? 154 CYS N HB3    1 
ATOM   2389   H  HG     . CYS A  1  154 ? 313.447 240.553 283.987 1.00 77.81  ? 154 CYS N HG     1 
ATOM   2390   N  N      . ASP A  1  155 ? 317.400 239.413 281.263 1.00 83.49  ? 155 ASP N N      1 
ATOM   2391   C  CA     . ASP A  1  155 ? 318.693 239.944 280.874 1.00 83.53  ? 155 ASP N CA     1 
ATOM   2392   C  C      . ASP A  1  155 ? 318.568 240.965 279.752 1.00 81.92  ? 155 ASP N C      1 
ATOM   2393   O  O      . ASP A  1  155 ? 317.548 241.022 279.057 1.00 90.77  ? 155 ASP N O      1 
ATOM   2394   C  CB     . ASP A  1  155 ? 319.617 238.806 280.423 1.00 121.40 ? 155 ASP N CB     1 
ATOM   2395   C  CG     . ASP A  1  155 ? 319.976 237.865 281.554 1.00 160.87 ? 155 ASP N CG     1 
ATOM   2396   O  OD1    . ASP A  1  155 ? 319.641 236.663 281.454 1.00 177.15 ? 155 ASP N OD1    1 
ATOM   2397   O  OD2    . ASP A  1  155 ? 320.597 238.329 282.536 1.00 178.21 ? 155 ASP N OD2    1 
ATOM   2398   H  H      . ASP A  1  155 ? 316.982 239.037 280.612 1.00 80.24  ? 155 ASP N H      1 
ATOM   2399   H  HA     . ASP A  1  155 ? 319.101 240.381 281.638 1.00 79.99  ? 155 ASP N HA     1 
ATOM   2400   H  HB2    . ASP A  1  155 ? 319.170 238.290 279.734 1.00 117.16 ? 155 ASP N HB2    1 
ATOM   2401   H  HB3    . ASP A  1  155 ? 320.439 239.184 280.075 1.00 117.16 ? 155 ASP N HB3    1 
ATOM   2402   N  N      . PRO A  1  156 ? 319.599 241.784 279.543 1.00 61.83  ? 156 PRO N N      1 
ATOM   2403   C  CA     . PRO A  1  156 ? 319.596 242.701 278.392 1.00 56.35  ? 156 PRO N CA     1 
ATOM   2404   C  C      . PRO A  1  156 ? 319.527 242.000 277.057 1.00 58.21  ? 156 PRO N C      1 
ATOM   2405   O  O      . PRO A  1  156 ? 319.092 242.611 276.076 1.00 75.05  ? 156 PRO N O      1 
ATOM   2406   C  CB     . PRO A  1  156 ? 320.921 243.461 278.540 1.00 70.21  ? 156 PRO N CB     1 
ATOM   2407   C  CG     . PRO A  1  156 ? 321.281 243.340 279.969 1.00 80.64  ? 156 PRO N CG     1 
ATOM   2408   C  CD     . PRO A  1  156 ? 320.706 242.054 280.466 1.00 76.50  ? 156 PRO N CD     1 
ATOM   2409   H  HA     . PRO A  1  156 ? 318.858 243.327 278.464 1.00 55.67  ? 156 PRO N HA     1 
ATOM   2410   H  HB2    . PRO A  1  156 ? 321.598 243.049 277.981 1.00 69.19  ? 156 PRO N HB2    1 
ATOM   2411   H  HB3    . PRO A  1  156 ? 320.793 244.391 278.296 1.00 69.19  ? 156 PRO N HB3    1 
ATOM   2412   H  HG2    . PRO A  1  156 ? 322.247 243.333 280.057 1.00 79.20  ? 156 PRO N HG2    1 
ATOM   2413   H  HG3    . PRO A  1  156 ? 320.904 244.089 280.459 1.00 79.20  ? 156 PRO N HG3    1 
ATOM   2414   H  HD2    . PRO A  1  156 ? 321.368 241.347 280.415 1.00 74.81  ? 156 PRO N HD2    1 
ATOM   2415   H  HD3    . PRO A  1  156 ? 320.372 242.162 281.371 1.00 74.81  ? 156 PRO N HD3    1 
ATOM   2416   N  N      . ALA A  1  157 ? 319.975 240.755 276.970 1.00 57.69  ? 157 ALA N N      1 
ATOM   2417   C  CA     . ALA A  1  157 ? 319.738 240.006 275.744 1.00 59.36  ? 157 ALA N CA     1 
ATOM   2418   C  C      . ALA A  1  157 ? 318.290 239.552 275.674 1.00 58.73  ? 157 ALA N C      1 
ATOM   2419   O  O      . ALA A  1  157 ? 317.685 239.542 274.599 1.00 58.85  ? 157 ALA N O      1 
ATOM   2420   C  CB     . ALA A  1  157 ? 320.678 238.803 275.666 1.00 68.88  ? 157 ALA N CB     1 
ATOM   2421   H  H      . ALA A  1  157 ? 320.405 240.333 277.584 1.00 51.19  ? 157 ALA N H      1 
ATOM   2422   H  HA     . ALA A  1  157 ? 319.913 240.579 274.981 1.00 52.87  ? 157 ALA N HA     1 
ATOM   2423   H  HB1    . ALA A  1  157 ? 320.504 238.319 274.844 1.00 61.60  ? 157 ALA N HB1    1 
ATOM   2424   H  HB2    . ALA A  1  157 ? 321.596 239.118 275.676 1.00 61.60  ? 157 ALA N HB2    1 
ATOM   2425   H  HB3    . ALA A  1  157 ? 320.518 238.227 276.430 1.00 61.60  ? 157 ALA N HB3    1 
ATOM   2426   N  N      . GLY A  1  158 ? 317.721 239.200 276.822 1.00 64.42  ? 158 GLY N N      1 
ATOM   2427   C  CA     . GLY A  1  158 ? 316.387 238.646 276.876 1.00 65.00  ? 158 GLY N CA     1 
ATOM   2428   C  C      . GLY A  1  158 ? 316.446 237.158 277.109 1.00 74.32  ? 158 GLY N C      1 
ATOM   2429   O  O      . GLY A  1  158 ? 316.162 236.374 276.200 1.00 76.68  ? 158 GLY N O      1 
ATOM   2430   H  H      . GLY A  1  158 ? 318.098 239.275 277.591 1.00 67.38  ? 158 GLY N H      1 
ATOM   2431   H  HA2    . GLY A  1  158 ? 315.889 239.058 277.599 1.00 68.29  ? 158 GLY N HA2    1 
ATOM   2432   H  HA3    . GLY A  1  158 ? 315.926 238.815 276.040 1.00 68.29  ? 158 GLY N HA3    1 
ATOM   2433   N  N      . TYR A  1  159 ? 316.837 236.740 278.314 1.00 66.40  ? 159 TYR N N      1 
ATOM   2434   C  CA     . TYR A  1  159 ? 316.800 235.321 278.637 1.00 69.72  ? 159 TYR N CA     1 
ATOM   2435   C  C      . TYR A  1  159 ? 316.436 235.178 280.110 1.00 68.76  ? 159 TYR N C      1 
ATOM   2436   O  O      . TYR A  1  159 ? 317.273 234.888 280.968 1.00 86.39  ? 159 TYR N O      1 
ATOM   2437   C  CB     . TYR A  1  159 ? 318.113 234.599 278.357 1.00 71.92  ? 159 TYR N CB     1 
ATOM   2438   C  CG     . TYR A  1  159 ? 318.048 233.161 278.822 1.00 91.34  ? 159 TYR N CG     1 
ATOM   2439   C  CD1    . TYR A  1  159 ? 317.175 232.265 278.218 1.00 128.50 ? 159 TYR N CD1    1 
ATOM   2440   C  CD2    . TYR A  1  159 ? 318.826 232.702 279.883 1.00 80.62  ? 159 TYR N CD2    1 
ATOM   2441   C  CE1    . TYR A  1  159 ? 317.089 230.949 278.637 1.00 154.31 ? 159 TYR N CE1    1 
ATOM   2442   C  CE2    . TYR A  1  159 ? 318.746 231.382 280.311 1.00 108.05 ? 159 TYR N CE2    1 
ATOM   2443   C  CZ     . TYR A  1  159 ? 317.874 230.510 279.682 1.00 148.31 ? 159 TYR N CZ     1 
ATOM   2444   O  OH     . TYR A  1  159 ? 317.778 229.195 280.088 1.00 170.44 ? 159 TYR N OH     1 
ATOM   2445   H  H      . TYR A  1  159 ? 317.122 237.248 278.947 1.00 70.56  ? 159 TYR N H      1 
ATOM   2446   H  HA     . TYR A  1  159 ? 316.105 234.894 278.111 1.00 73.34  ? 159 TYR N HA     1 
ATOM   2447   H  HB2    . TYR A  1  159 ? 318.287 234.604 277.403 1.00 74.76  ? 159 TYR N HB2    1 
ATOM   2448   H  HB3    . TYR A  1  159 ? 318.832 235.042 278.834 1.00 74.76  ? 159 TYR N HB3    1 
ATOM   2449   H  HD1    . TYR A  1  159 ? 316.643 232.553 277.511 1.00 130.85 ? 159 TYR N HD1    1 
ATOM   2450   H  HD2    . TYR A  1  159 ? 319.413 233.286 280.306 1.00 82.19  ? 159 TYR N HD2    1 
ATOM   2451   H  HE1    . TYR A  1  159 ? 316.504 230.362 278.215 1.00 156.10 ? 159 TYR N HE1    1 
ATOM   2452   H  HE2    . TYR A  1  159 ? 319.275 231.086 281.016 1.00 109.06 ? 159 TYR N HE2    1 
ATOM   2453   H  HH     . TYR A  1  159 ? 318.303 229.053 280.728 1.00 170.99 ? 159 TYR N HH     1 
ATOM   2454   N  N      . TYR A  1  160 ? 315.162 235.369 280.406 1.00 55.98  ? 160 TYR N N      1 
ATOM   2455   C  CA     . TYR A  1  160 ? 314.689 235.125 281.758 1.00 82.55  ? 160 TYR N CA     1 
ATOM   2456   C  C      . TYR A  1  160 ? 314.525 233.622 281.944 1.00 59.68  ? 160 TYR N C      1 
ATOM   2457   O  O      . TYR A  1  160 ? 313.793 232.964 281.194 1.00 62.17  ? 160 TYR N O      1 
ATOM   2458   C  CB     . TYR A  1  160 ? 313.377 235.853 282.019 1.00 107.57 ? 160 TYR N CB     1 
ATOM   2459   C  CG     . TYR A  1  160 ? 312.225 235.099 281.448 1.00 120.15 ? 160 TYR N CG     1 
ATOM   2460   C  CD1    . TYR A  1  160 ? 312.157 234.860 280.089 1.00 87.60  ? 160 TYR N CD1    1 
ATOM   2461   C  CD2    . TYR A  1  160 ? 311.241 234.572 282.261 1.00 143.11 ? 160 TYR N CD2    1 
ATOM   2462   C  CE1    . TYR A  1  160 ? 311.140 234.146 279.547 1.00 70.34  ? 160 TYR N CE1    1 
ATOM   2463   C  CE2    . TYR A  1  160 ? 310.201 233.854 281.729 1.00 124.96 ? 160 TYR N CE2    1 
ATOM   2464   C  CZ     . TYR A  1  160 ? 310.156 233.642 280.361 1.00 81.49  ? 160 TYR N CZ     1 
ATOM   2465   O  OH     . TYR A  1  160 ? 309.131 232.925 279.793 1.00 63.34  ? 160 TYR N OH     1 
ATOM   2466   H  H      . TYR A  1  160 ? 314.558 235.635 279.854 1.00 58.43  ? 160 TYR N H      1 
ATOM   2467   H  HA     . TYR A  1  160 ? 315.349 235.444 282.393 1.00 84.89  ? 160 TYR N HA     1 
ATOM   2468   H  HB2    . TYR A  1  160 ? 313.241 235.940 282.975 1.00 110.65 ? 160 TYR N HB2    1 
ATOM   2469   H  HB3    . TYR A  1  160 ? 313.406 236.729 281.602 1.00 110.65 ? 160 TYR N HB3    1 
ATOM   2470   H  HD1    . TYR A  1  160 ? 312.823 235.198 279.534 1.00 91.09  ? 160 TYR N HD1    1 
ATOM   2471   H  HD2    . TYR A  1  160 ? 311.277 234.717 283.179 1.00 146.52 ? 160 TYR N HD2    1 
ATOM   2472   H  HE1    . TYR A  1  160 ? 311.105 234.005 278.629 1.00 74.03  ? 160 TYR N HE1    1 
ATOM   2473   H  HE2    . TYR A  1  160 ? 309.535 233.510 282.281 1.00 128.59 ? 160 TYR N HE2    1 
ATOM   2474   H  HH     . TYR A  1  160 ? 308.594 232.671 280.387 1.00 67.29  ? 160 TYR N HH     1 
ATOM   2475   N  N      . CYS A  1  161 ? 315.261 233.072 282.903 1.00 57.06  ? 161 CYS N N      1 
ATOM   2476   C  CA     . CYS A  1  161 ? 314.997 231.742 283.414 1.00 60.49  ? 161 CYS N CA     1 
ATOM   2477   C  C      . CYS A  1  161 ? 314.642 231.854 284.889 1.00 59.46  ? 161 CYS N C      1 
ATOM   2478   O  O      . CYS A  1  161 ? 315.036 232.807 285.564 1.00 58.12  ? 161 CYS N O      1 
ATOM   2479   C  CB     . CYS A  1  161 ? 316.202 230.822 283.214 1.00 85.71  ? 161 CYS N CB     1 
ATOM   2480   S  SG     . CYS A  1  161 ? 315.764 229.073 283.096 1.00 107.93 ? 161 CYS N SG     1 
ATOM   2481   H  H      . CYS A  1  161 ? 315.931 233.460 283.279 1.00 57.77  ? 161 CYS N H      1 
ATOM   2482   H  HA     . CYS A  1  161 ? 314.239 231.361 282.944 1.00 60.71  ? 161 CYS N HA     1 
ATOM   2483   H  HB2    . CYS A  1  161 ? 316.654 231.071 282.392 1.00 85.09  ? 161 CYS N HB2    1 
ATOM   2484   H  HB3    . CYS A  1  161 ? 316.805 230.927 283.966 1.00 85.09  ? 161 CYS N HB3    1 
ATOM   2485   H  HG     . CYS A  1  161 ? 316.764 228.429 282.941 1.00 106.79 ? 161 CYS N HG     1 
ATOM   2486   N  N      . GLY A  1  162 ? 313.872 230.886 285.382 1.00 69.63  ? 162 GLY N N      1 
ATOM   2487   C  CA     . GLY A  1  162 ? 313.451 230.891 286.769 1.00 69.25  ? 162 GLY N CA     1 
ATOM   2488   C  C      . GLY A  1  162 ? 314.425 230.152 287.669 1.00 70.70  ? 162 GLY N C      1 
ATOM   2489   O  O      . GLY A  1  162 ? 315.053 229.173 287.272 1.00 73.04  ? 162 GLY N O      1 
ATOM   2490   H  H      . GLY A  1  162 ? 313.582 230.216 284.928 1.00 73.28  ? 162 GLY N H      1 
ATOM   2491   H  HA2    . GLY A  1  162 ? 313.377 231.806 287.082 1.00 72.82  ? 162 GLY N HA2    1 
ATOM   2492   H  HA3    . GLY A  1  162 ? 312.581 230.468 286.844 1.00 72.82  ? 162 GLY N HA3    1 
ATOM   2493   N  N      . PHE A  1  163 ? 314.524 230.625 288.909 1.00 79.66  ? 163 PHE N N      1 
ATOM   2494   C  CA     . PHE A  1  163 ? 315.626 230.275 289.789 1.00 80.58  ? 163 PHE N CA     1 
ATOM   2495   C  C      . PHE A  1  163 ? 315.125 229.772 291.134 1.00 82.96  ? 163 PHE N C      1 
ATOM   2496   O  O      . PHE A  1  163 ? 313.934 229.833 291.455 1.00 83.50  ? 163 PHE N O      1 
ATOM   2497   C  CB     . PHE A  1  163 ? 316.534 231.484 289.997 1.00 77.78  ? 163 PHE N CB     1 
ATOM   2498   C  CG     . PHE A  1  163 ? 317.314 231.848 288.787 1.00 76.86  ? 163 PHE N CG     1 
ATOM   2499   C  CD1    . PHE A  1  163 ? 318.521 231.236 288.531 1.00 96.00  ? 163 PHE N CD1    1 
ATOM   2500   C  CD2    . PHE A  1  163 ? 316.846 232.797 287.901 1.00 74.34  ? 163 PHE N CD2    1 
ATOM   2501   C  CE1    . PHE A  1  163 ? 319.257 231.562 287.416 1.00 103.26 ? 163 PHE N CE1    1 
ATOM   2502   C  CE2    . PHE A  1  163 ? 317.576 233.134 286.779 1.00 81.45  ? 163 PHE N CE2    1 
ATOM   2503   C  CZ     . PHE A  1  163 ? 318.786 232.514 286.536 1.00 94.48  ? 163 PHE N CZ     1 
ATOM   2504   H  H      . PHE A  1  163 ? 313.953 231.159 289.266 1.00 80.39  ? 163 PHE N H      1 
ATOM   2505   H  HA     . PHE A  1  163 ? 316.150 229.569 289.378 1.00 80.50  ? 163 PHE N HA     1 
ATOM   2506   H  HB2    . PHE A  1  163 ? 315.989 232.248 290.241 1.00 77.74  ? 163 PHE N HB2    1 
ATOM   2507   H  HB3    . PHE A  1  163 ? 317.163 231.286 290.709 1.00 77.74  ? 163 PHE N HB3    1 
ATOM   2508   H  HD1    . PHE A  1  163 ? 318.844 230.596 289.122 1.00 95.28  ? 163 PHE N HD1    1 
ATOM   2509   H  HD2    . PHE A  1  163 ? 316.032 233.217 288.064 1.00 75.13  ? 163 PHE N HD2    1 
ATOM   2510   H  HE1    . PHE A  1  163 ? 320.071 231.142 287.256 1.00 102.57 ? 163 PHE N HE1    1 
ATOM   2511   H  HE2    . PHE A  1  163 ? 317.254 233.775 286.187 1.00 82.27  ? 163 PHE N HE2    1 
ATOM   2512   H  HZ     . PHE A  1  163 ? 319.280 232.736 285.781 1.00 94.57  ? 163 PHE N HZ     1 
ATOM   2513   N  N      . LYS A  1  164 ? 316.073 229.257 291.918 1.00 86.18  ? 164 LYS N N      1 
ATOM   2514   C  CA     . LYS A  1  164 ? 315.875 229.011 293.338 1.00 87.28  ? 164 LYS N CA     1 
ATOM   2515   C  C      . LYS A  1  164 ? 316.592 230.019 294.212 1.00 85.48  ? 164 LYS N C      1 
ATOM   2516   O  O      . LYS A  1  164 ? 316.110 230.333 295.304 1.00 93.28  ? 164 LYS N O      1 
ATOM   2517   C  CB     . LYS A  1  164 ? 316.352 227.603 293.707 1.00 97.06  ? 164 LYS N CB     1 
ATOM   2518   C  CG     . LYS A  1  164 ? 315.398 226.515 293.265 1.00 113.19 ? 164 LYS N CG     1 
ATOM   2519   C  CD     . LYS A  1  164 ? 315.802 225.154 293.804 1.00 130.39 ? 164 LYS N CD     1 
ATOM   2520   C  CE     . LYS A  1  164 ? 317.013 224.596 293.075 1.00 143.99 ? 164 LYS N CE     1 
ATOM   2521   N  NZ     . LYS A  1  164 ? 316.727 224.356 291.633 1.00 149.46 ? 164 LYS N NZ     1 
ATOM   2522   H  H      . LYS A  1  164 ? 316.856 229.039 291.640 1.00 79.50  ? 164 LYS N H      1 
ATOM   2523   H  HA     . LYS A  1  164 ? 314.927 229.065 293.537 1.00 80.25  ? 164 LYS N HA     1 
ATOM   2524   H  HB2    . LYS A  1  164 ? 317.209 227.440 293.282 1.00 89.13  ? 164 LYS N HB2    1 
ATOM   2525   H  HB3    . LYS A  1  164 ? 316.445 227.545 294.671 1.00 89.13  ? 164 LYS N HB3    1 
ATOM   2526   H  HG2    . LYS A  1  164 ? 314.508 226.719 293.592 1.00 105.33 ? 164 LYS N HG2    1 
ATOM   2527   H  HG3    . LYS A  1  164 ? 315.395 226.468 292.296 1.00 105.33 ? 164 LYS N HG3    1 
ATOM   2528   H  HD2    . LYS A  1  164 ? 316.026 225.236 294.744 1.00 121.61 ? 164 LYS N HD2    1 
ATOM   2529   H  HD3    . LYS A  1  164 ? 315.066 224.533 293.688 1.00 121.61 ? 164 LYS N HD3    1 
ATOM   2530   H  HE2    . LYS A  1  164 ? 317.743 225.232 293.137 1.00 134.56 ? 164 LYS N HE2    1 
ATOM   2531   H  HE3    . LYS A  1  164 ? 317.268 223.752 293.478 1.00 134.56 ? 164 LYS N HE3    1 
ATOM   2532   H  HZ1    . LYS A  1  164 ? 316.494 225.119 291.238 1.00 140.40 ? 164 LYS N HZ1    1 
ATOM   2533   H  HZ2    . LYS A  1  164 ? 317.451 224.031 291.229 1.00 140.40 ? 164 LYS N HZ2    1 
ATOM   2534   H  HZ3    . LYS A  1  164 ? 315.848 224.332 291.497 1.00 140.40 ? 164 LYS N HZ3    1 
ATOM   2535   N  N      . ALA A  1  165 ? 317.727 230.533 293.750 1.00 66.02  ? 165 ALA N N      1 
ATOM   2536   C  CA     . ALA A  1  165 ? 318.405 231.646 294.392 1.00 64.30  ? 165 ALA N CA     1 
ATOM   2537   C  C      . ALA A  1  165 ? 319.349 232.237 293.365 1.00 77.72  ? 165 ALA N C      1 
ATOM   2538   O  O      . ALA A  1  165 ? 319.960 231.499 292.588 1.00 107.95 ? 165 ALA N O      1 
ATOM   2539   C  CB     . ALA A  1  165 ? 319.178 231.212 295.641 1.00 71.25  ? 165 ALA N CB     1 
ATOM   2540   H  H      . ALA A  1  165 ? 318.131 230.244 293.048 1.00 70.51  ? 165 ALA N H      1 
ATOM   2541   H  HA     . ALA A  1  165 ? 317.758 232.322 294.646 1.00 68.76  ? 165 ALA N HA     1 
ATOM   2542   H  HB1    . ALA A  1  165 ? 319.610 231.988 296.030 1.00 74.84  ? 165 ALA N HB1    1 
ATOM   2543   H  HB2    . ALA A  1  165 ? 318.556 230.826 296.278 1.00 74.84  ? 165 ALA N HB2    1 
ATOM   2544   H  HB3    . ALA A  1  165 ? 319.844 230.554 295.387 1.00 74.84  ? 165 ALA N HB3    1 
ATOM   2545   N  N      . THR A  1  166 ? 319.462 233.561 293.357 1.00 63.21  ? 166 THR N N      1 
ATOM   2546   C  CA     . THR A  1  166 ? 320.255 234.224 292.336 1.00 62.08  ? 166 THR N CA     1 
ATOM   2547   C  C      . THR A  1  166 ? 320.782 235.543 292.860 1.00 62.04  ? 166 THR N C      1 
ATOM   2548   O  O      . THR A  1  166 ? 320.366 236.043 293.909 1.00 71.53  ? 166 THR N O      1 
ATOM   2549   C  CB     . THR A  1  166 ? 319.452 234.495 291.063 1.00 74.29  ? 166 THR N CB     1 
ATOM   2550   O  OG1    . THR A  1  166 ? 318.425 233.509 290.930 1.00 86.30  ? 166 THR N OG1    1 
ATOM   2551   C  CG2    . THR A  1  166 ? 320.360 234.450 289.827 1.00 79.52  ? 166 THR N CG2    1 
ATOM   2552   H  H      . THR A  1  166 ? 319.094 234.091 293.925 1.00 65.59  ? 166 THR N H      1 
ATOM   2553   H  HA     . THR A  1  166 ? 321.013 233.664 292.104 1.00 64.59  ? 166 THR N HA     1 
ATOM   2554   H  HB     . THR A  1  166 ? 319.049 235.376 291.116 1.00 77.59  ? 166 THR N HB     1 
ATOM   2555   H  HG1    . THR A  1  166 ? 317.978 233.652 290.233 1.00 89.73  ? 166 THR N HG1    1 
ATOM   2556   H  HG21   . THR A  1  166 ? 319.840 234.623 289.027 1.00 82.67  ? 166 THR N HG21   1 
ATOM   2557   H  HG22   . THR A  1  166 ? 321.056 235.122 289.903 1.00 82.67  ? 166 THR N HG22   1 
ATOM   2558   H  HG23   . THR A  1  166 ? 320.774 233.576 289.752 1.00 82.67  ? 166 THR N HG23   1 
ATOM   2559   N  N      . ALA A  1  167 ? 321.710 236.096 292.093 1.00 60.96  ? 167 ALA N N      1 
ATOM   2560   C  CA     . ALA A  1  167 ? 322.229 237.425 292.328 1.00 65.73  ? 167 ALA N CA     1 
ATOM   2561   C  C      . ALA A  1  167 ? 322.403 238.113 290.986 1.00 67.09  ? 167 ALA N C      1 
ATOM   2562   O  O      . ALA A  1  167 ? 322.331 237.487 289.924 1.00 76.27  ? 167 ALA N O      1 
ATOM   2563   C  CB     . ALA A  1  167 ? 323.558 237.381 293.090 1.00 76.57  ? 167 ALA N CB     1 
ATOM   2564   H  H      . ALA A  1  167 ? 322.061 235.707 291.411 1.00 73.12  ? 167 ALA N H      1 
ATOM   2565   H  HA     . ALA A  1  167 ? 321.591 237.933 292.853 1.00 78.07  ? 167 ALA N HA     1 
ATOM   2566   H  HB1    . ALA A  1  167 ? 323.873 238.288 293.228 1.00 88.05  ? 167 ALA N HB1    1 
ATOM   2567   H  HB2    . ALA A  1  167 ? 323.417 236.946 293.945 1.00 88.05  ? 167 ALA N HB2    1 
ATOM   2568   H  HB3    . ALA A  1  167 ? 324.205 236.882 292.567 1.00 88.05  ? 167 ALA N HB3    1 
ATOM   2569   N  N      . ALA A  1  168 ? 322.622 239.422 291.046 1.00 57.32  ? 168 ALA N N      1 
ATOM   2570   C  CA     . ALA A  1  168 ? 322.967 240.209 289.875 1.00 64.94  ? 168 ALA N CA     1 
ATOM   2571   C  C      . ALA A  1  168 ? 323.950 241.284 290.295 1.00 69.83  ? 168 ALA N C      1 
ATOM   2572   O  O      . ALA A  1  168 ? 324.108 241.580 291.482 1.00 94.82  ? 168 ALA N O      1 
ATOM   2573   C  CB     . ALA A  1  168 ? 321.741 240.860 289.224 1.00 50.25  ? 168 ALA N CB     1 
ATOM   2574   H  H      . ALA A  1  168 ? 322.576 239.883 291.770 1.00 68.90  ? 168 ALA N H      1 
ATOM   2575   H  HA     . ALA A  1  168 ? 323.397 239.639 289.218 1.00 76.91  ? 168 ALA N HA     1 
ATOM   2576   H  HB1    . ALA A  1  168 ? 322.029 241.371 288.451 1.00 63.16  ? 168 ALA N HB1    1 
ATOM   2577   H  HB2    . ALA A  1  168 ? 321.123 240.165 288.950 1.00 63.16  ? 168 ALA N HB2    1 
ATOM   2578   H  HB3    . ALA A  1  168 ? 321.316 241.447 289.869 1.00 63.16  ? 168 ALA N HB3    1 
ATOM   2579   N  N      . GLY A  1  169 ? 324.617 241.857 289.309 1.00 124.41 ? 169 GLY N N      1 
ATOM   2580   C  CA     . GLY A  1  169 ? 325.495 242.971 289.548 1.00 140.31 ? 169 GLY N CA     1 
ATOM   2581   C  C      . GLY A  1  169 ? 326.955 242.574 289.548 1.00 157.88 ? 169 GLY N C      1 
ATOM   2582   O  O      . GLY A  1  169 ? 327.369 241.553 288.995 1.00 161.68 ? 169 GLY N O      1 
ATOM   2583   H  H      . GLY A  1  169 ? 324.574 241.612 288.486 1.00 106.23 ? 169 GLY N H      1 
ATOM   2584   H  HA2    . GLY A  1  169 ? 325.360 243.641 288.860 1.00 122.02 ? 169 GLY N HA2    1 
ATOM   2585   H  HA3    . GLY A  1  169 ? 325.286 243.367 290.408 1.00 122.02 ? 169 GLY N HA3    1 
ATOM   2586   N  N      . VAL A  1  170 ? 327.747 243.410 290.214 1.00 146.41 ? 170 VAL N N      1 
ATOM   2587   C  CA     . VAL A  1  170 ? 329.197 243.272 290.163 1.00 138.81 ? 170 VAL N CA     1 
ATOM   2588   C  C      . VAL A  1  170 ? 329.621 241.909 290.692 1.00 146.29 ? 170 VAL N C      1 
ATOM   2589   O  O      . VAL A  1  170 ? 330.254 241.114 289.989 1.00 162.68 ? 170 VAL N O      1 
ATOM   2590   C  CB     . VAL A  1  170 ? 329.867 244.414 290.943 1.00 124.72 ? 170 VAL N CB     1 
ATOM   2591   C  CG1    . VAL A  1  170 ? 331.377 244.306 290.857 1.00 119.28 ? 170 VAL N CG1    1 
ATOM   2592   C  CG2    . VAL A  1  170 ? 329.414 245.752 290.399 1.00 121.11 ? 170 VAL N CG2    1 
ATOM   2593   H  H      . VAL A  1  170 ? 327.470 244.062 290.701 1.00 131.24 ? 170 VAL N H      1 
ATOM   2594   H  HA     . VAL A  1  170 ? 329.485 243.334 289.239 1.00 122.88 ? 170 VAL N HA     1 
ATOM   2595   H  HB     . VAL A  1  170 ? 329.609 244.360 291.876 1.00 108.61 ? 170 VAL N HB     1 
ATOM   2596   H  HG11   . VAL A  1  170 ? 331.774 245.037 291.356 1.00 102.38 ? 170 VAL N HG11   1 
ATOM   2597   H  HG12   . VAL A  1  170 ? 331.654 243.457 291.236 1.00 102.38 ? 170 VAL N HG12   1 
ATOM   2598   H  HG13   . VAL A  1  170 ? 331.644 244.357 289.926 1.00 102.38 ? 170 VAL N HG13   1 
ATOM   2599   H  HG21   . VAL A  1  170 ? 329.846 246.460 290.902 1.00 105.80 ? 170 VAL N HG21   1 
ATOM   2600   H  HG22   . VAL A  1  170 ? 329.662 245.812 289.463 1.00 105.80 ? 170 VAL N HG22   1 
ATOM   2601   H  HG23   . VAL A  1  170 ? 328.451 245.820 290.492 1.00 105.80 ? 170 VAL N HG23   1 
ATOM   2602   N  N      . LYS A  1  171 ? 329.263 241.609 291.938 1.00 125.51 ? 171 LYS N N      1 
ATOM   2603   C  CA     . LYS A  1  171 ? 329.810 240.439 292.616 1.00 134.75 ? 171 LYS N CA     1 
ATOM   2604   C  C      . LYS A  1  171 ? 329.037 239.175 292.269 1.00 125.09 ? 171 LYS N C      1 
ATOM   2605   O  O      . LYS A  1  171 ? 328.920 238.271 293.099 1.00 128.27 ? 171 LYS N O      1 
ATOM   2606   C  CB     . LYS A  1  171 ? 329.800 240.674 294.130 1.00 144.80 ? 171 LYS N CB     1 
ATOM   2607   C  CG     . LYS A  1  171 ? 330.475 241.983 294.550 1.00 133.77 ? 171 LYS N CG     1 
ATOM   2608   C  CD     . LYS A  1  171 ? 331.970 241.997 294.233 1.00 113.11 ? 171 LYS N CD     1 
ATOM   2609   C  CE     . LYS A  1  171 ? 332.743 240.993 295.084 1.00 117.70 ? 171 LYS N CE     1 
ATOM   2610   N  NZ     . LYS A  1  171 ? 334.181 240.893 294.706 1.00 121.44 ? 171 LYS N NZ     1 
ATOM   2611   H  H      . LYS A  1  171 ? 328.708 242.065 292.410 1.00 114.49 ? 171 LYS N H      1 
ATOM   2612   H  HA     . LYS A  1  171 ? 330.730 240.313 292.337 1.00 122.85 ? 171 LYS N HA     1 
ATOM   2613   H  HB2    . LYS A  1  171 ? 328.881 240.701 294.437 1.00 132.56 ? 171 LYS N HB2    1 
ATOM   2614   H  HB3    . LYS A  1  171 ? 330.271 239.945 294.563 1.00 132.56 ? 171 LYS N HB3    1 
ATOM   2615   H  HG2    . LYS A  1  171 ? 330.059 242.720 294.075 1.00 121.50 ? 171 LYS N HG2    1 
ATOM   2616   H  HG3    . LYS A  1  171 ? 330.369 242.101 295.507 1.00 121.50 ? 171 LYS N HG3    1 
ATOM   2617   H  HD2    . LYS A  1  171 ? 332.101 241.767 293.300 1.00 100.14 ? 171 LYS N HD2    1 
ATOM   2618   H  HD3    . LYS A  1  171 ? 332.326 242.882 294.412 1.00 100.14 ? 171 LYS N HD3    1 
ATOM   2619   H  HE2    . LYS A  1  171 ? 332.696 241.265 296.013 1.00 103.70 ? 171 LYS N HE2    1 
ATOM   2620   H  HE3    . LYS A  1  171 ? 332.343 240.115 294.975 1.00 103.70 ? 171 LYS N HE3    1 
ATOM   2621   H  HZ1    . LYS A  1  171 ? 334.591 240.298 295.226 1.00 106.72 ? 171 LYS N HZ1    1 
ATOM   2622   H  HZ2    . LYS A  1  171 ? 334.255 240.636 293.857 1.00 106.72 ? 171 LYS N HZ2    1 
ATOM   2623   H  HZ3    . LYS A  1  171 ? 334.576 241.684 294.804 1.00 106.72 ? 171 LYS N HZ3    1 
ATOM   2624   N  N      . GLN A  1  172 ? 328.534 239.083 291.036 1.00 139.49 ? 172 GLN N N      1 
ATOM   2625   C  CA     . GLN A  1  172 ? 327.585 238.026 290.699 1.00 134.13 ? 172 GLN N CA     1 
ATOM   2626   C  C      . GLN A  1  172 ? 328.202 236.639 290.822 1.00 146.07 ? 172 GLN N C      1 
ATOM   2627   O  O      . GLN A  1  172 ? 327.487 235.674 291.114 1.00 155.37 ? 172 GLN N O      1 
ATOM   2628   C  CB     . GLN A  1  172 ? 327.038 238.229 289.281 1.00 130.09 ? 172 GLN N CB     1 
ATOM   2629   C  CG     . GLN A  1  172 ? 325.871 237.301 288.945 1.00 138.32 ? 172 GLN N CG     1 
ATOM   2630   C  CD     . GLN A  1  172 ? 325.216 237.629 287.614 1.00 153.11 ? 172 GLN N CD     1 
ATOM   2631   O  OE1    . GLN A  1  172 ? 324.927 238.788 287.319 1.00 167.85 ? 172 GLN N OE1    1 
ATOM   2632   N  NE2    . GLN A  1  172 ? 324.976 236.601 286.803 1.00 154.27 ? 172 GLN N NE2    1 
ATOM   2633   H  H      . GLN A  1  172 ? 328.724 239.614 290.386 1.00 118.66 ? 172 GLN N H      1 
ATOM   2634   H  HA     . GLN A  1  172 ? 326.836 238.072 291.314 1.00 113.49 ? 172 GLN N HA     1 
ATOM   2635   H  HB2    . GLN A  1  172 ? 326.727 239.143 289.192 1.00 110.15 ? 172 GLN N HB2    1 
ATOM   2636   H  HB3    . GLN A  1  172 ? 327.748 238.058 288.643 1.00 110.15 ? 172 GLN N HB3    1 
ATOM   2637   H  HG2    . GLN A  1  172 ? 326.196 236.388 288.901 1.00 118.70 ? 172 GLN N HG2    1 
ATOM   2638   H  HG3    . GLN A  1  172 ? 325.196 237.380 289.637 1.00 118.70 ? 172 GLN N HG3    1 
ATOM   2639   H  HE21   . GLN A  1  172 ? 325.189 235.804 287.044 1.00 135.33 ? 172 GLN N HE21   1 
ATOM   2640   H  HE22   . GLN A  1  172 ? 324.606 236.735 286.037 1.00 135.33 ? 172 GLN N HE22   1 
ATOM   2641   N  N      . THR A  1  173 ? 329.511 236.505 290.604 1.00 126.27 ? 173 THR N N      1 
ATOM   2642   C  CA     . THR A  1  173 ? 330.118 235.177 290.633 1.00 130.70 ? 173 THR N CA     1 
ATOM   2643   C  C      . THR A  1  173 ? 330.428 234.731 292.053 1.00 123.99 ? 173 THR N C      1 
ATOM   2644   O  O      . THR A  1  173 ? 330.417 233.529 292.339 1.00 118.99 ? 173 THR N O      1 
ATOM   2645   C  CB     . THR A  1  173 ? 331.393 235.149 289.788 1.00 144.89 ? 173 THR N CB     1 
ATOM   2646   O  OG1    . THR A  1  173 ? 331.058 235.371 288.412 1.00 148.01 ? 173 THR N OG1    1 
ATOM   2647   C  CG2    . THR A  1  173 ? 332.104 233.799 289.923 1.00 151.30 ? 173 THR N CG2    1 
ATOM   2648   H  H      . THR A  1  173 ? 330.057 237.150 290.440 1.00 115.29 ? 173 THR N H      1 
ATOM   2649   H  HA     . THR A  1  173 ? 329.494 234.540 290.251 1.00 118.87 ? 173 THR N HA     1 
ATOM   2650   H  HB     . THR A  1  173 ? 331.996 235.846 290.091 1.00 132.58 ? 173 THR N HB     1 
ATOM   2651   H  HG1    . THR A  1  173 ? 331.753 235.358 287.941 1.00 136.32 ? 173 THR N HG1    1 
ATOM   2652   H  HG21   . THR A  1  173 ? 332.910 233.794 289.383 1.00 138.00 ? 173 THR N HG21   1 
ATOM   2653   H  HG22   . THR A  1  173 ? 332.344 233.642 290.850 1.00 138.00 ? 173 THR N HG22   1 
ATOM   2654   H  HG23   . THR A  1  173 ? 331.520 233.085 289.623 1.00 138.00 ? 173 THR N HG23   1 
ATOM   2655   N  N      . GLU A  1  174 ? 330.707 235.675 292.946 1.00 145.08 ? 174 GLU N N      1 
ATOM   2656   C  CA     . GLU A  1  174 ? 330.956 235.316 294.332 1.00 168.47 ? 174 GLU N CA     1 
ATOM   2657   C  C      . GLU A  1  174 ? 329.686 234.839 295.015 1.00 161.96 ? 174 GLU N C      1 
ATOM   2658   O  O      . GLU A  1  174 ? 329.740 233.967 295.889 1.00 159.90 ? 174 GLU N O      1 
ATOM   2659   C  CB     . GLU A  1  174 ? 331.549 236.516 295.060 1.00 188.32 ? 174 GLU N CB     1 
ATOM   2660   C  CG     . GLU A  1  174 ? 332.728 237.107 294.322 1.00 200.36 ? 174 GLU N CG     1 
ATOM   2661   C  CD     . GLU A  1  174 ? 333.755 236.054 293.978 1.00 197.98 ? 174 GLU N CD     1 
ATOM   2662   O  OE1    . GLU A  1  174 ? 334.363 235.494 294.916 1.00 194.31 ? 174 GLU N OE1    1 
ATOM   2663   O  OE2    . GLU A  1  174 ? 333.926 235.768 292.772 1.00 199.53 ? 174 GLU N OE2    1 
ATOM   2664   H  H      . GLU A  1  174 ? 330.757 236.517 292.776 1.00 109.35 ? 174 GLU N H      1 
ATOM   2665   H  HA     . GLU A  1  174 ? 331.604 234.594 294.363 1.00 132.07 ? 174 GLU N HA     1 
ATOM   2666   H  HB2    . GLU A  1  174 ? 330.870 237.204 295.144 1.00 151.86 ? 174 GLU N HB2    1 
ATOM   2667   H  HB3    . GLU A  1  174 ? 331.852 236.238 295.939 1.00 151.86 ? 174 GLU N HB3    1 
ATOM   2668   H  HG2    . GLU A  1  174 ? 332.418 237.510 293.496 1.00 163.69 ? 174 GLU N HG2    1 
ATOM   2669   H  HG3    . GLU A  1  174 ? 333.154 237.774 294.882 1.00 163.69 ? 174 GLU N HG3    1 
ATOM   2670   N  N      . SER A  1  175 ? 328.537 235.384 294.616 1.00 120.02 ? 175 SER N N      1 
ATOM   2671   C  CA     . SER A  1  175 ? 327.278 235.036 295.265 1.00 120.90 ? 175 SER N CA     1 
ATOM   2672   C  C      . SER A  1  175 ? 326.829 233.634 294.877 1.00 121.58 ? 175 SER N C      1 
ATOM   2673   O  O      . SER A  1  175 ? 326.482 232.822 295.742 1.00 129.28 ? 175 SER N O      1 
ATOM   2674   C  CB     . SER A  1  175 ? 326.204 236.063 294.905 1.00 127.92 ? 175 SER N CB     1 
ATOM   2675   O  OG     . SER A  1  175 ? 326.393 237.277 295.614 1.00 143.21 ? 175 SER N OG     1 
ATOM   2676   H  H      . SER A  1  175 ? 328.461 235.954 293.976 1.00 118.93 ? 175 SER N H      1 
ATOM   2677   H  HA     . SER A  1  175 ? 327.402 235.055 296.227 1.00 120.15 ? 175 SER N HA     1 
ATOM   2678   H  HB2    . SER A  1  175 ? 326.250 236.246 293.953 1.00 128.24 ? 175 SER N HB2    1 
ATOM   2679   H  HB3    . SER A  1  175 ? 325.333 235.700 295.130 1.00 128.24 ? 175 SER N HB3    1 
ATOM   2680   H  HG     . SER A  1  175 ? 325.795 237.828 295.404 1.00 143.68 ? 175 SER N HG     1 
ATOM   2681   N  N      . THR A  1  176 ? 326.821 233.330 293.578 1.00 139.57 ? 176 THR N N      1 
ATOM   2682   C  CA     . THR A  1  176 ? 326.354 232.019 293.137 1.00 156.07 ? 176 THR N CA     1 
ATOM   2683   C  C      . THR A  1  176 ? 327.234 230.907 293.690 1.00 124.75 ? 176 THR N C      1 
ATOM   2684   O  O      . THR A  1  176 ? 326.744 229.805 293.959 1.00 124.11 ? 176 THR N O      1 
ATOM   2685   C  CB     . THR A  1  176 ? 326.315 231.958 291.611 1.00 161.06 ? 176 THR N CB     1 
ATOM   2686   O  OG1    . THR A  1  176 ? 327.623 232.212 291.082 1.00 165.95 ? 176 THR N OG1    1 
ATOM   2687   C  CG2    . THR A  1  176 ? 325.334 232.989 291.068 1.00 168.48 ? 176 THR N CG2    1 
ATOM   2688   H  H      . THR A  1  176 ? 327.076 233.854 292.946 1.00 118.55 ? 176 THR N H      1 
ATOM   2689   H  HA     . THR A  1  176 ? 325.453 231.878 293.466 1.00 134.87 ? 176 THR N HA     1 
ATOM   2690   H  HB     . THR A  1  176 ? 326.020 231.077 291.331 1.00 140.25 ? 176 THR N HB     1 
ATOM   2691   H  HG1    . THR A  1  176 ? 327.605 232.180 290.243 1.00 144.70 ? 176 THR N HG1    1 
ATOM   2692   H  HG21   . THR A  1  176 ? 325.312 232.947 290.099 1.00 148.74 ? 176 THR N HG21   1 
ATOM   2693   H  HG22   . THR A  1  176 ? 324.444 232.812 291.411 1.00 148.74 ? 176 THR N HG22   1 
ATOM   2694   H  HG23   . THR A  1  176 ? 325.605 233.880 291.339 1.00 148.74 ? 176 THR N HG23   1 
ATOM   2695   N  N      . SER A  1  177 ? 328.527 231.176 293.863 1.00 108.69 ? 177 SER N N      1 
ATOM   2696   C  CA     . SER A  1  177 ? 329.388 230.245 294.578 1.00 114.13 ? 177 SER N CA     1 
ATOM   2697   C  C      . SER A  1  177 ? 328.843 229.979 295.977 1.00 126.78 ? 177 SER N C      1 
ATOM   2698   O  O      . SER A  1  177 ? 328.578 228.833 296.354 1.00 125.30 ? 177 SER N O      1 
ATOM   2699   C  CB     . SER A  1  177 ? 330.808 230.808 294.648 1.00 117.21 ? 177 SER N CB     1 
ATOM   2700   O  OG     . SER A  1  177 ? 331.635 230.005 295.470 1.00 122.84 ? 177 SER N OG     1 
ATOM   2701   H  H      . SER A  1  177 ? 328.925 231.883 293.578 1.00 88.10  ? 177 SER N H      1 
ATOM   2702   H  HA     . SER A  1  177 ? 329.417 229.403 294.098 1.00 92.46  ? 177 SER N HA     1 
ATOM   2703   H  HB2    . SER A  1  177 ? 331.182 230.833 293.753 1.00 94.97  ? 177 SER N HB2    1 
ATOM   2704   H  HB3    . SER A  1  177 ? 330.774 231.705 295.016 1.00 94.97  ? 177 SER N HB3    1 
ATOM   2705   H  HG     . SER A  1  177 ? 332.411 230.326 295.498 1.00 99.53  ? 177 SER N HG     1 
ATOM   2706   N  N      . PHE A  1  178 ? 328.651 231.046 296.754 1.00 127.85 ? 178 PHE N N      1 
ATOM   2707   C  CA     . PHE A  1  178 ? 328.223 230.907 298.143 1.00 120.45 ? 178 PHE N CA     1 
ATOM   2708   C  C      . PHE A  1  178 ? 326.849 230.255 298.249 1.00 117.94 ? 178 PHE N C      1 
ATOM   2709   O  O      . PHE A  1  178 ? 326.608 229.443 299.150 1.00 115.71 ? 178 PHE N O      1 
ATOM   2710   C  CB     . PHE A  1  178 ? 328.214 232.281 298.810 1.00 111.78 ? 178 PHE N CB     1 
ATOM   2711   C  CG     . PHE A  1  178 ? 327.662 232.283 300.206 1.00 112.07 ? 178 PHE N CG     1 
ATOM   2712   C  CD1    . PHE A  1  178 ? 326.291 232.306 300.432 1.00 109.04 ? 178 PHE N CD1    1 
ATOM   2713   C  CD2    . PHE A  1  178 ? 328.514 232.281 301.293 1.00 121.08 ? 178 PHE N CD2    1 
ATOM   2714   C  CE1    . PHE A  1  178 ? 325.780 232.315 301.711 1.00 112.26 ? 178 PHE N CE1    1 
ATOM   2715   C  CE2    . PHE A  1  178 ? 328.010 232.291 302.582 1.00 130.91 ? 178 PHE N CE2    1 
ATOM   2716   C  CZ     . PHE A  1  178 ? 326.636 232.310 302.791 1.00 126.50 ? 178 PHE N CZ     1 
ATOM   2717   H  H      . PHE A  1  178 ? 328.762 231.860 296.500 1.00 124.89 ? 178 PHE N H      1 
ATOM   2718   H  HA     . PHE A  1  178 ? 328.858 230.347 298.615 1.00 117.24 ? 178 PHE N HA     1 
ATOM   2719   H  HB2    . PHE A  1  178 ? 329.125 232.612 298.853 1.00 108.96 ? 178 PHE N HB2    1 
ATOM   2720   H  HB3    . PHE A  1  178 ? 327.672 232.883 298.277 1.00 108.96 ? 178 PHE N HB3    1 
ATOM   2721   H  HD1    . PHE A  1  178 ? 325.708 232.310 299.707 1.00 106.77 ? 178 PHE N HD1    1 
ATOM   2722   H  HD2    . PHE A  1  178 ? 329.434 232.269 301.158 1.00 117.30 ? 178 PHE N HD2    1 
ATOM   2723   H  HE1    . PHE A  1  178 ? 324.859 232.327 301.846 1.00 109.86 ? 178 PHE N HE1    1 
ATOM   2724   H  HE2    . PHE A  1  178 ? 328.590 232.286 303.308 1.00 126.98 ? 178 PHE N HE2    1 
ATOM   2725   H  HZ     . PHE A  1  178 ? 326.296 232.315 303.656 1.00 123.27 ? 178 PHE N HZ     1 
ATOM   2726   N  N      . LEU A  1  179 ? 325.926 230.611 297.353 1.00 124.40 ? 179 LEU N N      1 
ATOM   2727   C  CA     . LEU A  1  179 ? 324.554 230.127 297.472 1.00 124.78 ? 179 LEU N CA     1 
ATOM   2728   C  C      . LEU A  1  179 ? 324.474 228.624 297.242 1.00 141.32 ? 179 LEU N C      1 
ATOM   2729   O  O      . LEU A  1  179 ? 323.875 227.894 298.040 1.00 166.51 ? 179 LEU N O      1 
ATOM   2730   C  CB     . LEU A  1  179 ? 323.649 230.856 296.480 1.00 103.65 ? 179 LEU N CB     1 
ATOM   2731   C  CG     . LEU A  1  179 ? 323.280 232.299 296.812 1.00 100.84 ? 179 LEU N CG     1 
ATOM   2732   C  CD1    . LEU A  1  179 ? 322.698 232.961 295.573 1.00 97.07  ? 179 LEU N CD1    1 
ATOM   2733   C  CD2    . LEU A  1  179 ? 322.302 232.371 297.983 1.00 100.99 ? 179 LEU N CD2    1 
ATOM   2734   H  H      . LEU A  1  179 ? 326.067 231.124 296.678 1.00 109.42 ? 179 LEU N H      1 
ATOM   2735   H  HA     . LEU A  1  179 ? 324.230 230.312 298.367 1.00 110.29 ? 179 LEU N HA     1 
ATOM   2736   H  HB2    . LEU A  1  179 ? 324.093 230.865 295.618 1.00 90.23  ? 179 LEU N HB2    1 
ATOM   2737   H  HB3    . LEU A  1  179 ? 322.820 230.358 296.407 1.00 90.23  ? 179 LEU N HB3    1 
ATOM   2738   H  HG     . LEU A  1  179 ? 324.083 232.782 297.061 1.00 88.11  ? 179 LEU N HG     1 
ATOM   2739   H  HD11   . LEU A  1  179 ? 322.464 233.878 295.786 1.00 85.25  ? 179 LEU N HD11   1 
ATOM   2740   H  HD12   . LEU A  1  179 ? 323.362 232.944 294.865 1.00 85.25  ? 179 LEU N HD12   1 
ATOM   2741   H  HD13   . LEU A  1  179 ? 321.907 232.473 295.296 1.00 85.25  ? 179 LEU N HD13   1 
ATOM   2742   H  HD21   . LEU A  1  179 ? 322.092 233.301 298.162 1.00 88.45  ? 179 LEU N HD21   1 
ATOM   2743   H  HD22   . LEU A  1  179 ? 321.493 231.889 297.749 1.00 88.45  ? 179 LEU N HD22   1 
ATOM   2744   H  HD23   . LEU A  1  179 ? 322.714 231.968 298.763 1.00 88.45  ? 179 LEU N HD23   1 
ATOM   2745   N  N      . GLU A  1  180 ? 325.076 228.142 296.155 1.00 148.53 ? 180 GLU N N      1 
ATOM   2746   C  CA     . GLU A  1  180 ? 324.829 226.774 295.719 1.00 145.42 ? 180 GLU N CA     1 
ATOM   2747   C  C      . GLU A  1  180 ? 325.311 225.742 296.728 1.00 147.85 ? 180 GLU N C      1 
ATOM   2748   O  O      . GLU A  1  180 ? 324.802 224.616 296.731 1.00 154.68 ? 180 GLU N O      1 
ATOM   2749   C  CB     . GLU A  1  180 ? 325.489 226.530 294.366 1.00 152.95 ? 180 GLU N CB     1 
ATOM   2750   C  CG     . GLU A  1  180 ? 326.991 226.688 294.369 1.00 156.27 ? 180 GLU N CG     1 
ATOM   2751   C  CD     . GLU A  1  180 ? 327.588 226.423 293.005 1.00 146.03 ? 180 GLU N CD     1 
ATOM   2752   O  OE1    . GLU A  1  180 ? 328.816 226.593 292.846 1.00 141.62 ? 180 GLU N OE1    1 
ATOM   2753   O  OE2    . GLU A  1  180 ? 326.824 226.043 292.091 1.00 141.89 ? 180 GLU N OE2    1 
ATOM   2754   H  H      . GLU A  1  180 ? 325.623 228.583 295.659 1.00 137.71 ? 180 GLU N H      1 
ATOM   2755   H  HA     . GLU A  1  180 ? 323.874 226.652 295.608 1.00 134.23 ? 180 GLU N HA     1 
ATOM   2756   H  HB2    . GLU A  1  180 ? 325.288 225.625 294.081 1.00 141.67 ? 180 GLU N HB2    1 
ATOM   2757   H  HB3    . GLU A  1  180 ? 325.127 227.162 293.726 1.00 141.67 ? 180 GLU N HB3    1 
ATOM   2758   H  HG2    . GLU A  1  180 ? 327.216 227.596 294.627 1.00 144.25 ? 180 GLU N HG2    1 
ATOM   2759   H  HG3    . GLU A  1  180 ? 327.377 226.056 294.996 1.00 144.25 ? 180 GLU N HG3    1 
ATOM   2760   N  N      . LYS A  1  181 ? 326.275 226.084 297.583 1.00 155.55 ? 181 LYS N N      1 
ATOM   2761   C  CA     . LYS A  1  181 ? 326.661 225.146 298.630 1.00 163.00 ? 181 LYS N CA     1 
ATOM   2762   C  C      . LYS A  1  181 ? 325.541 224.966 299.642 1.00 167.80 ? 181 LYS N C      1 
ATOM   2763   O  O      . LYS A  1  181 ? 325.381 223.874 300.199 1.00 183.63 ? 181 LYS N O      1 
ATOM   2764   C  CB     . LYS A  1  181 ? 327.936 225.617 299.329 1.00 162.64 ? 181 LYS N CB     1 
ATOM   2765   C  CG     . LYS A  1  181 ? 329.059 226.010 298.383 1.00 168.00 ? 181 LYS N CG     1 
ATOM   2766   C  CD     . LYS A  1  181 ? 329.354 224.924 297.351 1.00 177.93 ? 181 LYS N CD     1 
ATOM   2767   C  CE     . LYS A  1  181 ? 330.334 225.420 296.298 1.00 181.85 ? 181 LYS N CE     1 
ATOM   2768   N  NZ     . LYS A  1  181 ? 330.604 224.420 295.222 1.00 184.46 ? 181 LYS N NZ     1 
ATOM   2769   H  H      . LYS A  1  181 ? 326.707 226.827 297.578 1.00 125.47 ? 181 LYS N H      1 
ATOM   2770   H  HA     . LYS A  1  181 ? 326.842 224.282 298.228 1.00 131.95 ? 181 LYS N HA     1 
ATOM   2771   H  HB2    . LYS A  1  181 ? 327.724 226.392 299.873 1.00 130.88 ? 181 LYS N HB2    1 
ATOM   2772   H  HB3    . LYS A  1  181 ? 328.264 224.900 299.894 1.00 130.88 ? 181 LYS N HB3    1 
ATOM   2773   H  HG2    . LYS A  1  181 ? 328.806 226.817 297.908 1.00 136.08 ? 181 LYS N HG2    1 
ATOM   2774   H  HG3    . LYS A  1  181 ? 329.867 226.165 298.897 1.00 136.08 ? 181 LYS N HG3    1 
ATOM   2775   H  HD2    . LYS A  1  181 ? 329.746 224.157 297.795 1.00 145.63 ? 181 LYS N HD2    1 
ATOM   2776   H  HD3    . LYS A  1  181 ? 328.530 224.672 296.906 1.00 145.63 ? 181 LYS N HD3    1 
ATOM   2777   H  HE2    . LYS A  1  181 ? 329.969 226.216 295.880 1.00 149.54 ? 181 LYS N HE2    1 
ATOM   2778   H  HE3    . LYS A  1  181 ? 331.177 225.630 296.728 1.00 149.54 ? 181 LYS N HE3    1 
ATOM   2779   H  HZ1    . LYS A  1  181 ? 331.180 224.755 294.633 1.00 151.82 ? 181 LYS N HZ1    1 
ATOM   2780   H  HZ2    . LYS A  1  181 ? 330.949 223.679 295.575 1.00 151.82 ? 181 LYS N HZ2    1 
ATOM   2781   H  HZ3    . LYS A  1  181 ? 329.847 224.214 294.801 1.00 151.82 ? 181 LYS N HZ3    1 
ATOM   2782   N  N      . LYS A  1  182 ? 324.753 226.013 299.879 1.00 141.21 ? 182 LYS N N      1 
ATOM   2783   C  CA     . LYS A  1  182 ? 323.652 225.962 300.829 1.00 138.21 ? 182 LYS N CA     1 
ATOM   2784   C  C      . LYS A  1  182 ? 322.326 225.559 300.191 1.00 147.64 ? 182 LYS N C      1 
ATOM   2785   O  O      . LYS A  1  182 ? 321.308 225.530 300.890 1.00 144.23 ? 182 LYS N O      1 
ATOM   2786   C  CB     . LYS A  1  182 ? 323.499 227.319 301.522 1.00 135.75 ? 182 LYS N CB     1 
ATOM   2787   C  CG     . LYS A  1  182 ? 324.782 227.826 302.166 1.00 152.01 ? 182 LYS N CG     1 
ATOM   2788   C  CD     . LYS A  1  182 ? 324.600 229.202 302.789 1.00 166.12 ? 182 LYS N CD     1 
ATOM   2789   C  CE     . LYS A  1  182 ? 323.693 229.154 304.012 1.00 176.29 ? 182 LYS N CE     1 
ATOM   2790   N  NZ     . LYS A  1  182 ? 323.598 230.469 304.710 1.00 177.27 ? 182 LYS N NZ     1 
ATOM   2791   H  H      . LYS A  1  182 ? 324.841 226.777 299.493 1.00 129.82 ? 182 LYS N H      1 
ATOM   2792   H  HA     . LYS A  1  182 ? 323.861 225.305 301.511 1.00 127.10 ? 182 LYS N HA     1 
ATOM   2793   H  HB2    . LYS A  1  182 ? 323.217 227.976 300.866 1.00 125.13 ? 182 LYS N HB2    1 
ATOM   2794   H  HB3    . LYS A  1  182 ? 322.829 227.241 302.219 1.00 125.13 ? 182 LYS N HB3    1 
ATOM   2795   H  HG2    . LYS A  1  182 ? 325.053 227.211 302.865 1.00 140.71 ? 182 LYS N HG2    1 
ATOM   2796   H  HG3    . LYS A  1  182 ? 325.474 227.890 301.489 1.00 140.71 ? 182 LYS N HG3    1 
ATOM   2797   H  HD2    . LYS A  1  182 ? 325.464 229.544 303.066 1.00 155.32 ? 182 LYS N HD2    1 
ATOM   2798   H  HD3    . LYS A  1  182 ? 324.197 229.797 302.137 1.00 155.32 ? 182 LYS N HD3    1 
ATOM   2799   H  HE2    . LYS A  1  182 ? 322.800 228.897 303.734 1.00 165.56 ? 182 LYS N HE2    1 
ATOM   2800   H  HE3    . LYS A  1  182 ? 324.045 228.504 304.641 1.00 165.56 ? 182 LYS N HE3    1 
ATOM   2801   H  HZ1    . LYS A  1  182 ? 323.062 230.400 305.417 1.00 166.91 ? 182 LYS N HZ1    1 
ATOM   2802   H  HZ2    . LYS A  1  182 ? 324.405 230.726 304.984 1.00 166.91 ? 182 LYS N HZ2    1 
ATOM   2803   H  HZ3    . LYS A  1  182 ? 323.271 231.084 304.157 1.00 166.91 ? 182 LYS N HZ3    1 
ATOM   2804   N  N      . VAL A  1  183 ? 322.307 225.259 298.890 1.00 161.24 ? 183 VAL N N      1 
ATOM   2805   C  CA     . VAL A  1  183 ? 321.138 224.644 298.263 1.00 153.42 ? 183 VAL N CA     1 
ATOM   2806   C  C      . VAL A  1  183 ? 321.285 223.126 298.162 1.00 149.99 ? 183 VAL N C      1 
ATOM   2807   O  O      . VAL A  1  183 ? 320.275 222.432 297.969 1.00 135.76 ? 183 VAL N O      1 
ATOM   2808   C  CB     . VAL A  1  183 ? 320.865 225.254 296.869 1.00 145.42 ? 183 VAL N CB     1 
ATOM   2809   C  CG1    . VAL A  1  183 ? 319.671 224.577 296.191 1.00 147.39 ? 183 VAL N CG1    1 
ATOM   2810   C  CG2    . VAL A  1  183 ? 320.601 226.747 296.984 1.00 138.27 ? 183 VAL N CG2    1 
ATOM   2811   H  H      . VAL A  1  183 ? 322.960 225.402 298.349 1.00 139.93 ? 183 VAL N H      1 
ATOM   2812   H  HA     . VAL A  1  183 ? 320.362 224.825 298.816 1.00 132.62 ? 183 VAL N HA     1 
ATOM   2813   H  HB     . VAL A  1  183 ? 321.645 225.127 296.307 1.00 125.43 ? 183 VAL N HB     1 
ATOM   2814   H  HG11   . VAL A  1  183 ? 319.530 224.985 295.321 1.00 127.88 ? 183 VAL N HG11   1 
ATOM   2815   H  HG12   . VAL A  1  183 ? 319.862 223.632 296.086 1.00 127.88 ? 183 VAL N HG12   1 
ATOM   2816   H  HG13   . VAL A  1  183 ? 318.884 224.697 296.744 1.00 127.88 ? 183 VAL N HG13   1 
ATOM   2817   H  HG21   . VAL A  1  183 ? 320.432 227.107 296.099 1.00 119.06 ? 183 VAL N HG21   1 
ATOM   2818   H  HG22   . VAL A  1  183 ? 319.826 226.888 297.551 1.00 119.06 ? 183 VAL N HG22   1 
ATOM   2819   H  HG23   . VAL A  1  183 ? 321.379 227.176 297.373 1.00 119.06 ? 183 VAL N HG23   1 
ATOM   2820   N  N      . LYS A  1  184 ? 322.503 222.589 298.304 1.00 134.41 ? 184 LYS N N      1 
ATOM   2821   C  CA     . LYS A  1  184 ? 322.701 221.144 298.256 1.00 140.25 ? 184 LYS N CA     1 
ATOM   2822   C  C      . LYS A  1  184 ? 322.391 220.470 299.589 1.00 142.17 ? 184 LYS N C      1 
ATOM   2823   O  O      . LYS A  1  184 ? 321.928 219.323 299.602 1.00 129.01 ? 184 LYS N O      1 
ATOM   2824   C  CB     . LYS A  1  184 ? 324.136 220.831 297.832 1.00 141.44 ? 184 LYS N CB     1 
ATOM   2825   C  CG     . LYS A  1  184 ? 324.392 221.091 296.365 1.00 140.68 ? 184 LYS N CG     1 
ATOM   2826   C  CD     . LYS A  1  184 ? 325.852 220.901 296.012 1.00 126.27 ? 184 LYS N CD     1 
ATOM   2827   C  CE     . LYS A  1  184 ? 326.112 221.239 294.552 1.00 135.87 ? 184 LYS N CE     1 
ATOM   2828   N  NZ     . LYS A  1  184 ? 325.718 222.638 294.214 1.00 139.51 ? 184 LYS N NZ     1 
ATOM   2829   H  H      . LYS A  1  184 ? 323.224 223.041 298.428 1.00 117.89 ? 184 LYS N H      1 
ATOM   2830   H  HA     . LYS A  1  184 ? 322.106 220.769 297.589 1.00 122.92 ? 184 LYS N HA     1 
ATOM   2831   H  HB2    . LYS A  1  184 ? 324.744 221.387 298.344 1.00 123.29 ? 184 LYS N HB2    1 
ATOM   2832   H  HB3    . LYS A  1  184 ? 324.318 219.894 298.005 1.00 123.29 ? 184 LYS N HB3    1 
ATOM   2833   H  HG2    . LYS A  1  184 ? 323.868 220.471 295.834 1.00 122.94 ? 184 LYS N HG2    1 
ATOM   2834   H  HG3    . LYS A  1  184 ? 324.146 222.005 296.154 1.00 122.94 ? 184 LYS N HG3    1 
ATOM   2835   H  HD2    . LYS A  1  184 ? 326.395 221.487 296.563 1.00 107.72 ? 184 LYS N HD2    1 
ATOM   2836   H  HD3    . LYS A  1  184 ? 326.100 219.975 296.160 1.00 107.72 ? 184 LYS N HD3    1 
ATOM   2837   H  HE2    . LYS A  1  184 ? 327.059 221.140 294.367 1.00 117.75 ? 184 LYS N HE2    1 
ATOM   2838   H  HE3    . LYS A  1  184 ? 325.598 220.638 293.991 1.00 117.75 ? 184 LYS N HE3    1 
ATOM   2839   H  HZ1    . LYS A  1  184 ? 325.883 222.801 293.355 1.00 122.41 ? 184 LYS N HZ1    1 
ATOM   2840   H  HZ2    . LYS A  1  184 ? 324.849 222.755 294.369 1.00 122.41 ? 184 LYS N HZ2    1 
ATOM   2841   H  HZ3    . LYS A  1  184 ? 326.180 223.213 294.712 1.00 122.41 ? 184 LYS N HZ3    1 
ATOM   2842   N  N      . LYS A  1  185 ? 322.635 221.154 300.711 1.00 158.11 ? 185 LYS N N      1 
ATOM   2843   C  CA     . LYS A  1  185 ? 322.316 220.578 302.016 1.00 171.42 ? 185 LYS N CA     1 
ATOM   2844   C  C      . LYS A  1  185 ? 320.811 220.419 302.194 1.00 170.37 ? 185 LYS N C      1 
ATOM   2845   O  O      . LYS A  1  185 ? 320.344 219.419 302.750 1.00 169.96 ? 185 LYS N O      1 
ATOM   2846   C  CB     . LYS A  1  185 ? 322.868 221.451 303.144 1.00 171.03 ? 185 LYS N CB     1 
ATOM   2847   C  CG     . LYS A  1  185 ? 324.236 222.049 302.900 1.00 162.60 ? 185 LYS N CG     1 
ATOM   2848   C  CD     . LYS A  1  185 ? 325.283 220.985 302.707 1.00 164.06 ? 185 LYS N CD     1 
ATOM   2849   C  CE     . LYS A  1  185 ? 326.637 221.616 302.497 1.00 176.07 ? 185 LYS N CE     1 
ATOM   2850   N  NZ     . LYS A  1  185 ? 327.683 220.591 302.279 1.00 196.78 ? 185 LYS N NZ     1 
ATOM   2851   H  H      . LYS A  1  185 ? 322.980 221.941 300.742 1.00 142.12 ? 185 LYS N H      1 
ATOM   2852   H  HA     . LYS A  1  185 ? 322.723 219.700 302.086 1.00 154.91 ? 185 LYS N HA     1 
ATOM   2853   H  HB2    . LYS A  1  185 ? 322.252 222.186 303.291 1.00 154.29 ? 185 LYS N HB2    1 
ATOM   2854   H  HB3    . LYS A  1  185 ? 322.926 220.912 303.948 1.00 154.29 ? 185 LYS N HB3    1 
ATOM   2855   H  HG2    . LYS A  1  185 ? 324.208 222.596 302.100 1.00 145.48 ? 185 LYS N HG2    1 
ATOM   2856   H  HG3    . LYS A  1  185 ? 324.490 222.588 303.666 1.00 145.48 ? 185 LYS N HG3    1 
ATOM   2857   H  HD2    . LYS A  1  185 ? 325.324 220.424 303.497 1.00 145.87 ? 185 LYS N HD2    1 
ATOM   2858   H  HD3    . LYS A  1  185 ? 325.065 220.455 301.924 1.00 145.87 ? 185 LYS N HD3    1 
ATOM   2859   H  HE2    . LYS A  1  185 ? 326.605 222.190 301.716 1.00 157.49 ? 185 LYS N HE2    1 
ATOM   2860   H  HE3    . LYS A  1  185 ? 326.875 222.132 303.284 1.00 157.49 ? 185 LYS N HE3    1 
ATOM   2861   H  HZ1    . LYS A  1  185 ? 328.473 220.984 302.157 1.00 177.14 ? 185 LYS N HZ1    1 
ATOM   2862   H  HZ2    . LYS A  1  185 ? 327.734 220.053 302.986 1.00 177.14 ? 185 LYS N HZ2    1 
ATOM   2863   H  HZ3    . LYS A  1  185 ? 327.488 220.106 301.559 1.00 177.14 ? 185 LYS N HZ3    1 
ATOM   2864   N  N      . LYS A  1  186 ? 320.045 221.409 301.741 1.00 225.93 ? 186 LYS N N      1 
ATOM   2865   C  CA     . LYS A  1  186 ? 318.597 221.436 301.903 1.00 230.91 ? 186 LYS N CA     1 
ATOM   2866   C  C      . LYS A  1  186 ? 318.207 221.484 303.374 1.00 229.98 ? 186 LYS N C      1 
ATOM   2867   O  O      . LYS A  1  186 ? 318.164 220.454 304.055 1.00 219.73 ? 186 LYS N O      1 
ATOM   2868   C  CB     . LYS A  1  186 ? 317.954 220.236 301.205 1.00 237.01 ? 186 LYS N CB     1 
ATOM   2869   C  CG     . LYS A  1  186 ? 318.074 220.319 299.693 1.00 228.74 ? 186 LYS N CG     1 
ATOM   2870   C  CD     . LYS A  1  186 ? 317.002 219.517 298.978 1.00 213.44 ? 186 LYS N CD     1 
ATOM   2871   C  CE     . LYS A  1  186 ? 315.634 220.187 299.061 1.00 193.27 ? 186 LYS N CE     1 
ATOM   2872   N  NZ     . LYS A  1  186 ? 315.594 221.531 298.416 1.00 176.24 ? 186 LYS N NZ     1 
ATOM   2873   H  H      . LYS A  1  186 ? 320.352 222.096 301.325 1.00 188.72 ? 186 LYS N H      1 
ATOM   2874   H  HA     . LYS A  1  186 ? 318.253 222.239 301.482 1.00 194.42 ? 186 LYS N HA     1 
ATOM   2875   H  HB2    . LYS A  1  186 ? 318.396 219.424 301.499 1.00 200.47 ? 186 LYS N HB2    1 
ATOM   2876   H  HB3    . LYS A  1  186 ? 317.012 220.204 301.432 1.00 200.47 ? 186 LYS N HB3    1 
ATOM   2877   H  HG2    . LYS A  1  186 ? 317.989 221.245 299.419 1.00 192.62 ? 186 LYS N HG2    1 
ATOM   2878   H  HG3    . LYS A  1  186 ? 318.939 219.970 299.425 1.00 192.62 ? 186 LYS N HG3    1 
ATOM   2879   H  HD2    . LYS A  1  186 ? 317.240 219.431 298.042 1.00 177.67 ? 186 LYS N HD2    1 
ATOM   2880   H  HD3    . LYS A  1  186 ? 316.934 218.640 299.387 1.00 177.67 ? 186 LYS N HD3    1 
ATOM   2881   H  HE2    . LYS A  1  186 ? 314.981 219.623 298.617 1.00 158.50 ? 186 LYS N HE2    1 
ATOM   2882   H  HE3    . LYS A  1  186 ? 315.394 220.297 299.995 1.00 158.50 ? 186 LYS N HE3    1 
ATOM   2883   H  HZ1    . LYS A  1  186 ? 314.778 221.879 298.491 1.00 142.31 ? 186 LYS N HZ1    1 
ATOM   2884   H  HZ2    . LYS A  1  186 ? 316.177 222.075 298.810 1.00 142.31 ? 186 LYS N HZ2    1 
ATOM   2885   H  HZ3    . LYS A  1  186 ? 315.800 221.461 297.554 1.00 142.31 ? 186 LYS N HZ3    1 
ATOM   2886   N  N      . PHE A  1  187 ? 317.926 222.693 303.861 1.00 261.14 ? 187 PHE N N      1 
ATOM   2887   C  CA     . PHE A  1  187 ? 317.457 222.913 305.223 1.00 268.18 ? 187 PHE N CA     1 
ATOM   2888   C  C      . PHE A  1  187 ? 315.956 222.668 305.302 1.00 279.85 ? 187 PHE N C      1 
ATOM   2889   O  O      . PHE A  1  187 ? 315.419 221.815 304.587 1.00 255.58 ? 187 PHE N O      1 
ATOM   2890   C  CB     . PHE A  1  187 ? 317.766 224.345 305.674 1.00 257.85 ? 187 PHE N CB     1 
ATOM   2891   C  CG     . PHE A  1  187 ? 319.129 224.836 305.273 1.00 237.10 ? 187 PHE N CG     1 
ATOM   2892   C  CD1    . PHE A  1  187 ? 319.286 226.108 304.742 1.00 214.91 ? 187 PHE N CD1    1 
ATOM   2893   C  CD2    . PHE A  1  187 ? 320.249 224.041 305.440 1.00 233.33 ? 187 PHE N CD2    1 
ATOM   2894   C  CE1    . PHE A  1  187 ? 320.534 226.572 304.374 1.00 202.95 ? 187 PHE N CE1    1 
ATOM   2895   C  CE2    . PHE A  1  187 ? 321.501 224.501 305.074 1.00 221.28 ? 187 PHE N CE2    1 
ATOM   2896   C  CZ     . PHE A  1  187 ? 321.643 225.769 304.540 1.00 207.14 ? 187 PHE N CZ     1 
ATOM   2897   H  H      . PHE A  1  187 ? 318.002 223.419 303.406 1.00 236.03 ? 187 PHE N H      1 
ATOM   2898   H  HA     . PHE A  1  187 ? 317.903 222.297 305.824 1.00 242.98 ? 187 PHE N HA     1 
ATOM   2899   H  HB2    . PHE A  1  187 ? 317.110 224.943 305.283 1.00 233.01 ? 187 PHE N HB2    1 
ATOM   2900   H  HB3    . PHE A  1  187 ? 317.711 224.386 306.641 1.00 233.01 ? 187 PHE N HB3    1 
ATOM   2901   H  HD1    . PHE A  1  187 ? 318.542 226.653 304.627 1.00 190.38 ? 187 PHE N HD1    1 
ATOM   2902   H  HD2    . PHE A  1  187 ? 320.159 223.187 305.797 1.00 207.12 ? 187 PHE N HD2    1 
ATOM   2903   H  HE1    . PHE A  1  187 ? 320.627 227.425 304.016 1.00 178.09 ? 187 PHE N HE1    1 
ATOM   2904   H  HE2    . PHE A  1  187 ? 322.248 223.958 305.187 1.00 194.73 ? 187 PHE N HE2    1 
ATOM   2905   H  HZ     . PHE A  1  187 ? 322.485 226.080 304.294 1.00 181.28 ? 187 PHE N HZ     1 
ATOM   2906   N  N      . ASP A  1  188 ? 315.273 223.411 306.174 1.00 355.51 ? 188 ASP N N      1 
ATOM   2907   C  CA     . ASP A  1  188 ? 313.820 223.487 306.165 1.00 326.59 ? 188 ASP N CA     1 
ATOM   2908   C  C      . ASP A  1  188 ? 313.309 224.776 305.535 1.00 296.56 ? 188 ASP N C      1 
ATOM   2909   O  O      . ASP A  1  188 ? 312.100 224.896 305.305 1.00 258.63 ? 188 ASP N O      1 
ATOM   2910   C  CB     . ASP A  1  188 ? 313.278 223.362 307.593 1.00 306.12 ? 188 ASP N CB     1 
ATOM   2911   C  CG     . ASP A  1  188 ? 313.890 222.204 308.346 1.00 282.93 ? 188 ASP N CG     1 
ATOM   2912   O  OD1    . ASP A  1  188 ? 313.542 221.045 308.038 1.00 269.71 ? 188 ASP N OD1    1 
ATOM   2913   O  OD2    . ASP A  1  188 ? 314.717 222.455 309.248 1.00 270.85 ? 188 ASP N OD2    1 
ATOM   2914   H  H      . ASP A  1  188 ? 315.640 223.888 306.789 1.00 253.66 ? 188 ASP N H      1 
ATOM   2915   H  HA     . ASP A  1  188 ? 313.471 222.744 305.648 1.00 225.50 ? 188 ASP N HA     1 
ATOM   2916   H  HB2    . ASP A  1  188 ? 313.478 224.177 308.080 1.00 204.78 ? 188 ASP N HB2    1 
ATOM   2917   H  HB3    . ASP A  1  188 ? 312.318 223.224 307.557 1.00 204.78 ? 188 ASP N HB3    1 
ATOM   2918   N  N      . TRP A  1  189 ? 314.199 225.727 305.255 1.00 159.03 ? 189 TRP N N      1 
ATOM   2919   C  CA     . TRP A  1  189 ? 313.877 226.973 304.561 1.00 142.38 ? 189 TRP N CA     1 
ATOM   2920   C  C      . TRP A  1  189 ? 312.550 227.560 305.037 1.00 128.22 ? 189 TRP N C      1 
ATOM   2921   O  O      . TRP A  1  189 ? 311.603 227.744 304.272 1.00 112.21 ? 189 TRP N O      1 
ATOM   2922   C  CB     . TRP A  1  189 ? 313.841 226.773 303.050 1.00 131.18 ? 189 TRP N CB     1 
ATOM   2923   C  CG     . TRP A  1  189 ? 315.143 226.424 302.425 1.00 135.30 ? 189 TRP N CG     1 
ATOM   2924   C  CD1    . TRP A  1  189 ? 315.535 225.195 301.986 1.00 149.02 ? 189 TRP N CD1    1 
ATOM   2925   C  CD2    . TRP A  1  189 ? 316.227 227.318 302.144 1.00 135.26 ? 189 TRP N CD2    1 
ATOM   2926   N  NE1    . TRP A  1  189 ? 316.797 225.264 301.450 1.00 157.17 ? 189 TRP N NE1    1 
ATOM   2927   C  CE2    . TRP A  1  189 ? 317.245 226.557 301.536 1.00 148.32 ? 189 TRP N CE2    1 
ATOM   2928   C  CE3    . TRP A  1  189 ? 316.435 228.685 302.346 1.00 119.74 ? 189 TRP N CE3    1 
ATOM   2929   C  CZ2    . TRP A  1  189 ? 318.456 227.118 301.133 1.00 138.48 ? 189 TRP N CZ2    1 
ATOM   2930   C  CZ3    . TRP A  1  189 ? 317.639 229.240 301.945 1.00 108.61 ? 189 TRP N CZ3    1 
ATOM   2931   C  CH2    . TRP A  1  189 ? 318.634 228.458 301.345 1.00 116.20 ? 189 TRP N CH2    1 
ATOM   2932   H  H      . TRP A  1  189 ? 315.030 225.669 305.467 1.00 150.66 ? 189 TRP N H      1 
ATOM   2933   H  HA     . TRP A  1  189 ? 314.572 227.623 304.754 1.00 134.91 ? 189 TRP N HA     1 
ATOM   2934   H  HB2    . TRP A  1  189 ? 313.220 226.056 302.850 1.00 124.11 ? 189 TRP N HB2    1 
ATOM   2935   H  HB3    . TRP A  1  189 ? 313.531 227.595 302.639 1.00 124.11 ? 189 TRP N HB3    1 
ATOM   2936   H  HD1    . TRP A  1  189 ? 315.020 224.422 302.039 1.00 140.77 ? 189 TRP N HD1    1 
ATOM   2937   H  HE1    . TRP A  1  189 ? 317.237 224.603 301.118 1.00 148.48 ? 189 TRP N HE1    1 
ATOM   2938   H  HE3    . TRP A  1  189 ? 315.779 229.211 302.744 1.00 112.44 ? 189 TRP N HE3    1 
ATOM   2939   H  HZ2    . TRP A  1  189 ? 319.119 226.600 300.735 1.00 129.88 ? 189 TRP N HZ2    1 
ATOM   2940   H  HZ3    . TRP A  1  189 ? 317.789 230.149 302.076 1.00 101.07 ? 189 TRP N HZ3    1 
ATOM   2941   H  HH2    . TRP A  1  189 ? 319.433 228.857 301.086 1.00 108.02 ? 189 TRP N HH2    1 
ATOM   2942   N  N      . THR A  1  190 ? 312.495 227.860 306.328 1.00 171.35 ? 190 THR N N      1 
ATOM   2943   C  CA     . THR A  1  190 ? 311.373 228.615 306.854 1.00 170.53 ? 190 THR N CA     1 
ATOM   2944   C  C      . THR A  1  190 ? 311.523 230.081 306.449 1.00 172.95 ? 190 THR N C      1 
ATOM   2945   O  O      . THR A  1  190 ? 312.461 230.466 305.745 1.00 169.97 ? 190 THR N O      1 
ATOM   2946   C  CB     . THR A  1  190 ? 311.299 228.454 308.368 1.00 173.64 ? 190 THR N CB     1 
ATOM   2947   O  OG1    . THR A  1  190 ? 312.469 229.028 308.965 1.00 192.52 ? 190 THR N OG1    1 
ATOM   2948   C  CG2    . THR A  1  190 ? 311.214 226.974 308.734 1.00 157.99 ? 190 THR N CG2    1 
ATOM   2949   H  H      . THR A  1  190 ? 313.087 227.641 306.912 1.00 140.52 ? 190 THR N H      1 
ATOM   2950   H  HA     . THR A  1  190 ? 310.549 228.276 306.470 1.00 140.36 ? 190 THR N HA     1 
ATOM   2951   H  HB     . THR A  1  190 ? 310.508 228.903 308.706 1.00 142.94 ? 190 THR N HB     1 
ATOM   2952   H  HG1    . THR A  1  190 ? 312.436 228.943 309.800 1.00 161.30 ? 190 THR N HG1    1 
ATOM   2953   H  HG21   . THR A  1  190 ? 311.167 226.873 309.698 1.00 126.61 ? 190 THR N HG21   1 
ATOM   2954   H  HG22   . THR A  1  190 ? 310.422 226.580 308.337 1.00 126.61 ? 190 THR N HG22   1 
ATOM   2955   H  HG23   . THR A  1  190 ? 311.998 226.506 308.406 1.00 126.61 ? 190 THR N HG23   1 
ATOM   2956   N  N      . PHE A  1  191 ? 310.583 230.919 306.888 1.00 135.22 ? 191 PHE N N      1 
ATOM   2957   C  CA     . PHE A  1  191 ? 310.703 232.345 306.601 1.00 133.31 ? 191 PHE N CA     1 
ATOM   2958   C  C      . PHE A  1  191 ? 311.974 232.915 307.209 1.00 120.30 ? 191 PHE N C      1 
ATOM   2959   O  O      . PHE A  1  191 ? 312.679 233.706 306.570 1.00 114.70 ? 191 PHE N O      1 
ATOM   2960   C  CB     . PHE A  1  191 ? 309.488 233.111 307.126 1.00 131.64 ? 191 PHE N CB     1 
ATOM   2961   C  CG     . PHE A  1  191 ? 309.595 234.603 306.940 1.00 119.20 ? 191 PHE N CG     1 
ATOM   2962   C  CD1    . PHE A  1  191 ? 309.119 235.202 305.789 1.00 100.16 ? 191 PHE N CD1    1 
ATOM   2963   C  CD2    . PHE A  1  191 ? 310.187 235.402 307.907 1.00 122.49 ? 191 PHE N CD2    1 
ATOM   2964   C  CE1    . PHE A  1  191 ? 309.221 236.564 305.608 1.00 97.49  ? 191 PHE N CE1    1 
ATOM   2965   C  CE2    . PHE A  1  191 ? 310.291 236.770 307.728 1.00 114.31 ? 191 PHE N CE2    1 
ATOM   2966   C  CZ     . PHE A  1  191 ? 309.807 237.349 306.578 1.00 102.40 ? 191 PHE N CZ     1 
ATOM   2967   H  H      . PHE A  1  191 ? 309.887 230.695 307.341 1.00 126.72 ? 191 PHE N H      1 
ATOM   2968   H  HA     . PHE A  1  191 ? 310.746 232.472 305.640 1.00 125.38 ? 191 PHE N HA     1 
ATOM   2969   H  HB2    . PHE A  1  191 ? 308.697 232.808 306.653 1.00 124.35 ? 191 PHE N HB2    1 
ATOM   2970   H  HB3    . PHE A  1  191 ? 309.392 232.935 308.075 1.00 124.35 ? 191 PHE N HB3    1 
ATOM   2971   H  HD1    . PHE A  1  191 ? 308.722 234.679 305.130 1.00 94.18  ? 191 PHE N HD1    1 
ATOM   2972   H  HD2    . PHE A  1  191 ? 310.515 235.014 308.686 1.00 115.44 ? 191 PHE N HD2    1 
ATOM   2973   H  HE1    . PHE A  1  191 ? 308.893 236.955 304.830 1.00 91.97  ? 191 PHE N HE1    1 
ATOM   2974   H  HE2    . PHE A  1  191 ? 310.687 237.297 308.385 1.00 107.73 ? 191 PHE N HE2    1 
ATOM   2975   H  HZ     . PHE A  1  191 ? 309.874 238.269 306.455 1.00 96.58  ? 191 PHE N HZ     1 
ATOM   2976   N  N      . GLU A  1  192 ? 312.282 232.526 308.447 1.00 126.01 ? 192 GLU N N      1 
ATOM   2977   C  CA     . GLU A  1  192 ? 313.441 233.086 309.128 1.00 128.04 ? 192 GLU N CA     1 
ATOM   2978   C  C      . GLU A  1  192 ? 314.745 232.604 308.503 1.00 128.44 ? 192 GLU N C      1 
ATOM   2979   O  O      . GLU A  1  192 ? 315.718 233.362 308.425 1.00 135.04 ? 192 GLU N O      1 
ATOM   2980   C  CB     . GLU A  1  192 ? 313.397 232.727 310.612 1.00 146.63 ? 192 GLU N CB     1 
ATOM   2981   C  CG     . GLU A  1  192 ? 314.629 233.176 311.376 1.00 179.31 ? 192 GLU N CG     1 
ATOM   2982   C  CD     . GLU A  1  192 ? 314.944 234.644 311.146 1.00 208.03 ? 192 GLU N CD     1 
ATOM   2983   O  OE1    . GLU A  1  192 ? 316.011 234.946 310.568 1.00 207.43 ? 192 GLU N OE1    1 
ATOM   2984   O  OE2    . GLU A  1  192 ? 314.115 235.497 311.528 1.00 229.46 ? 192 GLU N OE2    1 
ATOM   2985   H  H      . GLU A  1  192 ? 311.841 231.948 308.905 1.00 117.13 ? 192 GLU N H      1 
ATOM   2986   H  HA     . GLU A  1  192 ? 313.413 234.052 309.053 1.00 118.60 ? 192 GLU N HA     1 
ATOM   2987   H  HB2    . GLU A  1  192 ? 312.625 233.153 311.015 1.00 136.56 ? 192 GLU N HB2    1 
ATOM   2988   H  HB3    . GLU A  1  192 ? 313.327 231.764 310.700 1.00 136.56 ? 192 GLU N HB3    1 
ATOM   2989   H  HG2    . GLU A  1  192 ? 314.480 233.045 312.325 1.00 168.54 ? 192 GLU N HG2    1 
ATOM   2990   H  HG3    . GLU A  1  192 ? 315.392 232.655 311.083 1.00 168.54 ? 192 GLU N HG3    1 
ATOM   2991   N  N      . GLN A  1  193 ? 314.792 231.350 308.056 1.00 147.51 ? 193 GLN N N      1 
ATOM   2992   C  CA     . GLN A  1  193 ? 316.029 230.804 307.514 1.00 149.58 ? 193 GLN N CA     1 
ATOM   2993   C  C      . GLN A  1  193 ? 316.330 231.297 306.108 1.00 150.26 ? 193 GLN N C      1 
ATOM   2994   O  O      . GLN A  1  193 ? 317.475 231.177 305.660 1.00 156.50 ? 193 GLN N O      1 
ATOM   2995   C  CB     . GLN A  1  193 ? 315.975 229.280 307.509 1.00 148.65 ? 193 GLN N CB     1 
ATOM   2996   C  CG     . GLN A  1  193 ? 315.948 228.681 308.889 1.00 159.90 ? 193 GLN N CG     1 
ATOM   2997   C  CD     . GLN A  1  193 ? 315.868 227.175 308.852 1.00 171.37 ? 193 GLN N CD     1 
ATOM   2998   O  OE1    . GLN A  1  193 ? 316.544 226.524 308.053 1.00 183.78 ? 193 GLN N OE1    1 
ATOM   2999   N  NE2    . GLN A  1  193 ? 315.028 226.610 309.709 1.00 167.12 ? 193 GLN N NE2    1 
ATOM   3000   H  H      . GLN A  1  193 ? 314.129 230.803 308.056 1.00 121.96 ? 193 GLN N H      1 
ATOM   3001   H  HA     . GLN A  1  193 ? 316.765 231.072 308.086 1.00 123.40 ? 193 GLN N HA     1 
ATOM   3002   H  HB2    . GLN A  1  193 ? 315.171 228.996 307.045 1.00 121.89 ? 193 GLN N HB2    1 
ATOM   3003   H  HB3    . GLN A  1  193 ? 316.759 228.939 307.051 1.00 121.89 ? 193 GLN N HB3    1 
ATOM   3004   H  HG2    . GLN A  1  193 ? 316.760 228.929 309.359 1.00 132.43 ? 193 GLN N HG2    1 
ATOM   3005   H  HG3    . GLN A  1  193 ? 315.172 229.014 309.366 1.00 132.43 ? 193 GLN N HG3    1 
ATOM   3006   H  HE21   . GLN A  1  193 ? 314.566 227.100 310.245 1.00 138.96 ? 193 GLN N HE21   1 
ATOM   3007   H  HE22   . GLN A  1  193 ? 314.944 225.754 309.729 1.00 138.96 ? 193 GLN N HE22   1 
ATOM   3008   N  N      . THR A  1  194 ? 315.337 231.834 305.401 1.00 129.50 ? 194 THR N N      1 
ATOM   3009   C  CA     . THR A  1  194 ? 315.580 232.385 304.074 1.00 127.69 ? 194 THR N CA     1 
ATOM   3010   C  C      . THR A  1  194 ? 316.058 233.832 304.152 1.00 126.38 ? 194 THR N C      1 
ATOM   3011   O  O      . THR A  1  194 ? 317.012 234.212 303.467 1.00 114.95 ? 194 THR N O      1 
ATOM   3012   C  CB     . THR A  1  194 ? 314.314 232.281 303.220 1.00 136.35 ? 194 THR N CB     1 
ATOM   3013   O  OG1    . THR A  1  194 ? 313.872 230.918 303.186 1.00 156.45 ? 194 THR N OG1    1 
ATOM   3014   C  CG2    . THR A  1  194 ? 314.584 232.757 301.795 1.00 124.39 ? 194 THR N CG2    1 
ATOM   3015   H  H      . THR A  1  194 ? 314.521 231.890 305.666 1.00 116.46 ? 194 THR N H      1 
ATOM   3016   H  HA     . THR A  1  194 ? 316.275 231.865 303.640 1.00 115.16 ? 194 THR N HA     1 
ATOM   3017   H  HB     . THR A  1  194 ? 313.618 232.838 303.603 1.00 124.64 ? 194 THR N HB     1 
ATOM   3018   H  HG1    . THR A  1  194 ? 313.703 230.651 303.964 1.00 144.44 ? 194 THR N HG1    1 
ATOM   3019   H  HG21   . THR A  1  194 ? 313.776 232.687 301.264 1.00 113.17 ? 194 THR N HG21   1 
ATOM   3020   H  HG22   . THR A  1  194 ? 314.876 233.682 301.805 1.00 113.17 ? 194 THR N HG22   1 
ATOM   3021   H  HG23   . THR A  1  194 ? 315.276 232.211 301.390 1.00 113.17 ? 194 THR N HG23   1 
ATOM   3022   N  N      . VAL A  1  195 ? 315.409 234.648 304.986 1.00 105.24 ? 195 VAL N N      1 
ATOM   3023   C  CA     . VAL A  1  195 ? 315.909 235.996 305.238 1.00 99.86  ? 195 VAL N CA     1 
ATOM   3024   C  C      . VAL A  1  195 ? 317.341 235.930 305.755 1.00 91.04  ? 195 VAL N C      1 
ATOM   3025   O  O      . VAL A  1  195 ? 318.162 236.803 305.455 1.00 88.73  ? 195 VAL N O      1 
ATOM   3026   C  CB     . VAL A  1  195 ? 314.978 236.741 306.221 1.00 100.62 ? 195 VAL N CB     1 
ATOM   3027   C  CG1    . VAL A  1  195 ? 315.548 238.109 306.574 1.00 99.38  ? 195 VAL N CG1    1 
ATOM   3028   C  CG2    . VAL A  1  195 ? 313.572 236.893 305.635 1.00 98.71  ? 195 VAL N CG2    1 
ATOM   3029   H  H      . VAL A  1  195 ? 314.689 234.447 305.411 1.00 108.13 ? 195 VAL N H      1 
ATOM   3030   H  HA     . VAL A  1  195 ? 315.917 236.490 304.403 1.00 102.91 ? 195 VAL N HA     1 
ATOM   3031   H  HB     . VAL A  1  195 ? 314.907 236.226 307.039 1.00 104.04 ? 195 VAL N HB     1 
ATOM   3032   H  HG11   . VAL A  1  195 ? 314.945 238.552 307.190 1.00 102.87 ? 195 VAL N HG11   1 
ATOM   3033   H  HG12   . VAL A  1  195 ? 316.417 237.990 306.988 1.00 102.87 ? 195 VAL N HG12   1 
ATOM   3034   H  HG13   . VAL A  1  195 ? 315.637 238.633 305.762 1.00 102.87 ? 195 VAL N HG13   1 
ATOM   3035   H  HG21   . VAL A  1  195 ? 313.013 237.363 306.274 1.00 103.01 ? 195 VAL N HG21   1 
ATOM   3036   H  HG22   . VAL A  1  195 ? 313.628 237.399 304.809 1.00 103.01 ? 195 VAL N HG22   1 
ATOM   3037   H  HG23   . VAL A  1  195 ? 313.206 236.012 305.460 1.00 103.01 ? 195 VAL N HG23   1 
ATOM   3038   N  N      . GLU A  1  196 ? 317.662 234.895 306.532 1.00 143.02 ? 196 GLU N N      1 
ATOM   3039   C  CA     . GLU A  1  196 ? 319.018 234.721 307.042 1.00 147.07 ? 196 GLU N CA     1 
ATOM   3040   C  C      . GLU A  1  196 ? 319.993 234.404 305.912 1.00 156.10 ? 196 GLU N C      1 
ATOM   3041   O  O      . GLU A  1  196 ? 321.071 235.001 305.824 1.00 156.51 ? 196 GLU N O      1 
ATOM   3042   C  CB     . GLU A  1  196 ? 319.020 233.612 308.097 1.00 155.80 ? 196 GLU N CB     1 
ATOM   3043   C  CG     . GLU A  1  196 ? 320.384 233.208 308.632 1.00 171.49 ? 196 GLU N CG     1 
ATOM   3044   C  CD     . GLU A  1  196 ? 320.292 232.041 309.601 1.00 183.79 ? 196 GLU N CD     1 
ATOM   3045   O  OE1    . GLU A  1  196 ? 319.206 231.423 309.684 1.00 184.34 ? 196 GLU N OE1    1 
ATOM   3046   O  OE2    . GLU A  1  196 ? 321.303 231.746 310.277 1.00 191.24 ? 196 GLU N OE2    1 
ATOM   3047   H  H      . GLU A  1  196 ? 317.111 234.282 306.778 1.00 116.30 ? 196 GLU N H      1 
ATOM   3048   H  HA     . GLU A  1  196 ? 319.306 235.543 307.467 1.00 119.44 ? 196 GLU N HA     1 
ATOM   3049   H  HB2    . GLU A  1  196 ? 318.489 233.909 308.853 1.00 127.39 ? 196 GLU N HB2    1 
ATOM   3050   H  HB3    . GLU A  1  196 ? 318.615 232.821 307.709 1.00 127.39 ? 196 GLU N HB3    1 
ATOM   3051   H  HG2    . GLU A  1  196 ? 320.951 232.941 307.891 1.00 142.03 ? 196 GLU N HG2    1 
ATOM   3052   H  HG3    . GLU A  1  196 ? 320.779 233.960 309.101 1.00 142.03 ? 196 GLU N HG3    1 
ATOM   3053   N  N      . THR A  1  197 ? 319.629 233.462 305.037 1.00 112.75 ? 197 THR N N      1 
ATOM   3054   C  CA     . THR A  1  197 ? 320.525 233.059 303.954 1.00 111.16 ? 197 THR N CA     1 
ATOM   3055   C  C      . THR A  1  197 ? 320.834 234.226 303.027 1.00 98.06  ? 197 THR N C      1 
ATOM   3056   O  O      . THR A  1  197 ? 321.956 234.352 302.522 1.00 92.35  ? 197 THR N O      1 
ATOM   3057   C  CB     . THR A  1  197 ? 319.905 231.905 303.158 1.00 115.22 ? 197 THR N CB     1 
ATOM   3058   O  OG1    . THR A  1  197 ? 319.904 230.712 303.955 1.00 127.19 ? 197 THR N OG1    1 
ATOM   3059   C  CG2    . THR A  1  197 ? 320.672 231.649 301.848 1.00 108.01 ? 197 THR N CG2    1 
ATOM   3060   H  H      . THR A  1  197 ? 318.876 233.046 305.049 1.00 114.54 ? 197 THR N H      1 
ATOM   3061   H  HA     . THR A  1  197 ? 321.361 232.747 304.334 1.00 112.70 ? 197 THR N HA     1 
ATOM   3062   H  HB     . THR A  1  197 ? 318.991 232.134 302.931 1.00 116.87 ? 197 THR N HB     1 
ATOM   3063   H  HG1    . THR A  1  197 ? 319.455 230.835 304.655 1.00 128.11 ? 197 THR N HG1    1 
ATOM   3064   H  HG21   . THR A  1  197 ? 320.263 230.916 301.363 1.00 109.59 ? 197 THR N HG21   1 
ATOM   3065   H  HG22   . THR A  1  197 ? 320.654 232.444 301.293 1.00 109.59 ? 197 THR N HG22   1 
ATOM   3066   H  HG23   . THR A  1  197 ? 321.595 231.421 302.043 1.00 109.59 ? 197 THR N HG23   1 
ATOM   3067   N  N      . ALA A  1  198 ? 319.844 235.078 302.772 1.00 129.19 ? 198 ALA N N      1 
ATOM   3068   C  CA     . ALA A  1  198 ? 320.051 236.191 301.857 1.00 151.71 ? 198 ALA N CA     1 
ATOM   3069   C  C      . ALA A  1  198 ? 321.036 237.199 302.437 1.00 161.78 ? 198 ALA N C      1 
ATOM   3070   O  O      . ALA A  1  198 ? 322.006 237.586 301.775 1.00 169.67 ? 198 ALA N O      1 
ATOM   3071   C  CB     . ALA A  1  198 ? 318.712 236.855 301.537 1.00 164.32 ? 198 ALA N CB     1 
ATOM   3072   H  H      . ALA A  1  198 ? 319.055 235.034 303.111 1.00 105.62 ? 198 ALA N H      1 
ATOM   3073   H  HA     . ALA A  1  198 ? 320.423 235.852 301.027 1.00 128.73 ? 198 ALA N HA     1 
ATOM   3074   H  HB1    . ALA A  1  198 ? 318.864 237.594 300.927 1.00 142.32 ? 198 ALA N HB1    1 
ATOM   3075   H  HB2    . ALA A  1  198 ? 318.125 236.202 301.126 1.00 142.32 ? 198 ALA N HB2    1 
ATOM   3076   H  HB3    . ALA A  1  198 ? 318.317 237.182 302.361 1.00 142.32 ? 198 ALA N HB3    1 
ATOM   3077   N  N      . ILE A  1  199 ? 320.806 237.632 303.678 1.00 114.86 ? 199 ILE N N      1 
ATOM   3078   C  CA     . ILE A  1  199 ? 321.649 238.667 304.271 1.00 101.18 ? 199 ILE N CA     1 
ATOM   3079   C  C      . ILE A  1  199 ? 323.087 238.178 304.383 1.00 119.02 ? 199 ILE N C      1 
ATOM   3080   O  O      . ILE A  1  199 ? 324.025 238.861 303.957 1.00 133.26 ? 199 ILE N O      1 
ATOM   3081   C  CB     . ILE A  1  199 ? 321.092 239.100 305.640 1.00 100.82 ? 199 ILE N CB     1 
ATOM   3082   C  CG1    . ILE A  1  199 ? 319.689 239.696 305.490 1.00 104.80 ? 199 ILE N CG1    1 
ATOM   3083   C  CG2    . ILE A  1  199 ? 322.014 240.132 306.282 1.00 101.57 ? 199 ILE N CG2    1 
ATOM   3084   C  CD1    . ILE A  1  199 ? 318.975 239.922 306.812 1.00 115.46 ? 199 ILE N CD1    1 
ATOM   3085   H  H      . ILE A  1  199 ? 320.177 237.347 304.190 1.00 112.85 ? 199 ILE N H      1 
ATOM   3086   H  HA     . ILE A  1  199 ? 321.644 239.444 303.691 1.00 98.91  ? 199 ILE N HA     1 
ATOM   3087   H  HB     . ILE A  1  199 ? 321.042 238.323 306.218 1.00 98.51  ? 199 ILE N HB     1 
ATOM   3088   H  HG12   . ILE A  1  199 ? 319.759 240.553 305.041 1.00 103.43 ? 199 ILE N HG12   1 
ATOM   3089   H  HG13   . ILE A  1  199 ? 319.147 239.090 304.960 1.00 103.43 ? 199 ILE N HG13   1 
ATOM   3090   H  HG21   . ILE A  1  199 ? 321.647 240.392 307.142 1.00 98.92  ? 199 ILE N HG21   1 
ATOM   3091   H  HG22   . ILE A  1  199 ? 322.892 239.739 306.402 1.00 98.92  ? 199 ILE N HG22   1 
ATOM   3092   H  HG23   . ILE A  1  199 ? 322.075 240.906 305.700 1.00 98.92  ? 199 ILE N HG23   1 
ATOM   3093   H  HD11   . ILE A  1  199 ? 318.099 240.298 306.636 1.00 114.06 ? 199 ILE N HD11   1 
ATOM   3094   H  HD12   . ILE A  1  199 ? 318.885 239.072 307.271 1.00 114.06 ? 199 ILE N HD12   1 
ATOM   3095   H  HD13   . ILE A  1  199 ? 319.498 240.536 307.351 1.00 114.06 ? 199 ILE N HD13   1 
ATOM   3096   N  N      . THR A  1  200 ? 323.286 236.988 304.958 1.00 152.36 ? 200 THR N N      1 
ATOM   3097   C  CA     . THR A  1  200 ? 324.639 236.479 305.166 1.00 154.85 ? 200 THR N CA     1 
ATOM   3098   C  C      . THR A  1  200 ? 325.335 236.105 303.865 1.00 152.36 ? 200 THR N C      1 
ATOM   3099   O  O      . THR A  1  200 ? 326.554 235.907 303.871 1.00 151.04 ? 200 THR N O      1 
ATOM   3100   C  CB     . THR A  1  200 ? 324.621 235.259 306.087 1.00 143.49 ? 200 THR N CB     1 
ATOM   3101   O  OG1    . THR A  1  200 ? 323.821 234.222 305.503 1.00 134.50 ? 200 THR N OG1    1 
ATOM   3102   C  CG2    . THR A  1  200 ? 324.065 235.629 307.455 1.00 138.57 ? 200 THR N CG2    1 
ATOM   3103   H  H      . THR A  1  200 ? 322.661 236.464 305.232 1.00 133.73 ? 200 THR N H      1 
ATOM   3104   H  HA     . THR A  1  200 ? 325.168 237.168 305.597 1.00 135.25 ? 200 THR N HA     1 
ATOM   3105   H  HB     . THR A  1  200 ? 325.527 234.935 306.206 1.00 123.12 ? 200 THR N HB     1 
ATOM   3106   H  HG1    . THR A  1  200 ? 323.034 234.494 305.392 1.00 114.37 ? 200 THR N HG1    1 
ATOM   3107   H  HG21   . THR A  1  200 ? 324.057 234.850 308.031 1.00 118.15 ? 200 THR N HG21   1 
ATOM   3108   H  HG22   . THR A  1  200 ? 324.616 236.317 307.861 1.00 118.15 ? 200 THR N HG22   1 
ATOM   3109   H  HG23   . THR A  1  200 ? 323.159 235.964 307.364 1.00 118.15 ? 200 THR N HG23   1 
ATOM   3110   N  N      . CYS A  1  201 ? 324.594 235.995 302.763 1.00 152.96 ? 201 CYS N N      1 
ATOM   3111   C  CA     . CYS A  1  201 ? 325.216 235.772 301.464 1.00 153.44 ? 201 CYS N CA     1 
ATOM   3112   C  C      . CYS A  1  201 ? 325.748 237.076 300.878 1.00 150.67 ? 201 CYS N C      1 
ATOM   3113   O  O      . CYS A  1  201 ? 326.799 237.087 300.226 1.00 141.06 ? 201 CYS N O      1 
ATOM   3114   C  CB     . CYS A  1  201 ? 324.207 235.120 300.521 1.00 165.03 ? 201 CYS N CB     1 
ATOM   3115   S  SG     . CYS A  1  201 ? 324.795 234.885 298.836 1.00 165.01 ? 201 CYS N SG     1 
ATOM   3116   H  H      . CYS A  1  201 ? 323.736 236.047 302.742 1.00 135.85 ? 201 CYS N H      1 
ATOM   3117   H  HA     . CYS A  1  201 ? 325.964 235.163 301.572 1.00 136.34 ? 201 CYS N HA     1 
ATOM   3118   H  HB2    . CYS A  1  201 ? 323.972 234.248 300.874 1.00 148.52 ? 201 CYS N HB2    1 
ATOM   3119   H  HB3    . CYS A  1  201 ? 323.415 235.679 300.481 1.00 148.52 ? 201 CYS N HB3    1 
ATOM   3120   H  HG     . CYS A  1  201 ? 325.765 234.179 298.856 1.00 148.62 ? 201 CYS N HG     1 
ATOM   3121   N  N      . LEU A  1  202 ? 325.031 238.182 301.102 1.00 129.13 ? 202 LEU N N      1 
ATOM   3122   C  CA     . LEU A  1  202 ? 325.526 239.501 300.720 1.00 117.54 ? 202 LEU N CA     1 
ATOM   3123   C  C      . LEU A  1  202 ? 326.630 239.978 301.663 1.00 113.16 ? 202 LEU N C      1 
ATOM   3124   O  O      . LEU A  1  202 ? 327.550 240.684 301.232 1.00 113.89 ? 202 LEU N O      1 
ATOM   3125   C  CB     . LEU A  1  202 ? 324.359 240.497 300.708 1.00 115.23 ? 202 LEU N CB     1 
ATOM   3126   C  CG     . LEU A  1  202 ? 324.455 241.801 299.905 1.00 129.78 ? 202 LEU N CG     1 
ATOM   3127   C  CD1    . LEU A  1  202 ? 324.491 241.529 298.410 1.00 135.61 ? 202 LEU N CD1    1 
ATOM   3128   C  CD2    . LEU A  1  202 ? 323.287 242.729 300.237 1.00 142.37 ? 202 LEU N CD2    1 
ATOM   3129   H  H      . LEU A  1  202 ? 324.256 238.192 301.473 1.00 107.89 ? 202 LEU N H      1 
ATOM   3130   H  HA     . LEU A  1  202 ? 325.894 239.456 299.824 1.00 96.63  ? 202 LEU N HA     1 
ATOM   3131   H  HB2    . LEU A  1  202 ? 323.581 240.026 300.370 1.00 95.26  ? 202 LEU N HB2    1 
ATOM   3132   H  HB3    . LEU A  1  202 ? 324.189 240.754 301.627 1.00 95.26  ? 202 LEU N HB3    1 
ATOM   3133   H  HG     . LEU A  1  202 ? 325.277 242.258 300.145 1.00 110.45 ? 202 LEU N HG     1 
ATOM   3134   H  HD11   . LEU A  1  202 ? 324.552 242.374 297.937 1.00 116.63 ? 202 LEU N HD11   1 
ATOM   3135   H  HD12   . LEU A  1  202 ? 325.264 240.979 298.208 1.00 116.63 ? 202 LEU N HD12   1 
ATOM   3136   H  HD13   . LEU A  1  202 ? 323.678 241.064 298.155 1.00 116.63 ? 202 LEU N HD13   1 
ATOM   3137   H  HD21   . LEU A  1  202 ? 323.373 243.543 299.717 1.00 123.81 ? 202 LEU N HD21   1 
ATOM   3138   H  HD22   . LEU A  1  202 ? 322.456 242.280 300.015 1.00 123.81 ? 202 LEU N HD22   1 
ATOM   3139   H  HD23   . LEU A  1  202 ? 323.308 242.936 301.184 1.00 123.81 ? 202 LEU N HD23   1 
ATOM   3140   N  N      . SER A  1  203 ? 326.567 239.586 302.940 1.00 147.27 ? 203 SER N N      1 
ATOM   3141   C  CA     . SER A  1  203 ? 327.501 240.099 303.943 1.00 158.09 ? 203 SER N CA     1 
ATOM   3142   C  C      . SER A  1  203 ? 328.917 239.594 303.708 1.00 170.70 ? 203 SER N C      1 
ATOM   3143   O  O      . SER A  1  203 ? 329.889 240.334 303.905 1.00 172.79 ? 203 SER N O      1 
ATOM   3144   C  CB     . SER A  1  203 ? 327.040 239.693 305.342 1.00 168.61 ? 203 SER N CB     1 
ATOM   3145   O  OG     . SER A  1  203 ? 325.925 240.457 305.767 1.00 177.48 ? 203 SER N OG     1 
ATOM   3146   H  H      . SER A  1  203 ? 325.992 239.025 303.249 1.00 121.84 ? 203 SER N H      1 
ATOM   3147   H  HA     . SER A  1  203 ? 327.515 241.067 303.899 1.00 131.99 ? 203 SER N HA     1 
ATOM   3148   H  HB2    . SER A  1  203 ? 326.790 238.755 305.330 1.00 142.13 ? 203 SER N HB2    1 
ATOM   3149   H  HB3    . SER A  1  203 ? 327.770 239.831 305.965 1.00 142.13 ? 203 SER N HB3    1 
ATOM   3150   H  HG     . SER A  1  203 ? 325.283 240.347 305.237 1.00 151.70 ? 203 SER N HG     1 
ATOM   3151   N  N      . THR A  1  204 ? 329.053 238.331 303.319 1.00 131.03 ? 204 THR N N      1 
ATOM   3152   C  CA     . THR A  1  204 ? 330.357 237.702 303.183 1.00 137.39 ? 204 THR N CA     1 
ATOM   3153   C  C      . THR A  1  204 ? 331.002 237.961 301.832 1.00 111.26 ? 204 THR N C      1 
ATOM   3154   O  O      . THR A  1  204 ? 332.227 237.864 301.713 1.00 114.76 ? 204 THR N O      1 
ATOM   3155   C  CB     . THR A  1  204 ? 330.225 236.194 303.399 1.00 124.06 ? 204 THR N CB     1 
ATOM   3156   O  OG1    . THR A  1  204 ? 329.380 235.638 302.384 1.00 115.53 ? 204 THR N OG1    1 
ATOM   3157   C  CG2    . THR A  1  204 ? 329.620 235.915 304.769 1.00 121.72 ? 204 THR N CG2    1 
ATOM   3158   H  H      . THR A  1  204 ? 328.395 237.812 303.125 1.00 126.22 ? 204 THR N H      1 
ATOM   3159   H  HA     . THR A  1  204 ? 330.948 238.052 303.868 1.00 131.67 ? 204 THR N HA     1 
ATOM   3160   H  HB     . THR A  1  204 ? 331.101 235.780 303.356 1.00 117.76 ? 204 THR N HB     1 
ATOM   3161   H  HG1    . THR A  1  204 ? 328.618 235.990 302.420 1.00 109.84 ? 204 THR N HG1    1 
ATOM   3162   H  HG21   . THR A  1  204 ? 329.537 234.958 304.905 1.00 115.17 ? 204 THR N HG21   1 
ATOM   3163   H  HG22   . THR A  1  204 ? 330.188 236.284 305.463 1.00 115.17 ? 204 THR N HG22   1 
ATOM   3164   H  HG23   . THR A  1  204 ? 328.741 236.320 304.831 1.00 115.17 ? 204 THR N HG23   1 
ATOM   3165   N  N      . VAL A  1  205 ? 330.207 238.295 300.816 1.00 101.10 ? 205 VAL N N      1 
ATOM   3166   C  CA     . VAL A  1  205 ? 330.753 238.604 299.501 1.00 107.14 ? 205 VAL N CA     1 
ATOM   3167   C  C      . VAL A  1  205 ? 331.240 240.044 299.426 1.00 110.49 ? 205 VAL N C      1 
ATOM   3168   O  O      . VAL A  1  205 ? 332.072 240.369 298.572 1.00 103.53 ? 205 VAL N O      1 
ATOM   3169   C  CB     . VAL A  1  205 ? 329.696 238.316 298.427 1.00 112.45 ? 205 VAL N CB     1 
ATOM   3170   C  CG1    . VAL A  1  205 ? 330.125 238.870 297.078 1.00 102.29 ? 205 VAL N CG1    1 
ATOM   3171   C  CG2    . VAL A  1  205 ? 329.462 236.814 298.345 1.00 130.22 ? 205 VAL N CG2    1 
ATOM   3172   H  H      . VAL A  1  205 ? 329.350 238.350 300.864 1.00 103.14 ? 205 VAL N H      1 
ATOM   3173   H  HA     . VAL A  1  205 ? 331.513 238.025 299.334 1.00 109.43 ? 205 VAL N HA     1 
ATOM   3174   H  HB     . VAL A  1  205 ? 328.861 238.740 298.678 1.00 115.56 ? 205 VAL N HB     1 
ATOM   3175   H  HG11   . VAL A  1  205 ? 329.438 238.672 296.423 1.00 105.79 ? 205 VAL N HG11   1 
ATOM   3176   H  HG12   . VAL A  1  205 ? 330.243 239.830 297.155 1.00 105.79 ? 205 VAL N HG12   1 
ATOM   3177   H  HG13   . VAL A  1  205 ? 330.962 238.453 296.818 1.00 105.79 ? 205 VAL N HG13   1 
ATOM   3178   H  HG21   . VAL A  1  205 ? 328.794 236.635 297.666 1.00 132.92 ? 205 VAL N HG21   1 
ATOM   3179   H  HG22   . VAL A  1  205 ? 330.296 236.377 298.113 1.00 132.92 ? 205 VAL N HG22   1 
ATOM   3180   H  HG23   . VAL A  1  205 ? 329.151 236.496 299.207 1.00 132.92 ? 205 VAL N HG23   1 
ATOM   3181   N  N      . LEU A  1  206 ? 330.728 240.918 300.284 1.00 131.74 ? 206 LEU N N      1 
ATOM   3182   C  CA     . LEU A  1  206 ? 331.259 242.263 300.437 1.00 130.66 ? 206 LEU N CA     1 
ATOM   3183   C  C      . LEU A  1  206 ? 332.080 242.419 301.703 1.00 144.88 ? 206 LEU N C      1 
ATOM   3184   O  O      . LEU A  1  206 ? 332.959 243.286 301.761 1.00 139.13 ? 206 LEU N O      1 
ATOM   3185   C  CB     . LEU A  1  206 ? 330.112 243.271 300.455 1.00 107.58 ? 206 LEU N CB     1 
ATOM   3186   C  CG     . LEU A  1  206 ? 329.094 243.055 299.341 1.00 101.42 ? 206 LEU N CG     1 
ATOM   3187   C  CD1    . LEU A  1  206 ? 327.843 243.835 299.657 1.00 100.27 ? 206 LEU N CD1    1 
ATOM   3188   C  CD2    . LEU A  1  206 ? 329.714 243.473 298.019 1.00 99.97  ? 206 LEU N CD2    1 
ATOM   3189   H  H      . LEU A  1  206 ? 330.059 240.751 300.798 1.00 128.26 ? 206 LEU N H      1 
ATOM   3190   H  HA     . LEU A  1  206 ? 331.829 242.467 299.680 1.00 127.30 ? 206 LEU N HA     1 
ATOM   3191   H  HB2    . LEU A  1  206 ? 329.645 243.200 301.302 1.00 105.17 ? 206 LEU N HB2    1 
ATOM   3192   H  HB3    . LEU A  1  206 ? 330.478 244.164 300.354 1.00 105.17 ? 206 LEU N HB3    1 
ATOM   3193   H  HG     . LEU A  1  206 ? 328.865 242.114 299.290 1.00 99.85  ? 206 LEU N HG     1 
ATOM   3194   H  HD11   . LEU A  1  206 ? 327.197 243.696 298.947 1.00 99.50  ? 206 LEU N HD11   1 
ATOM   3195   H  HD12   . LEU A  1  206 ? 327.480 243.521 300.500 1.00 99.50  ? 206 LEU N HD12   1 
ATOM   3196   H  HD13   . LEU A  1  206 ? 328.066 244.776 299.722 1.00 99.50  ? 206 LEU N HD13   1 
ATOM   3197   H  HD21   . LEU A  1  206 ? 329.067 243.336 297.310 1.00 98.63  ? 206 LEU N HD21   1 
ATOM   3198   H  HD22   . LEU A  1  206 ? 329.958 244.411 298.068 1.00 98.63  ? 206 LEU N HD22   1 
ATOM   3199   H  HD23   . LEU A  1  206 ? 330.503 242.933 297.856 1.00 98.63  ? 206 LEU N HD23   1 
ATOM   3200   N  N      . SER A  1  207 ? 331.799 241.596 302.714 1.00 209.85 ? 207 SER N N      1 
ATOM   3201   C  CA     . SER A  1  207 ? 332.550 241.592 303.964 1.00 204.80 ? 207 SER N CA     1 
ATOM   3202   C  C      . SER A  1  207 ? 332.223 242.843 304.787 1.00 191.63 ? 207 SER N C      1 
ATOM   3203   O  O      . SER A  1  207 ? 333.107 243.573 305.224 1.00 193.37 ? 207 SER N O      1 
ATOM   3204   C  CB     . SER A  1  207 ? 334.053 241.482 303.688 1.00 194.65 ? 207 SER N CB     1 
ATOM   3205   O  OG     . SER A  1  207 ? 334.310 240.405 302.801 1.00 178.15 ? 207 SER N OG     1 
ATOM   3206   H  H      . SER A  1  207 ? 331.161 241.019 302.697 1.00 163.88 ? 207 SER N H      1 
ATOM   3207   H  HA     . SER A  1  207 ? 332.287 240.817 304.485 1.00 157.96 ? 207 SER N HA     1 
ATOM   3208   H  HB2    . SER A  1  207 ? 334.363 242.307 303.284 1.00 147.00 ? 207 SER N HB2    1 
ATOM   3209   H  HB3    . SER A  1  207 ? 334.519 241.323 304.523 1.00 147.00 ? 207 SER N HB3    1 
ATOM   3210   H  HG     . SER A  1  207 ? 335.134 240.347 302.651 1.00 130.29 ? 207 SER N HG     1 
ATOM   3211   N  N      . ILE A  1  208 ? 330.927 243.084 304.987 1.00 168.03 ? 208 ILE N N      1 
ATOM   3212   C  CA     . ILE A  1  208 ? 330.480 244.307 305.638 1.00 172.96 ? 208 ILE N CA     1 
ATOM   3213   C  C      . ILE A  1  208 ? 329.943 243.999 307.026 1.00 185.67 ? 208 ILE N C      1 
ATOM   3214   O  O      . ILE A  1  208 ? 330.485 244.464 308.032 1.00 189.08 ? 208 ILE N O      1 
ATOM   3215   C  CB     . ILE A  1  208 ? 329.398 245.022 304.805 1.00 175.22 ? 208 ILE N CB     1 
ATOM   3216   C  CG1    . ILE A  1  208 ? 329.926 245.367 303.408 1.00 185.39 ? 208 ILE N CG1    1 
ATOM   3217   C  CG2    . ILE A  1  208 ? 328.891 246.272 305.528 1.00 169.94 ? 208 ILE N CG2    1 
ATOM   3218   C  CD1    . ILE A  1  208 ? 331.116 246.310 303.386 1.00 193.60 ? 208 ILE N CD1    1 
ATOM   3219   H  H      . ILE A  1  208 ? 330.291 242.554 304.754 1.00 143.91 ? 208 ILE N H      1 
ATOM   3220   H  HA     . ILE A  1  208 ? 331.234 244.910 305.734 1.00 149.24 ? 208 ILE N HA     1 
ATOM   3221   H  HB     . ILE A  1  208 ? 328.650 244.413 304.700 1.00 152.62 ? 208 ILE N HB     1 
ATOM   3222   H  HG12   . ILE A  1  208 ? 330.196 244.545 302.969 1.00 163.11 ? 208 ILE N HG12   1 
ATOM   3223   H  HG13   . ILE A  1  208 ? 329.212 245.785 302.903 1.00 163.11 ? 208 ILE N HG13   1 
ATOM   3224   H  HG21   . ILE A  1  208 ? 328.214 246.699 304.982 1.00 147.73 ? 208 ILE N HG21   1 
ATOM   3225   H  HG22   . ILE A  1  208 ? 328.512 246.010 306.382 1.00 147.73 ? 208 ILE N HG22   1 
ATOM   3226   H  HG23   . ILE A  1  208 ? 329.635 246.878 305.668 1.00 147.73 ? 208 ILE N HG23   1 
ATOM   3227   H  HD11   . ILE A  1  208 ? 331.376 246.468 302.465 1.00 170.97 ? 208 ILE N HD11   1 
ATOM   3228   H  HD12   . ILE A  1  208 ? 330.862 247.147 303.807 1.00 170.97 ? 208 ILE N HD12   1 
ATOM   3229   H  HD13   . ILE A  1  208 ? 331.849 245.903 303.873 1.00 170.97 ? 208 ILE N HD13   1 
ATOM   3230   N  N      . ASP A  1  209 ? 328.865 243.220 307.078 1.00 200.43 ? 209 ASP N N      1 
ATOM   3231   C  CA     . ASP A  1  209 ? 327.993 243.150 308.247 1.00 199.80 ? 209 ASP N CA     1 
ATOM   3232   C  C      . ASP A  1  209 ? 327.267 244.481 308.374 1.00 184.52 ? 209 ASP N C      1 
ATOM   3233   O  O      . ASP A  1  209 ? 327.832 245.473 308.845 1.00 166.66 ? 209 ASP N O      1 
ATOM   3234   C  CB     . ASP A  1  209 ? 328.764 242.834 309.529 1.00 210.55 ? 209 ASP N CB     1 
ATOM   3235   C  CG     . ASP A  1  209 ? 327.852 242.365 310.652 1.00 205.38 ? 209 ASP N CG     1 
ATOM   3236   O  OD1    . ASP A  1  209 ? 327.811 241.143 310.911 1.00 209.25 ? 209 ASP N OD1    1 
ATOM   3237   O  OD2    . ASP A  1  209 ? 327.171 243.215 311.264 1.00 194.86 ? 209 ASP N OD2    1 
ATOM   3238   H  H      . ASP A  1  209 ? 328.613 242.710 306.433 1.00 172.83 ? 209 ASP N H      1 
ATOM   3239   H  HA     . ASP A  1  209 ? 327.331 242.455 308.111 1.00 172.21 ? 209 ASP N HA     1 
ATOM   3240   H  HB2    . ASP A  1  209 ? 329.405 242.129 309.348 1.00 181.94 ? 209 ASP N HB2    1 
ATOM   3241   H  HB3    . ASP A  1  209 ? 329.224 243.633 309.829 1.00 181.94 ? 209 ASP N HB3    1 
ATOM   3242   N  N      . PHE A  1  210 ? 326.000 244.493 307.968 1.00 150.60 ? 210 PHE N N      1 
ATOM   3243   C  CA     . PHE A  1  210 ? 325.276 245.718 307.687 1.00 140.96 ? 210 PHE N CA     1 
ATOM   3244   C  C      . PHE A  1  210 ? 324.651 246.309 308.943 1.00 146.59 ? 210 PHE N C      1 
ATOM   3245   O  O      . PHE A  1  210 ? 324.361 245.606 309.914 1.00 140.53 ? 210 PHE N O      1 
ATOM   3246   C  CB     . PHE A  1  210 ? 324.173 245.447 306.656 1.00 122.75 ? 210 PHE N CB     1 
ATOM   3247   C  CG     . PHE A  1  210 ? 324.670 244.855 305.360 1.00 128.95 ? 210 PHE N CG     1 
ATOM   3248   C  CD1    . PHE A  1  210 ? 325.480 245.594 304.505 1.00 136.31 ? 210 PHE N CD1    1 
ATOM   3249   C  CD2    . PHE A  1  210 ? 324.306 243.568 304.985 1.00 136.99 ? 210 PHE N CD2    1 
ATOM   3250   C  CE1    . PHE A  1  210 ? 325.932 245.055 303.308 1.00 145.65 ? 210 PHE N CE1    1 
ATOM   3251   C  CE2    . PHE A  1  210 ? 324.753 243.025 303.788 1.00 149.66 ? 210 PHE N CE2    1 
ATOM   3252   C  CZ     . PHE A  1  210 ? 325.568 243.771 302.950 1.00 151.98 ? 210 PHE N CZ     1 
ATOM   3253   H  H      . PHE A  1  210 ? 325.531 243.782 307.845 1.00 141.51 ? 210 PHE N H      1 
ATOM   3254   H  HA     . PHE A  1  210 ? 325.888 246.373 307.314 1.00 132.72 ? 210 PHE N HA     1 
ATOM   3255   H  HB2    . PHE A  1  210 ? 323.536 244.824 307.040 1.00 115.37 ? 210 PHE N HB2    1 
ATOM   3256   H  HB3    . PHE A  1  210 ? 323.729 246.284 306.448 1.00 115.37 ? 210 PHE N HB3    1 
ATOM   3257   H  HD1    . PHE A  1  210 ? 325.729 246.458 304.742 1.00 129.07 ? 210 PHE N HD1    1 
ATOM   3258   H  HD2    . PHE A  1  210 ? 323.761 243.063 305.544 1.00 129.58 ? 210 PHE N HD2    1 
ATOM   3259   H  HE1    . PHE A  1  210 ? 326.478 245.558 302.747 1.00 138.44 ? 210 PHE N HE1    1 
ATOM   3260   H  HE2    . PHE A  1  210 ? 324.508 242.161 303.550 1.00 142.27 ? 210 PHE N HE2    1 
ATOM   3261   H  HZ     . PHE A  1  210 ? 325.869 243.408 302.148 1.00 144.69 ? 210 PHE N HZ     1 
ATOM   3262   N  N      . LYS A  1  211 ? 324.463 247.623 308.915 1.00 148.78 ? 211 LYS N N      1 
ATOM   3263   C  CA     . LYS A  1  211 ? 323.460 248.286 309.731 1.00 145.31 ? 211 LYS N CA     1 
ATOM   3264   C  C      . LYS A  1  211 ? 322.146 248.329 308.966 1.00 134.56 ? 211 LYS N C      1 
ATOM   3265   O  O      . LYS A  1  211 ? 322.133 248.300 307.733 1.00 124.28 ? 211 LYS N O      1 
ATOM   3266   C  CB     . LYS A  1  211 ? 323.900 249.707 310.060 1.00 137.20 ? 211 LYS N CB     1 
ATOM   3267   C  CG     . LYS A  1  211 ? 325.328 249.854 310.501 1.00 138.00 ? 211 LYS N CG     1 
ATOM   3268   C  CD     . LYS A  1  211 ? 325.641 251.320 310.775 1.00 145.24 ? 211 LYS N CD     1 
ATOM   3269   C  CE     . LYS A  1  211 ? 325.803 252.145 309.487 1.00 141.52 ? 211 LYS N CE     1 
ATOM   3270   N  NZ     . LYS A  1  211 ? 324.537 252.676 308.873 1.00 129.67 ? 211 LYS N NZ     1 
ATOM   3271   H  H      . LYS A  1  211 ? 324.914 248.162 308.419 1.00 140.07 ? 211 LYS N H      1 
ATOM   3272   H  HA     . LYS A  1  211 ? 323.328 247.797 310.558 1.00 136.97 ? 211 LYS N HA     1 
ATOM   3273   H  HB2    . LYS A  1  211 ? 323.782 250.256 309.269 1.00 128.88 ? 211 LYS N HB2    1 
ATOM   3274   H  HB3    . LYS A  1  211 ? 323.339 250.045 310.775 1.00 128.88 ? 211 LYS N HB3    1 
ATOM   3275   H  HG2    . LYS A  1  211 ? 325.469 249.351 311.318 1.00 128.82 ? 211 LYS N HG2    1 
ATOM   3276   H  HG3    . LYS A  1  211 ? 325.919 249.538 309.800 1.00 128.82 ? 211 LYS N HG3    1 
ATOM   3277   H  HD2    . LYS A  1  211 ? 324.916 251.708 311.290 1.00 136.15 ? 211 LYS N HD2    1 
ATOM   3278   H  HD3    . LYS A  1  211 ? 326.471 251.379 311.274 1.00 136.15 ? 211 LYS N HD3    1 
ATOM   3279   H  HE2    . LYS A  1  211 ? 326.369 252.908 309.683 1.00 133.05 ? 211 LYS N HE2    1 
ATOM   3280   H  HE3    . LYS A  1  211 ? 326.234 251.587 308.820 1.00 133.05 ? 211 LYS N HE3    1 
ATOM   3281   H  HZ1    . LYS A  1  211 ? 324.727 253.137 308.137 1.00 122.19 ? 211 LYS N HZ1    1 
ATOM   3282   H  HZ2    . LYS A  1  211 ? 323.997 252.001 308.661 1.00 122.19 ? 211 LYS N HZ2    1 
ATOM   3283   H  HZ3    . LYS A  1  211 ? 323.845 252.503 309.406 1.00 122.19 ? 211 LYS N HZ3    1 
ATOM   3284   N  N      . PRO A  1  212 ? 321.010 248.439 309.660 1.00 142.99 ? 212 PRO N N      1 
ATOM   3285   C  CA     . PRO A  1  212 ? 319.721 248.422 308.947 1.00 145.34 ? 212 PRO N CA     1 
ATOM   3286   C  C      . PRO A  1  212 ? 319.603 249.503 307.887 1.00 151.29 ? 212 PRO N C      1 
ATOM   3287   O  O      . PRO A  1  212 ? 318.669 249.453 307.078 1.00 129.80 ? 212 PRO N O      1 
ATOM   3288   C  CB     . PRO A  1  212 ? 318.696 248.628 310.066 1.00 140.56 ? 212 PRO N CB     1 
ATOM   3289   C  CG     . PRO A  1  212 ? 319.451 249.330 311.139 1.00 132.31 ? 212 PRO N CG     1 
ATOM   3290   C  CD     . PRO A  1  212 ? 320.838 248.772 311.085 1.00 135.94 ? 212 PRO N CD     1 
ATOM   3291   H  HA     . PRO A  1  212 ? 319.576 247.555 308.536 1.00 131.96 ? 212 PRO N HA     1 
ATOM   3292   H  HB2    . PRO A  1  212 ? 317.963 249.176 309.744 1.00 127.29 ? 212 PRO N HB2    1 
ATOM   3293   H  HB3    . PRO A  1  212 ? 318.373 247.768 310.378 1.00 127.29 ? 212 PRO N HB3    1 
ATOM   3294   H  HG2    . PRO A  1  212 ? 319.459 250.283 310.961 1.00 118.45 ? 212 PRO N HG2    1 
ATOM   3295   H  HG3    . PRO A  1  212 ? 319.042 249.146 311.999 1.00 118.45 ? 212 PRO N HG3    1 
ATOM   3296   H  HD2    . PRO A  1  212 ? 321.484 249.443 311.356 1.00 121.31 ? 212 PRO N HD2    1 
ATOM   3297   H  HD3    . PRO A  1  212 ? 320.903 247.972 311.630 1.00 121.31 ? 212 PRO N HD3    1 
ATOM   3298   N  N      . SER A  1  213 ? 320.519 250.468 307.862 1.00 153.02 ? 213 SER N N      1 
ATOM   3299   C  CA     . SER A  1  213 ? 320.466 251.578 306.925 1.00 136.16 ? 213 SER N CA     1 
ATOM   3300   C  C      . SER A  1  213 ? 321.196 251.288 305.621 1.00 117.50 ? 213 SER N C      1 
ATOM   3301   O  O      . SER A  1  213 ? 321.095 252.088 304.684 1.00 106.59 ? 213 SER N O      1 
ATOM   3302   C  CB     . SER A  1  213 ? 321.066 252.822 307.584 1.00 125.31 ? 213 SER N CB     1 
ATOM   3303   O  OG     . SER A  1  213 ? 320.867 252.781 308.990 1.00 118.71 ? 213 SER N OG     1 
ATOM   3304   H  H      . SER A  1  213 ? 321.196 250.499 308.392 1.00 140.68 ? 213 SER N H      1 
ATOM   3305   H  HA     . SER A  1  213 ? 319.539 251.768 306.714 1.00 124.44 ? 213 SER N HA     1 
ATOM   3306   H  HB2    . SER A  1  213 ? 322.018 252.852 307.399 1.00 113.34 ? 213 SER N HB2    1 
ATOM   3307   H  HB3    . SER A  1  213 ? 320.632 253.612 307.225 1.00 113.34 ? 213 SER N HB3    1 
ATOM   3308   H  HG     . SER A  1  213 ? 321.198 253.466 309.347 1.00 106.31 ? 213 SER N HG     1 
ATOM   3309   N  N      . GLU A  1  214 ? 321.923 250.171 305.536 1.00 139.27 ? 214 GLU N N      1 
ATOM   3310   C  CA     . GLU A  1  214 ? 322.713 249.848 304.357 1.00 144.76 ? 214 GLU N CA     1 
ATOM   3311   C  C      . GLU A  1  214 ? 322.112 248.740 303.503 1.00 133.98 ? 214 GLU N C      1 
ATOM   3312   O  O      . GLU A  1  214 ? 322.635 248.477 302.415 1.00 132.22 ? 214 GLU N O      1 
ATOM   3313   C  CB     . GLU A  1  214 ? 324.140 249.444 304.759 1.00 167.06 ? 214 GLU N CB     1 
ATOM   3314   C  CG     . GLU A  1  214 ? 324.862 250.443 305.658 1.00 181.70 ? 214 GLU N CG     1 
ATOM   3315   C  CD     . GLU A  1  214 ? 326.276 250.001 306.000 1.00 181.91 ? 214 GLU N CD     1 
ATOM   3316   O  OE1    . GLU A  1  214 ? 327.229 250.537 305.391 1.00 183.33 ? 214 GLU N OE1    1 
ATOM   3317   O  OE2    . GLU A  1  214 ? 326.427 249.111 306.870 1.00 177.68 ? 214 GLU N OE2    1 
ATOM   3318   H  H      . GLU A  1  214 ? 321.973 249.580 306.159 1.00 115.30 ? 214 GLU N H      1 
ATOM   3319   H  HA     . GLU A  1  214 ? 322.777 250.642 303.802 1.00 120.75 ? 214 GLU N HA     1 
ATOM   3320   H  HB2    . GLU A  1  214 ? 324.100 248.599 305.234 1.00 142.12 ? 214 GLU N HB2    1 
ATOM   3321   H  HB3    . GLU A  1  214 ? 324.670 249.339 303.954 1.00 142.12 ? 214 GLU N HB3    1 
ATOM   3322   H  HG2    . GLU A  1  214 ? 324.916 251.298 305.203 1.00 156.33 ? 214 GLU N HG2    1 
ATOM   3323   H  HG3    . GLU A  1  214 ? 324.368 250.538 306.488 1.00 156.33 ? 214 GLU N HG3    1 
ATOM   3324   N  N      . ILE A  1  215 ? 321.053 248.071 303.964 1.00 89.98  ? 215 ILE N N      1 
ATOM   3325   C  CA     . ILE A  1  215 ? 320.312 247.130 303.135 1.00 85.08  ? 215 ILE N CA     1 
ATOM   3326   C  C      . ILE A  1  215 ? 318.830 247.461 303.199 1.00 86.77  ? 215 ILE N C      1 
ATOM   3327   O  O      . ILE A  1  215 ? 318.343 248.093 304.138 1.00 96.53  ? 215 ILE N O      1 
ATOM   3328   C  CB     . ILE A  1  215 ? 320.515 245.649 303.536 1.00 82.60  ? 215 ILE N CB     1 
ATOM   3329   C  CG1    . ILE A  1  215 ? 320.056 245.398 304.976 1.00 90.63  ? 215 ILE N CG1    1 
ATOM   3330   C  CG2    . ILE A  1  215 ? 321.959 245.224 303.318 1.00 83.42  ? 215 ILE N CG2    1 
ATOM   3331   C  CD1    . ILE A  1  215 ? 319.827 243.941 305.279 1.00 98.34  ? 215 ILE N CD1    1 
ATOM   3332   H  H      . ILE A  1  215 ? 320.743 248.149 304.763 1.00 94.06  ? 215 ILE N H      1 
ATOM   3333   H  HA     . ILE A  1  215 ? 320.600 247.230 302.214 1.00 89.54  ? 215 ILE N HA     1 
ATOM   3334   H  HB     . ILE A  1  215 ? 319.960 245.108 302.953 1.00 86.43  ? 215 ILE N HB     1 
ATOM   3335   H  HG12   . ILE A  1  215 ? 320.736 245.726 305.585 1.00 94.13  ? 215 ILE N HG12   1 
ATOM   3336   H  HG13   . ILE A  1  215 ? 319.222 245.869 305.127 1.00 94.13  ? 215 ILE N HG13   1 
ATOM   3337   H  HG21   . ILE A  1  215 ? 322.057 244.294 303.577 1.00 86.51  ? 215 ILE N HG21   1 
ATOM   3338   H  HG22   . ILE A  1  215 ? 322.182 245.332 302.380 1.00 86.51  ? 215 ILE N HG22   1 
ATOM   3339   H  HG23   . ILE A  1  215 ? 322.538 245.782 303.862 1.00 86.51  ? 215 ILE N HG23   1 
ATOM   3340   H  HD11   . ILE A  1  215 ? 319.540 243.852 306.201 1.00 101.43 ? 215 ILE N HD11   1 
ATOM   3341   H  HD12   . ILE A  1  215 ? 319.141 243.599 304.684 1.00 101.43 ? 215 ILE N HD12   1 
ATOM   3342   H  HD13   . ILE A  1  215 ? 320.656 243.456 305.142 1.00 101.43 ? 215 ILE N HD13   1 
ATOM   3343   N  N      . GLU A  1  216 ? 318.113 246.988 302.184 1.00 84.71  ? 216 GLU N N      1 
ATOM   3344   C  CA     . GLU A  1  216 ? 316.665 247.094 302.116 1.00 83.11  ? 216 GLU N CA     1 
ATOM   3345   C  C      . GLU A  1  216 ? 316.142 245.760 301.619 1.00 81.65  ? 216 GLU N C      1 
ATOM   3346   O  O      . GLU A  1  216 ? 316.634 245.233 300.618 1.00 79.93  ? 216 GLU N O      1 
ATOM   3347   C  CB     . GLU A  1  216 ? 316.231 248.232 301.190 1.00 98.37  ? 216 GLU N CB     1 
ATOM   3348   C  CG     . GLU A  1  216 ? 316.901 248.190 299.825 1.00 128.54 ? 216 GLU N CG     1 
ATOM   3349   C  CD     . GLU A  1  216 ? 316.702 249.469 299.034 1.00 162.91 ? 216 GLU N CD     1 
ATOM   3350   O  OE1    . GLU A  1  216 ? 317.215 250.524 299.471 1.00 172.31 ? 216 GLU N OE1    1 
ATOM   3351   O  OE2    . GLU A  1  216 ? 316.033 249.417 297.977 1.00 183.77 ? 216 GLU N OE2    1 
ATOM   3352   H  H      . GLU A  1  216 ? 318.456 246.590 301.504 1.00 81.76  ? 216 GLU N H      1 
ATOM   3353   H  HA     . GLU A  1  216 ? 316.306 247.260 303.002 1.00 80.85  ? 216 GLU N HA     1 
ATOM   3354   H  HB2    . GLU A  1  216 ? 315.273 248.177 301.053 1.00 96.86  ? 216 GLU N HB2    1 
ATOM   3355   H  HB3    . GLU A  1  216 ? 316.457 249.078 301.606 1.00 96.86  ? 216 GLU N HB3    1 
ATOM   3356   H  HG2    . GLU A  1  216 ? 317.854 248.057 299.944 1.00 127.15 ? 216 GLU N HG2    1 
ATOM   3357   H  HG3    . GLU A  1  216 ? 316.525 247.459 299.311 1.00 127.15 ? 216 GLU N HG3    1 
ATOM   3358   N  N      . VAL A  1  217 ? 315.163 245.211 302.327 1.00 84.73  ? 217 VAL N N      1 
ATOM   3359   C  CA     . VAL A  1  217 ? 314.746 243.829 302.139 1.00 68.99  ? 217 VAL N CA     1 
ATOM   3360   C  C      . VAL A  1  217 ? 313.296 243.825 301.681 1.00 84.90  ? 217 VAL N C      1 
ATOM   3361   O  O      . VAL A  1  217 ? 312.408 244.295 302.405 1.00 84.46  ? 217 VAL N O      1 
ATOM   3362   C  CB     . VAL A  1  217 ? 314.936 243.011 303.425 1.00 72.68  ? 217 VAL N CB     1 
ATOM   3363   C  CG1    . VAL A  1  217 ? 314.395 241.594 303.265 1.00 72.25  ? 217 VAL N CG1    1 
ATOM   3364   C  CG2    . VAL A  1  217 ? 316.417 242.974 303.790 1.00 75.80  ? 217 VAL N CG2    1 
ATOM   3365   H  H      . VAL A  1  217 ? 314.716 245.628 302.932 1.00 87.08  ? 217 VAL N H      1 
ATOM   3366   H  HA     . VAL A  1  217 ? 315.286 243.426 301.442 1.00 71.20  ? 217 VAL N HA     1 
ATOM   3367   H  HB     . VAL A  1  217 ? 314.456 243.439 304.151 1.00 74.18  ? 217 VAL N HB     1 
ATOM   3368   H  HG11   . VAL A  1  217 ? 314.532 241.108 304.093 1.00 73.62  ? 217 VAL N HG11   1 
ATOM   3369   H  HG12   . VAL A  1  217 ? 313.448 241.639 303.060 1.00 73.62  ? 217 VAL N HG12   1 
ATOM   3370   H  HG13   . VAL A  1  217 ? 314.870 241.155 302.542 1.00 73.62  ? 217 VAL N HG13   1 
ATOM   3371   H  HG21   . VAL A  1  217 ? 316.529 242.456 304.602 1.00 76.51  ? 217 VAL N HG21   1 
ATOM   3372   H  HG22   . VAL A  1  217 ? 316.911 242.562 303.063 1.00 76.51  ? 217 VAL N HG22   1 
ATOM   3373   H  HG23   . VAL A  1  217 ? 316.730 243.881 303.930 1.00 76.51  ? 217 VAL N HG23   1 
ATOM   3374   N  N      . GLY A  1  218 ? 313.066 243.303 300.477 1.00 83.83  ? 218 GLY N N      1 
ATOM   3375   C  CA     . GLY A  1  218 ? 311.731 243.113 299.937 1.00 67.33  ? 218 GLY N CA     1 
ATOM   3376   C  C      . GLY A  1  218 ? 311.375 241.634 299.959 1.00 68.48  ? 218 GLY N C      1 
ATOM   3377   O  O      . GLY A  1  218 ? 312.141 240.793 299.483 1.00 70.95  ? 218 GLY N O      1 
ATOM   3378   H  H      . GLY A  1  218 ? 313.689 243.046 299.943 1.00 88.92  ? 218 GLY N H      1 
ATOM   3379   H  HA2    . GLY A  1  218 ? 311.084 243.601 300.469 1.00 73.07  ? 218 GLY N HA2    1 
ATOM   3380   H  HA3    . GLY A  1  218 ? 311.694 243.433 299.022 1.00 73.07  ? 218 GLY N HA3    1 
ATOM   3381   N  N      . VAL A  1  219 ? 310.202 241.338 300.510 1.00 63.91  ? 219 VAL N N      1 
ATOM   3382   C  CA     . VAL A  1  219 ? 309.835 239.978 300.876 1.00 65.27  ? 219 VAL N CA     1 
ATOM   3383   C  C      . VAL A  1  219 ? 308.361 239.756 300.563 1.00 63.51  ? 219 VAL N C      1 
ATOM   3384   O  O      . VAL A  1  219 ? 307.542 240.671 300.659 1.00 62.56  ? 219 VAL N O      1 
ATOM   3385   C  CB     . VAL A  1  219 ? 310.118 239.722 302.368 1.00 72.75  ? 219 VAL N CB     1 
ATOM   3386   C  CG1    . VAL A  1  219 ? 309.189 240.572 303.232 1.00 69.71  ? 219 VAL N CG1    1 
ATOM   3387   C  CG2    . VAL A  1  219 ? 309.978 238.254 302.694 1.00 87.74  ? 219 VAL N CG2    1 
ATOM   3388   H  H      . VAL A  1  219 ? 309.592 241.918 300.684 1.00 63.02  ? 219 VAL N H      1 
ATOM   3389   H  HA     . VAL A  1  219 ? 310.358 239.351 300.353 1.00 64.03  ? 219 VAL N HA     1 
ATOM   3390   H  HB     . VAL A  1  219 ? 311.031 239.985 302.564 1.00 70.89  ? 219 VAL N HB     1 
ATOM   3391   H  HG11   . VAL A  1  219 ? 309.381 240.398 304.167 1.00 68.22  ? 219 VAL N HG11   1 
ATOM   3392   H  HG12   . VAL A  1  219 ? 309.342 241.509 303.031 1.00 68.22  ? 219 VAL N HG12   1 
ATOM   3393   H  HG13   . VAL A  1  219 ? 308.269 240.336 303.033 1.00 68.22  ? 219 VAL N HG13   1 
ATOM   3394   H  HG21   . VAL A  1  219 ? 310.161 238.121 303.637 1.00 85.39  ? 219 VAL N HG21   1 
ATOM   3395   H  HG22   . VAL A  1  219 ? 309.074 237.970 302.489 1.00 85.39  ? 219 VAL N HG22   1 
ATOM   3396   H  HG23   . VAL A  1  219 ? 310.612 237.751 302.159 1.00 85.39  ? 219 VAL N HG23   1 
ATOM   3397   N  N      . VAL A  1  220 ? 308.027 238.520 300.212 1.00 62.76  ? 220 VAL N N      1 
ATOM   3398   C  CA     . VAL A  1  220 ? 306.668 238.174 299.811 1.00 61.39  ? 220 VAL N CA     1 
ATOM   3399   C  C      . VAL A  1  220 ? 306.391 236.742 300.259 1.00 63.54  ? 220 VAL N C      1 
ATOM   3400   O  O      . VAL A  1  220 ? 307.184 235.838 299.994 1.00 64.44  ? 220 VAL N O      1 
ATOM   3401   C  CB     . VAL A  1  220 ? 306.491 238.377 298.285 1.00 58.11  ? 220 VAL N CB     1 
ATOM   3402   C  CG1    . VAL A  1  220 ? 307.325 237.382 297.488 1.00 58.01  ? 220 VAL N CG1    1 
ATOM   3403   C  CG2    . VAL A  1  220 ? 305.027 238.319 297.881 1.00 56.77  ? 220 VAL N CG2    1 
ATOM   3404   H  H      . VAL A  1  220 ? 308.574 237.857 300.198 1.00 62.64  ? 220 VAL N H      1 
ATOM   3405   H  HA     . VAL A  1  220 ? 306.043 238.760 300.267 1.00 61.80  ? 220 VAL N HA     1 
ATOM   3406   H  HB     . VAL A  1  220 ? 306.814 239.263 298.060 1.00 59.04  ? 220 VAL N HB     1 
ATOM   3407   H  HG11   . VAL A  1  220 ? 307.187 237.541 296.541 1.00 58.52  ? 220 VAL N HG11   1 
ATOM   3408   H  HG12   . VAL A  1  220 ? 308.261 237.505 297.712 1.00 58.52  ? 220 VAL N HG12   1 
ATOM   3409   H  HG13   . VAL A  1  220 ? 307.046 236.481 297.717 1.00 58.52  ? 220 VAL N HG13   1 
ATOM   3410   H  HG21   . VAL A  1  220 ? 304.959 238.450 296.922 1.00 58.33  ? 220 VAL N HG21   1 
ATOM   3411   H  HG22   . VAL A  1  220 ? 304.667 237.452 298.124 1.00 58.33  ? 220 VAL N HG22   1 
ATOM   3412   H  HG23   . VAL A  1  220 ? 304.544 239.020 298.346 1.00 58.33  ? 220 VAL N HG23   1 
ATOM   3413   N  N      . THR A  1  221 ? 305.271 236.537 300.956 1.00 104.12 ? 221 THR N N      1 
ATOM   3414   C  CA     . THR A  1  221 ? 305.005 235.290 301.666 1.00 114.56 ? 221 THR N CA     1 
ATOM   3415   C  C      . THR A  1  221 ? 303.717 234.638 301.166 1.00 112.40 ? 221 THR N C      1 
ATOM   3416   O  O      . THR A  1  221 ? 302.909 235.257 300.468 1.00 105.89 ? 221 THR N O      1 
ATOM   3417   C  CB     . THR A  1  221 ? 304.911 235.544 303.179 1.00 128.76 ? 221 THR N CB     1 
ATOM   3418   O  OG1    . THR A  1  221 ? 303.872 236.497 303.444 1.00 137.55 ? 221 THR N OG1    1 
ATOM   3419   C  CG2    . THR A  1  221 ? 306.239 236.079 303.719 1.00 136.52 ? 221 THR N CG2    1 
ATOM   3420   H  H      . THR A  1  221 ? 304.641 237.117 301.031 1.00 85.40  ? 221 THR N H      1 
ATOM   3421   H  HA     . THR A  1  221 ? 305.736 234.673 301.509 1.00 95.35  ? 221 THR N HA     1 
ATOM   3422   H  HB     . THR A  1  221 ? 304.709 234.712 303.634 1.00 109.25 ? 221 THR N HB     1 
ATOM   3423   H  HG1    . THR A  1  221 ? 304.039 237.221 303.053 1.00 118.66 ? 221 THR N HG1    1 
ATOM   3424   H  HG21   . THR A  1  221 ? 306.170 236.236 304.674 1.00 116.51 ? 221 THR N HG21   1 
ATOM   3425   H  HG22   . THR A  1  221 ? 306.946 235.435 303.556 1.00 116.51 ? 221 THR N HG22   1 
ATOM   3426   H  HG23   . THR A  1  221 ? 306.464 236.913 303.278 1.00 116.51 ? 221 THR N HG23   1 
ATOM   3427   N  N      . VAL A  1  222 ? 303.528 233.367 301.545 1.00 106.25 ? 222 VAL N N      1 
ATOM   3428   C  CA     . VAL A  1  222 ? 302.326 232.624 301.155 1.00 105.75 ? 222 VAL N CA     1 
ATOM   3429   C  C      . VAL A  1  222 ? 301.162 232.878 302.102 1.00 101.56 ? 222 VAL N C      1 
ATOM   3430   O  O      . VAL A  1  222 ? 300.002 232.684 301.717 1.00 96.00  ? 222 VAL N O      1 
ATOM   3431   C  CB     . VAL A  1  222 ? 302.595 231.110 301.091 1.00 107.69 ? 222 VAL N CB     1 
ATOM   3432   C  CG1    . VAL A  1  222 ? 301.323 230.337 300.693 1.00 98.46  ? 222 VAL N CG1    1 
ATOM   3433   C  CG2    . VAL A  1  222 ? 303.726 230.807 300.117 1.00 118.92 ? 222 VAL N CG2    1 
ATOM   3434   H  H      . VAL A  1  222 ? 304.079 232.916 302.026 1.00 95.15  ? 222 VAL N H      1 
ATOM   3435   H  HA     . VAL A  1  222 ? 302.055 232.913 300.269 1.00 94.94  ? 222 VAL N HA     1 
ATOM   3436   H  HB     . VAL A  1  222 ? 302.868 230.802 301.969 1.00 96.27  ? 222 VAL N HB     1 
ATOM   3437   H  HG11   . VAL A  1  222 ? 301.527 229.389 300.662 1.00 87.34  ? 222 VAL N HG11   1 
ATOM   3438   H  HG12   . VAL A  1  222 ? 300.633 230.506 301.353 1.00 87.34  ? 222 VAL N HG12   1 
ATOM   3439   H  HG13   . VAL A  1  222 ? 301.029 230.642 299.820 1.00 87.34  ? 222 VAL N HG13   1 
ATOM   3440   H  HG21   . VAL A  1  222 ? 303.875 229.849 300.095 1.00 107.21 ? 222 VAL N HG21   1 
ATOM   3441   H  HG22   . VAL A  1  222 ? 303.475 231.123 299.235 1.00 107.21 ? 222 VAL N HG22   1 
ATOM   3442   H  HG23   . VAL A  1  222 ? 304.529 231.261 300.416 1.00 107.21 ? 222 VAL N HG23   1 
ATOM   3443   N  N      . GLU A  1  223 ? 301.437 233.285 303.339 1.00 134.83 ? 223 GLU N N      1 
ATOM   3444   C  CA     . GLU A  1  223 ? 300.359 233.693 304.231 1.00 137.66 ? 223 GLU N CA     1 
ATOM   3445   C  C      . GLU A  1  223 ? 299.814 235.053 303.822 1.00 137.37 ? 223 GLU N C      1 
ATOM   3446   O  O      . GLU A  1  223 ? 298.623 235.329 304.005 1.00 134.29 ? 223 GLU N O      1 
ATOM   3447   C  CB     . GLU A  1  223 ? 300.851 233.737 305.679 1.00 147.44 ? 223 GLU N CB     1 
ATOM   3448   C  CG     . GLU A  1  223 ? 301.577 232.480 306.144 1.00 172.68 ? 223 GLU N CG     1 
ATOM   3449   C  CD     . GLU A  1  223 ? 303.024 232.424 305.680 1.00 197.22 ? 223 GLU N CD     1 
ATOM   3450   O  OE1    . GLU A  1  223 ? 303.757 233.417 305.882 1.00 208.51 ? 223 GLU N OE1    1 
ATOM   3451   O  OE2    . GLU A  1  223 ? 303.420 231.391 305.097 1.00 206.61 ? 223 GLU N OE2    1 
ATOM   3452   H  H      . GLU A  1  223 ? 302.225 233.334 303.680 1.00 115.65 ? 223 GLU N H      1 
ATOM   3453   H  HA     . GLU A  1  223 ? 299.637 233.047 304.175 1.00 118.76 ? 223 GLU N HA     1 
ATOM   3454   H  HB2    . GLU A  1  223 ? 301.464 234.482 305.774 1.00 127.96 ? 223 GLU N HB2    1 
ATOM   3455   H  HB3    . GLU A  1  223 ? 300.087 233.866 306.261 1.00 127.96 ? 223 GLU N HB3    1 
ATOM   3456   H  HG2    . GLU A  1  223 ? 301.573 232.454 307.113 1.00 152.38 ? 223 GLU N HG2    1 
ATOM   3457   H  HG3    . GLU A  1  223 ? 301.119 231.702 305.789 1.00 152.38 ? 223 GLU N HG3    1 
ATOM   3458   N  N      . ASN A  1  224 ? 300.669 235.898 303.246 1.00 125.54 ? 224 ASN N N      1 
ATOM   3459   C  CA     . ASN A  1  224 ? 300.314 237.267 302.886 1.00 121.77 ? 224 ASN N CA     1 
ATOM   3460   C  C      . ASN A  1  224 ? 300.963 237.603 301.550 1.00 108.43 ? 224 ASN N C      1 
ATOM   3461   O  O      . ASN A  1  224 ? 302.103 238.080 301.500 1.00 110.15 ? 224 ASN N O      1 
ATOM   3462   C  CB     . ASN A  1  224 ? 300.764 238.247 303.967 1.00 129.21 ? 224 ASN N CB     1 
ATOM   3463   C  CG     . ASN A  1  224 ? 300.690 239.679 303.509 1.00 138.48 ? 224 ASN N CG     1 
ATOM   3464   O  OD1    . ASN A  1  224 ? 301.709 240.359 303.386 1.00 135.37 ? 224 ASN N OD1    1 
ATOM   3465   N  ND2    . ASN A  1  224 ? 299.480 240.141 303.227 1.00 151.28 ? 224 ASN N ND2    1 
ATOM   3466   H  H      . ASN A  1  224 ? 301.481 235.693 303.049 1.00 113.89 ? 224 ASN N H      1 
ATOM   3467   H  HA     . ASN A  1  224 ? 299.352 237.337 302.788 1.00 110.75 ? 224 ASN N HA     1 
ATOM   3468   H  HB2    . ASN A  1  224 ? 300.190 238.149 304.743 1.00 118.02 ? 224 ASN N HB2    1 
ATOM   3469   H  HB3    . ASN A  1  224 ? 301.684 238.054 304.206 1.00 118.02 ? 224 ASN N HB3    1 
ATOM   3470   H  HD21   . ASN A  1  224 ? 299.380 240.953 302.962 1.00 141.26 ? 224 ASN N HD21   1 
ATOM   3471   H  HD22   . ASN A  1  224 ? 298.794 239.629 303.311 1.00 141.26 ? 224 ASN N HD22   1 
ATOM   3472   N  N      . PRO A  1  225 ? 300.263 237.368 300.434 1.00 96.46  ? 225 PRO N N      1 
ATOM   3473   C  CA     . PRO A  1  225 ? 300.900 237.543 299.118 1.00 97.09  ? 225 PRO N CA     1 
ATOM   3474   C  C      . PRO A  1  225 ? 301.174 238.986 298.715 1.00 104.13 ? 225 PRO N C      1 
ATOM   3475   O  O      . PRO A  1  225 ? 301.583 239.229 297.573 1.00 119.84 ? 225 PRO N O      1 
ATOM   3476   C  CB     . PRO A  1  225 ? 299.895 236.893 298.154 1.00 89.12  ? 225 PRO N CB     1 
ATOM   3477   C  CG     . PRO A  1  225 ? 299.071 235.990 298.994 1.00 91.52  ? 225 PRO N CG     1 
ATOM   3478   C  CD     . PRO A  1  225 ? 298.971 236.670 300.322 1.00 96.56  ? 225 PRO N CD     1 
ATOM   3479   H  HA     . PRO A  1  225 ? 301.732 237.045 299.085 1.00 94.97  ? 225 PRO N HA     1 
ATOM   3480   H  HB2    . PRO A  1  225 ? 299.344 237.579 297.747 1.00 87.38  ? 225 PRO N HB2    1 
ATOM   3481   H  HB3    . PRO A  1  225 ? 300.372 236.390 297.476 1.00 87.38  ? 225 PRO N HB3    1 
ATOM   3482   H  HG2    . PRO A  1  225 ? 298.193 235.885 298.596 1.00 89.58  ? 225 PRO N HG2    1 
ATOM   3483   H  HG3    . PRO A  1  225 ? 299.514 235.131 299.082 1.00 89.58  ? 225 PRO N HG3    1 
ATOM   3484   H  HD2    . PRO A  1  225 ? 298.240 237.307 300.323 1.00 94.53  ? 225 PRO N HD2    1 
ATOM   3485   H  HD3    . PRO A  1  225 ? 298.876 236.016 301.032 1.00 94.53  ? 225 PRO N HD3    1 
ATOM   3486   N  N      . LYS A  1  226 ? 300.959 239.951 299.602 1.00 107.42 ? 226 LYS N N      1 
ATOM   3487   C  CA     . LYS A  1  226 ? 301.252 241.343 299.281 1.00 107.05 ? 226 LYS N CA     1 
ATOM   3488   C  C      . LYS A  1  226 ? 302.750 241.587 299.344 1.00 97.87  ? 226 LYS N C      1 
ATOM   3489   O  O      . LYS A  1  226 ? 303.407 241.213 300.318 1.00 111.97 ? 226 LYS N O      1 
ATOM   3490   C  CB     . LYS A  1  226 ? 300.527 242.281 300.245 1.00 118.83 ? 226 LYS N CB     1 
ATOM   3491   C  CG     . LYS A  1  226 ? 299.031 242.057 300.310 1.00 130.50 ? 226 LYS N CG     1 
ATOM   3492   C  CD     . LYS A  1  226 ? 298.364 242.321 298.969 1.00 131.90 ? 226 LYS N CD     1 
ATOM   3493   C  CE     . LYS A  1  226 ? 296.903 241.903 298.982 1.00 129.62 ? 226 LYS N CE     1 
ATOM   3494   N  NZ     . LYS A  1  226 ? 296.719 240.495 299.442 1.00 126.54 ? 226 LYS N NZ     1 
ATOM   3495   H  H      . LYS A  1  226 ? 300.646 239.827 300.394 1.00 97.77  ? 226 LYS N H      1 
ATOM   3496   H  HA     . LYS A  1  226 ? 300.948 241.536 298.380 1.00 97.76  ? 226 LYS N HA     1 
ATOM   3497   H  HB2    . LYS A  1  226 ? 300.885 242.149 301.137 1.00 109.78 ? 226 LYS N HB2    1 
ATOM   3498   H  HB3    . LYS A  1  226 ? 300.677 243.196 299.962 1.00 109.78 ? 226 LYS N HB3    1 
ATOM   3499   H  HG2    . LYS A  1  226 ? 298.857 241.136 300.559 1.00 121.86 ? 226 LYS N HG2    1 
ATOM   3500   H  HG3    . LYS A  1  226 ? 298.646 242.660 300.964 1.00 121.86 ? 226 LYS N HG3    1 
ATOM   3501   H  HD2    . LYS A  1  226 ? 298.406 243.270 298.772 1.00 123.87 ? 226 LYS N HD2    1 
ATOM   3502   H  HD3    . LYS A  1  226 ? 298.819 241.813 298.279 1.00 123.87 ? 226 LYS N HD3    1 
ATOM   3503   H  HE2    . LYS A  1  226 ? 296.412 242.483 299.584 1.00 121.92 ? 226 LYS N HE2    1 
ATOM   3504   H  HE3    . LYS A  1  226 ? 296.544 241.976 298.083 1.00 121.92 ? 226 LYS N HE3    1 
ATOM   3505   H  HZ1    . LYS A  1  226 ? 297.155 239.939 298.901 1.00 118.43 ? 226 LYS N HZ1    1 
ATOM   3506   H  HZ2    . LYS A  1  226 ? 296.555 240.480 300.317 1.00 118.43 ? 226 LYS N HZ2    1 
ATOM   3507   H  HZ3    . LYS A  1  226 ? 295.854 240.285 299.437 1.00 118.43 ? 226 LYS N HZ3    1 
ATOM   3508   N  N      . PHE A  1  227 ? 303.292 242.229 298.313 1.00 63.71  ? 227 PHE N N      1 
ATOM   3509   C  CA     . PHE A  1  227 ? 304.725 242.506 298.291 1.00 63.92  ? 227 PHE N CA     1 
ATOM   3510   C  C      . PHE A  1  227 ? 305.039 243.625 299.275 1.00 67.33  ? 227 PHE N C      1 
ATOM   3511   O  O      . PHE A  1  227 ? 304.725 244.794 299.031 1.00 77.85  ? 227 PHE N O      1 
ATOM   3512   C  CB     . PHE A  1  227 ? 305.195 242.878 296.894 1.00 61.36  ? 227 PHE N CB     1 
ATOM   3513   C  CG     . PHE A  1  227 ? 306.636 243.299 296.845 1.00 61.74  ? 227 PHE N CG     1 
ATOM   3514   C  CD1    . PHE A  1  227 ? 307.645 242.361 296.954 1.00 62.91  ? 227 PHE N CD1    1 
ATOM   3515   C  CD2    . PHE A  1  227 ? 306.982 244.633 296.703 1.00 61.26  ? 227 PHE N CD2    1 
ATOM   3516   C  CE1    . PHE A  1  227 ? 308.974 242.749 296.915 1.00 63.58  ? 227 PHE N CE1    1 
ATOM   3517   C  CE2    . PHE A  1  227 ? 308.309 245.024 296.663 1.00 61.88  ? 227 PHE N CE2    1 
ATOM   3518   C  CZ     . PHE A  1  227 ? 309.303 244.082 296.769 1.00 63.03  ? 227 PHE N CZ     1 
ATOM   3519   H  H      . PHE A  1  227 ? 302.860 242.510 297.624 1.00 59.62  ? 227 PHE N H      1 
ATOM   3520   H  HA     . PHE A  1  227 ? 305.207 241.713 298.571 1.00 59.41  ? 227 PHE N HA     1 
ATOM   3521   H  HB2    . PHE A  1  227 ? 305.088 242.110 296.312 1.00 57.13  ? 227 PHE N HB2    1 
ATOM   3522   H  HB3    . PHE A  1  227 ? 304.657 243.617 296.568 1.00 57.13  ? 227 PHE N HB3    1 
ATOM   3523   H  HD1    . PHE A  1  227 ? 307.430 241.462 297.053 1.00 57.65  ? 227 PHE N HD1    1 
ATOM   3524   H  HD2    . PHE A  1  227 ? 306.313 245.275 296.630 1.00 56.90  ? 227 PHE N HD2    1 
ATOM   3525   H  HE1    . PHE A  1  227 ? 309.646 242.110 296.986 1.00 57.93  ? 227 PHE N HE1    1 
ATOM   3526   H  HE2    . PHE A  1  227 ? 308.527 245.922 296.564 1.00 57.15  ? 227 PHE N HE2    1 
ATOM   3527   H  HZ     . PHE A  1  227 ? 310.195 244.341 296.742 1.00 57.66  ? 227 PHE N HZ     1 
ATOM   3528   N  N      . ARG A  1  228 ? 305.675 243.257 300.379 1.00 79.28  ? 228 ARG N N      1 
ATOM   3529   C  CA     . ARG A  1  228 ? 306.037 244.151 301.465 1.00 80.77  ? 228 ARG N CA     1 
ATOM   3530   C  C      . ARG A  1  228 ? 307.486 244.585 301.290 1.00 79.96  ? 228 ARG N C      1 
ATOM   3531   O  O      . ARG A  1  228 ? 308.294 243.866 300.701 1.00 78.97  ? 228 ARG N O      1 
ATOM   3532   C  CB     . ARG A  1  228 ? 305.837 243.409 302.789 1.00 82.93  ? 228 ARG N CB     1 
ATOM   3533   C  CG     . ARG A  1  228 ? 305.901 244.188 304.100 1.00 84.95  ? 228 ARG N CG     1 
ATOM   3534   C  CD     . ARG A  1  228 ? 305.811 243.186 305.265 1.00 96.36  ? 228 ARG N CD     1 
ATOM   3535   N  NE     . ARG A  1  228 ? 304.901 242.083 304.937 1.00 116.79 ? 228 ARG N NE     1 
ATOM   3536   C  CZ     . ARG A  1  228 ? 305.062 240.815 305.307 1.00 139.44 ? 228 ARG N CZ     1 
ATOM   3537   N  NH1    . ARG A  1  228 ? 306.109 240.436 306.031 1.00 166.08 ? 228 ARG N NH1    1 
ATOM   3538   N  NH2    . ARG A  1  228 ? 304.165 239.908 304.939 1.00 133.06 ? 228 ARG N NH2    1 
ATOM   3539   H  H      . ARG A  1  228 ? 305.920 242.446 300.527 1.00 72.39  ? 228 ARG N H      1 
ATOM   3540   H  HA     . ARG A  1  228 ? 305.468 244.937 301.452 1.00 73.68  ? 228 ARG N HA     1 
ATOM   3541   H  HB2    . ARG A  1  228 ? 304.964 242.987 302.760 1.00 75.35  ? 228 ARG N HB2    1 
ATOM   3542   H  HB3    . ARG A  1  228 ? 306.517 242.719 302.844 1.00 75.35  ? 228 ARG N HB3    1 
ATOM   3543   H  HG2    . ARG A  1  228 ? 306.743 244.665 304.161 1.00 77.17  ? 228 ARG N HG2    1 
ATOM   3544   H  HG3    . ARG A  1  228 ? 305.151 244.802 304.156 1.00 77.17  ? 228 ARG N HG3    1 
ATOM   3545   H  HD2    . ARG A  1  228 ? 306.690 242.815 305.439 1.00 88.01  ? 228 ARG N HD2    1 
ATOM   3546   H  HD3    . ARG A  1  228 ? 305.473 243.638 306.054 1.00 88.01  ? 228 ARG N HD3    1 
ATOM   3547   H  HE     . ARG A  1  228 ? 304.205 242.272 304.468 1.00 108.59 ? 228 ARG N HE     1 
ATOM   3548   H  HH11   . ARG A  1  228 ? 306.697 241.015 306.273 1.00 156.64 ? 228 ARG N HH11   1 
ATOM   3549   H  HH12   . ARG A  1  228 ? 306.198 239.612 306.261 1.00 156.64 ? 228 ARG N HH12   1 
ATOM   3550   H  HH21   . ARG A  1  228 ? 303.484 240.143 304.470 1.00 124.53 ? 228 ARG N HH21   1 
ATOM   3551   H  HH22   . ARG A  1  228 ? 304.263 239.086 305.175 1.00 124.53 ? 228 ARG N HH22   1 
ATOM   3552   N  N      . ILE A  1  229 ? 307.808 245.778 301.780 1.00 74.37  ? 229 ILE N N      1 
ATOM   3553   C  CA     . ILE A  1  229 ? 309.194 246.195 301.966 1.00 83.86  ? 229 ILE N CA     1 
ATOM   3554   C  C      . ILE A  1  229 ? 309.411 246.343 303.459 1.00 98.60  ? 229 ILE N C      1 
ATOM   3555   O  O      . ILE A  1  229 ? 308.685 247.087 304.129 1.00 127.34 ? 229 ILE N O      1 
ATOM   3556   C  CB     . ILE A  1  229 ? 309.526 247.501 301.235 1.00 73.73  ? 229 ILE N CB     1 
ATOM   3557   C  CG1    . ILE A  1  229 ? 309.528 247.263 299.723 1.00 79.62  ? 229 ILE N CG1    1 
ATOM   3558   C  CG2    . ILE A  1  229 ? 310.891 248.043 301.701 1.00 75.54  ? 229 ILE N CG2    1 
ATOM   3559   C  CD1    . ILE A  1  229 ? 309.661 248.529 298.907 1.00 88.07  ? 229 ILE N CD1    1 
ATOM   3560   H  H      . ILE A  1  229 ? 307.233 246.373 302.015 1.00 69.49  ? 229 ILE N H      1 
ATOM   3561   H  HA     . ILE A  1  229 ? 309.787 245.501 301.638 1.00 78.50  ? 229 ILE N HA     1 
ATOM   3562   H  HB     . ILE A  1  229 ? 308.843 248.157 301.445 1.00 68.76  ? 229 ILE N HB     1 
ATOM   3563   H  HG12   . ILE A  1  229 ? 310.274 246.686 299.499 1.00 75.02  ? 229 ILE N HG12   1 
ATOM   3564   H  HG13   . ILE A  1  229 ? 308.694 246.835 299.473 1.00 75.02  ? 229 ILE N HG13   1 
ATOM   3565   H  HG21   . ILE A  1  229 ? 311.081 248.867 301.227 1.00 70.04  ? 229 ILE N HG21   1 
ATOM   3566   H  HG22   . ILE A  1  229 ? 310.854 248.210 302.656 1.00 70.04  ? 229 ILE N HG22   1 
ATOM   3567   H  HG23   . ILE A  1  229 ? 311.575 247.383 301.506 1.00 70.04  ? 229 ILE N HG23   1 
ATOM   3568   H  HD11   . ILE A  1  229 ? 309.654 248.299 297.965 1.00 83.94  ? 229 ILE N HD11   1 
ATOM   3569   H  HD12   . ILE A  1  229 ? 308.915 249.115 299.111 1.00 83.94  ? 229 ILE N HD12   1 
ATOM   3570   H  HD13   . ILE A  1  229 ? 310.496 248.966 299.136 1.00 83.94  ? 229 ILE N HD13   1 
ATOM   3571   N  N      . LEU A  1  230 ? 310.407 245.641 303.981 1.00 98.50  ? 230 LEU N N      1 
ATOM   3572   C  CA     . LEU A  1  230 ? 310.637 245.663 305.413 1.00 102.93 ? 230 LEU N CA     1 
ATOM   3573   C  C      . LEU A  1  230 ? 311.237 246.994 305.847 1.00 102.90 ? 230 LEU N C      1 
ATOM   3574   O  O      . LEU A  1  230 ? 312.092 247.570 305.165 1.00 98.72  ? 230 LEU N O      1 
ATOM   3575   C  CB     . LEU A  1  230 ? 311.540 244.496 305.811 1.00 107.99 ? 230 LEU N CB     1 
ATOM   3576   C  CG     . LEU A  1  230 ? 310.884 243.119 305.652 1.00 109.27 ? 230 LEU N CG     1 
ATOM   3577   C  CD1    . LEU A  1  230 ? 311.834 242.038 306.132 1.00 110.48 ? 230 LEU N CD1    1 
ATOM   3578   C  CD2    . LEU A  1  230 ? 309.542 243.025 306.392 1.00 114.35 ? 230 LEU N CD2    1 
ATOM   3579   H  H      . LEU A  1  230 ? 310.955 245.152 303.534 1.00 98.50  ? 230 LEU N H      1 
ATOM   3580   H  HA     . LEU A  1  230 ? 309.788 245.554 305.871 1.00 102.39 ? 230 LEU N HA     1 
ATOM   3581   H  HB2    . LEU A  1  230 ? 312.334 244.511 305.254 1.00 106.66 ? 230 LEU N HB2    1 
ATOM   3582   H  HB3    . LEU A  1  230 ? 311.791 244.598 306.742 1.00 106.66 ? 230 LEU N HB3    1 
ATOM   3583   H  HG     . LEU A  1  230 ? 310.713 242.963 304.710 1.00 107.89 ? 230 LEU N HG     1 
ATOM   3584   H  HD11   . LEU A  1  230 ? 311.408 241.174 306.026 1.00 108.25 ? 230 LEU N HD11   1 
ATOM   3585   H  HD12   . LEU A  1  230 ? 312.646 242.074 305.602 1.00 108.25 ? 230 LEU N HD12   1 
ATOM   3586   H  HD13   . LEU A  1  230 ? 312.042 242.193 307.067 1.00 108.25 ? 230 LEU N HD13   1 
ATOM   3587   H  HD21   . LEU A  1  230 ? 309.170 242.139 306.261 1.00 113.26 ? 230 LEU N HD21   1 
ATOM   3588   H  HD22   . LEU A  1  230 ? 309.691 243.185 307.337 1.00 113.26 ? 230 LEU N HD22   1 
ATOM   3589   H  HD23   . LEU A  1  230 ? 308.937 243.694 306.034 1.00 113.26 ? 230 LEU N HD23   1 
ATOM   3590   N  N      . THR A  1  231 ? 310.752 247.488 306.987 1.00 141.59 ? 231 THR N N      1 
ATOM   3591   C  CA     . THR A  1  231 ? 311.227 248.724 307.587 1.00 138.82 ? 231 THR N CA     1 
ATOM   3592   C  C      . THR A  1  231 ? 312.489 248.472 308.407 1.00 141.53 ? 231 THR N C      1 
ATOM   3593   O  O      . THR A  1  231 ? 312.806 247.343 308.787 1.00 153.76 ? 231 THR N O      1 
ATOM   3594   C  CB     . THR A  1  231 ? 310.157 249.326 308.492 1.00 130.43 ? 231 THR N CB     1 
ATOM   3595   O  OG1    . THR A  1  231 ? 309.972 248.479 309.633 1.00 129.69 ? 231 THR N OG1    1 
ATOM   3596   C  CG2    . THR A  1  231 ? 308.835 249.461 307.757 1.00 126.75 ? 231 THR N CG2    1 
ATOM   3597   H  H      . THR A  1  231 ? 310.128 247.108 307.442 1.00 117.71 ? 231 THR N H      1 
ATOM   3598   H  HA     . THR A  1  231 ? 311.436 249.363 306.888 1.00 114.83 ? 231 THR N HA     1 
ATOM   3599   H  HB     . THR A  1  231 ? 310.438 250.207 308.785 1.00 106.70 ? 231 THR N HB     1 
ATOM   3600   H  HG1    . THR A  1  231 ? 309.729 247.713 309.386 1.00 105.45 ? 231 THR N HG1    1 
ATOM   3601   H  HG21   . THR A  1  231 ? 308.166 249.845 308.345 1.00 103.81 ? 231 THR N HG21   1 
ATOM   3602   H  HG22   . THR A  1  231 ? 308.943 250.038 306.984 1.00 103.81 ? 231 THR N HG22   1 
ATOM   3603   H  HG23   . THR A  1  231 ? 308.530 248.590 307.460 1.00 103.81 ? 231 THR N HG23   1 
ATOM   3604   N  N      . GLU A  1  232 ? 313.196 249.560 308.710 1.00 144.20 ? 232 GLU N N      1 
ATOM   3605   C  CA     . GLU A  1  232 ? 314.494 249.443 309.363 1.00 150.15 ? 232 GLU N CA     1 
ATOM   3606   C  C      . GLU A  1  232 ? 314.397 248.823 310.750 1.00 147.97 ? 232 GLU N C      1 
ATOM   3607   O  O      . GLU A  1  232 ? 315.400 248.301 311.251 1.00 148.89 ? 232 GLU N O      1 
ATOM   3608   C  CB     . GLU A  1  232 ? 315.149 250.820 309.428 1.00 170.70 ? 232 GLU N CB     1 
ATOM   3609   C  CG     . GLU A  1  232 ? 315.359 251.416 308.046 1.00 174.87 ? 232 GLU N CG     1 
ATOM   3610   C  CD     . GLU A  1  232 ? 316.180 252.689 308.060 1.00 164.81 ? 232 GLU N CD     1 
ATOM   3611   O  OE1    . GLU A  1  232 ? 315.975 253.522 308.969 1.00 171.86 ? 232 GLU N OE1    1 
ATOM   3612   O  OE2    . GLU A  1  232 ? 317.031 252.854 307.156 1.00 147.10 ? 232 GLU N OE2    1 
ATOM   3613   H  H      . GLU A  1  232 ? 312.949 250.367 308.550 1.00 124.85 ? 232 GLU N H      1 
ATOM   3614   H  HA     . GLU A  1  232 ? 315.062 248.871 308.824 1.00 129.99 ? 232 GLU N HA     1 
ATOM   3615   H  HB2    . GLU A  1  232 ? 314.579 251.421 309.933 1.00 150.53 ? 232 GLU N HB2    1 
ATOM   3616   H  HB3    . GLU A  1  232 ? 316.015 250.740 309.858 1.00 150.53 ? 232 GLU N HB3    1 
ATOM   3617   H  HG2    . GLU A  1  232 ? 315.823 250.768 307.492 1.00 155.23 ? 232 GLU N HG2    1 
ATOM   3618   H  HG3    . GLU A  1  232 ? 314.495 251.623 307.658 1.00 155.23 ? 232 GLU N HG3    1 
ATOM   3619   N  N      . ALA A  1  233 ? 313.222 248.856 311.382 1.00 136.96 ? 233 ALA N N      1 
ATOM   3620   C  CA     . ALA A  1  233 ? 313.061 248.182 312.664 1.00 153.23 ? 233 ALA N CA     1 
ATOM   3621   C  C      . ALA A  1  233 ? 313.071 246.667 312.491 1.00 139.15 ? 233 ALA N C      1 
ATOM   3622   O  O      . ALA A  1  233 ? 313.752 245.951 313.234 1.00 149.74 ? 233 ALA N O      1 
ATOM   3623   C  CB     . ALA A  1  233 ? 311.770 248.643 313.340 1.00 124.63 ? 233 ALA N CB     1 
ATOM   3624   H  H      . ALA A  1  233 ? 312.517 249.255 311.093 1.00 117.54 ? 233 ALA N H      1 
ATOM   3625   H  HA     . ALA A  1  233 ? 313.803 248.422 313.241 1.00 133.25 ? 233 ALA N HA     1 
ATOM   3626   H  HB1    . ALA A  1  233 ? 311.679 248.186 314.191 1.00 105.05 ? 233 ALA N HB1    1 
ATOM   3627   H  HB2    . ALA A  1  233 ? 311.813 249.602 313.483 1.00 105.05 ? 233 ALA N HB2    1 
ATOM   3628   H  HB3    . ALA A  1  233 ? 311.018 248.428 312.766 1.00 105.05 ? 233 ALA N HB3    1 
ATOM   3629   N  N      . GLU A  1  234 ? 312.327 246.160 311.504 1.00 156.42 ? 234 GLU N N      1 
ATOM   3630   C  CA     . GLU A  1  234 ? 312.233 244.715 311.309 1.00 162.85 ? 234 GLU N CA     1 
ATOM   3631   C  C      . GLU A  1  234 ? 313.498 244.135 310.690 1.00 157.48 ? 234 GLU N C      1 
ATOM   3632   O  O      . GLU A  1  234 ? 313.822 242.969 310.938 1.00 153.64 ? 234 GLU N O      1 
ATOM   3633   C  CB     . GLU A  1  234 ? 311.040 244.363 310.417 1.00 178.10 ? 234 GLU N CB     1 
ATOM   3634   C  CG     . GLU A  1  234 ? 309.744 245.093 310.729 1.00 195.59 ? 234 GLU N CG     1 
ATOM   3635   C  CD     . GLU A  1  234 ? 308.689 244.859 309.665 1.00 198.42 ? 234 GLU N CD     1 
ATOM   3636   O  OE1    . GLU A  1  234 ? 308.073 243.772 309.664 1.00 212.08 ? 234 GLU N OE1    1 
ATOM   3637   O  OE2    . GLU A  1  234 ? 308.485 245.758 308.821 1.00 188.03 ? 234 GLU N OE2    1 
ATOM   3638   H  H      . GLU A  1  234 ? 311.873 246.626 310.942 1.00 137.34 ? 234 GLU N H      1 
ATOM   3639   H  HA     . GLU A  1  234 ? 312.099 244.289 312.170 1.00 143.52 ? 234 GLU N HA     1 
ATOM   3640   H  HB2    . GLU A  1  234 ? 311.275 244.568 309.499 1.00 159.51 ? 234 GLU N HB2    1 
ATOM   3641   H  HB3    . GLU A  1  234 ? 310.865 243.413 310.501 1.00 159.51 ? 234 GLU N HB3    1 
ATOM   3642   H  HG2    . GLU A  1  234 ? 309.395 244.774 311.576 1.00 177.62 ? 234 GLU N HG2    1 
ATOM   3643   H  HG3    . GLU A  1  234 ? 309.918 246.046 310.776 1.00 177.62 ? 234 GLU N HG3    1 
ATOM   3644   N  N      . ILE A  1  235 ? 314.207 244.915 309.868 1.00 138.86 ? 235 ILE N N      1 
ATOM   3645   C  CA     . ILE A  1  235 ? 315.467 244.441 309.303 1.00 138.38 ? 235 ILE N CA     1 
ATOM   3646   C  C      . ILE A  1  235 ? 316.508 244.277 310.397 1.00 146.26 ? 235 ILE N C      1 
ATOM   3647   O  O      . ILE A  1  235 ? 317.365 243.389 310.320 1.00 165.87 ? 235 ILE N O      1 
ATOM   3648   C  CB     . ILE A  1  235 ? 315.965 245.403 308.206 1.00 123.18 ? 235 ILE N CB     1 
ATOM   3649   C  CG1    . ILE A  1  235 ? 315.016 245.377 307.007 1.00 139.23 ? 235 ILE N CG1    1 
ATOM   3650   C  CG2    . ILE A  1  235 ? 317.382 245.037 307.759 1.00 117.38 ? 235 ILE N CG2    1 
ATOM   3651   C  CD1    . ILE A  1  235 ? 315.280 246.474 305.994 1.00 158.03 ? 235 ILE N CD1    1 
ATOM   3652   H  H      . ILE A  1  235 ? 313.983 245.709 309.626 1.00 115.06 ? 235 ILE N H      1 
ATOM   3653   H  HA     . ILE A  1  235 ? 315.323 243.572 308.896 1.00 114.09 ? 235 ILE N HA     1 
ATOM   3654   H  HB     . ILE A  1  235 ? 315.979 246.302 308.569 1.00 99.31  ? 235 ILE N HB     1 
ATOM   3655   H  HG12   . ILE A  1  235 ? 315.110 244.525 306.553 1.00 116.19 ? 235 ILE N HG12   1 
ATOM   3656   H  HG13   . ILE A  1  235 ? 314.106 245.482 307.326 1.00 116.19 ? 235 ILE N HG13   1 
ATOM   3657   H  HG21   . ILE A  1  235 ? 317.665 245.659 307.070 1.00 92.92  ? 235 ILE N HG21   1 
ATOM   3658   H  HG22   . ILE A  1  235 ? 317.978 245.093 308.522 1.00 92.92  ? 235 ILE N HG22   1 
ATOM   3659   H  HG23   . ILE A  1  235 ? 317.378 244.133 307.407 1.00 92.92  ? 235 ILE N HG23   1 
ATOM   3660   H  HD11   . ILE A  1  235 ? 314.643 246.392 305.268 1.00 135.50 ? 235 ILE N HD11   1 
ATOM   3661   H  HD12   . ILE A  1  235 ? 315.179 247.335 306.428 1.00 135.50 ? 235 ILE N HD12   1 
ATOM   3662   H  HD13   . ILE A  1  235 ? 316.184 246.378 305.654 1.00 135.50 ? 235 ILE N HD13   1 
ATOM   3663   N  N      . ASP A  1  236 ? 316.462 245.124 311.423 1.00 164.65 ? 236 ASP N N      1 
ATOM   3664   C  CA     . ASP A  1  236 ? 317.452 245.050 312.485 1.00 166.90 ? 236 ASP N CA     1 
ATOM   3665   C  C      . ASP A  1  236 ? 317.190 243.899 313.444 1.00 185.29 ? 236 ASP N C      1 
ATOM   3666   O  O      . ASP A  1  236 ? 318.129 243.430 314.096 1.00 193.44 ? 236 ASP N O      1 
ATOM   3667   C  CB     . ASP A  1  236 ? 317.492 246.364 313.261 1.00 175.83 ? 236 ASP N CB     1 
ATOM   3668   C  CG     . ASP A  1  236 ? 318.745 246.504 314.092 1.00 191.14 ? 236 ASP N CG     1 
ATOM   3669   O  OD1    . ASP A  1  236 ? 319.791 246.879 313.523 1.00 196.08 ? 236 ASP N OD1    1 
ATOM   3670   O  OD2    . ASP A  1  236 ? 318.683 246.237 315.309 1.00 198.04 ? 236 ASP N OD2    1 
ATOM   3671   H  H      . ASP A  1  236 ? 315.874 245.743 311.525 1.00 131.19 ? 236 ASP N H      1 
ATOM   3672   H  HA     . ASP A  1  236 ? 318.327 244.912 312.089 1.00 132.55 ? 236 ASP N HA     1 
ATOM   3673   H  HB2    . ASP A  1  236 ? 317.462 247.104 312.634 1.00 141.51 ? 236 ASP N HB2    1 
ATOM   3674   H  HB3    . ASP A  1  236 ? 316.728 246.403 313.858 1.00 141.51 ? 236 ASP N HB3    1 
ATOM   3675   N  N      . ALA A  1  237 ? 315.943 243.438 313.552 1.00 144.61 ? 237 ALA N N      1 
ATOM   3676   C  CA     . ALA A  1  237 ? 315.665 242.261 314.367 1.00 139.49 ? 237 ALA N CA     1 
ATOM   3677   C  C      . ALA A  1  237 ? 316.329 241.020 313.777 1.00 130.04 ? 237 ALA N C      1 
ATOM   3678   O  O      . ALA A  1  237 ? 316.828 240.166 314.520 1.00 134.07 ? 237 ALA N O      1 
ATOM   3679   C  CB     . ALA A  1  237 ? 314.155 242.059 314.503 1.00 125.21 ? 237 ALA N CB     1 
ATOM   3680   H  H      . ALA A  1  237 ? 315.254 243.782 313.170 1.00 129.61 ? 237 ALA N H      1 
ATOM   3681   H  HA     . ALA A  1  237 ? 316.029 242.400 315.255 1.00 123.97 ? 237 ALA N HA     1 
ATOM   3682   H  HB1    . ALA A  1  237 ? 313.990 241.274 315.047 1.00 110.29 ? 237 ALA N HB1    1 
ATOM   3683   H  HB2    . ALA A  1  237 ? 313.769 242.842 314.927 1.00 110.29 ? 237 ALA N HB2    1 
ATOM   3684   H  HB3    . ALA A  1  237 ? 313.772 241.938 313.620 1.00 110.29 ? 237 ALA N HB3    1 
ATOM   3685   N  N      . HIS A  1  238 ? 316.349 240.905 312.444 1.00 120.16 ? 238 HIS N N      1 
ATOM   3686   C  CA     . HIS A  1  238 ? 317.011 239.783 311.785 1.00 119.84 ? 238 HIS N CA     1 
ATOM   3687   C  C      . HIS A  1  238 ? 318.528 239.922 311.764 1.00 122.42 ? 238 HIS N C      1 
ATOM   3688   O  O      . HIS A  1  238 ? 319.220 238.915 311.581 1.00 128.13 ? 238 HIS N O      1 
ATOM   3689   C  CB     . HIS A  1  238 ? 316.531 239.631 310.339 1.00 114.49 ? 238 HIS N CB     1 
ATOM   3690   C  CG     . HIS A  1  238 ? 315.061 239.382 310.201 1.00 132.25 ? 238 HIS N CG     1 
ATOM   3691   N  ND1    . HIS A  1  238 ? 314.474 238.179 310.530 1.00 139.53 ? 238 HIS N ND1    1 
ATOM   3692   C  CD2    . HIS A  1  238 ? 314.064 240.175 309.743 1.00 140.30 ? 238 HIS N CD2    1 
ATOM   3693   C  CE1    . HIS A  1  238 ? 313.175 238.247 310.293 1.00 142.70 ? 238 HIS N CE1    1 
ATOM   3694   N  NE2    . HIS A  1  238 ? 312.901 239.447 309.814 1.00 141.17 ? 238 HIS N NE2    1 
ATOM   3695   H  H      . HIS A  1  238 ? 315.986 241.465 311.902 1.00 108.73 ? 238 HIS N H      1 
ATOM   3696   H  HA     . HIS A  1  238 ? 316.792 238.966 312.260 1.00 107.99 ? 238 HIS N HA     1 
ATOM   3697   H  HB2    . HIS A  1  238 ? 316.738 240.445 309.855 1.00 103.36 ? 238 HIS N HB2    1 
ATOM   3698   H  HB3    . HIS A  1  238 ? 316.996 238.882 309.934 1.00 103.36 ? 238 HIS N HB3    1 
ATOM   3699   H  HD1    . HIS A  1  238 ? 314.886 237.494 310.846 1.00 128.84 ? 238 HIS N HD1    1 
ATOM   3700   H  HD2    . HIS A  1  238 ? 314.150 241.050 309.441 1.00 130.70 ? 238 HIS N HD2    1 
ATOM   3701   H  HE1    . HIS A  1  238 ? 312.559 237.565 310.439 1.00 132.71 ? 238 HIS N HE1    1 
ATOM   3702   N  N      . LEU A  1  239 ? 319.057 241.139 311.932 1.00 137.63 ? 239 LEU N N      1 
ATOM   3703   C  CA     . LEU A  1  239 ? 320.503 241.351 311.897 1.00 145.02 ? 239 LEU N CA     1 
ATOM   3704   C  C      . LEU A  1  239 ? 321.155 241.054 313.239 1.00 156.30 ? 239 LEU N C      1 
ATOM   3705   O  O      . LEU A  1  239 ? 322.304 240.594 313.280 1.00 137.63 ? 239 LEU N O      1 
ATOM   3706   C  CB     . LEU A  1  239 ? 320.823 242.792 311.496 1.00 140.15 ? 239 LEU N CB     1 
ATOM   3707   C  CG     . LEU A  1  239 ? 320.796 243.224 310.029 1.00 127.34 ? 239 LEU N CG     1 
ATOM   3708   C  CD1    . LEU A  1  239 ? 320.871 244.741 309.980 1.00 121.61 ? 239 LEU N CD1    1 
ATOM   3709   C  CD2    . LEU A  1  239 ? 321.938 242.608 309.231 1.00 122.09 ? 239 LEU N CD2    1 
ATOM   3710   H  H      . LEU A  1  239 ? 318.599 241.855 312.067 1.00 118.16 ? 239 LEU N H      1 
ATOM   3711   H  HA     . LEU A  1  239 ? 320.894 240.760 311.235 1.00 124.90 ? 239 LEU N HA     1 
ATOM   3712   H  HB2    . LEU A  1  239 ? 320.193 243.366 311.959 1.00 120.47 ? 239 LEU N HB2    1 
ATOM   3713   H  HB3    . LEU A  1  239 ? 321.716 242.989 311.820 1.00 120.47 ? 239 LEU N HB3    1 
ATOM   3714   H  HG     . LEU A  1  239 ? 319.958 242.947 309.627 1.00 108.36 ? 239 LEU N HG     1 
ATOM   3715   H  HD11   . LEU A  1  239 ? 320.854 245.028 309.053 1.00 103.05 ? 239 LEU N HD11   1 
ATOM   3716   H  HD12   . LEU A  1  239 ? 320.110 245.109 310.455 1.00 103.05 ? 239 LEU N HD12   1 
ATOM   3717   H  HD13   . LEU A  1  239 ? 321.696 245.029 310.401 1.00 103.05 ? 239 LEU N HD13   1 
ATOM   3718   H  HD21   . LEU A  1  239 ? 321.879 242.909 308.311 1.00 102.65 ? 239 LEU N HD21   1 
ATOM   3719   H  HD22   . LEU A  1  239 ? 322.781 242.889 309.619 1.00 102.65 ? 239 LEU N HD22   1 
ATOM   3720   H  HD23   . LEU A  1  239 ? 321.862 241.641 309.268 1.00 102.65 ? 239 LEU N HD23   1 
ATOM   3721   N  N      . VAL A  1  240 ? 320.457 241.342 314.342 1.00 158.42 ? 240 VAL N N      1 
ATOM   3722   C  CA     . VAL A  1  240 ? 320.957 240.971 315.663 1.00 162.66 ? 240 VAL N CA     1 
ATOM   3723   C  C      . VAL A  1  240 ? 320.752 239.496 315.953 1.00 163.89 ? 240 VAL N C      1 
ATOM   3724   O  O      . VAL A  1  240 ? 321.303 238.989 316.937 1.00 162.13 ? 240 VAL N O      1 
ATOM   3725   C  CB     . VAL A  1  240 ? 320.291 241.816 316.765 1.00 157.96 ? 240 VAL N CB     1 
ATOM   3726   C  CG1    . VAL A  1  240 ? 320.630 243.291 316.573 1.00 143.89 ? 240 VAL N CG1    1 
ATOM   3727   C  CG2    . VAL A  1  240 ? 318.781 241.597 316.781 1.00 141.87 ? 240 VAL N CG2    1 
ATOM   3728   H  H      . VAL A  1  240 ? 319.699 241.748 314.349 1.00 138.32 ? 240 VAL N H      1 
ATOM   3729   H  HA     . VAL A  1  240 ? 321.911 241.147 315.693 1.00 141.65 ? 240 VAL N HA     1 
ATOM   3730   H  HB     . VAL A  1  240 ? 320.641 241.540 317.627 1.00 137.09 ? 240 VAL N HB     1 
ATOM   3731   H  HG11   . VAL A  1  240 ? 320.203 243.806 317.275 1.00 123.37 ? 240 VAL N HG11   1 
ATOM   3732   H  HG12   . VAL A  1  240 ? 321.593 243.402 316.620 1.00 123.37 ? 240 VAL N HG12   1 
ATOM   3733   H  HG13   . VAL A  1  240 ? 320.305 243.579 315.706 1.00 123.37 ? 240 VAL N HG13   1 
ATOM   3734   H  HG21   . VAL A  1  240 ? 318.391 242.141 317.483 1.00 121.70 ? 240 VAL N HG21   1 
ATOM   3735   H  HG22   . VAL A  1  240 ? 318.416 241.856 315.920 1.00 121.70 ? 240 VAL N HG22   1 
ATOM   3736   H  HG23   . VAL A  1  240 ? 318.600 240.659 316.949 1.00 121.70 ? 240 VAL N HG23   1 
ATOM   3737   N  N      . ALA A  1  241 ? 319.971 238.796 315.127 1.00 157.78 ? 241 ALA N N      1 
ATOM   3738   C  CA     . ALA A  1  241 ? 319.864 237.345 315.184 1.00 148.92 ? 241 ALA N CA     1 
ATOM   3739   C  C      . ALA A  1  241 ? 320.926 236.644 314.341 1.00 152.15 ? 241 ALA N C      1 
ATOM   3740   O  O      . ALA A  1  241 ? 321.119 235.434 314.502 1.00 164.28 ? 241 ALA N O      1 
ATOM   3741   C  CB     . ALA A  1  241 ? 318.468 236.897 314.732 1.00 132.90 ? 241 ALA N CB     1 
ATOM   3742   H  H      . ALA A  1  241 ? 319.484 239.151 314.514 1.00 154.38 ? 241 ALA N H      1 
ATOM   3743   H  HA     . ALA A  1  241 ? 319.982 237.060 316.104 1.00 145.06 ? 241 ALA N HA     1 
ATOM   3744   H  HB1    . ALA A  1  241 ? 318.417 235.930 314.778 1.00 129.78 ? 241 ALA N HB1    1 
ATOM   3745   H  HB2    . ALA A  1  241 ? 317.805 237.292 315.320 1.00 129.78 ? 241 ALA N HB2    1 
ATOM   3746   H  HB3    . ALA A  1  241 ? 318.321 237.195 313.821 1.00 129.78 ? 241 ALA N HB3    1 
ATOM   3747   N  N      . LEU A  1  242 ? 321.611 237.364 313.444 1.00 184.20 ? 242 LEU N N      1 
ATOM   3748   C  CA     . LEU A  1  242 ? 322.818 236.828 312.821 1.00 176.78 ? 242 LEU N CA     1 
ATOM   3749   C  C      . LEU A  1  242 ? 324.007 236.910 313.764 1.00 182.74 ? 242 LEU N C      1 
ATOM   3750   O  O      . LEU A  1  242 ? 324.946 236.113 313.647 1.00 185.55 ? 242 LEU N O      1 
ATOM   3751   C  CB     . LEU A  1  242 ? 323.168 237.589 311.541 1.00 185.87 ? 242 LEU N CB     1 
ATOM   3752   C  CG     . LEU A  1  242 ? 322.144 237.821 310.433 1.00 198.61 ? 242 LEU N CG     1 
ATOM   3753   C  CD1    . LEU A  1  242 ? 322.806 238.635 309.331 1.00 193.40 ? 242 LEU N CD1    1 
ATOM   3754   C  CD2    . LEU A  1  242 ? 321.595 236.517 309.884 1.00 220.82 ? 242 LEU N CD2    1 
ATOM   3755   H  H      . LEU A  1  242 ? 321.397 238.156 313.184 1.00 138.64 ? 242 LEU N H      1 
ATOM   3756   H  HA     . LEU A  1  242 ? 322.674 235.897 312.592 1.00 130.63 ? 242 LEU N HA     1 
ATOM   3757   H  HB2    . LEU A  1  242 ? 323.476 238.469 311.809 1.00 140.31 ? 242 LEU N HB2    1 
ATOM   3758   H  HB3    . LEU A  1  242 ? 323.909 237.120 311.126 1.00 140.31 ? 242 LEU N HB3    1 
ATOM   3759   H  HG     . LEU A  1  242 ? 321.403 238.337 310.787 1.00 154.10 ? 242 LEU N HG     1 
ATOM   3760   H  HD11   . LEU A  1  242 ? 322.162 238.788 308.622 1.00 149.23 ? 242 LEU N HD11   1 
ATOM   3761   H  HD12   . LEU A  1  242 ? 323.100 239.483 309.699 1.00 149.23 ? 242 LEU N HD12   1 
ATOM   3762   H  HD13   . LEU A  1  242 ? 323.566 238.141 308.987 1.00 149.23 ? 242 LEU N HD13   1 
ATOM   3763   H  HD21   . LEU A  1  242 ? 320.951 236.715 309.186 1.00 176.34 ? 242 LEU N HD21   1 
ATOM   3764   H  HD22   . LEU A  1  242 ? 322.327 235.995 309.520 1.00 176.34 ? 242 LEU N HD22   1 
ATOM   3765   H  HD23   . LEU A  1  242 ? 321.164 236.029 310.603 1.00 176.34 ? 242 LEU N HD23   1 
ATOM   3766   N  N      . ALA A  1  243 ? 323.991 237.881 314.682 1.00 149.65 ? 243 ALA N N      1 
ATOM   3767   C  CA     . ALA A  1  243 ? 325.072 238.014 315.652 1.00 168.07 ? 243 ALA N CA     1 
ATOM   3768   C  C      . ALA A  1  243 ? 325.017 236.904 316.696 1.00 175.33 ? 243 ALA N C      1 
ATOM   3769   O  O      . ALA A  1  243 ? 326.060 236.396 317.125 1.00 182.43 ? 243 ALA N O      1 
ATOM   3770   C  CB     . ALA A  1  243 ? 324.999 239.388 316.317 1.00 150.04 ? 243 ALA N CB     1 
ATOM   3771   H  H      . ALA A  1  243 ? 323.369 238.470 314.761 1.00 124.60 ? 243 ALA N H      1 
ATOM   3772   H  HA     . ALA A  1  243 ? 325.922 237.949 315.189 1.00 142.06 ? 243 ALA N HA     1 
ATOM   3773   H  HB1    . ALA A  1  243 ? 325.721 239.466 316.959 1.00 124.27 ? 243 ALA N HB1    1 
ATOM   3774   H  HB2    . ALA A  1  243 ? 325.086 240.073 315.635 1.00 124.27 ? 243 ALA N HB2    1 
ATOM   3775   H  HB3    . ALA A  1  243 ? 324.144 239.475 316.767 1.00 124.27 ? 243 ALA N HB3    1 
ATOM   3776   N  N      . GLU A  1  244 ? 323.810 236.509 317.114 1.00 230.53 ? 244 GLU N N      1 
ATOM   3777   C  CA     . GLU A  1  244 ? 323.681 235.441 318.102 1.00 235.66 ? 244 GLU N CA     1 
ATOM   3778   C  C      . GLU A  1  244 ? 324.143 234.103 317.535 1.00 220.25 ? 244 GLU N C      1 
ATOM   3779   O  O      . GLU A  1  244 ? 324.847 233.345 318.213 1.00 212.64 ? 244 GLU N O      1 
ATOM   3780   C  CB     . GLU A  1  244 ? 322.233 235.332 318.583 1.00 236.00 ? 244 GLU N CB     1 
ATOM   3781   C  CG     . GLU A  1  244 ? 321.590 236.642 319.007 1.00 219.84 ? 244 GLU N CG     1 
ATOM   3782   C  CD     . GLU A  1  244 ? 322.453 237.450 319.957 1.00 205.50 ? 244 GLU N CD     1 
ATOM   3783   O  OE1    . GLU A  1  244 ? 322.938 238.528 319.551 1.00 198.51 ? 244 GLU N OE1    1 
ATOM   3784   O  OE2    . GLU A  1  244 ? 322.645 237.007 321.110 1.00 201.88 ? 244 GLU N OE2    1 
ATOM   3785   H  H      . GLU A  1  244 ? 323.064 236.840 316.844 1.00 197.75 ? 244 GLU N H      1 
ATOM   3786   H  HA     . GLU A  1  244 ? 324.237 235.650 318.869 1.00 202.14 ? 244 GLU N HA     1 
ATOM   3787   H  HB2    . GLU A  1  244 ? 321.697 234.963 317.864 1.00 203.03 ? 244 GLU N HB2    1 
ATOM   3788   H  HB3    . GLU A  1  244 ? 322.207 234.734 319.346 1.00 203.03 ? 244 GLU N HB3    1 
ATOM   3789   H  HG2    . GLU A  1  244 ? 321.427 237.182 318.219 1.00 187.51 ? 244 GLU N HG2    1 
ATOM   3790   H  HG3    . GLU A  1  244 ? 320.751 236.450 319.456 1.00 187.51 ? 244 GLU N HG3    1 
ATOM   3791   N  N      . ARG A  1  245 ? 323.755 233.794 316.302 1.00 232.21 ? 245 ARG N N      1 
ATOM   3792   C  CA     . ARG A  1  245 ? 324.103 232.523 315.677 1.00 219.93 ? 245 ARG N CA     1 
ATOM   3793   C  C      . ARG A  1  245 ? 325.546 232.525 315.181 1.00 215.55 ? 245 ARG N C      1 
ATOM   3794   O  O      . ARG A  1  245 ? 326.285 233.491 315.369 1.00 211.49 ? 245 ARG N O      1 
ATOM   3795   C  CB     . ARG A  1  245 ? 323.148 232.223 314.519 1.00 209.70 ? 245 ARG N CB     1 
ATOM   3796   C  CG     . ARG A  1  245 ? 321.722 231.962 314.969 1.00 207.92 ? 245 ARG N CG     1 
ATOM   3797   C  CD     . ARG A  1  245 ? 320.748 231.843 313.806 1.00 213.97 ? 245 ARG N CD     1 
ATOM   3798   N  NE     . ARG A  1  245 ? 320.458 233.138 313.189 1.00 230.12 ? 245 ARG N NE     1 
ATOM   3799   C  CZ     . ARG A  1  245 ? 319.279 233.488 312.679 1.00 241.58 ? 245 ARG N CZ     1 
ATOM   3800   N  NH1    . ARG A  1  245 ? 319.124 234.691 312.136 1.00 241.52 ? 245 ARG N NH1    1 
ATOM   3801   N  NH2    . ARG A  1  245 ? 318.245 232.655 312.720 1.00 248.50 ? 245 ARG N NH2    1 
ATOM   3802   H  H      . ARG A  1  245 ? 323.283 234.310 315.801 1.00 201.80 ? 245 ARG N H      1 
ATOM   3803   H  HA     . ARG A  1  245 ? 324.013 231.813 316.332 1.00 189.09 ? 245 ARG N HA     1 
ATOM   3804   H  HB2    . ARG A  1  245 ? 323.136 232.983 313.916 1.00 179.76 ? 245 ARG N HB2    1 
ATOM   3805   H  HB3    . ARG A  1  245 ? 323.461 231.434 314.049 1.00 179.76 ? 245 ARG N HB3    1 
ATOM   3806   H  HG2    . ARG A  1  245 ? 321.695 231.131 315.468 1.00 178.48 ? 245 ARG N HG2    1 
ATOM   3807   H  HG3    . ARG A  1  245 ? 321.429 232.696 315.531 1.00 178.48 ? 245 ARG N HG3    1 
ATOM   3808   H  HD2    . ARG A  1  245 ? 321.133 231.266 313.128 1.00 185.47 ? 245 ARG N HD2    1 
ATOM   3809   H  HD3    . ARG A  1  245 ? 319.913 231.469 314.128 1.00 185.47 ? 245 ARG N HD3    1 
ATOM   3810   H  HE     . ARG A  1  245 ? 321.095 233.715 313.154 1.00 202.52 ? 245 ARG N HE     1 
ATOM   3811   H  HH11   . ARG A  1  245 ? 319.785 235.239 312.109 1.00 215.61 ? 245 ARG N HH11   1 
ATOM   3812   H  HH12   . ARG A  1  245 ? 318.361 234.921 311.812 1.00 215.61 ? 245 ARG N HH12   1 
ATOM   3813   H  HH21   . ARG A  1  245 ? 318.336 231.874 313.069 1.00 222.06 ? 245 ARG N HH21   1 
ATOM   3814   H  HH22   . ARG A  1  245 ? 317.487 232.893 312.390 1.00 222.06 ? 245 ARG N HH22   1 
ATOM   3815   N  N      . ALA B  2  2   ? 312.561 259.792 268.469 1.00 152.71 ? 1   ALA O N      1 
ATOM   3816   C  CA     . ALA B  2  2   ? 312.968 258.365 268.331 1.00 177.56 ? 1   ALA O CA     1 
ATOM   3817   C  C      . ALA B  2  2   ? 312.970 257.947 266.862 1.00 198.99 ? 1   ALA O C      1 
ATOM   3818   O  O      . ALA B  2  2   ? 312.275 258.540 266.039 1.00 241.50 ? 1   ALA O O      1 
ATOM   3819   C  CB     . ALA B  2  2   ? 312.048 257.477 269.140 1.00 147.38 ? 1   ALA O CB     1 
ATOM   3820   H  H      . ALA B  2  2   ? 313.238 260.263 268.802 1.00 152.71 ? 1   ALA O H      1 
ATOM   3821   H  HA     . ALA B  2  2   ? 313.870 258.266 268.674 1.00 177.56 ? 1   ALA O HA     1 
ATOM   3822   H  HB1    . ALA B  2  2   ? 312.323 256.552 269.042 1.00 147.38 ? 1   ALA O HB1    1 
ATOM   3823   H  HB2    . ALA B  2  2   ? 312.093 257.730 270.075 1.00 147.38 ? 1   ALA O HB2    1 
ATOM   3824   H  HB3    . ALA B  2  2   ? 311.137 257.579 268.822 1.00 147.38 ? 1   ALA O HB3    1 
ATOM   3825   N  N      . GLU B  2  3   ? 313.748 256.915 266.545 1.00 241.22 ? 2   GLU O N      1 
ATOM   3826   C  CA     . GLU B  2  3   ? 314.012 256.569 265.153 1.00 235.60 ? 2   GLU O CA     1 
ATOM   3827   C  C      . GLU B  2  3   ? 312.760 256.045 264.464 1.00 216.60 ? 2   GLU O C      1 
ATOM   3828   O  O      . GLU B  2  3   ? 311.966 255.305 265.054 1.00 200.11 ? 2   GLU O O      1 
ATOM   3829   C  CB     . GLU B  2  3   ? 315.120 255.515 265.067 1.00 267.44 ? 2   GLU O CB     1 
ATOM   3830   C  CG     . GLU B  2  3   ? 316.533 256.071 264.899 1.00 282.95 ? 2   GLU O CG     1 
ATOM   3831   C  CD     . GLU B  2  3   ? 316.845 256.486 263.473 1.00 269.88 ? 2   GLU O CD     1 
ATOM   3832   O  OE1    . GLU B  2  3   ? 317.918 257.088 263.252 1.00 284.62 ? 2   GLU O OE1    1 
ATOM   3833   O  OE2    . GLU B  2  3   ? 316.024 256.205 262.574 1.00 239.95 ? 2   GLU O OE2    1 
ATOM   3834   H  H      . GLU B  2  3   ? 314.134 256.401 267.117 1.00 205.15 ? 2   GLU O H      1 
ATOM   3835   H  HA     . GLU B  2  3   ? 314.310 257.361 264.679 1.00 199.94 ? 2   GLU O HA     1 
ATOM   3836   H  HB2    . GLU B  2  3   ? 315.108 254.989 265.882 1.00 231.57 ? 2   GLU O HB2    1 
ATOM   3837   H  HB3    . GLU B  2  3   ? 314.939 254.940 264.307 1.00 231.57 ? 2   GLU O HB3    1 
ATOM   3838   H  HG2    . GLU B  2  3   ? 316.634 256.851 265.466 1.00 246.53 ? 2   GLU O HG2    1 
ATOM   3839   H  HG3    . GLU B  2  3   ? 317.172 255.389 265.158 1.00 246.53 ? 2   GLU O HG3    1 
ATOM   3840   N  N      . ARG B  2  4   ? 312.589 256.441 263.199 1.00 212.14 ? 3   ARG O N      1 
ATOM   3841   C  CA     . ARG B  2  4   ? 311.613 255.782 262.340 1.00 200.74 ? 3   ARG O CA     1 
ATOM   3842   C  C      . ARG B  2  4   ? 312.008 254.344 262.042 1.00 165.99 ? 3   ARG O C      1 
ATOM   3843   O  O      . ARG B  2  4   ? 311.147 253.537 261.674 1.00 156.49 ? 3   ARG O O      1 
ATOM   3844   C  CB     . ARG B  2  4   ? 311.431 256.565 261.021 1.00 196.80 ? 3   ARG O CB     1 
ATOM   3845   C  CG     . ARG B  2  4   ? 312.704 257.209 260.424 1.00 190.41 ? 3   ARG O CG     1 
ATOM   3846   C  CD     . ARG B  2  4   ? 312.558 257.615 258.933 1.00 196.08 ? 3   ARG O CD     1 
ATOM   3847   N  NE     . ARG B  2  4   ? 311.601 258.698 258.693 1.00 209.28 ? 3   ARG O NE     1 
ATOM   3848   C  CZ     . ARG B  2  4   ? 311.582 259.462 257.600 1.00 217.92 ? 3   ARG O CZ     1 
ATOM   3849   N  NH1    . ARG B  2  4   ? 310.670 260.418 257.473 1.00 211.91 ? 3   ARG O NH1    1 
ATOM   3850   N  NH2    . ARG B  2  4   ? 312.478 259.297 256.634 1.00 228.45 ? 3   ARG O NH2    1 
ATOM   3851   H  H      . ARG B  2  4   ? 313.023 257.081 262.822 1.00 180.17 ? 3   ARG O H      1 
ATOM   3852   H  HA     . ARG B  2  4   ? 310.757 255.766 262.795 1.00 169.46 ? 3   ARG O HA     1 
ATOM   3853   H  HB2    . ARG B  2  4   ? 311.076 255.957 260.354 1.00 165.80 ? 3   ARG O HB2    1 
ATOM   3854   H  HB3    . ARG B  2  4   ? 310.794 257.279 261.178 1.00 165.80 ? 3   ARG O HB3    1 
ATOM   3855   H  HG2    . ARG B  2  4   ? 312.917 258.009 260.930 1.00 159.02 ? 3   ARG O HG2    1 
ATOM   3856   H  HG3    . ARG B  2  4   ? 313.436 256.575 260.488 1.00 159.02 ? 3   ARG O HG3    1 
ATOM   3857   H  HD2    . ARG B  2  4   ? 313.422 257.908 258.604 1.00 165.03 ? 3   ARG O HD2    1 
ATOM   3858   H  HD3    . ARG B  2  4   ? 312.261 256.842 258.428 1.00 165.03 ? 3   ARG O HD3    1 
ATOM   3859   H  HE     . ARG B  2  4   ? 311.010 258.851 259.299 1.00 178.38 ? 3   ARG O HE     1 
ATOM   3860   H  HH11   . ARG B  2  4   ? 310.086 260.540 258.092 1.00 181.20 ? 3   ARG O HH11   1 
ATOM   3861   H  HH12   . ARG B  2  4   ? 310.662 260.914 256.771 1.00 181.20 ? 3   ARG O HH12   1 
ATOM   3862   H  HH21   . ARG B  2  4   ? 313.075 258.682 256.702 1.00 197.58 ? 3   ARG O HH21   1 
ATOM   3863   H  HH22   . ARG B  2  4   ? 312.456 259.799 255.936 1.00 197.58 ? 3   ARG O HH22   1 
ATOM   3864   N  N      . GLY B  2  5   ? 313.271 253.994 262.247 1.00 129.23 ? 4   GLY O N      1 
ATOM   3865   C  CA     . GLY B  2  5   ? 313.858 252.774 261.738 1.00 120.90 ? 4   GLY O CA     1 
ATOM   3866   C  C      . GLY B  2  5   ? 314.871 253.057 260.635 1.00 131.21 ? 4   GLY O C      1 
ATOM   3867   O  O      . GLY B  2  5   ? 314.830 254.084 259.951 1.00 147.91 ? 4   GLY O O      1 
ATOM   3868   H  H      . GLY B  2  5   ? 313.826 254.472 262.697 1.00 122.29 ? 4   GLY O H      1 
ATOM   3869   H  HA2    . GLY B  2  5   ? 314.307 252.303 262.458 1.00 114.10 ? 4   GLY O HA2    1 
ATOM   3870   H  HA3    . GLY B  2  5   ? 313.162 252.202 261.380 1.00 114.10 ? 4   GLY O HA3    1 
ATOM   3871   N  N      . TYR B  2  6   ? 315.812 252.131 260.474 1.00 66.65  ? 5   TYR O N      1 
ATOM   3872   C  CA     . TYR B  2  6   ? 316.642 252.120 259.279 1.00 76.74  ? 5   TYR O CA     1 
ATOM   3873   C  C      . TYR B  2  6   ? 315.920 251.368 258.177 1.00 67.87  ? 5   TYR O C      1 
ATOM   3874   O  O      . TYR B  2  6   ? 315.233 250.372 258.424 1.00 83.39  ? 5   TYR O O      1 
ATOM   3875   C  CB     . TYR B  2  6   ? 317.995 251.458 259.519 1.00 63.88  ? 5   TYR O CB     1 
ATOM   3876   C  CG     . TYR B  2  6   ? 318.817 252.078 260.615 1.00 67.33  ? 5   TYR O CG     1 
ATOM   3877   C  CD1    . TYR B  2  6   ? 318.661 253.410 260.967 1.00 69.74  ? 5   TYR O CD1    1 
ATOM   3878   C  CD2    . TYR B  2  6   ? 319.749 251.322 261.303 1.00 68.49  ? 5   TYR O CD2    1 
ATOM   3879   C  CE1    . TYR B  2  6   ? 319.413 253.969 261.973 1.00 73.27  ? 5   TYR O CE1    1 
ATOM   3880   C  CE2    . TYR B  2  6   ? 320.503 251.867 262.305 1.00 71.93  ? 5   TYR O CE2    1 
ATOM   3881   C  CZ     . TYR B  2  6   ? 320.333 253.190 262.638 1.00 74.27  ? 5   TYR O CZ     1 
ATOM   3882   O  OH     . TYR B  2  6   ? 321.092 253.730 263.641 1.00 78.00  ? 5   TYR O OH     1 
ATOM   3883   H  H      . TYR B  2  6   ? 315.986 251.504 261.036 1.00 68.72  ? 5   TYR O H      1 
ATOM   3884   H  HA     . TYR B  2  6   ? 316.794 253.031 258.982 1.00 78.61  ? 5   TYR O HA     1 
ATOM   3885   H  HB2    . TYR B  2  6   ? 317.846 250.529 259.754 1.00 64.81  ? 5   TYR O HB2    1 
ATOM   3886   H  HB3    . TYR B  2  6   ? 318.512 251.507 258.700 1.00 64.81  ? 5   TYR O HB3    1 
ATOM   3887   H  HD1    . TYR B  2  6   ? 318.038 253.933 260.516 1.00 70.55  ? 5   TYR O HD1    1 
ATOM   3888   H  HD2    . TYR B  2  6   ? 319.865 250.427 261.079 1.00 68.08  ? 5   TYR O HD2    1 
ATOM   3889   H  HE1    . TYR B  2  6   ? 319.302 254.863 262.201 1.00 73.56  ? 5   TYR O HE1    1 
ATOM   3890   H  HE2    . TYR B  2  6   ? 321.127 251.346 262.758 1.00 71.05  ? 5   TYR O HE2    1 
ATOM   3891   H  HH     . TYR B  2  6   ? 321.607 253.147 263.958 1.00 77.03  ? 5   TYR O HH     1 
ATOM   3892   N  N      . SER B  2  7   ? 316.092 251.842 256.950 1.00 88.44  ? 6   SER O N      1 
ATOM   3893   C  CA     . SER B  2  7   ? 315.392 251.264 255.813 1.00 81.38  ? 6   SER O CA     1 
ATOM   3894   C  C      . SER B  2  7   ? 316.296 250.376 254.978 1.00 72.89  ? 6   SER O C      1 
ATOM   3895   O  O      . SER B  2  7   ? 315.874 249.312 254.504 1.00 71.38  ? 6   SER O O      1 
ATOM   3896   C  CB     . SER B  2  7   ? 314.815 252.391 254.949 1.00 89.55  ? 6   SER O CB     1 
ATOM   3897   O  OG     . SER B  2  7   ? 314.333 253.450 255.765 1.00 87.84  ? 6   SER O OG     1 
ATOM   3898   H  H      . SER B  2  7   ? 316.609 252.499 256.749 1.00 98.58  ? 6   SER O H      1 
ATOM   3899   H  HA     . SER B  2  7   ? 314.654 250.724 256.136 1.00 91.94  ? 6   SER O HA     1 
ATOM   3900   H  HB2    . SER B  2  7   ? 315.513 252.732 254.368 1.00 100.86 ? 6   SER O HB2    1 
ATOM   3901   H  HB3    . SER B  2  7   ? 314.082 252.041 254.420 1.00 100.86 ? 6   SER O HB3    1 
ATOM   3902   H  HG     . SER B  2  7   ? 314.019 254.063 255.284 1.00 99.33  ? 6   SER O HG     1 
ATOM   3903   N  N      . PHE B  2  8   ? 317.535 250.811 254.809 1.00 59.51  ? 7   PHE O N      1 
ATOM   3904   C  CA     . PHE B  2  8   ? 318.539 250.067 254.061 1.00 60.42  ? 7   PHE O CA     1 
ATOM   3905   C  C      . PHE B  2  8   ? 318.789 248.705 254.685 1.00 58.94  ? 7   PHE O C      1 
ATOM   3906   O  O      . PHE B  2  8   ? 318.789 248.555 255.910 1.00 59.11  ? 7   PHE O O      1 
ATOM   3907   C  CB     . PHE B  2  8   ? 319.839 250.859 254.041 1.00 64.73  ? 7   PHE O CB     1 
ATOM   3908   C  CG     . PHE B  2  8   ? 320.285 251.273 255.408 1.00 66.28  ? 7   PHE O CG     1 
ATOM   3909   C  CD1    . PHE B  2  8   ? 321.189 250.507 256.112 1.00 67.12  ? 7   PHE O CD1    1 
ATOM   3910   C  CD2    . PHE B  2  8   ? 319.763 252.407 256.004 1.00 67.29  ? 7   PHE O CD2    1 
ATOM   3911   C  CE1    . PHE B  2  8   ? 321.577 250.879 257.376 1.00 68.95  ? 7   PHE O CE1    1 
ATOM   3912   C  CE2    . PHE B  2  8   ? 320.143 252.780 257.258 1.00 91.50  ? 7   PHE O CE2    1 
ATOM   3913   C  CZ     . PHE B  2  8   ? 321.051 252.018 257.952 1.00 95.19  ? 7   PHE O CZ     1 
ATOM   3914   H  H      . PHE B  2  8   ? 317.827 251.556 255.126 1.00 62.45  ? 7   PHE O H      1 
ATOM   3915   H  HA     . PHE B  2  8   ? 318.238 249.940 253.148 1.00 62.74  ? 7   PHE O HA     1 
ATOM   3916   H  HB2    . PHE B  2  8   ? 320.537 250.310 253.651 1.00 66.55  ? 7   PHE O HB2    1 
ATOM   3917   H  HB3    . PHE B  2  8   ? 319.712 251.661 253.511 1.00 66.55  ? 7   PHE O HB3    1 
ATOM   3918   H  HD1    . PHE B  2  8   ? 321.542 249.738 255.727 1.00 67.73  ? 7   PHE O HD1    1 
ATOM   3919   H  HD2    . PHE B  2  8   ? 319.146 252.925 255.540 1.00 69.23  ? 7   PHE O HD2    1 
ATOM   3920   H  HE1    . PHE B  2  8   ? 322.193 250.362 257.844 1.00 69.22  ? 7   PHE O HE1    1 
ATOM   3921   H  HE2    . PHE B  2  8   ? 319.790 253.549 257.642 1.00 93.10  ? 7   PHE O HE2    1 
ATOM   3922   H  HZ     . PHE B  2  8   ? 321.317 252.273 258.806 1.00 95.96  ? 7   PHE O HZ     1 
ATOM   3923   N  N      . SER B  2  9   ? 319.038 247.716 253.835 1.00 75.69  ? 8   SER O N      1 
ATOM   3924   C  CA     . SER B  2  9   ? 319.332 246.375 254.311 1.00 74.24  ? 8   SER O CA     1 
ATOM   3925   C  C      . SER B  2  9   ? 320.756 246.295 254.853 1.00 83.97  ? 8   SER O C      1 
ATOM   3926   O  O      . SER B  2  9   ? 321.665 246.988 254.383 1.00 95.80  ? 8   SER O O      1 
ATOM   3927   C  CB     . SER B  2  9   ? 319.138 245.357 253.186 1.00 76.36  ? 8   SER O CB     1 
ATOM   3928   O  OG     . SER B  2  9   ? 317.849 245.484 252.603 1.00 79.74  ? 8   SER O OG     1 
ATOM   3929   H  H      . SER B  2  9   ? 319.043 247.797 252.978 1.00 74.92  ? 8   SER O H      1 
ATOM   3930   H  HA     . SER B  2  9   ? 318.721 246.151 255.030 1.00 72.84  ? 8   SER O HA     1 
ATOM   3931   H  HB2    . SER B  2  9   ? 319.810 245.509 252.504 1.00 74.96  ? 8   SER O HB2    1 
ATOM   3932   H  HB3    . SER B  2  9   ? 319.232 244.463 253.551 1.00 74.96  ? 8   SER O HB3    1 
ATOM   3933   H  HG     . SER B  2  9   ? 317.756 244.921 251.988 1.00 79.20  ? 8   SER O HG     1 
ATOM   3934   N  N      . LEU B  2  10  ? 320.931 245.448 255.875 1.00 59.21  ? 9   LEU O N      1 
ATOM   3935   C  CA     . LEU B  2  10  ? 322.241 245.145 256.441 1.00 62.22  ? 9   LEU O CA     1 
ATOM   3936   C  C      . LEU B  2  10  ? 322.791 243.816 255.965 1.00 88.30  ? 9   LEU O C      1 
ATOM   3937   O  O      . LEU B  2  10  ? 324.008 243.599 256.040 1.00 65.42  ? 9   LEU O O      1 
ATOM   3938   C  CB     . LEU B  2  10  ? 322.166 245.130 257.965 1.00 62.36  ? 9   LEU O CB     1 
ATOM   3939   C  CG     . LEU B  2  10  ? 321.605 246.420 258.538 1.00 62.63  ? 9   LEU O CG     1 
ATOM   3940   C  CD1    . LEU B  2  10  ? 321.323 246.220 260.006 1.00 62.43  ? 9   LEU O CD1    1 
ATOM   3941   C  CD2    . LEU B  2  10  ? 322.591 247.554 258.297 1.00 66.40  ? 9   LEU O CD2    1 
ATOM   3942   H  H      . LEU B  2  10  ? 320.288 245.029 256.262 1.00 58.86  ? 9   LEU O H      1 
ATOM   3943   H  HA     . LEU B  2  10  ? 322.865 245.839 256.179 1.00 60.92  ? 9   LEU O HA     1 
ATOM   3944   H  HB2    . LEU B  2  10  ? 321.589 244.402 258.245 1.00 60.82  ? 9   LEU O HB2    1 
ATOM   3945   H  HB3    . LEU B  2  10  ? 323.058 245.004 258.324 1.00 60.82  ? 9   LEU O HB3    1 
ATOM   3946   H  HG     . LEU B  2  10  ? 320.772 246.637 258.092 1.00 61.69  ? 9   LEU O HG     1 
ATOM   3947   H  HD11   . LEU B  2  10  ? 320.965 247.044 260.373 1.00 61.30  ? 9   LEU O HD11   1 
ATOM   3948   H  HD12   . LEU B  2  10  ? 320.677 245.504 260.108 1.00 61.30  ? 9   LEU O HD12   1 
ATOM   3949   H  HD13   . LEU B  2  10  ? 322.150 245.988 260.457 1.00 61.30  ? 9   LEU O HD13   1 
ATOM   3950   H  HD21   . LEU B  2  10  ? 322.225 248.373 258.666 1.00 65.28  ? 9   LEU O HD21   1 
ATOM   3951   H  HD22   . LEU B  2  10  ? 323.430 247.340 258.733 1.00 65.28  ? 9   LEU O HD22   1 
ATOM   3952   H  HD23   . LEU B  2  10  ? 322.729 247.653 257.342 1.00 65.28  ? 9   LEU O HD23   1 
ATOM   3953   N  N      . THR B  2  11  ? 321.921 242.917 255.515 1.00 124.06 ? 10  THR O N      1 
ATOM   3954   C  CA     . THR B  2  11  ? 322.357 241.814 254.679 1.00 117.80 ? 10  THR O CA     1 
ATOM   3955   C  C      . THR B  2  11  ? 322.613 242.350 253.283 1.00 110.31 ? 10  THR O C      1 
ATOM   3956   O  O      . THR B  2  11  ? 321.833 243.141 252.750 1.00 109.84 ? 10  THR O O      1 
ATOM   3957   C  CB     . THR B  2  11  ? 321.305 240.712 254.625 1.00 123.49 ? 10  THR O CB     1 
ATOM   3958   O  OG1    . THR B  2  11  ? 320.901 240.356 255.953 1.00 126.61 ? 10  THR O OG1    1 
ATOM   3959   C  CG2    . THR B  2  11  ? 321.861 239.486 253.917 1.00 127.48 ? 10  THR O CG2    1 
ATOM   3960   H  H      . THR B  2  11  ? 321.077 242.927 255.681 1.00 106.74 ? 10  THR O H      1 
ATOM   3961   H  HA     . THR B  2  11  ? 323.182 241.442 255.028 1.00 100.02 ? 10  THR O HA     1 
ATOM   3962   H  HB     . THR B  2  11  ? 320.533 241.028 254.129 1.00 105.98 ? 10  THR O HB     1 
ATOM   3963   H  HG1    . THR B  2  11  ? 320.322 239.749 255.924 1.00 108.98 ? 10  THR O HG1    1 
ATOM   3964   H  HG21   . THR B  2  11  ? 321.188 238.788 253.885 1.00 109.38 ? 10  THR O HG21   1 
ATOM   3965   H  HG22   . THR B  2  11  ? 322.119 239.716 253.011 1.00 109.38 ? 10  THR O HG22   1 
ATOM   3966   H  HG23   . THR B  2  11  ? 322.639 239.153 254.392 1.00 109.38 ? 10  THR O HG23   1 
ATOM   3967   N  N      . THR B  2  12  ? 323.721 241.930 252.697 1.00 89.76  ? 11  THR O N      1 
ATOM   3968   C  CA     . THR B  2  12  ? 324.117 242.491 251.421 1.00 92.32  ? 11  THR O CA     1 
ATOM   3969   C  C      . THR B  2  12  ? 325.126 241.546 250.793 1.00 113.56 ? 11  THR O C      1 
ATOM   3970   O  O      . THR B  2  12  ? 325.827 240.816 251.497 1.00 148.54 ? 11  THR O O      1 
ATOM   3971   C  CB     . THR B  2  12  ? 324.692 243.901 251.607 1.00 98.67  ? 11  THR O CB     1 
ATOM   3972   O  OG1    . THR B  2  12  ? 325.200 244.393 250.362 1.00 107.85 ? 11  THR O OG1    1 
ATOM   3973   C  CG2    . THR B  2  12  ? 325.800 243.895 252.652 1.00 101.30 ? 11  THR O CG2    1 
ATOM   3974   H  H      . THR B  2  12  ? 324.252 241.331 253.011 1.00 79.11  ? 11  THR O H      1 
ATOM   3975   H  HA     . THR B  2  12  ? 323.344 242.548 250.838 1.00 81.82  ? 11  THR O HA     1 
ATOM   3976   H  HB     . THR B  2  12  ? 323.989 244.492 251.918 1.00 88.24  ? 11  THR O HB     1 
ATOM   3977   H  HG1    . THR B  2  12  ? 325.514 245.165 250.465 1.00 97.45  ? 11  THR O HG1    1 
ATOM   3978   H  HG21   . THR B  2  12  ? 326.156 244.791 252.762 1.00 90.03  ? 11  THR O HG21   1 
ATOM   3979   H  HG22   . THR B  2  12  ? 325.450 243.589 253.503 1.00 90.03  ? 11  THR O HG22   1 
ATOM   3980   H  HG23   . THR B  2  12  ? 326.515 243.303 252.373 1.00 90.03  ? 11  THR O HG23   1 
ATOM   3981   N  N      . PHE B  2  13  ? 325.172 241.543 249.467 1.00 61.37  ? 12  PHE O N      1 
ATOM   3982   C  CA     . PHE B  2  13  ? 326.090 240.657 248.775 1.00 64.16  ? 12  PHE O CA     1 
ATOM   3983   C  C      . PHE B  2  13  ? 327.534 241.112 248.940 1.00 68.81  ? 12  PHE O C      1 
ATOM   3984   O  O      . PHE B  2  13  ? 327.824 242.299 249.115 1.00 70.35  ? 12  PHE O O      1 
ATOM   3985   C  CB     . PHE B  2  13  ? 325.761 240.595 247.291 1.00 64.45  ? 12  PHE O CB     1 
ATOM   3986   C  CG     . PHE B  2  13  ? 324.518 239.834 246.971 1.00 60.69  ? 12  PHE O CG     1 
ATOM   3987   C  CD1    . PHE B  2  13  ? 324.543 238.454 246.845 1.00 60.36  ? 12  PHE O CD1    1 
ATOM   3988   C  CD2    . PHE B  2  13  ? 323.326 240.498 246.771 1.00 57.87  ? 12  PHE O CD2    1 
ATOM   3989   C  CE1    . PHE B  2  13  ? 323.401 237.751 246.535 1.00 57.22  ? 12  PHE O CE1    1 
ATOM   3990   C  CE2    . PHE B  2  13  ? 322.180 239.803 246.458 1.00 54.72  ? 12  PHE O CE2    1 
ATOM   3991   C  CZ     . PHE B  2  13  ? 322.218 238.423 246.339 1.00 54.40  ? 12  PHE O CZ     1 
ATOM   3992   H  H      . PHE B  2  13  ? 324.689 242.036 248.954 1.00 66.52  ? 12  PHE O H      1 
ATOM   3993   H  HA     . PHE B  2  13  ? 326.009 239.763 249.142 1.00 68.56  ? 12  PHE O HA     1 
ATOM   3994   H  HB2    . PHE B  2  13  ? 325.647 241.500 246.960 1.00 69.24  ? 12  PHE O HB2    1 
ATOM   3995   H  HB3    . PHE B  2  13  ? 326.497 240.167 246.827 1.00 69.24  ? 12  PHE O HB3    1 
ATOM   3996   H  HD1    . PHE B  2  13  ? 325.343 237.996 246.973 1.00 65.25  ? 12  PHE O HD1    1 
ATOM   3997   H  HD2    . PHE B  2  13  ? 323.297 241.425 246.847 1.00 64.18  ? 12  PHE O HD2    1 
ATOM   3998   H  HE1    . PHE B  2  13  ? 323.430 236.825 246.457 1.00 62.63  ? 12  PHE O HE1    1 
ATOM   3999   H  HE2    . PHE B  2  13  ? 321.379 240.259 246.329 1.00 61.55  ? 12  PHE O HE2    1 
ATOM   4000   H  HZ     . PHE B  2  13  ? 321.443 237.952 246.133 1.00 60.77  ? 12  PHE O HZ     1 
ATOM   4001   N  N      . SER B  2  14  ? 328.441 240.148 248.867 1.00 103.03 ? 13  SER O N      1 
ATOM   4002   C  CA     . SER B  2  14  ? 329.867 240.392 248.761 1.00 108.78 ? 13  SER O CA     1 
ATOM   4003   C  C      . SER B  2  14  ? 330.357 239.993 247.376 1.00 109.10 ? 13  SER O C      1 
ATOM   4004   O  O      . SER B  2  14  ? 329.699 239.224 246.667 1.00 112.83 ? 13  SER O O      1 
ATOM   4005   C  CB     . SER B  2  14  ? 330.631 239.595 249.822 1.00 122.62 ? 13  SER O CB     1 
ATOM   4006   O  OG     . SER B  2  14  ? 330.453 238.205 249.616 1.00 136.46 ? 13  SER O OG     1 
ATOM   4007   H  H      . SER B  2  14  ? 328.244 239.311 248.878 1.00 87.94  ? 13  SER O H      1 
ATOM   4008   H  HA     . SER B  2  14  ? 330.047 241.336 248.893 1.00 92.88  ? 13  SER O HA     1 
ATOM   4009   H  HB2    . SER B  2  14  ? 331.576 239.806 249.760 1.00 105.81 ? 13  SER O HB2    1 
ATOM   4010   H  HB3    . SER B  2  14  ? 330.294 239.831 250.701 1.00 105.81 ? 13  SER O HB3    1 
ATOM   4011   H  HG     . SER B  2  14  ? 330.873 237.771 250.200 1.00 119.31 ? 13  SER O HG     1 
ATOM   4012   N  N      . PRO B  2  15  ? 331.531 240.480 246.962 1.00 68.18  ? 14  PRO O N      1 
ATOM   4013   C  CA     . PRO B  2  15  ? 331.975 240.270 245.576 1.00 71.38  ? 14  PRO O CA     1 
ATOM   4014   C  C      . PRO B  2  15  ? 332.013 238.814 245.146 1.00 71.66  ? 14  PRO O C      1 
ATOM   4015   O  O      . PRO B  2  15  ? 332.023 238.508 243.947 1.00 73.65  ? 14  PRO O O      1 
ATOM   4016   C  CB     . PRO B  2  15  ? 333.377 240.893 245.568 1.00 77.01  ? 14  PRO O CB     1 
ATOM   4017   C  CG     . PRO B  2  15  ? 333.346 241.906 246.655 1.00 76.07  ? 14  PRO O CG     1 
ATOM   4018   C  CD     . PRO B  2  15  ? 332.493 241.295 247.727 1.00 71.33  ? 14  PRO O CD     1 
ATOM   4019   H  HA     . PRO B  2  15  ? 331.406 240.765 244.966 1.00 88.36  ? 14  PRO O HA     1 
ATOM   4020   H  HB2    . PRO B  2  15  ? 334.040 240.210 245.753 1.00 93.28  ? 14  PRO O HB2    1 
ATOM   4021   H  HB3    . PRO B  2  15  ? 333.544 241.313 244.710 1.00 93.28  ? 14  PRO O HB3    1 
ATOM   4022   H  HG2    . PRO B  2  15  ? 334.246 242.064 246.980 1.00 92.58  ? 14  PRO O HG2    1 
ATOM   4023   H  HG3    . PRO B  2  15  ? 332.949 242.728 246.326 1.00 92.58  ? 14  PRO O HG3    1 
ATOM   4024   H  HD2    . PRO B  2  15  ? 333.029 240.732 248.307 1.00 88.06  ? 14  PRO O HD2    1 
ATOM   4025   H  HD3    . PRO B  2  15  ? 332.031 241.986 248.227 1.00 88.06  ? 14  PRO O HD3    1 
ATOM   4026   N  N      . SER B  2  16  ? 332.031 237.901 246.108 1.00 98.92  ? 15  SER O N      1 
ATOM   4027   C  CA     . SER B  2  16  ? 332.073 236.483 245.784 1.00 96.90  ? 15  SER O CA     1 
ATOM   4028   C  C      . SER B  2  16  ? 330.688 235.928 245.489 1.00 92.25  ? 15  SER O C      1 
ATOM   4029   O  O      . SER B  2  16  ? 330.546 235.057 244.619 1.00 92.82  ? 15  SER O O      1 
ATOM   4030   C  CB     . SER B  2  16  ? 332.703 235.703 246.931 1.00 104.40 ? 15  SER O CB     1 
ATOM   4031   O  OG     . SER B  2  16  ? 331.813 235.642 248.028 1.00 93.38  ? 15  SER O OG     1 
ATOM   4032   H  H      . SER B  2  16  ? 332.021 238.074 246.950 1.00 99.01  ? 15  SER O H      1 
ATOM   4033   H  HA     . SER B  2  16  ? 332.623 236.354 244.995 1.00 96.50  ? 15  SER O HA     1 
ATOM   4034   H  HB2    . SER B  2  16  ? 332.901 234.802 246.632 1.00 103.15 ? 15  SER O HB2    1 
ATOM   4035   H  HB3    . SER B  2  16  ? 333.519 236.149 247.209 1.00 103.15 ? 15  SER O HB3    1 
ATOM   4036   H  HG     . SER B  2  16  ? 331.632 236.418 248.294 1.00 92.56  ? 15  SER O HG     1 
ATOM   4037   N  N      . GLY B  2  17  ? 329.667 236.410 246.194 1.00 100.24 ? 16  GLY O N      1 
ATOM   4038   C  CA     . GLY B  2  17  ? 328.324 235.889 246.033 1.00 96.83  ? 16  GLY O CA     1 
ATOM   4039   C  C      . GLY B  2  17  ? 327.727 235.318 247.302 1.00 95.94  ? 16  GLY O C      1 
ATOM   4040   O  O      . GLY B  2  17  ? 326.772 234.541 247.244 1.00 92.19  ? 16  GLY O O      1 
ATOM   4041   H  H      . GLY B  2  17  ? 329.731 237.043 246.773 1.00 89.98  ? 16  GLY O H      1 
ATOM   4042   H  HA2    . GLY B  2  17  ? 327.743 236.599 245.719 1.00 87.28  ? 16  GLY O HA2    1 
ATOM   4043   H  HA3    . GLY B  2  17  ? 328.334 235.188 245.363 1.00 87.28  ? 16  GLY O HA3    1 
ATOM   4044   N  N      . LYS B  2  18  ? 328.276 235.679 248.452 1.00 133.09 ? 17  LYS O N      1 
ATOM   4045   C  CA     . LYS B  2  18  ? 327.723 235.253 249.728 1.00 135.99 ? 17  LYS O CA     1 
ATOM   4046   C  C      . LYS B  2  18  ? 326.864 236.367 250.316 1.00 133.41 ? 17  LYS O C      1 
ATOM   4047   O  O      . LYS B  2  18  ? 327.016 237.543 249.975 1.00 140.85 ? 17  LYS O O      1 
ATOM   4048   C  CB     . LYS B  2  18  ? 328.843 234.868 250.702 1.00 145.29 ? 17  LYS O CB     1 
ATOM   4049   C  CG     . LYS B  2  18  ? 329.870 233.876 250.130 1.00 158.28 ? 17  LYS O CG     1 
ATOM   4050   C  CD     . LYS B  2  18  ? 329.202 232.616 249.568 1.00 168.01 ? 17  LYS O CD     1 
ATOM   4051   C  CE     . LYS B  2  18  ? 330.194 231.662 248.899 1.00 178.65 ? 17  LYS O CE     1 
ATOM   4052   N  NZ     . LYS B  2  18  ? 329.534 230.416 248.395 1.00 183.56 ? 17  LYS O NZ     1 
ATOM   4053   H  H      . LYS B  2  18  ? 328.975 236.174 248.522 1.00 103.25 ? 17  LYS O H      1 
ATOM   4054   H  HA     . LYS B  2  18  ? 327.159 234.476 249.589 1.00 106.16 ? 17  LYS O HA     1 
ATOM   4055   H  HB2    . LYS B  2  18  ? 329.322 235.672 250.959 1.00 114.46 ? 17  LYS O HB2    1 
ATOM   4056   H  HB3    . LYS B  2  18  ? 328.445 234.459 251.487 1.00 114.46 ? 17  LYS O HB3    1 
ATOM   4057   H  HG2    . LYS B  2  18  ? 330.359 234.305 249.410 1.00 126.51 ? 17  LYS O HG2    1 
ATOM   4058   H  HG3    . LYS B  2  18  ? 330.479 233.607 250.835 1.00 126.51 ? 17  LYS O HG3    1 
ATOM   4059   H  HD2    . LYS B  2  18  ? 328.770 232.138 250.294 1.00 136.30 ? 17  LYS O HD2    1 
ATOM   4060   H  HD3    . LYS B  2  18  ? 328.543 232.877 248.905 1.00 136.30 ? 17  LYS O HD3    1 
ATOM   4061   H  HE2    . LYS B  2  18  ? 330.605 232.111 248.144 1.00 146.03 ? 17  LYS O HE2    1 
ATOM   4062   H  HE3    . LYS B  2  18  ? 330.871 231.405 249.543 1.00 146.03 ? 17  LYS O HE3    1 
ATOM   4063   H  HZ1    . LYS B  2  18  ? 330.137 229.886 248.013 1.00 150.98 ? 17  LYS O HZ1    1 
ATOM   4064   H  HZ2    . LYS B  2  18  ? 329.152 229.980 249.070 1.00 150.98 ? 17  LYS O HZ2    1 
ATOM   4065   H  HZ3    . LYS B  2  18  ? 328.910 230.624 247.795 1.00 150.98 ? 17  LYS O HZ3    1 
ATOM   4066   N  N      . LEU B  2  19  ? 325.927 235.978 251.183 1.00 102.69 ? 18  LEU O N      1 
ATOM   4067   C  CA     . LEU B  2  19  ? 325.197 236.939 252.014 1.00 97.25  ? 18  LEU O CA     1 
ATOM   4068   C  C      . LEU B  2  19  ? 325.790 236.841 253.414 1.00 94.70  ? 18  LEU O C      1 
ATOM   4069   O  O      . LEU B  2  19  ? 325.226 236.254 254.339 1.00 98.53  ? 18  LEU O O      1 
ATOM   4070   C  CB     . LEU B  2  19  ? 323.693 236.683 251.981 1.00 92.43  ? 18  LEU O CB     1 
ATOM   4071   C  CG     . LEU B  2  19  ? 322.985 237.033 250.662 1.00 95.85  ? 18  LEU O CG     1 
ATOM   4072   C  CD1    . LEU B  2  19  ? 321.473 236.867 250.809 1.00 91.10  ? 18  LEU O CD1    1 
ATOM   4073   C  CD2    . LEU B  2  19  ? 323.322 238.447 250.167 1.00 109.04 ? 18  LEU O CD2    1 
ATOM   4074   H  H      . LEU B  2  19  ? 325.694 235.160 251.310 1.00 93.60  ? 18  LEU O H      1 
ATOM   4075   H  HA     . LEU B  2  19  ? 325.358 237.835 251.680 1.00 88.81  ? 18  LEU O HA     1 
ATOM   4076   H  HB2    . LEU B  2  19  ? 323.539 235.740 252.151 1.00 84.83  ? 18  LEU O HB2    1 
ATOM   4077   H  HB3    . LEU B  2  19  ? 323.277 237.209 252.682 1.00 84.83  ? 18  LEU O HB3    1 
ATOM   4078   H  HG     . LEU B  2  19  ? 323.280 236.409 249.981 1.00 89.01  ? 18  LEU O HG     1 
ATOM   4079   H  HD11   . LEU B  2  19  ? 321.047 237.092 249.967 1.00 85.09  ? 18  LEU O HD11   1 
ATOM   4080   H  HD12   . LEU B  2  19  ? 321.279 235.945 251.042 1.00 85.09  ? 18  LEU O HD12   1 
ATOM   4081   H  HD13   . LEU B  2  19  ? 321.157 237.459 251.509 1.00 85.09  ? 18  LEU O HD13   1 
ATOM   4082   H  HD21   . LEU B  2  19  ? 322.850 238.612 249.336 1.00 102.55 ? 18  LEU O HD21   1 
ATOM   4083   H  HD22   . LEU B  2  19  ? 323.046 239.091 250.838 1.00 102.55 ? 18  LEU O HD22   1 
ATOM   4084   H  HD23   . LEU B  2  19  ? 324.279 238.510 250.022 1.00 102.55 ? 18  LEU O HD23   1 
ATOM   4085   N  N      . VAL B  2  20  ? 326.954 237.473 253.544 1.00 84.78  ? 19  VAL O N      1 
ATOM   4086   C  CA     . VAL B  2  20  ? 327.866 237.365 254.680 1.00 85.49  ? 19  VAL O CA     1 
ATOM   4087   C  C      . VAL B  2  20  ? 327.119 237.246 256.000 1.00 109.58 ? 19  VAL O C      1 
ATOM   4088   O  O      . VAL B  2  20  ? 327.552 236.519 256.900 1.00 118.28 ? 19  VAL O O      1 
ATOM   4089   C  CB     . VAL B  2  20  ? 328.823 238.568 254.714 1.00 87.80  ? 19  VAL O CB     1 
ATOM   4090   C  CG1    . VAL B  2  20  ? 329.494 238.760 253.348 1.00 95.26  ? 19  VAL O CG1    1 
ATOM   4091   C  CG2    . VAL B  2  20  ? 328.091 239.839 255.141 1.00 86.36  ? 19  VAL O CG2    1 
ATOM   4092   H  H      . VAL B  2  20  ? 327.256 238.007 252.941 1.00 71.49  ? 19  VAL O H      1 
ATOM   4093   H  HA     . VAL B  2  20  ? 328.402 236.564 254.573 1.00 71.40  ? 19  VAL O HA     1 
ATOM   4094   H  HB     . VAL B  2  20  ? 329.520 238.395 255.366 1.00 73.52  ? 19  VAL O HB     1 
ATOM   4095   H  HG11   . VAL B  2  20  ? 330.091 239.523 253.395 1.00 80.85  ? 19  VAL O HG11   1 
ATOM   4096   H  HG12   . VAL B  2  20  ? 329.996 237.959 253.129 1.00 80.85  ? 19  VAL O HG12   1 
ATOM   4097   H  HG13   . VAL B  2  20  ? 328.809 238.916 252.680 1.00 80.85  ? 19  VAL O HG13   1 
ATOM   4098   H  HG21   . VAL B  2  20  ? 328.721 240.576 255.152 1.00 72.91  ? 19  VAL O HG21   1 
ATOM   4099   H  HG22   . VAL B  2  20  ? 327.379 240.020 254.507 1.00 72.91  ? 19  VAL O HG22   1 
ATOM   4100   H  HG23   . VAL B  2  20  ? 327.720 239.706 256.027 1.00 72.91  ? 19  VAL O HG23   1 
ATOM   4101   N  N      . GLN B  2  21  ? 326.010 237.977 256.141 1.00 90.56  ? 20  GLN O N      1 
ATOM   4102   C  CA     . GLN B  2  21  ? 325.290 237.942 257.407 1.00 58.47  ? 20  GLN O CA     1 
ATOM   4103   C  C      . GLN B  2  21  ? 324.653 236.580 257.635 1.00 56.43  ? 20  GLN O C      1 
ATOM   4104   O  O      . GLN B  2  21  ? 324.731 236.030 258.740 1.00 64.09  ? 20  GLN O O      1 
ATOM   4105   C  CB     . GLN B  2  21  ? 324.232 239.042 257.456 1.00 55.83  ? 20  GLN O CB     1 
ATOM   4106   C  CG     . GLN B  2  21  ? 324.782 240.421 257.808 1.00 58.11  ? 20  GLN O CG     1 
ATOM   4107   C  CD     . GLN B  2  21  ? 325.581 240.432 259.106 1.00 60.87  ? 20  GLN O CD     1 
ATOM   4108   O  OE1    . GLN B  2  21  ? 325.089 240.031 260.166 1.00 59.79  ? 20  GLN O OE1    1 
ATOM   4109   N  NE2    . GLN B  2  21  ? 326.826 240.892 259.021 1.00 92.41  ? 20  GLN O NE2    1 
ATOM   4110   H  H      . GLN B  2  21  ? 325.666 238.485 255.538 1.00 92.10  ? 20  GLN O H      1 
ATOM   4111   H  HA     . GLN B  2  21  ? 325.918 238.101 258.129 1.00 60.20  ? 20  GLN O HA     1 
ATOM   4112   H  HB2    . GLN B  2  21  ? 323.809 239.106 256.586 1.00 58.57  ? 20  GLN O HB2    1 
ATOM   4113   H  HB3    . GLN B  2  21  ? 323.571 238.807 258.126 1.00 58.57  ? 20  GLN O HB3    1 
ATOM   4114   H  HG2    . GLN B  2  21  ? 325.368 240.718 257.095 1.00 60.91  ? 20  GLN O HG2    1 
ATOM   4115   H  HG3    . GLN B  2  21  ? 324.042 241.039 257.907 1.00 60.91  ? 20  GLN O HG3    1 
ATOM   4116   H  HE21   . GLN B  2  21  ? 327.135 241.160 258.265 1.00 93.90  ? 20  GLN O HE21   1 
ATOM   4117   H  HE22   . GLN B  2  21  ? 327.322 240.922 259.723 1.00 93.90  ? 20  GLN O HE22   1 
ATOM   4118   N  N      . ILE B  2  22  ? 324.033 236.008 256.607 1.00 57.61  ? 21  ILE O N      1 
ATOM   4119   C  CA     . ILE B  2  22  ? 323.444 234.692 256.791 1.00 56.03  ? 21  ILE O CA     1 
ATOM   4120   C  C      . ILE B  2  22  ? 324.540 233.649 256.983 1.00 71.23  ? 21  ILE O C      1 
ATOM   4121   O  O      . ILE B  2  22  ? 324.316 232.613 257.617 1.00 89.28  ? 21  ILE O O      1 
ATOM   4122   C  CB     . ILE B  2  22  ? 322.513 234.342 255.619 1.00 53.58  ? 21  ILE O CB     1 
ATOM   4123   C  CG1    . ILE B  2  22  ? 321.412 235.401 255.498 1.00 61.60  ? 21  ILE O CG1    1 
ATOM   4124   C  CG2    . ILE B  2  22  ? 321.897 232.978 255.854 1.00 52.23  ? 21  ILE O CG2    1 
ATOM   4125   C  CD1    . ILE B  2  22  ? 320.470 235.216 254.311 1.00 74.99  ? 21  ILE O CD1    1 
ATOM   4126   H  H      . ILE B  2  22  ? 323.942 236.348 255.822 1.00 58.31  ? 21  ILE O H      1 
ATOM   4127   H  HA     . ILE B  2  22  ? 322.907 234.704 257.599 1.00 56.59  ? 21  ILE O HA     1 
ATOM   4128   H  HB     . ILE B  2  22  ? 323.029 234.322 254.798 1.00 54.80  ? 21  ILE O HB     1 
ATOM   4129   H  HG12   . ILE B  2  22  ? 320.874 235.381 256.304 1.00 63.87  ? 21  ILE O HG12   1 
ATOM   4130   H  HG13   . ILE B  2  22  ? 321.829 236.272 255.407 1.00 63.87  ? 21  ILE O HG13   1 
ATOM   4131   H  HG21   . ILE B  2  22  ? 321.311 232.765 255.110 1.00 53.29  ? 21  ILE O HG21   1 
ATOM   4132   H  HG22   . ILE B  2  22  ? 322.605 232.319 255.917 1.00 53.29  ? 21  ILE O HG22   1 
ATOM   4133   H  HG23   . ILE B  2  22  ? 321.389 233.000 256.680 1.00 53.29  ? 21  ILE O HG23   1 
ATOM   4134   H  HD11   . ILE B  2  22  ? 319.811 235.928 254.316 1.00 77.97  ? 21  ILE O HD11   1 
ATOM   4135   H  HD12   . ILE B  2  22  ? 320.986 235.249 253.490 1.00 77.97  ? 21  ILE O HD12   1 
ATOM   4136   H  HD13   . ILE B  2  22  ? 320.028 234.356 254.390 1.00 77.97  ? 21  ILE O HD13   1 
ATOM   4137   N  N      . GLU B  2  23  ? 325.737 233.897 256.454 1.00 88.40  ? 22  GLU O N      1 
ATOM   4138   C  CA     . GLU B  2  23  ? 326.842 232.980 256.699 1.00 110.33 ? 22  GLU O CA     1 
ATOM   4139   C  C      . GLU B  2  23  ? 327.194 232.942 258.176 1.00 90.08  ? 22  GLU O C      1 
ATOM   4140   O  O      . GLU B  2  23  ? 327.380 231.866 258.756 1.00 90.25  ? 22  GLU O O      1 
ATOM   4141   C  CB     . GLU B  2  23  ? 328.064 233.382 255.866 1.00 139.49 ? 22  GLU O CB     1 
ATOM   4142   C  CG     . GLU B  2  23  ? 327.916 233.094 254.388 1.00 166.15 ? 22  GLU O CG     1 
ATOM   4143   C  CD     . GLU B  2  23  ? 327.456 231.668 254.128 1.00 168.54 ? 22  GLU O CD     1 
ATOM   4144   O  OE1    . GLU B  2  23  ? 328.243 230.731 254.389 1.00 150.46 ? 22  GLU O OE1    1 
ATOM   4145   O  OE2    . GLU B  2  23  ? 326.298 231.491 253.688 1.00 185.07 ? 22  GLU O OE2    1 
ATOM   4146   H  H      . GLU B  2  23  ? 325.931 234.574 255.960 1.00 87.88  ? 22  GLU O H      1 
ATOM   4147   H  HA     . GLU B  2  23  ? 326.576 232.087 256.431 1.00 108.74 ? 22  GLU O HA     1 
ATOM   4148   H  HB2    . GLU B  2  23  ? 328.213 234.335 255.969 1.00 137.43 ? 22  GLU O HB2    1 
ATOM   4149   H  HB3    . GLU B  2  23  ? 328.837 232.892 256.188 1.00 137.43 ? 22  GLU O HB3    1 
ATOM   4150   H  HG2    . GLU B  2  23  ? 327.258 233.697 254.010 1.00 164.34 ? 22  GLU O HG2    1 
ATOM   4151   H  HG3    . GLU B  2  23  ? 328.773 233.219 253.952 1.00 164.34 ? 22  GLU O HG3    1 
ATOM   4152   N  N      . TYR B  2  24  ? 327.276 234.116 258.805 1.00 67.77  ? 23  TYR O N      1 
ATOM   4153   C  CA     . TYR B  2  24  ? 327.621 234.189 260.219 1.00 69.25  ? 23  TYR O CA     1 
ATOM   4154   C  C      . TYR B  2  24  ? 326.498 233.655 261.102 1.00 88.97  ? 23  TYR O C      1 
ATOM   4155   O  O      . TYR B  2  24  ? 326.757 233.049 262.149 1.00 97.78  ? 23  TYR O O      1 
ATOM   4156   C  CB     . TYR B  2  24  ? 327.938 235.628 260.608 1.00 70.29  ? 23  TYR O CB     1 
ATOM   4157   C  CG     . TYR B  2  24  ? 328.977 236.314 259.762 1.00 73.35  ? 23  TYR O CG     1 
ATOM   4158   C  CD1    . TYR B  2  24  ? 329.998 235.607 259.142 1.00 76.53  ? 23  TYR O CD1    1 
ATOM   4159   C  CD2    . TYR B  2  24  ? 328.931 237.686 259.591 1.00 102.18 ? 23  TYR O CD2    1 
ATOM   4160   C  CE1    . TYR B  2  24  ? 330.946 236.259 258.376 1.00 79.67  ? 23  TYR O CE1    1 
ATOM   4161   C  CE2    . TYR B  2  24  ? 329.860 238.342 258.831 1.00 96.02  ? 23  TYR O CE2    1 
ATOM   4162   C  CZ     . TYR B  2  24  ? 330.865 237.632 258.227 1.00 97.06  ? 23  TYR O CZ     1 
ATOM   4163   O  OH     . TYR B  2  24  ? 331.782 238.323 257.478 1.00 100.17 ? 23  TYR O OH     1 
ATOM   4164   H  H      . TYR B  2  24  ? 327.137 234.880 258.434 1.00 63.36  ? 23  TYR O H      1 
ATOM   4165   H  HA     . TYR B  2  24  ? 328.412 233.652 260.381 1.00 64.37  ? 23  TYR O HA     1 
ATOM   4166   H  HB2    . TYR B  2  24  ? 327.122 236.149 260.545 1.00 65.66  ? 23  TYR O HB2    1 
ATOM   4167   H  HB3    . TYR B  2  24  ? 328.257 235.635 261.524 1.00 65.66  ? 23  TYR O HB3    1 
ATOM   4168   H  HD1    . TYR B  2  24  ? 330.048 234.685 259.247 1.00 70.89  ? 23  TYR O HD1    1 
ATOM   4169   H  HD2    . TYR B  2  24  ? 328.253 238.173 260.000 1.00 97.88  ? 23  TYR O HD2    1 
ATOM   4170   H  HE1    . TYR B  2  24  ? 331.628 235.780 257.963 1.00 73.81  ? 23  TYR O HE1    1 
ATOM   4171   H  HE2    . TYR B  2  24  ? 329.813 239.265 258.730 1.00 91.51  ? 23  TYR O HE2    1 
ATOM   4172   H  HH     . TYR B  2  24  ? 331.599 239.143 257.484 1.00 94.68  ? 23  TYR O HH     1 
ATOM   4173   N  N      . ALA B  2  25  ? 325.240 233.898 260.724 1.00 80.43  ? 24  ALA O N      1 
ATOM   4174   C  CA     . ALA B  2  25  ? 324.133 233.387 261.529 1.00 71.93  ? 24  ALA O CA     1 
ATOM   4175   C  C      . ALA B  2  25  ? 324.234 231.874 261.677 1.00 82.67  ? 24  ALA O C      1 
ATOM   4176   O  O      . ALA B  2  25  ? 323.968 231.326 262.753 1.00 103.50 ? 24  ALA O O      1 
ATOM   4177   C  CB     . ALA B  2  25  ? 322.794 233.772 260.902 1.00 66.71  ? 24  ALA O CB     1 
ATOM   4178   H  H      . ALA B  2  25  ? 325.008 234.342 260.025 1.00 72.62  ? 24  ALA O H      1 
ATOM   4179   H  HA     . ALA B  2  25  ? 324.176 233.781 262.414 1.00 64.43  ? 24  ALA O HA     1 
ATOM   4180   H  HB1    . ALA B  2  25  ? 322.076 233.423 261.453 1.00 60.29  ? 24  ALA O HB1    1 
ATOM   4181   H  HB2    . ALA B  2  25  ? 322.735 234.739 260.854 1.00 60.29  ? 24  ALA O HB2    1 
ATOM   4182   H  HB3    . ALA B  2  25  ? 322.742 233.393 260.011 1.00 60.29  ? 24  ALA O HB3    1 
ATOM   4183   N  N      . LEU B  2  26  ? 324.635 231.189 260.607 1.00 69.54  ? 25  LEU O N      1 
ATOM   4184   C  CA     . LEU B  2  26  ? 324.809 229.747 260.662 1.00 66.95  ? 25  LEU O CA     1 
ATOM   4185   C  C      . LEU B  2  26  ? 325.859 229.342 261.692 1.00 80.92  ? 25  LEU O C      1 
ATOM   4186   O  O      . LEU B  2  26  ? 325.703 228.324 262.379 1.00 103.02 ? 25  LEU O O      1 
ATOM   4187   C  CB     . LEU B  2  26  ? 325.181 229.239 259.271 1.00 74.55  ? 25  LEU O CB     1 
ATOM   4188   C  CG     . LEU B  2  26  ? 324.021 229.416 258.293 1.00 86.36  ? 25  LEU O CG     1 
ATOM   4189   C  CD1    . LEU B  2  26  ? 324.503 229.275 256.859 1.00 112.29 ? 25  LEU O CD1    1 
ATOM   4190   C  CD2    . LEU B  2  26  ? 322.908 228.421 258.613 1.00 64.59  ? 25  LEU O CD2    1 
ATOM   4191   H  H      . LEU B  2  26  ? 324.812 231.538 259.841 1.00 66.74  ? 25  LEU O H      1 
ATOM   4192   H  HA     . LEU B  2  26  ? 323.967 229.337 260.916 1.00 63.48  ? 25  LEU O HA     1 
ATOM   4193   H  HB2    . LEU B  2  26  ? 325.941 229.741 258.938 1.00 70.95  ? 25  LEU O HB2    1 
ATOM   4194   H  HB3    . LEU B  2  26  ? 325.397 228.294 259.320 1.00 70.95  ? 25  LEU O HB3    1 
ATOM   4195   H  HG     . LEU B  2  26  ? 323.659 230.310 258.396 1.00 83.75  ? 25  LEU O HG     1 
ATOM   4196   H  HD11   . LEU B  2  26  ? 323.749 229.392 256.260 1.00 109.61 ? 25  LEU O HD11   1 
ATOM   4197   H  HD12   . LEU B  2  26  ? 325.174 229.953 256.683 1.00 109.61 ? 25  LEU O HD12   1 
ATOM   4198   H  HD13   . LEU B  2  26  ? 324.887 228.392 256.741 1.00 109.61 ? 25  LEU O HD13   1 
ATOM   4199   H  HD21   . LEU B  2  26  ? 322.181 228.548 257.983 1.00 62.22  ? 25  LEU O HD21   1 
ATOM   4200   H  HD22   . LEU B  2  26  ? 323.259 227.520 258.537 1.00 62.22  ? 25  LEU O HD22   1 
ATOM   4201   H  HD23   . LEU B  2  26  ? 322.594 228.579 259.517 1.00 62.22  ? 25  LEU O HD23   1 
ATOM   4202   N  N      . ALA B  2  27  ? 326.934 230.119 261.817 1.00 77.41  ? 26  ALA O N      1 
ATOM   4203   C  CA     . ALA B  2  27  ? 327.968 229.800 262.795 1.00 87.57  ? 26  ALA O CA     1 
ATOM   4204   C  C      . ALA B  2  27  ? 327.504 230.045 264.223 1.00 94.83  ? 26  ALA O C      1 
ATOM   4205   O  O      . ALA B  2  27  ? 328.061 229.452 265.150 1.00 108.95 ? 26  ALA O O      1 
ATOM   4206   C  CB     . ALA B  2  27  ? 329.236 230.609 262.523 1.00 92.80  ? 26  ALA O CB     1 
ATOM   4207   H  H      . ALA B  2  27  ? 327.086 230.828 261.354 1.00 73.51  ? 26  ALA O H      1 
ATOM   4208   H  HA     . ALA B  2  27  ? 328.193 228.860 262.715 1.00 82.67  ? 26  ALA O HA     1 
ATOM   4209   H  HB1    . ALA B  2  27  ? 329.906 230.378 263.185 1.00 87.48  ? 26  ALA O HB1    1 
ATOM   4210   H  HB2    . ALA B  2  27  ? 329.562 230.395 261.634 1.00 87.48  ? 26  ALA O HB2    1 
ATOM   4211   H  HB3    . ALA B  2  27  ? 329.026 231.554 262.579 1.00 87.48  ? 26  ALA O HB3    1 
ATOM   4212   N  N      . ALA B  2  28  ? 326.514 230.913 264.425 1.00 94.43  ? 27  ALA O N      1 
ATOM   4213   C  CA     . ALA B  2  28  ? 325.894 231.021 265.740 1.00 105.01 ? 27  ALA O CA     1 
ATOM   4214   C  C      . ALA B  2  28  ? 325.104 229.757 266.052 1.00 91.51  ? 27  ALA O C      1 
ATOM   4215   O  O      . ALA B  2  28  ? 325.243 229.171 267.128 1.00 98.17  ? 27  ALA O O      1 
ATOM   4216   C  CB     . ALA B  2  28  ? 324.986 232.247 265.795 1.00 110.31 ? 27  ALA O CB     1 
ATOM   4217   H  H      . ALA B  2  28  ? 326.190 231.442 263.829 1.00 84.25  ? 27  ALA O H      1 
ATOM   4218   H  HA     . ALA B  2  28  ? 326.585 231.122 266.413 1.00 94.95  ? 27  ALA O HA     1 
ATOM   4219   H  HB1    . ALA B  2  28  ? 324.583 232.302 266.676 1.00 101.26 ? 27  ALA O HB1    1 
ATOM   4220   H  HB2    . ALA B  2  28  ? 325.517 233.041 265.624 1.00 101.26 ? 27  ALA O HB2    1 
ATOM   4221   H  HB3    . ALA B  2  28  ? 324.295 232.159 265.120 1.00 101.26 ? 27  ALA O HB3    1 
ATOM   4222   N  N      . VAL B  2  29  ? 324.266 229.332 265.105 1.00 64.80  ? 28  VAL O N      1 
ATOM   4223   C  CA     . VAL B  2  29  ? 323.555 228.061 265.209 1.00 63.82  ? 28  VAL O CA     1 
ATOM   4224   C  C      . VAL B  2  29  ? 324.510 226.946 265.618 1.00 87.42  ? 28  VAL O C      1 
ATOM   4225   O  O      . VAL B  2  29  ? 324.364 226.325 266.676 1.00 92.95  ? 28  VAL O O      1 
ATOM   4226   C  CB     . VAL B  2  29  ? 322.856 227.738 263.880 1.00 73.79  ? 28  VAL O CB     1 
ATOM   4227   C  CG1    . VAL B  2  29  ? 322.561 226.233 263.732 1.00 61.19  ? 28  VAL O CG1    1 
ATOM   4228   C  CG2    . VAL B  2  29  ? 321.596 228.568 263.765 1.00 74.41  ? 28  VAL O CG2    1 
ATOM   4229   H  H      . VAL B  2  29  ? 324.093 229.768 264.384 1.00 59.19  ? 28  VAL O H      1 
ATOM   4230   H  HA     . VAL B  2  29  ? 322.874 228.137 265.895 1.00 58.12  ? 28  VAL O HA     1 
ATOM   4231   H  HB     . VAL B  2  29  ? 323.443 227.994 263.151 1.00 68.70  ? 28  VAL O HB     1 
ATOM   4232   H  HG11   . VAL B  2  29  ? 322.121 226.080 262.881 1.00 55.72  ? 28  VAL O HG11   1 
ATOM   4233   H  HG12   . VAL B  2  29  ? 323.397 225.743 263.766 1.00 55.72  ? 28  VAL O HG12   1 
ATOM   4234   H  HG13   . VAL B  2  29  ? 321.983 225.953 264.459 1.00 55.72  ? 28  VAL O HG13   1 
ATOM   4235   H  HG21   . VAL B  2  29  ? 321.158 228.362 262.924 1.00 70.43  ? 28  VAL O HG21   1 
ATOM   4236   H  HG22   . VAL B  2  29  ? 321.008 228.354 264.506 1.00 70.43  ? 28  VAL O HG22   1 
ATOM   4237   H  HG23   . VAL B  2  29  ? 321.834 229.508 263.791 1.00 70.43  ? 28  VAL O HG23   1 
ATOM   4238   N  N      . ALA B  2  30  ? 325.522 226.688 264.785 1.00 105.80 ? 29  ALA O N      1 
ATOM   4239   C  CA     . ALA B  2  30  ? 326.425 225.565 264.982 1.00 107.78 ? 29  ALA O CA     1 
ATOM   4240   C  C      . ALA B  2  30  ? 327.250 225.692 266.255 1.00 106.46 ? 29  ALA O C      1 
ATOM   4241   O  O      . ALA B  2  30  ? 328.126 224.859 266.502 1.00 96.43  ? 29  ALA O O      1 
ATOM   4242   C  CB     . ALA B  2  30  ? 327.351 225.421 263.770 1.00 125.68 ? 29  ALA O CB     1 
ATOM   4243   H  H      . ALA B  2  30  ? 325.705 227.160 264.090 1.00 94.71  ? 29  ALA O H      1 
ATOM   4244   H  HA     . ALA B  2  30  ? 325.900 224.752 265.051 1.00 95.62  ? 29  ALA O HA     1 
ATOM   4245   H  HB1    . ALA B  2  30  ? 327.946 224.669 263.916 1.00 113.16 ? 29  ALA O HB1    1 
ATOM   4246   H  HB2    . ALA B  2  30  ? 326.812 225.268 262.978 1.00 113.16 ? 29  ALA O HB2    1 
ATOM   4247   H  HB3    . ALA B  2  30  ? 327.866 226.236 263.669 1.00 113.16 ? 29  ALA O HB3    1 
ATOM   4248   N  N      . GLY B  2  31  ? 326.986 226.713 267.055 1.00 90.11  ? 30  GLY O N      1 
ATOM   4249   C  CA     . GLY B  2  31  ? 327.606 226.830 268.360 1.00 85.15  ? 30  GLY O CA     1 
ATOM   4250   C  C      . GLY B  2  31  ? 326.653 226.457 269.473 1.00 88.75  ? 30  GLY O C      1 
ATOM   4251   O  O      . GLY B  2  31  ? 327.054 226.366 270.635 1.00 95.41  ? 30  GLY O O      1 
ATOM   4252   H  H      . GLY B  2  31  ? 326.447 227.355 266.863 1.00 84.59  ? 30  GLY O H      1 
ATOM   4253   H  HA2    . GLY B  2  31  ? 328.379 226.246 268.406 1.00 78.96  ? 30  GLY O HA2    1 
ATOM   4254   H  HA3    . GLY B  2  31  ? 327.900 227.744 268.499 1.00 78.96  ? 30  GLY O HA3    1 
ATOM   4255   N  N      . GLY B  2  32  ? 325.391 226.221 269.125 1.00 86.33  ? 31  GLY O N      1 
ATOM   4256   C  CA     . GLY B  2  32  ? 324.338 226.075 270.106 1.00 93.09  ? 31  GLY O CA     1 
ATOM   4257   C  C      . GLY B  2  32  ? 324.301 224.699 270.737 1.00 98.23  ? 31  GLY O C      1 
ATOM   4258   O  O      . GLY B  2  32  ? 325.229 223.896 270.633 1.00 120.00 ? 31  GLY O O      1 
ATOM   4259   H  H      . GLY B  2  32  ? 325.121 226.141 268.312 1.00 85.27  ? 31  GLY O H      1 
ATOM   4260   H  HA2    . GLY B  2  32  ? 324.463 226.731 270.810 1.00 92.36  ? 31  GLY O HA2    1 
ATOM   4261   H  HA3    . GLY B  2  32  ? 323.481 226.240 269.683 1.00 92.36  ? 31  GLY O HA3    1 
ATOM   4262   N  N      . ALA B  2  33  ? 323.194 224.434 271.412 1.00 79.08  ? 32  ALA O N      1 
ATOM   4263   C  CA     . ALA B  2  33  ? 323.014 223.161 272.090 1.00 94.37  ? 32  ALA O CA     1 
ATOM   4264   C  C      . ALA B  2  33  ? 322.620 222.089 271.078 1.00 90.65  ? 32  ALA O C      1 
ATOM   4265   O  O      . ALA B  2  33  ? 321.676 222.293 270.307 1.00 70.07  ? 32  ALA O O      1 
ATOM   4266   C  CB     . ALA B  2  33  ? 321.946 223.275 273.171 1.00 129.15 ? 32  ALA O CB     1 
ATOM   4267   H  H      . ALA B  2  33  ? 322.531 224.975 271.493 1.00 89.06  ? 32  ALA O H      1 
ATOM   4268   H  HA     . ALA B  2  33  ? 323.848 222.896 272.509 1.00 103.74 ? 32  ALA O HA     1 
ATOM   4269   H  HB1    . ALA B  2  33  ? 321.845 222.414 273.607 1.00 138.91 ? 32  ALA O HB1    1 
ATOM   4270   H  HB2    . ALA B  2  33  ? 322.221 223.943 273.818 1.00 138.91 ? 32  ALA O HB2    1 
ATOM   4271   H  HB3    . ALA B  2  33  ? 321.107 223.538 272.760 1.00 138.91 ? 32  ALA O HB3    1 
ATOM   4272   N  N      . PRO B  2  34  ? 323.298 220.941 271.060 1.00 91.39  ? 33  PRO O N      1 
ATOM   4273   C  CA     . PRO B  2  34  ? 323.000 219.924 270.047 1.00 70.78  ? 33  PRO O CA     1 
ATOM   4274   C  C      . PRO B  2  34  ? 321.577 219.409 270.158 1.00 68.16  ? 33  PRO O C      1 
ATOM   4275   O  O      . PRO B  2  34  ? 320.984 219.370 271.238 1.00 68.64  ? 33  PRO O O      1 
ATOM   4276   C  CB     . PRO B  2  34  ? 324.017 218.817 270.344 1.00 75.78  ? 33  PRO O CB     1 
ATOM   4277   C  CG     . PRO B  2  34  ? 324.350 219.002 271.782 1.00 78.70  ? 33  PRO O CG     1 
ATOM   4278   C  CD     . PRO B  2  34  ? 324.340 220.486 271.992 1.00 76.62  ? 33  PRO O CD     1 
ATOM   4279   H  HA     . PRO B  2  34  ? 323.152 220.275 269.155 1.00 67.58  ? 33  PRO O HA     1 
ATOM   4280   H  HB2    . PRO B  2  34  ? 323.612 217.949 270.192 1.00 71.38  ? 33  PRO O HB2    1 
ATOM   4281   H  HB3    . PRO B  2  34  ? 324.804 218.935 269.789 1.00 71.38  ? 33  PRO O HB3    1 
ATOM   4282   H  HG2    . PRO B  2  34  ? 323.677 218.571 272.332 1.00 73.77  ? 33  PRO O HG2    1 
ATOM   4283   H  HG3    . PRO B  2  34  ? 325.230 218.635 271.963 1.00 73.77  ? 33  PRO O HG3    1 
ATOM   4284   H  HD2    . PRO B  2  34  ? 324.094 220.698 272.906 1.00 72.29  ? 33  PRO O HD2    1 
ATOM   4285   H  HD3    . PRO B  2  34  ? 325.199 220.869 271.754 1.00 72.29  ? 33  PRO O HD3    1 
ATOM   4286   N  N      . SER B  2  35  ? 321.036 219.003 269.013 1.00 79.12  ? 34  SER O N      1 
ATOM   4287   C  CA     . SER B  2  35  ? 319.675 218.504 268.927 1.00 73.25  ? 34  SER O CA     1 
ATOM   4288   C  C      . SER B  2  35  ? 319.575 217.580 267.727 1.00 73.69  ? 34  SER O C      1 
ATOM   4289   O  O      . SER B  2  35  ? 320.212 217.804 266.693 1.00 67.65  ? 34  SER O O      1 
ATOM   4290   C  CB     . SER B  2  35  ? 318.658 219.639 268.792 1.00 72.08  ? 34  SER O CB     1 
ATOM   4291   O  OG     . SER B  2  35  ? 318.777 220.268 267.525 1.00 68.46  ? 34  SER O OG     1 
ATOM   4292   H  H      . SER B  2  35  ? 321.450 219.008 268.259 1.00 81.06  ? 34  SER O H      1 
ATOM   4293   H  HA     . SER B  2  35  ? 319.465 217.996 269.726 1.00 75.83  ? 34  SER O HA     1 
ATOM   4294   H  HB2    . SER B  2  35  ? 317.763 219.276 268.881 1.00 75.79  ? 34  SER O HB2    1 
ATOM   4295   H  HB3    . SER B  2  35  ? 318.822 220.295 269.487 1.00 75.79  ? 34  SER O HB3    1 
ATOM   4296   H  HG     . SER B  2  35  ? 318.216 220.890 267.459 1.00 72.71  ? 34  SER O HG     1 
ATOM   4297   N  N      . VAL B  2  36  ? 318.756 216.545 267.873 1.00 52.64  ? 35  VAL O N      1 
ATOM   4298   C  CA     . VAL B  2  36  ? 318.618 215.516 266.859 1.00 53.15  ? 35  VAL O CA     1 
ATOM   4299   C  C      . VAL B  2  36  ? 317.145 215.263 266.593 1.00 50.18  ? 35  VAL O C      1 
ATOM   4300   O  O      . VAL B  2  36  ? 316.282 215.493 267.443 1.00 48.89  ? 35  VAL O O      1 
ATOM   4301   C  CB     . VAL B  2  36  ? 319.310 214.215 267.284 1.00 57.97  ? 35  VAL O CB     1 
ATOM   4302   C  CG1    . VAL B  2  36  ? 320.797 214.433 267.342 1.00 61.13  ? 35  VAL O CG1    1 
ATOM   4303   C  CG2    . VAL B  2  36  ? 318.781 213.776 268.638 1.00 59.48  ? 35  VAL O CG2    1 
ATOM   4304   H  H      . VAL B  2  36  ? 318.261 216.417 268.565 1.00 62.15  ? 35  VAL O H      1 
ATOM   4305   H  HA     . VAL B  2  36  ? 319.028 215.822 266.034 1.00 62.57  ? 35  VAL O HA     1 
ATOM   4306   H  HB     . VAL B  2  36  ? 319.122 213.518 266.636 1.00 66.27  ? 35  VAL O HB     1 
ATOM   4307   H  HG11   . VAL B  2  36  ? 321.227 213.606 267.611 1.00 68.60  ? 35  VAL O HG11   1 
ATOM   4308   H  HG12   . VAL B  2  36  ? 321.111 214.699 266.463 1.00 68.60  ? 35  VAL O HG12   1 
ATOM   4309   H  HG13   . VAL B  2  36  ? 320.988 215.131 267.987 1.00 68.60  ? 35  VAL O HG13   1 
ATOM   4310   H  HG21   . VAL B  2  36  ? 319.224 212.953 268.898 1.00 67.54  ? 35  VAL O HG21   1 
ATOM   4311   H  HG22   . VAL B  2  36  ? 318.965 214.472 269.288 1.00 67.54  ? 35  VAL O HG22   1 
ATOM   4312   H  HG23   . VAL B  2  36  ? 317.824 213.631 268.570 1.00 67.54  ? 35  VAL O HG23   1 
ATOM   4313   N  N      . GLY B  2  37  ? 316.873 214.764 265.395 1.00 64.01  ? 36  GLY O N      1 
ATOM   4314   C  CA     . GLY B  2  37  ? 315.525 214.427 265.003 1.00 63.62  ? 36  GLY O CA     1 
ATOM   4315   C  C      . GLY B  2  37  ? 315.505 213.110 264.265 1.00 70.71  ? 36  GLY O C      1 
ATOM   4316   O  O      . GLY B  2  37  ? 316.334 212.873 263.384 1.00 85.68  ? 36  GLY O O      1 
ATOM   4317   H  H      . GLY B  2  37  ? 317.463 214.610 264.788 1.00 72.56  ? 36  GLY O H      1 
ATOM   4318   H  HA2    . GLY B  2  37  ? 314.961 214.356 265.789 1.00 72.93  ? 36  GLY O HA2    1 
ATOM   4319   H  HA3    . GLY B  2  37  ? 315.169 215.118 264.423 1.00 72.93  ? 36  GLY O HA3    1 
ATOM   4320   N  N      . ILE B  2  38  ? 314.579 212.233 264.632 1.00 58.55  ? 37  ILE O N      1 
ATOM   4321   C  CA     . ILE B  2  38  ? 314.442 210.930 264.003 1.00 60.91  ? 37  ILE O CA     1 
ATOM   4322   C  C      . ILE B  2  38  ? 312.968 210.723 263.677 1.00 63.46  ? 37  ILE O C      1 
ATOM   4323   O  O      . ILE B  2  38  ? 312.138 210.587 264.585 1.00 77.31  ? 37  ILE O O      1 
ATOM   4324   C  CB     . ILE B  2  38  ? 314.976 209.804 264.896 1.00 65.62  ? 37  ILE O CB     1 
ATOM   4325   C  CG1    . ILE B  2  38  ? 316.404 210.143 265.345 1.00 68.00  ? 37  ILE O CG1    1 
ATOM   4326   C  CG2    . ILE B  2  38  ? 314.928 208.474 264.146 1.00 68.45  ? 37  ILE O CG2    1 
ATOM   4327   C  CD1    . ILE B  2  38  ? 317.066 209.090 266.214 1.00 126.98 ? 37  ILE O CD1    1 
ATOM   4328   H  H      . ILE B  2  38  ? 314.006 212.375 265.258 1.00 61.00  ? 37  ILE O H      1 
ATOM   4329   H  HA     . ILE B  2  38  ? 314.942 210.922 263.172 1.00 63.02  ? 37  ILE O HA     1 
ATOM   4330   H  HB     . ILE B  2  38  ? 314.412 209.737 265.681 1.00 66.66  ? 37  ILE O HB     1 
ATOM   4331   H  HG12   . ILE B  2  38  ? 316.957 210.261 264.556 1.00 68.21  ? 37  ILE O HG12   1 
ATOM   4332   H  HG13   . ILE B  2  38  ? 316.381 210.969 265.852 1.00 68.21  ? 37  ILE O HG13   1 
ATOM   4333   H  HG21   . ILE B  2  38  ? 315.268 207.774 264.723 1.00 69.11  ? 37  ILE O HG21   1 
ATOM   4334   H  HG22   . ILE B  2  38  ? 314.008 208.284 263.901 1.00 69.11  ? 37  ILE O HG22   1 
ATOM   4335   H  HG23   . ILE B  2  38  ? 315.476 208.542 263.348 1.00 69.11  ? 37  ILE O HG23   1 
ATOM   4336   H  HD11   . ILE B  2  38  ? 317.959 209.390 266.447 1.00 126.06 ? 37  ILE O HD11   1 
ATOM   4337   H  HD12   . ILE B  2  38  ? 316.537 208.968 267.018 1.00 126.06 ? 37  ILE O HD12   1 
ATOM   4338   H  HD13   . ILE B  2  38  ? 317.114 208.258 265.719 1.00 126.06 ? 37  ILE O HD13   1 
ATOM   4339   N  N      . LYS B  2  39  ? 312.640 210.713 262.386 1.00 67.83  ? 38  LYS O N      1 
ATOM   4340   C  CA     . LYS B  2  39  ? 311.309 210.331 261.932 1.00 68.39  ? 38  LYS O CA     1 
ATOM   4341   C  C      . LYS B  2  39  ? 311.240 208.812 261.882 1.00 71.95  ? 38  LYS O C      1 
ATOM   4342   O  O      . LYS B  2  39  ? 312.059 208.174 261.215 1.00 72.60  ? 38  LYS O O      1 
ATOM   4343   C  CB     . LYS B  2  39  ? 311.020 210.931 260.556 1.00 66.55  ? 38  LYS O CB     1 
ATOM   4344   C  CG     . LYS B  2  39  ? 309.951 210.172 259.763 1.00 69.03  ? 38  LYS O CG     1 
ATOM   4345   C  CD     . LYS B  2  39  ? 309.839 210.640 258.328 1.00 79.79  ? 38  LYS O CD     1 
ATOM   4346   C  CE     . LYS B  2  39  ? 309.548 212.119 258.239 1.00 100.24 ? 38  LYS O CE     1 
ATOM   4347   N  NZ     . LYS B  2  39  ? 309.065 212.491 256.885 1.00 120.04 ? 38  LYS O NZ     1 
ATOM   4348   H  H      . LYS B  2  39  ? 313.178 210.926 261.749 1.00 63.00  ? 38  LYS O H      1 
ATOM   4349   H  HA     . LYS B  2  39  ? 310.644 210.654 262.559 1.00 64.29  ? 38  LYS O HA     1 
ATOM   4350   H  HB2    . LYS B  2  39  ? 310.712 211.843 260.671 1.00 63.23  ? 38  LYS O HB2    1 
ATOM   4351   H  HB3    . LYS B  2  39  ? 311.837 210.924 260.034 1.00 63.23  ? 38  LYS O HB3    1 
ATOM   4352   H  HG2    . LYS B  2  39  ? 310.175 209.229 259.753 1.00 66.20  ? 38  LYS O HG2    1 
ATOM   4353   H  HG3    . LYS B  2  39  ? 309.089 210.304 260.188 1.00 66.20  ? 38  LYS O HG3    1 
ATOM   4354   H  HD2    . LYS B  2  39  ? 310.677 210.468 257.871 1.00 77.58  ? 38  LYS O HD2    1 
ATOM   4355   H  HD3    . LYS B  2  39  ? 309.116 210.162 257.892 1.00 77.58  ? 38  LYS O HD3    1 
ATOM   4356   H  HE2    . LYS B  2  39  ? 308.859 212.350 258.882 1.00 98.86  ? 38  LYS O HE2    1 
ATOM   4357   H  HE3    . LYS B  2  39  ? 310.359 212.617 258.421 1.00 98.86  ? 38  LYS O HE3    1 
ATOM   4358   H  HZ1    . LYS B  2  39  ? 309.683 212.290 256.277 1.00 119.41 ? 38  LYS O HZ1    1 
ATOM   4359   H  HZ2    . LYS B  2  39  ? 308.261 212.138 256.743 1.00 119.41 ? 38  LYS O HZ2    1 
ATOM   4360   H  HZ3    . LYS B  2  39  ? 308.899 213.365 256.852 1.00 119.41 ? 38  LYS O HZ3    1 
ATOM   4361   N  N      . ALA B  2  40  ? 310.259 208.227 262.563 1.00 74.20  ? 39  ALA O N      1 
ATOM   4362   C  CA     . ALA B  2  40  ? 310.236 206.788 262.794 1.00 102.33 ? 39  ALA O CA     1 
ATOM   4363   C  C      . ALA B  2  40  ? 309.185 206.065 261.958 1.00 119.69 ? 39  ALA O C      1 
ATOM   4364   O  O      . ALA B  2  40  ? 308.719 204.994 262.353 1.00 136.86 ? 39  ALA O O      1 
ATOM   4365   C  CB     . ALA B  2  40  ? 310.010 206.493 264.276 1.00 108.45 ? 39  ALA O CB     1 
ATOM   4366   H  H      . ALA B  2  40  ? 309.589 208.646 262.904 1.00 77.20  ? 39  ALA O H      1 
ATOM   4367   H  HA     . ALA B  2  40  ? 311.102 206.424 262.552 1.00 104.63 ? 39  ALA O HA     1 
ATOM   4368   H  HB1    . ALA B  2  40  ? 309.998 205.532 264.408 1.00 110.34 ? 39  ALA O HB1    1 
ATOM   4369   H  HB2    . ALA B  2  40  ? 310.730 206.889 264.790 1.00 110.34 ? 39  ALA O HB2    1 
ATOM   4370   H  HB3    . ALA B  2  40  ? 309.160 206.875 264.547 1.00 110.34 ? 39  ALA O HB3    1 
ATOM   4371   N  N      . ALA B  2  41  ? 308.815 206.615 260.801 1.00 149.09 ? 40  ALA O N      1 
ATOM   4372   C  CA     . ALA B  2  41  ? 307.794 206.007 259.945 1.00 136.22 ? 40  ALA O CA     1 
ATOM   4373   C  C      . ALA B  2  41  ? 306.649 205.451 260.791 1.00 118.25 ? 40  ALA O C      1 
ATOM   4374   O  O      . ALA B  2  41  ? 306.223 204.302 260.648 1.00 114.87 ? 40  ALA O O      1 
ATOM   4375   C  CB     . ALA B  2  41  ? 308.405 204.921 259.061 1.00 146.49 ? 40  ALA O CB     1 
ATOM   4376   H  H      . ALA B  2  41  ? 309.142 207.345 260.487 1.00 141.75 ? 40  ALA O H      1 
ATOM   4377   H  HA     . ALA B  2  41  ? 307.427 206.690 259.363 1.00 129.41 ? 40  ALA O HA     1 
ATOM   4378   H  HB1    . ALA B  2  41  ? 307.708 204.537 258.506 1.00 139.05 ? 40  ALA O HB1    1 
ATOM   4379   H  HB2    . ALA B  2  41  ? 309.092 205.318 258.503 1.00 139.05 ? 40  ALA O HB2    1 
ATOM   4380   H  HB3    . ALA B  2  41  ? 308.793 204.235 259.627 1.00 139.05 ? 40  ALA O HB3    1 
ATOM   4381   N  N      . ASN B  2  42  ? 306.147 206.305 261.682 1.00 101.79 ? 41  ASN O N      1 
ATOM   4382   C  CA     . ASN B  2  42  ? 305.256 205.905 262.765 1.00 93.22  ? 41  ASN O CA     1 
ATOM   4383   C  C      . ASN B  2  42  ? 305.086 207.066 263.737 1.00 91.31  ? 41  ASN O C      1 
ATOM   4384   O  O      . ASN B  2  42  ? 304.084 207.155 264.456 1.00 91.61  ? 41  ASN O O      1 
ATOM   4385   C  CB     . ASN B  2  42  ? 305.821 204.678 263.488 1.00 96.77  ? 41  ASN O CB     1 
ATOM   4386   C  CG     . ASN B  2  42  ? 304.961 204.231 264.639 1.00 98.64  ? 41  ASN O CG     1 
ATOM   4387   O  OD1    . ASN B  2  42  ? 303.806 204.642 264.771 1.00 98.46  ? 41  ASN O OD1    1 
ATOM   4388   N  ND2    . ASN B  2  42  ? 305.516 203.365 265.480 1.00 101.68 ? 41  ASN O ND2    1 
ATOM   4389   H  H      . ASN B  2  42  ? 306.316 207.149 261.678 1.00 91.64  ? 41  ASN O H      1 
ATOM   4390   H  HA     . ASN B  2  42  ? 304.386 205.676 262.402 1.00 83.10  ? 41  ASN O HA     1 
ATOM   4391   H  HB2    . ASN B  2  42  ? 305.886 203.943 262.859 1.00 85.57  ? 41  ASN O HB2    1 
ATOM   4392   H  HB3    . ASN B  2  42  ? 306.700 204.895 263.837 1.00 85.57  ? 41  ASN O HB3    1 
ATOM   4393   H  HD21   . ASN B  2  42  ? 305.070 203.075 266.156 1.00 89.48  ? 41  ASN O HD21   1 
ATOM   4394   H  HD22   . ASN B  2  42  ? 306.322 203.094 265.349 1.00 89.48  ? 41  ASN O HD22   1 
ATOM   4395   N  N      . GLY B  2  43  ? 306.066 207.958 263.747 1.00 83.47  ? 42  GLY O N      1 
ATOM   4396   C  CA     . GLY B  2  43  ? 306.131 209.062 264.682 1.00 81.85  ? 42  GLY O CA     1 
ATOM   4397   C  C      . GLY B  2  43  ? 307.468 209.744 264.519 1.00 79.76  ? 42  GLY O C      1 
ATOM   4398   O  O      . GLY B  2  43  ? 308.377 209.235 263.858 1.00 88.72  ? 42  GLY O O      1 
ATOM   4399   H  H      . GLY B  2  43  ? 306.728 207.941 263.198 1.00 83.87  ? 42  GLY O H      1 
ATOM   4400   H  HA2    . GLY B  2  43  ? 305.422 209.698 264.501 1.00 82.44  ? 42  GLY O HA2    1 
ATOM   4401   H  HA3    . GLY B  2  43  ? 306.045 208.737 265.592 1.00 82.44  ? 42  GLY O HA3    1 
ATOM   4402   N  N      . VAL B  2  44  ? 307.580 210.919 265.125 1.00 53.54  ? 43  VAL O N      1 
ATOM   4403   C  CA     . VAL B  2  44  ? 308.821 211.681 265.086 1.00 53.10  ? 43  VAL O CA     1 
ATOM   4404   C  C      . VAL B  2  44  ? 309.288 211.919 266.509 1.00 54.70  ? 43  VAL O C      1 
ATOM   4405   O  O      . VAL B  2  44  ? 308.482 212.102 267.425 1.00 54.38  ? 43  VAL O O      1 
ATOM   4406   C  CB     . VAL B  2  44  ? 308.664 213.027 264.353 1.00 49.05  ? 43  VAL O CB     1 
ATOM   4407   C  CG1    . VAL B  2  44  ? 310.010 213.741 264.291 1.00 49.11  ? 43  VAL O CG1    1 
ATOM   4408   C  CG2    . VAL B  2  44  ? 308.092 212.803 262.969 1.00 47.67  ? 43  VAL O CG2    1 
ATOM   4409   H  H      . VAL B  2  44  ? 306.948 211.299 265.569 1.00 57.97  ? 43  VAL O H      1 
ATOM   4410   H  HA     . VAL B  2  44  ? 309.500 211.163 264.626 1.00 57.17  ? 43  VAL O HA     1 
ATOM   4411   H  HB     . VAL B  2  44  ? 308.047 213.588 264.848 1.00 53.99  ? 43  VAL O HB     1 
ATOM   4412   H  HG11   . VAL B  2  44  ? 309.898 214.586 263.827 1.00 53.62  ? 43  VAL O HG11   1 
ATOM   4413   H  HG12   . VAL B  2  44  ? 310.326 213.899 265.194 1.00 53.62  ? 43  VAL O HG12   1 
ATOM   4414   H  HG13   . VAL B  2  44  ? 310.642 213.182 263.812 1.00 53.62  ? 43  VAL O HG13   1 
ATOM   4415   H  HG21   . VAL B  2  44  ? 308.000 213.660 262.524 1.00 53.21  ? 43  VAL O HG21   1 
ATOM   4416   H  HG22   . VAL B  2  44  ? 308.693 212.232 262.468 1.00 53.21  ? 43  VAL O HG22   1 
ATOM   4417   H  HG23   . VAL B  2  44  ? 307.223 212.379 263.052 1.00 53.21  ? 43  VAL O HG23   1 
ATOM   4418   N  N      . VAL B  2  45  ? 310.601 211.927 266.696 1.00 51.60  ? 44  VAL O N      1 
ATOM   4419   C  CA     . VAL B  2  45  ? 311.189 212.184 268.000 1.00 53.47  ? 44  VAL O CA     1 
ATOM   4420   C  C      . VAL B  2  45  ? 312.131 213.369 267.884 1.00 51.91  ? 44  VAL O C      1 
ATOM   4421   O  O      . VAL B  2  45  ? 312.991 213.408 266.998 1.00 52.07  ? 44  VAL O O      1 
ATOM   4422   C  CB     . VAL B  2  45  ? 311.919 210.953 268.560 1.00 58.28  ? 44  VAL O CB     1 
ATOM   4423   C  CG1    . VAL B  2  45  ? 312.318 211.214 270.002 1.00 60.39  ? 44  VAL O CG1    1 
ATOM   4424   C  CG2    . VAL B  2  45  ? 311.017 209.733 268.482 1.00 60.04  ? 44  VAL O CG2    1 
ATOM   4425   H  H      . VAL B  2  45  ? 311.178 211.786 266.075 1.00 59.43  ? 44  VAL O H      1 
ATOM   4426   H  HA     . VAL B  2  45  ? 310.484 212.422 268.623 1.00 60.70  ? 44  VAL O HA     1 
ATOM   4427   H  HB     . VAL B  2  45  ? 312.720 210.782 268.040 1.00 64.38  ? 44  VAL O HB     1 
ATOM   4428   H  HG11   . VAL B  2  45  ? 312.778 210.433 270.348 1.00 65.96  ? 44  VAL O HG11   1 
ATOM   4429   H  HG12   . VAL B  2  45  ? 312.907 211.985 270.032 1.00 65.96  ? 44  VAL O HG12   1 
ATOM   4430   H  HG13   . VAL B  2  45  ? 311.519 211.386 270.524 1.00 65.96  ? 44  VAL O HG13   1 
ATOM   4431   H  HG21   . VAL B  2  45  ? 311.492 208.967 268.838 1.00 66.14  ? 44  VAL O HG21   1 
ATOM   4432   H  HG22   . VAL B  2  45  ? 310.216 209.899 269.004 1.00 66.14  ? 44  VAL O HG22   1 
ATOM   4433   H  HG23   . VAL B  2  45  ? 310.780 209.575 267.554 1.00 66.14  ? 44  VAL O HG23   1 
ATOM   4434   N  N      . LEU B  2  46  ? 311.962 214.327 268.788 1.00 76.90  ? 45  LEU O N      1 
ATOM   4435   C  CA     . LEU B  2  46  ? 312.822 215.497 268.896 1.00 74.65  ? 45  LEU O CA     1 
ATOM   4436   C  C      . LEU B  2  46  ? 313.485 215.484 270.257 1.00 93.59  ? 45  LEU O C      1 
ATOM   4437   O  O      . LEU B  2  46  ? 312.799 215.518 271.286 1.00 103.02 ? 45  LEU O O      1 
ATOM   4438   C  CB     . LEU B  2  46  ? 312.014 216.776 268.726 1.00 71.72  ? 45  LEU O CB     1 
ATOM   4439   C  CG     . LEU B  2  46  ? 311.465 216.964 267.326 1.00 69.86  ? 45  LEU O CG     1 
ATOM   4440   C  CD1    . LEU B  2  46  ? 310.498 218.122 267.342 1.00 70.90  ? 45  LEU O CD1    1 
ATOM   4441   C  CD2    . LEU B  2  46  ? 312.615 217.205 266.364 1.00 69.95  ? 45  LEU O CD2    1 
ATOM   4442   H  H      . LEU B  2  46  ? 311.330 214.320 269.372 1.00 69.36  ? 45  LEU O H      1 
ATOM   4443   H  HA     . LEU B  2  46  ? 313.509 215.466 268.211 1.00 67.09  ? 45  LEU O HA     1 
ATOM   4444   H  HB2    . LEU B  2  46  ? 311.263 216.756 269.339 1.00 65.22  ? 45  LEU O HB2    1 
ATOM   4445   H  HB3    . LEU B  2  46  ? 312.583 217.535 268.926 1.00 65.22  ? 45  LEU O HB3    1 
ATOM   4446   H  HG     . LEU B  2  46  ? 310.990 216.165 267.050 1.00 64.14  ? 45  LEU O HG     1 
ATOM   4447   H  HD11   . LEU B  2  46  ? 310.142 218.248 266.449 1.00 66.20  ? 45  LEU O HD11   1 
ATOM   4448   H  HD12   . LEU B  2  46  ? 309.777 217.922 267.960 1.00 66.20  ? 45  LEU O HD12   1 
ATOM   4449   H  HD13   . LEU B  2  46  ? 310.967 218.921 267.628 1.00 66.20  ? 45  LEU O HD13   1 
ATOM   4450   H  HD21   . LEU B  2  46  ? 312.258 217.325 265.470 1.00 63.94  ? 45  LEU O HD21   1 
ATOM   4451   H  HD22   . LEU B  2  46  ? 313.094 218.002 266.640 1.00 63.94  ? 45  LEU O HD22   1 
ATOM   4452   H  HD23   . LEU B  2  46  ? 313.208 216.438 266.384 1.00 63.94  ? 45  LEU O HD23   1 
ATOM   4453   N  N      . ALA B  2  47  ? 314.807 215.438 270.266 1.00 53.14  ? 46  ALA O N      1 
ATOM   4454   C  CA     . ALA B  2  47  ? 315.548 215.496 271.511 1.00 56.40  ? 46  ALA O CA     1 
ATOM   4455   C  C      . ALA B  2  47  ? 316.623 216.562 271.417 1.00 56.05  ? 46  ALA O C      1 
ATOM   4456   O  O      . ALA B  2  47  ? 317.182 216.827 270.349 1.00 54.73  ? 46  ALA O O      1 
ATOM   4457   C  CB     . ALA B  2  47  ? 316.184 214.152 271.877 1.00 61.00  ? 46  ALA O CB     1 
ATOM   4458   H  H      . ALA B  2  47  ? 315.298 215.374 269.563 1.00 61.22  ? 46  ALA O H      1 
ATOM   4459   H  HA     . ALA B  2  47  ? 314.942 215.745 272.227 1.00 63.71  ? 46  ALA O HA     1 
ATOM   4460   H  HB1    . ALA B  2  47  ? 316.665 214.249 272.714 1.00 67.23  ? 46  ALA O HB1    1 
ATOM   4461   H  HB2    . ALA B  2  47  ? 315.484 213.488 271.972 1.00 67.23  ? 46  ALA O HB2    1 
ATOM   4462   H  HB3    . ALA B  2  47  ? 316.796 213.891 271.172 1.00 67.23  ? 46  ALA O HB3    1 
ATOM   4463   N  N      . THR B  2  48  ? 316.893 217.170 272.563 1.00 72.89  ? 47  THR O N      1 
ATOM   4464   C  CA     . THR B  2  48  ? 317.869 218.235 272.665 1.00 84.32  ? 47  THR O CA     1 
ATOM   4465   C  C      . THR B  2  48  ? 318.372 218.249 274.098 1.00 98.83  ? 47  THR O C      1 
ATOM   4466   O  O      . THR B  2  48  ? 317.654 217.859 275.023 1.00 131.82 ? 47  THR O O      1 
ATOM   4467   C  CB     . THR B  2  48  ? 317.258 219.585 272.269 1.00 77.96  ? 47  THR O CB     1 
ATOM   4468   O  OG1    . THR B  2  48  ? 318.246 220.619 272.357 1.00 68.29  ? 47  THR O OG1    1 
ATOM   4469   C  CG2    . THR B  2  48  ? 316.068 219.920 273.166 1.00 84.35  ? 47  THR O CG2    1 
ATOM   4470   H  H      . THR B  2  48  ? 316.515 216.976 273.310 1.00 76.19  ? 47  THR O H      1 
ATOM   4471   H  HA     . THR B  2  48  ? 318.617 218.050 272.076 1.00 87.48  ? 47  THR O HA     1 
ATOM   4472   H  HB     . THR B  2  48  ? 316.938 219.531 271.355 1.00 82.17  ? 47  THR O HB     1 
ATOM   4473   H  HG1    . THR B  2  48  ? 318.887 220.449 271.840 1.00 72.33  ? 47  THR O HG1    1 
ATOM   4474   H  HG21   . THR B  2  48  ? 315.689 220.774 272.907 1.00 89.13  ? 47  THR O HG21   1 
ATOM   4475   H  HG22   . THR B  2  48  ? 315.387 219.234 273.082 1.00 89.13  ? 47  THR O HG22   1 
ATOM   4476   H  HG23   . THR B  2  48  ? 316.354 219.968 274.091 1.00 89.13  ? 47  THR O HG23   1 
ATOM   4477   N  N      . GLU B  2  49  ? 319.613 218.679 274.269 1.00 79.33  ? 48  GLU O N      1 
ATOM   4478   C  CA     . GLU B  2  49  ? 320.205 218.765 275.590 1.00 82.73  ? 48  GLU O CA     1 
ATOM   4479   C  C      . GLU B  2  49  ? 319.839 220.096 276.227 1.00 81.43  ? 48  GLU O C      1 
ATOM   4480   O  O      . GLU B  2  49  ? 319.694 221.112 275.545 1.00 78.34  ? 48  GLU O O      1 
ATOM   4481   C  CB     . GLU B  2  49  ? 321.720 218.629 275.513 1.00 104.45 ? 48  GLU O CB     1 
ATOM   4482   C  CG     . GLU B  2  49  ? 322.402 219.793 274.811 1.00 140.29 ? 48  GLU O CG     1 
ATOM   4483   C  CD     . GLU B  2  49  ? 323.823 219.995 275.281 1.00 182.92 ? 48  GLU O CD     1 
ATOM   4484   O  OE1    . GLU B  2  49  ? 324.104 221.074 275.852 1.00 203.64 ? 48  GLU O OE1    1 
ATOM   4485   O  OE2    . GLU B  2  49  ? 324.648 219.077 275.095 1.00 198.05 ? 48  GLU O OE2    1 
ATOM   4486   H  H      . GLU B  2  49  ? 320.135 218.927 273.632 1.00 83.81  ? 48  GLU O H      1 
ATOM   4487   H  HA     . GLU B  2  49  ? 319.860 218.051 276.148 1.00 86.50  ? 48  GLU O HA     1 
ATOM   4488   H  HB2    . GLU B  2  49  ? 322.076 218.576 276.414 1.00 107.27 ? 48  GLU O HB2    1 
ATOM   4489   H  HB3    . GLU B  2  49  ? 321.937 217.819 275.025 1.00 107.27 ? 48  GLU O HB3    1 
ATOM   4490   H  HG2    . GLU B  2  49  ? 322.422 219.620 273.857 1.00 143.42 ? 48  GLU O HG2    1 
ATOM   4491   H  HG3    . GLU B  2  49  ? 321.907 220.607 274.992 1.00 143.42 ? 48  GLU O HG3    1 
ATOM   4492   N  N      . LYS B  2  50  ? 319.717 220.090 277.550 1.00 121.28 ? 49  LYS O N      1 
ATOM   4493   C  CA     . LYS B  2  50  ? 319.256 221.245 278.298 1.00 120.67 ? 49  LYS O CA     1 
ATOM   4494   C  C      . LYS B  2  50  ? 320.147 221.382 279.537 1.00 132.35 ? 49  LYS O C      1 
ATOM   4495   O  O      . LYS B  2  50  ? 319.728 221.193 280.677 1.00 142.05 ? 49  LYS O O      1 
ATOM   4496   C  CB     . LYS B  2  50  ? 317.776 221.097 278.664 1.00 125.44 ? 49  LYS O CB     1 
ATOM   4497   C  CG     . LYS B  2  50  ? 317.109 222.359 279.194 1.00 147.23 ? 49  LYS O CG     1 
ATOM   4498   C  CD     . LYS B  2  50  ? 315.706 222.054 279.713 1.00 169.90 ? 49  LYS O CD     1 
ATOM   4499   C  CE     . LYS B  2  50  ? 314.951 223.305 280.172 1.00 183.70 ? 49  LYS O CE     1 
ATOM   4500   N  NZ     . LYS B  2  50  ? 315.453 223.896 281.449 1.00 191.82 ? 49  LYS O NZ     1 
ATOM   4501   H  H      . LYS B  2  50  ? 319.900 219.411 278.045 1.00 100.07 ? 49  LYS O H      1 
ATOM   4502   H  HA     . LYS B  2  50  ? 319.359 222.042 277.756 1.00 99.99  ? 49  LYS O HA     1 
ATOM   4503   H  HB2    . LYS B  2  50  ? 317.289 220.821 277.871 1.00 105.44 ? 49  LYS O HB2    1 
ATOM   4504   H  HB3    . LYS B  2  50  ? 317.694 220.414 279.348 1.00 105.44 ? 49  LYS O HB3    1 
ATOM   4505   H  HG2    . LYS B  2  50  ? 317.635 222.718 279.926 1.00 127.97 ? 49  LYS O HG2    1 
ATOM   4506   H  HG3    . LYS B  2  50  ? 317.036 223.011 278.479 1.00 127.97 ? 49  LYS O HG3    1 
ATOM   4507   H  HD2    . LYS B  2  50  ? 315.192 221.638 279.004 1.00 151.14 ? 49  LYS O HD2    1 
ATOM   4508   H  HD3    . LYS B  2  50  ? 315.774 221.452 280.470 1.00 151.14 ? 49  LYS O HD3    1 
ATOM   4509   H  HE2    . LYS B  2  50  ? 315.027 223.984 279.484 1.00 165.73 ? 49  LYS O HE2    1 
ATOM   4510   H  HE3    . LYS B  2  50  ? 314.018 223.074 280.302 1.00 165.73 ? 49  LYS O HE3    1 
ATOM   4511   H  HZ1    . LYS B  2  50  ? 315.384 223.301 282.107 1.00 173.38 ? 49  LYS O HZ1    1 
ATOM   4512   H  HZ2    . LYS B  2  50  ? 316.278 224.209 281.335 1.00 173.38 ? 49  LYS O HZ2    1 
ATOM   4513   H  HZ3    . LYS B  2  50  ? 314.974 224.616 281.659 1.00 173.38 ? 49  LYS O HZ3    1 
ATOM   4514   N  N      . LYS B  2  51  ? 321.415 221.715 279.310 1.00 125.79 ? 50  LYS O N      1 
ATOM   4515   C  CA     . LYS B  2  51  ? 322.377 221.826 280.397 1.00 132.67 ? 50  LYS O CA     1 
ATOM   4516   C  C      . LYS B  2  51  ? 322.383 223.235 280.962 1.00 140.44 ? 50  LYS O C      1 
ATOM   4517   O  O      . LYS B  2  51  ? 322.266 224.217 280.221 1.00 148.32 ? 50  LYS O O      1 
ATOM   4518   C  CB     . LYS B  2  51  ? 323.783 221.467 279.927 1.00 129.20 ? 50  LYS O CB     1 
ATOM   4519   C  CG     . LYS B  2  51  ? 323.958 220.010 279.609 1.00 138.24 ? 50  LYS O CG     1 
ATOM   4520   C  CD     . LYS B  2  51  ? 325.344 219.740 279.068 1.00 156.84 ? 50  LYS O CD     1 
ATOM   4521   C  CE     . LYS B  2  51  ? 326.379 219.695 280.175 1.00 177.73 ? 50  LYS O CE     1 
ATOM   4522   N  NZ     . LYS B  2  51  ? 327.715 219.323 279.636 1.00 195.05 ? 50  LYS O NZ     1 
ATOM   4523   H  H      . LYS B  2  51  ? 321.742 221.882 278.532 1.00 107.77 ? 50  LYS O H      1 
ATOM   4524   H  HA     . LYS B  2  51  ? 322.129 221.214 281.108 1.00 113.78 ? 50  LYS O HA     1 
ATOM   4525   H  HB2    . LYS B  2  51  ? 323.983 221.973 279.124 1.00 109.46 ? 50  LYS O HB2    1 
ATOM   4526   H  HB3    . LYS B  2  51  ? 324.415 221.697 280.627 1.00 109.46 ? 50  LYS O HB3    1 
ATOM   4527   H  HG2    . LYS B  2  51  ? 323.837 219.487 280.417 1.00 117.85 ? 50  LYS O HG2    1 
ATOM   4528   H  HG3    . LYS B  2  51  ? 323.311 219.747 278.936 1.00 117.85 ? 50  LYS O HG3    1 
ATOM   4529   H  HD2    . LYS B  2  51  ? 325.348 218.883 278.614 1.00 135.65 ? 50  LYS O HD2    1 
ATOM   4530   H  HD3    . LYS B  2  51  ? 325.590 220.448 278.452 1.00 135.65 ? 50  LYS O HD3    1 
ATOM   4531   H  HE2    . LYS B  2  51  ? 326.448 220.570 280.588 1.00 155.52 ? 50  LYS O HE2    1 
ATOM   4532   H  HE3    . LYS B  2  51  ? 326.119 219.030 280.833 1.00 155.52 ? 50  LYS O HE3    1 
ATOM   4533   H  HZ1    . LYS B  2  51  ? 328.313 219.300 280.294 1.00 172.01 ? 50  LYS O HZ1    1 
ATOM   4534   H  HZ2    . LYS B  2  51  ? 327.675 218.521 279.252 1.00 172.01 ? 50  LYS O HZ2    1 
ATOM   4535   H  HZ3    . LYS B  2  51  ? 327.975 219.921 279.030 1.00 172.01 ? 50  LYS O HZ3    1 
ATOM   4536   N  N      . GLN B  2  52  ? 322.534 223.324 282.277 1.00 136.68 ? 51  GLN O N      1 
ATOM   4537   C  CA     . GLN B  2  52  ? 322.583 224.592 282.984 1.00 138.74 ? 51  GLN O CA     1 
ATOM   4538   C  C      . GLN B  2  52  ? 323.954 224.770 283.615 1.00 133.59 ? 51  GLN O C      1 
ATOM   4539   O  O      . GLN B  2  52  ? 324.747 223.830 283.726 1.00 137.01 ? 51  GLN O O      1 
ATOM   4540   C  CB     . GLN B  2  52  ? 321.493 224.676 284.059 1.00 154.42 ? 51  GLN O CB     1 
ATOM   4541   C  CG     . GLN B  2  52  ? 320.140 225.155 283.545 1.00 159.65 ? 51  GLN O CG     1 
ATOM   4542   C  CD     . GLN B  2  52  ? 319.379 224.120 282.731 1.00 159.29 ? 51  GLN O CD     1 
ATOM   4543   O  OE1    . GLN B  2  52  ? 318.579 224.479 281.866 1.00 150.29 ? 51  GLN O OE1    1 
ATOM   4544   N  NE2    . GLN B  2  52  ? 319.601 222.836 283.013 1.00 168.63 ? 51  GLN O NE2    1 
ATOM   4545   H  H      . GLN B  2  52  ? 322.612 222.642 282.795 1.00 117.87 ? 51  GLN O H      1 
ATOM   4546   H  HA     . GLN B  2  52  ? 322.443 225.315 282.353 1.00 120.20 ? 51  GLN O HA     1 
ATOM   4547   H  HB2    . GLN B  2  52  ? 321.367 223.794 284.443 1.00 136.19 ? 51  GLN O HB2    1 
ATOM   4548   H  HB3    . GLN B  2  52  ? 321.783 225.294 284.748 1.00 136.19 ? 51  GLN O HB3    1 
ATOM   4549   H  HG2    . GLN B  2  52  ? 319.587 225.398 284.304 1.00 142.58 ? 51  GLN O HG2    1 
ATOM   4550   H  HG3    . GLN B  2  52  ? 320.279 225.931 282.980 1.00 142.58 ? 51  GLN O HG3    1 
ATOM   4551   H  HE21   . GLN B  2  52  ? 320.156 222.621 283.634 1.00 151.08 ? 51  GLN O HE21   1 
ATOM   4552   H  HE22   . GLN B  2  52  ? 319.189 222.222 282.573 1.00 151.08 ? 51  GLN O HE22   1 
ATOM   4553   N  N      . LYS B  2  53  ? 324.213 226.000 284.044 1.00 135.66 ? 52  LYS O N      1 
ATOM   4554   C  CA     . LYS B  2  53  ? 325.498 226.371 284.613 1.00 140.53 ? 52  LYS O CA     1 
ATOM   4555   C  C      . LYS B  2  53  ? 325.575 226.183 286.120 1.00 145.79 ? 52  LYS O C      1 
ATOM   4556   O  O      . LYS B  2  53  ? 326.586 226.557 286.721 1.00 150.33 ? 52  LYS O O      1 
ATOM   4557   C  CB     . LYS B  2  53  ? 325.805 227.829 284.280 1.00 139.23 ? 52  LYS O CB     1 
ATOM   4558   C  CG     . LYS B  2  53  ? 325.649 228.158 282.822 1.00 155.00 ? 52  LYS O CG     1 
ATOM   4559   C  CD     . LYS B  2  53  ? 326.095 229.575 282.556 1.00 183.86 ? 52  LYS O CD     1 
ATOM   4560   C  CE     . LYS B  2  53  ? 325.930 229.936 281.095 1.00 205.65 ? 52  LYS O CE     1 
ATOM   4561   N  NZ     . LYS B  2  53  ? 326.831 229.134 280.224 1.00 221.93 ? 52  LYS O NZ     1 
ATOM   4562   H  H      . LYS B  2  53  ? 323.649 226.648 284.014 1.00 114.53 ? 52  LYS O H      1 
ATOM   4563   H  HA     . LYS B  2  53  ? 326.189 225.822 284.210 1.00 118.59 ? 52  LYS O HA     1 
ATOM   4564   H  HB2    . LYS B  2  53  ? 325.200 228.398 284.780 1.00 117.83 ? 52  LYS O HB2    1 
ATOM   4565   H  HB3    . LYS B  2  53  ? 326.722 228.021 284.532 1.00 117.83 ? 52  LYS O HB3    1 
ATOM   4566   H  HG2    . LYS B  2  53  ? 326.199 227.558 282.294 1.00 134.32 ? 52  LYS O HG2    1 
ATOM   4567   H  HG3    . LYS B  2  53  ? 324.716 228.076 282.570 1.00 134.32 ? 52  LYS O HG3    1 
ATOM   4568   H  HD2    . LYS B  2  53  ? 325.556 230.185 283.084 1.00 163.58 ? 52  LYS O HD2    1 
ATOM   4569   H  HD3    . LYS B  2  53  ? 327.032 229.665 282.789 1.00 163.58 ? 52  LYS O HD3    1 
ATOM   4570   H  HE2    . LYS B  2  53  ? 325.015 229.765 280.825 1.00 186.08 ? 52  LYS O HE2    1 
ATOM   4571   H  HE3    . LYS B  2  53  ? 326.146 230.874 280.972 1.00 186.08 ? 52  LYS O HE3    1 
ATOM   4572   H  HZ1    . LYS B  2  53  ? 326.715 229.365 279.373 1.00 201.77 ? 52  LYS O HZ1    1 
ATOM   4573   H  HZ2    . LYS B  2  53  ? 327.679 229.278 280.450 1.00 201.77 ? 52  LYS O HZ2    1 
ATOM   4574   H  HZ3    . LYS B  2  53  ? 326.649 228.268 280.316 1.00 201.77 ? 52  LYS O HZ3    1 
ATOM   4575   N  N      . SER B  2  54  ? 324.549 225.634 286.752 1.00 130.15 ? 53  SER O N      1 
ATOM   4576   C  CA     . SER B  2  54  ? 324.566 225.468 288.202 1.00 133.69 ? 53  SER O CA     1 
ATOM   4577   C  C      . SER B  2  54  ? 323.438 224.529 288.599 1.00 118.16 ? 53  SER O C      1 
ATOM   4578   O  O      . SER B  2  54  ? 322.822 223.862 287.758 1.00 114.10 ? 53  SER O O      1 
ATOM   4579   C  CB     . SER B  2  54  ? 324.423 226.812 288.919 1.00 135.35 ? 53  SER O CB     1 
ATOM   4580   O  OG     . SER B  2  54  ? 325.569 227.615 288.728 1.00 139.31 ? 53  SER O OG     1 
ATOM   4581   H  H      . SER B  2  54  ? 323.834 225.349 286.369 1.00 124.23 ? 53  SER O H      1 
ATOM   4582   H  HA     . SER B  2  54  ? 325.407 225.066 288.470 1.00 127.17 ? 53  SER O HA     1 
ATOM   4583   H  HB2    . SER B  2  54  ? 323.649 227.278 288.564 1.00 129.23 ? 53  SER O HB2    1 
ATOM   4584   H  HB3    . SER B  2  54  ? 324.305 226.651 289.868 1.00 129.23 ? 53  SER O HB3    1 
ATOM   4585   H  HG     . SER B  2  54  ? 326.247 227.224 289.032 1.00 132.92 ? 53  SER O HG     1 
ATOM   4586   N  N      . ILE B  2  55  ? 323.196 224.461 289.908 1.00 105.20 ? 54  ILE O N      1 
ATOM   4587   C  CA     . ILE B  2  55  ? 322.006 223.849 290.465 1.00 105.19 ? 54  ILE O CA     1 
ATOM   4588   C  C      . ILE B  2  55  ? 320.934 224.880 290.761 1.00 113.65 ? 54  ILE O C      1 
ATOM   4589   O  O      . ILE B  2  55  ? 319.830 224.516 291.181 1.00 123.12 ? 54  ILE O O      1 
ATOM   4590   C  CB     . ILE B  2  55  ? 322.366 223.073 291.747 1.00 111.93 ? 54  ILE O CB     1 
ATOM   4591   C  CG1    . ILE B  2  55  ? 321.219 222.145 292.152 1.00 112.20 ? 54  ILE O CG1    1 
ATOM   4592   C  CG2    . ILE B  2  55  ? 322.735 224.053 292.869 1.00 116.31 ? 54  ILE O CG2    1 
ATOM   4593   C  CD1    . ILE B  2  55  ? 321.599 221.120 293.203 1.00 118.75 ? 54  ILE O CD1    1 
ATOM   4594   H  H      . ILE B  2  55  ? 323.728 224.775 290.506 1.00 114.31 ? 54  ILE O H      1 
ATOM   4595   H  HA     . ILE B  2  55  ? 321.645 223.218 289.822 1.00 114.52 ? 54  ILE O HA     1 
ATOM   4596   H  HB     . ILE B  2  55  ? 323.143 222.524 291.558 1.00 120.23 ? 54  ILE O HB     1 
ATOM   4597   H  HG12   . ILE B  2  55  ? 320.495 222.683 292.511 1.00 120.60 ? 54  ILE O HG12   1 
ATOM   4598   H  HG13   . ILE B  2  55  ? 320.913 221.665 291.367 1.00 120.60 ? 54  ILE O HG13   1 
ATOM   4599   H  HG21   . ILE B  2  55  ? 322.958 223.549 293.667 1.00 124.39 ? 54  ILE O HG21   1 
ATOM   4600   H  HG22   . ILE B  2  55  ? 323.497 224.583 292.588 1.00 124.39 ? 54  ILE O HG22   1 
ATOM   4601   H  HG23   . ILE B  2  55  ? 321.976 224.632 293.045 1.00 124.39 ? 54  ILE O HG23   1 
ATOM   4602   H  HD11   . ILE B  2  55  ? 320.823 220.574 293.405 1.00 126.07 ? 54  ILE O HD11   1 
ATOM   4603   H  HD12   . ILE B  2  55  ? 322.314 220.564 292.856 1.00 126.07 ? 54  ILE O HD12   1 
ATOM   4604   H  HD13   . ILE B  2  55  ? 321.896 221.582 294.002 1.00 126.07 ? 54  ILE O HD13   1 
ATOM   4605   N  N      . LEU B  2  56  ? 321.231 226.164 290.554 1.00 119.59 ? 55  LEU O N      1 
ATOM   4606   C  CA     . LEU B  2  56  ? 320.333 227.230 290.974 1.00 117.98 ? 55  LEU O CA     1 
ATOM   4607   C  C      . LEU B  2  56  ? 319.125 227.361 290.062 1.00 111.20 ? 55  LEU O C      1 
ATOM   4608   O  O      . LEU B  2  56  ? 318.030 227.689 290.535 1.00 119.44 ? 55  LEU O O      1 
ATOM   4609   C  CB     . LEU B  2  56  ? 321.090 228.554 291.012 1.00 116.97 ? 55  LEU O CB     1 
ATOM   4610   C  CG     . LEU B  2  56  ? 322.274 228.600 291.969 1.00 132.32 ? 55  LEU O CG     1 
ATOM   4611   C  CD1    . LEU B  2  56  ? 322.987 229.923 291.789 1.00 139.30 ? 55  LEU O CD1    1 
ATOM   4612   C  CD2    . LEU B  2  56  ? 321.809 228.412 293.404 1.00 126.38 ? 55  LEU O CD2    1 
ATOM   4613   H  H      . LEU B  2  56  ? 321.950 226.440 290.171 1.00 122.29 ? 55  LEU O H      1 
ATOM   4614   H  HA     . LEU B  2  56  ? 320.013 227.040 291.870 1.00 121.47 ? 55  LEU O HA     1 
ATOM   4615   H  HB2    . LEU B  2  56  ? 321.426 228.742 290.122 1.00 120.57 ? 55  LEU O HB2    1 
ATOM   4616   H  HB3    . LEU B  2  56  ? 320.472 229.253 291.279 1.00 120.57 ? 55  LEU O HB3    1 
ATOM   4617   H  HG     . LEU B  2  56  ? 322.893 227.886 291.750 1.00 134.91 ? 55  LEU O HG     1 
ATOM   4618   H  HD11   . LEU B  2  56  ? 323.743 229.959 292.396 1.00 142.10 ? 55  LEU O HD11   1 
ATOM   4619   H  HD12   . LEU B  2  56  ? 323.295 229.994 290.872 1.00 142.10 ? 55  LEU O HD12   1 
ATOM   4620   H  HD13   . LEU B  2  56  ? 322.369 230.644 291.988 1.00 142.10 ? 55  LEU O HD13   1 
ATOM   4621   H  HD21   . LEU B  2  56  ? 322.580 228.445 293.992 1.00 128.61 ? 55  LEU O HD21   1 
ATOM   4622   H  HD22   . LEU B  2  56  ? 321.189 229.122 293.630 1.00 128.61 ? 55  LEU O HD22   1 
ATOM   4623   H  HD23   . LEU B  2  56  ? 321.370 227.551 293.482 1.00 128.61 ? 55  LEU O HD23   1 
ATOM   4624   N  N      . TYR B  2  57  ? 319.305 227.121 288.767 1.00 117.17 ? 56  TYR O N      1 
ATOM   4625   C  CA     . TYR B  2  57  ? 318.225 227.293 287.812 1.00 111.49 ? 56  TYR O CA     1 
ATOM   4626   C  C      . TYR B  2  57  ? 317.058 226.366 288.145 1.00 129.61 ? 56  TYR O C      1 
ATOM   4627   O  O      . TYR B  2  57  ? 317.159 225.453 288.967 1.00 135.05 ? 56  TYR O O      1 
ATOM   4628   C  CB     . TYR B  2  57  ? 318.721 227.013 286.396 1.00 107.53 ? 56  TYR O CB     1 
ATOM   4629   C  CG     . TYR B  2  57  ? 319.730 228.015 285.898 1.00 107.17 ? 56  TYR O CG     1 
ATOM   4630   C  CD1    . TYR B  2  57  ? 319.374 228.978 284.973 1.00 102.82 ? 56  TYR O CD1    1 
ATOM   4631   C  CD2    . TYR B  2  57  ? 321.036 228.002 286.359 1.00 133.19 ? 56  TYR O CD2    1 
ATOM   4632   C  CE1    . TYR B  2  57  ? 320.289 229.899 284.515 1.00 114.82 ? 56  TYR O CE1    1 
ATOM   4633   C  CE2    . TYR B  2  57  ? 321.959 228.919 285.907 1.00 131.78 ? 56  TYR O CE2    1 
ATOM   4634   C  CZ     . TYR B  2  57  ? 321.580 229.868 284.985 1.00 127.12 ? 56  TYR O CZ     1 
ATOM   4635   O  OH     . TYR B  2  57  ? 322.492 230.792 284.529 1.00 138.34 ? 56  TYR O OH     1 
ATOM   4636   H  H      . TYR B  2  57  ? 320.045 226.858 288.418 1.00 106.10 ? 56  TYR O H      1 
ATOM   4637   H  HA     . TYR B  2  57  ? 317.907 228.209 287.848 1.00 101.44 ? 56  TYR O HA     1 
ATOM   4638   H  HB2    . TYR B  2  57  ? 319.138 226.137 286.378 1.00 97.60  ? 56  TYR O HB2    1 
ATOM   4639   H  HB3    . TYR B  2  57  ? 317.963 227.029 285.791 1.00 97.60  ? 56  TYR O HB3    1 
ATOM   4640   H  HD1    . TYR B  2  57  ? 318.502 229.003 284.653 1.00 93.82  ? 56  TYR O HD1    1 
ATOM   4641   H  HD2    . TYR B  2  57  ? 321.294 227.363 286.983 1.00 122.37 ? 56  TYR O HD2    1 
ATOM   4642   H  HE1    . TYR B  2  57  ? 320.033 230.541 283.892 1.00 105.83 ? 56  TYR O HE1    1 
ATOM   4643   H  HE2    . TYR B  2  57  ? 322.833 228.899 286.226 1.00 120.97 ? 56  TYR O HE2    1 
ATOM   4644   H  HH     . TYR B  2  57  ? 323.238 230.663 284.892 1.00 128.44 ? 56  TYR O HH     1 
ATOM   4645   N  N      . ASP B  2  58  ? 315.930 226.624 287.496 1.00 133.20 ? 57  ASP O N      1 
ATOM   4646   C  CA     . ASP B  2  58  ? 314.804 225.707 287.486 1.00 149.66 ? 57  ASP O CA     1 
ATOM   4647   C  C      . ASP B  2  58  ? 314.629 225.154 286.078 1.00 157.18 ? 57  ASP O C      1 
ATOM   4648   O  O      . ASP B  2  58  ? 314.928 225.827 285.088 1.00 167.54 ? 57  ASP O O      1 
ATOM   4649   C  CB     . ASP B  2  58  ? 313.518 226.394 287.945 1.00 152.10 ? 57  ASP O CB     1 
ATOM   4650   C  CG     . ASP B  2  58  ? 312.373 225.421 288.110 1.00 156.71 ? 57  ASP O CG     1 
ATOM   4651   O  OD1    . ASP B  2  58  ? 311.210 225.873 288.152 1.00 161.78 ? 57  ASP O OD1    1 
ATOM   4652   O  OD2    . ASP B  2  58  ? 312.641 224.202 288.190 1.00 157.69 ? 57  ASP O OD2    1 
ATOM   4653   H  H      . ASP B  2  58  ? 315.791 227.342 287.043 1.00 123.21 ? 57  ASP O H      1 
ATOM   4654   H  HA     . ASP B  2  58  ? 314.987 224.966 288.086 1.00 139.91 ? 57  ASP O HA     1 
ATOM   4655   H  HB2    . ASP B  2  58  ? 313.675 226.822 288.801 1.00 143.14 ? 57  ASP O HB2    1 
ATOM   4656   H  HB3    . ASP B  2  58  ? 313.259 227.055 287.285 1.00 143.14 ? 57  ASP O HB3    1 
ATOM   4657   N  N      . GLU B  2  59  ? 314.151 223.916 285.993 1.00 140.88 ? 58  GLU O N      1 
ATOM   4658   C  CA     . GLU B  2  59  ? 313.985 223.243 284.712 1.00 135.61 ? 58  GLU O CA     1 
ATOM   4659   C  C      . GLU B  2  59  ? 312.540 223.217 284.251 1.00 120.82 ? 58  GLU O C      1 
ATOM   4660   O  O      . GLU B  2  59  ? 312.276 222.877 283.094 1.00 104.26 ? 58  GLU O O      1 
ATOM   4661   C  CB     . GLU B  2  59  ? 314.519 221.810 284.789 1.00 147.13 ? 58  GLU O CB     1 
ATOM   4662   C  CG     . GLU B  2  59  ? 316.017 221.750 284.980 1.00 155.71 ? 58  GLU O CG     1 
ATOM   4663   C  CD     . GLU B  2  59  ? 316.456 222.448 286.250 1.00 163.78 ? 58  GLU O CD     1 
ATOM   4664   O  OE1    . GLU B  2  59  ? 315.924 222.109 287.327 1.00 147.00 ? 58  GLU O OE1    1 
ATOM   4665   O  OE2    . GLU B  2  59  ? 317.297 223.368 286.164 1.00 188.99 ? 58  GLU O OE2    1 
ATOM   4666   H  H      . GLU B  2  59  ? 313.914 223.441 286.670 1.00 144.91 ? 58  GLU O H      1 
ATOM   4667   H  HA     . GLU B  2  59  ? 314.502 223.717 284.041 1.00 139.92 ? 58  GLU O HA     1 
ATOM   4668   H  HB2    . GLU B  2  59  ? 314.104 221.358 285.540 1.00 150.52 ? 58  GLU O HB2    1 
ATOM   4669   H  HB3    . GLU B  2  59  ? 314.304 221.348 283.964 1.00 150.52 ? 58  GLU O HB3    1 
ATOM   4670   H  HG2    . GLU B  2  59  ? 316.294 220.822 285.034 1.00 158.18 ? 58  GLU O HG2    1 
ATOM   4671   H  HG3    . GLU B  2  59  ? 316.450 222.186 284.230 1.00 158.18 ? 58  GLU O HG3    1 
ATOM   4672   N  N      . ARG B  2  60  ? 311.610 223.572 285.127 1.00 162.82 ? 59  ARG O N      1 
ATOM   4673   C  CA     . ARG B  2  60  ? 310.198 223.654 284.800 1.00 162.67 ? 59  ARG O CA     1 
ATOM   4674   C  C      . ARG B  2  60  ? 309.770 225.090 284.563 1.00 157.55 ? 59  ARG O C      1 
ATOM   4675   O  O      . ARG B  2  60  ? 308.573 225.398 284.590 1.00 150.06 ? 59  ARG O O      1 
ATOM   4676   C  CB     . ARG B  2  60  ? 309.392 223.006 285.916 1.00 174.97 ? 59  ARG O CB     1 
ATOM   4677   C  CG     . ARG B  2  60  ? 310.186 221.886 286.539 1.00 188.46 ? 59  ARG O CG     1 
ATOM   4678   C  CD     . ARG B  2  60  ? 309.344 220.952 287.346 1.00 204.19 ? 59  ARG O CD     1 
ATOM   4679   N  NE     . ARG B  2  60  ? 310.116 219.764 287.692 1.00 214.93 ? 59  ARG O NE     1 
ATOM   4680   C  CZ     . ARG B  2  60  ? 310.371 218.768 286.850 1.00 211.78 ? 59  ARG O CZ     1 
ATOM   4681   N  NH1    . ARG B  2  60  ? 311.089 217.730 287.254 1.00 211.98 ? 59  ARG O NH1    1 
ATOM   4682   N  NH2    . ARG B  2  60  ? 309.911 218.802 285.604 1.00 208.63 ? 59  ARG O NH2    1 
ATOM   4683   H  H      . ARG B  2  60  ? 311.780 223.777 285.945 1.00 138.75 ? 59  ARG O H      1 
ATOM   4684   H  HA     . ARG B  2  60  ? 310.035 223.155 283.984 1.00 139.50 ? 59  ARG O HA     1 
ATOM   4685   H  HB2    . ARG B  2  60  ? 309.197 223.664 286.601 1.00 151.54 ? 59  ARG O HB2    1 
ATOM   4686   H  HB3    . ARG B  2  60  ? 308.572 222.638 285.553 1.00 151.54 ? 59  ARG O HB3    1 
ATOM   4687   H  HG2    . ARG B  2  60  ? 310.612 221.372 285.835 1.00 163.93 ? 59  ARG O HG2    1 
ATOM   4688   H  HG3    . ARG B  2  60  ? 310.858 222.265 287.126 1.00 163.93 ? 59  ARG O HG3    1 
ATOM   4689   H  HD2    . ARG B  2  60  ? 309.066 221.390 288.165 1.00 179.41 ? 59  ARG O HD2    1 
ATOM   4690   H  HD3    . ARG B  2  60  ? 308.572 220.679 286.826 1.00 179.41 ? 59  ARG O HD3    1 
ATOM   4691   H  HE     . ARG B  2  60  ? 310.449 219.717 288.484 1.00 189.12 ? 59  ARG O HE     1 
ATOM   4692   H  HH11   . ARG B  2  60  ? 311.388 217.702 288.060 1.00 184.95 ? 59  ARG O HH11   1 
ATOM   4693   H  HH12   . ARG B  2  60  ? 311.252 217.083 286.712 1.00 184.95 ? 59  ARG O HH12   1 
ATOM   4694   H  HH21   . ARG B  2  60  ? 309.446 219.474 285.336 1.00 183.30 ? 59  ARG O HH21   1 
ATOM   4695   H  HH22   . ARG B  2  60  ? 310.079 218.154 285.065 1.00 183.30 ? 59  ARG O HH22   1 
ATOM   4696   N  N      . SER B  2  61  ? 310.739 225.974 284.353 1.00 127.35 ? 60  SER O N      1 
ATOM   4697   C  CA     . SER B  2  61  ? 310.488 227.339 283.922 1.00 122.48 ? 60  SER O CA     1 
ATOM   4698   C  C      . SER B  2  61  ? 310.397 227.397 282.403 1.00 114.57 ? 60  SER O C      1 
ATOM   4699   O  O      . SER B  2  61  ? 309.381 227.826 281.844 1.00 123.84 ? 60  SER O O      1 
ATOM   4700   C  CB     . SER B  2  61  ? 311.612 228.247 284.429 1.00 103.30 ? 60  SER O CB     1 
ATOM   4701   O  OG     . SER B  2  61  ? 312.875 227.688 284.104 1.00 94.28  ? 60  SER O OG     1 
ATOM   4702   H  H      . SER B  2  61  ? 311.575 225.799 284.459 1.00 120.53 ? 60  SER O H      1 
ATOM   4703   H  HA     . SER B  2  61  ? 309.648 227.648 284.294 1.00 116.48 ? 60  SER O HA     1 
ATOM   4704   H  HB2    . SER B  2  61  ? 311.531 229.118 284.008 1.00 96.89  ? 60  SER O HB2    1 
ATOM   4705   H  HB3    . SER B  2  61  ? 311.540 228.334 285.392 1.00 96.89  ? 60  SER O HB3    1 
ATOM   4706   H  HG     . SER B  2  61  ? 313.490 228.187 284.383 1.00 87.11  ? 60  SER O HG     1 
ATOM   4707   N  N      . VAL B  2  62  ? 311.448 226.935 281.729 1.00 137.61 ? 61  VAL O N      1 
ATOM   4708   C  CA     . VAL B  2  62  ? 311.595 227.064 280.289 1.00 133.97 ? 61  VAL O CA     1 
ATOM   4709   C  C      . VAL B  2  62  ? 311.678 225.673 279.680 1.00 143.41 ? 61  VAL O C      1 
ATOM   4710   O  O      . VAL B  2  62  ? 312.030 224.697 280.348 1.00 167.62 ? 61  VAL O O      1 
ATOM   4711   C  CB     . VAL B  2  62  ? 312.840 227.893 279.918 1.00 140.69 ? 61  VAL O CB     1 
ATOM   4712   C  CG1    . VAL B  2  62  ? 312.605 229.365 280.235 1.00 163.44 ? 61  VAL O CG1    1 
ATOM   4713   C  CG2    . VAL B  2  62  ? 314.072 227.347 280.651 1.00 121.98 ? 61  VAL O CG2    1 
ATOM   4714   H  H      . VAL B  2  62  ? 312.109 226.530 282.102 1.00 115.28 ? 61  VAL O H      1 
ATOM   4715   H  HA     . VAL B  2  62  ? 310.814 227.509 279.925 1.00 112.10 ? 61  VAL O HA     1 
ATOM   4716   H  HB     . VAL B  2  62  ? 313.000 227.814 278.965 1.00 118.61 ? 61  VAL O HB     1 
ATOM   4717   H  HG11   . VAL B  2  62  ? 313.399 229.870 279.996 1.00 141.94 ? 61  VAL O HG11   1 
ATOM   4718   H  HG12   . VAL B  2  62  ? 311.845 229.681 279.722 1.00 141.94 ? 61  VAL O HG12   1 
ATOM   4719   H  HG13   . VAL B  2  62  ? 312.427 229.459 281.184 1.00 141.94 ? 61  VAL O HG13   1 
ATOM   4720   H  HG21   . VAL B  2  62  ? 314.846 227.880 280.408 1.00 98.78  ? 61  VAL O HG21   1 
ATOM   4721   H  HG22   . VAL B  2  62  ? 313.920 227.403 281.608 1.00 98.78  ? 61  VAL O HG22   1 
ATOM   4722   H  HG23   . VAL B  2  62  ? 314.211 226.423 280.391 1.00 98.78  ? 61  VAL O HG23   1 
ATOM   4723   N  N      . HIS B  2  63  ? 311.351 225.592 278.392 1.00 105.75 ? 62  HIS O N      1 
ATOM   4724   C  CA     . HIS B  2  63  ? 311.496 224.351 277.650 1.00 106.26 ? 62  HIS O CA     1 
ATOM   4725   C  C      . HIS B  2  63  ? 312.014 224.630 276.252 1.00 92.42  ? 62  HIS O C      1 
ATOM   4726   O  O      . HIS B  2  63  ? 311.861 225.725 275.707 1.00 90.80  ? 62  HIS O O      1 
ATOM   4727   C  CB     . HIS B  2  63  ? 310.177 223.591 277.556 1.00 119.49 ? 62  HIS O CB     1 
ATOM   4728   C  CG     . HIS B  2  63  ? 309.525 223.384 278.880 1.00 138.19 ? 62  HIS O CG     1 
ATOM   4729   N  ND1    . HIS B  2  63  ? 308.862 224.394 279.543 1.00 143.53 ? 62  HIS O ND1    1 
ATOM   4730   C  CD2    . HIS B  2  63  ? 309.463 222.297 279.685 1.00 158.85 ? 62  HIS O CD2    1 
ATOM   4731   C  CE1    . HIS B  2  63  ? 308.402 223.932 280.691 1.00 156.48 ? 62  HIS O CE1    1 
ATOM   4732   N  NE2    . HIS B  2  63  ? 308.754 222.663 280.803 1.00 165.46 ? 62  HIS O NE2    1 
ATOM   4733   H  H      . HIS B  2  63  ? 311.042 226.247 277.927 1.00 99.55  ? 62  HIS O H      1 
ATOM   4734   H  HA     . HIS B  2  63  ? 312.139 223.783 278.103 1.00 99.74  ? 62  HIS O HA     1 
ATOM   4735   H  HB2    . HIS B  2  63  ? 309.564 224.093 276.997 1.00 113.40 ? 62  HIS O HB2    1 
ATOM   4736   H  HB3    . HIS B  2  63  ? 310.344 222.719 277.166 1.00 113.40 ? 62  HIS O HB3    1 
ATOM   4737   H  HD2    . HIS B  2  63  ? 309.825 221.459 279.510 1.00 151.91 ? 62  HIS O HD2    1 
ATOM   4738   H  HE1    . HIS B  2  63  ? 307.914 224.418 281.317 1.00 150.41 ? 62  HIS O HE1    1 
ATOM   4739   H  HE2    . HIS B  2  63  ? 308.568 222.149 281.467 1.00 158.66 ? 62  HIS O HE2    1 
ATOM   4740   N  N      . LYS B  2  64  ? 312.628 223.604 275.678 1.00 68.22  ? 63  LYS O N      1 
ATOM   4741   C  CA     . LYS B  2  64  ? 313.108 223.641 274.309 1.00 70.05  ? 63  LYS O CA     1 
ATOM   4742   C  C      . LYS B  2  64  ? 312.228 222.839 273.362 1.00 64.19  ? 63  LYS O C      1 
ATOM   4743   O  O      . LYS B  2  64  ? 312.578 222.687 272.189 1.00 62.56  ? 63  LYS O O      1 
ATOM   4744   C  CB     . LYS B  2  64  ? 314.537 223.112 274.241 1.00 73.83  ? 63  LYS O CB     1 
ATOM   4745   C  CG     . LYS B  2  64  ? 315.560 223.971 274.928 1.00 81.99  ? 63  LYS O CG     1 
ATOM   4746   C  CD     . LYS B  2  64  ? 316.920 223.560 274.435 1.00 106.61 ? 63  LYS O CD     1 
ATOM   4747   C  CE     . LYS B  2  64  ? 318.031 224.297 275.134 1.00 135.77 ? 63  LYS O CE     1 
ATOM   4748   N  NZ     . LYS B  2  64  ? 318.152 225.688 274.632 1.00 150.73 ? 63  LYS O NZ     1 
ATOM   4749   H  H      . LYS B  2  64  ? 312.780 222.856 276.074 1.00 67.88  ? 63  LYS O H      1 
ATOM   4750   H  HA     . LYS B  2  64  ? 313.115 224.561 274.003 1.00 69.88  ? 63  LYS O HA     1 
ATOM   4751   H  HB2    . LYS B  2  64  ? 314.562 222.236 274.658 1.00 72.68  ? 63  LYS O HB2    1 
ATOM   4752   H  HB3    . LYS B  2  64  ? 314.795 223.037 273.309 1.00 72.68  ? 63  LYS O HB3    1 
ATOM   4753   H  HG2    . LYS B  2  64  ? 315.413 224.904 274.704 1.00 80.40  ? 63  LYS O HG2    1 
ATOM   4754   H  HG3    . LYS B  2  64  ? 315.517 223.834 275.887 1.00 80.40  ? 63  LYS O HG3    1 
ATOM   4755   H  HD2    . LYS B  2  64  ? 317.042 222.611 274.595 1.00 104.23 ? 63  LYS O HD2    1 
ATOM   4756   H  HD3    . LYS B  2  64  ? 316.984 223.748 273.486 1.00 104.23 ? 63  LYS O HD3    1 
ATOM   4757   H  HE2    . LYS B  2  64  ? 317.844 224.332 276.085 1.00 132.85 ? 63  LYS O HE2    1 
ATOM   4758   H  HE3    . LYS B  2  64  ? 318.871 223.840 274.972 1.00 132.85 ? 63  LYS O HE3    1 
ATOM   4759   H  HZ1    . LYS B  2  64  ? 318.812 226.108 275.055 1.00 148.45 ? 63  LYS O HZ1    1 
ATOM   4760   H  HZ2    . LYS B  2  64  ? 318.326 225.682 273.759 1.00 148.45 ? 63  LYS O HZ2    1 
ATOM   4761   H  HZ3    . LYS B  2  64  ? 317.392 226.129 274.772 1.00 148.45 ? 63  LYS O HZ3    1 
ATOM   4762   N  N      . VAL B  2  65  ? 311.112 222.311 273.840 1.00 47.24  ? 64  VAL O N      1 
ATOM   4763   C  CA     . VAL B  2  65  ? 310.156 221.602 272.997 1.00 45.28  ? 64  VAL O CA     1 
ATOM   4764   C  C      . VAL B  2  65  ? 308.839 222.352 273.122 1.00 54.62  ? 64  VAL O C      1 
ATOM   4765   O  O      . VAL B  2  65  ? 307.959 221.990 273.911 1.00 66.57  ? 64  VAL O O      1 
ATOM   4766   C  CB     . VAL B  2  65  ? 309.994 220.130 273.374 1.00 47.94  ? 64  VAL O CB     1 
ATOM   4767   C  CG1    . VAL B  2  65  ? 310.906 219.281 272.515 1.00 48.75  ? 64  VAL O CG1    1 
ATOM   4768   C  CG2    . VAL B  2  65  ? 310.254 219.931 274.863 1.00 69.59  ? 64  VAL O CG2    1 
ATOM   4769   H  H      . VAL B  2  65  ? 310.880 222.348 274.667 1.00 55.05  ? 64  VAL O H      1 
ATOM   4770   H  HA     . VAL B  2  65  ? 310.447 221.649 272.073 1.00 53.58  ? 64  VAL O HA     1 
ATOM   4771   H  HB     . VAL B  2  65  ? 309.080 219.860 273.194 1.00 55.61  ? 64  VAL O HB     1 
ATOM   4772   H  HG11   . VAL B  2  65  ? 310.795 218.349 272.763 1.00 55.84  ? 64  VAL O HG11   1 
ATOM   4773   H  HG12   . VAL B  2  65  ? 310.668 219.406 271.583 1.00 55.84  ? 64  VAL O HG12   1 
ATOM   4774   H  HG13   . VAL B  2  65  ? 311.824 219.556 272.663 1.00 55.84  ? 64  VAL O HG13   1 
ATOM   4775   H  HG21   . VAL B  2  65  ? 310.146 218.992 275.079 1.00 76.58  ? 64  VAL O HG21   1 
ATOM   4776   H  HG22   . VAL B  2  65  ? 311.159 220.216 275.065 1.00 76.58  ? 64  VAL O HG22   1 
ATOM   4777   H  HG23   . VAL B  2  65  ? 309.619 220.462 275.368 1.00 76.58  ? 64  VAL O HG23   1 
ATOM   4778   N  N      . GLU B  2  66  ? 308.706 223.330 272.390 1.00 57.61  ? 65  GLU O N      1 
ATOM   4779   C  CA     . GLU B  2  66  ? 307.450 224.044 272.444 1.00 56.89  ? 65  GLU O CA     1 
ATOM   4780   C  C      . GLU B  2  66  ? 306.463 223.408 271.471 1.00 56.52  ? 65  GLU O C      1 
ATOM   4781   O  O      . GLU B  2  66  ? 306.836 223.043 270.352 1.00 55.14  ? 65  GLU O O      1 
ATOM   4782   C  CB     . GLU B  2  66  ? 307.629 225.500 272.077 1.00 91.52  ? 65  GLU O CB     1 
ATOM   4783   C  CG     . GLU B  2  66  ? 308.573 226.236 273.000 1.00 131.79 ? 65  GLU O CG     1 
ATOM   4784   C  CD     . GLU B  2  66  ? 307.971 226.515 274.357 1.00 166.42 ? 65  GLU O CD     1 
ATOM   4785   O  OE1    . GLU B  2  66  ? 308.708 226.392 275.360 1.00 180.58 ? 65  GLU O OE1    1 
ATOM   4786   O  OE2    . GLU B  2  66  ? 306.767 226.845 274.423 1.00 179.26 ? 65  GLU O OE2    1 
ATOM   4787   H  H      . GLU B  2  66  ? 309.292 223.638 271.840 1.00 52.40  ? 65  GLU O H      1 
ATOM   4788   H  HA     . GLU B  2  66  ? 307.082 223.991 273.339 1.00 52.60  ? 65  GLU O HA     1 
ATOM   4789   H  HB2    . GLU B  2  66  ? 307.987 225.557 271.178 1.00 87.80  ? 65  GLU O HB2    1 
ATOM   4790   H  HB3    . GLU B  2  66  ? 306.766 225.943 272.118 1.00 87.80  ? 65  GLU O HB3    1 
ATOM   4791   H  HG2    . GLU B  2  66  ? 309.369 225.698 273.131 1.00 127.58 ? 65  GLU O HG2    1 
ATOM   4792   H  HG3    . GLU B  2  66  ? 308.810 227.086 272.597 1.00 127.58 ? 65  GLU O HG3    1 
ATOM   4793   N  N      . PRO B  2  67  ? 305.223 223.237 271.911 1.00 45.69  ? 66  PRO O N      1 
ATOM   4794   C  CA     . PRO B  2  67  ? 304.147 222.892 270.981 1.00 43.74  ? 66  PRO O CA     1 
ATOM   4795   C  C      . PRO B  2  67  ? 303.583 224.123 270.277 1.00 40.80  ? 66  PRO O C      1 
ATOM   4796   O  O      . PRO B  2  67  ? 303.358 225.175 270.880 1.00 40.78  ? 66  PRO O O      1 
ATOM   4797   C  CB     . PRO B  2  67  ? 303.099 222.240 271.894 1.00 45.76  ? 66  PRO O CB     1 
ATOM   4798   C  CG     . PRO B  2  67  ? 303.435 222.704 273.283 1.00 48.12  ? 66  PRO O CG     1 
ATOM   4799   C  CD     . PRO B  2  67  ? 304.891 222.931 273.309 1.00 48.64  ? 66  PRO O CD     1 
ATOM   4800   H  HA     . PRO B  2  67  ? 304.454 222.249 270.323 1.00 47.35  ? 66  PRO O HA     1 
ATOM   4801   H  HB2    . PRO B  2  67  ? 302.212 222.540 271.638 1.00 49.37  ? 66  PRO O HB2    1 
ATOM   4802   H  HB3    . PRO B  2  67  ? 303.166 221.275 271.830 1.00 49.37  ? 66  PRO O HB3    1 
ATOM   4803   H  HG2    . PRO B  2  67  ? 302.960 223.529 273.471 1.00 51.31  ? 66  PRO O HG2    1 
ATOM   4804   H  HG3    . PRO B  2  67  ? 303.187 222.017 273.921 1.00 51.31  ? 66  PRO O HG3    1 
ATOM   4805   H  HD2    . PRO B  2  67  ? 305.105 223.687 273.878 1.00 51.17  ? 66  PRO O HD2    1 
ATOM   4806   H  HD3    . PRO B  2  67  ? 305.352 222.128 273.597 1.00 51.17  ? 66  PRO O HD3    1 
ATOM   4807   N  N      . ILE B  2  68  ? 303.376 223.980 268.970 1.00 55.11  ? 67  ILE O N      1 
ATOM   4808   C  CA     . ILE B  2  68  ? 302.770 225.018 268.149 1.00 49.54  ? 67  ILE O CA     1 
ATOM   4809   C  C      . ILE B  2  68  ? 301.277 224.785 267.969 1.00 62.48  ? 67  ILE O C      1 
ATOM   4810   O  O      . ILE B  2  68  ? 300.484 225.723 268.066 1.00 78.71  ? 67  ILE O O      1 
ATOM   4811   C  CB     . ILE B  2  68  ? 303.480 225.102 266.780 1.00 46.55  ? 67  ILE O CB     1 
ATOM   4812   C  CG1    . ILE B  2  68  ? 304.992 225.319 266.942 1.00 64.99  ? 67  ILE O CG1    1 
ATOM   4813   C  CG2    . ILE B  2  68  ? 302.879 226.221 265.937 1.00 43.27  ? 67  ILE O CG2    1 
ATOM   4814   C  CD1    . ILE B  2  68  ? 305.373 226.557 267.730 1.00 85.51  ? 67  ILE O CD1    1 
ATOM   4815   H  H      . ILE B  2  68  ? 303.584 223.273 268.529 1.00 56.37  ? 67  ILE O H      1 
ATOM   4816   H  HA     . ILE B  2  68  ? 302.884 225.872 268.594 1.00 51.73  ? 67  ILE O HA     1 
ATOM   4817   H  HB     . ILE B  2  68  ? 303.342 224.262 266.315 1.00 48.80  ? 67  ILE O HB     1 
ATOM   4818   H  HG12   . ILE B  2  68  ? 305.368 224.552 267.401 1.00 66.50  ? 67  ILE O HG12   1 
ATOM   4819   H  HG13   . ILE B  2  68  ? 305.390 225.399 266.060 1.00 66.50  ? 67  ILE O HG13   1 
ATOM   4820   H  HG21   . ILE B  2  68  ? 303.340 226.255 265.084 1.00 46.45  ? 67  ILE O HG21   1 
ATOM   4821   H  HG22   . ILE B  2  68  ? 301.937 226.039 265.798 1.00 46.45  ? 67  ILE O HG22   1 
ATOM   4822   H  HG23   . ILE B  2  68  ? 302.989 227.063 266.406 1.00 46.45  ? 67  ILE O HG23   1 
ATOM   4823   H  HD11   . ILE B  2  68  ? 306.340 226.613 267.781 1.00 87.06  ? 67  ILE O HD11   1 
ATOM   4824   H  HD12   . ILE B  2  68  ? 305.019 227.339 267.279 1.00 87.06  ? 67  ILE O HD12   1 
ATOM   4825   H  HD13   . ILE B  2  68  ? 304.998 226.491 268.622 1.00 87.06  ? 67  ILE O HD13   1 
ATOM   4826   N  N      . THR B  2  69  ? 300.887 223.547 267.690 1.00 69.90  ? 68  THR O N      1 
ATOM   4827   C  CA     . THR B  2  69  ? 299.483 223.181 267.551 1.00 84.47  ? 68  THR O CA     1 
ATOM   4828   C  C      . THR B  2  69  ? 299.272 221.939 268.414 1.00 75.17  ? 68  THR O C      1 
ATOM   4829   O  O      . THR B  2  69  ? 300.015 221.646 269.354 1.00 76.88  ? 68  THR O O      1 
ATOM   4830   C  CB     . THR B  2  69  ? 299.121 222.960 266.075 1.00 112.21 ? 68  THR O CB     1 
ATOM   4831   O  OG1    . THR B  2  69  ? 300.071 223.634 265.241 1.00 151.99 ? 68  THR O OG1    1 
ATOM   4832   C  CG2    . THR B  2  69  ? 297.730 223.496 265.786 1.00 97.34  ? 68  THR O CG2    1 
ATOM   4833   H  H      . THR B  2  69  ? 301.428 222.889 267.575 1.00 72.86  ? 68  THR O H      1 
ATOM   4834   H  HA     . THR B  2  69  ? 298.927 223.895 267.900 1.00 88.02  ? 68  THR O HA     1 
ATOM   4835   H  HB     . THR B  2  69  ? 299.133 222.010 265.876 1.00 116.28 ? 68  THR O HB     1 
ATOM   4836   H  HG1    . THR B  2  69  ? 299.877 223.517 264.432 1.00 156.07 ? 68  THR O HG1    1 
ATOM   4837   H  HG21   . THR B  2  69  ? 297.507 223.354 264.853 1.00 102.35 ? 68  THR O HG21   1 
ATOM   4838   H  HG22   . THR B  2  69  ? 297.077 223.039 266.340 1.00 102.35 ? 68  THR O HG22   1 
ATOM   4839   H  HG23   . THR B  2  69  ? 297.695 224.446 265.978 1.00 102.35 ? 68  THR O HG23   1 
ATOM   4840   N  N      . LYS B  2  70  ? 298.233 221.174 268.092 1.00 93.39  ? 69  LYS O N      1 
ATOM   4841   C  CA     . LYS B  2  70  ? 298.005 219.882 268.720 1.00 97.04  ? 69  LYS O CA     1 
ATOM   4842   C  C      . LYS B  2  70  ? 298.596 218.746 267.892 1.00 98.85  ? 69  LYS O C      1 
ATOM   4843   O  O      . LYS B  2  70  ? 298.045 217.641 267.869 1.00 101.00 ? 69  LYS O O      1 
ATOM   4844   C  CB     . LYS B  2  70  ? 296.509 219.650 268.946 1.00 97.40  ? 69  LYS O CB     1 
ATOM   4845   C  CG     . LYS B  2  70  ? 295.793 220.799 269.665 1.00 121.12 ? 69  LYS O CG     1 
ATOM   4846   C  CD     . LYS B  2  70  ? 294.297 220.509 269.842 1.00 150.83 ? 69  LYS O CD     1 
ATOM   4847   C  CE     . LYS B  2  70  ? 293.476 221.729 270.300 1.00 174.85 ? 69  LYS O CE     1 
ATOM   4848   N  NZ     . LYS B  2  70  ? 293.243 222.774 269.253 1.00 186.08 ? 69  LYS O NZ     1 
ATOM   4849   H  H      . LYS B  2  70  ? 297.640 221.386 267.506 1.00 82.75  ? 69  LYS O H      1 
ATOM   4850   H  HA     . LYS B  2  70  ? 298.441 219.875 269.587 1.00 85.84  ? 69  LYS O HA     1 
ATOM   4851   H  HB2    . LYS B  2  70  ? 296.080 219.529 268.084 1.00 86.76  ? 69  LYS O HB2    1 
ATOM   4852   H  HB3    . LYS B  2  70  ? 296.396 218.850 269.482 1.00 86.76  ? 69  LYS O HB3    1 
ATOM   4853   H  HG2    . LYS B  2  70  ? 296.184 220.919 270.544 1.00 111.03 ? 69  LYS O HG2    1 
ATOM   4854   H  HG3    . LYS B  2  70  ? 295.885 221.611 269.143 1.00 111.03 ? 69  LYS O HG3    1 
ATOM   4855   H  HD2    . LYS B  2  70  ? 293.934 220.210 268.993 1.00 141.27 ? 69  LYS O HD2    1 
ATOM   4856   H  HD3    . LYS B  2  70  ? 294.190 219.812 270.508 1.00 141.27 ? 69  LYS O HD3    1 
ATOM   4857   H  HE2    . LYS B  2  70  ? 292.608 221.420 270.602 1.00 165.97 ? 69  LYS O HE2    1 
ATOM   4858   H  HE3    . LYS B  2  70  ? 293.943 222.154 271.037 1.00 165.97 ? 69  LYS O HE3    1 
ATOM   4859   H  HZ1    . LYS B  2  70  ? 292.764 223.443 269.593 1.00 178.00 ? 69  LYS O HZ1    1 
ATOM   4860   H  HZ2    . LYS B  2  70  ? 294.021 223.093 268.964 1.00 178.00 ? 69  LYS O HZ2    1 
ATOM   4861   H  HZ3    . LYS B  2  70  ? 292.800 222.421 268.566 1.00 178.00 ? 69  LYS O HZ3    1 
ATOM   4862   N  N      . HIS B  2  71  ? 299.712 219.015 267.204 1.00 87.07  ? 70  HIS O N      1 
ATOM   4863   C  CA     . HIS B  2  71  ? 300.437 218.014 266.426 1.00 88.47  ? 70  HIS O CA     1 
ATOM   4864   C  C      . HIS B  2  71  ? 301.579 218.662 265.651 1.00 85.72  ? 70  HIS O C      1 
ATOM   4865   O  O      . HIS B  2  71  ? 301.865 218.263 264.517 1.00 85.83  ? 70  HIS O O      1 
ATOM   4866   C  CB     . HIS B  2  71  ? 299.501 217.296 265.460 1.00 102.94 ? 70  HIS O CB     1 
ATOM   4867   C  CG     . HIS B  2  71  ? 298.678 218.235 264.643 1.00 122.04 ? 70  HIS O CG     1 
ATOM   4868   N  ND1    . HIS B  2  71  ? 299.187 219.407 264.124 1.00 123.27 ? 70  HIS O ND1    1 
ATOM   4869   C  CD2    . HIS B  2  71  ? 297.378 218.193 264.272 1.00 141.04 ? 70  HIS O CD2    1 
ATOM   4870   C  CE1    . HIS B  2  71  ? 298.240 220.037 263.454 1.00 130.14 ? 70  HIS O CE1    1 
ATOM   4871   N  NE2    . HIS B  2  71  ? 297.132 219.321 263.529 1.00 139.26 ? 70  HIS O NE2    1 
ATOM   4872   H  H      . HIS B  2  71  ? 300.076 219.795 267.175 1.00 83.40  ? 70  HIS O H      1 
ATOM   4873   H  HA     . HIS B  2  71  ? 300.816 217.354 267.028 1.00 84.27  ? 70  HIS O HA     1 
ATOM   4874   H  HB2    . HIS B  2  71  ? 300.029 216.755 264.852 1.00 99.20  ? 70  HIS O HB2    1 
ATOM   4875   H  HB3    . HIS B  2  71  ? 298.897 216.732 265.967 1.00 99.20  ? 70  HIS O HB3    1 
ATOM   4876   H  HD2    . HIS B  2  71  ? 296.768 217.520 264.473 1.00 139.03 ? 70  HIS O HD2    1 
ATOM   4877   H  HE1    . HIS B  2  71  ? 298.336 220.848 263.009 1.00 128.63 ? 70  HIS O HE1    1 
ATOM   4878   H  HE2    . HIS B  2  71  ? 296.378 219.530 263.172 1.00 138.01 ? 70  HIS O HE2    1 
ATOM   4879   N  N      . ILE B  2  72  ? 302.226 219.669 266.239 1.00 51.45  ? 71  ILE O N      1 
ATOM   4880   C  CA     . ILE B  2  72  ? 303.417 220.279 265.653 1.00 44.61  ? 71  ILE O CA     1 
ATOM   4881   C  C      . ILE B  2  72  ? 304.319 220.795 266.761 1.00 59.71  ? 71  ILE O C      1 
ATOM   4882   O  O      . ILE B  2  72  ? 303.947 221.717 267.492 1.00 89.73  ? 71  ILE O O      1 
ATOM   4883   C  CB     . ILE B  2  72  ? 303.051 221.421 264.695 1.00 41.23  ? 71  ILE O CB     1 
ATOM   4884   C  CG1    . ILE B  2  72  ? 302.246 220.870 263.519 1.00 41.61  ? 71  ILE O CG1    1 
ATOM   4885   C  CG2    . ILE B  2  72  ? 304.324 222.135 264.235 1.00 40.08  ? 71  ILE O CG2    1 
ATOM   4886   C  CD1    . ILE B  2  72  ? 302.019 221.841 262.404 1.00 38.43  ? 71  ILE O CD1    1 
ATOM   4887   H  H      . ILE B  2  72  ? 301.990 220.020 266.988 1.00 50.96  ? 71  ILE O H      1 
ATOM   4888   H  HA     . ILE B  2  72  ? 303.905 219.608 265.152 1.00 43.91  ? 71  ILE O HA     1 
ATOM   4889   H  HB     . ILE B  2  72  ? 302.498 222.059 265.173 1.00 41.42  ? 71  ILE O HB     1 
ATOM   4890   H  HG12   . ILE B  2  72  ? 302.719 220.106 263.152 1.00 42.32  ? 71  ILE O HG12   1 
ATOM   4891   H  HG13   . ILE B  2  72  ? 301.377 220.589 263.845 1.00 42.32  ? 71  ILE O HG13   1 
ATOM   4892   H  HG21   . ILE B  2  72  ? 304.082 222.854 263.631 1.00 40.01  ? 71  ILE O HG21   1 
ATOM   4893   H  HG22   . ILE B  2  72  ? 304.782 222.494 265.011 1.00 40.01  ? 71  ILE O HG22   1 
ATOM   4894   H  HG23   . ILE B  2  72  ? 304.896 221.497 263.780 1.00 40.01  ? 71  ILE O HG23   1 
ATOM   4895   H  HD11   . ILE B  2  72  ? 301.503 221.405 261.707 1.00 39.91  ? 71  ILE O HD11   1 
ATOM   4896   H  HD12   . ILE B  2  72  ? 301.533 222.607 262.747 1.00 39.91  ? 71  ILE O HD12   1 
ATOM   4897   H  HD13   . ILE B  2  72  ? 302.878 222.123 262.052 1.00 39.91  ? 71  ILE O HD13   1 
ATOM   4898   N  N      . GLY B  2  73  ? 305.520 220.238 266.871 1.00 51.40  ? 72  GLY O N      1 
ATOM   4899   C  CA     . GLY B  2  73  ? 306.463 220.702 267.871 1.00 51.17  ? 72  GLY O CA     1 
ATOM   4900   C  C      . GLY B  2  73  ? 307.719 221.323 267.303 1.00 49.16  ? 72  GLY O C      1 
ATOM   4901   O  O      . GLY B  2  73  ? 308.119 221.031 266.170 1.00 57.72  ? 72  GLY O O      1 
ATOM   4902   H  H      . GLY B  2  73  ? 305.809 219.593 266.380 1.00 51.77  ? 72  GLY O H      1 
ATOM   4903   H  HA2    . GLY B  2  73  ? 306.028 221.363 268.433 1.00 50.94  ? 72  GLY O HA2    1 
ATOM   4904   H  HA3    . GLY B  2  73  ? 306.724 219.954 268.431 1.00 50.94  ? 72  GLY O HA3    1 
ATOM   4905   N  N      . LEU B  2  74  ? 308.354 222.183 268.093 1.00 42.33  ? 73  LEU O N      1 
ATOM   4906   C  CA     . LEU B  2  74  ? 309.639 222.757 267.741 1.00 42.50  ? 73  LEU O CA     1 
ATOM   4907   C  C      . LEU B  2  74  ? 310.704 222.319 268.723 1.00 45.75  ? 73  LEU O C      1 
ATOM   4908   O  O      . LEU B  2  74  ? 310.426 221.929 269.858 1.00 65.12  ? 73  LEU O O      1 
ATOM   4909   C  CB     . LEU B  2  74  ? 309.620 224.281 267.740 1.00 40.72  ? 73  LEU O CB     1 
ATOM   4910   C  CG     . LEU B  2  74  ? 308.696 224.976 266.754 1.00 38.72  ? 73  LEU O CG     1 
ATOM   4911   C  CD1    . LEU B  2  74  ? 308.918 226.462 266.871 1.00 38.31  ? 73  LEU O CD1    1 
ATOM   4912   C  CD2    . LEU B  2  74  ? 308.942 224.522 265.333 1.00 38.64  ? 73  LEU O CD2    1 
ATOM   4913   H  H      . LEU B  2  74  ? 308.052 222.452 268.851 1.00 44.99  ? 73  LEU O H      1 
ATOM   4914   H  HA     . LEU B  2  74  ? 309.895 222.453 266.856 1.00 44.79  ? 73  LEU O HA     1 
ATOM   4915   H  HB2    . LEU B  2  74  ? 309.363 224.578 268.627 1.00 43.61  ? 73  LEU O HB2    1 
ATOM   4916   H  HB3    . LEU B  2  74  ? 310.520 224.591 267.551 1.00 43.61  ? 73  LEU O HB3    1 
ATOM   4917   H  HG     . LEU B  2  74  ? 307.774 224.783 266.984 1.00 41.58  ? 73  LEU O HG     1 
ATOM   4918   H  HD11   . LEU B  2  74  ? 308.333 226.918 266.246 1.00 41.03  ? 73  LEU O HD11   1 
ATOM   4919   H  HD12   . LEU B  2  74  ? 308.716 226.741 267.777 1.00 41.03  ? 73  LEU O HD12   1 
ATOM   4920   H  HD13   . LEU B  2  74  ? 309.844 226.660 266.662 1.00 41.03  ? 73  LEU O HD13   1 
ATOM   4921   H  HD21   . LEU B  2  74  ? 308.332 224.991 264.743 1.00 40.63  ? 73  LEU O HD21   1 
ATOM   4922   H  HD22   . LEU B  2  74  ? 309.859 224.726 265.091 1.00 40.63  ? 73  LEU O HD22   1 
ATOM   4923   H  HD23   . LEU B  2  74  ? 308.789 223.566 265.277 1.00 40.63  ? 73  LEU O HD23   1 
ATOM   4924   N  N      . VAL B  2  75  ? 311.935 222.381 268.236 1.00 43.18  ? 74  VAL O N      1 
ATOM   4925   C  CA     . VAL B  2  75  ? 313.137 222.457 269.052 1.00 45.98  ? 74  VAL O CA     1 
ATOM   4926   C  C      . VAL B  2  75  ? 314.086 223.343 268.273 1.00 45.22  ? 74  VAL O C      1 
ATOM   4927   O  O      . VAL B  2  75  ? 313.839 223.677 267.115 1.00 55.67  ? 74  VAL O O      1 
ATOM   4928   C  CB     . VAL B  2  75  ? 313.799 221.094 269.317 1.00 49.30  ? 74  VAL O CB     1 
ATOM   4929   C  CG1    . VAL B  2  75  ? 312.908 220.227 270.174 1.00 124.84 ? 74  VAL O CG1    1 
ATOM   4930   C  CG2    . VAL B  2  75  ? 314.136 220.425 267.988 1.00 48.99  ? 74  VAL O CG2    1 
ATOM   4931   H  H      . VAL B  2  75  ? 312.106 222.381 267.393 1.00 47.40  ? 74  VAL O H      1 
ATOM   4932   H  HA     . VAL B  2  75  ? 312.935 222.881 269.901 1.00 49.34  ? 74  VAL O HA     1 
ATOM   4933   H  HB     . VAL B  2  75  ? 314.629 221.236 269.798 1.00 51.66  ? 74  VAL O HB     1 
ATOM   4934   H  HG11   . VAL B  2  75  ? 313.348 219.376 270.326 1.00 127.10 ? 74  VAL O HG11   1 
ATOM   4935   H  HG12   . VAL B  2  75  ? 312.753 220.675 271.021 1.00 127.10 ? 74  VAL O HG12   1 
ATOM   4936   H  HG13   . VAL B  2  75  ? 312.066 220.087 269.714 1.00 127.10 ? 74  VAL O HG13   1 
ATOM   4937   H  HG21   . VAL B  2  75  ? 314.553 219.566 268.163 1.00 51.25  ? 74  VAL O HG21   1 
ATOM   4938   H  HG22   . VAL B  2  75  ? 313.319 220.299 267.481 1.00 51.25  ? 74  VAL O HG22   1 
ATOM   4939   H  HG23   . VAL B  2  75  ? 314.747 220.994 267.494 1.00 51.25  ? 74  VAL O HG23   1 
ATOM   4940   N  N      . TYR B  2  76  ? 315.196 223.700 268.887 1.00 51.91  ? 75  TYR O N      1 
ATOM   4941   C  CA     . TYR B  2  76  ? 316.106 224.582 268.192 1.00 51.56  ? 75  TYR O CA     1 
ATOM   4942   C  C      . TYR B  2  76  ? 317.508 224.425 268.736 1.00 67.45  ? 75  TYR O C      1 
ATOM   4943   O  O      . TYR B  2  76  ? 317.754 223.745 269.737 1.00 69.53  ? 75  TYR O O      1 
ATOM   4944   C  CB     . TYR B  2  76  ? 315.664 226.033 268.337 1.00 49.60  ? 75  TYR O CB     1 
ATOM   4945   C  CG     . TYR B  2  76  ? 315.957 226.570 269.710 1.00 51.79  ? 75  TYR O CG     1 
ATOM   4946   C  CD1    . TYR B  2  76  ? 315.150 226.236 270.790 1.00 64.68  ? 75  TYR O CD1    1 
ATOM   4947   C  CD2    . TYR B  2  76  ? 317.053 227.392 269.935 1.00 53.53  ? 75  TYR O CD2    1 
ATOM   4948   C  CE1    . TYR B  2  76  ? 315.418 226.716 272.053 1.00 70.72  ? 75  TYR O CE1    1 
ATOM   4949   C  CE2    . TYR B  2  76  ? 317.333 227.877 271.194 1.00 55.88  ? 75  TYR O CE2    1 
ATOM   4950   C  CZ     . TYR B  2  76  ? 316.510 227.536 272.253 1.00 86.94  ? 75  TYR O CZ     1 
ATOM   4951   O  OH     . TYR B  2  76  ? 316.774 228.012 273.516 1.00 94.02  ? 75  TYR O OH     1 
ATOM   4952   H  H      . TYR B  2  76  ? 315.440 223.457 269.675 1.00 50.28  ? 75  TYR O H      1 
ATOM   4953   H  HA     . TYR B  2  76  ? 316.117 224.357 267.248 1.00 49.96  ? 75  TYR O HA     1 
ATOM   4954   H  HB2    . TYR B  2  76  ? 316.140 226.578 267.691 1.00 48.78  ? 75  TYR O HB2    1 
ATOM   4955   H  HB3    . TYR B  2  76  ? 314.708 226.092 268.186 1.00 48.78  ? 75  TYR O HB3    1 
ATOM   4956   H  HD1    . TYR B  2  76  ? 314.414 225.683 270.657 1.00 63.55  ? 75  TYR O HD1    1 
ATOM   4957   H  HD2    . TYR B  2  76  ? 317.606 227.621 269.223 1.00 52.01  ? 75  TYR O HD2    1 
ATOM   4958   H  HE1    . TYR B  2  76  ? 314.867 226.488 272.767 1.00 69.27  ? 75  TYR O HE1    1 
ATOM   4959   H  HE2    . TYR B  2  76  ? 318.068 228.431 271.331 1.00 54.04  ? 75  TYR O HE2    1 
ATOM   4960   H  HH     . TYR B  2  76  ? 317.460 228.496 273.504 1.00 91.89  ? 75  TYR O HH     1 
ATOM   4961   N  N      . SER B  2  77  ? 318.423 225.068 268.033 1.00 65.50  ? 76  SER O N      1 
ATOM   4962   C  CA     . SER B  2  77  ? 319.697 225.480 268.578 1.00 86.58  ? 76  SER O CA     1 
ATOM   4963   C  C      . SER B  2  77  ? 319.983 226.844 267.981 1.00 78.92  ? 76  SER O C      1 
ATOM   4964   O  O      . SER B  2  77  ? 319.467 227.204 266.923 1.00 75.09  ? 76  SER O O      1 
ATOM   4965   C  CB     . SER B  2  77  ? 320.813 224.476 268.275 1.00 122.52 ? 76  SER O CB     1 
ATOM   4966   O  OG     . SER B  2  77  ? 321.153 224.473 266.902 1.00 147.27 ? 76  SER O OG     1 
ATOM   4967   H  H      . SER B  2  77  ? 318.322 225.283 267.206 1.00 62.67  ? 76  SER O H      1 
ATOM   4968   H  HA     . SER B  2  77  ? 319.621 225.574 269.540 1.00 83.02  ? 76  SER O HA     1 
ATOM   4969   H  HB2    . SER B  2  77  ? 321.598 224.715 268.792 1.00 117.97 ? 76  SER O HB2    1 
ATOM   4970   H  HB3    . SER B  2  77  ? 320.512 223.588 268.525 1.00 117.97 ? 76  SER O HB3    1 
ATOM   4971   H  HG     . SER B  2  77  ? 321.766 223.916 266.759 1.00 142.87 ? 76  SER O HG     1 
ATOM   4972   N  N      . GLY B  2  78  ? 320.788 227.618 268.686 1.00 104.72 ? 77  GLY O N      1 
ATOM   4973   C  CA     . GLY B  2  78  ? 320.965 229.000 268.296 1.00 102.66 ? 77  GLY O CA     1 
ATOM   4974   C  C      . GLY B  2  78  ? 320.702 229.924 269.461 1.00 100.55 ? 77  GLY O C      1 
ATOM   4975   O  O      . GLY B  2  78  ? 321.136 229.645 270.581 1.00 119.37 ? 77  GLY O O      1 
ATOM   4976   H  H      . GLY B  2  78  ? 321.234 227.374 269.380 1.00 95.61  ? 77  GLY O H      1 
ATOM   4977   H  HA2    . GLY B  2  78  ? 321.873 229.139 267.985 1.00 94.09  ? 77  GLY O HA2    1 
ATOM   4978   H  HA3    . GLY B  2  78  ? 320.351 229.219 267.578 1.00 94.09  ? 77  GLY O HA3    1 
ATOM   4979   N  N      . MET B  2  79  ? 319.970 231.012 269.232 1.00 62.72  ? 78  MET O N      1 
ATOM   4980   C  CA     . MET B  2  79  ? 319.822 232.070 270.221 1.00 63.42  ? 78  MET O CA     1 
ATOM   4981   C  C      . MET B  2  79  ? 318.436 231.990 270.855 1.00 62.13  ? 78  MET O C      1 
ATOM   4982   O  O      . MET B  2  79  ? 317.427 232.268 270.200 1.00 82.09  ? 78  MET O O      1 
ATOM   4983   C  CB     . MET B  2  79  ? 320.053 233.436 269.575 1.00 62.94  ? 78  MET O CB     1 
ATOM   4984   C  CG     . MET B  2  79  ? 321.356 233.531 268.788 1.00 83.02  ? 78  MET O CG     1 
ATOM   4985   S  SD     . MET B  2  79  ? 321.676 235.213 268.220 1.00 104.37 ? 78  MET O SD     1 
ATOM   4986   C  CE     . MET B  2  79  ? 321.840 236.071 269.784 1.00 138.16 ? 78  MET O CE     1 
ATOM   4987   H  H      . MET B  2  79  ? 319.544 231.161 268.500 1.00 63.01  ? 78  MET O H      1 
ATOM   4988   H  HA     . MET B  2  79  ? 320.491 231.950 270.912 1.00 63.93  ? 78  MET O HA     1 
ATOM   4989   H  HB2    . MET B  2  79  ? 319.323 233.619 268.963 1.00 63.99  ? 78  MET O HB2    1 
ATOM   4990   H  HB3    . MET B  2  79  ? 320.076 234.111 270.271 1.00 63.99  ? 78  MET O HB3    1 
ATOM   4991   H  HG2    . MET B  2  79  ? 322.093 233.258 269.357 1.00 83.56  ? 78  MET O HG2    1 
ATOM   4992   H  HG3    . MET B  2  79  ? 321.302 232.954 268.010 1.00 83.56  ? 78  MET O HG3    1 
ATOM   4993   H  HE1    . MET B  2  79  ? 321.014 235.977 270.283 1.00 139.08 ? 78  MET O HE1    1 
ATOM   4994   H  HE2    . MET B  2  79  ? 322.575 235.680 270.283 1.00 139.08 ? 78  MET O HE2    1 
ATOM   4995   H  HE3    . MET B  2  79  ? 322.019 237.009 269.612 1.00 139.08 ? 78  MET O HE3    1 
ATOM   4996   N  N      . GLY B  2  80  ? 318.393 231.640 272.143 1.00 57.04  ? 79  GLY O N      1 
ATOM   4997   C  CA     . GLY B  2  80  ? 317.152 231.415 272.854 1.00 54.39  ? 79  GLY O CA     1 
ATOM   4998   C  C      . GLY B  2  80  ? 316.159 232.552 272.758 1.00 52.10  ? 79  GLY O C      1 
ATOM   4999   O  O      . GLY B  2  80  ? 314.943 232.337 272.782 1.00 50.02  ? 79  GLY O O      1 
ATOM   5000   H  H      . GLY B  2  80  ? 319.092 231.527 272.631 1.00 58.16  ? 79  GLY O H      1 
ATOM   5001   H  HA2    . GLY B  2  80  ? 316.728 230.616 272.503 1.00 55.93  ? 79  GLY O HA2    1 
ATOM   5002   H  HA3    . GLY B  2  80  ? 317.347 231.265 273.792 1.00 55.93  ? 79  GLY O HA3    1 
ATOM   5003   N  N      . PRO B  2  81  ? 316.651 233.806 272.693 1.00 60.88  ? 80  PRO O N      1 
ATOM   5004   C  CA     . PRO B  2  81  ? 315.751 234.927 272.418 1.00 63.42  ? 80  PRO O CA     1 
ATOM   5005   C  C      . PRO B  2  81  ? 315.081 234.819 271.057 1.00 60.29  ? 80  PRO O C      1 
ATOM   5006   O  O      . PRO B  2  81  ? 313.859 234.803 270.958 1.00 68.59  ? 80  PRO O O      1 
ATOM   5007   C  CB     . PRO B  2  81  ? 316.686 236.146 272.485 1.00 65.22  ? 80  PRO O CB     1 
ATOM   5008   C  CG     . PRO B  2  81  ? 317.758 235.732 273.407 1.00 68.52  ? 80  PRO O CG     1 
ATOM   5009   C  CD     . PRO B  2  81  ? 317.952 234.258 273.181 1.00 64.28  ? 80  PRO O CD     1 
ATOM   5010   H  HA     . PRO B  2  81  ? 315.075 234.998 273.109 1.00 61.37  ? 80  PRO O HA     1 
ATOM   5011   H  HB2    . PRO B  2  81  ? 317.044 236.336 271.604 1.00 63.07  ? 80  PRO O HB2    1 
ATOM   5012   H  HB3    . PRO B  2  81  ? 316.205 236.911 272.836 1.00 63.07  ? 80  PRO O HB3    1 
ATOM   5013   H  HG2    . PRO B  2  81  ? 318.571 236.219 273.199 1.00 65.38  ? 80  PRO O HG2    1 
ATOM   5014   H  HG3    . PRO B  2  81  ? 317.483 235.903 274.322 1.00 65.38  ? 80  PRO O HG3    1 
ATOM   5015   H  HD2    . PRO B  2  81  ? 318.635 234.107 272.509 1.00 60.57  ? 80  PRO O HD2    1 
ATOM   5016   H  HD3    . PRO B  2  81  ? 318.171 233.815 274.015 1.00 60.57  ? 80  PRO O HD3    1 
ATOM   5017   N  N      . ASP B  2  82  ? 315.900 234.746 270.001 1.00 58.67  ? 81  ASP O N      1 
ATOM   5018   C  CA     . ASP B  2  82  ? 315.341 234.679 268.657 1.00 56.19  ? 81  ASP O CA     1 
ATOM   5019   C  C      . ASP B  2  82  ? 314.471 233.451 268.473 1.00 54.93  ? 81  ASP O C      1 
ATOM   5020   O  O      . ASP B  2  82  ? 313.614 233.433 267.591 1.00 52.91  ? 81  ASP O O      1 
ATOM   5021   C  CB     . ASP B  2  82  ? 316.469 234.681 267.623 1.00 87.72  ? 81  ASP O CB     1 
ATOM   5022   C  CG     . ASP B  2  82  ? 317.306 235.938 267.689 1.00 119.00 ? 81  ASP O CG     1 
ATOM   5023   O  OD1    . ASP B  2  82  ? 318.214 236.001 268.548 1.00 138.57 ? 81  ASP O OD1    1 
ATOM   5024   O  OD2    . ASP B  2  82  ? 317.049 236.867 266.893 1.00 128.17 ? 81  ASP O OD2    1 
ATOM   5025   H  H      . ASP B  2  82  ? 316.759 234.734 270.039 1.00 57.14  ? 81  ASP O H      1 
ATOM   5026   H  HA     . ASP B  2  82  ? 314.791 235.463 268.503 1.00 55.30  ? 81  ASP O HA     1 
ATOM   5027   H  HB2    . ASP B  2  82  ? 317.050 233.923 267.786 1.00 86.48  ? 81  ASP O HB2    1 
ATOM   5028   H  HB3    . ASP B  2  82  ? 316.084 234.622 266.734 1.00 86.48  ? 81  ASP O HB3    1 
ATOM   5029   N  N      . TYR B  2  83  ? 314.668 232.425 269.292 1.00 40.25  ? 82  TYR O N      1 
ATOM   5030   C  CA     . TYR B  2  83  ? 313.829 231.245 269.202 1.00 39.83  ? 82  TYR O CA     1 
ATOM   5031   C  C      . TYR B  2  83  ? 312.446 231.515 269.771 1.00 39.14  ? 82  TYR O C      1 
ATOM   5032   O  O      . TYR B  2  83  ? 311.444 231.074 269.210 1.00 38.61  ? 82  TYR O O      1 
ATOM   5033   C  CB     . TYR B  2  83  ? 314.481 230.088 269.946 1.00 59.78  ? 82  TYR O CB     1 
ATOM   5034   C  CG     . TYR B  2  83  ? 313.513 228.981 270.229 1.00 43.67  ? 82  TYR O CG     1 
ATOM   5035   C  CD1    . TYR B  2  83  ? 313.065 228.155 269.209 1.00 40.55  ? 82  TYR O CD1    1 
ATOM   5036   C  CD2    . TYR B  2  83  ? 313.038 228.769 271.515 1.00 42.99  ? 82  TYR O CD2    1 
ATOM   5037   C  CE1    . TYR B  2  83  ? 312.176 227.139 269.456 1.00 40.52  ? 82  TYR O CE1    1 
ATOM   5038   C  CE2    . TYR B  2  83  ? 312.152 227.755 271.780 1.00 42.87  ? 82  TYR O CE2    1 
ATOM   5039   C  CZ     . TYR B  2  83  ? 311.725 226.943 270.744 1.00 62.49  ? 82  TYR O CZ     1 
ATOM   5040   O  OH     . TYR B  2  83  ? 310.838 225.936 271.003 1.00 93.18  ? 82  TYR O OH     1 
ATOM   5041   H  H      . TYR B  2  83  ? 315.274 232.390 269.902 1.00 47.76  ? 82  TYR O H      1 
ATOM   5042   H  HA     . TYR B  2  83  ? 313.731 230.993 268.271 1.00 46.64  ? 82  TYR O HA     1 
ATOM   5043   H  HB2    . TYR B  2  83  ? 315.201 229.728 269.404 1.00 66.37  ? 82  TYR O HB2    1 
ATOM   5044   H  HB3    . TYR B  2  83  ? 314.829 230.409 270.792 1.00 66.37  ? 82  TYR O HB3    1 
ATOM   5045   H  HD1    . TYR B  2  83  ? 313.375 228.290 268.342 1.00 46.19  ? 82  TYR O HD1    1 
ATOM   5046   H  HD2    . TYR B  2  83  ? 313.331 229.315 272.208 1.00 49.44  ? 82  TYR O HD2    1 
ATOM   5047   H  HE1    . TYR B  2  83  ? 311.885 226.589 268.765 1.00 46.05  ? 82  TYR O HE1    1 
ATOM   5048   H  HE2    . TYR B  2  83  ? 311.839 227.617 272.645 1.00 49.34  ? 82  TYR O HE2    1 
ATOM   5049   H  HH     . TYR B  2  83  ? 310.645 225.926 271.821 1.00 99.89  ? 82  TYR O HH     1 
ATOM   5050   N  N      . ARG B  2  84  ? 312.375 232.239 270.882 1.00 70.58  ? 83  ARG O N      1 
ATOM   5051   C  CA     . ARG B  2  84  ? 311.098 232.567 271.498 1.00 72.17  ? 83  ARG O CA     1 
ATOM   5052   C  C      . ARG B  2  84  ? 310.265 233.504 270.626 1.00 68.85  ? 83  ARG O C      1 
ATOM   5053   O  O      . ARG B  2  84  ? 309.052 233.593 270.823 1.00 68.92  ? 83  ARG O O      1 
ATOM   5054   C  CB     . ARG B  2  84  ? 311.365 233.190 272.872 1.00 82.75  ? 83  ARG O CB     1 
ATOM   5055   C  CG     . ARG B  2  84  ? 310.189 233.222 273.830 1.00 93.11  ? 83  ARG O CG     1 
ATOM   5056   C  CD     . ARG B  2  84  ? 310.626 233.698 275.221 1.00 103.47 ? 83  ARG O CD     1 
ATOM   5057   N  NE     . ARG B  2  84  ? 311.170 235.058 275.194 1.00 114.24 ? 83  ARG O NE     1 
ATOM   5058   C  CZ     . ARG B  2  84  ? 312.464 235.364 275.209 1.00 129.04 ? 83  ARG O CZ     1 
ATOM   5059   N  NH1    . ARG B  2  84  ? 313.390 234.414 275.257 1.00 132.43 ? 83  ARG O NH1    1 
ATOM   5060   N  NH2    . ARG B  2  84  ? 312.839 236.636 275.182 1.00 139.83 ? 83  ARG O NH2    1 
ATOM   5061   H  H      . ARG B  2  84  ? 313.057 232.553 271.302 1.00 60.00  ? 83  ARG O H      1 
ATOM   5062   H  HA     . ARG B  2  84  ? 310.591 231.751 271.631 1.00 62.21  ? 83  ARG O HA     1 
ATOM   5063   H  HB2    . ARG B  2  84  ? 312.074 232.687 273.302 1.00 72.47  ? 83  ARG O HB2    1 
ATOM   5064   H  HB3    . ARG B  2  84  ? 311.655 234.107 272.740 1.00 72.47  ? 83  ARG O HB3    1 
ATOM   5065   H  HG2    . ARG B  2  84  ? 309.517 233.836 273.495 1.00 83.17  ? 83  ARG O HG2    1 
ATOM   5066   H  HG3    . ARG B  2  84  ? 309.818 232.330 273.915 1.00 83.17  ? 83  ARG O HG3    1 
ATOM   5067   H  HD2    . ARG B  2  84  ? 309.859 233.691 275.815 1.00 93.06  ? 83  ARG O HD2    1 
ATOM   5068   H  HD3    . ARG B  2  84  ? 311.315 233.104 275.558 1.00 93.06  ? 83  ARG O HD3    1 
ATOM   5069   H  HE     . ARG B  2  84  ? 310.609 235.709 275.166 1.00 104.03 ? 83  ARG O HE     1 
ATOM   5070   H  HH11   . ARG B  2  84  ? 313.156 233.586 275.275 1.00 120.82 ? 83  ARG O HH11   1 
ATOM   5071   H  HH12   . ARG B  2  84  ? 314.223 234.625 275.267 1.00 120.82 ? 83  ARG O HH12   1 
ATOM   5072   H  HH21   . ARG B  2  84  ? 312.247 237.258 275.152 1.00 129.30 ? 83  ARG O HH21   1 
ATOM   5073   H  HH22   . ARG B  2  84  ? 313.675 236.838 275.193 1.00 129.30 ? 83  ARG O HH22   1 
ATOM   5074   N  N      . VAL B  2  85  ? 310.886 234.193 269.670 1.00 64.33  ? 84  VAL O N      1 
ATOM   5075   C  CA     . VAL B  2  85  ? 310.145 235.046 268.747 1.00 63.39  ? 84  VAL O CA     1 
ATOM   5076   C  C      . VAL B  2  85  ? 309.491 234.208 267.658 1.00 56.50  ? 84  VAL O C      1 
ATOM   5077   O  O      . VAL B  2  85  ? 308.306 234.375 267.349 1.00 59.98  ? 84  VAL O O      1 
ATOM   5078   C  CB     . VAL B  2  85  ? 311.079 236.117 268.146 1.00 63.82  ? 84  VAL O CB     1 
ATOM   5079   C  CG1    . VAL B  2  85  ? 310.414 236.837 266.953 1.00 58.55  ? 84  VAL O CG1    1 
ATOM   5080   C  CG2    . VAL B  2  85  ? 311.508 237.109 269.228 1.00 79.76  ? 84  VAL O CG2    1 
ATOM   5081   H  H      . VAL B  2  85  ? 311.736 234.184 269.536 1.00 63.36  ? 84  VAL O H      1 
ATOM   5082   H  HA     . VAL B  2  85  ? 309.442 235.502 269.236 1.00 63.34  ? 84  VAL O HA     1 
ATOM   5083   H  HB     . VAL B  2  85  ? 311.879 235.679 267.816 1.00 63.81  ? 84  VAL O HB     1 
ATOM   5084   H  HG11   . VAL B  2  85  ? 311.029 237.501 266.603 1.00 59.43  ? 84  VAL O HG11   1 
ATOM   5085   H  HG12   . VAL B  2  85  ? 310.206 236.184 266.267 1.00 59.43  ? 84  VAL O HG12   1 
ATOM   5086   H  HG13   . VAL B  2  85  ? 309.601 237.268 267.258 1.00 59.43  ? 84  VAL O HG13   1 
ATOM   5087   H  HG21   . VAL B  2  85  ? 312.093 237.773 268.833 1.00 79.57  ? 84  VAL O HG21   1 
ATOM   5088   H  HG22   . VAL B  2  85  ? 310.718 237.538 269.594 1.00 79.57  ? 84  VAL O HG22   1 
ATOM   5089   H  HG23   . VAL B  2  85  ? 311.977 236.628 269.928 1.00 79.57  ? 84  VAL O HG23   1 
ATOM   5090   N  N      . LEU B  2  86  ? 310.261 233.310 267.042 1.00 49.03  ? 85  LEU O N      1 
ATOM   5091   C  CA     . LEU B  2  86  ? 309.705 232.455 266.003 1.00 47.15  ? 85  LEU O CA     1 
ATOM   5092   C  C      . LEU B  2  86  ? 308.602 231.561 266.559 1.00 57.72  ? 85  LEU O C      1 
ATOM   5093   O  O      . LEU B  2  86  ? 307.581 231.353 265.896 1.00 62.49  ? 85  LEU O O      1 
ATOM   5094   C  CB     . LEU B  2  86  ? 310.812 231.619 265.356 1.00 47.87  ? 85  LEU O CB     1 
ATOM   5095   C  CG     . LEU B  2  86  ? 311.928 232.422 264.676 1.00 54.32  ? 85  LEU O CG     1 
ATOM   5096   C  CD1    . LEU B  2  86  ? 313.054 231.518 264.190 1.00 60.22  ? 85  LEU O CD1    1 
ATOM   5097   C  CD2    . LEU B  2  86  ? 311.387 233.242 263.522 1.00 48.78  ? 85  LEU O CD2    1 
ATOM   5098   H  H      . LEU B  2  86  ? 311.095 233.180 267.206 1.00 43.75  ? 85  LEU O H      1 
ATOM   5099   H  HA     . LEU B  2  86  ? 309.314 233.014 265.313 1.00 42.13  ? 85  LEU O HA     1 
ATOM   5100   H  HB2    . LEU B  2  86  ? 311.224 231.071 266.042 1.00 42.15  ? 85  LEU O HB2    1 
ATOM   5101   H  HB3    . LEU B  2  86  ? 310.412 231.048 264.682 1.00 42.15  ? 85  LEU O HB3    1 
ATOM   5102   H  HG     . LEU B  2  86  ? 312.305 233.039 265.323 1.00 48.45  ? 85  LEU O HG     1 
ATOM   5103   H  HD11   . LEU B  2  86  ? 313.736 232.063 263.768 1.00 53.54  ? 85  LEU O HD11   1 
ATOM   5104   H  HD12   . LEU B  2  86  ? 313.429 231.047 264.950 1.00 53.54  ? 85  LEU O HD12   1 
ATOM   5105   H  HD13   . LEU B  2  86  ? 312.695 230.883 263.551 1.00 53.54  ? 85  LEU O HD13   1 
ATOM   5106   H  HD21   . LEU B  2  86  ? 312.117 233.735 263.116 1.00 43.77  ? 85  LEU O HD21   1 
ATOM   5107   H  HD22   . LEU B  2  86  ? 310.989 232.644 262.870 1.00 43.77  ? 85  LEU O HD22   1 
ATOM   5108   H  HD23   . LEU B  2  86  ? 310.718 233.858 263.859 1.00 43.77  ? 85  LEU O HD23   1 
ATOM   5109   N  N      . VAL B  2  87  ? 308.775 231.029 267.777 1.00 46.60  ? 86  VAL O N      1 
ATOM   5110   C  CA     . VAL B  2  87  ? 307.718 230.205 268.367 1.00 47.44  ? 86  VAL O CA     1 
ATOM   5111   C  C      . VAL B  2  87  ? 306.423 230.987 268.405 1.00 48.51  ? 86  VAL O C      1 
ATOM   5112   O  O      . VAL B  2  87  ? 305.341 230.460 268.121 1.00 63.78  ? 86  VAL O O      1 
ATOM   5113   C  CB     . VAL B  2  87  ? 308.085 229.734 269.786 1.00 50.23  ? 86  VAL O CB     1 
ATOM   5114   C  CG1    . VAL B  2  87  ? 306.899 228.960 270.397 1.00 51.70  ? 86  VAL O CG1    1 
ATOM   5115   C  CG2    . VAL B  2  87  ? 309.329 228.882 269.790 1.00 71.07  ? 86  VAL O CG2    1 
ATOM   5116   H  H      . VAL B  2  87  ? 309.474 231.128 268.267 1.00 45.98  ? 86  VAL O H      1 
ATOM   5117   H  HA     . VAL B  2  87  ? 307.581 229.420 267.814 1.00 46.92  ? 86  VAL O HA     1 
ATOM   5118   H  HB     . VAL B  2  87  ? 308.253 230.511 270.342 1.00 48.96  ? 86  VAL O HB     1 
ATOM   5119   H  HG11   . VAL B  2  87  ? 307.139 228.667 271.290 1.00 50.58  ? 86  VAL O HG11   1 
ATOM   5120   H  HG12   . VAL B  2  87  ? 306.127 229.546 270.436 1.00 50.58  ? 86  VAL O HG12   1 
ATOM   5121   H  HG13   . VAL B  2  87  ? 306.703 228.191 269.838 1.00 50.58  ? 86  VAL O HG13   1 
ATOM   5122   H  HG21   . VAL B  2  87  ? 309.521 228.609 270.700 1.00 68.84  ? 86  VAL O HG21   1 
ATOM   5123   H  HG22   . VAL B  2  87  ? 309.177 228.101 269.235 1.00 68.84  ? 86  VAL O HG22   1 
ATOM   5124   H  HG23   . VAL B  2  87  ? 310.068 229.401 269.436 1.00 68.84  ? 86  VAL O HG23   1 
ATOM   5125   N  N      . HIS B  2  88  ? 306.509 232.251 268.796 1.00 73.61  ? 87  HIS O N      1 
ATOM   5126   C  CA     . HIS B  2  88  ? 305.303 233.036 268.963 1.00 73.91  ? 87  HIS O CA     1 
ATOM   5127   C  C      . HIS B  2  88  ? 304.672 233.352 267.616 1.00 71.04  ? 87  HIS O C      1 
ATOM   5128   O  O      . HIS B  2  88  ? 303.457 233.225 267.444 1.00 79.91  ? 87  HIS O O      1 
ATOM   5129   C  CB     . HIS B  2  88  ? 305.612 234.317 269.713 1.00 75.51  ? 87  HIS O CB     1 
ATOM   5130   C  CG     . HIS B  2  88  ? 304.416 235.174 269.882 1.00 76.53  ? 87  HIS O CG     1 
ATOM   5131   N  ND1    . HIS B  2  88  ? 303.419 234.874 270.784 1.00 86.99  ? 87  HIS O ND1    1 
ATOM   5132   C  CD2    . HIS B  2  88  ? 304.013 236.283 269.220 1.00 100.35 ? 87  HIS O CD2    1 
ATOM   5133   C  CE1    . HIS B  2  88  ? 302.463 235.783 270.690 1.00 120.73 ? 87  HIS O CE1    1 
ATOM   5134   N  NE2    . HIS B  2  88  ? 302.799 236.650 269.749 1.00 124.53 ? 87  HIS O NE2    1 
ATOM   5135   H  H      . HIS B  2  88  ? 307.241 232.669 268.966 1.00 60.77  ? 87  HIS O H      1 
ATOM   5136   H  HA     . HIS B  2  88  ? 304.663 232.527 269.485 1.00 61.89  ? 87  HIS O HA     1 
ATOM   5137   H  HB2    . HIS B  2  88  ? 305.951 234.095 270.594 1.00 63.55  ? 87  HIS O HB2    1 
ATOM   5138   H  HB3    . HIS B  2  88  ? 306.277 234.821 269.218 1.00 63.55  ? 87  HIS O HB3    1 
ATOM   5139   H  HD2    . HIS B  2  88  ? 304.477 236.722 268.543 1.00 89.95  ? 87  HIS O HD2    1 
ATOM   5140   H  HE1    . HIS B  2  88  ? 301.687 235.810 271.202 1.00 110.49 ? 87  HIS O HE1    1 
ATOM   5141   H  HE2    . HIS B  2  88  ? 302.335 237.334 269.510 1.00 114.67 ? 87  HIS O HE2    1 
ATOM   5142   N  N      . ARG B  2  89  ? 305.485 233.774 266.648 1.00 65.94  ? 88  ARG O N      1 
ATOM   5143   C  CA     . ARG B  2  89  ? 304.965 234.028 265.313 1.00 63.40  ? 88  ARG O CA     1 
ATOM   5144   C  C      . ARG B  2  89  ? 304.295 232.787 264.736 1.00 64.33  ? 88  ARG O C      1 
ATOM   5145   O  O      . ARG B  2  89  ? 303.212 232.873 264.147 1.00 76.28  ? 88  ARG O O      1 
ATOM   5146   C  CB     . ARG B  2  89  ? 306.093 234.491 264.393 1.00 62.28  ? 88  ARG O CB     1 
ATOM   5147   C  CG     . ARG B  2  89  ? 305.612 235.040 263.054 1.00 60.31  ? 88  ARG O CG     1 
ATOM   5148   C  CD     . ARG B  2  89  ? 305.169 236.488 263.164 1.00 60.71  ? 88  ARG O CD     1 
ATOM   5149   N  NE     . ARG B  2  89  ? 306.113 237.253 263.971 1.00 73.40  ? 88  ARG O NE     1 
ATOM   5150   C  CZ     . ARG B  2  89  ? 307.125 237.964 263.485 1.00 82.90  ? 88  ARG O CZ     1 
ATOM   5151   N  NH1    . ARG B  2  89  ? 307.337 238.048 262.177 1.00 94.33  ? 88  ARG O NH1    1 
ATOM   5152   N  NH2    . ARG B  2  89  ? 307.926 238.610 264.318 1.00 80.84  ? 88  ARG O NH2    1 
ATOM   5153   H  H      . ARG B  2  89  ? 306.328 233.918 266.740 1.00 55.42  ? 88  ARG O H      1 
ATOM   5154   H  HA     . ARG B  2  89  ? 304.303 234.735 265.358 1.00 53.58  ? 88  ARG O HA     1 
ATOM   5155   H  HB2    . ARG B  2  89  ? 306.591 235.194 264.840 1.00 52.28  ? 88  ARG O HB2    1 
ATOM   5156   H  HB3    . ARG B  2  89  ? 306.677 233.738 264.213 1.00 52.28  ? 88  ARG O HB3    1 
ATOM   5157   H  HG2    . ARG B  2  89  ? 306.337 234.993 262.411 1.00 51.06  ? 88  ARG O HG2    1 
ATOM   5158   H  HG3    . ARG B  2  89  ? 304.857 234.514 262.746 1.00 51.06  ? 88  ARG O HG3    1 
ATOM   5159   H  HD2    . ARG B  2  89  ? 305.132 236.882 262.278 1.00 52.12  ? 88  ARG O HD2    1 
ATOM   5160   H  HD3    . ARG B  2  89  ? 304.298 236.528 263.589 1.00 52.12  ? 88  ARG O HD3    1 
ATOM   5161   H  HE     . ARG B  2  89  ? 306.007 237.243 264.825 1.00 64.38  ? 88  ARG O HE     1 
ATOM   5162   H  HH11   . ARG B  2  89  ? 306.821 237.629 261.631 1.00 85.38  ? 88  ARG O HH11   1 
ATOM   5163   H  HH12   . ARG B  2  89  ? 307.993 238.515 261.877 1.00 85.38  ? 88  ARG O HH12   1 
ATOM   5164   H  HH21   . ARG B  2  89  ? 307.791 238.565 265.166 1.00 71.25  ? 88  ARG O HH21   1 
ATOM   5165   H  HH22   . ARG B  2  89  ? 308.578 239.079 264.011 1.00 71.25  ? 88  ARG O HH22   1 
ATOM   5166   N  N      . ALA B  2  90  ? 304.930 231.625 264.878 1.00 41.74  ? 89  ALA O N      1 
ATOM   5167   C  CA     . ALA B  2  90  ? 304.355 230.405 264.322 1.00 41.61  ? 89  ALA O CA     1 
ATOM   5168   C  C      . ALA B  2  90  ? 302.966 230.157 264.886 1.00 42.33  ? 89  ALA O C      1 
ATOM   5169   O  O      . ALA B  2  90  ? 302.046 229.788 264.149 1.00 56.28  ? 89  ALA O O      1 
ATOM   5170   C  CB     . ALA B  2  90  ? 305.261 229.201 264.601 1.00 44.20  ? 89  ALA O CB     1 
ATOM   5171   H  H      . ALA B  2  90  ? 305.681 231.518 265.284 1.00 38.31  ? 89  ALA O H      1 
ATOM   5172   H  HA     . ALA B  2  90  ? 304.276 230.504 263.360 1.00 38.20  ? 89  ALA O HA     1 
ATOM   5173   H  HB1    . ALA B  2  90  ? 304.855 228.407 264.221 1.00 39.84  ? 89  ALA O HB1    1 
ATOM   5174   H  HB2    . ALA B  2  90  ? 306.128 229.358 264.193 1.00 39.84  ? 89  ALA O HB2    1 
ATOM   5175   H  HB3    . ALA B  2  90  ? 305.360 229.096 265.560 1.00 39.84  ? 89  ALA O HB3    1 
ATOM   5176   N  N      . ARG B  2  91  ? 302.790 230.357 266.190 1.00 38.50  ? 90  ARG O N      1 
ATOM   5177   C  CA     . ARG B  2  91  ? 301.497 230.084 266.801 1.00 39.29  ? 90  ARG O CA     1 
ATOM   5178   C  C      . ARG B  2  91  ? 300.414 230.999 266.258 1.00 43.91  ? 90  ARG O C      1 
ATOM   5179   O  O      . ARG B  2  91  ? 299.246 230.601 266.195 1.00 60.80  ? 90  ARG O O      1 
ATOM   5180   C  CB     . ARG B  2  91  ? 301.591 230.232 268.309 1.00 42.12  ? 90  ARG O CB     1 
ATOM   5181   C  CG     . ARG B  2  91  ? 302.374 229.144 268.946 1.00 43.94  ? 90  ARG O CG     1 
ATOM   5182   C  CD     . ARG B  2  91  ? 302.572 229.454 270.378 1.00 46.37  ? 90  ARG O CD     1 
ATOM   5183   N  NE     . ARG B  2  91  ? 303.354 228.421 271.023 1.00 48.15  ? 90  ARG O NE     1 
ATOM   5184   C  CZ     . ARG B  2  91  ? 303.809 228.521 272.260 1.00 50.26  ? 90  ARG O CZ     1 
ATOM   5185   N  NH1    . ARG B  2  91  ? 303.549 229.613 272.970 1.00 59.72  ? 90  ARG O NH1    1 
ATOM   5186   N  NH2    . ARG B  2  91  ? 304.526 227.536 272.780 1.00 57.80  ? 90  ARG O NH2    1 
ATOM   5187   H  H      . ARG B  2  91  ? 303.393 230.644 266.733 1.00 38.13  ? 90  ARG O H      1 
ATOM   5188   H  HA     . ARG B  2  91  ? 301.242 229.169 266.605 1.00 39.29  ? 90  ARG O HA     1 
ATOM   5189   H  HB2    . ARG B  2  91  ? 302.024 231.075 268.517 1.00 41.71  ? 90  ARG O HB2    1 
ATOM   5190   H  HB3    . ARG B  2  91  ? 300.697 230.217 268.684 1.00 41.71  ? 90  ARG O HB3    1 
ATOM   5191   H  HG2    . ARG B  2  91  ? 301.890 228.307 268.874 1.00 42.60  ? 90  ARG O HG2    1 
ATOM   5192   H  HG3    . ARG B  2  91  ? 303.243 229.075 268.521 1.00 42.60  ? 90  ARG O HG3    1 
ATOM   5193   H  HD2    . ARG B  2  91  ? 303.047 230.295 270.463 1.00 44.62  ? 90  ARG O HD2    1 
ATOM   5194   H  HD3    . ARG B  2  91  ? 301.710 229.506 270.819 1.00 44.62  ? 90  ARG O HD3    1 
ATOM   5195   H  HE     . ARG B  2  91  ? 303.406 227.655 270.636 1.00 45.47  ? 90  ARG O HE     1 
ATOM   5196   H  HH11   . ARG B  2  91  ? 303.086 230.250 272.625 1.00 56.78  ? 90  ARG O HH11   1 
ATOM   5197   H  HH12   . ARG B  2  91  ? 303.843 229.683 273.775 1.00 56.78  ? 90  ARG O HH12   1 
ATOM   5198   H  HH21   . ARG B  2  91  ? 304.689 226.832 272.315 1.00 53.70  ? 90  ARG O HH21   1 
ATOM   5199   H  HH22   . ARG B  2  91  ? 304.821 227.598 273.585 1.00 53.70  ? 90  ARG O HH22   1 
ATOM   5200   N  N      . LYS B  2  92  ? 300.768 232.222 265.871 1.00 64.30  ? 91  LYS O N      1 
ATOM   5201   C  CA     . LYS B  2  92  ? 299.773 233.113 265.292 1.00 62.70  ? 91  LYS O CA     1 
ATOM   5202   C  C      . LYS B  2  92  ? 299.451 232.699 263.864 1.00 60.23  ? 91  LYS O C      1 
ATOM   5203   O  O      . LYS B  2  92  ? 298.291 232.752 263.444 1.00 82.11  ? 91  LYS O O      1 
ATOM   5204   C  CB     . LYS B  2  92  ? 300.266 234.556 265.322 1.00 62.35  ? 91  LYS O CB     1 
ATOM   5205   C  CG     . LYS B  2  92  ? 300.281 235.210 266.694 1.00 66.44  ? 91  LYS O CG     1 
ATOM   5206   C  CD     . LYS B  2  92  ? 301.141 236.477 266.681 1.00 86.22  ? 91  LYS O CD     1 
ATOM   5207   C  CE     . LYS B  2  92  ? 300.655 237.487 265.641 1.00 105.13 ? 91  LYS O CE     1 
ATOM   5208   N  NZ     . LYS B  2  92  ? 301.521 238.698 265.516 1.00 121.88 ? 91  LYS O NZ     1 
ATOM   5209   H  H      . LYS B  2  92  ? 301.560 232.552 265.931 1.00 58.82  ? 91  LYS O H      1 
ATOM   5210   H  HA     . LYS B  2  92  ? 298.957 233.061 265.814 1.00 58.13  ? 91  LYS O HA     1 
ATOM   5211   H  HB2    . LYS B  2  92  ? 301.172 234.579 264.978 1.00 58.00  ? 91  LYS O HB2    1 
ATOM   5212   H  HB3    . LYS B  2  92  ? 299.689 235.089 264.752 1.00 58.00  ? 91  LYS O HB3    1 
ATOM   5213   H  HG2    . LYS B  2  92  ? 299.377 235.456 266.944 1.00 61.92  ? 91  LYS O HG2    1 
ATOM   5214   H  HG3    . LYS B  2  92  ? 300.656 234.592 267.341 1.00 61.92  ? 91  LYS O HG3    1 
ATOM   5215   H  HD2    . LYS B  2  92  ? 301.100 236.898 267.554 1.00 81.70  ? 91  LYS O HD2    1 
ATOM   5216   H  HD3    . LYS B  2  92  ? 302.056 236.238 266.467 1.00 81.70  ? 91  LYS O HD3    1 
ATOM   5217   H  HE2    . LYS B  2  92  ? 300.628 237.052 264.774 1.00 101.42 ? 91  LYS O HE2    1 
ATOM   5218   H  HE3    . LYS B  2  92  ? 299.765 237.783 265.886 1.00 101.42 ? 91  LYS O HE3    1 
ATOM   5219   H  HZ1    . LYS B  2  92  ? 301.189 239.246 264.898 1.00 118.16 ? 91  LYS O HZ1    1 
ATOM   5220   H  HZ2    . LYS B  2  92  ? 301.556 239.128 266.294 1.00 118.16 ? 91  LYS O HZ2    1 
ATOM   5221   H  HZ3    . LYS B  2  92  ? 302.345 238.460 265.278 1.00 118.16 ? 91  LYS O HZ3    1 
ATOM   5222   N  N      . LEU B  2  93  ? 300.467 232.289 263.108 1.00 34.78  ? 92  LEU O N      1 
ATOM   5223   C  CA     . LEU B  2  93  ? 300.224 231.751 261.780 1.00 33.46  ? 92  LEU O CA     1 
ATOM   5224   C  C      . LEU B  2  93  ? 299.322 230.537 261.848 1.00 45.06  ? 92  LEU O C      1 
ATOM   5225   O  O      . LEU B  2  93  ? 298.304 230.464 261.154 1.00 69.25  ? 92  LEU O O      1 
ATOM   5226   C  CB     . LEU B  2  93  ? 301.543 231.383 261.114 1.00 33.16  ? 92  LEU O CB     1 
ATOM   5227   C  CG     . LEU B  2  93  ? 302.258 232.606 260.579 1.00 45.64  ? 92  LEU O CG     1 
ATOM   5228   C  CD1    . LEU B  2  93  ? 303.705 232.269 260.328 1.00 66.29  ? 92  LEU O CD1    1 
ATOM   5229   C  CD2    . LEU B  2  93  ? 301.550 233.059 259.314 1.00 31.61  ? 92  LEU O CD2    1 
ATOM   5230   H  H      . LEU B  2  93  ? 301.295 232.314 263.340 1.00 36.20  ? 92  LEU O H      1 
ATOM   5231   H  HA     . LEU B  2  93  ? 299.787 232.425 261.237 1.00 35.16  ? 92  LEU O HA     1 
ATOM   5232   H  HB2    . LEU B  2  93  ? 302.121 230.954 261.764 1.00 34.27  ? 92  LEU O HB2    1 
ATOM   5233   H  HB3    . LEU B  2  93  ? 301.370 230.784 260.372 1.00 34.27  ? 92  LEU O HB3    1 
ATOM   5234   H  HG     . LEU B  2  93  ? 302.214 233.322 261.232 1.00 46.93  ? 92  LEU O HG     1 
ATOM   5235   H  HD11   . LEU B  2  93  ? 304.158 233.055 259.985 1.00 66.82  ? 92  LEU O HD11   1 
ATOM   5236   H  HD12   . LEU B  2  93  ? 304.113 231.989 261.162 1.00 66.82  ? 92  LEU O HD12   1 
ATOM   5237   H  HD13   . LEU B  2  93  ? 303.753 231.550 259.678 1.00 66.82  ? 92  LEU O HD13   1 
ATOM   5238   H  HD21   . LEU B  2  93  ? 302.001 233.843 258.963 1.00 33.69  ? 92  LEU O HD21   1 
ATOM   5239   H  HD22   . LEU B  2  93  ? 301.579 232.341 258.662 1.00 33.69  ? 92  LEU O HD22   1 
ATOM   5240   H  HD23   . LEU B  2  93  ? 300.628 233.274 259.528 1.00 33.69  ? 92  LEU O HD23   1 
ATOM   5241   N  N      . ALA B  2  94  ? 299.695 229.559 262.664 1.00 34.83  ? 93  ALA O N      1 
ATOM   5242   C  CA     . ALA B  2  94  ? 298.844 228.397 262.854 1.00 36.49  ? 93  ALA O CA     1 
ATOM   5243   C  C      . ALA B  2  94  ? 297.411 228.832 263.144 1.00 36.64  ? 93  ALA O C      1 
ATOM   5244   O  O      . ALA B  2  94  ? 296.473 228.428 262.451 1.00 40.54  ? 93  ALA O O      1 
ATOM   5245   C  CB     . ALA B  2  94  ? 299.397 227.525 263.983 1.00 41.20  ? 93  ALA O CB     1 
ATOM   5246   H  H      . ALA B  2  94  ? 300.427 229.544 263.115 1.00 39.23  ? 93  ALA O H      1 
ATOM   5247   H  HA     . ALA B  2  94  ? 298.840 227.870 262.039 1.00 40.86  ? 93  ALA O HA     1 
ATOM   5248   H  HB1    . ALA B  2  94  ? 298.819 226.754 264.098 1.00 44.71  ? 93  ALA O HB1    1 
ATOM   5249   H  HB2    . ALA B  2  94  ? 300.292 227.236 263.748 1.00 44.71  ? 93  ALA O HB2    1 
ATOM   5250   H  HB3    . ALA B  2  94  ? 299.420 228.046 264.801 1.00 44.71  ? 93  ALA O HB3    1 
ATOM   5251   N  N      . GLN B  2  95  ? 297.220 229.682 264.151 1.00 42.59  ? 94  GLN O N      1 
ATOM   5252   C  CA     . GLN B  2  95  ? 295.864 230.045 264.533 1.00 43.02  ? 94  GLN O CA     1 
ATOM   5253   C  C      . GLN B  2  95  ? 295.180 230.827 263.425 1.00 59.22  ? 94  GLN O C      1 
ATOM   5254   O  O      . GLN B  2  95  ? 294.038 230.527 263.057 1.00 76.83  ? 94  GLN O O      1 
ATOM   5255   C  CB     . GLN B  2  95  ? 295.875 230.839 265.839 1.00 44.47  ? 94  GLN O CB     1 
ATOM   5256   C  CG     . GLN B  2  95  ? 296.282 230.010 267.049 1.00 68.90  ? 94  GLN O CG     1 
ATOM   5257   C  CD     . GLN B  2  95  ? 295.594 228.657 267.091 1.00 89.72  ? 94  GLN O CD     1 
ATOM   5258   O  OE1    . GLN B  2  95  ? 294.396 228.545 266.819 1.00 102.93 ? 94  GLN O OE1    1 
ATOM   5259   N  NE2    . GLN B  2  95  ? 296.356 227.616 267.411 1.00 101.98 ? 94  GLN O NE2    1 
ATOM   5260   H  H      . GLN B  2  95  ? 297.842 230.052 264.615 1.00 39.06  ? 94  GLN O H      1 
ATOM   5261   H  HA     . GLN B  2  95  ? 295.354 229.234 264.683 1.00 40.12  ? 94  GLN O HA     1 
ATOM   5262   H  HB2    . GLN B  2  95  ? 296.504 231.573 265.756 1.00 41.47  ? 94  GLN O HB2    1 
ATOM   5263   H  HB3    . GLN B  2  95  ? 294.984 231.186 266.003 1.00 41.47  ? 94  GLN O HB3    1 
ATOM   5264   H  HG2    . GLN B  2  95  ? 297.240 229.858 267.021 1.00 65.11  ? 94  GLN O HG2    1 
ATOM   5265   H  HG3    . GLN B  2  95  ? 296.046 230.492 267.857 1.00 65.11  ? 94  GLN O HG3    1 
ATOM   5266   H  HE21   . GLN B  2  95  ? 297.191 227.730 267.581 1.00 97.25  ? 94  GLN O HE21   1 
ATOM   5267   H  HE22   . GLN B  2  95  ? 296.013 226.828 267.448 1.00 97.25  ? 94  GLN O HE22   1 
ATOM   5268   N  N      . GLN B  2  96  ? 295.862 231.827 262.872 1.00 51.44  ? 95  GLN O N      1 
ATOM   5269   C  CA     . GLN B  2  96  ? 295.316 232.547 261.727 1.00 42.83  ? 95  GLN O CA     1 
ATOM   5270   C  C      . GLN B  2  96  ? 294.824 231.568 260.664 1.00 42.73  ? 95  GLN O C      1 
ATOM   5271   O  O      . GLN B  2  96  ? 293.719 231.709 260.134 1.00 53.05  ? 95  GLN O O      1 
ATOM   5272   C  CB     . GLN B  2  96  ? 296.382 233.493 261.169 1.00 41.21  ? 95  GLN O CB     1 
ATOM   5273   C  CG     . GLN B  2  96  ? 296.102 234.040 259.787 1.00 53.97  ? 95  GLN O CG     1 
ATOM   5274   C  CD     . GLN B  2  96  ? 296.376 233.024 258.695 1.00 92.64  ? 95  GLN O CD     1 
ATOM   5275   O  OE1    . GLN B  2  96  ? 297.493 232.526 258.559 1.00 101.95 ? 95  GLN O OE1    1 
ATOM   5276   N  NE2    . GLN B  2  96  ? 295.345 232.691 257.929 1.00 130.69 ? 95  GLN O NE2    1 
ATOM   5277   H  H      . GLN B  2  96  ? 296.632 232.105 263.138 1.00 52.44  ? 95  GLN O H      1 
ATOM   5278   H  HA     . GLN B  2  96  ? 294.561 233.081 262.018 1.00 44.60  ? 95  GLN O HA     1 
ATOM   5279   H  HB2    . GLN B  2  96  ? 296.466 234.250 261.771 1.00 42.93  ? 95  GLN O HB2    1 
ATOM   5280   H  HB3    . GLN B  2  96  ? 297.226 233.016 261.129 1.00 42.93  ? 95  GLN O HB3    1 
ATOM   5281   H  HG2    . GLN B  2  96  ? 295.168 234.297 259.731 1.00 56.32  ? 95  GLN O HG2    1 
ATOM   5282   H  HG3    . GLN B  2  96  ? 296.669 234.811 259.630 1.00 56.32  ? 95  GLN O HG3    1 
ATOM   5283   H  HE21   . GLN B  2  96  ? 294.574 233.047 258.066 1.00 133.42 ? 95  GLN O HE21   1 
ATOM   5284   H  HE22   . GLN B  2  96  ? 295.447 232.119 257.295 1.00 133.42 ? 95  GLN O HE22   1 
ATOM   5285   N  N      . TYR B  2  97  ? 295.647 230.570 260.337 1.00 30.92  ? 96  TYR O N      1 
ATOM   5286   C  CA     . TYR B  2  97  ? 295.251 229.559 259.361 1.00 30.77  ? 96  TYR O CA     1 
ATOM   5287   C  C      . TYR B  2  97  ? 294.027 228.785 259.826 1.00 31.99  ? 96  TYR O C      1 
ATOM   5288   O  O      . TYR B  2  97  ? 293.099 228.553 259.044 1.00 32.11  ? 96  TYR O O      1 
ATOM   5289   C  CB     . TYR B  2  97  ? 296.404 228.591 259.110 1.00 30.75  ? 96  TYR O CB     1 
ATOM   5290   C  CG     . TYR B  2  97  ? 296.109 227.540 258.073 1.00 30.88  ? 96  TYR O CG     1 
ATOM   5291   C  CD1    . TYR B  2  97  ? 295.662 226.281 258.433 1.00 32.12  ? 96  TYR O CD1    1 
ATOM   5292   C  CD2    . TYR B  2  97  ? 296.285 227.812 256.733 1.00 30.11  ? 96  TYR O CD2    1 
ATOM   5293   C  CE1    . TYR B  2  97  ? 295.399 225.326 257.482 1.00 32.57  ? 96  TYR O CE1    1 
ATOM   5294   C  CE2    . TYR B  2  97  ? 296.026 226.864 255.780 1.00 30.85  ? 96  TYR O CE2    1 
ATOM   5295   C  CZ     . TYR B  2  97  ? 295.585 225.621 256.159 1.00 31.79  ? 96  TYR O CZ     1 
ATOM   5296   O  OH     . TYR B  2  97  ? 295.330 224.681 255.186 1.00 32.90  ? 96  TYR O OH     1 
ATOM   5297   H  H      . TYR B  2  97  ? 296.435 230.458 260.665 1.00 36.72  ? 96  TYR O H      1 
ATOM   5298   H  HA     . TYR B  2  97  ? 295.033 229.994 258.522 1.00 36.67  ? 96  TYR O HA     1 
ATOM   5299   H  HB2    . TYR B  2  97  ? 297.175 229.096 258.807 1.00 35.86  ? 96  TYR O HB2    1 
ATOM   5300   H  HB3    . TYR B  2  97  ? 296.615 228.135 259.940 1.00 35.86  ? 96  TYR O HB3    1 
ATOM   5301   H  HD1    . TYR B  2  97  ? 295.538 226.079 259.333 1.00 36.98  ? 96  TYR O HD1    1 
ATOM   5302   H  HD2    . TYR B  2  97  ? 296.587 228.652 256.473 1.00 35.59  ? 96  TYR O HD2    1 
ATOM   5303   H  HE1    . TYR B  2  97  ? 295.099 224.482 257.736 1.00 37.46  ? 96  TYR O HE1    1 
ATOM   5304   H  HE2    . TYR B  2  97  ? 296.150 227.061 254.879 1.00 36.36  ? 96  TYR O HE2    1 
ATOM   5305   H  HH     . TYR B  2  97  ? 295.489 225.003 254.426 1.00 38.15  ? 96  TYR O HH     1 
ATOM   5306   N  N      . TYR B  2  98  ? 294.020 228.350 261.087 1.00 53.68  ? 97  TYR O N      1 
ATOM   5307   C  CA     . TYR B  2  98  ? 292.904 227.567 261.597 1.00 55.95  ? 97  TYR O CA     1 
ATOM   5308   C  C      . TYR B  2  98  ? 291.634 228.388 261.657 1.00 54.96  ? 97  TYR O C      1 
ATOM   5309   O  O      . TYR B  2  98  ? 290.535 227.825 261.692 1.00 61.74  ? 97  TYR O O      1 
ATOM   5310   C  CB     . TYR B  2  98  ? 293.228 227.030 262.989 1.00 58.46  ? 97  TYR O CB     1 
ATOM   5311   C  CG     . TYR B  2  98  ? 292.074 226.305 263.651 1.00 62.89  ? 97  TYR O CG     1 
ATOM   5312   C  CD1    . TYR B  2  98  ? 291.759 225.005 263.299 1.00 63.30  ? 97  TYR O CD1    1 
ATOM   5313   C  CD2    . TYR B  2  98  ? 291.308 226.923 264.631 1.00 68.01  ? 97  TYR O CD2    1 
ATOM   5314   C  CE1    . TYR B  2  98  ? 290.719 224.338 263.890 1.00 65.58  ? 97  TYR O CE1    1 
ATOM   5315   C  CE2    . TYR B  2  98  ? 290.263 226.263 265.234 1.00 74.59  ? 97  TYR O CE2    1 
ATOM   5316   C  CZ     . TYR B  2  98  ? 289.973 224.969 264.860 1.00 98.71  ? 97  TYR O CZ     1 
ATOM   5317   O  OH     . TYR B  2  98  ? 288.929 224.310 265.463 1.00 143.06 ? 97  TYR O OH     1 
ATOM   5318   H  H      . TYR B  2  98  ? 294.645 228.495 261.659 1.00 51.87  ? 97  TYR O H      1 
ATOM   5319   H  HA     . TYR B  2  98  ? 292.749 226.811 261.009 1.00 54.26  ? 97  TYR O HA     1 
ATOM   5320   H  HB2    . TYR B  2  98  ? 293.968 226.407 262.919 1.00 56.07  ? 97  TYR O HB2    1 
ATOM   5321   H  HB3    . TYR B  2  98  ? 293.477 227.773 263.560 1.00 56.07  ? 97  TYR O HB3    1 
ATOM   5322   H  HD1    . TYR B  2  98  ? 292.261 224.576 262.645 1.00 60.81  ? 97  TYR O HD1    1 
ATOM   5323   H  HD2    . TYR B  2  98  ? 291.505 227.796 264.883 1.00 65.99  ? 97  TYR O HD2    1 
ATOM   5324   H  HE1    . TYR B  2  98  ? 290.521 223.464 263.642 1.00 63.16  ? 97  TYR O HE1    1 
ATOM   5325   H  HE2    . TYR B  2  98  ? 289.756 226.686 265.889 1.00 72.63  ? 97  TYR O HE2    1 
ATOM   5326   H  HH     . TYR B  2  98  ? 288.564 224.809 266.031 1.00 140.96 ? 97  TYR O HH     1 
ATOM   5327   N  N      . LEU B  2  99  ? 291.770 229.705 261.677 1.00 49.39  ? 98  LEU O N      1 
ATOM   5328   C  CA     . LEU B  2  99  ? 290.621 230.584 261.724 1.00 49.25  ? 98  LEU O CA     1 
ATOM   5329   C  C      . LEU B  2  99  ? 289.916 230.672 260.377 1.00 48.28  ? 98  LEU O C      1 
ATOM   5330   O  O      . LEU B  2  99  ? 288.708 230.926 260.328 1.00 48.94  ? 98  LEU O O      1 
ATOM   5331   C  CB     . LEU B  2  99  ? 291.087 231.963 262.179 1.00 48.44  ? 98  LEU O CB     1 
ATOM   5332   C  CG     . LEU B  2  99  ? 290.015 232.993 262.472 1.00 60.28  ? 98  LEU O CG     1 
ATOM   5333   C  CD1    . LEU B  2  99  ? 289.082 232.499 263.572 1.00 77.81  ? 98  LEU O CD1    1 
ATOM   5334   C  CD2    . LEU B  2  99  ? 290.700 234.288 262.863 1.00 56.65  ? 98  LEU O CD2    1 
ATOM   5335   H  H      . LEU B  2  99  ? 292.525 230.116 261.663 1.00 47.87  ? 98  LEU O H      1 
ATOM   5336   H  HA     . LEU B  2  99  ? 289.987 230.247 262.377 1.00 48.49  ? 98  LEU O HA     1 
ATOM   5337   H  HB2    . LEU B  2  99  ? 291.606 231.852 262.991 1.00 47.78  ? 98  LEU O HB2    1 
ATOM   5338   H  HB3    . LEU B  2  99  ? 291.655 232.332 261.485 1.00 47.78  ? 98  LEU O HB3    1 
ATOM   5339   H  HG     . LEU B  2  99  ? 289.490 233.151 261.672 1.00 60.30  ? 98  LEU O HG     1 
ATOM   5340   H  HD11   . LEU B  2  99  ? 288.407 233.175 263.740 1.00 77.78  ? 98  LEU O HD11   1 
ATOM   5341   H  HD12   . LEU B  2  99  ? 288.661 231.675 263.281 1.00 77.78  ? 98  LEU O HD12   1 
ATOM   5342   H  HD13   . LEU B  2  99  ? 289.600 232.340 264.377 1.00 77.78  ? 98  LEU O HD13   1 
ATOM   5343   H  HD21   . LEU B  2  99  ? 290.024 234.957 263.054 1.00 56.66  ? 98  LEU O HD21   1 
ATOM   5344   H  HD22   . LEU B  2  99  ? 291.243 234.132 263.651 1.00 56.66  ? 98  LEU O HD22   1 
ATOM   5345   H  HD23   . LEU B  2  99  ? 291.260 234.583 262.128 1.00 56.66  ? 98  LEU O HD23   1 
ATOM   5346   N  N      . VAL B  2  100 ? 290.639 230.453 259.281 1.00 37.57  ? 99  VAL O N      1 
ATOM   5347   C  CA     . VAL B  2  100 ? 290.115 230.692 257.945 1.00 36.78  ? 99  VAL O CA     1 
ATOM   5348   C  C      . VAL B  2  100 ? 289.682 229.397 257.257 1.00 40.69  ? 99  VAL O C      1 
ATOM   5349   O  O      . VAL B  2  100 ? 288.721 229.394 256.484 1.00 51.93  ? 99  VAL O O      1 
ATOM   5350   C  CB     . VAL B  2  100 ? 291.156 231.446 257.097 1.00 35.06  ? 99  VAL O CB     1 
ATOM   5351   C  CG1    . VAL B  2  100 ? 290.646 231.690 255.678 1.00 34.87  ? 99  VAL O CG1    1 
ATOM   5352   C  CG2    . VAL B  2  100 ? 291.493 232.764 257.778 1.00 34.83  ? 99  VAL O CG2    1 
ATOM   5353   H  H      . VAL B  2  100 ? 291.448 230.162 259.289 1.00 43.98  ? 99  VAL O H      1 
ATOM   5354   H  HA     . VAL B  2  100 ? 289.331 231.260 258.018 1.00 43.82  ? 99  VAL O HA     1 
ATOM   5355   H  HB     . VAL B  2  100 ? 291.967 230.916 257.042 1.00 42.08  ? 99  VAL O HB     1 
ATOM   5356   H  HG11   . VAL B  2  100 ? 291.327 232.165 255.176 1.00 42.52  ? 99  VAL O HG11   1 
ATOM   5357   H  HG12   . VAL B  2  100 ? 290.461 230.835 255.258 1.00 42.52  ? 99  VAL O HG12   1 
ATOM   5358   H  HG13   . VAL B  2  100 ? 289.836 232.221 255.721 1.00 42.52  ? 99  VAL O HG13   1 
ATOM   5359   H  HG21   . VAL B  2  100 ? 292.150 233.237 257.242 1.00 41.94  ? 99  VAL O HG21   1 
ATOM   5360   H  HG22   . VAL B  2  100 ? 290.685 233.295 257.855 1.00 41.94  ? 99  VAL O HG22   1 
ATOM   5361   H  HG23   . VAL B  2  100 ? 291.855 232.581 258.659 1.00 41.94  ? 99  VAL O HG23   1 
ATOM   5362   N  N      . TYR B  2  101 ? 290.371 228.293 257.514 1.00 34.24  ? 100 TYR O N      1 
ATOM   5363   C  CA     . TYR B  2  101 ? 290.031 227.023 256.880 1.00 35.03  ? 100 TYR O CA     1 
ATOM   5364   C  C      . TYR B  2  101 ? 289.414 226.010 257.829 1.00 36.80  ? 100 TYR O C      1 
ATOM   5365   O  O      . TYR B  2  101 ? 289.023 224.928 257.380 1.00 38.33  ? 100 TYR O O      1 
ATOM   5366   C  CB     . TYR B  2  101 ? 291.261 226.397 256.234 1.00 34.21  ? 100 TYR O CB     1 
ATOM   5367   C  CG     . TYR B  2  101 ? 291.916 227.307 255.256 1.00 32.88  ? 100 TYR O CG     1 
ATOM   5368   C  CD1    . TYR B  2  101 ? 291.770 227.118 253.896 1.00 33.04  ? 100 TYR O CD1    1 
ATOM   5369   C  CD2    . TYR B  2  101 ? 292.671 228.373 255.695 1.00 31.77  ? 100 TYR O CD2    1 
ATOM   5370   C  CE1    . TYR B  2  101 ? 292.369 227.962 253.003 1.00 32.13  ? 100 TYR O CE1    1 
ATOM   5371   C  CE2    . TYR B  2  101 ? 293.272 229.221 254.818 1.00 30.83  ? 100 TYR O CE2    1 
ATOM   5372   C  CZ     . TYR B  2  101 ? 293.119 229.016 253.469 1.00 36.66  ? 100 TYR O CZ     1 
ATOM   5373   O  OH     . TYR B  2  101 ? 293.725 229.885 252.589 1.00 55.91  ? 100 TYR O OH     1 
ATOM   5374   H  H      . TYR B  2  101 ? 291.042 228.251 258.051 1.00 41.53  ? 100 TYR O H      1 
ATOM   5375   H  HA     . TYR B  2  101 ? 289.386 227.194 256.176 1.00 42.22  ? 100 TYR O HA     1 
ATOM   5376   H  HB2    . TYR B  2  101 ? 291.907 226.182 256.925 1.00 40.81  ? 100 TYR O HB2    1 
ATOM   5377   H  HB3    . TYR B  2  101 ? 290.996 225.591 255.765 1.00 40.81  ? 100 TYR O HB3    1 
ATOM   5378   H  HD1    . TYR B  2  101 ? 291.261 226.405 253.584 1.00 40.18  ? 100 TYR O HD1    1 
ATOM   5379   H  HD2    . TYR B  2  101 ? 292.775 228.513 256.608 1.00 38.49  ? 100 TYR O HD2    1 
ATOM   5380   H  HE1    . TYR B  2  101 ? 292.266 227.827 252.088 1.00 39.47  ? 100 TYR O HE1    1 
ATOM   5381   H  HE2    . TYR B  2  101 ? 293.779 229.936 255.129 1.00 37.75  ? 100 TYR O HE2    1 
ATOM   5382   H  HH     . TYR B  2  101 ? 294.147 230.475 253.013 1.00 63.32  ? 100 TYR O HH     1 
ATOM   5383   N  N      . GLN B  2  102 ? 289.328 226.305 259.121 1.00 67.05  ? 101 GLN O N      1 
ATOM   5384   C  CA     . GLN B  2  102 ? 288.688 225.398 260.069 1.00 69.90  ? 101 GLN O CA     1 
ATOM   5385   C  C      . GLN B  2  102 ? 289.310 224.012 260.050 1.00 72.57  ? 101 GLN O C      1 
ATOM   5386   O  O      . GLN B  2  102 ? 288.660 223.032 260.425 1.00 75.07  ? 101 GLN O O      1 
ATOM   5387   C  CB     . GLN B  2  102 ? 287.190 225.299 259.790 1.00 70.98  ? 101 GLN O CB     1 
ATOM   5388   C  CG     . GLN B  2  102 ? 286.457 226.544 260.180 1.00 104.74 ? 101 GLN O CG     1 
ATOM   5389   C  CD     . GLN B  2  102 ? 286.545 226.786 261.669 1.00 137.87 ? 101 GLN O CD     1 
ATOM   5390   O  OE1    . GLN B  2  102 ? 286.006 226.019 262.466 1.00 138.25 ? 101 GLN O OE1    1 
ATOM   5391   N  NE2    . GLN B  2  102 ? 287.255 227.840 262.056 1.00 168.24 ? 101 GLN O NE2    1 
ATOM   5392   H  H      . GLN B  2  102 ? 289.633 227.026 259.476 1.00 65.35  ? 101 GLN O H      1 
ATOM   5393   H  HA     . GLN B  2  102 ? 288.798 225.758 260.964 1.00 67.94  ? 101 GLN O HA     1 
ATOM   5394   H  HB2    . GLN B  2  102 ? 287.053 225.153 258.841 1.00 69.70  ? 101 GLN O HB2    1 
ATOM   5395   H  HB3    . GLN B  2  102 ? 286.821 224.560 260.298 1.00 69.70  ? 101 GLN O HB3    1 
ATOM   5396   H  HG2    . GLN B  2  102 ? 286.850 227.304 259.723 1.00 104.06 ? 101 GLN O HG2    1 
ATOM   5397   H  HG3    . GLN B  2  102 ? 285.522 226.454 259.940 1.00 104.06 ? 101 GLN O HG3    1 
ATOM   5398   H  HE21   . GLN B  2  102 ? 287.634 228.342 261.469 1.00 167.13 ? 101 GLN O HE21   1 
ATOM   5399   H  HE22   . GLN B  2  102 ? 287.335 228.020 262.893 1.00 167.13 ? 101 GLN O HE22   1 
ATOM   5400   N  N      . GLU B  2  103 ? 290.549 223.915 259.597 1.00 84.45  ? 102 GLU O N      1 
ATOM   5401   C  CA     . GLU B  2  103 ? 291.351 222.721 259.767 1.00 87.40  ? 102 GLU O CA     1 
ATOM   5402   C  C      . GLU B  2  103 ? 292.556 223.118 260.591 1.00 87.16  ? 102 GLU O C      1 
ATOM   5403   O  O      . GLU B  2  103 ? 292.862 224.310 260.703 1.00 109.37 ? 102 GLU O O      1 
ATOM   5404   C  CB     . GLU B  2  103 ? 291.829 222.136 258.439 1.00 107.90 ? 102 GLU O CB     1 
ATOM   5405   C  CG     . GLU B  2  103 ? 290.744 221.794 257.451 1.00 133.60 ? 102 GLU O CG     1 
ATOM   5406   C  CD     . GLU B  2  103 ? 290.309 220.349 257.560 1.00 152.36 ? 102 GLU O CD     1 
ATOM   5407   O  OE1    . GLU B  2  103 ? 289.472 220.048 258.438 1.00 169.27 ? 102 GLU O OE1    1 
ATOM   5408   O  OE2    . GLU B  2  103 ? 290.814 219.512 256.776 1.00 148.01 ? 102 GLU O OE2    1 
ATOM   5409   H  H      . GLU B  2  103 ? 290.956 224.545 259.176 1.00 86.76  ? 102 GLU O H      1 
ATOM   5410   H  HA     . GLU B  2  103 ? 290.846 222.047 260.247 1.00 88.90  ? 102 GLU O HA     1 
ATOM   5411   H  HB2    . GLU B  2  103 ? 292.416 222.781 258.014 1.00 109.32 ? 102 GLU O HB2    1 
ATOM   5412   H  HB3    . GLU B  2  103 ? 292.323 221.322 258.623 1.00 109.32 ? 102 GLU O HB3    1 
ATOM   5413   H  HG2    . GLU B  2  103 ? 289.972 222.356 257.620 1.00 135.64 ? 102 GLU O HG2    1 
ATOM   5414   H  HG3    . GLU B  2  103 ? 291.075 221.942 256.551 1.00 135.64 ? 102 GLU O HG3    1 
ATOM   5415   N  N      . PRO B  2  104 ? 293.264 222.186 261.148 1.00 60.38  ? 103 PRO O N      1 
ATOM   5416   C  CA     . PRO B  2  104 ? 294.578 222.525 261.695 1.00 60.03  ? 103 PRO O CA     1 
ATOM   5417   C  C      . PRO B  2  104 ? 295.656 222.483 260.622 1.00 59.45  ? 103 PRO O C      1 
ATOM   5418   O  O      . PRO B  2  104 ? 295.842 221.482 259.922 1.00 63.01  ? 103 PRO O O      1 
ATOM   5419   C  CB     . PRO B  2  104 ? 294.786 221.474 262.778 1.00 63.67  ? 103 PRO O CB     1 
ATOM   5420   C  CG     . PRO B  2  104 ? 294.013 220.286 262.290 1.00 66.25  ? 103 PRO O CG     1 
ATOM   5421   C  CD     . PRO B  2  104 ? 292.863 220.808 261.471 1.00 64.07  ? 103 PRO O CD     1 
ATOM   5422   H  HA     . PRO B  2  104 ? 294.560 223.406 262.100 1.00 62.77  ? 103 PRO O HA     1 
ATOM   5423   H  HB2    . PRO B  2  104 ? 295.730 221.264 262.857 1.00 65.65  ? 103 PRO O HB2    1 
ATOM   5424   H  HB3    . PRO B  2  104 ? 294.430 221.795 263.621 1.00 65.65  ? 103 PRO O HB3    1 
ATOM   5425   H  HG2    . PRO B  2  104 ? 294.591 219.730 261.744 1.00 68.30  ? 103 PRO O HG2    1 
ATOM   5426   H  HG3    . PRO B  2  104 ? 293.684 219.783 263.052 1.00 68.30  ? 103 PRO O HG3    1 
ATOM   5427   H  HD2    . PRO B  2  104 ? 292.763 220.286 260.659 1.00 67.06  ? 103 PRO O HD2    1 
ATOM   5428   H  HD3    . PRO B  2  104 ? 292.047 220.807 261.996 1.00 67.06  ? 103 PRO O HD3    1 
ATOM   5429   N  N      . ILE B  2  105 ? 296.313 223.626 260.464 1.00 37.57  ? 104 ILE O N      1 
ATOM   5430   C  CA     . ILE B  2  105 ? 297.483 223.861 259.620 1.00 36.54  ? 104 ILE O CA     1 
ATOM   5431   C  C      . ILE B  2  105 ? 298.288 222.590 259.343 1.00 37.91  ? 104 ILE O C      1 
ATOM   5432   O  O      . ILE B  2  105 ? 298.762 221.945 260.290 1.00 48.90  ? 104 ILE O O      1 
ATOM   5433   C  CB     . ILE B  2  105 ? 298.327 224.953 260.295 1.00 35.83  ? 104 ILE O CB     1 
ATOM   5434   C  CG1    . ILE B  2  105 ? 299.570 225.321 259.501 1.00 35.05  ? 104 ILE O CG1    1 
ATOM   5435   C  CG2    . ILE B  2  105 ? 298.676 224.561 261.720 1.00 37.29  ? 104 ILE O CG2    1 
ATOM   5436   C  CD1    . ILE B  2  105 ? 299.279 226.301 258.415 1.00 41.43  ? 104 ILE O CD1    1 
ATOM   5437   H  H      . ILE B  2  105 ? 296.076 224.343 260.876 1.00 38.90  ? 104 ILE O H      1 
ATOM   5438   H  HA     . ILE B  2  105 ? 297.183 224.208 258.765 1.00 37.61  ? 104 ILE O HA     1 
ATOM   5439   H  HB     . ILE B  2  105 ? 297.775 225.749 260.345 1.00 36.70  ? 104 ILE O HB     1 
ATOM   5440   H  HG12   . ILE B  2  105 ? 300.222 225.718 260.098 1.00 35.64  ? 104 ILE O HG12   1 
ATOM   5441   H  HG13   . ILE B  2  105 ? 299.934 224.520 259.094 1.00 35.64  ? 104 ILE O HG13   1 
ATOM   5442   H  HG21   . ILE B  2  105 ? 299.207 225.266 262.120 1.00 37.49  ? 104 ILE O HG21   1 
ATOM   5443   H  HG22   . ILE B  2  105 ? 297.855 224.437 262.223 1.00 37.49  ? 104 ILE O HG22   1 
ATOM   5444   H  HG23   . ILE B  2  105 ? 299.182 223.733 261.704 1.00 37.49  ? 104 ILE O HG23   1 
ATOM   5445   H  HD11   . ILE B  2  105 ? 300.102 226.501 257.942 1.00 42.76  ? 104 ILE O HD11   1 
ATOM   5446   H  HD12   . ILE B  2  105 ? 298.632 225.914 257.805 1.00 42.76  ? 104 ILE O HD12   1 
ATOM   5447   H  HD13   . ILE B  2  105 ? 298.919 227.111 258.809 1.00 42.76  ? 104 ILE O HD13   1 
ATOM   5448   N  N      . PRO B  2  106 ? 298.453 222.180 258.079 1.00 45.13  ? 105 PRO O N      1 
ATOM   5449   C  CA     . PRO B  2  106 ? 299.397 221.097 257.767 1.00 47.94  ? 105 PRO O CA     1 
ATOM   5450   C  C      . PRO B  2  106 ? 300.831 221.518 258.044 1.00 51.64  ? 105 PRO O C      1 
ATOM   5451   O  O      . PRO B  2  106 ? 301.145 222.704 258.150 1.00 65.88  ? 105 PRO O O      1 
ATOM   5452   C  CB     . PRO B  2  106 ? 299.184 220.845 256.270 1.00 48.54  ? 105 PRO O CB     1 
ATOM   5453   C  CG     . PRO B  2  106 ? 297.851 221.362 255.974 1.00 46.60  ? 105 PRO O CG     1 
ATOM   5454   C  CD     . PRO B  2  106 ? 297.619 222.517 256.912 1.00 43.90  ? 105 PRO O CD     1 
ATOM   5455   H  HA     . PRO B  2  106 ? 299.184 220.296 258.271 1.00 46.69  ? 105 PRO O HA     1 
ATOM   5456   H  HB2    . PRO B  2  106 ? 299.857 221.323 255.760 1.00 47.66  ? 105 PRO O HB2    1 
ATOM   5457   H  HB3    . PRO B  2  106 ? 299.230 219.893 256.090 1.00 47.66  ? 105 PRO O HB3    1 
ATOM   5458   H  HG2    . PRO B  2  106 ? 297.819 221.662 255.052 1.00 46.64  ? 105 PRO O HG2    1 
ATOM   5459   H  HG3    . PRO B  2  106 ? 297.194 220.665 256.126 1.00 46.64  ? 105 PRO O HG3    1 
ATOM   5460   H  HD2    . PRO B  2  106 ? 297.920 223.346 256.509 1.00 44.25  ? 105 PRO O HD2    1 
ATOM   5461   H  HD3    . PRO B  2  106 ? 296.684 222.564 257.167 1.00 44.25  ? 105 PRO O HD3    1 
ATOM   5462   N  N      . THR B  2  107 ? 301.719 220.524 258.137 1.00 40.80  ? 106 THR O N      1 
ATOM   5463   C  CA     . THR B  2  107 ? 303.095 220.834 258.519 1.00 39.86  ? 106 THR O CA     1 
ATOM   5464   C  C      . THR B  2  107 ? 303.919 221.317 257.340 1.00 38.69  ? 106 THR O C      1 
ATOM   5465   O  O      . THR B  2  107 ? 304.827 222.133 257.523 1.00 37.00  ? 106 THR O O      1 
ATOM   5466   C  CB     . THR B  2  107 ? 303.783 219.626 259.142 1.00 42.61  ? 106 THR O CB     1 
ATOM   5467   O  OG1    . THR B  2  107 ? 303.003 219.145 260.242 1.00 44.68  ? 106 THR O OG1    1 
ATOM   5468   C  CG2    . THR B  2  107 ? 305.174 220.031 259.642 1.00 41.60  ? 106 THR O CG2    1 
ATOM   5469   H  H      . THR B  2  107 ? 301.557 219.693 257.990 1.00 46.36  ? 106 THR O H      1 
ATOM   5470   H  HA     . THR B  2  107 ? 303.083 221.542 259.182 1.00 44.73  ? 106 THR O HA     1 
ATOM   5471   H  HB     . THR B  2  107 ? 303.881 218.925 258.478 1.00 46.51  ? 106 THR O HB     1 
ATOM   5472   H  HG1    . THR B  2  107 ? 303.377 218.478 260.590 1.00 48.54  ? 106 THR O HG1    1 
ATOM   5473   H  HG21   . THR B  2  107 ? 305.619 219.267 260.040 1.00 44.80  ? 106 THR O HG21   1 
ATOM   5474   H  HG22   . THR B  2  107 ? 305.710 220.358 258.903 1.00 44.80  ? 106 THR O HG22   1 
ATOM   5475   H  HG23   . THR B  2  107 ? 305.095 220.732 260.308 1.00 44.80  ? 106 THR O HG23   1 
ATOM   5476   N  N      . ALA B  2  108 ? 303.647 220.811 256.139 1.00 64.32  ? 107 ALA O N      1 
ATOM   5477   C  CA     . ALA B  2  108 ? 304.259 221.394 254.956 1.00 63.34  ? 107 ALA O CA     1 
ATOM   5478   C  C      . ALA B  2  108 ? 303.992 222.893 254.910 1.00 68.17  ? 107 ALA O C      1 
ATOM   5479   O  O      . ALA B  2  108 ? 304.904 223.700 254.700 1.00 79.49  ? 107 ALA O O      1 
ATOM   5480   C  CB     . ALA B  2  108 ? 303.716 220.703 253.704 1.00 65.68  ? 107 ALA O CB     1 
ATOM   5481   H  H      . ALA B  2  108 ? 303.123 220.146 255.987 1.00 53.59  ? 107 ALA O H      1 
ATOM   5482   H  HA     . ALA B  2  108 ? 305.218 221.256 254.989 1.00 52.77  ? 107 ALA O HA     1 
ATOM   5483   H  HB1    . ALA B  2  108 ? 304.130 221.099 252.921 1.00 55.41  ? 107 ALA O HB1    1 
ATOM   5484   H  HB2    . ALA B  2  108 ? 303.929 219.758 253.749 1.00 55.41  ? 107 ALA O HB2    1 
ATOM   5485   H  HB3    . ALA B  2  108 ? 302.755 220.825 253.669 1.00 55.41  ? 107 ALA O HB3    1 
ATOM   5486   N  N      . GLN B  2  109 ? 302.735 223.278 255.132 1.00 67.46  ? 108 GLN O N      1 
ATOM   5487   C  CA     . GLN B  2  109 ? 302.359 224.688 255.135 1.00 63.49  ? 108 GLN O CA     1 
ATOM   5488   C  C      . GLN B  2  109 ? 303.135 225.474 256.185 1.00 60.83  ? 108 GLN O C      1 
ATOM   5489   O  O      . GLN B  2  109 ? 303.731 226.515 255.880 1.00 59.71  ? 108 GLN O O      1 
ATOM   5490   C  CB     . GLN B  2  109 ? 300.857 224.807 255.376 1.00 78.07  ? 108 GLN O CB     1 
ATOM   5491   C  CG     . GLN B  2  109 ? 300.040 224.298 254.223 1.00 99.24  ? 108 GLN O CG     1 
ATOM   5492   C  CD     . GLN B  2  109 ? 300.198 225.179 253.011 1.00 120.01 ? 108 GLN O CD     1 
ATOM   5493   O  OE1    . GLN B  2  109 ? 300.975 224.880 252.105 1.00 125.87 ? 108 GLN O OE1    1 
ATOM   5494   N  NE2    . GLN B  2  109 ? 299.474 226.290 252.999 1.00 137.59 ? 108 GLN O NE2    1 
ATOM   5495   H  H      . GLN B  2  109 ? 302.081 222.740 255.283 1.00 69.41  ? 108 GLN O H      1 
ATOM   5496   H  HA     . GLN B  2  109 ? 302.556 225.070 254.266 1.00 66.14  ? 108 GLN O HA     1 
ATOM   5497   H  HB2    . GLN B  2  109 ? 300.621 224.290 256.162 1.00 81.47  ? 108 GLN O HB2    1 
ATOM   5498   H  HB3    . GLN B  2  109 ? 300.632 225.741 255.513 1.00 81.47  ? 108 GLN O HB3    1 
ATOM   5499   H  HG2    . GLN B  2  109 ? 300.335 223.404 253.990 1.00 103.13 ? 108 GLN O HG2    1 
ATOM   5500   H  HG3    . GLN B  2  109 ? 299.103 224.289 254.473 1.00 103.13 ? 108 GLN O HG3    1 
ATOM   5501   H  HE21   . GLN B  2  109 ? 298.954 226.471 253.659 1.00 142.71 ? 108 GLN O HE21   1 
ATOM   5502   H  HE22   . GLN B  2  109 ? 299.525 226.829 252.331 1.00 142.71 ? 108 GLN O HE22   1 
ATOM   5503   N  N      . LEU B  2  110 ? 303.133 224.995 257.436 1.00 54.02  ? 109 LEU O N      1 
ATOM   5504   C  CA     . LEU B  2  110 ? 303.716 225.759 258.534 1.00 38.54  ? 109 LEU O CA     1 
ATOM   5505   C  C      . LEU B  2  110 ? 305.225 225.895 258.424 1.00 39.41  ? 109 LEU O C      1 
ATOM   5506   O  O      . LEU B  2  110 ? 305.818 226.675 259.172 1.00 39.62  ? 109 LEU O O      1 
ATOM   5507   C  CB     . LEU B  2  110 ? 303.369 225.126 259.880 1.00 39.62  ? 109 LEU O CB     1 
ATOM   5508   C  CG     . LEU B  2  110 ? 303.810 225.980 261.076 1.00 39.90  ? 109 LEU O CG     1 
ATOM   5509   C  CD1    . LEU B  2  110 ? 302.889 227.174 261.202 1.00 38.55  ? 109 LEU O CD1    1 
ATOM   5510   C  CD2    . LEU B  2  110 ? 303.898 225.192 262.345 1.00 41.68  ? 109 LEU O CD2    1 
ATOM   5511   H  H      . LEU B  2  110 ? 302.802 224.236 257.668 1.00 50.27  ? 109 LEU O H      1 
ATOM   5512   H  HA     . LEU B  2  110 ? 303.339 226.653 258.523 1.00 34.51  ? 109 LEU O HA     1 
ATOM   5513   H  HB2    . LEU B  2  110 ? 302.408 225.009 259.935 1.00 35.22  ? 109 LEU O HB2    1 
ATOM   5514   H  HB3    . LEU B  2  110 ? 303.813 224.266 259.947 1.00 35.22  ? 109 LEU O HB3    1 
ATOM   5515   H  HG     . LEU B  2  110 ? 304.699 226.323 260.891 1.00 35.29  ? 109 LEU O HG     1 
ATOM   5516   H  HD11   . LEU B  2  110 ? 303.170 227.711 261.959 1.00 34.79  ? 109 LEU O HD11   1 
ATOM   5517   H  HD12   . LEU B  2  110 ? 302.939 227.698 260.387 1.00 34.79  ? 109 LEU O HD12   1 
ATOM   5518   H  HD13   . LEU B  2  110 ? 301.982 226.859 261.338 1.00 34.79  ? 109 LEU O HD13   1 
ATOM   5519   H  HD21   . LEU B  2  110 ? 304.180 225.781 263.063 1.00 36.42  ? 109 LEU O HD21   1 
ATOM   5520   H  HD22   . LEU B  2  110 ? 303.026 224.819 262.546 1.00 36.42  ? 109 LEU O HD22   1 
ATOM   5521   H  HD23   . LEU B  2  110 ? 304.545 224.479 262.229 1.00 36.42  ? 109 LEU O HD23   1 
ATOM   5522   N  N      . VAL B  2  111 ? 305.867 225.178 257.517 1.00 41.08  ? 110 VAL O N      1 
ATOM   5523   C  CA     . VAL B  2  111 ? 307.292 225.379 257.320 1.00 41.46  ? 110 VAL O CA     1 
ATOM   5524   C  C      . VAL B  2  111 ? 307.550 226.504 256.328 1.00 50.35  ? 110 VAL O C      1 
ATOM   5525   O  O      . VAL B  2  111 ? 308.436 227.334 256.543 1.00 69.77  ? 110 VAL O O      1 
ATOM   5526   C  CB     . VAL B  2  111 ? 307.935 224.052 256.889 1.00 92.90  ? 110 VAL O CB     1 
ATOM   5527   C  CG1    . VAL B  2  111 ? 309.362 224.275 256.416 1.00 109.95 ? 110 VAL O CG1    1 
ATOM   5528   C  CG2    . VAL B  2  111 ? 307.886 223.090 258.065 1.00 118.34 ? 110 VAL O CG2    1 
ATOM   5529   H  H      . VAL B  2  111 ? 305.510 224.582 257.011 1.00 45.14  ? 110 VAL O H      1 
ATOM   5530   H  HA     . VAL B  2  111 ? 307.689 225.637 258.166 1.00 44.88  ? 110 VAL O HA     1 
ATOM   5531   H  HB     . VAL B  2  111 ? 307.426 223.669 256.157 1.00 95.58  ? 110 VAL O HB     1 
ATOM   5532   H  HG11   . VAL B  2  111 ? 309.743 223.423 256.151 1.00 112.04 ? 110 VAL O HG11   1 
ATOM   5533   H  HG12   . VAL B  2  111 ? 309.353 224.883 255.661 1.00 112.04 ? 110 VAL O HG12   1 
ATOM   5534   H  HG13   . VAL B  2  111 ? 309.879 224.656 257.143 1.00 112.04 ? 110 VAL O HG13   1 
ATOM   5535   H  HG21   . VAL B  2  111 ? 308.290 222.249 257.802 1.00 120.42 ? 110 VAL O HG21   1 
ATOM   5536   H  HG22   . VAL B  2  111 ? 308.376 223.476 258.808 1.00 120.42 ? 110 VAL O HG22   1 
ATOM   5537   H  HG23   . VAL B  2  111 ? 306.960 222.948 258.317 1.00 120.42 ? 110 VAL O HG23   1 
ATOM   5538   N  N      . GLN B  2  112 ? 306.768 226.573 255.247 1.00 77.31  ? 111 GLN O N      1 
ATOM   5539   C  CA     . GLN B  2  112 ? 306.902 227.682 254.308 1.00 77.13  ? 111 GLN O CA     1 
ATOM   5540   C  C      . GLN B  2  112 ? 306.579 229.012 254.973 1.00 84.68  ? 111 GLN O C      1 
ATOM   5541   O  O      . GLN B  2  112 ? 307.277 230.009 254.753 1.00 117.59 ? 111 GLN O O      1 
ATOM   5542   C  CB     . GLN B  2  112 ? 305.983 227.477 253.116 1.00 75.87  ? 111 GLN O CB     1 
ATOM   5543   C  CG     . GLN B  2  112 ? 306.264 226.238 252.323 1.00 80.02  ? 111 GLN O CG     1 
ATOM   5544   C  CD     . GLN B  2  112 ? 305.189 225.995 251.293 1.00 110.75 ? 111 GLN O CD     1 
ATOM   5545   O  OE1    . GLN B  2  112 ? 304.425 225.032 251.381 1.00 107.71 ? 111 GLN O OE1    1 
ATOM   5546   N  NE2    . GLN B  2  112 ? 305.111 226.882 250.309 1.00 137.85 ? 111 GLN O NE2    1 
ATOM   5547   H  H      . GLN B  2  112 ? 306.162 225.998 255.040 1.00 68.45  ? 111 GLN O H      1 
ATOM   5548   H  HA     . GLN B  2  112 ? 307.816 227.718 253.985 1.00 68.79  ? 111 GLN O HA     1 
ATOM   5549   H  HB2    . GLN B  2  112 ? 305.069 227.421 253.434 1.00 68.19  ? 111 GLN O HB2    1 
ATOM   5550   H  HB3    . GLN B  2  112 ? 306.076 228.235 252.519 1.00 68.19  ? 111 GLN O HB3    1 
ATOM   5551   H  HG2    . GLN B  2  112 ? 307.111 226.337 251.862 1.00 71.92  ? 111 GLN O HG2    1 
ATOM   5552   H  HG3    . GLN B  2  112 ? 306.292 225.474 252.920 1.00 71.92  ? 111 GLN O HG3    1 
ATOM   5553   H  HE21   . GLN B  2  112 ? 305.656 227.547 250.286 1.00 130.98 ? 111 GLN O HE21   1 
ATOM   5554   H  HE22   . GLN B  2  112 ? 304.516 226.792 249.695 1.00 130.98 ? 111 GLN O HE22   1 
ATOM   5555   N  N      . ARG B  2  113 ? 305.515 229.053 255.776 1.00 52.51  ? 112 ARG O N      1 
ATOM   5556   C  CA     . ARG B  2  113 ? 305.112 230.306 256.399 1.00 49.95  ? 112 ARG O CA     1 
ATOM   5557   C  C      . ARG B  2  113 ? 306.165 230.797 257.386 1.00 49.89  ? 112 ARG O C      1 
ATOM   5558   O  O      . ARG B  2  113 ? 306.547 231.974 257.364 1.00 52.52  ? 112 ARG O O      1 
ATOM   5559   C  CB     . ARG B  2  113 ? 303.756 230.139 257.079 1.00 48.82  ? 112 ARG O CB     1 
ATOM   5560   C  CG     . ARG B  2  113 ? 302.606 230.096 256.105 1.00 73.04  ? 112 ARG O CG     1 
ATOM   5561   C  CD     . ARG B  2  113 ? 301.316 229.724 256.797 1.00 99.80  ? 112 ARG O CD     1 
ATOM   5562   N  NE     . ARG B  2  113 ? 300.312 229.302 255.826 1.00 108.80 ? 112 ARG O NE     1 
ATOM   5563   C  CZ     . ARG B  2  113 ? 299.338 230.074 255.358 1.00 102.33 ? 112 ARG O CZ     1 
ATOM   5564   N  NH1    . ARG B  2  113 ? 299.204 231.329 255.770 1.00 97.72  ? 112 ARG O NH1    1 
ATOM   5565   N  NH2    . ARG B  2  113 ? 298.484 229.585 254.471 1.00 108.55 ? 112 ARG O NH2    1 
ATOM   5566   H  H      . ARG B  2  113 ? 305.019 228.378 255.973 1.00 50.09  ? 112 ARG O H      1 
ATOM   5567   H  HA     . ARG B  2  113 ? 305.016 230.981 255.709 1.00 48.03  ? 112 ARG O HA     1 
ATOM   5568   H  HB2    . ARG B  2  113 ? 303.756 229.309 257.580 1.00 47.39  ? 112 ARG O HB2    1 
ATOM   5569   H  HB3    . ARG B  2  113 ? 303.611 230.887 257.680 1.00 47.39  ? 112 ARG O HB3    1 
ATOM   5570   H  HG2    . ARG B  2  113 ? 302.494 230.970 255.701 1.00 72.39  ? 112 ARG O HG2    1 
ATOM   5571   H  HG3    . ARG B  2  113 ? 302.788 229.431 255.423 1.00 72.39  ? 112 ARG O HG3    1 
ATOM   5572   H  HD2    . ARG B  2  113 ? 301.479 228.989 257.409 1.00 99.51  ? 112 ARG O HD2    1 
ATOM   5573   H  HD3    . ARG B  2  113 ? 300.974 230.495 257.277 1.00 99.51  ? 112 ARG O HD3    1 
ATOM   5574   H  HE     . ARG B  2  113 ? 300.354 228.494 255.535 1.00 109.09 ? 112 ARG O HE     1 
ATOM   5575   H  HH11   . ARG B  2  113 ? 299.755 231.655 256.344 1.00 99.21  ? 112 ARG O HH11   1 
ATOM   5576   H  HH12   . ARG B  2  113 ? 298.568 231.818 255.460 1.00 99.21  ? 112 ARG O HH12   1 
ATOM   5577   H  HH21   . ARG B  2  113 ? 298.563 228.772 254.202 1.00 110.12 ? 112 ARG O HH21   1 
ATOM   5578   H  HH22   . ARG B  2  113 ? 297.849 230.079 254.167 1.00 110.12 ? 112 ARG O HH22   1 
ATOM   5579   N  N      . VAL B  2  114 ? 306.666 229.913 258.249 1.00 40.38  ? 113 VAL O N      1 
ATOM   5580   C  CA     . VAL B  2  114 ? 307.719 230.320 259.174 1.00 41.60  ? 113 VAL O CA     1 
ATOM   5581   C  C      . VAL B  2  114 ? 308.980 230.681 258.407 1.00 58.53  ? 113 VAL O C      1 
ATOM   5582   O  O      . VAL B  2  114 ? 309.646 231.679 258.713 1.00 91.51  ? 113 VAL O O      1 
ATOM   5583   C  CB     . VAL B  2  114 ? 307.988 229.213 260.204 1.00 42.97  ? 113 VAL O CB     1 
ATOM   5584   C  CG1    . VAL B  2  114 ? 309.241 229.531 261.017 1.00 44.68  ? 113 VAL O CG1    1 
ATOM   5585   C  CG2    . VAL B  2  114 ? 306.784 229.056 261.108 1.00 42.50  ? 113 VAL O CG2    1 
ATOM   5586   H  H      . VAL B  2  114 ? 306.419 229.092 258.318 1.00 33.71  ? 113 VAL O H      1 
ATOM   5587   H  HA     . VAL B  2  114 ? 307.427 231.110 259.655 1.00 34.31  ? 113 VAL O HA     1 
ATOM   5588   H  HB     . VAL B  2  114 ? 308.131 228.373 259.741 1.00 34.91  ? 113 VAL O HB     1 
ATOM   5589   H  HG11   . VAL B  2  114 ? 309.389 228.819 261.659 1.00 35.88  ? 113 VAL O HG11   1 
ATOM   5590   H  HG12   . VAL B  2  114 ? 309.999 229.597 260.415 1.00 35.88  ? 113 VAL O HG12   1 
ATOM   5591   H  HG13   . VAL B  2  114 ? 309.112 230.373 261.480 1.00 35.88  ? 113 VAL O HG13   1 
ATOM   5592   H  HG21   . VAL B  2  114 ? 306.964 228.355 261.755 1.00 34.81  ? 113 VAL O HG21   1 
ATOM   5593   H  HG22   . VAL B  2  114 ? 306.621 229.895 261.567 1.00 34.81  ? 113 VAL O HG22   1 
ATOM   5594   H  HG23   . VAL B  2  114 ? 306.013 228.819 260.569 1.00 34.81  ? 113 VAL O HG23   1 
ATOM   5595   N  N      . ALA B  2  115 ? 309.336 229.870 257.409 1.00 60.67  ? 114 ALA O N      1 
ATOM   5596   C  CA     . ALA B  2  115 ? 310.514 230.153 256.604 1.00 62.60  ? 114 ALA O CA     1 
ATOM   5597   C  C      . ALA B  2  115 ? 310.472 231.575 256.057 1.00 80.40  ? 114 ALA O C      1 
ATOM   5598   O  O      . ALA B  2  115 ? 311.456 232.315 256.134 1.00 110.04 ? 114 ALA O O      1 
ATOM   5599   C  CB     . ALA B  2  115 ? 310.620 229.145 255.460 1.00 76.31  ? 114 ALA O CB     1 
ATOM   5600   H  H      . ALA B  2  115 ? 308.913 229.156 257.183 1.00 54.16  ? 114 ALA O H      1 
ATOM   5601   H  HA     . ALA B  2  115 ? 311.306 230.066 257.157 1.00 55.72  ? 114 ALA O HA     1 
ATOM   5602   H  HB1    . ALA B  2  115 ? 311.410 229.347 254.934 1.00 69.26  ? 114 ALA O HB1    1 
ATOM   5603   H  HB2    . ALA B  2  115 ? 310.690 228.252 255.832 1.00 69.26  ? 114 ALA O HB2    1 
ATOM   5604   H  HB3    . ALA B  2  115 ? 309.827 229.211 254.906 1.00 69.26  ? 114 ALA O HB3    1 
ATOM   5605   N  N      . SER B  2  116 ? 309.322 231.980 255.517 1.00 52.57  ? 115 SER O N      1 
ATOM   5606   C  CA     . SER B  2  116 ? 309.226 233.293 254.889 1.00 54.08  ? 115 SER O CA     1 
ATOM   5607   C  C      . SER B  2  116 ? 309.498 234.412 255.887 1.00 61.25  ? 115 SER O C      1 
ATOM   5608   O  O      . SER B  2  116 ? 310.136 235.415 255.547 1.00 80.21  ? 115 SER O O      1 
ATOM   5609   C  CB     . SER B  2  116 ? 307.851 233.471 254.255 1.00 72.21  ? 115 SER O CB     1 
ATOM   5610   O  OG     . SER B  2  116 ? 307.691 232.593 253.153 1.00 93.53  ? 115 SER O OG     1 
ATOM   5611   H  H      . SER B  2  116 ? 308.595 231.520 255.502 1.00 51.17  ? 115 SER O H      1 
ATOM   5612   H  HA     . SER B  2  116 ? 309.890 233.353 254.185 1.00 53.30  ? 115 SER O HA     1 
ATOM   5613   H  HB2    . SER B  2  116 ? 307.169 233.275 254.917 1.00 72.34  ? 115 SER O HB2    1 
ATOM   5614   H  HB3    . SER B  2  116 ? 307.761 234.386 253.946 1.00 72.34  ? 115 SER O HB3    1 
ATOM   5615   H  HG     . SER B  2  116 ? 307.768 231.796 253.407 1.00 93.68  ? 115 SER O HG     1 
ATOM   5616   N  N      . VAL B  2  117 ? 309.018 234.268 257.122 1.00 54.40  ? 116 VAL O N      1 
ATOM   5617   C  CA     . VAL B  2  117 ? 309.297 235.286 258.127 1.00 48.68  ? 116 VAL O CA     1 
ATOM   5618   C  C      . VAL B  2  117 ? 310.795 235.389 258.356 1.00 58.34  ? 116 VAL O C      1 
ATOM   5619   O  O      . VAL B  2  117 ? 311.369 236.484 258.358 1.00 82.86  ? 116 VAL O O      1 
ATOM   5620   C  CB     . VAL B  2  117 ? 308.546 234.983 259.433 1.00 54.35  ? 116 VAL O CB     1 
ATOM   5621   C  CG1    . VAL B  2  117 ? 309.063 235.875 260.557 1.00 60.67  ? 116 VAL O CG1    1 
ATOM   5622   C  CG2    . VAL B  2  117 ? 307.060 235.197 259.223 1.00 51.52  ? 116 VAL O CG2    1 
ATOM   5623   H  H      . VAL B  2  117 ? 308.540 233.607 257.396 1.00 52.66  ? 116 VAL O H      1 
ATOM   5624   H  HA     . VAL B  2  117 ? 308.987 236.144 257.799 1.00 46.91  ? 116 VAL O HA     1 
ATOM   5625   H  HB     . VAL B  2  117 ? 308.692 234.057 259.683 1.00 52.59  ? 116 VAL O HB     1 
ATOM   5626   H  HG11   . VAL B  2  117 ? 308.577 235.669 261.371 1.00 58.67  ? 116 VAL O HG11   1 
ATOM   5627   H  HG12   . VAL B  2  117 ? 310.010 235.705 260.684 1.00 58.67  ? 116 VAL O HG12   1 
ATOM   5628   H  HG13   . VAL B  2  117 ? 308.922 236.803 260.313 1.00 58.67  ? 116 VAL O HG13   1 
ATOM   5629   H  HG21   . VAL B  2  117 ? 306.593 235.004 260.052 1.00 50.64  ? 116 VAL O HG21   1 
ATOM   5630   H  HG22   . VAL B  2  117 ? 306.908 236.120 258.965 1.00 50.64  ? 116 VAL O HG22   1 
ATOM   5631   H  HG23   . VAL B  2  117 ? 306.751 234.602 258.522 1.00 50.64  ? 116 VAL O HG23   1 
ATOM   5632   N  N      . MET B  2  118 ? 311.451 234.250 258.564 1.00 51.84  ? 117 MET O N      1 
ATOM   5633   C  CA     . MET B  2  118 ? 312.903 234.263 258.682 1.00 54.09  ? 117 MET O CA     1 
ATOM   5634   C  C      . MET B  2  118 ? 313.538 234.851 257.427 1.00 65.48  ? 117 MET O C      1 
ATOM   5635   O  O      . MET B  2  118 ? 314.477 235.650 257.515 1.00 74.92  ? 117 MET O O      1 
ATOM   5636   C  CB     . MET B  2  118 ? 313.421 232.852 258.956 1.00 56.28  ? 117 MET O CB     1 
ATOM   5637   C  CG     . MET B  2  118 ? 313.000 232.325 260.316 1.00 79.46  ? 117 MET O CG     1 
ATOM   5638   S  SD     . MET B  2  118 ? 313.439 230.603 260.584 1.00 95.76  ? 117 MET O SD     1 
ATOM   5639   C  CE     . MET B  2  118 ? 315.219 230.700 260.435 1.00 115.44 ? 117 MET O CE     1 
ATOM   5640   H  H      . MET B  2  118 ? 311.088 233.474 258.639 1.00 52.65  ? 117 MET O H      1 
ATOM   5641   H  HA     . MET B  2  118 ? 313.147 234.817 259.440 1.00 54.09  ? 117 MET O HA     1 
ATOM   5642   H  HB2    . MET B  2  118 ? 313.072 232.251 258.280 1.00 55.46  ? 117 MET O HB2    1 
ATOM   5643   H  HB3    . MET B  2  118 ? 314.391 232.860 258.924 1.00 55.46  ? 117 MET O HB3    1 
ATOM   5644   H  HG2    . MET B  2  118 ? 313.433 232.853 261.005 1.00 78.39  ? 117 MET O HG2    1 
ATOM   5645   H  HG3    . MET B  2  118 ? 312.036 232.403 260.398 1.00 78.39  ? 117 MET O HG3    1 
ATOM   5646   H  HE1    . MET B  2  118 ? 315.595 229.815 260.561 1.00 112.53 ? 117 MET O HE1    1 
ATOM   5647   H  HE2    . MET B  2  118 ? 315.444 231.032 259.552 1.00 112.53 ? 117 MET O HE2    1 
ATOM   5648   H  HE3    . MET B  2  118 ? 315.560 231.305 261.113 1.00 112.53 ? 117 MET O HE3    1 
ATOM   5649   N  N      . GLN B  2  119 ? 313.026 234.489 256.247 1.00 67.18  ? 118 GLN O N      1 
ATOM   5650   C  CA     . GLN B  2  119 ? 313.543 235.074 255.015 1.00 65.78  ? 118 GLN O CA     1 
ATOM   5651   C  C      . GLN B  2  119 ? 313.385 236.586 255.026 1.00 65.87  ? 118 GLN O C      1 
ATOM   5652   O  O      . GLN B  2  119 ? 314.295 237.320 254.621 1.00 77.68  ? 118 GLN O O      1 
ATOM   5653   C  CB     . GLN B  2  119 ? 312.825 234.482 253.800 1.00 63.96  ? 118 GLN O CB     1 
ATOM   5654   C  CG     . GLN B  2  119 ? 313.366 234.962 252.450 1.00 79.72  ? 118 GLN O CG     1 
ATOM   5655   C  CD     . GLN B  2  119 ? 312.907 236.361 252.083 1.00 89.24  ? 118 GLN O CD     1 
ATOM   5656   O  OE1    . GLN B  2  119 ? 311.810 236.783 252.449 1.00 90.59  ? 118 GLN O OE1    1 
ATOM   5657   N  NE2    . GLN B  2  119 ? 313.755 237.092 251.364 1.00 98.93  ? 118 GLN O NE2    1 
ATOM   5658   H  H      . GLN B  2  119 ? 312.392 233.919 256.138 1.00 66.23  ? 118 GLN O H      1 
ATOM   5659   H  HA     . GLN B  2  119 ? 314.488 234.870 254.937 1.00 64.98  ? 118 GLN O HA     1 
ATOM   5660   H  HB2    . GLN B  2  119 ? 312.915 233.516 253.826 1.00 63.60  ? 118 GLN O HB2    1 
ATOM   5661   H  HB3    . GLN B  2  119 ? 311.887 234.724 253.844 1.00 63.60  ? 118 GLN O HB3    1 
ATOM   5662   H  HG2    . GLN B  2  119 ? 314.336 234.966 252.484 1.00 79.47  ? 118 GLN O HG2    1 
ATOM   5663   H  HG3    . GLN B  2  119 ? 313.062 234.357 251.756 1.00 79.47  ? 118 GLN O HG3    1 
ATOM   5664   H  HE21   . GLN B  2  119 ? 314.516 236.766 251.133 1.00 99.35  ? 118 GLN O HE21   1 
ATOM   5665   H  HE22   . GLN B  2  119 ? 313.541 237.892 251.130 1.00 99.35  ? 118 GLN O HE22   1 
ATOM   5666   N  N      . GLU B  2  120 ? 312.233 237.070 255.490 1.00 80.59  ? 119 GLU O N      1 
ATOM   5667   C  CA     . GLU B  2  120 ? 311.936 238.493 255.414 1.00 80.34  ? 119 GLU O CA     1 
ATOM   5668   C  C      . GLU B  2  120 ? 312.943 239.329 256.194 1.00 81.91  ? 119 GLU O C      1 
ATOM   5669   O  O      . GLU B  2  120 ? 313.197 240.483 255.834 1.00 83.25  ? 119 GLU O O      1 
ATOM   5670   C  CB     . GLU B  2  120 ? 310.520 238.735 255.924 1.00 94.37  ? 119 GLU O CB     1 
ATOM   5671   C  CG     . GLU B  2  120 ? 310.162 240.188 256.184 1.00 125.96 ? 119 GLU O CG     1 
ATOM   5672   C  CD     . GLU B  2  120 ? 308.955 240.324 257.085 1.00 159.82 ? 119 GLU O CD     1 
ATOM   5673   O  OE1    . GLU B  2  120 ? 308.069 239.439 257.040 1.00 180.79 ? 119 GLU O OE1    1 
ATOM   5674   O  OE2    . GLU B  2  120 ? 308.917 241.308 257.860 1.00 170.40 ? 119 GLU O OE2    1 
ATOM   5675   H  H      . GLU B  2  120 ? 311.613 236.596 255.851 1.00 67.63  ? 119 GLU O H      1 
ATOM   5676   H  HA     . GLU B  2  120 ? 311.972 238.773 254.486 1.00 68.00  ? 119 GLU O HA     1 
ATOM   5677   H  HB2    . GLU B  2  120 ? 309.894 238.395 255.266 1.00 82.76  ? 119 GLU O HB2    1 
ATOM   5678   H  HB3    . GLU B  2  120 ? 310.407 238.253 256.758 1.00 82.76  ? 119 GLU O HB3    1 
ATOM   5679   H  HG2    . GLU B  2  120 ? 310.911 240.628 256.615 1.00 114.93 ? 119 GLU O HG2    1 
ATOM   5680   H  HG3    . GLU B  2  120 ? 309.960 240.622 255.340 1.00 114.93 ? 119 GLU O HG3    1 
ATOM   5681   N  N      . TYR B  2  121 ? 313.514 238.786 257.263 1.00 43.58  ? 120 TYR O N      1 
ATOM   5682   C  CA     . TYR B  2  121 ? 314.508 239.512 258.041 1.00 45.78  ? 120 TYR O CA     1 
ATOM   5683   C  C      . TYR B  2  121 ? 315.908 239.451 257.441 1.00 55.38  ? 120 TYR O C      1 
ATOM   5684   O  O      . TYR B  2  121 ? 316.870 239.818 258.125 1.00 74.95  ? 120 TYR O O      1 
ATOM   5685   C  CB     . TYR B  2  121 ? 314.547 238.985 259.471 1.00 46.17  ? 120 TYR O CB     1 
ATOM   5686   C  CG     . TYR B  2  121 ? 313.428 239.499 260.328 1.00 45.09  ? 120 TYR O CG     1 
ATOM   5687   C  CD1    . TYR B  2  121 ? 312.114 239.185 260.041 1.00 42.83  ? 120 TYR O CD1    1 
ATOM   5688   C  CD2    . TYR B  2  121 ? 313.686 240.292 261.432 1.00 46.71  ? 120 TYR O CD2    1 
ATOM   5689   C  CE1    . TYR B  2  121 ? 311.084 239.648 260.829 1.00 56.11  ? 120 TYR O CE1    1 
ATOM   5690   C  CE2    . TYR B  2  121 ? 312.664 240.763 262.227 1.00 53.94  ? 120 TYR O CE2    1 
ATOM   5691   C  CZ     . TYR B  2  121 ? 311.364 240.438 261.922 1.00 71.50  ? 120 TYR O CZ     1 
ATOM   5692   O  OH     . TYR B  2  121 ? 310.342 240.909 262.714 1.00 108.26 ? 120 TYR O OH     1 
ATOM   5693   H  H      . TYR B  2  121 ? 313.343 237.996 257.559 1.00 41.21  ? 120 TYR O H      1 
ATOM   5694   H  HA     . TYR B  2  121 ? 314.247 240.446 258.080 1.00 42.94  ? 120 TYR O HA     1 
ATOM   5695   H  HB2    . TYR B  2  121 ? 314.486 238.017 259.450 1.00 42.84  ? 120 TYR O HB2    1 
ATOM   5696   H  HB3    . TYR B  2  121 ? 315.384 239.253 259.882 1.00 42.84  ? 120 TYR O HB3    1 
ATOM   5697   H  HD1    . TYR B  2  121 ? 311.922 238.651 259.305 1.00 40.75  ? 120 TYR O HD1    1 
ATOM   5698   H  HD2    . TYR B  2  121 ? 314.565 240.512 261.641 1.00 43.83  ? 120 TYR O HD2    1 
ATOM   5699   H  HE1    . TYR B  2  121 ? 310.204 239.430 260.623 1.00 54.54  ? 120 TYR O HE1    1 
ATOM   5700   H  HE2    . TYR B  2  121 ? 312.852 241.296 262.965 1.00 51.57  ? 120 TYR O HE2    1 
ATOM   5701   H  HH     . TYR B  2  121 ? 310.654 241.374 263.340 1.00 107.03 ? 120 TYR O HH     1 
ATOM   5702   N  N      . THR B  2  122 ? 316.060 239.001 256.199 1.00 75.09  ? 121 THR O N      1 
ATOM   5703   C  CA     . THR B  2  122 ? 317.313 239.147 255.468 1.00 85.12  ? 121 THR O CA     1 
ATOM   5704   C  C      . THR B  2  122 ? 317.109 240.028 254.248 1.00 89.47  ? 121 THR O C      1 
ATOM   5705   O  O      . THR B  2  122 ? 317.775 239.863 253.227 1.00 94.56  ? 121 THR O O      1 
ATOM   5706   C  CB     . THR B  2  122 ? 317.881 237.799 255.040 1.00 103.82 ? 121 THR O CB     1 
ATOM   5707   O  OG1    . THR B  2  122 ? 317.085 237.254 253.976 1.00 94.77  ? 121 THR O OG1    1 
ATOM   5708   C  CG2    . THR B  2  122 ? 317.909 236.841 256.210 1.00 127.88 ? 121 THR O CG2    1 
ATOM   5709   H  H      . THR B  2  122 ? 315.443 238.602 255.752 1.00 67.29  ? 121 THR O H      1 
ATOM   5710   H  HA     . THR B  2  122 ? 317.965 239.577 256.043 1.00 76.80  ? 121 THR O HA     1 
ATOM   5711   H  HB     . THR B  2  122 ? 318.791 237.921 254.728 1.00 94.82  ? 121 THR O HB     1 
ATOM   5712   H  HG1    . THR B  2  122 ? 316.293 237.149 254.235 1.00 86.25  ? 121 THR O HG1    1 
ATOM   5713   H  HG21   . THR B  2  122 ? 318.271 235.986 255.930 1.00 118.33 ? 121 THR O HG21   1 
ATOM   5714   H  HG22   . THR B  2  122 ? 318.463 237.201 256.920 1.00 118.33 ? 121 THR O HG22   1 
ATOM   5715   H  HG23   . THR B  2  122 ? 317.010 236.706 256.550 1.00 118.33 ? 121 THR O HG23   1 
ATOM   5716   N  N      . GLN B  2  123 ? 316.163 240.951 254.341 1.00 63.49  ? 122 GLN O N      1 
ATOM   5717   C  CA     . GLN B  2  123 ? 315.837 241.802 253.212 1.00 56.74  ? 122 GLN O CA     1 
ATOM   5718   C  C      . GLN B  2  123 ? 315.009 243.004 253.643 1.00 65.37  ? 122 GLN O C      1 
ATOM   5719   O  O      . GLN B  2  123 ? 314.526 243.767 252.802 1.00 86.95  ? 122 GLN O O      1 
ATOM   5720   C  CB     . GLN B  2  123 ? 315.096 240.984 252.163 1.00 56.10  ? 122 GLN O CB     1 
ATOM   5721   C  CG     . GLN B  2  123 ? 315.167 241.585 250.796 1.00 73.18  ? 122 GLN O CG     1 
ATOM   5722   C  CD     . GLN B  2  123 ? 314.287 240.861 249.811 1.00 81.49  ? 122 GLN O CD     1 
ATOM   5723   O  OE1    . GLN B  2  123 ? 313.092 240.672 250.044 1.00 77.79  ? 122 GLN O OE1    1 
ATOM   5724   N  NE2    . GLN B  2  123 ? 314.875 240.443 248.702 1.00 92.84  ? 122 GLN O NE2    1 
ATOM   5725   H  H      . GLN B  2  123 ? 315.697 241.105 255.047 1.00 70.43  ? 122 GLN O H      1 
ATOM   5726   H  HA     . GLN B  2  123 ? 316.658 242.130 252.814 1.00 64.32  ? 122 GLN O HA     1 
ATOM   5727   H  HB2    . GLN B  2  123 ? 315.488 240.097 252.120 1.00 64.03  ? 122 GLN O HB2    1 
ATOM   5728   H  HB3    . GLN B  2  123 ? 314.162 240.921 252.414 1.00 64.03  ? 122 GLN O HB3    1 
ATOM   5729   H  HG2    . GLN B  2  123 ? 314.875 242.509 250.840 1.00 81.48  ? 122 GLN O HG2    1 
ATOM   5730   H  HG3    . GLN B  2  123 ? 316.081 241.539 250.475 1.00 81.48  ? 122 GLN O HG3    1 
ATOM   5731   H  HE21   . GLN B  2  123 ? 315.713 240.590 248.578 1.00 101.30 ? 122 GLN O HE21   1 
ATOM   5732   H  HE22   . GLN B  2  123 ? 314.419 240.024 248.105 1.00 101.30 ? 122 GLN O HE22   1 
ATOM   5733   N  N      . SER B  2  124 ? 314.830 243.178 254.946 1.00 82.24  ? 123 SER O N      1 
ATOM   5734   C  CA     . SER B  2  124 ? 314.183 244.347 255.500 1.00 93.11  ? 123 SER O CA     1 
ATOM   5735   C  C      . SER B  2  124 ? 315.249 245.287 256.044 1.00 84.83  ? 123 SER O C      1 
ATOM   5736   O  O      . SER B  2  124 ? 316.448 244.998 256.011 1.00 86.24  ? 123 SER O O      1 
ATOM   5737   C  CB     . SER B  2  124 ? 313.182 243.943 256.586 1.00 120.79 ? 123 SER O CB     1 
ATOM   5738   O  OG     . SER B  2  124 ? 312.030 243.336 256.023 1.00 139.54 ? 123 SER O OG     1 
ATOM   5739   H  H      . SER B  2  124 ? 315.085 242.613 255.542 1.00 76.15  ? 123 SER O H      1 
ATOM   5740   H  HA     . SER B  2  124 ? 313.699 244.809 254.798 1.00 87.61  ? 123 SER O HA     1 
ATOM   5741   H  HB2    . SER B  2  124 ? 313.608 243.312 257.187 1.00 115.50 ? 123 SER O HB2    1 
ATOM   5742   H  HB3    . SER B  2  124 ? 312.912 244.736 257.076 1.00 115.50 ? 123 SER O HB3    1 
ATOM   5743   H  HG     . SER B  2  124 ? 312.248 242.647 255.595 1.00 134.79 ? 123 SER O HG     1 
ATOM   5744   N  N      . GLY B  2  125 ? 314.802 246.428 256.562 1.00 78.90  ? 124 GLY O N      1 
ATOM   5745   C  CA     . GLY B  2  125 ? 315.730 247.440 257.029 1.00 84.19  ? 124 GLY O CA     1 
ATOM   5746   C  C      . GLY B  2  125 ? 316.238 247.170 258.440 1.00 73.84  ? 124 GLY O C      1 
ATOM   5747   O  O      . GLY B  2  125 ? 315.511 246.692 259.310 1.00 65.42  ? 124 GLY O O      1 
ATOM   5748   H  H      . GLY B  2  125 ? 313.972 246.636 256.652 1.00 87.30  ? 124 GLY O H      1 
ATOM   5749   H  HA2    . GLY B  2  125 ? 316.494 247.477 256.431 1.00 92.29  ? 124 GLY O HA2    1 
ATOM   5750   H  HA3    . GLY B  2  125 ? 315.293 248.306 257.021 1.00 92.29  ? 124 GLY O HA3    1 
ATOM   5751   N  N      . GLY B  2  126 ? 317.518 247.470 258.648 1.00 58.19  ? 125 GLY O N      1 
ATOM   5752   C  CA     . GLY B  2  126 ? 318.082 247.617 259.970 1.00 59.54  ? 125 GLY O CA     1 
ATOM   5753   C  C      . GLY B  2  126 ? 318.086 246.381 260.835 1.00 69.33  ? 125 GLY O C      1 
ATOM   5754   O  O      . GLY B  2  126 ? 318.511 246.462 261.993 1.00 84.58  ? 125 GLY O O      1 
ATOM   5755   H  H      . GLY B  2  126 ? 318.088 247.594 258.016 1.00 60.34  ? 125 GLY O H      1 
ATOM   5756   H  HA2    . GLY B  2  126 ? 318.999 247.919 259.884 1.00 61.16  ? 125 GLY O HA2    1 
ATOM   5757   H  HA3    . GLY B  2  126 ? 317.587 248.305 260.443 1.00 61.16  ? 125 GLY O HA3    1 
ATOM   5758   N  N      . VAL B  2  127 ? 317.642 245.242 260.327 1.00 57.60  ? 126 VAL O N      1 
ATOM   5759   C  CA     . VAL B  2  127 ? 317.542 244.036 261.132 1.00 56.65  ? 126 VAL O CA     1 
ATOM   5760   C  C      . VAL B  2  127 ? 318.644 243.075 260.723 1.00 67.38  ? 126 VAL O C      1 
ATOM   5761   O  O      . VAL B  2  127 ? 319.226 243.169 259.637 1.00 77.20  ? 126 VAL O O      1 
ATOM   5762   C  CB     . VAL B  2  127 ? 316.156 243.370 261.010 1.00 53.31  ? 126 VAL O CB     1 
ATOM   5763   C  CG1    . VAL B  2  127 ? 315.141 244.142 261.829 1.00 52.84  ? 126 VAL O CG1    1 
ATOM   5764   C  CG2    . VAL B  2  127 ? 315.720 243.283 259.551 1.00 51.63  ? 126 VAL O CG2    1 
ATOM   5765   H  H      . VAL B  2  127 ? 317.390 245.140 259.511 1.00 57.61  ? 126 VAL O H      1 
ATOM   5766   H  HA     . VAL B  2  127 ? 317.679 244.269 262.064 1.00 56.18  ? 126 VAL O HA     1 
ATOM   5767   H  HB     . VAL B  2  127 ? 316.206 242.468 261.364 1.00 53.42  ? 126 VAL O HB     1 
ATOM   5768   H  HG11   . VAL B  2  127 ? 314.275 243.712 261.743 1.00 53.55  ? 126 VAL O HG11   1 
ATOM   5769   H  HG12   . VAL B  2  127 ? 315.420 244.142 262.758 1.00 53.55  ? 126 VAL O HG12   1 
ATOM   5770   H  HG13   . VAL B  2  127 ? 315.093 245.052 261.497 1.00 53.55  ? 126 VAL O HG13   1 
ATOM   5771   H  HG21   . VAL B  2  127 ? 314.848 242.861 259.507 1.00 52.26  ? 126 VAL O HG21   1 
ATOM   5772   H  HG22   . VAL B  2  127 ? 315.673 244.179 259.182 1.00 52.26  ? 126 VAL O HG22   1 
ATOM   5773   H  HG23   . VAL B  2  127 ? 316.368 242.755 259.059 1.00 52.26  ? 126 VAL O HG23   1 
ATOM   5774   N  N      . ARG B  2  128 ? 318.942 242.152 261.628 1.00 50.73  ? 127 ARG O N      1 
ATOM   5775   C  CA     . ARG B  2  128 ? 319.813 241.020 261.363 1.00 51.63  ? 127 ARG O CA     1 
ATOM   5776   C  C      . ARG B  2  128 ? 318.989 239.750 261.231 1.00 49.00  ? 127 ARG O C      1 
ATOM   5777   O  O      . ARG B  2  128 ? 317.825 239.703 261.639 1.00 103.55 ? 127 ARG O O      1 
ATOM   5778   C  CB     . ARG B  2  128 ? 320.831 240.829 262.489 1.00 54.65  ? 127 ARG O CB     1 
ATOM   5779   C  CG     . ARG B  2  128 ? 320.169 240.880 263.834 1.00 54.27  ? 127 ARG O CG     1 
ATOM   5780   C  CD     . ARG B  2  128 ? 320.992 240.294 264.942 1.00 69.42  ? 127 ARG O CD     1 
ATOM   5781   N  NE     . ARG B  2  128 ? 320.213 240.349 266.175 1.00 66.40  ? 127 ARG O NE     1 
ATOM   5782   C  CZ     . ARG B  2  128 ? 319.444 239.364 266.629 1.00 66.22  ? 127 ARG O CZ     1 
ATOM   5783   N  NH1    . ARG B  2  128 ? 319.361 238.214 265.975 1.00 61.04  ? 127 ARG O NH1    1 
ATOM   5784   N  NH2    . ARG B  2  128 ? 318.759 239.525 267.752 1.00 55.22  ? 127 ARG O NH2    1 
ATOM   5785   H  H      . ARG B  2  128 ? 318.638 242.162 262.433 1.00 53.34  ? 127 ARG O H      1 
ATOM   5786   H  HA     . ARG B  2  128 ? 320.293 241.166 260.533 1.00 53.45  ? 127 ARG O HA     1 
ATOM   5787   H  HB2    . ARG B  2  128 ? 321.258 239.963 262.392 1.00 55.58  ? 127 ARG O HB2    1 
ATOM   5788   H  HB3    . ARG B  2  128 ? 321.492 241.537 262.448 1.00 55.58  ? 127 ARG O HB3    1 
ATOM   5789   H  HG2    . ARG B  2  128 ? 319.988 241.806 264.058 1.00 55.30  ? 127 ARG O HG2    1 
ATOM   5790   H  HG3    . ARG B  2  128 ? 319.336 240.385 263.791 1.00 55.30  ? 127 ARG O HG3    1 
ATOM   5791   H  HD2    . ARG B  2  128 ? 321.200 239.367 264.744 1.00 69.53  ? 127 ARG O HD2    1 
ATOM   5792   H  HD3    . ARG B  2  128 ? 321.803 240.812 265.060 1.00 69.53  ? 127 ARG O HD3    1 
ATOM   5793   H  HE     . ARG B  2  128 ? 320.255 241.071 266.641 1.00 66.68  ? 127 ARG O HE     1 
ATOM   5794   H  HH11   . ARG B  2  128 ? 319.798 238.102 265.243 1.00 61.14  ? 127 ARG O HH11   1 
ATOM   5795   H  HH12   . ARG B  2  128 ? 318.864 237.581 266.280 1.00 61.14  ? 127 ARG O HH12   1 
ATOM   5796   H  HH21   . ARG B  2  128 ? 318.812 240.266 268.187 1.00 55.66  ? 127 ARG O HH21   1 
ATOM   5797   H  HH22   . ARG B  2  128 ? 318.270 238.885 268.053 1.00 55.66  ? 127 ARG O HH22   1 
ATOM   5798   N  N      . PRO B  2  129 ? 319.559 238.695 260.666 1.00 39.91  ? 128 PRO O N      1 
ATOM   5799   C  CA     . PRO B  2  129 ? 318.837 237.419 260.587 1.00 38.37  ? 128 PRO O CA     1 
ATOM   5800   C  C      . PRO B  2  129 ? 318.694 236.767 261.956 1.00 48.00  ? 128 PRO O C      1 
ATOM   5801   O  O      . PRO B  2  129 ? 319.445 237.048 262.894 1.00 67.08  ? 128 PRO O O      1 
ATOM   5802   C  CB     . PRO B  2  129 ? 319.708 236.574 259.652 1.00 39.12  ? 128 PRO O CB     1 
ATOM   5803   C  CG     . PRO B  2  129 ? 320.581 237.576 258.920 1.00 41.05  ? 128 PRO O CG     1 
ATOM   5804   C  CD     . PRO B  2  129 ? 320.797 238.691 259.874 1.00 42.33  ? 128 PRO O CD     1 
ATOM   5805   H  HA     . PRO B  2  129 ? 317.961 237.545 260.191 1.00 47.95  ? 128 PRO O HA     1 
ATOM   5806   H  HB2    . PRO B  2  129 ? 320.251 235.962 260.174 1.00 48.62  ? 128 PRO O HB2    1 
ATOM   5807   H  HB3    . PRO B  2  129 ? 319.145 236.089 259.029 1.00 48.62  ? 128 PRO O HB3    1 
ATOM   5808   H  HG2    . PRO B  2  129 ? 321.425 237.160 258.683 1.00 50.54  ? 128 PRO O HG2    1 
ATOM   5809   H  HG3    . PRO B  2  129 ? 320.121 237.890 258.126 1.00 50.54  ? 128 PRO O HG3    1 
ATOM   5810   H  HD2    . PRO B  2  129 ? 321.562 238.508 260.441 1.00 51.87  ? 128 PRO O HD2    1 
ATOM   5811   H  HD3    . PRO B  2  129 ? 320.898 239.530 259.398 1.00 51.87  ? 128 PRO O HD3    1 
ATOM   5812   N  N      . PHE B  2  130 ? 317.700 235.881 262.064 1.00 65.43  ? 129 PHE O N      1 
ATOM   5813   C  CA     . PHE B  2  130 ? 317.489 235.129 263.300 1.00 61.45  ? 129 PHE O CA     1 
ATOM   5814   C  C      . PHE B  2  130 ? 318.602 234.102 263.471 1.00 71.09  ? 129 PHE O C      1 
ATOM   5815   O  O      . PHE B  2  130 ? 318.882 233.325 262.555 1.00 69.50  ? 129 PHE O O      1 
ATOM   5816   C  CB     . PHE B  2  130 ? 316.135 234.418 263.290 1.00 56.79  ? 129 PHE O CB     1 
ATOM   5817   C  CG     . PHE B  2  130 ? 314.942 235.341 263.310 1.00 54.95  ? 129 PHE O CG     1 
ATOM   5818   C  CD1    . PHE B  2  130 ? 314.399 235.774 264.510 1.00 64.19  ? 129 PHE O CD1    1 
ATOM   5819   C  CD2    . PHE B  2  130 ? 314.345 235.749 262.132 1.00 53.58  ? 129 PHE O CD2    1 
ATOM   5820   C  CE1    . PHE B  2  130 ? 313.290 236.611 264.530 1.00 65.31  ? 129 PHE O CE1    1 
ATOM   5821   C  CE2    . PHE B  2  130 ? 313.240 236.588 262.148 1.00 54.48  ? 129 PHE O CE2    1 
ATOM   5822   C  CZ     . PHE B  2  130 ? 312.714 237.016 263.347 1.00 63.90  ? 129 PHE O CZ     1 
ATOM   5823   H  H      . PHE B  2  130 ? 317.139 235.699 261.438 1.00 62.09  ? 129 PHE O H      1 
ATOM   5824   H  HA     . PHE B  2  130 ? 317.513 235.736 264.056 1.00 57.69  ? 129 PHE O HA     1 
ATOM   5825   H  HB2    . PHE B  2  130 ? 316.074 233.877 262.487 1.00 53.55  ? 129 PHE O HB2    1 
ATOM   5826   H  HB3    . PHE B  2  130 ? 316.078 233.848 264.073 1.00 53.55  ? 129 PHE O HB3    1 
ATOM   5827   H  HD1    . PHE B  2  130 ? 314.784 235.504 265.312 1.00 62.08  ? 129 PHE O HD1    1 
ATOM   5828   H  HD2    . PHE B  2  130 ? 314.693 235.464 261.318 1.00 52.05  ? 129 PHE O HD2    1 
ATOM   5829   H  HE1    . PHE B  2  130 ? 312.940 236.900 265.341 1.00 64.07  ? 129 PHE O HE1    1 
ATOM   5830   H  HE2    . PHE B  2  130 ? 312.852 236.859 261.348 1.00 53.82  ? 129 PHE O HE2    1 
ATOM   5831   H  HZ     . PHE B  2  130 ? 311.974 237.578 263.358 1.00 63.39  ? 129 PHE O HZ     1 
ATOM   5832   N  N      . GLY B  2  131 ? 319.226 234.086 264.645 1.00 44.86  ? 130 GLY O N      1 
ATOM   5833   C  CA     . GLY B  2  131 ? 320.344 233.192 264.884 1.00 47.64  ? 130 GLY O CA     1 
ATOM   5834   C  C      . GLY B  2  131 ? 319.899 231.803 265.295 1.00 62.58  ? 130 GLY O C      1 
ATOM   5835   O  O      . GLY B  2  131 ? 320.433 231.228 266.251 1.00 62.48  ? 130 GLY O O      1 
ATOM   5836   H  H      . GLY B  2  131 ? 319.020 234.584 265.315 1.00 51.49  ? 130 GLY O H      1 
ATOM   5837   H  HA2    . GLY B  2  131 ? 320.876 233.117 264.076 1.00 53.25  ? 130 GLY O HA2    1 
ATOM   5838   H  HA3    . GLY B  2  131 ? 320.904 233.556 265.588 1.00 53.25  ? 130 GLY O HA3    1 
ATOM   5839   N  N      . VAL B  2  132 ? 318.940 231.240 264.557 1.00 54.54  ? 131 VAL O N      1 
ATOM   5840   C  CA     . VAL B  2  132 ? 318.255 230.020 264.961 1.00 46.18  ? 131 VAL O CA     1 
ATOM   5841   C  C      . VAL B  2  132 ? 318.109 229.088 263.767 1.00 45.15  ? 131 VAL O C      1 
ATOM   5842   O  O      . VAL B  2  132 ? 318.100 229.514 262.610 1.00 43.76  ? 131 VAL O O      1 
ATOM   5843   C  CB     . VAL B  2  132 ? 316.857 230.327 265.545 1.00 43.94  ? 131 VAL O CB     1 
ATOM   5844   C  CG1    . VAL B  2  132 ? 316.252 229.094 266.203 1.00 67.24  ? 131 VAL O CG1    1 
ATOM   5845   C  CG2    . VAL B  2  132 ? 316.924 231.482 266.522 1.00 44.88  ? 131 VAL O CG2    1 
ATOM   5846   H  H      . VAL B  2  132 ? 318.666 231.555 263.805 1.00 56.28  ? 131 VAL O H      1 
ATOM   5847   H  HA     . VAL B  2  132 ? 318.778 229.567 265.641 1.00 47.76  ? 131 VAL O HA     1 
ATOM   5848   H  HB     . VAL B  2  132 ? 316.269 230.590 264.819 1.00 46.29  ? 131 VAL O HB     1 
ATOM   5849   H  HG11   . VAL B  2  132 ? 315.378 229.322 266.557 1.00 69.31  ? 131 VAL O HG11   1 
ATOM   5850   H  HG12   . VAL B  2  132 ? 316.167 228.392 265.539 1.00 69.31  ? 131 VAL O HG12   1 
ATOM   5851   H  HG13   . VAL B  2  132 ? 316.835 228.802 266.921 1.00 69.31  ? 131 VAL O HG13   1 
ATOM   5852   H  HG21   . VAL B  2  132 ? 316.035 231.652 266.871 1.00 47.38  ? 131 VAL O HG21   1 
ATOM   5853   H  HG22   . VAL B  2  132 ? 317.525 231.248 267.246 1.00 47.38  ? 131 VAL O HG22   1 
ATOM   5854   H  HG23   . VAL B  2  132 ? 317.254 232.268 266.058 1.00 47.38  ? 131 VAL O HG23   1 
ATOM   5855   N  N      . SER B  2  133 ? 317.992 227.797 264.065 1.00 62.92  ? 132 SER O N      1 
ATOM   5856   C  CA     . SER B  2  133 ? 317.441 226.822 263.138 1.00 62.11  ? 132 SER O CA     1 
ATOM   5857   C  C      . SER B  2  133 ? 316.363 226.036 263.865 1.00 65.22  ? 132 SER O C      1 
ATOM   5858   O  O      . SER B  2  133 ? 316.492 225.748 265.057 1.00 75.80  ? 132 SER O O      1 
ATOM   5859   C  CB     . SER B  2  133 ? 318.505 225.867 262.590 1.00 64.40  ? 132 SER O CB     1 
ATOM   5860   O  OG     . SER B  2  133 ? 318.650 226.023 261.187 1.00 64.72  ? 132 SER O OG     1 
ATOM   5861   H  H      . SER B  2  133 ? 318.231 227.457 264.818 1.00 59.51  ? 132 SER O H      1 
ATOM   5862   H  HA     . SER B  2  133 ? 317.032 227.285 262.390 1.00 58.87  ? 132 SER O HA     1 
ATOM   5863   H  HB2    . SER B  2  133 ? 319.354 226.060 263.019 1.00 60.29  ? 132 SER O HB2    1 
ATOM   5864   H  HB3    . SER B  2  133 ? 318.238 224.954 262.781 1.00 60.29  ? 132 SER O HB3    1 
ATOM   5865   H  HG     . SER B  2  133 ? 317.921 225.859 260.803 1.00 60.91  ? 132 SER O HG     1 
ATOM   5866   N  N      . LEU B  2  134 ? 315.296 225.707 263.153 1.00 51.20  ? 133 LEU O N      1 
ATOM   5867   C  CA     . LEU B  2  134 ? 314.161 225.020 263.742 1.00 50.47  ? 133 LEU O CA     1 
ATOM   5868   C  C      . LEU B  2  134 ? 314.088 223.584 263.237 1.00 66.20  ? 133 LEU O C      1 
ATOM   5869   O  O      . LEU B  2  134 ? 314.467 223.288 262.104 1.00 83.36  ? 133 LEU O O      1 
ATOM   5870   C  CB     . LEU B  2  134 ? 312.860 225.768 263.420 1.00 47.61  ? 133 LEU O CB     1 
ATOM   5871   C  CG     . LEU B  2  134 ? 312.823 227.216 263.923 1.00 46.50  ? 133 LEU O CG     1 
ATOM   5872   C  CD1    . LEU B  2  134 ? 311.622 227.973 263.369 1.00 55.02  ? 133 LEU O CD1    1 
ATOM   5873   C  CD2    . LEU B  2  134 ? 312.811 227.259 265.444 1.00 48.05  ? 133 LEU O CD2    1 
ATOM   5874   H  H      . LEU B  2  134 ? 315.204 225.875 262.314 1.00 47.52  ? 133 LEU O H      1 
ATOM   5875   H  HA     . LEU B  2  134 ? 314.267 224.998 264.705 1.00 47.03  ? 133 LEU O HA     1 
ATOM   5876   H  HB2    . LEU B  2  134 ? 312.743 225.787 262.458 1.00 45.27  ? 133 LEU O HB2    1 
ATOM   5877   H  HB3    . LEU B  2  134 ? 312.120 225.294 263.831 1.00 45.27  ? 133 LEU O HB3    1 
ATOM   5878   H  HG     . LEU B  2  134 ? 313.624 227.672 263.621 1.00 44.60  ? 133 LEU O HG     1 
ATOM   5879   H  HD11   . LEU B  2  134 ? 311.636 228.881 263.711 1.00 54.20  ? 133 LEU O HD11   1 
ATOM   5880   H  HD12   . LEU B  2  134 ? 311.674 227.983 262.401 1.00 54.20  ? 133 LEU O HD12   1 
ATOM   5881   H  HD13   . LEU B  2  134 ? 310.809 227.526 263.653 1.00 54.20  ? 133 LEU O HD13   1 
ATOM   5882   H  HD21   . LEU B  2  134 ? 312.787 228.184 265.734 1.00 45.79  ? 133 LEU O HD21   1 
ATOM   5883   H  HD22   . LEU B  2  134 ? 312.025 226.790 265.766 1.00 45.79  ? 133 LEU O HD22   1 
ATOM   5884   H  HD23   . LEU B  2  134 ? 313.613 226.828 265.778 1.00 45.79  ? 133 LEU O HD23   1 
ATOM   5885   N  N      . LEU B  2  135 ? 313.631 222.686 264.109 1.00 60.98  ? 134 LEU O N      1 
ATOM   5886   C  CA     . LEU B  2  135 ? 313.160 221.362 263.711 1.00 53.39  ? 134 LEU O CA     1 
ATOM   5887   C  C      . LEU B  2  135 ? 311.662 221.303 263.963 1.00 52.82  ? 134 LEU O C      1 
ATOM   5888   O  O      . LEU B  2  135 ? 311.214 221.416 265.107 1.00 53.30  ? 134 LEU O O      1 
ATOM   5889   C  CB     . LEU B  2  135 ? 313.858 220.244 264.475 1.00 56.21  ? 134 LEU O CB     1 
ATOM   5890   C  CG     . LEU B  2  135 ? 315.162 219.795 263.847 1.00 80.75  ? 134 LEU O CG     1 
ATOM   5891   C  CD1    . LEU B  2  135 ? 316.193 220.786 264.222 1.00 84.91  ? 134 LEU O CD1    1 
ATOM   5892   C  CD2    . LEU B  2  135 ? 315.563 218.410 264.303 1.00 99.68  ? 134 LEU O CD2    1 
ATOM   5893   H  H      . LEU B  2  135 ? 313.584 222.825 264.957 1.00 59.13  ? 134 LEU O H      1 
ATOM   5894   H  HA     . LEU B  2  135 ? 313.319 221.233 262.763 1.00 51.38  ? 134 LEU O HA     1 
ATOM   5895   H  HB2    . LEU B  2  135 ? 314.053 220.553 265.374 1.00 53.15  ? 134 LEU O HB2    1 
ATOM   5896   H  HB3    . LEU B  2  135 ? 313.268 219.475 264.513 1.00 53.15  ? 134 LEU O HB3    1 
ATOM   5897   H  HG     . LEU B  2  135 ? 315.074 219.790 262.881 1.00 76.91  ? 134 LEU O HG     1 
ATOM   5898   H  HD11   . LEU B  2  135 ? 317.041 220.522 263.832 1.00 80.78  ? 134 LEU O HD11   1 
ATOM   5899   H  HD12   . LEU B  2  135 ? 315.930 221.657 263.886 1.00 80.78  ? 134 LEU O HD12   1 
ATOM   5900   H  HD13   . LEU B  2  135 ? 316.267 220.812 265.189 1.00 80.78  ? 134 LEU O HD13   1 
ATOM   5901   H  HD21   . LEU B  2  135 ? 316.400 218.168 263.876 1.00 94.92  ? 134 LEU O HD21   1 
ATOM   5902   H  HD22   . LEU B  2  135 ? 315.672 218.415 265.267 1.00 94.92  ? 134 LEU O HD22   1 
ATOM   5903   H  HD23   . LEU B  2  135 ? 314.869 217.782 264.051 1.00 94.92  ? 134 LEU O HD23   1 
ATOM   5904   N  N      . ILE B  2  136 ? 310.901 221.117 262.903 1.00 51.37  ? 135 ILE O N      1 
ATOM   5905   C  CA     . ILE B  2  136 ? 309.455 221.261 262.955 1.00 50.78  ? 135 ILE O CA     1 
ATOM   5906   C  C      . ILE B  2  136 ? 308.861 219.904 262.616 1.00 53.45  ? 135 ILE O C      1 
ATOM   5907   O  O      . ILE B  2  136 ? 308.547 219.612 261.458 1.00 57.93  ? 135 ILE O O      1 
ATOM   5908   C  CB     . ILE B  2  136 ? 308.955 222.349 261.999 1.00 50.31  ? 135 ILE O CB     1 
ATOM   5909   C  CG1    . ILE B  2  136 ? 309.842 223.597 262.116 1.00 59.54  ? 135 ILE O CG1    1 
ATOM   5910   C  CG2    . ILE B  2  136 ? 307.491 222.646 262.292 1.00 47.44  ? 135 ILE O CG2    1 
ATOM   5911   C  CD1    . ILE B  2  136 ? 309.390 224.771 261.280 1.00 69.13  ? 135 ILE O CD1    1 
ATOM   5912   H  H      . ILE B  2  136 ? 311.201 220.903 262.126 1.00 53.92  ? 135 ILE O H      1 
ATOM   5913   H  HA     . ILE B  2  136 ? 309.186 221.498 263.856 1.00 54.18  ? 135 ILE O HA     1 
ATOM   5914   H  HB     . ILE B  2  136 ? 309.021 222.012 261.092 1.00 54.65  ? 135 ILE O HB     1 
ATOM   5915   H  HG12   . ILE B  2  136 ? 309.853 223.883 263.043 1.00 63.84  ? 135 ILE O HG12   1 
ATOM   5916   H  HG13   . ILE B  2  136 ? 310.741 223.365 261.835 1.00 63.84  ? 135 ILE O HG13   1 
ATOM   5917   H  HG21   . ILE B  2  136 ? 307.181 223.335 261.684 1.00 52.61  ? 135 ILE O HG21   1 
ATOM   5918   H  HG22   . ILE B  2  136 ? 306.973 221.836 262.167 1.00 52.61  ? 135 ILE O HG22   1 
ATOM   5919   H  HG23   . ILE B  2  136 ? 307.409 222.953 263.209 1.00 52.61  ? 135 ILE O HG23   1 
ATOM   5920   H  HD11   . ILE B  2  136 ? 310.005 225.509 261.415 1.00 74.32  ? 135 ILE O HD11   1 
ATOM   5921   H  HD12   . ILE B  2  136 ? 309.386 224.510 260.346 1.00 74.32  ? 135 ILE O HD12   1 
ATOM   5922   H  HD13   . ILE B  2  136 ? 308.497 225.029 261.556 1.00 74.32  ? 135 ILE O HD13   1 
ATOM   5923   N  N      . CYS B  2  137 ? 308.699 219.058 263.618 1.00 44.64  ? 136 CYS O N      1 
ATOM   5924   C  CA     . CYS B  2  137 ? 308.020 217.796 263.394 1.00 46.22  ? 136 CYS O CA     1 
ATOM   5925   C  C      . CYS B  2  137 ? 306.509 217.999 263.405 1.00 45.76  ? 136 CYS O C      1 
ATOM   5926   O  O      . CYS B  2  137 ? 305.993 219.029 263.850 1.00 61.21  ? 136 CYS O O      1 
ATOM   5927   C  CB     . CYS B  2  137 ? 308.403 216.784 264.456 1.00 49.12  ? 136 CYS O CB     1 
ATOM   5928   S  SG     . CYS B  2  137 ? 307.607 217.133 266.032 1.00 58.88  ? 136 CYS O SG     1 
ATOM   5929   H  H      . CYS B  2  137 ? 308.968 219.187 264.425 1.00 44.25  ? 136 CYS O H      1 
ATOM   5930   H  HA     . CYS B  2  137 ? 308.275 217.442 262.527 1.00 45.75  ? 136 CYS O HA     1 
ATOM   5931   H  HB2    . CYS B  2  137 ? 308.129 215.899 264.167 1.00 47.75  ? 136 CYS O HB2    1 
ATOM   5932   H  HB3    . CYS B  2  137 ? 309.364 216.810 264.590 1.00 47.75  ? 136 CYS O HB3    1 
ATOM   5933   H  HG     . CYS B  2  137 ? 306.416 217.098 265.885 1.00 57.66  ? 136 CYS O HG     1 
ATOM   5934   N  N      . GLY B  2  138 ? 305.794 216.985 262.929 1.00 55.34  ? 137 GLY O N      1 
ATOM   5935   C  CA     . GLY B  2  138 ? 304.345 217.043 262.869 1.00 56.44  ? 137 GLY O CA     1 
ATOM   5936   C  C      . GLY B  2  138 ? 303.767 215.813 262.202 1.00 59.71  ? 137 GLY O C      1 
ATOM   5937   O  O      . GLY B  2  138 ? 304.432 215.200 261.363 1.00 65.50  ? 137 GLY O O      1 
ATOM   5938   H  H      . GLY B  2  138 ? 306.129 216.250 262.634 1.00 50.86  ? 137 GLY O H      1 
ATOM   5939   H  HA2    . GLY B  2  138 ? 303.984 217.108 263.766 1.00 52.78  ? 137 GLY O HA2    1 
ATOM   5940   H  HA3    . GLY B  2  138 ? 304.071 217.826 262.366 1.00 52.78  ? 137 GLY O HA3    1 
ATOM   5941   N  N      . TRP B  2  139 ? 302.531 215.442 262.551 1.00 71.26  ? 138 TRP O N      1 
ATOM   5942   C  CA     . TRP B  2  139 ? 301.915 214.191 262.092 1.00 74.04  ? 138 TRP O CA     1 
ATOM   5943   C  C      . TRP B  2  139 ? 300.578 214.530 261.443 1.00 77.86  ? 138 TRP O C      1 
ATOM   5944   O  O      . TRP B  2  139 ? 299.536 214.508 262.101 1.00 74.73  ? 138 TRP O O      1 
ATOM   5945   C  CB     . TRP B  2  139 ? 301.747 213.205 263.251 1.00 82.32  ? 138 TRP O CB     1 
ATOM   5946   C  CG     . TRP B  2  139 ? 301.625 211.756 262.828 1.00 87.27  ? 138 TRP O CG     1 
ATOM   5947   C  CD1    . TRP B  2  139 ? 302.602 210.802 262.867 1.00 90.12  ? 138 TRP O CD1    1 
ATOM   5948   C  CD2    . TRP B  2  139 ? 300.458 211.106 262.315 1.00 86.13  ? 138 TRP O CD2    1 
ATOM   5949   N  NE1    . TRP B  2  139 ? 302.116 209.603 262.411 1.00 82.13  ? 138 TRP O NE1    1 
ATOM   5950   C  CE2    . TRP B  2  139 ? 300.802 209.763 262.065 1.00 81.80  ? 138 TRP O CE2    1 
ATOM   5951   C  CE3    . TRP B  2  139 ? 299.157 211.530 262.037 1.00 97.77  ? 138 TRP O CE3    1 
ATOM   5952   C  CZ2    . TRP B  2  139 ? 299.896 208.845 261.551 1.00 87.63  ? 138 TRP O CZ2    1 
ATOM   5953   C  CZ3    . TRP B  2  139 ? 298.261 210.619 261.527 1.00 108.98 ? 138 TRP O CZ3    1 
ATOM   5954   C  CH2    . TRP B  2  139 ? 298.632 209.290 261.292 1.00 103.20 ? 138 TRP O CH2    1 
ATOM   5955   H  H      . TRP B  2  139 ? 302.020 215.907 263.062 1.00 70.62  ? 138 TRP O H      1 
ATOM   5956   H  HA     . TRP B  2  139 ? 302.484 213.780 261.423 1.00 73.34  ? 138 TRP O HA     1 
ATOM   5957   H  HB2    . TRP B  2  139 ? 302.518 213.278 263.835 1.00 80.99  ? 138 TRP O HB2    1 
ATOM   5958   H  HB3    . TRP B  2  139 ? 300.943 213.437 263.742 1.00 80.99  ? 138 TRP O HB3    1 
ATOM   5959   H  HD1    . TRP B  2  139 ? 303.471 210.944 263.167 1.00 87.44  ? 138 TRP O HD1    1 
ATOM   5960   H  HE1    . TRP B  2  139 ? 302.564 208.871 262.351 1.00 79.32  ? 138 TRP O HE1    1 
ATOM   5961   H  HE3    . TRP B  2  139 ? 298.902 212.411 262.192 1.00 97.43  ? 138 TRP O HE3    1 
ATOM   5962   H  HZ2    . TRP B  2  139 ? 300.140 207.962 261.391 1.00 85.91  ? 138 TRP O HZ2    1 
ATOM   5963   H  HZ3    . TRP B  2  139 ? 297.390 210.889 261.342 1.00 108.86 ? 138 TRP O HZ3    1 
ATOM   5964   H  HH2    . TRP B  2  139 ? 298.003 208.697 260.948 1.00 102.40 ? 138 TRP O HH2    1 
ATOM   5965   N  N      . ASN B  2  140 ? 300.618 214.829 260.147 1.00 99.08  ? 139 ASN O N      1 
ATOM   5966   C  CA     . ASN B  2  140 ? 299.450 215.226 259.379 1.00 98.59  ? 139 ASN O CA     1 
ATOM   5967   C  C      . ASN B  2  140 ? 299.171 214.208 258.286 1.00 115.22 ? 139 ASN O C      1 
ATOM   5968   O  O      . ASN B  2  140 ? 300.092 213.611 257.726 1.00 133.03 ? 139 ASN O O      1 
ATOM   5969   C  CB     . ASN B  2  140 ? 299.656 216.601 258.731 1.00 112.38 ? 139 ASN O CB     1 
ATOM   5970   C  CG     . ASN B  2  140 ? 299.239 217.737 259.626 1.00 155.56 ? 139 ASN O CG     1 
ATOM   5971   O  OD1    . ASN B  2  140 ? 298.049 218.006 259.792 1.00 167.47 ? 139 ASN O OD1    1 
ATOM   5972   N  ND2    . ASN B  2  140 ? 300.214 218.432 260.192 1.00 188.39 ? 139 ASN O ND2    1 
ATOM   5973   H  H      . ASN B  2  140 ? 301.338 214.807 259.678 1.00 104.99 ? 139 ASN O H      1 
ATOM   5974   H  HA     . ASN B  2  140 ? 298.677 215.272 259.964 1.00 105.45 ? 139 ASN O HA     1 
ATOM   5975   H  HB2    . ASN B  2  140 ? 300.596 216.714 258.523 1.00 119.84 ? 139 ASN O HB2    1 
ATOM   5976   H  HB3    . ASN B  2  140 ? 299.128 216.650 257.919 1.00 119.84 ? 139 ASN O HB3    1 
ATOM   5977   H  HD21   . ASN B  2  140 ? 300.027 219.091 260.712 1.00 195.90 ? 139 ASN O HD21   1 
ATOM   5978   H  HD22   . ASN B  2  140 ? 301.035 218.224 260.040 1.00 195.90 ? 139 ASN O HD22   1 
ATOM   5979   N  N      . GLU B  2  141 ? 297.889 214.015 257.985 1.00 124.69 ? 140 GLU O N      1 
ATOM   5980   C  CA     . GLU B  2  141 ? 297.465 213.343 256.763 1.00 137.97 ? 140 GLU O CA     1 
ATOM   5981   C  C      . GLU B  2  141 ? 297.827 211.866 256.748 1.00 126.62 ? 140 GLU O C      1 
ATOM   5982   O  O      . GLU B  2  141 ? 297.903 211.263 255.673 1.00 126.61 ? 140 GLU O O      1 
ATOM   5983   C  CB     . GLU B  2  141 ? 298.068 214.027 255.530 1.00 166.03 ? 140 GLU O CB     1 
ATOM   5984   C  CG     . GLU B  2  141 ? 297.879 215.540 255.473 1.00 193.38 ? 140 GLU O CG     1 
ATOM   5985   C  CD     . GLU B  2  141 ? 296.467 215.953 255.117 1.00 203.56 ? 140 GLU O CD     1 
ATOM   5986   O  OE1    . GLU B  2  141 ? 295.772 215.174 254.430 1.00 206.95 ? 140 GLU O OE1    1 
ATOM   5987   O  OE2    . GLU B  2  141 ? 296.055 217.060 255.530 1.00 206.66 ? 140 GLU O OE2    1 
ATOM   5988   H  H      . GLU B  2  141 ? 297.236 214.271 258.482 1.00 124.78 ? 140 GLU O H      1 
ATOM   5989   H  HA     . GLU B  2  141 ? 296.499 213.409 256.694 1.00 138.31 ? 140 GLU O HA     1 
ATOM   5990   H  HB2    . GLU B  2  141 ? 299.022 213.851 255.515 1.00 166.63 ? 140 GLU O HB2    1 
ATOM   5991   H  HB3    . GLU B  2  141 ? 297.656 213.651 254.736 1.00 166.63 ? 140 GLU O HB3    1 
ATOM   5992   H  HG2    . GLU B  2  141 ? 298.089 215.916 256.342 1.00 194.68 ? 140 GLU O HG2    1 
ATOM   5993   H  HG3    . GLU B  2  141 ? 298.475 215.907 254.801 1.00 194.68 ? 140 GLU O HG3    1 
ATOM   5994   N  N      . GLY B  2  142 ? 298.066 211.265 257.910 1.00 104.28 ? 141 GLY O N      1 
ATOM   5995   C  CA     . GLY B  2  142 ? 298.413 209.864 257.989 1.00 105.87 ? 141 GLY O CA     1 
ATOM   5996   C  C      . GLY B  2  142 ? 299.898 209.569 258.085 1.00 82.58  ? 141 GLY O C      1 
ATOM   5997   O  O      . GLY B  2  142 ? 300.262 208.415 258.332 1.00 80.06  ? 141 GLY O O      1 
ATOM   5998   H  H      . GLY B  2  142 ? 298.031 211.659 258.674 1.00 108.11 ? 141 GLY O H      1 
ATOM   5999   H  HA2    . GLY B  2  142 ? 297.982 209.478 258.767 1.00 108.93 ? 141 GLY O HA2    1 
ATOM   6000   H  HA3    . GLY B  2  142 ? 298.070 209.411 257.202 1.00 108.93 ? 141 GLY O HA3    1 
ATOM   6001   N  N      . ARG B  2  143 ? 300.764 210.565 257.890 1.00 105.07 ? 142 ARG O N      1 
ATOM   6002   C  CA     . ARG B  2  143 ? 302.205 210.330 257.929 1.00 103.19 ? 142 ARG O CA     1 
ATOM   6003   C  C      . ARG B  2  143 ? 302.865 211.068 259.083 1.00 102.43 ? 142 ARG O C      1 
ATOM   6004   O  O      . ARG B  2  143 ? 302.185 211.676 259.919 1.00 106.37 ? 142 ARG O O      1 
ATOM   6005   C  CB     . ARG B  2  143 ? 302.870 210.784 256.631 1.00 101.55 ? 142 ARG O CB     1 
ATOM   6006   C  CG     . ARG B  2  143 ? 302.160 210.376 255.371 1.00 104.16 ? 142 ARG O CG     1 
ATOM   6007   C  CD     . ARG B  2  143 ? 302.750 211.084 254.164 1.00 116.42 ? 142 ARG O CD     1 
ATOM   6008   N  NE     . ARG B  2  143 ? 304.141 210.699 253.920 1.00 132.37 ? 142 ARG O NE     1 
ATOM   6009   C  CZ     . ARG B  2  143 ? 305.204 211.404 254.297 1.00 140.47 ? 142 ARG O CZ     1 
ATOM   6010   N  NH1    . ARG B  2  143 ? 306.425 210.967 254.024 1.00 163.30 ? 142 ARG O NH1    1 
ATOM   6011   N  NH2    . ARG B  2  143 ? 305.063 212.545 254.947 1.00 118.31 ? 142 ARG O NH2    1 
ATOM   6012   H  H      . ARG B  2  143 ? 300.543 211.381 257.735 1.00 101.87 ? 142 ARG O H      1 
ATOM   6013   H  HA     . ARG B  2  143 ? 302.371 209.381 258.040 1.00 99.11  ? 142 ARG O HA     1 
ATOM   6014   H  HB2    . ARG B  2  143 ? 302.924 211.752 256.635 1.00 97.61  ? 142 ARG O HB2    1 
ATOM   6015   H  HB3    . ARG B  2  143 ? 303.764 210.409 256.596 1.00 97.61  ? 142 ARG O HB3    1 
ATOM   6016   H  HG2    . ARG B  2  143 ? 302.256 209.420 255.242 1.00 100.74 ? 142 ARG O HG2    1 
ATOM   6017   H  HG3    . ARG B  2  143 ? 301.222 210.616 255.438 1.00 100.74 ? 142 ARG O HG3    1 
ATOM   6018   H  HD2    . ARG B  2  143 ? 302.231 210.855 253.377 1.00 113.25 ? 142 ARG O HD2    1 
ATOM   6019   H  HD3    . ARG B  2  143 ? 302.724 212.042 254.314 1.00 113.25 ? 142 ARG O HD3    1 
ATOM   6020   H  HE     . ARG B  2  143 ? 304.282 209.962 253.500 1.00 128.33 ? 142 ARG O HE     1 
ATOM   6021   H  HH11   . ARG B  2  143 ? 306.532 210.225 253.602 1.00 158.07 ? 142 ARG O HH11   1 
ATOM   6022   H  HH12   . ARG B  2  143 ? 307.110 211.424 254.270 1.00 158.07 ? 142 ARG O HH12   1 
ATOM   6023   H  HH21   . ARG B  2  143 ? 304.277 212.841 255.130 1.00 114.29 ? 142 ARG O HH21   1 
ATOM   6024   H  HH22   . ARG B  2  143 ? 305.758 212.992 255.186 1.00 114.29 ? 142 ARG O HH22   1 
ATOM   6025   N  N      . PRO B  2  144 ? 304.178 210.990 259.180 1.00 58.88  ? 143 PRO O N      1 
ATOM   6026   C  CA     . PRO B  2  144 ? 304.933 211.965 259.974 1.00 57.35  ? 143 PRO O CA     1 
ATOM   6027   C  C      . PRO B  2  144 ? 305.665 212.958 259.081 1.00 66.94  ? 143 PRO O C      1 
ATOM   6028   O  O      . PRO B  2  144 ? 305.725 212.763 257.863 1.00 83.75  ? 143 PRO O O      1 
ATOM   6029   C  CB     . PRO B  2  144 ? 305.905 211.082 260.752 1.00 59.44  ? 143 PRO O CB     1 
ATOM   6030   C  CG     . PRO B  2  144 ? 306.198 209.967 259.788 1.00 63.02  ? 143 PRO O CG     1 
ATOM   6031   C  CD     . PRO B  2  144 ? 304.930 209.738 258.997 1.00 61.35  ? 143 PRO O CD     1 
ATOM   6032   H  HA     . PRO B  2  144 ? 304.350 212.437 260.589 1.00 55.75  ? 143 PRO O HA     1 
ATOM   6033   H  HB2    . PRO B  2  144 ? 306.710 211.580 260.965 1.00 56.73  ? 143 PRO O HB2    1 
ATOM   6034   H  HB3    . PRO B  2  144 ? 305.479 210.746 261.556 1.00 56.73  ? 143 PRO O HB3    1 
ATOM   6035   H  HG2    . PRO B  2  144 ? 306.921 210.232 259.198 1.00 59.91  ? 143 PRO O HG2    1 
ATOM   6036   H  HG3    . PRO B  2  144 ? 306.438 209.168 260.282 1.00 59.91  ? 143 PRO O HG3    1 
ATOM   6037   H  HD2    . PRO B  2  144 ? 305.137 209.603 258.059 1.00 59.05  ? 143 PRO O HD2    1 
ATOM   6038   H  HD3    . PRO B  2  144 ? 304.434 208.990 259.364 1.00 59.05  ? 143 PRO O HD3    1 
ATOM   6039   N  N      . TYR B  2  145 ? 306.226 214.018 259.661 1.00 67.75  ? 144 TYR O N      1 
ATOM   6040   C  CA     . TYR B  2  145 ? 307.037 214.967 258.910 1.00 65.08  ? 144 TYR O CA     1 
ATOM   6041   C  C      . TYR B  2  145 ? 308.131 215.519 259.792 1.00 63.53  ? 144 TYR O C      1 
ATOM   6042   O  O      . TYR B  2  145 ? 307.930 215.734 260.990 1.00 63.41  ? 144 TYR O O      1 
ATOM   6043   C  CB     . TYR B  2  145 ? 306.252 216.162 258.387 1.00 62.98  ? 144 TYR O CB     1 
ATOM   6044   C  CG     . TYR B  2  145 ? 305.301 215.853 257.280 1.00 73.85  ? 144 TYR O CG     1 
ATOM   6045   C  CD1    . TYR B  2  145 ? 305.755 215.628 255.994 1.00 81.98  ? 144 TYR O CD1    1 
ATOM   6046   C  CD2    . TYR B  2  145 ? 303.944 215.810 257.517 1.00 77.88  ? 144 TYR O CD2    1 
ATOM   6047   C  CE1    . TYR B  2  145 ? 304.877 215.364 254.976 1.00 87.98  ? 144 TYR O CE1    1 
ATOM   6048   C  CE2    . TYR B  2  145 ? 303.058 215.543 256.516 1.00 80.06  ? 144 TYR O CE2    1 
ATOM   6049   C  CZ     . TYR B  2  145 ? 303.526 215.314 255.246 1.00 95.33  ? 144 TYR O CZ     1 
ATOM   6050   O  OH     . TYR B  2  145 ? 302.625 215.040 254.249 1.00 120.85 ? 144 TYR O OH     1 
ATOM   6051   H  H      . TYR B  2  145 ? 306.150 214.209 260.497 1.00 65.42  ? 144 TYR O H      1 
ATOM   6052   H  HA     . TYR B  2  145 ? 307.447 214.515 258.156 1.00 62.88  ? 144 TYR O HA     1 
ATOM   6053   H  HB2    . TYR B  2  145 ? 305.738 216.537 259.119 1.00 61.83  ? 144 TYR O HB2    1 
ATOM   6054   H  HB3    . TYR B  2  145 ? 306.880 216.823 258.057 1.00 61.83  ? 144 TYR O HB3    1 
ATOM   6055   H  HD1    . TYR B  2  145 ? 306.667 215.661 255.816 1.00 81.44  ? 144 TYR O HD1    1 
ATOM   6056   H  HD2    . TYR B  2  145 ? 303.626 215.963 258.378 1.00 78.05  ? 144 TYR O HD2    1 
ATOM   6057   H  HE1    . TYR B  2  145 ? 305.190 215.205 254.115 1.00 88.05  ? 144 TYR O HE1    1 
ATOM   6058   H  HE2    . TYR B  2  145 ? 302.146 215.510 256.693 1.00 80.83  ? 144 TYR O HE2    1 
ATOM   6059   H  HH     . TYR B  2  145 ? 301.844 215.042 254.559 1.00 122.18 ? 144 TYR O HH     1 
ATOM   6060   N  N      . LEU B  2  146 ? 309.270 215.793 259.175 1.00 41.35  ? 145 LEU O N      1 
ATOM   6061   C  CA     . LEU B  2  146 ? 310.343 216.506 259.843 1.00 41.67  ? 145 LEU O CA     1 
ATOM   6062   C  C      . LEU B  2  146 ? 310.970 217.474 258.850 1.00 40.93  ? 145 LEU O C      1 
ATOM   6063   O  O      . LEU B  2  146 ? 311.300 217.089 257.724 1.00 41.25  ? 145 LEU O O      1 
ATOM   6064   C  CB     . LEU B  2  146 ? 311.373 215.525 260.405 1.00 45.37  ? 145 LEU O CB     1 
ATOM   6065   C  CG     . LEU B  2  146 ? 312.550 216.133 261.159 1.00 46.38  ? 145 LEU O CG     1 
ATOM   6066   C  CD1    . LEU B  2  146 ? 312.085 217.075 262.256 1.00 44.61  ? 145 LEU O CD1    1 
ATOM   6067   C  CD2    . LEU B  2  146 ? 313.385 215.017 261.746 1.00 50.42  ? 145 LEU O CD2    1 
ATOM   6068   H  H      . LEU B  2  146 ? 309.447 215.574 258.363 1.00 47.44  ? 145 LEU O H      1 
ATOM   6069   H  HA     . LEU B  2  146 ? 309.977 217.020 260.580 1.00 47.28  ? 145 LEU O HA     1 
ATOM   6070   H  HB2    . LEU B  2  146 ? 310.919 214.926 261.018 1.00 49.85  ? 145 LEU O HB2    1 
ATOM   6071   H  HB3    . LEU B  2  146 ? 311.739 215.013 259.667 1.00 49.85  ? 145 LEU O HB3    1 
ATOM   6072   H  HG     . LEU B  2  146 ? 313.103 216.635 260.540 1.00 50.25  ? 145 LEU O HG     1 
ATOM   6073   H  HD11   . LEU B  2  146 ? 312.862 217.438 262.709 1.00 48.87  ? 145 LEU O HD11   1 
ATOM   6074   H  HD12   . LEU B  2  146 ? 311.568 217.792 261.858 1.00 48.87  ? 145 LEU O HD12   1 
ATOM   6075   H  HD13   . LEU B  2  146 ? 311.537 216.580 262.885 1.00 48.87  ? 145 LEU O HD13   1 
ATOM   6076   H  HD21   . LEU B  2  146 ? 314.134 215.403 262.226 1.00 53.18  ? 145 LEU O HD21   1 
ATOM   6077   H  HD22   . LEU B  2  146 ? 312.834 214.497 262.353 1.00 53.18  ? 145 LEU O HD22   1 
ATOM   6078   H  HD23   . LEU B  2  146 ? 313.707 214.453 261.026 1.00 53.18  ? 145 LEU O HD23   1 
ATOM   6079   N  N      . PHE B  2  147 ? 311.104 218.731 259.264 1.00 45.34  ? 146 PHE O N      1 
ATOM   6080   C  CA     . PHE B  2  147 ? 311.689 219.787 258.454 1.00 43.81  ? 146 PHE O CA     1 
ATOM   6081   C  C      . PHE B  2  147 ? 312.749 220.512 259.267 1.00 44.24  ? 146 PHE O C      1 
ATOM   6082   O  O      . PHE B  2  147 ? 312.883 220.310 260.477 1.00 49.28  ? 146 PHE O O      1 
ATOM   6083   C  CB     . PHE B  2  147 ? 310.632 220.785 257.995 1.00 41.32  ? 146 PHE O CB     1 
ATOM   6084   C  CG     . PHE B  2  147 ? 309.644 220.215 257.042 1.00 41.77  ? 146 PHE O CG     1 
ATOM   6085   C  CD1    . PHE B  2  147 ? 308.529 219.539 257.499 1.00 42.33  ? 146 PHE O CD1    1 
ATOM   6086   C  CD2    . PHE B  2  147 ? 309.819 220.366 255.682 1.00 42.00  ? 146 PHE O CD2    1 
ATOM   6087   C  CE1    . PHE B  2  147 ? 307.610 219.020 256.615 1.00 50.62  ? 146 PHE O CE1    1 
ATOM   6088   C  CE2    . PHE B  2  147 ? 308.905 219.849 254.790 1.00 51.38  ? 146 PHE O CE2    1 
ATOM   6089   C  CZ     . PHE B  2  147 ? 307.798 219.174 255.256 1.00 55.40  ? 146 PHE O CZ     1 
ATOM   6090   H  H      . PHE B  2  147 ? 310.852 219.003 260.040 1.00 45.35  ? 146 PHE O H      1 
ATOM   6091   H  HA     . PHE B  2  147 ? 312.110 219.400 257.671 1.00 44.10  ? 146 PHE O HA     1 
ATOM   6092   H  HB2    . PHE B  2  147 ? 310.145 221.105 258.771 1.00 42.71  ? 146 PHE O HB2    1 
ATOM   6093   H  HB3    . PHE B  2  147 ? 311.074 221.528 257.555 1.00 42.71  ? 146 PHE O HB3    1 
ATOM   6094   H  HD1    . PHE B  2  147 ? 308.398 219.434 258.414 1.00 44.52  ? 146 PHE O HD1    1 
ATOM   6095   H  HD2    . PHE B  2  147 ? 310.565 220.821 255.363 1.00 44.20  ? 146 PHE O HD2    1 
ATOM   6096   H  HE1    . PHE B  2  147 ? 306.864 218.564 256.933 1.00 53.32  ? 146 PHE O HE1    1 
ATOM   6097   H  HE2    . PHE B  2  147 ? 309.036 219.955 253.875 1.00 54.08  ? 146 PHE O HE2    1 
ATOM   6098   H  HZ     . PHE B  2  147 ? 307.180 218.823 254.657 1.00 58.36  ? 146 PHE O HZ     1 
ATOM   6099   N  N      . GLN B  2  148 ? 313.504 221.377 258.596 1.00 58.39  ? 147 GLN O N      1 
ATOM   6100   C  CA     . GLN B  2  148 ? 314.487 222.191 259.300 1.00 60.81  ? 147 GLN O CA     1 
ATOM   6101   C  C      . GLN B  2  148 ? 314.675 223.525 258.594 1.00 60.20  ? 147 GLN O C      1 
ATOM   6102   O  O      . GLN B  2  148 ? 315.158 223.567 257.456 1.00 60.89  ? 147 GLN O O      1 
ATOM   6103   C  CB     . GLN B  2  148 ? 315.819 221.461 259.420 1.00 60.07  ? 147 GLN O CB     1 
ATOM   6104   C  CG     . GLN B  2  148 ? 316.882 222.287 260.104 1.00 59.99  ? 147 GLN O CG     1 
ATOM   6105   C  CD     . GLN B  2  148 ? 318.254 221.702 259.938 1.00 72.84  ? 147 GLN O CD     1 
ATOM   6106   O  OE1    . GLN B  2  148 ? 318.841 221.172 260.882 1.00 76.10  ? 147 GLN O OE1    1 
ATOM   6107   N  NE2    . GLN B  2  148 ? 318.784 221.797 258.724 1.00 77.67  ? 147 GLN O NE2    1 
ATOM   6108   H  H      . GLN B  2  148 ? 313.469 221.510 257.747 1.00 56.85  ? 147 GLN O H      1 
ATOM   6109   H  HA     . GLN B  2  148 ? 314.163 222.371 260.196 1.00 58.86  ? 147 GLN O HA     1 
ATOM   6110   H  HB2    . GLN B  2  148 ? 315.689 220.652 259.939 1.00 57.02  ? 147 GLN O HB2    1 
ATOM   6111   H  HB3    . GLN B  2  148 ? 316.138 221.239 258.532 1.00 57.02  ? 147 GLN O HB3    1 
ATOM   6112   H  HG2    . GLN B  2  148 ? 316.886 223.178 259.721 1.00 56.49  ? 147 GLN O HG2    1 
ATOM   6113   H  HG3    . GLN B  2  148 ? 316.687 222.333 261.053 1.00 56.49  ? 147 GLN O HG3    1 
ATOM   6114   H  HE21   . GLN B  2  148 ? 318.343 222.177 258.091 1.00 73.14  ? 147 GLN O HE21   1 
ATOM   6115   H  HE22   . GLN B  2  148 ? 319.568 221.479 258.571 1.00 73.14  ? 147 GLN O HE22   1 
ATOM   6116   N  N      . SER B  2  149 ? 314.342 224.604 259.299 1.00 79.54  ? 148 SER O N      1 
ATOM   6117   C  CA     . SER B  2  149 ? 314.389 225.959 258.766 1.00 78.49  ? 148 SER O CA     1 
ATOM   6118   C  C      . SER B  2  149 ? 315.705 226.620 259.142 1.00 79.97  ? 148 SER O C      1 
ATOM   6119   O  O      . SER B  2  149 ? 316.084 226.632 260.318 1.00 84.62  ? 148 SER O O      1 
ATOM   6120   C  CB     . SER B  2  149 ? 313.230 226.793 259.308 1.00 83.57  ? 148 SER O CB     1 
ATOM   6121   O  OG     . SER B  2  149 ? 311.982 226.314 258.842 1.00 95.76  ? 148 SER O OG     1 
ATOM   6122   H  H      . SER B  2  149 ? 314.076 224.572 260.116 1.00 75.16  ? 148 SER O H      1 
ATOM   6123   H  HA     . SER B  2  149 ? 314.323 225.931 257.799 1.00 74.72  ? 148 SER O HA     1 
ATOM   6124   H  HB2    . SER B  2  149 ? 313.240 226.750 260.278 1.00 80.65  ? 148 SER O HB2    1 
ATOM   6125   H  HB3    . SER B  2  149 ? 313.342 227.711 259.018 1.00 80.65  ? 148 SER O HB3    1 
ATOM   6126   H  HG     . SER B  2  149 ? 311.359 226.786 259.152 1.00 93.47  ? 148 SER O HG     1 
ATOM   6127   N  N      . ASP B  2  150 ? 316.381 227.192 258.150 1.00 82.73  ? 149 ASP O N      1 
ATOM   6128   C  CA     . ASP B  2  150 ? 317.676 227.799 258.382 1.00 99.53  ? 149 ASP O CA     1 
ATOM   6129   C  C      . ASP B  2  150 ? 317.582 229.323 258.384 1.00 83.05  ? 149 ASP O C      1 
ATOM   6130   O  O      . ASP B  2  150 ? 316.719 229.901 257.716 1.00 82.75  ? 149 ASP O O      1 
ATOM   6131   C  CB     . ASP B  2  150 ? 318.680 227.348 257.317 1.00 121.25 ? 149 ASP O CB     1 
ATOM   6132   C  CG     . ASP B  2  150 ? 319.151 225.922 257.532 1.00 146.82 ? 149 ASP O CG     1 
ATOM   6133   O  OD1    . ASP B  2  150 ? 320.226 225.737 258.144 1.00 162.33 ? 149 ASP O OD1    1 
ATOM   6134   O  OD2    . ASP B  2  150 ? 318.437 224.987 257.101 1.00 154.71 ? 149 ASP O OD2    1 
ATOM   6135   H  H      . ASP B  2  150 ? 316.108 227.240 257.336 1.00 77.93  ? 149 ASP O H      1 
ATOM   6136   H  HA     . ASP B  2  150 ? 318.008 227.516 259.249 1.00 94.15  ? 149 ASP O HA     1 
ATOM   6137   H  HB2    . ASP B  2  150 ? 318.260 227.399 256.444 1.00 115.33 ? 149 ASP O HB2    1 
ATOM   6138   H  HB3    . ASP B  2  150 ? 319.456 227.929 257.347 1.00 115.33 ? 149 ASP O HB3    1 
ATOM   6139   N  N      . PRO B  2  151 ? 318.476 230.003 259.108 1.00 61.13  ? 150 PRO O N      1 
ATOM   6140   C  CA     . PRO B  2  151 ? 318.434 231.473 259.167 1.00 52.83  ? 150 PRO O CA     1 
ATOM   6141   C  C      . PRO B  2  151 ? 318.398 232.105 257.788 1.00 52.21  ? 150 PRO O C      1 
ATOM   6142   O  O      . PRO B  2  151 ? 318.012 233.263 257.628 1.00 59.04  ? 150 PRO O O      1 
ATOM   6143   C  CB     . PRO B  2  151 ? 319.726 231.838 259.906 1.00 55.87  ? 150 PRO O CB     1 
ATOM   6144   C  CG     . PRO B  2  151 ? 320.152 230.599 260.603 1.00 70.16  ? 150 PRO O CG     1 
ATOM   6145   C  CD     . PRO B  2  151 ? 319.653 229.452 259.793 1.00 76.15  ? 150 PRO O CD     1 
ATOM   6146   H  HA     . PRO B  2  151 ? 317.669 231.772 259.683 1.00 55.80  ? 150 PRO O HA     1 
ATOM   6147   H  HB2    . PRO B  2  151 ? 320.399 232.118 259.266 1.00 58.06  ? 150 PRO O HB2    1 
ATOM   6148   H  HB3    . PRO B  2  151 ? 319.547 232.545 260.545 1.00 58.06  ? 150 PRO O HB3    1 
ATOM   6149   H  HG2    . PRO B  2  151 ? 321.120 230.577 260.658 1.00 71.49  ? 150 PRO O HG2    1 
ATOM   6150   H  HG3    . PRO B  2  151 ? 319.763 230.579 261.491 1.00 71.49  ? 150 PRO O HG3    1 
ATOM   6151   H  HD2    . PRO B  2  151 ? 320.323 229.177 259.147 1.00 77.53  ? 150 PRO O HD2    1 
ATOM   6152   H  HD3    . PRO B  2  151 ? 319.395 228.717 260.371 1.00 77.53  ? 150 PRO O HD3    1 
ATOM   6153   N  N      . SER B  2  152 ? 318.839 231.348 256.787 1.00 79.75  ? 151 SER O N      1 
ATOM   6154   C  CA     . SER B  2  152 ? 318.700 231.791 255.408 1.00 87.71  ? 151 SER O CA     1 
ATOM   6155   C  C      . SER B  2  152 ? 317.240 232.039 255.068 1.00 77.22  ? 151 SER O C      1 
ATOM   6156   O  O      . SER B  2  152 ? 316.875 233.120 254.594 1.00 69.96  ? 151 SER O O      1 
ATOM   6157   C  CB     . SER B  2  152 ? 319.293 230.742 254.466 1.00 107.25 ? 151 SER O CB     1 
ATOM   6158   O  OG     . SER B  2  152 ? 318.565 229.528 254.561 1.00 108.43 ? 151 SER O OG     1 
ATOM   6159   H  H      . SER B  2  152 ? 319.219 230.582 256.880 1.00 75.77  ? 151 SER O H      1 
ATOM   6160   H  HA     . SER B  2  152 ? 319.187 232.621 255.286 1.00 84.24  ? 151 SER O HA     1 
ATOM   6161   H  HB2    . SER B  2  152 ? 319.246 231.070 253.555 1.00 103.24 ? 151 SER O HB2    1 
ATOM   6162   H  HB3    . SER B  2  152 ? 320.217 230.579 254.714 1.00 103.24 ? 151 SER O HB3    1 
ATOM   6163   H  HG     . SER B  2  152 ? 318.894 228.954 254.042 1.00 104.39 ? 151 SER O HG     1 
ATOM   6164   N  N      . GLY B  2  153 ? 316.389 231.047 255.313 1.00 107.36 ? 152 GLY O N      1 
ATOM   6165   C  CA     . GLY B  2  153 ? 314.999 231.117 254.916 1.00 107.04 ? 152 GLY O CA     1 
ATOM   6166   C  C      . GLY B  2  153 ? 314.610 229.985 253.988 1.00 115.14 ? 152 GLY O C      1 
ATOM   6167   O  O      . GLY B  2  153 ? 313.549 230.027 253.358 1.00 117.20 ? 152 GLY O O      1 
ATOM   6168   H  H      . GLY B  2  153 ? 316.601 230.316 255.713 1.00 91.83  ? 152 GLY O H      1 
ATOM   6169   H  HA2    . GLY B  2  153 ? 314.435 231.077 255.704 1.00 92.41  ? 152 GLY O HA2    1 
ATOM   6170   H  HA3    . GLY B  2  153 ? 314.835 231.958 254.461 1.00 92.41  ? 152 GLY O HA3    1 
ATOM   6171   N  N      . ALA B  2  154 ? 315.469 228.977 253.883 1.00 60.05  ? 153 ALA O N      1 
ATOM   6172   C  CA     . ALA B  2  154 ? 315.159 227.758 253.156 1.00 56.42  ? 153 ALA O CA     1 
ATOM   6173   C  C      . ALA B  2  154 ? 314.853 226.642 254.145 1.00 57.92  ? 153 ALA O C      1 
ATOM   6174   O  O      . ALA B  2  154 ? 315.060 226.775 255.350 1.00 71.59  ? 153 ALA O O      1 
ATOM   6175   C  CB     . ALA B  2  154 ? 316.319 227.366 252.235 1.00 57.58  ? 153 ALA O CB     1 
ATOM   6176   H  H      . ALA B  2  154 ? 316.255 228.978 254.234 1.00 65.85  ? 153 ALA O H      1 
ATOM   6177   H  HA     . ALA B  2  154 ? 314.372 227.903 252.608 1.00 62.09  ? 153 ALA O HA     1 
ATOM   6178   H  HB1    . ALA B  2  154 ? 316.085 226.551 251.763 1.00 62.61  ? 153 ALA O HB1    1 
ATOM   6179   H  HB2    . ALA B  2  154 ? 316.473 228.084 251.600 1.00 62.61  ? 153 ALA O HB2    1 
ATOM   6180   H  HB3    . ALA B  2  154 ? 317.113 227.222 252.772 1.00 62.61  ? 153 ALA O HB3    1 
ATOM   6181   N  N      . TYR B  2  155 ? 314.348 225.527 253.624 1.00 53.88  ? 154 TYR O N      1 
ATOM   6182   C  CA     . TYR B  2  155 ? 314.024 224.393 254.477 1.00 53.60  ? 154 TYR O CA     1 
ATOM   6183   C  C      . TYR B  2  155 ? 314.260 223.097 253.719 1.00 67.93  ? 154 TYR O C      1 
ATOM   6184   O  O      . TYR B  2  155 ? 314.330 223.078 252.489 1.00 93.54  ? 154 TYR O O      1 
ATOM   6185   C  CB     . TYR B  2  155 ? 312.578 224.473 254.962 1.00 51.50  ? 154 TYR O CB     1 
ATOM   6186   C  CG     . TYR B  2  155 ? 311.586 224.591 253.843 1.00 51.81  ? 154 TYR O CG     1 
ATOM   6187   C  CD1    . TYR B  2  155 ? 311.325 225.817 253.254 1.00 50.92  ? 154 TYR O CD1    1 
ATOM   6188   C  CD2    . TYR B  2  155 ? 310.914 223.477 253.364 1.00 59.72  ? 154 TYR O CD2    1 
ATOM   6189   C  CE1    . TYR B  2  155 ? 310.416 225.934 252.221 1.00 63.93  ? 154 TYR O CE1    1 
ATOM   6190   C  CE2    . TYR B  2  155 ? 310.001 223.583 252.330 1.00 71.35  ? 154 TYR O CE2    1 
ATOM   6191   C  CZ     . TYR B  2  155 ? 309.756 224.818 251.760 1.00 78.25  ? 154 TYR O CZ     1 
ATOM   6192   O  OH     . TYR B  2  155 ? 308.853 224.947 250.722 1.00 93.45  ? 154 TYR O OH     1 
ATOM   6193   H  H      . TYR B  2  155 ? 314.187 225.404 252.788 1.00 52.54  ? 154 TYR O H      1 
ATOM   6194   H  HA     . TYR B  2  155 ? 314.606 224.401 255.253 1.00 51.85  ? 154 TYR O HA     1 
ATOM   6195   H  HB2    . TYR B  2  155 ? 312.369 223.669 255.463 1.00 50.51  ? 154 TYR O HB2    1 
ATOM   6196   H  HB3    . TYR B  2  155 ? 312.480 225.252 255.532 1.00 50.51  ? 154 TYR O HB3    1 
ATOM   6197   H  HD1    . TYR B  2  155 ? 311.767 226.575 253.561 1.00 51.49  ? 154 TYR O HD1    1 
ATOM   6198   H  HD2    . TYR B  2  155 ? 311.077 222.645 253.747 1.00 59.63  ? 154 TYR O HD2    1 
ATOM   6199   H  HE1    . TYR B  2  155 ? 310.252 226.765 251.836 1.00 65.25  ? 154 TYR O HE1    1 
ATOM   6200   H  HE2    . TYR B  2  155 ? 309.557 222.827 252.019 1.00 72.02  ? 154 TYR O HE2    1 
ATOM   6201   H  HH     . TYR B  2  155 ? 308.521 224.198 250.535 1.00 95.57  ? 154 TYR O HH     1 
ATOM   6202   N  N      . PHE B  2  156 ? 314.386 222.008 254.476 1.00 73.62  ? 155 PHE O N      1 
ATOM   6203   C  CA     . PHE B  2  156 ? 314.613 220.685 253.909 1.00 76.14  ? 155 PHE O CA     1 
ATOM   6204   C  C      . PHE B  2  156 ? 313.876 219.635 254.718 1.00 88.22  ? 155 PHE O C      1 
ATOM   6205   O  O      . PHE B  2  156 ? 313.859 219.686 255.950 1.00 105.15 ? 155 PHE O O      1 
ATOM   6206   C  CB     . PHE B  2  156 ? 316.098 220.351 253.880 1.00 83.69  ? 155 PHE O CB     1 
ATOM   6207   C  CG     . PHE B  2  156 ? 316.933 221.453 253.350 1.00 87.80  ? 155 PHE O CG     1 
ATOM   6208   C  CD1    . PHE B  2  156 ? 317.653 222.264 254.205 1.00 91.75  ? 155 PHE O CD1    1 
ATOM   6209   C  CD2    . PHE B  2  156 ? 316.964 221.708 251.995 1.00 102.03 ? 155 PHE O CD2    1 
ATOM   6210   C  CE1    . PHE B  2  156 ? 318.412 223.295 253.714 1.00 111.21 ? 155 PHE O CE1    1 
ATOM   6211   C  CE2    . PHE B  2  156 ? 317.716 222.738 251.493 1.00 119.92 ? 155 PHE O CE2    1 
ATOM   6212   C  CZ     . PHE B  2  156 ? 318.446 223.537 252.353 1.00 124.40 ? 155 PHE O CZ     1 
ATOM   6213   H  H      . PHE B  2  156 ? 314.343 222.012 255.335 1.00 72.41  ? 155 PHE O H      1 
ATOM   6214   H  HA     . PHE B  2  156 ? 314.276 220.662 252.999 1.00 74.39  ? 155 PHE O HA     1 
ATOM   6215   H  HB2    . PHE B  2  156 ? 316.395 220.160 254.783 1.00 80.92  ? 155 PHE O HB2    1 
ATOM   6216   H  HB3    . PHE B  2  156 ? 316.235 219.575 253.315 1.00 80.92  ? 155 PHE O HB3    1 
ATOM   6217   H  HD1    . PHE B  2  156 ? 317.632 222.102 255.120 1.00 88.75  ? 155 PHE O HD1    1 
ATOM   6218   H  HD2    . PHE B  2  156 ? 316.474 221.171 251.414 1.00 99.65  ? 155 PHE O HD2    1 
ATOM   6219   H  HE1    . PHE B  2  156 ? 318.901 223.832 254.295 1.00 108.25 ? 155 PHE O HE1    1 
ATOM   6220   H  HE2    . PHE B  2  156 ? 317.738 222.897 250.577 1.00 117.58 ? 155 PHE O HE2    1 
ATOM   6221   H  HZ     . PHE B  2  156 ? 318.960 224.235 252.016 1.00 121.77 ? 155 PHE O HZ     1 
ATOM   6222   N  N      . ALA B  2  157 ? 313.287 218.675 254.017 1.00 77.67  ? 156 ALA O N      1 
ATOM   6223   C  CA     . ALA B  2  157 ? 312.541 217.595 254.652 1.00 81.93  ? 156 ALA O CA     1 
ATOM   6224   C  C      . ALA B  2  157 ? 313.465 216.400 254.868 1.00 105.34 ? 156 ALA O C      1 
ATOM   6225   O  O      . ALA B  2  157 ? 313.949 215.798 253.903 1.00 117.43 ? 156 ALA O O      1 
ATOM   6226   C  CB     . ALA B  2  157 ? 311.338 217.205 253.797 1.00 78.08  ? 156 ALA O CB     1 
ATOM   6227   H  H      . ALA B  2  157 ? 313.304 218.626 253.158 1.00 77.67  ? 156 ALA O H      1 
ATOM   6228   H  HA     . ALA B  2  157 ? 312.218 217.892 255.517 1.00 81.80  ? 156 ALA O HA     1 
ATOM   6229   H  HB1    . ALA B  2  157 ? 310.858 216.487 254.238 1.00 78.67  ? 156 ALA O HB1    1 
ATOM   6230   H  HB2    . ALA B  2  157 ? 310.760 217.977 253.697 1.00 78.67  ? 156 ALA O HB2    1 
ATOM   6231   H  HB3    . ALA B  2  157 ? 311.652 216.910 252.928 1.00 78.67  ? 156 ALA O HB3    1 
ATOM   6232   N  N      . TRP B  2  158 ? 313.693 216.056 256.131 1.00 82.03  ? 157 TRP O N      1 
ATOM   6233   C  CA     . TRP B  2  158 ? 314.614 214.997 256.519 1.00 80.19  ? 157 TRP O CA     1 
ATOM   6234   C  C      . TRP B  2  158 ? 313.865 213.764 257.006 1.00 80.70  ? 157 TRP O C      1 
ATOM   6235   O  O      . TRP B  2  158 ? 312.666 213.794 257.300 1.00 91.03  ? 157 TRP O O      1 
ATOM   6236   C  CB     . TRP B  2  158 ? 315.550 215.462 257.637 1.00 59.90  ? 157 TRP O CB     1 
ATOM   6237   C  CG     . TRP B  2  158 ? 316.421 216.593 257.299 1.00 59.38  ? 157 TRP O CG     1 
ATOM   6238   C  CD1    . TRP B  2  158 ? 316.268 217.886 257.685 1.00 56.69  ? 157 TRP O CD1    1 
ATOM   6239   C  CD2    . TRP B  2  158 ? 317.614 216.540 256.525 1.00 62.02  ? 157 TRP O CD2    1 
ATOM   6240   N  NE1    . TRP B  2  158 ? 317.293 218.650 257.190 1.00 57.45  ? 157 TRP O NE1    1 
ATOM   6241   C  CE2    . TRP B  2  158 ? 318.136 217.844 256.477 1.00 60.73  ? 157 TRP O CE2    1 
ATOM   6242   C  CE3    . TRP B  2  158 ? 318.296 215.515 255.868 1.00 73.19  ? 157 TRP O CE3    1 
ATOM   6243   C  CZ2    . TRP B  2  158 ? 319.305 218.152 255.795 1.00 62.92  ? 157 TRP O CZ2    1 
ATOM   6244   C  CZ3    . TRP B  2  158 ? 319.452 215.820 255.187 1.00 81.52  ? 157 TRP O CZ3    1 
ATOM   6245   C  CH2    . TRP B  2  158 ? 319.948 217.128 255.155 1.00 89.35  ? 157 TRP O CH2    1 
ATOM   6246   H  H      . TRP B  2  158 ? 313.312 216.436 256.802 1.00 77.92  ? 157 TRP O H      1 
ATOM   6247   H  HA     . TRP B  2  158 ? 315.154 214.745 255.754 1.00 75.00  ? 157 TRP O HA     1 
ATOM   6248   H  HB2    . TRP B  2  158 ? 315.010 215.728 258.398 1.00 54.10  ? 157 TRP O HB2    1 
ATOM   6249   H  HB3    . TRP B  2  158 ? 316.121 214.720 257.888 1.00 54.10  ? 157 TRP O HB3    1 
ATOM   6250   H  HD1    . TRP B  2  158 ? 315.570 218.207 258.208 1.00 51.47  ? 157 TRP O HD1    1 
ATOM   6251   H  HE1    . TRP B  2  158 ? 317.391 219.496 257.312 1.00 52.03  ? 157 TRP O HE1    1 
ATOM   6252   H  HE3    . TRP B  2  158 ? 317.973 214.643 255.888 1.00 66.11  ? 157 TRP O HE3    1 
ATOM   6253   H  HZ2    . TRP B  2  158 ? 319.633 219.022 255.767 1.00 56.36  ? 157 TRP O HZ2    1 
ATOM   6254   H  HZ3    . TRP B  2  158 ? 319.915 215.145 254.746 1.00 74.00  ? 157 TRP O HZ3    1 
ATOM   6255   H  HH2    . TRP B  2  158 ? 320.732 217.306 254.687 1.00 82.08  ? 157 TRP O HH2    1 
ATOM   6256   N  N      . LYS B  2  159 ? 314.616 212.672 257.108 1.00 102.97 ? 158 LYS O N      1 
ATOM   6257   C  CA     . LYS B  2  159 ? 314.197 211.485 257.834 1.00 102.75 ? 158 LYS O CA     1 
ATOM   6258   C  C      . LYS B  2  159 ? 314.996 211.286 259.107 1.00 112.26 ? 158 LYS O C      1 
ATOM   6259   O  O      . LYS B  2  159 ? 314.607 210.473 259.951 1.00 126.28 ? 158 LYS O O      1 
ATOM   6260   C  CB     . LYS B  2  159 ? 314.340 210.247 256.946 1.00 100.12 ? 158 LYS O CB     1 
ATOM   6261   C  CG     . LYS B  2  159 ? 313.462 210.314 255.720 1.00 95.13  ? 158 LYS O CG     1 
ATOM   6262   C  CD     . LYS B  2  159 ? 313.546 209.057 254.876 1.00 94.42  ? 158 LYS O CD     1 
ATOM   6263   C  CE     . LYS B  2  159 ? 314.950 208.816 254.351 1.00 102.38 ? 158 LYS O CE     1 
ATOM   6264   N  NZ     . LYS B  2  159 ? 314.984 207.713 253.354 1.00 113.34 ? 158 LYS O NZ     1 
ATOM   6265   H  H      . LYS B  2  159 ? 315.396 212.597 256.754 1.00 94.70  ? 158 LYS O H      1 
ATOM   6266   H  HA     . LYS B  2  159 ? 313.262 211.575 258.077 1.00 94.04  ? 158 LYS O HA     1 
ATOM   6267   H  HB2    . LYS B  2  159 ? 315.261 210.172 256.652 1.00 90.98  ? 158 LYS O HB2    1 
ATOM   6268   H  HB3    . LYS B  2  159 ? 314.087 209.461 257.454 1.00 90.98  ? 158 LYS O HB3    1 
ATOM   6269   H  HG2    . LYS B  2  159 ? 312.539 210.430 255.997 1.00 86.83  ? 158 LYS O HG2    1 
ATOM   6270   H  HG3    . LYS B  2  159 ? 313.741 211.064 255.171 1.00 86.83  ? 158 LYS O HG3    1 
ATOM   6271   H  HD2    . LYS B  2  159 ? 313.290 208.293 255.416 1.00 85.69  ? 158 LYS O HD2    1 
ATOM   6272   H  HD3    . LYS B  2  159 ? 312.949 209.143 254.116 1.00 85.69  ? 158 LYS O HD3    1 
ATOM   6273   H  HE2    . LYS B  2  159 ? 315.273 209.623 253.921 1.00 92.79  ? 158 LYS O HE2    1 
ATOM   6274   H  HE3    . LYS B  2  159 ? 315.530 208.575 255.090 1.00 92.79  ? 158 LYS O HE3    1 
ATOM   6275   H  HZ1    . LYS B  2  159 ? 315.816 207.592 253.063 1.00 103.44 ? 158 LYS O HZ1    1 
ATOM   6276   H  HZ2    . LYS B  2  159 ? 314.695 206.958 253.726 1.00 103.44 ? 158 LYS O HZ2    1 
ATOM   6277   H  HZ3    . LYS B  2  159 ? 314.461 207.913 252.662 1.00 103.44 ? 158 LYS O HZ3    1 
ATOM   6278   N  N      . ALA B  2  160 ? 316.104 212.000 259.246 1.00 76.60  ? 159 ALA O N      1 
ATOM   6279   C  CA     . ALA B  2  160 ? 316.882 212.096 260.465 1.00 67.17  ? 159 ALA O CA     1 
ATOM   6280   C  C      . ALA B  2  160 ? 317.832 213.256 260.251 1.00 78.30  ? 159 ALA O C      1 
ATOM   6281   O  O      . ALA B  2  160 ? 318.142 213.611 259.112 1.00 104.64 ? 159 ALA O O      1 
ATOM   6282   C  CB     . ALA B  2  160 ? 317.659 210.815 260.773 1.00 66.43  ? 159 ALA O CB     1 
ATOM   6283   H  H      . ALA B  2  160 ? 316.441 212.465 258.606 1.00 88.64  ? 159 ALA O H      1 
ATOM   6284   H  HA     . ALA B  2  160 ? 316.300 212.300 261.214 1.00 78.49  ? 159 ALA O HA     1 
ATOM   6285   H  HB1    . ALA B  2  160 ? 318.157 210.939 261.596 1.00 76.62  ? 159 ALA O HB1    1 
ATOM   6286   H  HB2    . ALA B  2  160 ? 317.031 210.082 260.873 1.00 76.62  ? 159 ALA O HB2    1 
ATOM   6287   H  HB3    . ALA B  2  160 ? 318.268 210.632 260.041 1.00 76.62  ? 159 ALA O HB3    1 
ATOM   6288   N  N      . THR B  2  161 ? 318.281 213.850 261.344 1.00 62.09  ? 160 THR O N      1 
ATOM   6289   C  CA     . THR B  2  161 ? 319.289 214.892 261.237 1.00 65.67  ? 160 THR O CA     1 
ATOM   6290   C  C      . THR B  2  161 ? 319.646 215.336 262.644 1.00 71.62  ? 160 THR O C      1 
ATOM   6291   O  O      . THR B  2  161 ? 318.933 215.062 263.614 1.00 71.63  ? 160 THR O O      1 
ATOM   6292   C  CB     . THR B  2  161 ? 318.828 216.102 260.405 1.00 65.37  ? 160 THR O CB     1 
ATOM   6293   O  OG1    . THR B  2  161 ? 319.970 216.836 259.945 1.00 54.49  ? 160 THR O OG1    1 
ATOM   6294   C  CG2    . THR B  2  161 ? 317.921 217.024 261.229 1.00 72.98  ? 160 THR O CG2    1 
ATOM   6295   H  H      . THR B  2  161 ? 318.025 213.674 262.146 1.00 70.72  ? 160 THR O H      1 
ATOM   6296   H  HA     . THR B  2  161 ? 320.086 214.524 260.822 1.00 74.17  ? 160 THR O HA     1 
ATOM   6297   H  HB     . THR B  2  161 ? 318.323 215.787 259.639 1.00 74.88  ? 160 THR O HB     1 
ATOM   6298   H  HG1    . THR B  2  161 ? 319.723 217.498 259.491 1.00 63.71  ? 160 THR O HG1    1 
ATOM   6299   H  HG21   . THR B  2  161 ? 317.640 217.780 260.691 1.00 83.24  ? 160 THR O HG21   1 
ATOM   6300   H  HG22   . THR B  2  161 ? 317.135 216.538 261.525 1.00 83.24  ? 160 THR O HG22   1 
ATOM   6301   H  HG23   . THR B  2  161 ? 318.400 217.352 262.007 1.00 83.24  ? 160 THR O HG23   1 
ATOM   6302   N  N      . ALA B  2  162 ? 320.756 216.037 262.734 1.00 48.31  ? 161 ALA O N      1 
ATOM   6303   C  CA     . ALA B  2  162 ? 321.160 216.739 263.931 1.00 50.86  ? 161 ALA O CA     1 
ATOM   6304   C  C      . ALA B  2  162 ? 321.354 218.209 263.580 1.00 58.66  ? 161 ALA O C      1 
ATOM   6305   O  O      . ALA B  2  162 ? 321.194 218.626 262.430 1.00 77.35  ? 161 ALA O O      1 
ATOM   6306   C  CB     . ALA B  2  162 ? 322.437 216.127 264.504 1.00 53.38  ? 161 ALA O CB     1 
ATOM   6307   H  H      . ALA B  2  162 ? 321.316 216.124 262.087 1.00 64.40  ? 161 ALA O H      1 
ATOM   6308   H  HA     . ALA B  2  162 ? 320.459 216.671 264.599 1.00 67.27  ? 161 ALA O HA     1 
ATOM   6309   H  HB1    . ALA B  2  162 ? 322.688 216.613 265.305 1.00 68.57  ? 161 ALA O HB1    1 
ATOM   6310   H  HB2    . ALA B  2  162 ? 322.271 215.196 264.720 1.00 68.57  ? 161 ALA O HB2    1 
ATOM   6311   H  HB3    . ALA B  2  162 ? 323.143 216.192 263.842 1.00 68.57  ? 161 ALA O HB3    1 
ATOM   6312   N  N      . MET B  2  163 ? 321.692 219.000 264.587 1.00 74.74  ? 162 MET O N      1 
ATOM   6313   C  CA     . MET B  2  163 ? 322.156 220.357 264.351 1.00 73.47  ? 162 MET O CA     1 
ATOM   6314   C  C      . MET B  2  163 ? 322.799 220.852 265.638 1.00 74.32  ? 162 MET O C      1 
ATOM   6315   O  O      . MET B  2  163 ? 322.867 220.132 266.639 1.00 75.90  ? 162 MET O O      1 
ATOM   6316   C  CB     . MET B  2  163 ? 321.015 221.265 263.884 1.00 70.53  ? 162 MET O CB     1 
ATOM   6317   C  CG     . MET B  2  163 ? 319.827 221.349 264.831 1.00 104.32 ? 162 MET O CG     1 
ATOM   6318   S  SD     . MET B  2  163 ? 318.601 222.537 264.234 1.00 119.55 ? 162 MET O SD     1 
ATOM   6319   C  CE     . MET B  2  163 ? 319.001 223.948 265.238 1.00 136.00 ? 162 MET O CE     1 
ATOM   6320   H  H      . MET B  2  163 ? 321.662 218.775 265.416 1.00 70.75  ? 162 MET O H      1 
ATOM   6321   H  HA     . MET B  2  163 ? 322.827 220.342 263.652 1.00 69.83  ? 162 MET O HA     1 
ATOM   6322   H  HB2    . MET B  2  163 ? 321.363 222.163 263.771 1.00 68.09  ? 162 MET O HB2    1 
ATOM   6323   H  HB3    . MET B  2  163 ? 320.688 220.934 263.033 1.00 68.09  ? 162 MET O HB3    1 
ATOM   6324   H  HG2    . MET B  2  163 ? 319.403 220.479 264.893 1.00 102.41 ? 162 MET O HG2    1 
ATOM   6325   H  HG3    . MET B  2  163 ? 320.132 221.639 265.705 1.00 102.41 ? 162 MET O HG3    1 
ATOM   6326   H  HE1    . MET B  2  163 ? 318.402 224.677 265.012 1.00 135.54 ? 162 MET O HE1    1 
ATOM   6327   H  HE2    . MET B  2  163 ? 318.895 223.710 266.173 1.00 135.54 ? 162 MET O HE2    1 
ATOM   6328   H  HE3    . MET B  2  163 ? 319.919 224.209 265.065 1.00 135.54 ? 162 MET O HE3    1 
ATOM   6329   N  N      . GLY B  2  164 ? 323.285 222.090 265.600 1.00 97.00  ? 163 GLY O N      1 
ATOM   6330   C  CA     . GLY B  2  164 ? 323.982 222.628 266.748 1.00 85.89  ? 163 GLY O CA     1 
ATOM   6331   C  C      . GLY B  2  164 ? 325.377 222.042 266.868 1.00 100.87 ? 163 GLY O C      1 
ATOM   6332   O  O      . GLY B  2  164 ? 326.029 221.696 265.881 1.00 119.71 ? 163 GLY O O      1 
ATOM   6333   H  H      . GLY B  2  164 ? 323.223 222.626 264.931 1.00 83.43  ? 163 GLY O H      1 
ATOM   6334   H  HA2    . GLY B  2  164 ? 324.055 223.591 266.664 1.00 71.82  ? 163 GLY O HA2    1 
ATOM   6335   H  HA3    . GLY B  2  164 ? 323.487 222.422 267.556 1.00 71.82  ? 163 GLY O HA3    1 
ATOM   6336   N  N      . LYS B  2  165 ? 325.839 221.927 268.109 1.00 95.61  ? 164 LYS O N      1 
ATOM   6337   C  CA     . LYS B  2  165 ? 327.188 221.443 268.359 1.00 105.79 ? 164 LYS O CA     1 
ATOM   6338   C  C      . LYS B  2  165 ? 327.401 220.074 267.725 1.00 104.33 ? 164 LYS O C      1 
ATOM   6339   O  O      . LYS B  2  165 ? 326.519 219.212 267.757 1.00 100.57 ? 164 LYS O O      1 
ATOM   6340   C  CB     . LYS B  2  165 ? 327.447 221.366 269.869 1.00 116.46 ? 164 LYS O CB     1 
ATOM   6341   C  CG     . LYS B  2  165 ? 328.911 221.174 270.247 1.00 118.25 ? 164 LYS O CG     1 
ATOM   6342   C  CD     . LYS B  2  165 ? 329.823 222.211 269.591 1.00 122.39 ? 164 LYS O CD     1 
ATOM   6343   C  CE     . LYS B  2  165 ? 329.393 223.632 269.930 1.00 127.74 ? 164 LYS O CE     1 
ATOM   6344   N  NZ     . LYS B  2  165 ? 329.366 223.864 271.400 1.00 134.19 ? 164 LYS O NZ     1 
ATOM   6345   H  H      . LYS B  2  165 ? 325.394 222.122 268.818 1.00 77.51  ? 164 LYS O H      1 
ATOM   6346   H  HA     . LYS B  2  165 ? 327.827 222.061 267.971 1.00 86.56  ? 164 LYS O HA     1 
ATOM   6347   H  HB2    . LYS B  2  165 ? 327.142 222.190 270.279 1.00 96.64  ? 164 LYS O HB2    1 
ATOM   6348   H  HB3    . LYS B  2  165 ? 326.949 220.617 270.231 1.00 96.64  ? 164 LYS O HB3    1 
ATOM   6349   H  HG2    . LYS B  2  165 ? 329.004 221.257 271.209 1.00 97.30  ? 164 LYS O HG2    1 
ATOM   6350   H  HG3    . LYS B  2  165 ? 329.201 220.294 269.959 1.00 97.30  ? 164 LYS O HG3    1 
ATOM   6351   H  HD2    . LYS B  2  165 ? 330.731 222.085 269.909 1.00 101.47 ? 164 LYS O HD2    1 
ATOM   6352   H  HD3    . LYS B  2  165 ? 329.787 222.105 268.628 1.00 101.47 ? 164 LYS O HD3    1 
ATOM   6353   H  HE2    . LYS B  2  165 ? 330.020 224.258 269.536 1.00 107.63 ? 164 LYS O HE2    1 
ATOM   6354   H  HE3    . LYS B  2  165 ? 328.501 223.787 269.582 1.00 107.63 ? 164 LYS O HE3    1 
ATOM   6355   H  HZ1    . LYS B  2  165 ? 328.792 223.302 271.786 1.00 113.81 ? 164 LYS O HZ1    1 
ATOM   6356   H  HZ2    . LYS B  2  165 ? 329.866 223.254 271.813 1.00 113.81 ? 164 LYS O HZ2    1 
ATOM   6357   H  HZ3    . LYS B  2  165 ? 329.112 224.699 271.572 1.00 113.81 ? 164 LYS O HZ3    1 
ATOM   6358   N  N      . ASN B  2  166 ? 328.585 219.884 267.145 1.00 123.02 ? 165 ASN O N      1 
ATOM   6359   C  CA     . ASN B  2  166 ? 329.013 218.585 266.624 1.00 130.51 ? 165 ASN O CA     1 
ATOM   6360   C  C      . ASN B  2  166 ? 327.936 217.947 265.759 1.00 130.32 ? 165 ASN O C      1 
ATOM   6361   O  O      . ASN B  2  166 ? 327.623 216.762 265.889 1.00 141.61 ? 165 ASN O O      1 
ATOM   6362   C  CB     . ASN B  2  166 ? 329.381 217.628 267.749 1.00 129.26 ? 165 ASN O CB     1 
ATOM   6363   C  CG     . ASN B  2  166 ? 330.301 218.240 268.761 1.00 137.15 ? 165 ASN O CG     1 
ATOM   6364   O  OD1    . ASN B  2  166 ? 330.911 219.281 268.522 1.00 149.37 ? 165 ASN O OD1    1 
ATOM   6365   N  ND2    . ASN B  2  166 ? 330.408 217.592 269.910 1.00 135.22 ? 165 ASN O ND2    1 
ATOM   6366   H  H      . ASN B  2  166 ? 329.171 220.505 267.039 1.00 96.16  ? 165 ASN O H      1 
ATOM   6367   H  HA     . ASN B  2  166 ? 329.801 218.713 266.072 1.00 102.92 ? 165 ASN O HA     1 
ATOM   6368   H  HB2    . ASN B  2  166 ? 328.571 217.355 268.208 1.00 100.71 ? 165 ASN O HB2    1 
ATOM   6369   H  HB3    . ASN B  2  166 ? 329.825 216.852 267.371 1.00 100.71 ? 165 ASN O HB3    1 
ATOM   6370   H  HD21   . ASN B  2  166 ? 330.922 217.896 270.529 1.00 105.41 ? 165 ASN O HD21   1 
ATOM   6371   H  HD22   . ASN B  2  166 ? 329.963 216.867 270.038 1.00 105.41 ? 165 ASN O HD22   1 
ATOM   6372   N  N      . TYR B  2  167 ? 327.359 218.739 264.869 1.00 100.71 ? 166 TYR O N      1 
ATOM   6373   C  CA     . TYR B  2  167 ? 326.356 218.178 263.980 1.00 115.91 ? 166 TYR O CA     1 
ATOM   6374   C  C      . TYR B  2  167 ? 326.989 217.425 262.817 1.00 139.64 ? 166 TYR O C      1 
ATOM   6375   O  O      . TYR B  2  167 ? 326.314 216.615 262.178 1.00 143.09 ? 166 TYR O O      1 
ATOM   6376   C  CB     . TYR B  2  167 ? 325.428 219.282 263.475 1.00 106.71 ? 166 TYR O CB     1 
ATOM   6377   C  CG     . TYR B  2  167 ? 326.045 220.157 262.422 1.00 103.41 ? 166 TYR O CG     1 
ATOM   6378   C  CD1    . TYR B  2  167 ? 325.505 220.215 261.152 1.00 91.71  ? 166 TYR O CD1    1 
ATOM   6379   C  CD2    . TYR B  2  167 ? 327.176 220.914 262.694 1.00 115.99 ? 166 TYR O CD2    1 
ATOM   6380   C  CE1    . TYR B  2  167 ? 326.064 221.006 260.182 1.00 116.14 ? 166 TYR O CE1    1 
ATOM   6381   C  CE2    . TYR B  2  167 ? 327.743 221.707 261.737 1.00 134.80 ? 166 TYR O CE2    1 
ATOM   6382   C  CZ     . TYR B  2  167 ? 327.185 221.752 260.480 1.00 145.89 ? 166 TYR O CZ     1 
ATOM   6383   O  OH     . TYR B  2  167 ? 327.764 222.552 259.526 1.00 179.93 ? 166 TYR O OH     1 
ATOM   6384   H  H      . TYR B  2  167 ? 327.522 219.576 264.761 1.00 91.92  ? 166 TYR O H      1 
ATOM   6385   H  HA     . TYR B  2  167 ? 325.817 217.545 264.480 1.00 107.73 ? 166 TYR O HA     1 
ATOM   6386   H  HB2    . TYR B  2  167 ? 324.634 218.874 263.094 1.00 99.74  ? 166 TYR O HB2    1 
ATOM   6387   H  HB3    . TYR B  2  167 ? 325.179 219.848 264.222 1.00 99.74  ? 166 TYR O HB3    1 
ATOM   6388   H  HD1    . TYR B  2  167 ? 324.748 219.712 260.952 1.00 85.63  ? 166 TYR O HD1    1 
ATOM   6389   H  HD2    . TYR B  2  167 ? 327.552 220.884 263.544 1.00 108.78 ? 166 TYR O HD2    1 
ATOM   6390   H  HE1    . TYR B  2  167 ? 325.690 221.039 259.331 1.00 110.25 ? 166 TYR O HE1    1 
ATOM   6391   H  HE2    . TYR B  2  167 ? 328.499 222.211 261.933 1.00 127.78 ? 166 TYR O HE2    1 
ATOM   6392   H  HH     . TYR B  2  167 ? 328.434 222.944 259.847 1.00 173.74 ? 166 TYR O HH     1 
ATOM   6393   N  N      . VAL B  2  168 ? 328.273 217.663 262.542 1.00 137.31 ? 167 VAL O N      1 
ATOM   6394   C  CA     . VAL B  2  168 ? 328.987 216.847 261.566 1.00 126.72 ? 167 VAL O CA     1 
ATOM   6395   C  C      . VAL B  2  168 ? 329.242 215.451 262.122 1.00 130.55 ? 167 VAL O C      1 
ATOM   6396   O  O      . VAL B  2  168 ? 329.248 214.469 261.371 1.00 131.89 ? 167 VAL O O      1 
ATOM   6397   C  CB     . VAL B  2  168 ? 330.293 217.547 261.147 1.00 114.30 ? 167 VAL O CB     1 
ATOM   6398   C  CG1    . VAL B  2  168 ? 329.977 218.854 260.432 1.00 97.93  ? 167 VAL O CG1    1 
ATOM   6399   C  CG2    . VAL B  2  168 ? 331.191 217.789 262.360 1.00 109.97 ? 167 VAL O CG2    1 
ATOM   6400   H  H      . VAL B  2  168 ? 328.746 218.284 262.903 1.00 127.04 ? 167 VAL O H      1 
ATOM   6401   H  HA     . VAL B  2  168 ? 328.435 216.753 260.774 1.00 115.83 ? 167 VAL O HA     1 
ATOM   6402   H  HB     . VAL B  2  168 ? 330.773 216.975 260.528 1.00 102.95 ? 167 VAL O HB     1 
ATOM   6403   H  HG11   . VAL B  2  168 ? 330.808 219.282 260.175 1.00 87.53  ? 167 VAL O HG11   1 
ATOM   6404   H  HG12   . VAL B  2  168 ? 329.446 218.661 259.643 1.00 87.53  ? 167 VAL O HG12   1 
ATOM   6405   H  HG13   . VAL B  2  168 ? 329.480 219.430 261.034 1.00 87.53  ? 167 VAL O HG13   1 
ATOM   6406   H  HG21   . VAL B  2  168 ? 332.004 218.229 262.067 1.00 97.85  ? 167 VAL O HG21   1 
ATOM   6407   H  HG22   . VAL B  2  168 ? 330.720 218.351 262.994 1.00 97.85  ? 167 VAL O HG22   1 
ATOM   6408   H  HG23   . VAL B  2  168 ? 331.406 216.936 262.769 1.00 97.85  ? 167 VAL O HG23   1 
ATOM   6409   N  N      . ASN B  2  169 ? 329.458 215.334 263.435 1.00 161.42 ? 168 ASN O N      1 
ATOM   6410   C  CA     . ASN B  2  169 ? 329.591 214.021 264.059 1.00 160.12 ? 168 ASN O CA     1 
ATOM   6411   C  C      . ASN B  2  169 ? 328.240 213.332 264.184 1.00 151.25 ? 168 ASN O C      1 
ATOM   6412   O  O      . ASN B  2  169 ? 328.135 212.118 263.982 1.00 155.48 ? 168 ASN O O      1 
ATOM   6413   C  CB     . ASN B  2  169 ? 330.222 214.147 265.445 1.00 155.46 ? 168 ASN O CB     1 
ATOM   6414   C  CG     . ASN B  2  169 ? 331.574 214.817 265.413 1.00 147.15 ? 168 ASN O CG     1 
ATOM   6415   O  OD1    . ASN B  2  169 ? 331.751 215.912 265.948 1.00 142.51 ? 168 ASN O OD1    1 
ATOM   6416   N  ND2    . ASN B  2  169 ? 332.542 214.156 264.795 1.00 148.35 ? 168 ASN O ND2    1 
ATOM   6417   H  H      . ASN B  2  169 ? 329.531 215.995 263.980 1.00 136.74 ? 168 ASN O H      1 
ATOM   6418   H  HA     . ASN B  2  169 ? 330.167 213.463 263.512 1.00 134.59 ? 168 ASN O HA     1 
ATOM   6419   H  HB2    . ASN B  2  169 ? 329.638 214.676 266.011 1.00 129.23 ? 168 ASN O HB2    1 
ATOM   6420   H  HB3    . ASN B  2  169 ? 330.336 213.260 265.822 1.00 129.23 ? 168 ASN O HB3    1 
ATOM   6421   H  HD21   . ASN B  2  169 ? 333.331 214.493 264.748 1.00 120.70 ? 168 ASN O HD21   1 
ATOM   6422   H  HD22   . ASN B  2  169 ? 332.380 213.389 264.441 1.00 120.70 ? 168 ASN O HD22   1 
ATOM   6423   N  N      . GLY B  2  170 ? 327.203 214.092 264.532 1.00 122.04 ? 169 GLY O N      1 
ATOM   6424   C  CA     . GLY B  2  170 ? 325.892 213.497 264.705 1.00 121.30 ? 169 GLY O CA     1 
ATOM   6425   C  C      . GLY B  2  170 ? 325.267 213.095 263.384 1.00 132.65 ? 169 GLY O C      1 
ATOM   6426   O  O      . GLY B  2  170 ? 324.583 212.072 263.295 1.00 165.91 ? 169 GLY O O      1 
ATOM   6427   H  H      . GLY B  2  170 ? 327.236 214.940 264.672 1.00 99.38  ? 169 GLY O H      1 
ATOM   6428   H  HA2    . GLY B  2  170 ? 325.966 212.707 265.263 1.00 99.18  ? 169 GLY O HA2    1 
ATOM   6429   H  HA3    . GLY B  2  170 ? 325.304 214.131 265.144 1.00 99.18  ? 169 GLY O HA3    1 
ATOM   6430   N  N      . LYS B  2  171 ? 325.508 213.885 262.336 1.00 127.93 ? 170 LYS O N      1 
ATOM   6431   C  CA     . LYS B  2  171 ? 324.883 213.607 261.049 1.00 129.58 ? 170 LYS O CA     1 
ATOM   6432   C  C      . LYS B  2  171 ? 325.430 212.331 260.424 1.00 144.82 ? 170 LYS O C      1 
ATOM   6433   O  O      . LYS B  2  171 ? 324.696 211.619 259.728 1.00 135.62 ? 170 LYS O O      1 
ATOM   6434   C  CB     . LYS B  2  171 ? 325.086 214.788 260.105 1.00 136.89 ? 170 LYS O CB     1 
ATOM   6435   C  CG     . LYS B  2  171 ? 324.006 214.917 259.068 1.00 146.77 ? 170 LYS O CG     1 
ATOM   6436   C  CD     . LYS B  2  171 ? 324.026 216.281 258.414 1.00 157.50 ? 170 LYS O CD     1 
ATOM   6437   C  CE     . LYS B  2  171 ? 322.810 216.460 257.533 1.00 180.56 ? 170 LYS O CE     1 
ATOM   6438   N  NZ     . LYS B  2  171 ? 322.712 215.369 256.526 1.00 204.75 ? 170 LYS O NZ     1 
ATOM   6439   H  H      . LYS B  2  171 ? 326.021 214.575 262.346 1.00 108.52 ? 170 LYS O H      1 
ATOM   6440   H  HA     . LYS B  2  171 ? 323.929 213.490 261.181 1.00 110.75 ? 170 LYS O HA     1 
ATOM   6441   H  HB2    . LYS B  2  171 ? 325.099 215.607 260.625 1.00 118.68 ? 170 LYS O HB2    1 
ATOM   6442   H  HB3    . LYS B  2  171 ? 325.932 214.677 259.642 1.00 118.68 ? 170 LYS O HB3    1 
ATOM   6443   H  HG2    . LYS B  2  171 ? 324.142 214.247 258.379 1.00 129.56 ? 170 LYS O HG2    1 
ATOM   6444   H  HG3    . LYS B  2  171 ? 323.141 214.795 259.490 1.00 129.56 ? 170 LYS O HG3    1 
ATOM   6445   H  HD2    . LYS B  2  171 ? 324.014 216.968 259.098 1.00 141.02 ? 170 LYS O HD2    1 
ATOM   6446   H  HD3    . LYS B  2  171 ? 324.820 216.364 257.863 1.00 141.02 ? 170 LYS O HD3    1 
ATOM   6447   H  HE2    . LYS B  2  171 ? 322.010 216.442 258.082 1.00 165.13 ? 170 LYS O HE2    1 
ATOM   6448   H  HE3    . LYS B  2  171 ? 322.876 217.305 257.062 1.00 165.13 ? 170 LYS O HE3    1 
ATOM   6449   H  HZ1    . LYS B  2  171 ? 321.992 215.490 256.017 1.00 189.12 ? 170 LYS O HZ1    1 
ATOM   6450   H  HZ2    . LYS B  2  171 ? 323.436 215.368 256.008 1.00 189.12 ? 170 LYS O HZ2    1 
ATOM   6451   H  HZ3    . LYS B  2  171 ? 322.648 214.582 256.936 1.00 189.12 ? 170 LYS O HZ3    1 
ATOM   6452   N  N      . THR B  2  172 ? 326.706 212.023 260.661 1.00 140.21 ? 171 THR O N      1 
ATOM   6453   C  CA     . THR B  2  172 ? 327.276 210.778 260.160 1.00 135.20 ? 171 THR O CA     1 
ATOM   6454   C  C      . THR B  2  172 ? 326.970 209.605 261.081 1.00 135.40 ? 171 THR O C      1 
ATOM   6455   O  O      . THR B  2  172 ? 326.901 208.463 260.615 1.00 131.23 ? 171 THR O O      1 
ATOM   6456   C  CB     . THR B  2  172 ? 328.786 210.927 259.979 1.00 126.69 ? 171 THR O CB     1 
ATOM   6457   O  OG1    . THR B  2  172 ? 329.383 211.349 261.213 1.00 123.01 ? 171 THR O OG1    1 
ATOM   6458   C  CG2    . THR B  2  172 ? 329.083 211.946 258.884 1.00 119.73 ? 171 THR O CG2    1 
ATOM   6459   H  H      . THR B  2  172 ? 327.256 212.514 261.104 1.00 131.31 ? 171 THR O H      1 
ATOM   6460   H  HA     . THR B  2  172 ? 326.890 210.584 259.292 1.00 125.45 ? 171 THR O HA     1 
ATOM   6461   H  HB     . THR B  2  172 ? 329.164 210.074 259.714 1.00 116.02 ? 171 THR O HB     1 
ATOM   6462   H  HG1    . THR B  2  172 ? 329.061 212.088 261.450 1.00 111.86 ? 171 THR O HG1    1 
ATOM   6463   H  HG21   . THR B  2  172 ? 330.042 212.039 258.771 1.00 109.59 ? 171 THR O HG21   1 
ATOM   6464   H  HG22   . THR B  2  172 ? 328.693 211.654 258.046 1.00 109.59 ? 171 THR O HG22   1 
ATOM   6465   H  HG23   . THR B  2  172 ? 328.708 212.808 259.123 1.00 109.59 ? 171 THR O HG23   1 
ATOM   6466   N  N      . PHE B  2  173 ? 326.789 209.855 262.380 1.00 107.58 ? 172 PHE O N      1 
ATOM   6467   C  CA     . PHE B  2  173 ? 326.324 208.791 263.260 1.00 116.28 ? 172 PHE O CA     1 
ATOM   6468   C  C      . PHE B  2  173 ? 324.927 208.341 262.865 1.00 121.08 ? 172 PHE O C      1 
ATOM   6469   O  O      . PHE B  2  173 ? 324.604 207.149 262.941 1.00 143.56 ? 172 PHE O O      1 
ATOM   6470   C  CB     . PHE B  2  173 ? 326.330 209.245 264.719 1.00 97.67  ? 172 PHE O CB     1 
ATOM   6471   C  CG     . PHE B  2  173 ? 325.983 208.145 265.683 1.00 100.63 ? 172 PHE O CG     1 
ATOM   6472   C  CD1    . PHE B  2  173 ? 324.664 207.903 266.043 1.00 97.78  ? 172 PHE O CD1    1 
ATOM   6473   C  CD2    . PHE B  2  173 ? 326.976 207.336 266.210 1.00 117.21 ? 172 PHE O CD2    1 
ATOM   6474   C  CE1    . PHE B  2  173 ? 324.344 206.880 266.922 1.00 100.83 ? 172 PHE O CE1    1 
ATOM   6475   C  CE2    . PHE B  2  173 ? 326.664 206.314 267.088 1.00 109.68 ? 172 PHE O CE2    1 
ATOM   6476   C  CZ     . PHE B  2  173 ? 325.347 206.085 267.445 1.00 106.79 ? 172 PHE O CZ     1 
ATOM   6477   H  H      . PHE B  2  173 ? 326.925 210.612 262.765 1.00 106.49 ? 172 PHE O H      1 
ATOM   6478   H  HA     . PHE B  2  173 ? 326.919 208.030 263.178 1.00 114.77 ? 172 PHE O HA     1 
ATOM   6479   H  HB2    . PHE B  2  173 ? 327.217 209.569 264.943 1.00 96.01  ? 172 PHE O HB2    1 
ATOM   6480   H  HB3    . PHE B  2  173 ? 325.680 209.956 264.831 1.00 96.01  ? 172 PHE O HB3    1 
ATOM   6481   H  HD1    . PHE B  2  173 ? 323.988 208.436 265.692 1.00 96.23  ? 172 PHE O HD1    1 
ATOM   6482   H  HD2    . PHE B  2  173 ? 327.863 207.485 265.974 1.00 113.80 ? 172 PHE O HD2    1 
ATOM   6483   H  HE1    . PHE B  2  173 ? 323.458 206.730 267.159 1.00 98.76  ? 172 PHE O HE1    1 
ATOM   6484   H  HE2    . PHE B  2  173 ? 327.340 205.780 267.439 1.00 105.74 ? 172 PHE O HE2    1 
ATOM   6485   H  HZ     . PHE B  2  173 ? 325.137 205.399 268.036 1.00 103.52 ? 172 PHE O HZ     1 
ATOM   6486   N  N      . LEU B  2  174 ? 324.082 209.282 262.441 1.00 130.15 ? 173 LEU O N      1 
ATOM   6487   C  CA     . LEU B  2  174 ? 322.719 208.948 262.041 1.00 124.79 ? 173 LEU O CA     1 
ATOM   6488   C  C      . LEU B  2  174 ? 322.682 208.319 260.656 1.00 120.84 ? 173 LEU O C      1 
ATOM   6489   O  O      . LEU B  2  174 ? 321.886 207.407 260.404 1.00 121.54 ? 173 LEU O O      1 
ATOM   6490   C  CB     . LEU B  2  174 ? 321.846 210.200 262.071 1.00 108.16 ? 173 LEU O CB     1 
ATOM   6491   C  CG     . LEU B  2  174 ? 321.379 210.691 263.439 1.00 99.51  ? 173 LEU O CG     1 
ATOM   6492   C  CD1    . LEU B  2  174 ? 320.856 212.108 263.300 1.00 102.63 ? 173 LEU O CD1    1 
ATOM   6493   C  CD2    . LEU B  2  174 ? 320.311 209.771 264.014 1.00 98.08  ? 173 LEU O CD2    1 
ATOM   6494   H  H      . LEU B  2  174 ? 324.275 210.117 262.375 1.00 112.67 ? 173 LEU O H      1 
ATOM   6495   H  HA     . LEU B  2  174 ? 322.351 208.310 262.672 1.00 108.14 ? 173 LEU O HA     1 
ATOM   6496   H  HB2    . LEU B  2  174 ? 322.345 210.925 261.663 1.00 92.66  ? 173 LEU O HB2    1 
ATOM   6497   H  HB3    . LEU B  2  174 ? 321.050 210.025 261.544 1.00 92.66  ? 173 LEU O HB3    1 
ATOM   6498   H  HG     . LEU B  2  174 ? 322.132 210.703 264.049 1.00 84.20  ? 173 LEU O HG     1 
ATOM   6499   H  HD11   . LEU B  2  174 ? 320.559 212.421 264.169 1.00 88.34  ? 173 LEU O HD11   1 
ATOM   6500   H  HD12   . LEU B  2  174 ? 321.570 212.676 262.970 1.00 88.34  ? 173 LEU O HD12   1 
ATOM   6501   H  HD13   . LEU B  2  174 ? 320.114 212.111 262.676 1.00 88.34  ? 173 LEU O HD13   1 
ATOM   6502   H  HD21   . LEU B  2  174 ? 320.036 210.110 264.881 1.00 82.87  ? 173 LEU O HD21   1 
ATOM   6503   H  HD22   . LEU B  2  174 ? 319.552 209.753 263.410 1.00 82.87  ? 173 LEU O HD22   1 
ATOM   6504   H  HD23   . LEU B  2  174 ? 320.680 208.880 264.109 1.00 82.87  ? 173 LEU O HD23   1 
ATOM   6505   N  N      . GLU B  2  175 ? 323.530 208.795 259.743 1.00 121.01 ? 174 GLU O N      1 
ATOM   6506   C  CA     . GLU B  2  175 ? 323.547 208.236 258.399 1.00 139.90 ? 174 GLU O CA     1 
ATOM   6507   C  C      . GLU B  2  175 ? 323.840 206.745 258.432 1.00 127.38 ? 174 GLU O C      1 
ATOM   6508   O  O      . GLU B  2  175 ? 323.403 206.003 257.545 1.00 128.40 ? 174 GLU O O      1 
ATOM   6509   C  CB     . GLU B  2  175 ? 324.584 208.963 257.548 1.00 168.34 ? 174 GLU O CB     1 
ATOM   6510   C  CG     . GLU B  2  175 ? 324.440 208.713 256.062 1.00 190.01 ? 174 GLU O CG     1 
ATOM   6511   C  CD     . GLU B  2  175 ? 325.242 209.692 255.231 1.00 182.90 ? 174 GLU O CD     1 
ATOM   6512   O  OE1    . GLU B  2  175 ? 326.193 210.295 255.778 1.00 179.16 ? 174 GLU O OE1    1 
ATOM   6513   O  OE2    . GLU B  2  175 ? 324.914 209.859 254.034 1.00 174.69 ? 174 GLU O OE2    1 
ATOM   6514   H  H      . GLU B  2  175 ? 324.095 209.429 259.877 1.00 110.14 ? 174 GLU O H      1 
ATOM   6515   H  HA     . GLU B  2  175 ? 322.677 208.364 257.990 1.00 129.05 ? 174 GLU O HA     1 
ATOM   6516   H  HB2    . GLU B  2  175 ? 324.498 209.918 257.698 1.00 157.34 ? 174 GLU O HB2    1 
ATOM   6517   H  HB3    . GLU B  2  175 ? 325.469 208.668 257.814 1.00 157.34 ? 174 GLU O HB3    1 
ATOM   6518   H  HG2    . GLU B  2  175 ? 324.754 207.818 255.860 1.00 179.31 ? 174 GLU O HG2    1 
ATOM   6519   H  HG3    . GLU B  2  175 ? 323.506 208.802 255.815 1.00 179.31 ? 174 GLU O HG3    1 
ATOM   6520   N  N      . LYS B  2  176 ? 324.567 206.293 259.451 1.00 142.16 ? 175 LYS O N      1 
ATOM   6521   C  CA     . LYS B  2  176 ? 324.908 204.889 259.626 1.00 150.97 ? 175 LYS O CA     1 
ATOM   6522   C  C      . LYS B  2  176 ? 323.852 204.141 260.437 1.00 131.77 ? 175 LYS O C      1 
ATOM   6523   O  O      . LYS B  2  176 ? 323.377 203.083 260.015 1.00 136.66 ? 175 LYS O O      1 
ATOM   6524   C  CB     . LYS B  2  176 ? 326.279 204.783 260.304 1.00 127.73 ? 175 LYS O CB     1 
ATOM   6525   C  CG     . LYS B  2  176 ? 326.730 203.360 260.604 1.00 133.99 ? 175 LYS O CG     1 
ATOM   6526   C  CD     . LYS B  2  176 ? 327.944 203.321 261.533 1.00 156.87 ? 175 LYS O CD     1 
ATOM   6527   C  CE     . LYS B  2  176 ? 328.235 201.890 261.993 1.00 170.52 ? 175 LYS O CE     1 
ATOM   6528   N  NZ     . LYS B  2  176 ? 329.475 201.747 262.815 1.00 185.63 ? 175 LYS O NZ     1 
ATOM   6529   H  H      . LYS B  2  176 ? 324.882 206.799 260.071 1.00 120.69 ? 175 LYS O H      1 
ATOM   6530   H  HA     . LYS B  2  176 ? 324.970 204.468 258.754 1.00 128.53 ? 175 LYS O HA     1 
ATOM   6531   H  HB2    . LYS B  2  176 ? 326.944 205.186 259.723 1.00 104.15 ? 175 LYS O HB2    1 
ATOM   6532   H  HB3    . LYS B  2  176 ? 326.247 205.265 261.145 1.00 104.15 ? 175 LYS O HB3    1 
ATOM   6533   H  HG2    . LYS B  2  176 ? 326.005 202.881 261.035 1.00 109.32 ? 175 LYS O HG2    1 
ATOM   6534   H  HG3    . LYS B  2  176 ? 326.973 202.922 259.773 1.00 109.32 ? 175 LYS O HG3    1 
ATOM   6535   H  HD2    . LYS B  2  176 ? 328.723 203.654 261.061 1.00 131.12 ? 175 LYS O HD2    1 
ATOM   6536   H  HD3    . LYS B  2  176 ? 327.767 203.864 262.318 1.00 131.12 ? 175 LYS O HD3    1 
ATOM   6537   H  HE2    . LYS B  2  176 ? 327.488 201.578 262.528 1.00 143.72 ? 175 LYS O HE2    1 
ATOM   6538   H  HE3    . LYS B  2  176 ? 328.334 201.327 261.209 1.00 143.72 ? 175 LYS O HE3    1 
ATOM   6539   H  HZ1    . LYS B  2  176 ? 329.587 200.896 263.050 1.00 157.69 ? 175 LYS O HZ1    1 
ATOM   6540   H  HZ2    . LYS B  2  176 ? 330.183 202.014 262.347 1.00 157.69 ? 175 LYS O HZ2    1 
ATOM   6541   H  HZ3    . LYS B  2  176 ? 329.411 202.244 263.551 1.00 157.69 ? 175 LYS O HZ3    1 
ATOM   6542   N  N      . ARG B  2  177 ? 323.470 204.685 261.594 1.00 125.58 ? 176 ARG O N      1 
ATOM   6543   C  CA     . ARG B  2  177 ? 322.646 203.982 262.571 1.00 135.35 ? 176 ARG O CA     1 
ATOM   6544   C  C      . ARG B  2  177 ? 321.149 204.199 262.373 1.00 119.90 ? 176 ARG O C      1 
ATOM   6545   O  O      . ARG B  2  177 ? 320.378 203.992 263.317 1.00 119.50 ? 176 ARG O O      1 
ATOM   6546   C  CB     . ARG B  2  177 ? 323.030 204.416 263.989 1.00 155.32 ? 176 ARG O CB     1 
ATOM   6547   C  CG     . ARG B  2  177 ? 324.451 204.072 264.401 1.00 178.50 ? 176 ARG O CG     1 
ATOM   6548   C  CD     . ARG B  2  177 ? 324.566 202.657 264.950 1.00 192.07 ? 176 ARG O CD     1 
ATOM   6549   N  NE     . ARG B  2  177 ? 323.898 202.511 266.244 1.00 190.17 ? 176 ARG O NE     1 
ATOM   6550   C  CZ     . ARG B  2  177 ? 322.667 202.035 266.419 1.00 184.59 ? 176 ARG O CZ     1 
ATOM   6551   N  NH1    . ARG B  2  177 ? 322.161 201.946 267.642 1.00 177.05 ? 176 ARG O NH1    1 
ATOM   6552   N  NH2    . ARG B  2  177 ? 321.936 201.643 265.383 1.00 187.34 ? 176 ARG O NH2    1 
ATOM   6553   H  H      . ARG B  2  177 ? 323.682 205.482 261.838 1.00 118.49 ? 176 ARG O H      1 
ATOM   6554   H  HA     . ARG B  2  177 ? 322.819 203.031 262.496 1.00 128.21 ? 176 ARG O HA     1 
ATOM   6555   H  HB2    . ARG B  2  177 ? 322.931 205.379 264.055 1.00 147.78 ? 176 ARG O HB2    1 
ATOM   6556   H  HB3    . ARG B  2  177 ? 322.430 203.984 264.617 1.00 147.78 ? 176 ARG O HB3    1 
ATOM   6557   H  HG2    . ARG B  2  177 ? 325.032 204.144 263.628 1.00 169.74 ? 176 ARG O HG2    1 
ATOM   6558   H  HG3    . ARG B  2  177 ? 324.739 204.688 265.093 1.00 169.74 ? 176 ARG O HG3    1 
ATOM   6559   H  HD2    . ARG B  2  177 ? 324.153 202.039 264.326 1.00 182.37 ? 176 ARG O HD2    1 
ATOM   6560   H  HD3    . ARG B  2  177 ? 325.503 202.436 265.067 1.00 182.37 ? 176 ARG O HD3    1 
ATOM   6561   H  HE     . ARG B  2  177 ? 324.334 202.752 266.945 1.00 180.50 ? 176 ARG O HE     1 
ATOM   6562   H  HH11   . ARG B  2  177 ? 322.627 202.198 268.319 1.00 167.86 ? 176 ARG O HH11   1 
ATOM   6563   H  HH12   . ARG B  2  177 ? 321.366 201.639 267.757 1.00 167.86 ? 176 ARG O HH12   1 
ATOM   6564   H  HH21   . ARG B  2  177 ? 322.256 201.696 264.586 1.00 178.76 ? 176 ARG O HH21   1 
ATOM   6565   H  HH22   . ARG B  2  177 ? 321.142 201.336 265.508 1.00 178.76 ? 176 ARG O HH22   1 
ATOM   6566   N  N      . TYR B  2  178 ? 320.714 204.609 261.185 1.00 143.84 ? 177 TYR O N      1 
ATOM   6567   C  CA     . TYR B  2  178 ? 319.298 204.814 260.911 1.00 143.22 ? 177 TYR O CA     1 
ATOM   6568   C  C      . TYR B  2  178 ? 318.820 203.810 259.874 1.00 147.09 ? 177 TYR O C      1 
ATOM   6569   O  O      . TYR B  2  178 ? 319.414 203.691 258.796 1.00 151.93 ? 177 TYR O O      1 
ATOM   6570   C  CB     . TYR B  2  178 ? 319.019 206.231 260.419 1.00 131.43 ? 177 TYR O CB     1 
ATOM   6571   C  CG     . TYR B  2  178 ? 317.608 206.373 259.910 1.00 125.45 ? 177 TYR O CG     1 
ATOM   6572   C  CD1    . TYR B  2  178 ? 316.528 206.187 260.761 1.00 126.23 ? 177 TYR O CD1    1 
ATOM   6573   C  CD2    . TYR B  2  178 ? 317.354 206.668 258.577 1.00 122.31 ? 177 TYR O CD2    1 
ATOM   6574   C  CE1    . TYR B  2  178 ? 315.233 206.302 260.304 1.00 124.86 ? 177 TYR O CE1    1 
ATOM   6575   C  CE2    . TYR B  2  178 ? 316.060 206.787 258.108 1.00 121.43 ? 177 TYR O CE2    1 
ATOM   6576   C  CZ     . TYR B  2  178 ? 315.003 206.603 258.976 1.00 121.39 ? 177 TYR O CZ     1 
ATOM   6577   O  OH     . TYR B  2  178 ? 313.713 206.719 258.514 1.00 121.01 ? 177 TYR O OH     1 
ATOM   6578   H  H      . TYR B  2  178 ? 321.226 204.776 260.515 1.00 120.32 ? 177 TYR O H      1 
ATOM   6579   H  HA     . TYR B  2  178 ? 318.792 204.671 261.726 1.00 120.78 ? 177 TYR O HA     1 
ATOM   6580   H  HB2    . TYR B  2  178 ? 319.142 206.855 261.152 1.00 109.98 ? 177 TYR O HB2    1 
ATOM   6581   H  HB3    . TYR B  2  178 ? 319.627 206.443 259.693 1.00 109.98 ? 177 TYR O HB3    1 
ATOM   6582   H  HD1    . TYR B  2  178 ? 316.680 205.985 261.656 1.00 106.24 ? 177 TYR O HD1    1 
ATOM   6583   H  HD2    . TYR B  2  178 ? 318.066 206.792 257.992 1.00 102.56 ? 177 TYR O HD2    1 
ATOM   6584   H  HE1    . TYR B  2  178 ? 314.519 206.179 260.886 1.00 105.85 ? 177 TYR O HE1    1 
ATOM   6585   H  HE2    . TYR B  2  178 ? 315.903 206.989 257.214 1.00 102.66 ? 177 TYR O HE2    1 
ATOM   6586   H  HH     . TYR B  2  178 ? 313.717 206.903 257.694 1.00 103.56 ? 177 TYR O HH     1 
ATOM   6587   N  N      . ASN B  2  179 ? 317.742 203.102 260.198 1.00 162.90 ? 178 ASN O N      1 
ATOM   6588   C  CA     . ASN B  2  179 ? 317.155 202.114 259.302 1.00 163.30 ? 178 ASN O CA     1 
ATOM   6589   C  C      . ASN B  2  179 ? 315.670 202.399 259.187 1.00 147.03 ? 178 ASN O C      1 
ATOM   6590   O  O      . ASN B  2  179 ? 314.954 202.376 260.192 1.00 140.76 ? 178 ASN O O      1 
ATOM   6591   C  CB     . ASN B  2  179 ? 317.387 200.693 259.814 1.00 175.30 ? 178 ASN O CB     1 
ATOM   6592   C  CG     . ASN B  2  179 ? 318.855 200.362 259.952 1.00 189.97 ? 178 ASN O CG     1 
ATOM   6593   O  OD1    . ASN B  2  179 ? 319.367 200.197 261.058 1.00 201.69 ? 178 ASN O OD1    1 
ATOM   6594   N  ND2    . ASN B  2  179 ? 319.545 200.263 258.822 1.00 196.08 ? 178 ASN O ND2    1 
ATOM   6595   H  H      . ASN B  2  179 ? 317.325 203.179 260.946 1.00 137.37 ? 178 ASN O H      1 
ATOM   6596   H  HA     . ASN B  2  179 ? 317.555 202.195 258.422 1.00 137.88 ? 178 ASN O HA     1 
ATOM   6597   H  HB2    . ASN B  2  179 ? 316.974 200.598 260.686 1.00 148.90 ? 178 ASN O HB2    1 
ATOM   6598   H  HB3    . ASN B  2  179 ? 316.994 200.063 259.190 1.00 148.90 ? 178 ASN O HB3    1 
ATOM   6599   H  HD21   . ASN B  2  179 ? 320.384 200.076 258.846 1.00 168.31 ? 178 ASN O HD21   1 
ATOM   6600   H  HD22   . ASN B  2  179 ? 319.153 200.385 258.067 1.00 168.31 ? 178 ASN O HD22   1 
ATOM   6601   N  N      . GLU B  2  180 ? 315.216 202.669 257.967 1.00 154.40 ? 179 GLU O N      1 
ATOM   6602   C  CA     . GLU B  2  180 ? 313.809 202.955 257.746 1.00 189.43 ? 179 GLU O CA     1 
ATOM   6603   C  C      . GLU B  2  180 ? 312.954 201.856 258.356 1.00 196.69 ? 179 GLU O C      1 
ATOM   6604   O  O      . GLU B  2  180 ? 313.372 200.699 258.459 1.00 198.49 ? 179 GLU O O      1 
ATOM   6605   C  CB     . GLU B  2  180 ? 313.527 203.095 256.250 1.00 206.45 ? 179 GLU O CB     1 
ATOM   6606   C  CG     . GLU B  2  180 ? 314.277 204.256 255.615 1.00 207.62 ? 179 GLU O CG     1 
ATOM   6607   C  CD     . GLU B  2  180 ? 313.924 204.465 254.153 1.00 194.06 ? 179 GLU O CD     1 
ATOM   6608   O  OE1    . GLU B  2  180 ? 314.774 204.159 253.287 1.00 196.83 ? 179 GLU O OE1    1 
ATOM   6609   O  OE2    . GLU B  2  180 ? 312.800 204.936 253.872 1.00 178.05 ? 179 GLU O OE2    1 
ATOM   6610   H  H      . GLU B  2  180 ? 315.701 202.692 257.257 1.00 133.76 ? 179 GLU O H      1 
ATOM   6611   H  HA     . GLU B  2  180 ? 313.581 203.793 258.179 1.00 169.85 ? 179 GLU O HA     1 
ATOM   6612   H  HB2    . GLU B  2  180 ? 313.800 202.280 255.800 1.00 187.47 ? 179 GLU O HB2    1 
ATOM   6613   H  HB3    . GLU B  2  180 ? 312.578 203.244 256.120 1.00 187.47 ? 179 GLU O HB3    1 
ATOM   6614   H  HG2    . GLU B  2  180 ? 314.059 205.071 256.094 1.00 188.87 ? 179 GLU O HG2    1 
ATOM   6615   H  HG3    . GLU B  2  180 ? 315.230 204.084 255.671 1.00 188.87 ? 179 GLU O HG3    1 
ATOM   6616   N  N      . ASP B  2  181 ? 311.752 202.236 258.785 1.00 186.79 ? 180 ASP O N      1 
ATOM   6617   C  CA     . ASP B  2  181 ? 310.824 201.322 259.441 1.00 182.95 ? 180 ASP O CA     1 
ATOM   6618   C  C      . ASP B  2  181 ? 311.290 200.973 260.847 1.00 172.60 ? 180 ASP O C      1 
ATOM   6619   O  O      . ASP B  2  181 ? 310.953 199.916 261.383 1.00 145.60 ? 180 ASP O O      1 
ATOM   6620   C  CB     . ASP B  2  181 ? 310.618 200.060 258.604 1.00 202.75 ? 180 ASP O CB     1 
ATOM   6621   C  CG     . ASP B  2  181 ? 310.411 200.377 257.139 1.00 212.02 ? 180 ASP O CG     1 
ATOM   6622   O  OD1    . ASP B  2  181 ? 309.803 201.431 256.850 1.00 209.89 ? 180 ASP O OD1    1 
ATOM   6623   O  OD2    . ASP B  2  181 ? 310.868 199.590 256.284 1.00 221.63 ? 180 ASP O OD2    1 
ATOM   6624   H  H      . ASP B  2  181 ? 311.446 203.036 258.705 1.00 169.23 ? 180 ASP O H      1 
ATOM   6625   H  HA     . ASP B  2  181 ? 309.964 201.763 259.521 1.00 165.35 ? 180 ASP O HA     1 
ATOM   6626   H  HB2    . ASP B  2  181 ? 311.402 199.494 258.683 1.00 184.87 ? 180 ASP O HB2    1 
ATOM   6627   H  HB3    . ASP B  2  181 ? 309.833 199.590 258.925 1.00 184.87 ? 180 ASP O HB3    1 
ATOM   6628   N  N      . LEU B  2  182 ? 312.084 201.860 261.434 1.00 164.30 ? 181 LEU O N      1 
ATOM   6629   C  CA     . LEU B  2  182 ? 312.354 201.819 262.860 1.00 163.68 ? 181 LEU O CA     1 
ATOM   6630   C  C      . LEU B  2  182 ? 311.056 202.020 263.635 1.00 138.96 ? 181 LEU O C      1 
ATOM   6631   O  O      . LEU B  2  182 ? 310.148 202.731 263.198 1.00 123.08 ? 181 LEU O O      1 
ATOM   6632   C  CB     . LEU B  2  182 ? 313.362 202.912 263.217 1.00 170.22 ? 181 LEU O CB     1 
ATOM   6633   C  CG     . LEU B  2  182 ? 313.993 202.931 264.604 1.00 163.88 ? 181 LEU O CG     1 
ATOM   6634   C  CD1    . LEU B  2  182 ? 314.822 201.684 264.823 1.00 161.75 ? 181 LEU O CD1    1 
ATOM   6635   C  CD2    . LEU B  2  182 ? 314.851 204.177 264.734 1.00 163.52 ? 181 LEU O CD2    1 
ATOM   6636   H  H      . LEU B  2  182 ? 312.482 202.501 261.022 1.00 149.79 ? 181 LEU O H      1 
ATOM   6637   H  HA     . LEU B  2  182 ? 312.730 200.957 263.099 1.00 148.61 ? 181 LEU O HA     1 
ATOM   6638   H  HB2    . LEU B  2  182 ? 314.092 202.854 262.581 1.00 154.97 ? 181 LEU O HB2    1 
ATOM   6639   H  HB3    . LEU B  2  182 ? 312.917 203.767 263.104 1.00 154.97 ? 181 LEU O HB3    1 
ATOM   6640   H  HG     . LEU B  2  182 ? 313.296 202.963 265.278 1.00 147.88 ? 181 LEU O HG     1 
ATOM   6641   H  HD11   . LEU B  2  182 ? 315.214 201.717 265.710 1.00 144.56 ? 181 LEU O HD11   1 
ATOM   6642   H  HD12   . LEU B  2  182 ? 314.249 200.906 264.743 1.00 144.56 ? 181 LEU O HD12   1 
ATOM   6643   H  HD13   . LEU B  2  182 ? 315.523 201.649 264.153 1.00 144.56 ? 181 LEU O HD13   1 
ATOM   6644   H  HD21   . LEU B  2  182 ? 315.254 204.191 265.617 1.00 147.56 ? 181 LEU O HD21   1 
ATOM   6645   H  HD22   . LEU B  2  182 ? 315.543 204.156 264.055 1.00 147.56 ? 181 LEU O HD22   1 
ATOM   6646   H  HD23   . LEU B  2  182 ? 314.291 204.960 264.613 1.00 147.56 ? 181 LEU O HD23   1 
ATOM   6647   N  N      . GLU B  2  183 ? 310.962 201.379 264.792 1.00 141.95 ? 182 GLU O N      1 
ATOM   6648   C  CA     . GLU B  2  183 ? 309.797 201.584 265.634 1.00 156.79 ? 182 GLU O CA     1 
ATOM   6649   C  C      . GLU B  2  183 ? 309.880 202.953 266.305 1.00 139.42 ? 182 GLU O C      1 
ATOM   6650   O  O      . GLU B  2  183 ? 310.945 203.572 266.378 1.00 142.24 ? 182 GLU O O      1 
ATOM   6651   C  CB     . GLU B  2  183 ? 309.695 200.477 266.686 1.00 185.26 ? 182 GLU O CB     1 
ATOM   6652   C  CG     . GLU B  2  183 ? 308.360 200.420 267.405 1.00 199.51 ? 182 GLU O CG     1 
ATOM   6653   C  CD     . GLU B  2  183 ? 307.195 200.259 266.452 1.00 188.98 ? 182 GLU O CD     1 
ATOM   6654   O  OE1    . GLU B  2  183 ? 307.054 199.171 265.854 1.00 180.34 ? 182 GLU O OE1    1 
ATOM   6655   O  OE2    . GLU B  2  183 ? 306.430 201.231 266.291 1.00 185.34 ? 182 GLU O OE2    1 
ATOM   6656   H  H      . GLU B  2  183 ? 311.546 200.831 265.106 1.00 129.60 ? 182 GLU O H      1 
ATOM   6657   H  HA     . GLU B  2  183 ? 308.997 201.560 265.087 1.00 145.00 ? 182 GLU O HA     1 
ATOM   6658   H  HB2    . GLU B  2  183 ? 309.832 199.621 266.250 1.00 172.68 ? 182 GLU O HB2    1 
ATOM   6659   H  HB3    . GLU B  2  183 ? 310.384 200.618 267.354 1.00 172.68 ? 182 GLU O HB3    1 
ATOM   6660   H  HG2    . GLU B  2  183 ? 308.359 199.662 268.012 1.00 187.48 ? 182 GLU O HG2    1 
ATOM   6661   H  HG3    . GLU B  2  183 ? 308.232 201.243 267.901 1.00 187.48 ? 182 GLU O HG3    1 
ATOM   6662   N  N      . LEU B  2  184 ? 308.735 203.433 266.795 1.00 109.35 ? 183 LEU O N      1 
ATOM   6663   C  CA     . LEU B  2  184 ? 308.731 204.722 267.478 1.00 106.85 ? 183 LEU O CA     1 
ATOM   6664   C  C      . LEU B  2  184 ? 309.466 204.632 268.811 1.00 99.15  ? 183 LEU O C      1 
ATOM   6665   O  O      . LEU B  2  184 ? 310.352 205.445 269.098 1.00 96.30  ? 183 LEU O O      1 
ATOM   6666   C  CB     . LEU B  2  184 ? 307.300 205.225 267.682 1.00 112.31 ? 183 LEU O CB     1 
ATOM   6667   C  CG     . LEU B  2  184 ? 307.192 206.609 268.347 1.00 109.54 ? 183 LEU O CG     1 
ATOM   6668   C  CD1    . LEU B  2  184 ? 307.984 207.667 267.590 1.00 98.16  ? 183 LEU O CD1    1 
ATOM   6669   C  CD2    . LEU B  2  184 ? 305.743 207.057 268.476 1.00 119.88 ? 183 LEU O CD2    1 
ATOM   6670   H  H      . LEU B  2  184 ? 307.970 203.043 266.747 1.00 99.72  ? 183 LEU O H      1 
ATOM   6671   H  HA     . LEU B  2  184 ? 309.197 205.370 266.926 1.00 97.64  ? 183 LEU O HA     1 
ATOM   6672   H  HB2    . LEU B  2  184 ? 306.865 205.280 266.817 1.00 104.09 ? 183 LEU O HB2    1 
ATOM   6673   H  HB3    . LEU B  2  184 ? 306.827 204.592 268.245 1.00 104.09 ? 183 LEU O HB3    1 
ATOM   6674   H  HG     . LEU B  2  184 ? 307.562 206.551 269.242 1.00 101.82 ? 183 LEU O HG     1 
ATOM   6675   H  HD11   . LEU B  2  184 ? 307.887 208.519 268.043 1.00 90.70  ? 183 LEU O HD11   1 
ATOM   6676   H  HD12   . LEU B  2  184 ? 308.918 207.408 267.569 1.00 90.70  ? 183 LEU O HD12   1 
ATOM   6677   H  HD13   . LEU B  2  184 ? 307.639 207.732 266.685 1.00 90.70  ? 183 LEU O HD13   1 
ATOM   6678   H  HD21   . LEU B  2  184 ? 305.720 207.930 268.898 1.00 113.14 ? 183 LEU O HD21   1 
ATOM   6679   H  HD22   . LEU B  2  184 ? 305.349 207.106 267.591 1.00 113.14 ? 183 LEU O HD22   1 
ATOM   6680   H  HD23   . LEU B  2  184 ? 305.261 206.414 269.019 1.00 113.14 ? 183 LEU O HD23   1 
ATOM   6681   N  N      . GLU B  2  185 ? 309.107 203.653 269.645 1.00 127.63 ? 184 GLU O N      1 
ATOM   6682   C  CA     . GLU B  2  185 ? 309.870 203.411 270.865 1.00 129.38 ? 184 GLU O CA     1 
ATOM   6683   C  C      . GLU B  2  185 ? 311.360 203.339 270.561 1.00 131.34 ? 184 GLU O C      1 
ATOM   6684   O  O      . GLU B  2  185 ? 312.166 204.062 271.157 1.00 128.43 ? 184 GLU O O      1 
ATOM   6685   C  CB     . GLU B  2  185 ? 309.413 202.114 271.535 1.00 160.13 ? 184 GLU O CB     1 
ATOM   6686   C  CG     . GLU B  2  185 ? 307.985 202.120 272.051 1.00 183.17 ? 184 GLU O CG     1 
ATOM   6687   C  CD     . GLU B  2  185 ? 307.600 200.799 272.692 1.00 201.33 ? 184 GLU O CD     1 
ATOM   6688   O  OE1    . GLU B  2  185 ? 306.822 200.039 272.074 1.00 215.98 ? 184 GLU O OE1    1 
ATOM   6689   O  OE2    . GLU B  2  185 ? 308.086 200.518 273.809 1.00 203.10 ? 184 GLU O OE2    1 
ATOM   6690   H  H      . GLU B  2  185 ? 308.438 203.125 269.528 1.00 108.72 ? 184 GLU O H      1 
ATOM   6691   H  HA     . GLU B  2  185 ? 309.721 204.142 271.485 1.00 109.54 ? 184 GLU O HA     1 
ATOM   6692   H  HB2    . GLU B  2  185 ? 309.487 201.392 270.892 1.00 139.72 ? 184 GLU O HB2    1 
ATOM   6693   H  HB3    . GLU B  2  185 ? 309.995 201.936 272.291 1.00 139.72 ? 184 GLU O HB3    1 
ATOM   6694   H  HG2    . GLU B  2  185 ? 307.891 202.818 272.718 1.00 163.42 ? 184 GLU O HG2    1 
ATOM   6695   H  HG3    . GLU B  2  185 ? 307.380 202.283 271.310 1.00 163.42 ? 184 GLU O HG3    1 
ATOM   6696   N  N      . ASP B  2  186 ? 311.742 202.472 269.619 1.00 150.85 ? 185 ASP O N      1 
ATOM   6697   C  CA     . ASP B  2  186 ? 313.153 202.236 269.339 1.00 160.29 ? 185 ASP O CA     1 
ATOM   6698   C  C      . ASP B  2  186 ? 313.852 203.470 268.790 1.00 148.13 ? 185 ASP O C      1 
ATOM   6699   O  O      . ASP B  2  186 ? 315.073 203.585 268.931 1.00 148.58 ? 185 ASP O O      1 
ATOM   6700   C  CB     . ASP B  2  186 ? 313.309 201.070 268.360 1.00 187.48 ? 185 ASP O CB     1 
ATOM   6701   C  CG     . ASP B  2  186 ? 313.140 199.715 269.032 1.00 219.85 ? 185 ASP O CG     1 
ATOM   6702   O  OD1    . ASP B  2  186 ? 312.412 199.639 270.044 1.00 224.35 ? 185 ASP O OD1    1 
ATOM   6703   O  OD2    . ASP B  2  186 ? 313.743 198.730 268.553 1.00 243.65 ? 185 ASP O OD2    1 
ATOM   6704   H  H      . ASP B  2  186 ? 311.203 202.011 269.132 1.00 134.38 ? 185 ASP O H      1 
ATOM   6705   H  HA     . ASP B  2  186 ? 313.597 201.989 270.165 1.00 142.94 ? 185 ASP O HA     1 
ATOM   6706   H  HB2    . ASP B  2  186 ? 312.635 201.148 267.666 1.00 169.75 ? 185 ASP O HB2    1 
ATOM   6707   H  HB3    . ASP B  2  186 ? 314.195 201.103 267.967 1.00 169.75 ? 185 ASP O HB3    1 
ATOM   6708   N  N      . ALA B  2  187 ? 313.116 204.390 268.163 1.00 118.12 ? 186 ALA O N      1 
ATOM   6709   C  CA     . ALA B  2  187 ? 313.722 205.652 267.756 1.00 110.85 ? 186 ALA O CA     1 
ATOM   6710   C  C      . ALA B  2  187 ? 314.182 206.447 268.967 1.00 110.75 ? 186 ALA O C      1 
ATOM   6711   O  O      . ALA B  2  187 ? 315.246 207.076 268.938 1.00 111.72 ? 186 ALA O O      1 
ATOM   6712   C  CB     . ALA B  2  187 ? 312.734 206.466 266.923 1.00 103.62 ? 186 ALA O CB     1 
ATOM   6713   H  H      . ALA B  2  187 ? 312.283 204.308 267.967 1.00 104.00 ? 186 ALA O H      1 
ATOM   6714   H  HA     . ALA B  2  187 ? 314.499 205.467 267.205 1.00 97.09  ? 186 ALA O HA     1 
ATOM   6715   H  HB1    . ALA B  2  187 ? 313.154 207.301 266.662 1.00 91.07  ? 186 ALA O HB1    1 
ATOM   6716   H  HB2    . ALA B  2  187 ? 312.491 205.957 266.135 1.00 91.07  ? 186 ALA O HB2    1 
ATOM   6717   H  HB3    . ALA B  2  187 ? 311.944 206.646 267.458 1.00 91.07  ? 186 ALA O HB3    1 
ATOM   6718   N  N      . ILE B  2  188 ? 313.393 206.429 270.044 1.00 85.59  ? 187 ILE O N      1 
ATOM   6719   C  CA     . ILE B  2  188 ? 313.757 207.172 271.250 1.00 84.73  ? 187 ILE O CA     1 
ATOM   6720   C  C      . ILE B  2  188 ? 315.106 206.694 271.772 1.00 86.69  ? 187 ILE O C      1 
ATOM   6721   O  O      . ILE B  2  188 ? 315.962 207.502 272.156 1.00 88.58  ? 187 ILE O O      1 
ATOM   6722   C  CB     . ILE B  2  188 ? 312.650 207.041 272.313 1.00 82.50  ? 187 ILE O CB     1 
ATOM   6723   C  CG1    . ILE B  2  188 ? 311.321 207.563 271.757 1.00 80.98  ? 187 ILE O CG1    1 
ATOM   6724   C  CG2    . ILE B  2  188 ? 313.020 207.821 273.572 1.00 83.30  ? 187 ILE O CG2    1 
ATOM   6725   C  CD1    . ILE B  2  188 ? 310.112 207.204 272.591 1.00 93.45  ? 187 ILE O CD1    1 
ATOM   6726   H  H      . ILE B  2  188 ? 312.650 206.000 270.101 1.00 84.82  ? 187 ILE O H      1 
ATOM   6727   H  HA     . ILE B  2  188 ? 313.842 208.111 271.025 1.00 83.74  ? 187 ILE O HA     1 
ATOM   6728   H  HB     . ILE B  2  188 ? 312.547 206.105 272.544 1.00 81.77  ? 187 ILE O HB     1 
ATOM   6729   H  HG12   . ILE B  2  188 ? 311.365 208.531 271.704 1.00 81.44  ? 187 ILE O HG12   1 
ATOM   6730   H  HG13   . ILE B  2  188 ? 311.188 207.193 270.871 1.00 81.44  ? 187 ILE O HG13   1 
ATOM   6731   H  HG21   . ILE B  2  188 ? 312.308 207.723 274.224 1.00 82.33  ? 187 ILE O HG21   1 
ATOM   6732   H  HG22   . ILE B  2  188 ? 313.849 207.467 273.930 1.00 82.33  ? 187 ILE O HG22   1 
ATOM   6733   H  HG23   . ILE B  2  188 ? 313.132 208.757 273.341 1.00 82.33  ? 187 ILE O HG23   1 
ATOM   6734   H  HD11   . ILE B  2  188 ? 309.319 207.570 272.170 1.00 94.18  ? 187 ILE O HD11   1 
ATOM   6735   H  HD12   . ILE B  2  188 ? 310.043 206.238 272.645 1.00 94.18  ? 187 ILE O HD12   1 
ATOM   6736   H  HD13   . ILE B  2  188 ? 310.220 207.578 273.479 1.00 94.18  ? 187 ILE O HD13   1 
ATOM   6737   N  N      . HIS B  2  189 ? 315.322 205.375 271.788 1.00 143.94 ? 188 HIS O N      1 
ATOM   6738   C  CA     . HIS B  2  189 ? 316.639 204.854 272.140 1.00 146.84 ? 188 HIS O CA     1 
ATOM   6739   C  C      . HIS B  2  189 ? 317.700 205.371 271.179 1.00 145.57 ? 188 HIS O C      1 
ATOM   6740   O  O      . HIS B  2  189 ? 318.827 205.666 271.590 1.00 147.39 ? 188 HIS O O      1 
ATOM   6741   C  CB     . HIS B  2  189 ? 316.631 203.324 272.143 1.00 164.14 ? 188 HIS O CB     1 
ATOM   6742   C  CG     . HIS B  2  189 ? 315.721 202.721 273.168 1.00 187.95 ? 188 HIS O CG     1 
ATOM   6743   N  ND1    . HIS B  2  189 ? 315.927 202.859 274.524 1.00 200.56 ? 188 HIS O ND1    1 
ATOM   6744   C  CD2    . HIS B  2  189 ? 314.610 201.957 273.033 1.00 195.52 ? 188 HIS O CD2    1 
ATOM   6745   C  CE1    . HIS B  2  189 ? 314.976 202.216 275.180 1.00 204.12 ? 188 HIS O CE1    1 
ATOM   6746   N  NE2    . HIS B  2  189 ? 314.165 201.659 274.298 1.00 198.21 ? 188 HIS O NE2    1 
ATOM   6747   H  H      . HIS B  2  189 ? 314.734 204.775 271.602 1.00 120.35 ? 188 HIS O H      1 
ATOM   6748   H  HA     . HIS B  2  189 ? 316.869 205.155 273.033 1.00 122.09 ? 188 HIS O HA     1 
ATOM   6749   H  HB2    . HIS B  2  189 ? 316.343 203.012 271.271 1.00 138.64 ? 188 HIS O HB2    1 
ATOM   6750   H  HB3    . HIS B  2  189 ? 317.530 203.009 272.324 1.00 138.64 ? 188 HIS O HB3    1 
ATOM   6751   H  HD2    . HIS B  2  189 ? 314.219 201.689 272.233 1.00 170.29 ? 188 HIS O HD2    1 
ATOM   6752   H  HE1    . HIS B  2  189 ? 314.893 202.164 276.105 1.00 178.11 ? 188 HIS O HE1    1 
ATOM   6753   H  HE2    . HIS B  2  189 ? 313.470 201.188 274.486 1.00 172.70 ? 188 HIS O HE2    1 
ATOM   6754   N  N      . THR B  2  190 ? 317.356 205.497 269.893 1.00 106.05 ? 189 THR O N      1 
ATOM   6755   C  CA     . THR B  2  190 ? 318.328 205.986 268.919 1.00 105.90 ? 189 THR O CA     1 
ATOM   6756   C  C      . THR B  2  190 ? 318.566 207.474 269.073 1.00 89.36  ? 189 THR O C      1 
ATOM   6757   O  O      . THR B  2  190 ? 319.669 207.956 268.793 1.00 91.32  ? 189 THR O O      1 
ATOM   6758   C  CB     . THR B  2  190 ? 317.869 205.710 267.491 1.00 115.68 ? 189 THR O CB     1 
ATOM   6759   O  OG1    . THR B  2  190 ? 317.391 204.365 267.385 1.00 131.19 ? 189 THR O OG1    1 
ATOM   6760   C  CG2    . THR B  2  190 ? 319.030 205.938 266.520 1.00 86.80  ? 189 THR O CG2    1 
ATOM   6761   H  H      . THR B  2  190 ? 316.582 205.311 269.567 1.00 104.73 ? 189 THR O H      1 
ATOM   6762   H  HA     . THR B  2  190 ? 319.173 205.529 269.058 1.00 104.49 ? 189 THR O HA     1 
ATOM   6763   H  HB     . THR B  2  190 ? 317.154 206.324 267.260 1.00 114.83 ? 189 THR O HB     1 
ATOM   6764   H  HG1    . THR B  2  190 ? 316.744 204.247 267.908 1.00 130.01 ? 189 THR O HG1    1 
ATOM   6765   H  HG21   . THR B  2  190 ? 318.741 205.763 265.610 1.00 85.60  ? 189 THR O HG21   1 
ATOM   6766   H  HG22   . THR B  2  190 ? 319.339 206.855 266.582 1.00 85.60  ? 189 THR O HG22   1 
ATOM   6767   H  HG23   . THR B  2  190 ? 319.765 205.343 266.736 1.00 85.60  ? 189 THR O HG23   1 
ATOM   6768   N  N      . ALA B  2  191 ? 317.547 208.219 269.486 1.00 145.58 ? 190 ALA O N      1 
ATOM   6769   C  CA     . ALA B  2  191 ? 317.695 209.655 269.646 1.00 149.94 ? 190 ALA O CA     1 
ATOM   6770   C  C      . ALA B  2  191 ? 318.661 209.941 270.782 1.00 137.06 ? 190 ALA O C      1 
ATOM   6771   O  O      . ALA B  2  191 ? 319.767 210.447 270.560 1.00 142.87 ? 190 ALA O O      1 
ATOM   6772   C  CB     . ALA B  2  191 ? 316.337 210.305 269.908 1.00 173.30 ? 190 ALA O CB     1 
ATOM   6773   H  H      . ALA B  2  191 ? 316.765 207.917 269.679 1.00 120.65 ? 190 ALA O H      1 
ATOM   6774   H  HA     . ALA B  2  191 ? 318.061 210.033 268.831 1.00 125.55 ? 190 ALA O HA     1 
ATOM   6775   H  HB1    . ALA B  2  191 ? 316.460 211.262 270.011 1.00 149.96 ? 190 ALA O HB1    1 
ATOM   6776   H  HB2    . ALA B  2  191 ? 315.750 210.125 269.157 1.00 149.96 ? 190 ALA O HB2    1 
ATOM   6777   H  HB3    . ALA B  2  191 ? 315.959 209.930 270.720 1.00 149.96 ? 190 ALA O HB3    1 
ATOM   6778   N  N      . ILE B  2  192 ? 318.259 209.590 272.005 1.00 89.83  ? 191 ILE O N      1 
ATOM   6779   C  CA     . ILE B  2  192 ? 319.104 209.842 273.167 1.00 99.41  ? 191 ILE O CA     1 
ATOM   6780   C  C      . ILE B  2  192 ? 320.500 209.283 272.934 1.00 118.49 ? 191 ILE O C      1 
ATOM   6781   O  O      . ILE B  2  192 ? 321.490 209.819 273.448 1.00 145.42 ? 191 ILE O O      1 
ATOM   6782   C  CB     . ILE B  2  192 ? 318.463 209.245 274.436 1.00 98.35  ? 191 ILE O CB     1 
ATOM   6783   C  CG1    . ILE B  2  192 ? 317.035 209.769 274.632 1.00 90.82  ? 191 ILE O CG1    1 
ATOM   6784   C  CG2    . ILE B  2  192 ? 319.308 209.588 275.654 1.00 109.92 ? 191 ILE O CG2    1 
ATOM   6785   C  CD1    . ILE B  2  192 ? 316.267 209.036 275.711 1.00 93.64  ? 191 ILE O CD1    1 
ATOM   6786   H  H      . ILE B  2  192 ? 317.509 209.209 272.184 1.00 86.53  ? 191 ILE O H      1 
ATOM   6787   H  HA     . ILE B  2  192 ? 319.184 210.800 273.295 1.00 95.37  ? 191 ILE O HA     1 
ATOM   6788   H  HB     . ILE B  2  192 ? 318.430 208.280 274.342 1.00 94.02  ? 191 ILE O HB     1 
ATOM   6789   H  HG12   . ILE B  2  192 ? 317.076 210.706 274.880 1.00 87.55  ? 191 ILE O HG12   1 
ATOM   6790   H  HG13   . ILE B  2  192 ? 316.547 209.669 273.800 1.00 87.55  ? 191 ILE O HG13   1 
ATOM   6791   H  HG21   . ILE B  2  192 ? 318.894 209.206 276.443 1.00 104.86 ? 191 ILE O HG21   1 
ATOM   6792   H  HG22   . ILE B  2  192 ? 320.197 209.218 275.535 1.00 104.86 ? 191 ILE O HG22   1 
ATOM   6793   H  HG23   . ILE B  2  192 ? 319.360 210.553 275.740 1.00 104.86 ? 191 ILE O HG23   1 
ATOM   6794   H  HD11   . ILE B  2  192 ? 315.378 209.418 275.780 1.00 90.14  ? 191 ILE O HD11   1 
ATOM   6795   H  HD12   . ILE B  2  192 ? 316.207 208.098 275.473 1.00 90.14  ? 191 ILE O HD12   1 
ATOM   6796   H  HD13   . ILE B  2  192 ? 316.736 209.135 276.555 1.00 90.14  ? 191 ILE O HD13   1 
ATOM   6797   N  N      . LEU B  2  193 ? 320.605 208.202 272.159 1.00 123.99 ? 192 LEU O N      1 
ATOM   6798   C  CA     . LEU B  2  193 ? 321.906 207.606 271.881 1.00 126.86 ? 192 LEU O CA     1 
ATOM   6799   C  C      . LEU B  2  193 ? 322.777 208.551 271.064 1.00 135.95 ? 192 LEU O C      1 
ATOM   6800   O  O      . LEU B  2  193 ? 323.906 208.868 271.457 1.00 156.96 ? 192 LEU O O      1 
ATOM   6801   C  CB     . LEU B  2  193 ? 321.720 206.274 271.151 1.00 122.36 ? 192 LEU O CB     1 
ATOM   6802   C  CG     . LEU B  2  193 ? 322.975 205.475 270.801 1.00 128.19 ? 192 LEU O CG     1 
ATOM   6803   C  CD1    . LEU B  2  193 ? 323.753 205.153 272.064 1.00 142.37 ? 192 LEU O CD1    1 
ATOM   6804   C  CD2    . LEU B  2  193 ? 322.617 204.197 270.048 1.00 125.53 ? 192 LEU O CD2    1 
ATOM   6805   H  H      . LEU B  2  193 ? 319.942 207.800 271.787 1.00 103.46 ? 192 LEU O H      1 
ATOM   6806   H  HA     . LEU B  2  193 ? 322.360 207.429 272.720 1.00 105.30 ? 192 LEU O HA     1 
ATOM   6807   H  HB2    . LEU B  2  193 ? 321.167 205.703 271.706 1.00 100.47 ? 192 LEU O HB2    1 
ATOM   6808   H  HB3    . LEU B  2  193 ? 321.256 206.452 270.318 1.00 100.47 ? 192 LEU O HB3    1 
ATOM   6809   H  HG     . LEU B  2  193 ? 323.543 206.013 270.227 1.00 105.20 ? 192 LEU O HG     1 
ATOM   6810   H  HD11   . LEU B  2  193 ? 324.546 204.647 271.826 1.00 118.34 ? 192 LEU O HD11   1 
ATOM   6811   H  HD12   . LEU B  2  193 ? 324.008 205.982 272.498 1.00 118.34 ? 192 LEU O HD12   1 
ATOM   6812   H  HD13   . LEU B  2  193 ? 323.191 204.629 272.656 1.00 118.34 ? 192 LEU O HD13   1 
ATOM   6813   H  HD21   . LEU B  2  193 ? 323.432 203.714 269.841 1.00 102.35 ? 192 LEU O HD21   1 
ATOM   6814   H  HD22   . LEU B  2  193 ? 322.042 203.652 270.608 1.00 102.35 ? 192 LEU O HD22   1 
ATOM   6815   H  HD23   . LEU B  2  193 ? 322.154 204.433 269.229 1.00 102.35 ? 192 LEU O HD23   1 
ATOM   6816   N  N      . THR B  2  194 ? 322.264 209.018 269.922 1.00 129.22 ? 193 THR O N      1 
ATOM   6817   C  CA     . THR B  2  194 ? 323.039 209.901 269.057 1.00 126.69 ? 193 THR O CA     1 
ATOM   6818   C  C      . THR B  2  194 ? 323.221 211.283 269.665 1.00 116.76 ? 193 THR O C      1 
ATOM   6819   O  O      . THR B  2  194 ? 324.103 212.031 269.230 1.00 106.34 ? 193 THR O O      1 
ATOM   6820   C  CB     . THR B  2  194 ? 322.368 210.023 267.688 1.00 138.16 ? 193 THR O CB     1 
ATOM   6821   O  OG1    . THR B  2  194 ? 323.162 210.859 266.835 1.00 160.33 ? 193 THR O OG1    1 
ATOM   6822   C  CG2    . THR B  2  194 ? 320.972 210.621 267.819 1.00 124.68 ? 193 THR O CG2    1 
ATOM   6823   H  H      . THR B  2  194 ? 321.476 208.838 269.630 1.00 118.87 ? 193 THR O H      1 
ATOM   6824   H  HA     . THR B  2  194 ? 323.920 209.516 268.924 1.00 116.51 ? 193 THR O HA     1 
ATOM   6825   H  HB     . THR B  2  194 ? 322.287 209.142 267.290 1.00 128.85 ? 193 THR O HB     1 
ATOM   6826   H  HG1    . THR B  2  194 ? 323.927 210.526 266.738 1.00 151.13 ? 193 THR O HG1    1 
ATOM   6827   H  HG21   . THR B  2  194 ? 320.559 210.692 266.944 1.00 116.50 ? 193 THR O HG21   1 
ATOM   6828   H  HG22   . THR B  2  194 ? 320.422 210.055 268.383 1.00 116.50 ? 193 THR O HG22   1 
ATOM   6829   H  HG23   . THR B  2  194 ? 321.026 211.504 268.216 1.00 116.50 ? 193 THR O HG23   1 
ATOM   6830   N  N      . LEU B  2  195 ? 322.391 211.645 270.639 1.00 108.22 ? 194 LEU O N      1 
ATOM   6831   C  CA     . LEU B  2  195 ? 322.616 212.846 271.424 1.00 108.96 ? 194 LEU O CA     1 
ATOM   6832   C  C      . LEU B  2  195 ? 323.692 212.645 272.477 1.00 96.06  ? 194 LEU O C      1 
ATOM   6833   O  O      . LEU B  2  195 ? 324.165 213.626 273.059 1.00 96.11  ? 194 LEU O O      1 
ATOM   6834   C  CB     . LEU B  2  195 ? 321.307 213.271 272.090 1.00 95.84  ? 194 LEU O CB     1 
ATOM   6835   C  CG     . LEU B  2  195 ? 321.271 214.628 272.784 1.00 90.40  ? 194 LEU O CG     1 
ATOM   6836   C  CD1    . LEU B  2  195 ? 321.482 215.752 271.776 1.00 85.35  ? 194 LEU O CD1    1 
ATOM   6837   C  CD2    . LEU B  2  195 ? 319.947 214.770 273.518 1.00 91.39  ? 194 LEU O CD2    1 
ATOM   6838   H  H      . LEU B  2  195 ? 321.686 211.207 270.863 1.00 104.79 ? 194 LEU O H      1 
ATOM   6839   H  HA     . LEU B  2  195 ? 322.901 213.562 270.835 1.00 105.73 ? 194 LEU O HA     1 
ATOM   6840   H  HB2    . LEU B  2  195 ? 320.615 213.282 271.410 1.00 93.43  ? 194 LEU O HB2    1 
ATOM   6841   H  HB3    . LEU B  2  195 ? 321.082 212.605 272.759 1.00 93.43  ? 194 LEU O HB3    1 
ATOM   6842   H  HG     . LEU B  2  195 ? 321.985 214.670 273.438 1.00 88.43  ? 194 LEU O HG     1 
ATOM   6843   H  HD11   . LEU B  2  195 ? 321.455 216.603 272.241 1.00 84.06  ? 194 LEU O HD11   1 
ATOM   6844   H  HD12   . LEU B  2  195 ? 322.346 215.636 271.350 1.00 84.06  ? 194 LEU O HD12   1 
ATOM   6845   H  HD13   . LEU B  2  195 ? 320.777 215.716 271.110 1.00 84.06  ? 194 LEU O HD13   1 
ATOM   6846   H  HD21   . LEU B  2  195 ? 319.923 215.633 273.960 1.00 90.08  ? 194 LEU O HD21   1 
ATOM   6847   H  HD22   . LEU B  2  195 ? 319.223 214.706 272.876 1.00 90.08  ? 194 LEU O HD22   1 
ATOM   6848   H  HD23   . LEU B  2  195 ? 319.873 214.060 274.174 1.00 90.08  ? 194 LEU O HD23   1 
ATOM   6849   N  N      . LYS B  2  196 ? 324.092 211.398 272.724 1.00 105.22 ? 195 LYS O N      1 
ATOM   6850   C  CA     . LYS B  2  196 ? 325.061 211.096 273.764 1.00 110.58 ? 195 LYS O CA     1 
ATOM   6851   C  C      . LYS B  2  196 ? 326.499 211.302 273.309 1.00 130.82 ? 195 LYS O C      1 
ATOM   6852   O  O      . LYS B  2  196 ? 327.381 211.483 274.156 1.00 138.67 ? 195 LYS O O      1 
ATOM   6853   C  CB     . LYS B  2  196 ? 324.862 209.651 274.237 1.00 114.67 ? 195 LYS O CB     1 
ATOM   6854   C  CG     . LYS B  2  196 ? 325.677 209.267 275.453 1.00 120.44 ? 195 LYS O CG     1 
ATOM   6855   C  CD     . LYS B  2  196 ? 325.293 210.087 276.677 1.00 151.99 ? 195 LYS O CD     1 
ATOM   6856   C  CE     . LYS B  2  196 ? 326.478 210.293 277.602 1.00 168.15 ? 195 LYS O CE     1 
ATOM   6857   N  NZ     . LYS B  2  196 ? 327.568 211.105 276.978 1.00 182.41 ? 195 LYS O NZ     1 
ATOM   6858   H  H      . LYS B  2  196 ? 323.811 210.707 272.297 1.00 90.84  ? 195 LYS O H      1 
ATOM   6859   H  HA     . LYS B  2  196 ? 324.901 211.682 274.520 1.00 95.13  ? 195 LYS O HA     1 
ATOM   6860   H  HB2    . LYS B  2  196 ? 323.926 209.523 274.458 1.00 98.50  ? 195 LYS O HB2    1 
ATOM   6861   H  HB3    . LYS B  2  196 ? 325.111 209.052 273.516 1.00 98.50  ? 195 LYS O HB3    1 
ATOM   6862   H  HG2    . LYS B  2  196 ? 325.524 208.331 275.656 1.00 103.19 ? 195 LYS O HG2    1 
ATOM   6863   H  HG3    . LYS B  2  196 ? 326.617 209.420 275.268 1.00 103.19 ? 195 LYS O HG3    1 
ATOM   6864   H  HD2    . LYS B  2  196 ? 324.975 210.958 276.392 1.00 135.01 ? 195 LYS O HD2    1 
ATOM   6865   H  HD3    . LYS B  2  196 ? 324.600 209.622 277.170 1.00 135.01 ? 195 LYS O HD3    1 
ATOM   6866   H  HE2    . LYS B  2  196 ? 326.179 210.756 278.400 1.00 150.22 ? 195 LYS O HE2    1 
ATOM   6867   H  HE3    . LYS B  2  196 ? 326.847 209.428 277.839 1.00 150.22 ? 195 LYS O HE3    1 
ATOM   6868   H  HZ1    . LYS B  2  196 ? 327.259 211.910 276.757 1.00 164.36 ? 195 LYS O HZ1    1 
ATOM   6869   H  HZ2    . LYS B  2  196 ? 328.241 211.202 277.552 1.00 164.36 ? 195 LYS O HZ2    1 
ATOM   6870   H  HZ3    . LYS B  2  196 ? 327.376 211.266 276.124 1.00 164.36 ? 195 LYS O HZ3    1 
ATOM   6871   N  N      . GLU B  2  197 ? 326.756 211.289 271.999 1.00 128.07 ? 196 GLU O N      1 
ATOM   6872   C  CA     . GLU B  2  197 ? 328.113 211.500 271.503 1.00 131.30 ? 196 GLU O CA     1 
ATOM   6873   C  C      . GLU B  2  197 ? 328.569 212.934 271.748 1.00 123.94 ? 196 GLU O C      1 
ATOM   6874   O  O      . GLU B  2  197 ? 329.612 213.169 272.368 1.00 120.58 ? 196 GLU O O      1 
ATOM   6875   C  CB     . GLU B  2  197 ? 328.186 211.163 270.013 1.00 141.52 ? 196 GLU O CB     1 
ATOM   6876   C  CG     . GLU B  2  197 ? 328.413 209.689 269.706 1.00 156.37 ? 196 GLU O CG     1 
ATOM   6877   C  CD     . GLU B  2  197 ? 327.221 208.822 270.053 1.00 164.62 ? 196 GLU O CD     1 
ATOM   6878   O  OE1    . GLU B  2  197 ? 327.079 208.446 271.235 1.00 168.30 ? 196 GLU O OE1    1 
ATOM   6879   O  OE2    . GLU B  2  197 ? 326.422 208.522 269.142 1.00 168.25 ? 196 GLU O OE2    1 
ATOM   6880   H  H      . GLU B  2  197 ? 326.168 211.160 271.385 1.00 126.81 ? 196 GLU O H      1 
ATOM   6881   H  HA     . GLU B  2  197 ? 328.718 210.908 271.976 1.00 129.39 ? 196 GLU O HA     1 
ATOM   6882   H  HB2    . GLU B  2  197 ? 327.351 211.425 269.594 1.00 139.81 ? 196 GLU O HB2    1 
ATOM   6883   H  HB3    . GLU B  2  197 ? 328.919 211.661 269.618 1.00 139.81 ? 196 GLU O HB3    1 
ATOM   6884   H  HG2    . GLU B  2  197 ? 328.590 209.588 268.757 1.00 153.87 ? 196 GLU O HG2    1 
ATOM   6885   H  HG3    . GLU B  2  197 ? 329.172 209.373 270.220 1.00 153.87 ? 196 GLU O HG3    1 
ATOM   6886   N  N      . SER B  2  198 ? 327.799 213.908 271.262 1.00 169.74 ? 197 SER O N      1 
ATOM   6887   C  CA     . SER B  2  198 ? 328.158 215.310 271.460 1.00 182.19 ? 197 SER O CA     1 
ATOM   6888   C  C      . SER B  2  198 ? 328.153 215.673 272.937 1.00 203.90 ? 197 SER O C      1 
ATOM   6889   O  O      . SER B  2  198 ? 329.071 216.338 273.434 1.00 177.36 ? 197 SER O O      1 
ATOM   6890   C  CB     . SER B  2  198 ? 327.187 216.204 270.688 1.00 186.06 ? 197 SER O CB     1 
ATOM   6891   O  OG     . SER B  2  198 ? 325.873 215.666 270.720 1.00 188.45 ? 197 SER O OG     1 
ATOM   6892   H  H      . SER B  2  198 ? 327.071 213.785 270.820 1.00 147.68 ? 197 SER O H      1 
ATOM   6893   H  HA     . SER B  2  198 ? 329.051 215.462 271.114 1.00 160.50 ? 197 SER O HA     1 
ATOM   6894   H  HB2    . SER B  2  198 ? 327.178 217.085 271.093 1.00 165.63 ? 197 SER O HB2    1 
ATOM   6895   H  HB3    . SER B  2  198 ? 327.480 216.266 269.765 1.00 165.63 ? 197 SER O HB3    1 
ATOM   6896   H  HG     . SER B  2  198 ? 325.348 216.164 270.294 1.00 168.61 ? 197 SER O HG     1 
ATOM   6897   N  N      . PHE B  2  199 ? 327.117 215.245 273.655 1.00 172.92 ? 198 PHE O N      1 
ATOM   6898   C  CA     . PHE B  2  199 ? 326.912 215.597 275.054 1.00 152.34 ? 198 PHE O CA     1 
ATOM   6899   C  C      . PHE B  2  199 ? 328.165 215.353 275.886 1.00 131.50 ? 198 PHE O C      1 
ATOM   6900   O  O      . PHE B  2  199 ? 328.999 214.519 275.531 1.00 113.99 ? 198 PHE O O      1 
ATOM   6901   C  CB     . PHE B  2  199 ? 325.743 214.785 275.612 1.00 128.41 ? 198 PHE O CB     1 
ATOM   6902   C  CG     . PHE B  2  199 ? 325.231 215.290 276.919 1.00 110.92 ? 198 PHE O CG     1 
ATOM   6903   C  CD1    . PHE B  2  199 ? 324.268 216.279 276.957 1.00 99.40  ? 198 PHE O CD1    1 
ATOM   6904   C  CD2    . PHE B  2  199 ? 325.712 214.777 278.109 1.00 116.20 ? 198 PHE O CD2    1 
ATOM   6905   C  CE1    . PHE B  2  199 ? 323.791 216.750 278.161 1.00 112.33 ? 198 PHE O CE1    1 
ATOM   6906   C  CE2    . PHE B  2  199 ? 325.239 215.242 279.319 1.00 124.87 ? 198 PHE O CE2    1 
ATOM   6907   C  CZ     . PHE B  2  199 ? 324.277 216.231 279.346 1.00 119.97 ? 198 PHE O CZ     1 
ATOM   6908   H  H      . PHE B  2  199 ? 326.502 214.733 273.341 1.00 171.66 ? 198 PHE O H      1 
ATOM   6909   H  HA     . PHE B  2  199 ? 326.686 216.538 275.116 1.00 150.96 ? 198 PHE O HA     1 
ATOM   6910   H  HB2    . PHE B  2  199 ? 325.012 214.813 274.976 1.00 127.23 ? 198 PHE O HB2    1 
ATOM   6911   H  HB3    . PHE B  2  199 ? 326.033 213.868 275.741 1.00 127.23 ? 198 PHE O HB3    1 
ATOM   6912   H  HD1    . PHE B  2  199 ? 323.938 216.631 276.162 1.00 99.44  ? 198 PHE O HD1    1 
ATOM   6913   H  HD2    . PHE B  2  199 ? 326.360 214.111 278.094 1.00 114.27 ? 198 PHE O HD2    1 
ATOM   6914   H  HE1    . PHE B  2  199 ? 323.142 217.416 278.175 1.00 112.50 ? 198 PHE O HE1    1 
ATOM   6915   H  HE2    . PHE B  2  199 ? 325.569 214.891 280.114 1.00 123.07 ? 198 PHE O HE2    1 
ATOM   6916   H  HZ     . PHE B  2  199 ? 323.956 216.547 280.160 1.00 119.22 ? 198 PHE O HZ     1 
ATOM   6917   N  N      . GLU B  2  200 ? 328.309 216.081 276.994 1.00 173.23 ? 199 GLU O N      1 
ATOM   6918   C  CA     . GLU B  2  200 ? 329.406 215.863 277.923 1.00 180.38 ? 199 GLU O CA     1 
ATOM   6919   C  C      . GLU B  2  200 ? 328.847 215.778 279.331 1.00 183.89 ? 199 GLU O C      1 
ATOM   6920   O  O      . GLU B  2  200 ? 328.025 216.611 279.729 1.00 180.30 ? 199 GLU O O      1 
ATOM   6921   C  CB     . GLU B  2  200 ? 330.449 216.978 277.834 1.00 193.47 ? 199 GLU O CB     1 
ATOM   6922   C  CG     . GLU B  2  200 ? 331.582 216.826 278.836 1.00 220.17 ? 199 GLU O CG     1 
ATOM   6923   C  CD     . GLU B  2  200 ? 332.227 215.455 278.779 1.00 243.96 ? 199 GLU O CD     1 
ATOM   6924   O  OE1    . GLU B  2  200 ? 332.193 214.740 279.804 1.00 242.71 ? 199 GLU O OE1    1 
ATOM   6925   O  OE2    . GLU B  2  200 ? 332.752 215.089 277.706 1.00 263.17 ? 199 GLU O OE2    1 
ATOM   6926   H  H      . GLU B  2  200 ? 327.776 216.714 277.228 1.00 141.99 ? 199 GLU O H      1 
ATOM   6927   H  HA     . GLU B  2  200 ? 329.841 215.021 277.715 1.00 148.04 ? 199 GLU O HA     1 
ATOM   6928   H  HB2    . GLU B  2  200 ? 330.835 216.977 276.945 1.00 161.01 ? 199 GLU O HB2    1 
ATOM   6929   H  HB3    . GLU B  2  200 ? 330.014 217.828 278.004 1.00 161.01 ? 199 GLU O HB3    1 
ATOM   6930   H  HG2    . GLU B  2  200 ? 332.265 217.488 278.644 1.00 186.58 ? 199 GLU O HG2    1 
ATOM   6931   H  HG3    . GLU B  2  200 ? 331.233 216.958 279.731 1.00 186.58 ? 199 GLU O HG3    1 
ATOM   6932   N  N      . GLY B  2  201 ? 329.301 214.784 280.081 1.00 159.43 ? 200 GLY O N      1 
ATOM   6933   C  CA     . GLY B  2  201 ? 328.799 214.526 281.413 1.00 165.47 ? 200 GLY O CA     1 
ATOM   6934   C  C      . GLY B  2  201 ? 327.702 213.475 281.407 1.00 176.87 ? 200 GLY O C      1 
ATOM   6935   O  O      . GLY B  2  201 ? 327.251 212.993 280.365 1.00 177.83 ? 200 GLY O O      1 
ATOM   6936   H  H      . GLY B  2  201 ? 329.914 214.236 279.831 1.00 140.13 ? 200 GLY O H      1 
ATOM   6937   H  HA2    . GLY B  2  201 ? 329.522 214.215 281.979 1.00 145.94 ? 200 GLY O HA2    1 
ATOM   6938   H  HA3    . GLY B  2  201 ? 328.441 215.345 281.790 1.00 145.94 ? 200 GLY O HA3    1 
ATOM   6939   N  N      . GLN B  2  202 ? 327.269 213.119 282.608 1.00 187.92 ? 201 GLN O N      1 
ATOM   6940   C  CA     . GLN B  2  202 ? 326.231 212.112 282.752 1.00 186.84 ? 201 GLN O CA     1 
ATOM   6941   C  C      . GLN B  2  202 ? 324.874 212.661 282.322 1.00 167.89 ? 201 GLN O C      1 
ATOM   6942   O  O      . GLN B  2  202 ? 324.568 213.844 282.498 1.00 153.02 ? 201 GLN O O      1 
ATOM   6943   C  CB     . GLN B  2  202 ? 326.163 211.633 284.199 1.00 167.66 ? 201 GLN O CB     1 
ATOM   6944   C  CG     . GLN B  2  202 ? 325.168 210.515 284.436 1.00 168.33 ? 201 GLN O CG     1 
ATOM   6945   C  CD     . GLN B  2  202 ? 324.951 210.241 285.905 1.00 173.12 ? 201 GLN O CD     1 
ATOM   6946   O  OE1    . GLN B  2  202 ? 325.265 209.159 286.402 1.00 178.50 ? 201 GLN O OE1    1 
ATOM   6947   N  NE2    . GLN B  2  202 ? 324.398 211.222 286.612 1.00 171.48 ? 201 GLN O NE2    1 
ATOM   6948   H  H      . GLN B  2  202 ? 327.558 213.443 283.351 1.00 149.05 ? 201 GLN O H      1 
ATOM   6949   H  HA     . GLN B  2  202 ? 326.443 211.351 282.190 1.00 148.09 ? 201 GLN O HA     1 
ATOM   6950   H  HB2    . GLN B  2  202 ? 327.039 211.308 284.461 1.00 128.22 ? 201 GLN O HB2    1 
ATOM   6951   H  HB3    . GLN B  2  202 ? 325.908 212.380 284.763 1.00 128.22 ? 201 GLN O HB3    1 
ATOM   6952   H  HG2    . GLN B  2  202 ? 324.315 210.762 284.046 1.00 128.89 ? 201 GLN O HG2    1 
ATOM   6953   H  HG3    . GLN B  2  202 ? 325.500 209.702 284.023 1.00 128.89 ? 201 GLN O HG3    1 
ATOM   6954   H  HE21   . GLN B  2  202 ? 324.186 211.961 286.228 1.00 132.09 ? 201 GLN O HE21   1 
ATOM   6955   H  HE22   . GLN B  2  202 ? 324.253 211.117 287.453 1.00 132.09 ? 201 GLN O HE22   1 
ATOM   6956   N  N      . MET B  2  203 ? 324.061 211.778 281.749 1.00 135.23 ? 202 MET O N      1 
ATOM   6957   C  CA     . MET B  2  203 ? 322.684 212.107 281.411 1.00 133.62 ? 202 MET O CA     1 
ATOM   6958   C  C      . MET B  2  203 ? 321.789 211.953 282.631 1.00 134.85 ? 202 MET O C      1 
ATOM   6959   O  O      . MET B  2  203 ? 321.980 211.052 283.450 1.00 141.75 ? 202 MET O O      1 
ATOM   6960   C  CB     . MET B  2  203 ? 322.162 211.191 280.305 1.00 132.10 ? 202 MET O CB     1 
ATOM   6961   C  CG     . MET B  2  203 ? 322.722 211.449 278.928 1.00 131.12 ? 202 MET O CG     1 
ATOM   6962   S  SD     . MET B  2  203 ? 322.045 212.943 278.190 1.00 124.95 ? 202 MET O SD     1 
ATOM   6963   C  CE     . MET B  2  203 ? 322.484 212.687 276.473 1.00 134.02 ? 202 MET O CE     1 
ATOM   6964   H  H      . MET B  2  203 ? 324.287 210.973 281.545 1.00 123.30 ? 202 MET O H      1 
ATOM   6965   H  HA     . MET B  2  203 ? 322.641 213.023 281.095 1.00 122.82 ? 202 MET O HA     1 
ATOM   6966   H  HB2    . MET B  2  203 ? 322.377 210.275 280.539 1.00 121.55 ? 202 MET O HB2    1 
ATOM   6967   H  HB3    . MET B  2  203 ? 321.199 211.294 280.251 1.00 121.55 ? 202 MET O HB3    1 
ATOM   6968   H  HG2    . MET B  2  203 ? 323.685 211.553 278.991 1.00 120.81 ? 202 MET O HG2    1 
ATOM   6969   H  HG3    . MET B  2  203 ? 322.504 210.701 278.351 1.00 120.81 ? 202 MET O HG3    1 
ATOM   6970   H  HE1    . MET B  2  203 ? 322.169 213.441 275.951 1.00 125.23 ? 202 MET O HE1    1 
ATOM   6971   H  HE2    . MET B  2  203 ? 323.449 212.615 276.402 1.00 125.23 ? 202 MET O HE2    1 
ATOM   6972   H  HE3    . MET B  2  203 ? 322.067 211.869 276.160 1.00 125.23 ? 202 MET O HE3    1 
ATOM   6973   N  N      . THR B  2  204 ? 320.801 212.832 282.740 1.00 134.60 ? 203 THR O N      1 
ATOM   6974   C  CA     . THR B  2  204 ? 319.733 212.677 283.713 1.00 139.47 ? 203 THR O CA     1 
ATOM   6975   C  C      . THR B  2  204 ? 318.424 213.059 283.046 1.00 136.96 ? 203 THR O C      1 
ATOM   6976   O  O      . THR B  2  204 ? 318.385 213.444 281.873 1.00 136.97 ? 203 THR O O      1 
ATOM   6977   C  CB     . THR B  2  204 ? 319.963 213.531 284.963 1.00 147.61 ? 203 THR O CB     1 
ATOM   6978   O  OG1    . THR B  2  204 ? 319.955 214.919 284.603 1.00 158.73 ? 203 THR O OG1    1 
ATOM   6979   C  CG2    . THR B  2  204 ? 321.285 213.182 285.621 1.00 142.02 ? 203 THR O CG2    1 
ATOM   6980   H  H      . THR B  2  204 ? 320.726 213.537 282.253 1.00 133.66 ? 203 THR O H      1 
ATOM   6981   H  HA     . THR B  2  204 ? 319.678 211.747 283.984 1.00 138.76 ? 203 THR O HA     1 
ATOM   6982   H  HB     . THR B  2  204 ? 319.252 213.363 285.601 1.00 146.72 ? 203 THR O HB     1 
ATOM   6983   H  HG1    . THR B  2  204 ? 320.080 215.393 285.284 1.00 158.62 ? 203 THR O HG1    1 
ATOM   6984   H  HG21   . THR B  2  204 ? 321.417 213.730 286.410 1.00 139.93 ? 203 THR O HG21   1 
ATOM   6985   H  HG22   . THR B  2  204 ? 321.289 212.248 285.881 1.00 139.93 ? 203 THR O HG22   1 
ATOM   6986   H  HG23   . THR B  2  204 ? 322.015 213.340 285.001 1.00 139.93 ? 203 THR O HG23   1 
ATOM   6987   N  N      . GLU B  2  205 ? 317.341 212.955 283.810 1.00 172.65 ? 204 GLU O N      1 
ATOM   6988   C  CA     . GLU B  2  205 ? 316.031 213.335 283.306 1.00 173.55 ? 204 GLU O CA     1 
ATOM   6989   C  C      . GLU B  2  205 ? 315.865 214.842 283.178 1.00 171.63 ? 204 GLU O C      1 
ATOM   6990   O  O      . GLU B  2  205 ? 314.904 215.286 282.542 1.00 154.68 ? 204 GLU O O      1 
ATOM   6991   C  CB     . GLU B  2  205 ? 314.950 212.769 284.220 1.00 179.10 ? 204 GLU O CB     1 
ATOM   6992   C  CG     . GLU B  2  205 ? 315.059 213.242 285.657 1.00 181.62 ? 204 GLU O CG     1 
ATOM   6993   C  CD     . GLU B  2  205 ? 314.106 212.515 286.578 1.00 180.91 ? 204 GLU O CD     1 
ATOM   6994   O  OE1    . GLU B  2  205 ? 314.352 211.322 286.864 1.00 167.33 ? 204 GLU O OE1    1 
ATOM   6995   O  OE2    . GLU B  2  205 ? 313.108 213.134 287.007 1.00 193.49 ? 204 GLU O OE2    1 
ATOM   6996   H  H      . GLU B  2  205 ? 317.340 212.668 284.621 1.00 145.42 ? 204 GLU O H      1 
ATOM   6997   H  HA     . GLU B  2  205 ? 315.910 212.946 282.426 1.00 147.43 ? 204 GLU O HA     1 
ATOM   6998   H  HB2    . GLU B  2  205 ? 314.082 213.041 283.883 1.00 153.01 ? 204 GLU O HB2    1 
ATOM   6999   H  HB3    . GLU B  2  205 ? 315.015 211.801 284.221 1.00 153.01 ? 204 GLU O HB3    1 
ATOM   7000   H  HG2    . GLU B  2  205 ? 315.962 213.086 285.974 1.00 155.16 ? 204 GLU O HG2    1 
ATOM   7001   H  HG3    . GLU B  2  205 ? 314.852 214.189 285.696 1.00 155.16 ? 204 GLU O HG3    1 
ATOM   7002   N  N      . ASP B  2  206 ? 316.765 215.635 283.757 1.00 193.38 ? 205 ASP O N      1 
ATOM   7003   C  CA     . ASP B  2  206 ? 316.711 217.085 283.632 1.00 183.67 ? 205 ASP O CA     1 
ATOM   7004   C  C      . ASP B  2  206 ? 317.584 217.615 282.507 1.00 166.39 ? 205 ASP O C      1 
ATOM   7005   O  O      . ASP B  2  206 ? 317.451 218.789 282.143 1.00 148.91 ? 205 ASP O O      1 
ATOM   7006   C  CB     . ASP B  2  206 ? 317.150 217.752 284.938 1.00 186.48 ? 205 ASP O CB     1 
ATOM   7007   C  CG     . ASP B  2  206 ? 316.434 217.197 286.145 1.00 179.92 ? 205 ASP O CG     1 
ATOM   7008   O  OD1    . ASP B  2  206 ? 317.121 216.814 287.114 1.00 168.72 ? 205 ASP O OD1    1 
ATOM   7009   O  OD2    . ASP B  2  206 ? 315.187 217.152 286.127 1.00 185.48 ? 205 ASP O OD2    1 
ATOM   7010   H  H      . ASP B  2  206 ? 317.424 215.352 284.232 1.00 168.14 ? 205 ASP O H      1 
ATOM   7011   H  HA     . ASP B  2  206 ? 315.796 217.352 283.452 1.00 159.16 ? 205 ASP O HA     1 
ATOM   7012   H  HB2    . ASP B  2  206 ? 318.102 217.610 285.062 1.00 161.55 ? 205 ASP O HB2    1 
ATOM   7013   H  HB3    . ASP B  2  206 ? 316.961 218.702 284.888 1.00 161.55 ? 205 ASP O HB3    1 
ATOM   7014   N  N      . ASN B  2  207 ? 318.469 216.788 281.956 1.00 127.51 ? 206 ASN O N      1 
ATOM   7015   C  CA     . ASN B  2  207 ? 319.442 217.259 280.985 1.00 129.30 ? 206 ASN O CA     1 
ATOM   7016   C  C      . ASN B  2  207 ? 318.946 217.191 279.551 1.00 124.75 ? 206 ASN O C      1 
ATOM   7017   O  O      . ASN B  2  207 ? 319.442 217.944 278.706 1.00 144.91 ? 206 ASN O O      1 
ATOM   7018   C  CB     . ASN B  2  207 ? 320.735 216.448 281.112 1.00 116.97 ? 206 ASN O CB     1 
ATOM   7019   C  CG     . ASN B  2  207 ? 321.786 217.161 281.936 1.00 123.70 ? 206 ASN O CG     1 
ATOM   7020   O  OD1    . ASN B  2  207 ? 321.752 218.385 282.091 1.00 118.68 ? 206 ASN O OD1    1 
ATOM   7021   N  ND2    . ASN B  2  207 ? 322.733 216.397 282.469 1.00 136.12 ? 206 ASN O ND2    1 
ATOM   7022   H  H      . ASN B  2  207 ? 318.525 215.948 282.131 1.00 109.57 ? 206 ASN O H      1 
ATOM   7023   H  HA     . ASN B  2  207 ? 319.653 218.186 281.180 1.00 111.33 ? 206 ASN O HA     1 
ATOM   7024   H  HB2    . ASN B  2  207 ? 320.537 215.602 281.543 1.00 97.82  ? 206 ASN O HB2    1 
ATOM   7025   H  HB3    . ASN B  2  207 ? 321.100 216.294 280.227 1.00 97.82  ? 206 ASN O HB3    1 
ATOM   7026   H  HD21   . ASN B  2  207 ? 323.355 216.752 282.946 1.00 115.28 ? 206 ASN O HD21   1 
ATOM   7027   H  HD22   . ASN B  2  207 ? 322.725 215.548 282.337 1.00 115.28 ? 206 ASN O HD22   1 
ATOM   7028   N  N      . ILE B  2  208 ? 317.991 216.321 279.249 1.00 82.24  ? 207 ILE O N      1 
ATOM   7029   C  CA     . ILE B  2  208 ? 317.476 216.169 277.896 1.00 78.12  ? 207 ILE O CA     1 
ATOM   7030   C  C      . ILE B  2  208 ? 315.978 216.410 277.900 1.00 74.87  ? 207 ILE O C      1 
ATOM   7031   O  O      . ILE B  2  208 ? 315.265 215.974 278.810 1.00 76.70  ? 207 ILE O O      1 
ATOM   7032   C  CB     . ILE B  2  208 ? 317.790 214.779 277.309 1.00 80.08  ? 207 ILE O CB     1 
ATOM   7033   C  CG1    . ILE B  2  208 ? 317.292 213.679 278.244 1.00 83.74  ? 207 ILE O CG1    1 
ATOM   7034   C  CG2    . ILE B  2  208 ? 319.280 214.649 277.062 1.00 108.29 ? 207 ILE O CG2    1 
ATOM   7035   C  CD1    . ILE B  2  208 ? 317.367 212.308 277.641 1.00 86.33  ? 207 ILE O CD1    1 
ATOM   7036   H  H      . ILE B  2  208 ? 317.619 215.798 279.822 1.00 80.05  ? 207 ILE O H      1 
ATOM   7037   H  HA     . ILE B  2  208 ? 317.886 216.837 277.325 1.00 76.60  ? 207 ILE O HA     1 
ATOM   7038   H  HB     . ILE B  2  208 ? 317.329 214.693 276.460 1.00 77.94  ? 207 ILE O HB     1 
ATOM   7039   H  HG12   . ILE B  2  208 ? 317.835 213.680 279.048 1.00 81.09  ? 207 ILE O HG12   1 
ATOM   7040   H  HG13   . ILE B  2  208 ? 316.365 213.854 278.471 1.00 81.09  ? 207 ILE O HG13   1 
ATOM   7041   H  HG21   . ILE B  2  208 ? 319.462 213.771 276.693 1.00 105.28 ? 207 ILE O HG21   1 
ATOM   7042   H  HG22   . ILE B  2  208 ? 319.557 215.336 276.436 1.00 105.28 ? 207 ILE O HG22   1 
ATOM   7043   H  HG23   . ILE B  2  208 ? 319.749 214.759 277.904 1.00 105.28 ? 207 ILE O HG23   1 
ATOM   7044   H  HD11   . ILE B  2  208 ? 317.037 211.661 278.284 1.00 83.20  ? 207 ILE O HD11   1 
ATOM   7045   H  HD12   . ILE B  2  208 ? 316.820 212.286 276.840 1.00 83.20  ? 207 ILE O HD12   1 
ATOM   7046   H  HD13   . ILE B  2  208 ? 318.290 212.112 277.417 1.00 83.20  ? 207 ILE O HD13   1 
ATOM   7047   N  N      . GLU B  2  209 ? 315.507 217.098 276.870 1.00 79.60  ? 208 GLU O N      1 
ATOM   7048   C  CA     . GLU B  2  209 ? 314.087 217.268 276.610 1.00 76.30  ? 208 GLU O CA     1 
ATOM   7049   C  C      . GLU B  2  209 ? 313.752 216.406 275.407 1.00 75.07  ? 208 GLU O C      1 
ATOM   7050   O  O      . GLU B  2  209 ? 314.329 216.588 274.331 1.00 73.11  ? 208 GLU O O      1 
ATOM   7051   C  CB     . GLU B  2  209 ? 313.745 218.732 276.342 1.00 103.06 ? 208 GLU O CB     1 
ATOM   7052   C  CG     . GLU B  2  209 ? 314.208 219.692 277.430 1.00 140.39 ? 208 GLU O CG     1 
ATOM   7053   C  CD     . GLU B  2  209 ? 313.234 219.779 278.591 1.00 171.56 ? 208 GLU O CD     1 
ATOM   7054   O  OE1    . GLU B  2  209 ? 312.031 220.020 278.344 1.00 181.03 ? 208 GLU O OE1    1 
ATOM   7055   O  OE2    . GLU B  2  209 ? 313.676 219.602 279.749 1.00 190.41 ? 208 GLU O OE2    1 
ATOM   7056   H  H      . GLU B  2  209 ? 316.008 217.488 276.290 1.00 74.42  ? 208 GLU O H      1 
ATOM   7057   H  HA     . GLU B  2  209 ? 313.572 216.959 277.372 1.00 72.09  ? 208 GLU O HA     1 
ATOM   7058   H  HB2    . GLU B  2  209 ? 314.165 219.003 275.511 1.00 99.75  ? 208 GLU O HB2    1 
ATOM   7059   H  HB3    . GLU B  2  209 ? 312.781 218.818 276.264 1.00 99.75  ? 208 GLU O HB3    1 
ATOM   7060   H  HG2    . GLU B  2  209 ? 315.062 219.389 277.776 1.00 136.88 ? 208 GLU O HG2    1 
ATOM   7061   H  HG3    . GLU B  2  209 ? 314.300 220.580 277.049 1.00 136.88 ? 208 GLU O HG3    1 
ATOM   7062   N  N      . VAL B  2  210 ? 312.852 215.455 275.595 1.00 67.02  ? 209 VAL O N      1 
ATOM   7063   C  CA     . VAL B  2  210 ? 312.419 214.576 274.522 1.00 65.81  ? 209 VAL O CA     1 
ATOM   7064   C  C      . VAL B  2  210 ? 310.942 214.830 274.278 1.00 62.79  ? 209 VAL O C      1 
ATOM   7065   O  O      . VAL B  2  210 ? 310.162 214.988 275.225 1.00 63.62  ? 209 VAL O O      1 
ATOM   7066   C  CB     . VAL B  2  210 ? 312.684 213.096 274.853 1.00 70.08  ? 209 VAL O CB     1 
ATOM   7067   C  CG1    . VAL B  2  210 ? 312.389 212.222 273.644 1.00 69.58  ? 209 VAL O CG1    1 
ATOM   7068   C  CG2    . VAL B  2  210 ? 314.126 212.916 275.305 1.00 73.73  ? 209 VAL O CG2    1 
ATOM   7069   H  H      . VAL B  2  210 ? 312.471 215.295 276.349 1.00 67.81  ? 209 VAL O H      1 
ATOM   7070   H  HA     . VAL B  2  210 ? 312.903 214.798 273.712 1.00 66.80  ? 209 VAL O HA     1 
ATOM   7071   H  HB     . VAL B  2  210 ? 312.102 212.820 275.578 1.00 70.15  ? 209 VAL O HB     1 
ATOM   7072   H  HG11   . VAL B  2  210 ? 312.563 211.296 273.873 1.00 69.81  ? 209 VAL O HG11   1 
ATOM   7073   H  HG12   . VAL B  2  210 ? 311.458 212.333 273.395 1.00 69.81  ? 209 VAL O HG12   1 
ATOM   7074   H  HG13   . VAL B  2  210 ? 312.963 212.495 272.910 1.00 69.81  ? 209 VAL O HG13   1 
ATOM   7075   H  HG21   . VAL B  2  210 ? 314.277 211.980 275.509 1.00 72.75  ? 209 VAL O HG21   1 
ATOM   7076   H  HG22   . VAL B  2  210 ? 314.718 213.199 274.590 1.00 72.75  ? 209 VAL O HG22   1 
ATOM   7077   H  HG23   . VAL B  2  210 ? 314.278 213.456 276.095 1.00 72.75  ? 209 VAL O HG23   1 
ATOM   7078   N  N      . GLY B  2  211 ? 310.566 214.889 273.003 1.00 82.38  ? 210 GLY O N      1 
ATOM   7079   C  CA     . GLY B  2  211 ? 309.195 215.151 272.621 1.00 85.43  ? 210 GLY O CA     1 
ATOM   7080   C  C      . GLY B  2  211 ? 308.801 214.345 271.407 1.00 83.86  ? 210 GLY O C      1 
ATOM   7081   O  O      . GLY B  2  211 ? 309.433 214.452 270.351 1.00 84.66  ? 210 GLY O O      1 
ATOM   7082   H  H      . GLY B  2  211 ? 311.098 214.779 272.336 1.00 74.37  ? 210 GLY O H      1 
ATOM   7083   H  HA2    . GLY B  2  211 ? 308.602 214.920 273.354 1.00 78.41  ? 210 GLY O HA2    1 
ATOM   7084   H  HA3    . GLY B  2  211 ? 309.087 216.093 272.418 1.00 78.41  ? 210 GLY O HA3    1 
ATOM   7085   N  N      . ILE B  2  212 ? 307.760 213.536 271.542 1.00 98.78  ? 211 ILE O N      1 
ATOM   7086   C  CA     . ILE B  2  212 ? 307.313 212.682 270.470 1.00 105.48 ? 211 ILE O CA     1 
ATOM   7087   C  C      . ILE B  2  212 ? 306.186 213.368 269.712 1.00 107.13 ? 211 ILE O C      1 
ATOM   7088   O  O      . ILE B  2  212 ? 305.698 214.429 270.096 1.00 120.34 ? 211 ILE O O      1 
ATOM   7089   C  CB     . ILE B  2  212 ? 306.872 211.289 270.981 1.00 122.17 ? 211 ILE O CB     1 
ATOM   7090   C  CG1    . ILE B  2  212 ? 305.686 211.416 271.950 1.00 128.23 ? 211 ILE O CG1    1 
ATOM   7091   C  CG2    . ILE B  2  212 ? 308.059 210.581 271.606 1.00 134.93 ? 211 ILE O CG2    1 
ATOM   7092   C  CD1    . ILE B  2  212 ? 304.976 210.103 272.253 1.00 132.74 ? 211 ILE O CD1    1 
ATOM   7093   H  H      . ILE B  2  212 ? 307.291 213.467 272.260 1.00 86.59  ? 211 ILE O H      1 
ATOM   7094   H  HA     . ILE B  2  212 ? 308.048 212.549 269.851 1.00 93.49  ? 211 ILE O HA     1 
ATOM   7095   H  HB     . ILE B  2  212 ? 306.580 210.767 270.217 1.00 109.66 ? 211 ILE O HB     1 
ATOM   7096   H  HG12   . ILE B  2  212 ? 306.010 211.777 272.791 1.00 116.12 ? 211 ILE O HG12   1 
ATOM   7097   H  HG13   . ILE B  2  212 ? 305.034 212.022 271.565 1.00 116.12 ? 211 ILE O HG13   1 
ATOM   7098   H  HG21   . ILE B  2  212 ? 307.775 209.710 271.924 1.00 121.26 ? 211 ILE O HG21   1 
ATOM   7099   H  HG22   . ILE B  2  212 ? 308.754 210.479 270.937 1.00 121.26 ? 211 ILE O HG22   1 
ATOM   7100   H  HG23   . ILE B  2  212 ? 308.389 211.113 272.347 1.00 121.26 ? 211 ILE O HG23   1 
ATOM   7101   H  HD11   . ILE B  2  212 ? 304.246 210.274 272.868 1.00 120.34 ? 211 ILE O HD11   1 
ATOM   7102   H  HD12   . ILE B  2  212 ? 304.632 209.733 271.425 1.00 120.34 ? 211 ILE O HD12   1 
ATOM   7103   H  HD13   . ILE B  2  212 ? 305.610 209.487 272.653 1.00 120.34 ? 211 ILE O HD13   1 
ATOM   7104   N  N      . CYS B  2  213 ? 305.759 212.738 268.626 1.00 85.85  ? 212 CYS O N      1 
ATOM   7105   C  CA     . CYS B  2  213 ? 304.806 213.309 267.696 1.00 80.89  ? 212 CYS O CA     1 
ATOM   7106   C  C      . CYS B  2  213 ? 304.272 212.176 266.824 1.00 84.07  ? 212 CYS O C      1 
ATOM   7107   O  O      . CYS B  2  213 ? 304.815 211.897 265.752 1.00 94.19  ? 212 CYS O O      1 
ATOM   7108   C  CB     . CYS B  2  213 ? 305.475 214.409 266.863 1.00 93.62  ? 212 CYS O CB     1 
ATOM   7109   S  SG     . CYS B  2  213 ? 304.509 215.085 265.508 1.00 95.92  ? 212 CYS O SG     1 
ATOM   7110   H  H      . CYS B  2  213 ? 306.019 211.949 268.402 1.00 81.79  ? 212 CYS O H      1 
ATOM   7111   H  HA     . CYS B  2  213 ? 304.065 213.699 268.186 1.00 77.86  ? 212 CYS O HA     1 
ATOM   7112   H  HB2    . CYS B  2  213 ? 305.696 215.146 267.455 1.00 90.94  ? 212 CYS O HB2    1 
ATOM   7113   H  HB3    . CYS B  2  213 ? 306.291 214.048 266.483 1.00 90.94  ? 212 CYS O HB3    1 
ATOM   7114   H  HG     . CYS B  2  213 ? 304.241 214.202 264.741 1.00 94.42  ? 212 CYS O HG     1 
ATOM   7115   N  N      . ASN B  2  214 ? 303.247 211.502 267.319 1.00 111.52 ? 213 ASN O N      1 
ATOM   7116   C  CA     . ASN B  2  214 ? 302.548 210.442 266.602 1.00 115.93 ? 213 ASN O CA     1 
ATOM   7117   C  C      . ASN B  2  214 ? 301.111 210.894 266.367 1.00 117.12 ? 213 ASN O C      1 
ATOM   7118   O  O      . ASN B  2  214 ? 300.710 211.987 266.777 1.00 123.10 ? 213 ASN O O      1 
ATOM   7119   C  CB     . ASN B  2  214 ? 302.612 209.132 267.392 1.00 113.36 ? 213 ASN O CB     1 
ATOM   7120   C  CG     . ASN B  2  214 ? 302.093 209.289 268.808 1.00 112.50 ? 213 ASN O CG     1 
ATOM   7121   O  OD1    . ASN B  2  214 ? 301.987 210.401 269.324 1.00 114.10 ? 213 ASN O OD1    1 
ATOM   7122   N  ND2    . ASN B  2  214 ? 301.773 208.171 269.448 1.00 112.62 ? 213 ASN O ND2    1 
ATOM   7123   H  H      . ASN B  2  214 ? 302.923 211.646 268.103 1.00 98.60  ? 213 ASN O H      1 
ATOM   7124   H  HA     . ASN B  2  214 ? 302.970 210.301 265.741 1.00 103.13 ? 213 ASN O HA     1 
ATOM   7125   H  HB2    . ASN B  2  214 ? 302.070 208.464 266.945 1.00 99.73  ? 213 ASN O HB2    1 
ATOM   7126   H  HB3    . ASN B  2  214 ? 303.535 208.836 267.441 1.00 99.73  ? 213 ASN O HB3    1 
ATOM   7127   H  HD21   . ASN B  2  214 ? 301.474 208.207 270.253 1.00 98.39  ? 213 ASN O HD21   1 
ATOM   7128   H  HD22   . ASN B  2  214 ? 301.866 207.411 269.057 1.00 98.39  ? 213 ASN O HD22   1 
ATOM   7129   N  N      . GLU B  2  215 ? 300.319 210.046 265.713 1.00 116.13 ? 214 GLU O N      1 
ATOM   7130   C  CA     . GLU B  2  215 ? 298.958 210.440 265.368 1.00 115.62 ? 214 GLU O CA     1 
ATOM   7131   C  C      . GLU B  2  215 ? 298.134 210.848 266.584 1.00 115.79 ? 214 GLU O C      1 
ATOM   7132   O  O      . GLU B  2  215 ? 297.035 211.389 266.413 1.00 114.76 ? 214 GLU O O      1 
ATOM   7133   C  CB     . GLU B  2  215 ? 298.237 209.307 264.634 1.00 121.02 ? 214 GLU O CB     1 
ATOM   7134   C  CG     . GLU B  2  215 ? 297.502 208.339 265.541 1.00 139.27 ? 214 GLU O CG     1 
ATOM   7135   C  CD     . GLU B  2  215 ? 298.399 207.775 266.616 1.00 164.75 ? 214 GLU O CD     1 
ATOM   7136   O  OE1    . GLU B  2  215 ? 297.996 207.819 267.799 1.00 163.38 ? 214 GLU O OE1    1 
ATOM   7137   O  OE2    . GLU B  2  215 ? 299.510 207.313 266.276 1.00 190.01 ? 214 GLU O OE2    1 
ATOM   7138   H  H      . GLU B  2  215 ? 300.541 209.254 265.462 1.00 103.43 ? 214 GLU O H      1 
ATOM   7139   H  HA     . GLU B  2  215 ? 298.997 211.202 264.769 1.00 103.89 ? 214 GLU O HA     1 
ATOM   7140   H  HB2    . GLU B  2  215 ? 297.586 209.694 264.028 1.00 109.39 ? 214 GLU O HB2    1 
ATOM   7141   H  HB3    . GLU B  2  215 ? 298.891 208.798 264.130 1.00 109.39 ? 214 GLU O HB3    1 
ATOM   7142   H  HG2    . GLU B  2  215 ? 296.768 208.803 265.973 1.00 127.34 ? 214 GLU O HG2    1 
ATOM   7143   H  HG3    . GLU B  2  215 ? 297.165 207.600 265.010 1.00 127.34 ? 214 GLU O HG3    1 
ATOM   7144   N  N      . ALA B  2  216 ? 298.614 210.584 267.797 1.00 102.70 ? 215 ALA O N      1 
ATOM   7145   C  CA     . ALA B  2  216 ? 297.935 211.060 268.990 1.00 91.25  ? 215 ALA O CA     1 
ATOM   7146   C  C      . ALA B  2  216 ? 298.235 212.520 269.290 1.00 81.75  ? 215 ALA O C      1 
ATOM   7147   O  O      . ALA B  2  216 ? 297.555 213.114 270.131 1.00 80.97  ? 215 ALA O O      1 
ATOM   7148   C  CB     . ALA B  2  216 ? 298.325 210.206 270.196 1.00 86.29  ? 215 ALA O CB     1 
ATOM   7149   H  H      . ALA B  2  216 ? 299.328 210.132 267.952 1.00 96.13  ? 215 ALA O H      1 
ATOM   7150   H  HA     . ALA B  2  216 ? 296.977 210.974 268.862 1.00 84.86  ? 215 ALA O HA     1 
ATOM   7151   H  HB1    . ALA B  2  216 ? 297.863 210.539 270.981 1.00 78.96  ? 215 ALA O HB1    1 
ATOM   7152   H  HB2    . ALA B  2  216 ? 298.070 209.286 270.027 1.00 78.96  ? 215 ALA O HB2    1 
ATOM   7153   H  HB3    . ALA B  2  216 ? 299.285 210.265 270.327 1.00 78.96  ? 215 ALA O HB3    1 
ATOM   7154   N  N      . GLY B  2  217 ? 299.222 213.105 268.637 1.00 112.90 ? 216 GLY O N      1 
ATOM   7155   C  CA     . GLY B  2  217 ? 299.542 214.500 268.841 1.00 112.87 ? 216 GLY O CA     1 
ATOM   7156   C  C      . GLY B  2  217 ? 300.894 214.684 269.507 1.00 123.62 ? 216 GLY O C      1 
ATOM   7157   O  O      . GLY B  2  217 ? 301.379 213.828 270.255 1.00 130.92 ? 216 GLY O O      1 
ATOM   7158   H  H      . GLY B  2  217 ? 299.727 212.710 268.064 1.00 105.21 ? 216 GLY O H      1 
ATOM   7159   H  HA2    . GLY B  2  217 ? 299.554 214.958 267.986 1.00 105.53 ? 216 GLY O HA2    1 
ATOM   7160   H  HA3    . GLY B  2  217 ? 298.864 214.909 269.401 1.00 105.53 ? 216 GLY O HA3    1 
ATOM   7161   N  N      . PHE B  2  218 ? 301.506 215.830 269.226 1.00 82.90  ? 217 PHE O N      1 
ATOM   7162   C  CA     . PHE B  2  218 ? 302.762 216.209 269.847 1.00 71.36  ? 217 PHE O CA     1 
ATOM   7163   C  C      . PHE B  2  218 ? 302.567 216.409 271.347 1.00 72.41  ? 217 PHE O C      1 
ATOM   7164   O  O      . PHE B  2  218 ? 301.464 216.660 271.832 1.00 79.60  ? 217 PHE O O      1 
ATOM   7165   C  CB     . PHE B  2  218 ? 303.293 217.480 269.189 1.00 67.79  ? 217 PHE O CB     1 
ATOM   7166   C  CG     . PHE B  2  218 ? 304.528 218.036 269.823 1.00 66.54  ? 217 PHE O CG     1 
ATOM   7167   C  CD1    . PHE B  2  218 ? 305.771 217.520 269.513 1.00 80.08  ? 217 PHE O CD1    1 
ATOM   7168   C  CD2    . PHE B  2  218 ? 304.449 219.092 270.712 1.00 65.53  ? 217 PHE O CD2    1 
ATOM   7169   C  CE1    . PHE B  2  218 ? 306.914 218.035 270.095 1.00 100.52 ? 217 PHE O CE1    1 
ATOM   7170   C  CE2    . PHE B  2  218 ? 305.584 219.617 271.293 1.00 96.81  ? 217 PHE O CE2    1 
ATOM   7171   C  CZ     . PHE B  2  218 ? 306.819 219.091 270.983 1.00 113.24 ? 217 PHE O CZ     1 
ATOM   7172   H  H      . PHE B  2  218 ? 301.205 216.413 268.670 1.00 78.85  ? 217 PHE O H      1 
ATOM   7173   H  HA     . PHE B  2  218 ? 303.413 215.501 269.714 1.00 66.63  ? 217 PHE O HA     1 
ATOM   7174   H  HB2    . PHE B  2  218 ? 303.500 217.286 268.261 1.00 63.50  ? 217 PHE O HB2    1 
ATOM   7175   H  HB3    . PHE B  2  218 ? 302.606 218.163 269.235 1.00 63.50  ? 217 PHE O HB3    1 
ATOM   7176   H  HD1    . PHE B  2  218 ? 305.839 216.810 268.916 1.00 74.41  ? 217 PHE O HD1    1 
ATOM   7177   H  HD2    . PHE B  2  218 ? 303.617 219.451 270.924 1.00 60.83  ? 217 PHE O HD2    1 
ATOM   7178   H  HE1    . PHE B  2  218 ? 307.746 217.679 269.882 1.00 94.28  ? 217 PHE O HE1    1 
ATOM   7179   H  HE2    . PHE B  2  218 ? 305.515 220.325 271.892 1.00 91.55  ? 217 PHE O HE2    1 
ATOM   7180   H  HZ     . PHE B  2  218 ? 307.586 219.441 271.375 1.00 107.22 ? 217 PHE O HZ     1 
ATOM   7181   N  N      . ARG B  2  219 ? 303.666 216.282 272.084 1.00 79.74  ? 218 ARG O N      1 
ATOM   7182   C  CA     . ARG B  2  219 ? 303.663 216.367 273.535 1.00 81.57  ? 218 ARG O CA     1 
ATOM   7183   C  C      . ARG B  2  219 ? 305.110 216.410 273.980 1.00 82.21  ? 218 ARG O C      1 
ATOM   7184   O  O      . ARG B  2  219 ? 306.018 216.107 273.207 1.00 81.65  ? 218 ARG O O      1 
ATOM   7185   C  CB     . ARG B  2  219 ? 302.946 215.172 274.171 1.00 84.68  ? 218 ARG O CB     1 
ATOM   7186   C  CG     . ARG B  2  219 ? 303.432 213.832 273.641 1.00 86.48  ? 218 ARG O CG     1 
ATOM   7187   C  CD     . ARG B  2  219 ? 302.725 212.641 274.276 1.00 89.70  ? 218 ARG O CD     1 
ATOM   7188   N  NE     . ARG B  2  219 ? 302.852 212.642 275.731 1.00 102.04 ? 218 ARG O NE     1 
ATOM   7189   C  CZ     . ARG B  2  219 ? 302.842 211.551 276.494 1.00 115.69 ? 218 ARG O CZ     1 
ATOM   7190   N  NH1    . ARG B  2  219 ? 302.729 210.340 275.958 1.00 114.08 ? 218 ARG O NH1    1 
ATOM   7191   N  NH2    . ARG B  2  219 ? 302.960 211.674 277.809 1.00 130.59 ? 218 ARG O NH2    1 
ATOM   7192   H  H      . ARG B  2  219 ? 304.447 216.143 271.753 1.00 62.59  ? 218 ARG O H      1 
ATOM   7193   H  HA     . ARG B  2  219 ? 303.223 217.184 273.817 1.00 64.00  ? 218 ARG O HA     1 
ATOM   7194   H  HB2    . ARG B  2  219 ? 303.098 215.187 275.129 1.00 66.78  ? 218 ARG O HB2    1 
ATOM   7195   H  HB3    . ARG B  2  219 ? 301.996 215.240 273.986 1.00 66.78  ? 218 ARG O HB3    1 
ATOM   7196   H  HG2    . ARG B  2  219 ? 303.274 213.797 272.684 1.00 67.94  ? 218 ARG O HG2    1 
ATOM   7197   H  HG3    . ARG B  2  219 ? 304.381 213.748 273.823 1.00 67.94  ? 218 ARG O HG3    1 
ATOM   7198   H  HD2    . ARG B  2  219 ? 301.781 212.676 274.055 1.00 70.81  ? 218 ARG O HD2    1 
ATOM   7199   H  HD3    . ARG B  2  219 ? 303.117 211.821 273.939 1.00 70.81  ? 218 ARG O HD3    1 
ATOM   7200   H  HE     . ARG B  2  219 ? 302.939 213.402 276.124 1.00 82.60  ? 218 ARG O HE     1 
ATOM   7201   H  HH11   . ARG B  2  219 ? 302.652 210.253 275.105 1.00 93.63  ? 218 ARG O HH11   1 
ATOM   7202   H  HH12   . ARG B  2  219 ? 302.727 209.644 276.463 1.00 93.63  ? 218 ARG O HH12   1 
ATOM   7203   H  HH21   . ARG B  2  219 ? 303.037 212.454 278.163 1.00 109.97 ? 218 ARG O HH21   1 
ATOM   7204   H  HH22   . ARG B  2  219 ? 302.960 210.973 278.308 1.00 109.97 ? 218 ARG O HH22   1 
ATOM   7205   N  N      . ARG B  2  220 ? 305.323 216.800 275.224 1.00 79.20  ? 219 ARG O N      1 
ATOM   7206   C  CA     . ARG B  2  220 ? 306.587 216.496 275.868 1.00 80.22  ? 219 ARG O CA     1 
ATOM   7207   C  C      . ARG B  2  220 ? 306.449 215.172 276.592 1.00 84.91  ? 219 ARG O C      1 
ATOM   7208   O  O      . ARG B  2  220 ? 305.358 214.792 277.027 1.00 94.50  ? 219 ARG O O      1 
ATOM   7209   C  CB     . ARG B  2  220 ? 307.008 217.573 276.863 1.00 79.78  ? 219 ARG O CB     1 
ATOM   7210   C  CG     . ARG B  2  220 ? 307.238 218.914 276.249 1.00 76.65  ? 219 ARG O CG     1 
ATOM   7211   C  CD     . ARG B  2  220 ? 307.464 219.960 277.318 1.00 76.74  ? 219 ARG O CD     1 
ATOM   7212   N  NE     . ARG B  2  220 ? 307.108 221.286 276.822 1.00 89.85  ? 219 ARG O NE     1 
ATOM   7213   C  CZ     . ARG B  2  220 ? 306.540 222.244 277.550 1.00 106.05 ? 219 ARG O CZ     1 
ATOM   7214   N  NH1    . ARG B  2  220 ? 306.240 222.043 278.829 1.00 119.97 ? 219 ARG O NH1    1 
ATOM   7215   N  NH2    . ARG B  2  220 ? 306.257 223.413 276.989 1.00 114.68 ? 219 ARG O NH2    1 
ATOM   7216   H  H      . ARG B  2  220 ? 304.763 217.235 275.711 1.00 74.85  ? 219 ARG O H      1 
ATOM   7217   H  HA     . ARG B  2  220 ? 307.281 216.409 275.195 1.00 74.86  ? 219 ARG O HA     1 
ATOM   7218   H  HB2    . ARG B  2  220 ? 306.312 217.670 277.531 1.00 74.33  ? 219 ARG O HB2    1 
ATOM   7219   H  HB3    . ARG B  2  220 ? 307.835 217.298 277.289 1.00 74.33  ? 219 ARG O HB3    1 
ATOM   7220   H  HG2    . ARG B  2  220 ? 308.025 218.879 275.683 1.00 71.83  ? 219 ARG O HG2    1 
ATOM   7221   H  HG3    . ARG B  2  220 ? 306.459 219.170 275.730 1.00 71.83  ? 219 ARG O HG3    1 
ATOM   7222   H  HD2    . ARG B  2  220 ? 306.909 219.761 278.088 1.00 71.88  ? 219 ARG O HD2    1 
ATOM   7223   H  HD3    . ARG B  2  220 ? 308.401 219.968 277.569 1.00 71.88  ? 219 ARG O HD3    1 
ATOM   7224   H  HE     . ARG B  2  220 ? 307.278 221.461 275.998 1.00 85.87  ? 219 ARG O HE     1 
ATOM   7225   H  HH11   . ARG B  2  220 ? 306.418 221.287 279.199 1.00 116.07 ? 219 ARG O HH11   1 
ATOM   7226   H  HH12   . ARG B  2  220 ? 305.871 222.670 279.288 1.00 116.07 ? 219 ARG O HH12   1 
ATOM   7227   H  HH21   . ARG B  2  220 ? 306.447 223.550 276.161 1.00 111.92 ? 219 ARG O HH21   1 
ATOM   7228   H  HH22   . ARG B  2  220 ? 305.889 224.035 277.454 1.00 111.92 ? 219 ARG O HH22   1 
ATOM   7229   N  N      . LEU B  2  221 ? 307.560 214.458 276.698 1.00 90.99  ? 220 LEU O N      1 
ATOM   7230   C  CA     . LEU B  2  221 ? 307.622 213.335 277.616 1.00 101.94 ? 220 LEU O CA     1 
ATOM   7231   C  C      . LEU B  2  221 ? 307.915 213.873 279.007 1.00 95.00  ? 220 LEU O C      1 
ATOM   7232   O  O      . LEU B  2  221 ? 308.824 214.689 279.191 1.00 90.09  ? 220 LEU O O      1 
ATOM   7233   C  CB     . LEU B  2  221 ? 308.686 212.328 277.177 1.00 116.76 ? 220 LEU O CB     1 
ATOM   7234   C  CG     . LEU B  2  221 ? 308.432 211.571 275.867 1.00 121.55 ? 220 LEU O CG     1 
ATOM   7235   C  CD1    . LEU B  2  221 ? 309.494 210.498 275.680 1.00 119.07 ? 220 LEU O CD1    1 
ATOM   7236   C  CD2    . LEU B  2  221 ? 307.035 210.955 275.816 1.00 132.52 ? 220 LEU O CD2    1 
ATOM   7237   H  H      . LEU B  2  221 ? 308.283 214.601 276.255 1.00 93.79  ? 220 LEU O H      1 
ATOM   7238   H  HA     . LEU B  2  221 ? 306.763 212.885 277.634 1.00 103.91 ? 220 LEU O HA     1 
ATOM   7239   H  HB2    . LEU B  2  221 ? 309.526 212.803 277.074 1.00 117.86 ? 220 LEU O HB2    1 
ATOM   7240   H  HB3    . LEU B  2  221 ? 308.779 211.664 277.877 1.00 117.86 ? 220 LEU O HB3    1 
ATOM   7241   H  HG     . LEU B  2  221 ? 308.507 212.193 275.127 1.00 122.88 ? 220 LEU O HG     1 
ATOM   7242   H  HD11   . LEU B  2  221 ? 309.323 210.027 274.850 1.00 119.40 ? 220 LEU O HD11   1 
ATOM   7243   H  HD12   . LEU B  2  221 ? 310.366 210.921 275.647 1.00 119.40 ? 220 LEU O HD12   1 
ATOM   7244   H  HD13   . LEU B  2  221 ? 309.453 209.880 276.426 1.00 119.40 ? 220 LEU O HD13   1 
ATOM   7245   H  HD21   . LEU B  2  221 ? 306.925 210.490 274.972 1.00 134.36 ? 220 LEU O HD21   1 
ATOM   7246   H  HD22   . LEU B  2  221 ? 306.938 210.331 276.553 1.00 134.36 ? 220 LEU O HD22   1 
ATOM   7247   H  HD23   . LEU B  2  221 ? 306.375 211.662 275.892 1.00 134.36 ? 220 LEU O HD23   1 
ATOM   7248   N  N      . THR B  2  222 ? 307.114 213.450 279.977 1.00 135.38 ? 221 THR O N      1 
ATOM   7249   C  CA     . THR B  2  222 ? 307.288 213.904 281.342 1.00 147.54 ? 221 THR O CA     1 
ATOM   7250   C  C      . THR B  2  222 ? 308.615 213.385 281.895 1.00 161.36 ? 221 THR O C      1 
ATOM   7251   O  O      . THR B  2  222 ? 309.112 212.344 281.455 1.00 175.57 ? 221 THR O O      1 
ATOM   7252   C  CB     . THR B  2  222 ? 306.128 213.413 282.200 1.00 150.65 ? 221 THR O CB     1 
ATOM   7253   O  OG1    . THR B  2  222 ? 306.037 211.986 282.100 1.00 169.66 ? 221 THR O OG1    1 
ATOM   7254   C  CG2    . THR B  2  222 ? 304.819 214.036 281.724 1.00 137.60 ? 221 THR O CG2    1 
ATOM   7255   H  H      . THR B  2  222 ? 306.462 212.899 279.867 1.00 113.00 ? 221 THR O H      1 
ATOM   7256   H  HA     . THR B  2  222 ? 307.301 214.874 281.364 1.00 124.79 ? 221 THR O HA     1 
ATOM   7257   H  HB     . THR B  2  222 ? 306.275 213.666 283.125 1.00 127.98 ? 221 THR O HB     1 
ATOM   7258   H  HG1    . THR B  2  222 ? 305.400 211.704 282.570 1.00 146.45 ? 221 THR O HG1    1 
ATOM   7259   H  HG21   . THR B  2  222 ? 304.083 213.721 282.272 1.00 116.06 ? 221 THR O HG21   1 
ATOM   7260   H  HG22   . THR B  2  222 ? 304.869 215.003 281.789 1.00 116.06 ? 221 THR O HG22   1 
ATOM   7261   H  HG23   . THR B  2  222 ? 304.651 213.791 280.801 1.00 116.06 ? 221 THR O HG23   1 
ATOM   7262   N  N      . PRO B  2  223 ? 309.208 214.088 282.878 1.00 109.86 ? 222 PRO O N      1 
ATOM   7263   C  CA     . PRO B  2  223 ? 310.531 213.678 283.372 1.00 109.83 ? 222 PRO O CA     1 
ATOM   7264   C  C      . PRO B  2  223 ? 310.584 212.212 283.767 1.00 124.72 ? 222 PRO O C      1 
ATOM   7265   O  O      . PRO B  2  223 ? 311.657 211.606 283.793 1.00 151.16 ? 222 PRO O O      1 
ATOM   7266   C  CB     . PRO B  2  223 ? 310.749 214.588 284.587 1.00 99.14  ? 222 PRO O CB     1 
ATOM   7267   C  CG     . PRO B  2  223 ? 309.386 214.985 285.005 1.00 99.29  ? 222 PRO O CG     1 
ATOM   7268   C  CD     . PRO B  2  223 ? 308.638 215.156 283.716 1.00 106.71 ? 222 PRO O CD     1 
ATOM   7269   H  HA     . PRO B  2  223 ? 311.213 213.859 282.706 1.00 115.50 ? 222 PRO O HA     1 
ATOM   7270   H  HB2    . PRO B  2  223 ? 311.195 214.093 285.292 1.00 104.65 ? 222 PRO O HB2    1 
ATOM   7271   H  HB3    . PRO B  2  223 ? 311.269 215.364 284.327 1.00 104.65 ? 222 PRO O HB3    1 
ATOM   7272   H  HG2    . PRO B  2  223 ? 308.989 214.283 285.545 1.00 105.56 ? 222 PRO O HG2    1 
ATOM   7273   H  HG3    . PRO B  2  223 ? 309.423 215.821 285.497 1.00 105.56 ? 222 PRO O HG3    1 
ATOM   7274   H  HD2    . PRO B  2  223 ? 307.688 215.013 283.852 1.00 113.93 ? 222 PRO O HD2    1 
ATOM   7275   H  HD3    . PRO B  2  223 ? 308.819 216.026 283.329 1.00 113.93 ? 222 PRO O HD3    1 
ATOM   7276   N  N      . THR B  2  224 ? 309.426 211.628 284.076 1.00 130.39 ? 223 THR O N      1 
ATOM   7277   C  CA     . THR B  2  224 ? 309.398 210.233 284.497 1.00 136.60 ? 223 THR O CA     1 
ATOM   7278   C  C      . THR B  2  224 ? 309.649 209.292 283.325 1.00 139.62 ? 223 THR O C      1 
ATOM   7279   O  O      . THR B  2  224 ? 310.434 208.344 283.442 1.00 153.93 ? 223 THR O O      1 
ATOM   7280   C  CB     . THR B  2  224 ? 308.060 209.911 285.156 1.00 131.53 ? 223 THR O CB     1 
ATOM   7281   O  OG1    . THR B  2  224 ? 307.692 210.979 286.037 1.00 127.69 ? 223 THR O OG1    1 
ATOM   7282   C  CG2    . THR B  2  224 ? 308.170 208.618 285.948 1.00 130.62 ? 223 THR O CG2    1 
ATOM   7283   H  H      . THR B  2  224 ? 308.657 212.012 284.050 1.00 120.78 ? 223 THR O H      1 
ATOM   7284   H  HA     . THR B  2  224 ? 310.098 210.088 285.153 1.00 126.21 ? 223 THR O HA     1 
ATOM   7285   H  HB     . THR B  2  224 ? 307.378 209.800 284.475 1.00 121.47 ? 223 THR O HB     1 
ATOM   7286   H  HG1    . THR B  2  224 ? 306.956 210.809 286.404 1.00 117.98 ? 223 THR O HG1    1 
ATOM   7287   H  HG21   . THR B  2  224 ? 307.320 208.413 286.368 1.00 119.59 ? 223 THR O HG21   1 
ATOM   7288   H  HG22   . THR B  2  224 ? 308.415 207.888 285.358 1.00 119.59 ? 223 THR O HG22   1 
ATOM   7289   H  HG23   . THR B  2  224 ? 308.847 208.708 286.637 1.00 119.59 ? 223 THR O HG23   1 
ATOM   7290   N  N      . GLU B  2  225 ? 308.992 209.533 282.188 1.00 141.19 ? 224 GLU O N      1 
ATOM   7291   C  CA     . GLU B  2  225 ? 309.176 208.662 281.032 1.00 148.35 ? 224 GLU O CA     1 
ATOM   7292   C  C      . GLU B  2  225 ? 310.614 208.681 280.547 1.00 155.91 ? 224 GLU O C      1 
ATOM   7293   O  O      . GLU B  2  225 ? 311.121 207.665 280.057 1.00 158.99 ? 224 GLU O O      1 
ATOM   7294   C  CB     . GLU B  2  225 ? 308.254 209.089 279.896 1.00 155.68 ? 224 GLU O CB     1 
ATOM   7295   C  CG     . GLU B  2  225 ? 306.788 208.930 280.190 1.00 172.76 ? 224 GLU O CG     1 
ATOM   7296   C  CD     . GLU B  2  225 ? 305.928 209.539 279.108 1.00 178.34 ? 224 GLU O CD     1 
ATOM   7297   O  OE1    . GLU B  2  225 ? 305.985 210.775 278.933 1.00 180.14 ? 224 GLU O OE1    1 
ATOM   7298   O  OE2    . GLU B  2  225 ? 305.210 208.779 278.423 1.00 179.03 ? 224 GLU O OE2    1 
ATOM   7299   H  H      . GLU B  2  225 ? 308.443 210.183 282.064 1.00 117.61 ? 224 GLU O H      1 
ATOM   7300   H  HA     . GLU B  2  225 ? 308.951 207.752 281.280 1.00 124.69 ? 224 GLU O HA     1 
ATOM   7301   H  HB2    . GLU B  2  225 ? 308.415 210.025 279.700 1.00 133.12 ? 224 GLU O HB2    1 
ATOM   7302   H  HB3    . GLU B  2  225 ? 308.456 208.552 279.114 1.00 133.12 ? 224 GLU O HB3    1 
ATOM   7303   H  HG2    . GLU B  2  225 ? 306.575 207.986 280.251 1.00 150.82 ? 224 GLU O HG2    1 
ATOM   7304   H  HG3    . GLU B  2  225 ? 306.581 209.375 281.027 1.00 150.82 ? 224 GLU O HG3    1 
ATOM   7305   N  N      . VAL B  2  226 ? 311.277 209.829 280.659 1.00 131.69 ? 225 VAL O N      1 
ATOM   7306   C  CA     . VAL B  2  226 ? 312.647 209.953 280.185 1.00 129.97 ? 225 VAL O CA     1 
ATOM   7307   C  C      . VAL B  2  226 ? 313.622 209.244 281.111 1.00 149.05 ? 225 VAL O C      1 
ATOM   7308   O  O      . VAL B  2  226 ? 314.718 208.868 280.678 1.00 160.02 ? 225 VAL O O      1 
ATOM   7309   C  CB     . VAL B  2  226 ? 312.980 211.444 280.025 1.00 108.49 ? 225 VAL O CB     1 
ATOM   7310   C  CG1    . VAL B  2  226 ? 314.454 211.662 279.732 1.00 107.38 ? 225 VAL O CG1    1 
ATOM   7311   C  CG2    . VAL B  2  226 ? 312.127 212.027 278.915 1.00 104.56 ? 225 VAL O CG2    1 
ATOM   7312   H  H      . VAL B  2  226 ? 310.956 210.547 281.006 1.00 116.08 ? 225 VAL O H      1 
ATOM   7313   H  HA     . VAL B  2  226 ? 312.714 209.538 279.311 1.00 113.81 ? 225 VAL O HA     1 
ATOM   7314   H  HB     . VAL B  2  226 ? 312.764 211.909 280.848 1.00 92.89  ? 225 VAL O HB     1 
ATOM   7315   H  HG11   . VAL B  2  226 ? 314.619 212.614 279.638 1.00 91.14  ? 225 VAL O HG11   1 
ATOM   7316   H  HG12   . VAL B  2  226 ? 314.978 211.306 280.466 1.00 91.14  ? 225 VAL O HG12   1 
ATOM   7317   H  HG13   . VAL B  2  226 ? 314.683 211.204 278.908 1.00 91.14  ? 225 VAL O HG13   1 
ATOM   7318   H  HG21   . VAL B  2  226 ? 312.339 212.968 278.815 1.00 90.09  ? 225 VAL O HG21   1 
ATOM   7319   H  HG22   . VAL B  2  226 ? 312.318 211.556 278.089 1.00 90.09  ? 225 VAL O HG22   1 
ATOM   7320   H  HG23   . VAL B  2  226 ? 311.191 211.921 279.147 1.00 90.09  ? 225 VAL O HG23   1 
ATOM   7321   N  N      . LYS B  2  227 ? 313.246 209.042 282.375 1.00 159.70 ? 226 LYS O N      1 
ATOM   7322   C  CA     . LYS B  2  227 ? 314.087 208.296 283.295 1.00 136.59 ? 226 LYS O CA     1 
ATOM   7323   C  C      . LYS B  2  227 ? 314.066 206.804 282.996 1.00 160.24 ? 226 LYS O C      1 
ATOM   7324   O  O      . LYS B  2  227 ? 315.022 206.101 283.338 1.00 170.48 ? 226 LYS O O      1 
ATOM   7325   C  CB     . LYS B  2  227 ? 313.632 208.566 284.732 1.00 139.70 ? 226 LYS O CB     1 
ATOM   7326   C  CG     . LYS B  2  227 ? 314.548 208.014 285.809 1.00 146.17 ? 226 LYS O CG     1 
ATOM   7327   C  CD     . LYS B  2  227 ? 315.964 208.562 285.691 1.00 147.61 ? 226 LYS O CD     1 
ATOM   7328   C  CE     . LYS B  2  227 ? 316.886 207.944 286.724 1.00 160.63 ? 226 LYS O CE     1 
ATOM   7329   N  NZ     . LYS B  2  227 ? 316.414 208.168 288.114 1.00 156.81 ? 226 LYS O NZ     1 
ATOM   7330   H  H      . LYS B  2  227 ? 312.510 209.326 282.717 1.00 127.36 ? 226 LYS O H      1 
ATOM   7331   H  HA     . LYS B  2  227 ? 315.002 208.606 283.207 1.00 103.08 ? 226 LYS O HA     1 
ATOM   7332   H  HB2    . LYS B  2  227 ? 313.573 209.525 284.862 1.00 106.05 ? 226 LYS O HB2    1 
ATOM   7333   H  HB3    . LYS B  2  227 ? 312.757 208.167 284.859 1.00 106.05 ? 226 LYS O HB3    1 
ATOM   7334   H  HG2    . LYS B  2  227 ? 314.200 208.261 286.680 1.00 111.33 ? 226 LYS O HG2    1 
ATOM   7335   H  HG3    . LYS B  2  227 ? 314.590 207.048 285.727 1.00 111.33 ? 226 LYS O HG3    1 
ATOM   7336   H  HD2    . LYS B  2  227 ? 316.314 208.358 284.810 1.00 112.26 ? 226 LYS O HD2    1 
ATOM   7337   H  HD3    . LYS B  2  227 ? 315.948 209.522 285.832 1.00 112.26 ? 226 LYS O HD3    1 
ATOM   7338   H  HE2    . LYS B  2  227 ? 316.936 206.988 286.573 1.00 124.05 ? 226 LYS O HE2    1 
ATOM   7339   H  HE3    . LYS B  2  227 ? 317.768 208.340 286.638 1.00 124.05 ? 226 LYS O HE3    1 
ATOM   7340   H  HZ1    . LYS B  2  227 ? 316.366 209.040 288.283 1.00 120.09 ? 226 LYS O HZ1    1 
ATOM   7341   H  HZ2    . LYS B  2  227 ? 315.695 207.669 288.276 1.00 120.09 ? 226 LYS O HZ2    1 
ATOM   7342   H  HZ3    . LYS B  2  227 ? 316.979 207.793 288.691 1.00 120.09 ? 226 LYS O HZ3    1 
ATOM   7343   N  N      . ASP B  2  228 ? 313.004 206.312 282.360 1.00 162.20 ? 227 ASP O N      1 
ATOM   7344   C  CA     . ASP B  2  228 ? 312.920 204.919 281.944 1.00 174.34 ? 227 ASP O CA     1 
ATOM   7345   C  C      . ASP B  2  228 ? 313.478 204.683 280.550 1.00 159.16 ? 227 ASP O C      1 
ATOM   7346   O  O      . ASP B  2  228 ? 313.659 203.525 280.164 1.00 161.77 ? 227 ASP O O      1 
ATOM   7347   C  CB     . ASP B  2  228 ? 311.468 204.436 281.983 1.00 195.76 ? 227 ASP O CB     1 
ATOM   7348   C  CG     . ASP B  2  228 ? 310.948 204.274 283.394 1.00 215.85 ? 227 ASP O CG     1 
ATOM   7349   O  OD1    . ASP B  2  228 ? 309.950 204.942 283.741 1.00 234.38 ? 227 ASP O OD1    1 
ATOM   7350   O  OD2    . ASP B  2  228 ? 311.538 203.473 284.152 1.00 211.90 ? 227 ASP O OD2    1 
ATOM   7351   H  H      . ASP B  2  228 ? 312.309 206.775 282.156 1.00 137.42 ? 227 ASP O H      1 
ATOM   7352   H  HA     . ASP B  2  228 ? 313.431 204.376 282.565 1.00 149.08 ? 227 ASP O HA     1 
ATOM   7353   H  HB2    . ASP B  2  228 ? 310.907 205.084 281.528 1.00 171.08 ? 227 ASP O HB2    1 
ATOM   7354   H  HB3    . ASP B  2  228 ? 311.409 203.575 281.540 1.00 171.08 ? 227 ASP O HB3    1 
ATOM   7355   N  N      . TYR B  2  229 ? 313.719 205.740 279.778 1.00 114.81 ? 228 TYR O N      1 
ATOM   7356   C  CA     . TYR B  2  229 ? 314.451 205.607 278.526 1.00 108.34 ? 228 TYR O CA     1 
ATOM   7357   C  C      . TYR B  2  229 ? 315.950 205.680 278.731 1.00 111.37 ? 228 TYR O C      1 
ATOM   7358   O  O      . TYR B  2  229 ? 316.701 204.993 278.029 1.00 121.09 ? 228 TYR O O      1 
ATOM   7359   C  CB     . TYR B  2  229 ? 314.028 206.693 277.538 1.00 102.02 ? 228 TYR O CB     1 
ATOM   7360   C  CG     . TYR B  2  229 ? 312.721 206.374 276.876 1.00 99.34  ? 228 TYR O CG     1 
ATOM   7361   C  CD1    . TYR B  2  229 ? 311.592 207.138 277.121 1.00 105.17 ? 228 TYR O CD1    1 
ATOM   7362   C  CD2    . TYR B  2  229 ? 312.610 205.281 276.029 1.00 100.59 ? 228 TYR O CD2    1 
ATOM   7363   C  CE1    . TYR B  2  229 ? 310.389 206.835 276.525 1.00 110.15 ? 228 TYR O CE1    1 
ATOM   7364   C  CE2    . TYR B  2  229 ? 311.417 204.965 275.428 1.00 117.23 ? 228 TYR O CE2    1 
ATOM   7365   C  CZ     . TYR B  2  229 ? 310.306 205.744 275.678 1.00 115.52 ? 228 TYR O CZ     1 
ATOM   7366   O  OH     . TYR B  2  229 ? 309.114 205.426 275.073 1.00 126.54 ? 228 TYR O OH     1 
ATOM   7367   H  H      . TYR B  2  229 ? 313.469 206.543 279.958 1.00 107.18 ? 228 TYR O H      1 
ATOM   7368   H  HA     . TYR B  2  229 ? 314.245 204.746 278.131 1.00 100.65 ? 228 TYR O HA     1 
ATOM   7369   H  HB2    . TYR B  2  229 ? 313.930 207.534 278.012 1.00 95.44  ? 228 TYR O HB2    1 
ATOM   7370   H  HB3    . TYR B  2  229 ? 314.704 206.777 276.848 1.00 95.44  ? 228 TYR O HB3    1 
ATOM   7371   H  HD1    . TYR B  2  229 ? 311.650 207.871 277.691 1.00 100.36 ? 228 TYR O HD1    1 
ATOM   7372   H  HD2    . TYR B  2  229 ? 313.359 204.755 275.861 1.00 94.66  ? 228 TYR O HD2    1 
ATOM   7373   H  HE1    . TYR B  2  229 ? 309.638 207.358 276.691 1.00 106.08 ? 228 TYR O HE1    1 
ATOM   7374   H  HE2    . TYR B  2  229 ? 311.358 204.233 274.857 1.00 112.04 ? 228 TYR O HE2    1 
ATOM   7375   H  HH     . TYR B  2  229 ? 309.209 204.746 274.590 1.00 123.01 ? 228 TYR O HH     1 
ATOM   7376   N  N      . LEU B  2  230 ? 316.400 206.493 279.682 1.00 141.50 ? 229 LEU O N      1 
ATOM   7377   C  CA     . LEU B  2  230 ? 317.820 206.548 279.989 1.00 148.21 ? 229 LEU O CA     1 
ATOM   7378   C  C      . LEU B  2  230 ? 318.301 205.219 280.556 1.00 149.05 ? 229 LEU O C      1 
ATOM   7379   O  O      . LEU B  2  230 ? 319.251 204.621 280.038 1.00 148.75 ? 229 LEU O O      1 
ATOM   7380   C  CB     . LEU B  2  230 ? 318.085 207.702 280.956 1.00 156.43 ? 229 LEU O CB     1 
ATOM   7381   C  CG     . LEU B  2  230 ? 317.887 209.068 280.292 1.00 152.89 ? 229 LEU O CG     1 
ATOM   7382   C  CD1    . LEU B  2  230 ? 317.865 210.190 281.317 1.00 156.14 ? 229 LEU O CD1    1 
ATOM   7383   C  CD2    . LEU B  2  230 ? 318.971 209.311 279.248 1.00 150.95 ? 229 LEU O CD2    1 
ATOM   7384   H  H      . LEU B  2  230 ? 315.908 207.015 280.157 1.00 116.06 ? 229 LEU O H      1 
ATOM   7385   H  HA     . LEU B  2  230 ? 318.313 206.721 279.173 1.00 121.84 ? 229 LEU O HA     1 
ATOM   7386   H  HB2    . LEU B  2  230 ? 317.472 207.638 281.704 1.00 130.13 ? 229 LEU O HB2    1 
ATOM   7387   H  HB3    . LEU B  2  230 ? 319.002 207.649 281.270 1.00 130.13 ? 229 LEU O HB3    1 
ATOM   7388   H  HG     . LEU B  2  230 ? 317.032 209.070 279.835 1.00 127.60 ? 229 LEU O HG     1 
ATOM   7389   H  HD11   . LEU B  2  230 ? 317.738 211.035 280.858 1.00 131.05 ? 229 LEU O HD11   1 
ATOM   7390   H  HD12   . LEU B  2  230 ? 317.135 210.037 281.937 1.00 131.05 ? 229 LEU O HD12   1 
ATOM   7391   H  HD13   . LEU B  2  230 ? 318.709 210.197 281.796 1.00 131.05 ? 229 LEU O HD13   1 
ATOM   7392   H  HD21   . LEU B  2  230 ? 318.827 210.179 278.840 1.00 125.48 ? 229 LEU O HD21   1 
ATOM   7393   H  HD22   . LEU B  2  230 ? 319.838 209.288 279.682 1.00 125.48 ? 229 LEU O HD22   1 
ATOM   7394   H  HD23   . LEU B  2  230 ? 318.920 208.616 278.573 1.00 125.48 ? 229 LEU O HD23   1 
ATOM   7395   N  N      . ALA B  2  231 ? 317.645 204.731 281.610 1.00 165.43 ? 230 ALA O N      1 
ATOM   7396   C  CA     . ALA B  2  231 ? 317.946 203.396 282.114 1.00 177.97 ? 230 ALA O CA     1 
ATOM   7397   C  C      . ALA B  2  231 ? 317.863 202.361 280.996 1.00 182.28 ? 230 ALA O C      1 
ATOM   7398   O  O      . ALA B  2  231 ? 318.848 201.684 280.684 1.00 187.52 ? 230 ALA O O      1 
ATOM   7399   C  CB     . ALA B  2  231 ? 316.986 203.040 283.252 1.00 173.73 ? 230 ALA O CB     1 
ATOM   7400   H  H      . ALA B  2  231 ? 317.030 205.148 282.043 1.00 132.76 ? 230 ALA O H      1 
ATOM   7401   H  HA     . ALA B  2  231 ? 318.849 203.386 282.467 1.00 144.26 ? 230 ALA O HA     1 
ATOM   7402   H  HB1    . ALA B  2  231 ? 317.198 202.150 283.576 1.00 140.02 ? 230 ALA O HB1    1 
ATOM   7403   H  HB2    . ALA B  2  231 ? 317.090 203.687 283.967 1.00 140.02 ? 230 ALA O HB2    1 
ATOM   7404   H  HB3    . ALA B  2  231 ? 316.076 203.061 282.915 1.00 140.02 ? 230 ALA O HB3    1 
ATOM   7405   N  N      . ALA B  2  232 ? 316.686 202.256 280.367 1.00 210.85 ? 231 ALA O N      1 
ATOM   7406   C  CA     . ALA B  2  232 ? 316.342 201.213 279.402 1.00 220.74 ? 231 ALA O CA     1 
ATOM   7407   C  C      . ALA B  2  232 ? 315.891 199.946 280.128 1.00 269.94 ? 231 ALA O C      1 
ATOM   7408   O  O      . ALA B  2  232 ? 316.460 198.869 279.919 1.00 289.89 ? 231 ALA O O      1 
ATOM   7409   C  CB     . ALA B  2  232 ? 317.509 200.916 278.445 1.00 183.14 ? 231 ALA O CB     1 
ATOM   7410   H  H      . ALA B  2  232 ? 316.041 202.809 280.495 1.00 177.09 ? 231 ALA O H      1 
ATOM   7411   H  HA     . ALA B  2  232 ? 315.596 201.523 278.865 1.00 186.99 ? 231 ALA O HA     1 
ATOM   7412   H  HB1    . ALA B  2  232 ? 317.240 200.222 277.824 1.00 148.85 ? 231 ALA O HB1    1 
ATOM   7413   H  HB2    . ALA B  2  232 ? 317.733 201.726 277.959 1.00 148.85 ? 231 ALA O HB2    1 
ATOM   7414   H  HB3    . ALA B  2  232 ? 318.274 200.619 278.963 1.00 148.85 ? 231 ALA O HB3    1 
ATOM   7415   N  N      . ILE B  2  233 ? 314.858 200.066 280.969 1.00 332.32 ? 232 ILE O N      1 
ATOM   7416   C  CA     . ILE B  2  233 ? 314.350 198.957 281.772 1.00 306.32 ? 232 ILE O CA     1 
ATOM   7417   C  C      . ILE B  2  233 ? 312.866 198.687 281.547 1.00 301.06 ? 232 ILE O C      1 
ATOM   7418   O  O      . ILE B  2  233 ? 312.323 197.756 282.156 1.00 252.17 ? 232 ILE O O      1 
ATOM   7419   C  CB     . ILE B  2  233 ? 314.613 199.182 283.279 1.00 272.70 ? 232 ILE O CB     1 
ATOM   7420   C  CG1    . ILE B  2  233 ? 314.076 200.550 283.725 1.00 251.70 ? 232 ILE O CG1    1 
ATOM   7421   C  CG2    . ILE B  2  233 ? 316.099 199.005 283.616 1.00 261.10 ? 232 ILE O CG2    1 
ATOM   7422   C  CD1    . ILE B  2  233 ? 314.267 200.859 285.209 1.00 247.35 ? 232 ILE O CD1    1 
ATOM   7423   H  H      . ILE B  2  233 ? 314.428 200.800 281.092 1.00 267.04 ? 232 ILE O H      1 
ATOM   7424   H  HA     . ILE B  2  233 ? 314.829 198.154 281.515 1.00 240.48 ? 232 ILE O HA     1 
ATOM   7425   H  HB     . ILE B  2  233 ? 314.121 198.503 283.766 1.00 206.27 ? 232 ILE O HB     1 
ATOM   7426   H  HG12   . ILE B  2  233 ? 314.533 201.241 283.220 1.00 186.13 ? 232 ILE O HG12   1 
ATOM   7427   H  HG13   . ILE B  2  233 ? 313.125 200.585 283.538 1.00 186.13 ? 232 ILE O HG13   1 
ATOM   7428   H  HG21   . ILE B  2  233 ? 316.227 199.153 284.566 1.00 193.55 ? 232 ILE O HG21   1 
ATOM   7429   H  HG22   . ILE B  2  233 ? 316.370 198.103 283.381 1.00 193.55 ? 232 ILE O HG22   1 
ATOM   7430   H  HG23   . ILE B  2  233 ? 316.617 199.649 283.107 1.00 193.55 ? 232 ILE O HG23   1 
ATOM   7431   H  HD11   . ILE B  2  233 ? 313.901 201.737 285.398 1.00 181.27 ? 232 ILE O HD11   1 
ATOM   7432   H  HD12   . ILE B  2  233 ? 313.804 200.186 285.733 1.00 181.27 ? 232 ILE O HD12   1 
ATOM   7433   H  HD13   . ILE B  2  233 ? 315.215 200.844 285.414 1.00 181.27 ? 232 ILE O HD13   1 
ATOM   7434   N  N      . ALA B  2  234 ? 312.188 199.458 280.698 1.00 410.60 ? 233 ALA O N      1 
ATOM   7435   C  CA     . ALA B  2  234 ? 310.735 199.319 280.553 1.00 375.20 ? 233 ALA O CA     1 
ATOM   7436   C  C      . ALA B  2  234 ? 310.336 197.973 279.955 1.00 347.05 ? 233 ALA O C      1 
ATOM   7437   O  O      . ALA B  2  234 ? 311.144 197.053 279.838 1.00 341.17 ? 233 ALA O O      1 
ATOM   7438   C  CB     . ALA B  2  234 ? 310.180 200.439 279.704 1.00 333.98 ? 233 ALA O CB     1 
ATOM   7439   O  OXT    . ALA B  2  234 ? 309.178 197.770 279.585 1.00 335.65 ? 233 ALA O OXT    1 
ATOM   7440   H  H      . ALA B  2  234 ? 312.539 200.064 280.199 1.00 216.44 ? 233 ALA O H      1 
ATOM   7441   H  HA     . ALA B  2  234 ? 310.327 199.384 281.431 1.00 181.88 ? 233 ALA O HA     1 
ATOM   7442   H  HB1    . ALA B  2  234 ? 309.220 200.327 279.622 1.00 141.85 ? 233 ALA O HB1    1 
ATOM   7443   H  HB2    . ALA B  2  234 ? 310.379 201.287 280.131 1.00 141.85 ? 233 ALA O HB2    1 
ATOM   7444   H  HB3    . ALA B  2  234 ? 310.594 200.405 278.827 1.00 141.85 ? 233 ALA O HB3    1 
ATOM   7445   N  N      . SER C  3  2   ? 320.673 256.878 260.165 1.00 102.13 ? 2   SER P N      1 
ATOM   7446   C  CA     . SER C  3  2   ? 322.101 257.152 260.035 1.00 104.55 ? 2   SER P CA     1 
ATOM   7447   C  C      . SER C  3  2   ? 322.610 256.907 258.628 1.00 84.25  ? 2   SER P C      1 
ATOM   7448   O  O      . SER C  3  2   ? 322.083 256.066 257.909 1.00 81.37  ? 2   SER P O      1 
ATOM   7449   C  CB     . SER C  3  2   ? 322.906 256.289 261.001 1.00 88.04  ? 2   SER P CB     1 
ATOM   7450   O  OG     . SER C  3  2   ? 322.699 256.691 262.338 1.00 90.53  ? 2   SER P OG     1 
ATOM   7451   H  HA     . SER C  3  2   ? 322.265 258.082 260.256 1.00 100.46 ? 2   SER P HA     1 
ATOM   7452   H  HB2    . SER C  3  2   ? 322.628 255.365 260.903 1.00 83.66  ? 2   SER P HB2    1 
ATOM   7453   H  HB3    . SER C  3  2   ? 323.849 256.375 260.789 1.00 83.66  ? 2   SER P HB3    1 
ATOM   7454   H  HG     . SER C  3  2   ? 323.148 256.205 262.856 1.00 86.28  ? 2   SER P HG     1 
ATOM   7455   N  N      . ARG C  3  3   ? 323.648 257.646 258.243 1.00 100.26 ? 3   ARG P N      1 
ATOM   7456   C  CA     . ARG C  3  3   ? 324.342 257.411 256.988 1.00 110.25 ? 3   ARG P CA     1 
ATOM   7457   C  C      . ARG C  3  3   ? 325.669 256.703 257.180 1.00 115.62 ? 3   ARG P C      1 
ATOM   7458   O  O      . ARG C  3  3   ? 326.225 256.179 256.209 1.00 127.80 ? 3   ARG P O      1 
ATOM   7459   C  CB     . ARG C  3  3   ? 324.588 258.735 256.254 1.00 114.73 ? 3   ARG P CB     1 
ATOM   7460   C  CG     . ARG C  3  3   ? 325.679 259.591 256.871 1.00 131.49 ? 3   ARG P CG     1 
ATOM   7461   C  CD     . ARG C  3  3   ? 325.728 260.939 256.195 1.00 145.40 ? 3   ARG P CD     1 
ATOM   7462   N  NE     . ARG C  3  3   ? 324.586 261.767 256.574 1.00 141.25 ? 3   ARG P NE     1 
ATOM   7463   C  CZ     . ARG C  3  3   ? 324.618 262.728 257.493 1.00 128.30 ? 3   ARG P CZ     1 
ATOM   7464   N  NH1    . ARG C  3  3   ? 325.743 263.012 258.142 1.00 134.36 ? 3   ARG P NH1    1 
ATOM   7465   N  NH2    . ARG C  3  3   ? 323.518 263.419 257.762 1.00 111.81 ? 3   ARG P NH2    1 
ATOM   7466   H  H      . ARG C  3  3   ? 323.970 258.298 258.701 1.00 94.10  ? 3   ARG P H      1 
ATOM   7467   H  HA     . ARG C  3  3   ? 323.786 256.854 256.421 1.00 103.79 ? 3   ARG P HA     1 
ATOM   7468   H  HB2    . ARG C  3  3   ? 324.846 258.541 255.340 1.00 108.23 ? 3   ARG P HB2    1 
ATOM   7469   H  HB3    . ARG C  3  3   ? 323.767 259.252 256.261 1.00 108.23 ? 3   ARG P HB3    1 
ATOM   7470   H  HG2    . ARG C  3  3   ? 325.492 259.726 257.813 1.00 124.71 ? 3   ARG P HG2    1 
ATOM   7471   H  HG3    . ARG C  3  3   ? 326.538 259.156 256.754 1.00 124.71 ? 3   ARG P HG3    1 
ATOM   7472   H  HD2    . ARG C  3  3   ? 326.540 261.401 256.458 1.00 138.65 ? 3   ARG P HD2    1 
ATOM   7473   H  HD3    . ARG C  3  3   ? 325.709 260.816 255.233 1.00 138.65 ? 3   ARG P HD3    1 
ATOM   7474   H  HE     . ARG C  3  3   ? 323.838 261.623 256.174 1.00 134.94 ? 3   ARG P HE     1 
ATOM   7475   H  HH11   . ARG C  3  3   ? 326.460 262.568 257.973 1.00 127.79 ? 3   ARG P HH11   1 
ATOM   7476   H  HH12   . ARG C  3  3   ? 325.753 263.636 258.733 1.00 127.79 ? 3   ARG P HH12   1 
ATOM   7477   H  HH21   . ARG C  3  3   ? 322.786 263.243 257.345 1.00 105.97 ? 3   ARG P HH21   1 
ATOM   7478   H  HH22   . ARG C  3  3   ? 323.535 264.043 258.353 1.00 105.97 ? 3   ARG P HH22   1 
ATOM   7479   N  N      . ARG C  3  4   ? 326.184 256.681 258.406 1.00 84.66  ? 4   ARG P N      1 
ATOM   7480   C  CA     . ARG C  3  4   ? 327.458 256.036 258.680 1.00 86.87  ? 4   ARG P CA     1 
ATOM   7481   C  C      . ARG C  3  4   ? 327.383 254.539 258.393 1.00 84.86  ? 4   ARG P C      1 
ATOM   7482   O  O      . ARG C  3  4   ? 328.243 253.986 257.701 1.00 85.19  ? 4   ARG P O      1 
ATOM   7483   C  CB     . ARG C  3  4   ? 327.838 256.321 260.130 1.00 90.19  ? 4   ARG P CB     1 
ATOM   7484   C  CG     . ARG C  3  4   ? 329.214 255.907 260.534 1.00 93.15  ? 4   ARG P CG     1 
ATOM   7485   C  CD     . ARG C  3  4   ? 329.313 255.914 262.039 1.00 95.87  ? 4   ARG P CD     1 
ATOM   7486   N  NE     . ARG C  3  4   ? 330.463 255.139 262.484 1.00 162.23 ? 4   ARG P NE     1 
ATOM   7487   C  CZ     . ARG C  3  4   ? 330.522 254.457 263.624 1.00 155.55 ? 4   ARG P CZ     1 
ATOM   7488   N  NH1    . ARG C  3  4   ? 329.492 254.433 264.465 1.00 153.94 ? 4   ARG P NH1    1 
ATOM   7489   N  NH2    . ARG C  3  4   ? 331.626 253.786 263.919 1.00 170.65 ? 4   ARG P NH2    1 
ATOM   7490   H  H      . ARG C  3  4   ? 325.812 257.033 259.096 1.00 82.32  ? 4   ARG P H      1 
ATOM   7491   H  HA     . ARG C  3  4   ? 328.140 256.420 258.107 1.00 84.05  ? 4   ARG P HA     1 
ATOM   7492   H  HB2    . ARG C  3  4   ? 327.765 257.276 260.284 1.00 87.33  ? 4   ARG P HB2    1 
ATOM   7493   H  HB3    . ARG C  3  4   ? 327.214 255.853 260.707 1.00 87.33  ? 4   ARG P HB3    1 
ATOM   7494   H  HG2    . ARG C  3  4   ? 329.393 255.009 260.214 1.00 89.79  ? 4   ARG P HG2    1 
ATOM   7495   H  HG3    . ARG C  3  4   ? 329.862 256.534 260.176 1.00 89.79  ? 4   ARG P HG3    1 
ATOM   7496   H  HD2    . ARG C  3  4   ? 329.419 256.827 262.351 1.00 92.53  ? 4   ARG P HD2    1 
ATOM   7497   H  HD3    . ARG C  3  4   ? 328.512 255.519 262.417 1.00 92.53  ? 4   ARG P HD3    1 
ATOM   7498   H  HE     . ARG C  3  4   ? 331.154 255.121 261.972 1.00 158.43 ? 4   ARG P HE     1 
ATOM   7499   H  HH11   . ARG C  3  4   ? 328.774 254.866 264.277 1.00 150.48 ? 4   ARG P HH11   1 
ATOM   7500   H  HH12   . ARG C  3  4   ? 329.546 253.986 265.197 1.00 150.48 ? 4   ARG P HH12   1 
ATOM   7501   H  HH21   . ARG C  3  4   ? 332.294 253.798 263.378 1.00 166.36 ? 4   ARG P HH21   1 
ATOM   7502   H  HH22   . ARG C  3  4   ? 331.675 253.341 264.653 1.00 166.36 ? 4   ARG P HH22   1 
ATOM   7503   N  N      . TYR C  3  5   ? 326.347 253.869 258.900 1.00 94.32  ? 5   TYR P N      1 
ATOM   7504   C  CA     . TYR C  3  5   ? 326.209 252.428 258.718 1.00 92.64  ? 5   TYR P CA     1 
ATOM   7505   C  C      . TYR C  3  5   ? 325.585 252.037 257.388 1.00 89.21  ? 5   TYR P C      1 
ATOM   7506   O  O      . TYR C  3  5   ? 325.454 250.838 257.122 1.00 95.43  ? 5   TYR P O      1 
ATOM   7507   C  CB     . TYR C  3  5   ? 325.355 251.815 259.829 1.00 92.37  ? 5   TYR P CB     1 
ATOM   7508   C  CG     . TYR C  3  5   ? 325.801 252.145 261.224 1.00 95.78  ? 5   TYR P CG     1 
ATOM   7509   C  CD1    . TYR C  3  5   ? 327.074 251.813 261.660 1.00 98.85  ? 5   TYR P CD1    1 
ATOM   7510   C  CD2    . TYR C  3  5   ? 324.943 252.767 262.116 1.00 96.21  ? 5   TYR P CD2    1 
ATOM   7511   C  CE1    . TYR C  3  5   ? 327.486 252.110 262.942 1.00 111.74 ? 5   TYR P CE1    1 
ATOM   7512   C  CE2    . TYR C  3  5   ? 325.345 253.068 263.401 1.00 99.62  ? 5   TYR P CE2    1 
ATOM   7513   C  CZ     . TYR C  3  5   ? 326.621 252.737 263.810 1.00 110.15 ? 5   TYR P CZ     1 
ATOM   7514   O  OH     . TYR C  3  5   ? 327.040 253.026 265.091 1.00 106.23 ? 5   TYR P OH     1 
ATOM   7515   H  H      . TYR C  3  5   ? 325.710 254.228 259.352 1.00 88.82  ? 5   TYR P H      1 
ATOM   7516   H  HA     . TYR C  3  5   ? 327.089 252.023 258.763 1.00 87.04  ? 5   TYR P HA     1 
ATOM   7517   H  HB2    . TYR C  3  5   ? 324.444 252.134 259.730 1.00 87.06  ? 5   TYR P HB2    1 
ATOM   7518   H  HB3    . TYR C  3  5   ? 325.373 250.850 259.736 1.00 87.06  ? 5   TYR P HB3    1 
ATOM   7519   H  HD1    . TYR C  3  5   ? 327.662 251.392 261.076 1.00 93.02  ? 5   TYR P HD1    1 
ATOM   7520   H  HD2    . TYR C  3  5   ? 324.084 252.994 261.840 1.00 91.22  ? 5   TYR P HD2    1 
ATOM   7521   H  HE1    . TYR C  3  5   ? 328.345 251.886 263.220 1.00 105.84 ? 5   TYR P HE1    1 
ATOM   7522   H  HE2    . TYR C  3  5   ? 324.760 253.491 263.988 1.00 94.55  ? 5   TYR P HE2    1 
ATOM   7523   H  HH     . TYR C  3  5   ? 326.423 253.406 265.516 1.00 100.62 ? 5   TYR P HH     1 
ATOM   7524   N  N      . ASP C  3  6   ? 325.177 252.988 256.560 1.00 104.91 ? 6   ASP P N      1 
ATOM   7525   C  CA     . ASP C  3  6   ? 324.450 252.636 255.350 1.00 128.57 ? 6   ASP P CA     1 
ATOM   7526   C  C      . ASP C  3  6   ? 325.393 252.050 254.305 1.00 107.47 ? 6   ASP P C      1 
ATOM   7527   O  O      . ASP C  3  6   ? 326.523 252.518 254.127 1.00 108.53 ? 6   ASP P O      1 
ATOM   7528   C  CB     . ASP C  3  6   ? 323.728 253.861 254.782 1.00 144.42 ? 6   ASP P CB     1 
ATOM   7529   C  CG     . ASP C  3  6   ? 322.688 253.496 253.731 1.00 139.79 ? 6   ASP P CG     1 
ATOM   7530   O  OD1    . ASP C  3  6   ? 322.280 254.389 252.951 1.00 132.91 ? 6   ASP P OD1    1 
ATOM   7531   O  OD2    . ASP C  3  6   ? 322.283 252.314 253.686 1.00 132.92 ? 6   ASP P OD2    1 
ATOM   7532   H  H      . ASP C  3  6   ? 325.305 253.831 256.673 1.00 95.42  ? 6   ASP P H      1 
ATOM   7533   H  HA     . ASP C  3  6   ? 323.783 251.965 255.563 1.00 119.21 ? 6   ASP P HA     1 
ATOM   7534   H  HB2    . ASP C  3  6   ? 323.275 254.323 255.504 1.00 135.39 ? 6   ASP P HB2    1 
ATOM   7535   H  HB3    . ASP C  3  6   ? 324.379 254.448 254.368 1.00 135.39 ? 6   ASP P HB3    1 
ATOM   7536   N  N      . SER C  3  7   ? 324.921 251.011 253.620 1.00 97.83  ? 7   SER P N      1 
ATOM   7537   C  CA     . SER C  3  7   ? 325.595 250.445 252.451 1.00 98.50  ? 7   SER P CA     1 
ATOM   7538   C  C      . SER C  3  7   ? 324.742 250.810 251.251 1.00 115.47 ? 7   SER P C      1 
ATOM   7539   O  O      . SER C  3  7   ? 323.684 250.216 251.032 1.00 141.86 ? 7   SER P O      1 
ATOM   7540   C  CB     . SER C  3  7   ? 325.747 248.932 252.547 1.00 106.08 ? 7   SER P CB     1 
ATOM   7541   O  OG     . SER C  3  7   ? 326.381 248.532 253.742 1.00 140.13 ? 7   SER P OG     1 
ATOM   7542   H  H      . SER C  3  7   ? 324.190 250.604 253.818 1.00 89.57  ? 7   SER P H      1 
ATOM   7543   H  HA     . SER C  3  7   ? 326.473 250.845 252.349 1.00 89.85  ? 7   SER P HA     1 
ATOM   7544   H  HB2    . SER C  3  7   ? 324.866 248.528 252.512 1.00 97.20  ? 7   SER P HB2    1 
ATOM   7545   H  HB3    . SER C  3  7   ? 326.278 248.624 251.796 1.00 97.20  ? 7   SER P HB3    1 
ATOM   7546   H  HG     . SER C  3  7   ? 326.449 247.695 253.765 1.00 131.08 ? 7   SER P HG     1 
ATOM   7547   N  N      . ARG C  3  8   ? 325.188 251.787 250.481 1.00 106.96 ? 8   ARG P N      1 
ATOM   7548   C  CA     . ARG C  3  8   ? 324.412 252.204 249.325 1.00 108.46 ? 8   ARG P CA     1 
ATOM   7549   C  C      . ARG C  3  8   ? 324.414 251.084 248.297 1.00 106.23 ? 8   ARG P C      1 
ATOM   7550   O  O      . ARG C  3  8   ? 325.474 250.664 247.825 1.00 107.78 ? 8   ARG P O      1 
ATOM   7551   C  CB     . ARG C  3  8   ? 324.982 253.495 248.759 1.00 130.81 ? 8   ARG P CB     1 
ATOM   7552   C  CG     . ARG C  3  8   ? 325.073 254.563 249.821 1.00 151.61 ? 8   ARG P CG     1 
ATOM   7553   C  CD     . ARG C  3  8   ? 325.458 255.892 249.256 1.00 168.30 ? 8   ARG P CD     1 
ATOM   7554   N  NE     . ARG C  3  8   ? 325.272 256.947 250.243 1.00 168.07 ? 8   ARG P NE     1 
ATOM   7555   C  CZ     . ARG C  3  8   ? 325.345 258.243 249.969 1.00 158.29 ? 8   ARG P CZ     1 
ATOM   7556   N  NH1    . ARG C  3  8   ? 325.605 258.647 248.730 1.00 145.53 ? 8   ARG P NH1    1 
ATOM   7557   N  NH2    . ARG C  3  8   ? 325.153 259.134 250.931 1.00 162.44 ? 8   ARG P NH2    1 
ATOM   7558   H  H      . ARG C  3  8   ? 325.923 252.218 250.600 1.00 91.64  ? 8   ARG P H      1 
ATOM   7559   H  HA     . ARG C  3  8   ? 323.495 252.369 249.596 1.00 93.35  ? 8   ARG P HA     1 
ATOM   7560   H  HB2    . ARG C  3  8   ? 325.874 253.328 248.416 1.00 115.58 ? 8   ARG P HB2    1 
ATOM   7561   H  HB3    . ARG C  3  8   ? 324.403 253.817 248.050 1.00 115.58 ? 8   ARG P HB3    1 
ATOM   7562   H  HG2    . ARG C  3  8   ? 324.209 254.658 250.251 1.00 136.56 ? 8   ARG P HG2    1 
ATOM   7563   H  HG3    . ARG C  3  8   ? 325.744 254.307 250.473 1.00 136.56 ? 8   ARG P HG3    1 
ATOM   7564   H  HD2    . ARG C  3  8   ? 326.394 255.875 249.000 1.00 153.18 ? 8   ARG P HD2    1 
ATOM   7565   H  HD3    . ARG C  3  8   ? 324.901 256.090 248.488 1.00 153.18 ? 8   ARG P HD3    1 
ATOM   7566   H  HE     . ARG C  3  8   ? 325.045 256.717 251.040 1.00 153.20 ? 8   ARG P HE     1 
ATOM   7567   H  HH11   . ARG C  3  8   ? 325.727 258.069 248.106 1.00 130.54 ? 8   ARG P HH11   1 
ATOM   7568   H  HH12   . ARG C  3  8   ? 325.652 259.488 248.554 1.00 130.54 ? 8   ARG P HH12   1 
ATOM   7569   H  HH21   . ARG C  3  8   ? 324.986 258.872 251.733 1.00 147.83 ? 8   ARG P HH21   1 
ATOM   7570   H  HH22   . ARG C  3  8   ? 325.203 259.974 250.755 1.00 147.83 ? 8   ARG P HH22   1 
ATOM   7571   N  N      . THR C  3  9   ? 323.225 250.574 247.984 1.00 84.52  ? 9   THR P N      1 
ATOM   7572   C  CA     . THR C  3  9   ? 323.064 249.458 247.067 1.00 97.62  ? 9   THR P CA     1 
ATOM   7573   C  C      . THR C  3  9   ? 322.256 249.843 245.838 1.00 85.76  ? 9   THR P C      1 
ATOM   7574   O  O      . THR C  3  9   ? 322.051 249.002 244.956 1.00 84.76  ? 9   THR P O      1 
ATOM   7575   C  CB     . THR C  3  9   ? 322.386 248.280 247.777 1.00 116.61 ? 9   THR P CB     1 
ATOM   7576   O  OG1    . THR C  3  9   ? 321.145 248.713 248.346 1.00 121.24 ? 9   THR P OG1    1 
ATOM   7577   C  CG2    . THR C  3  9   ? 323.288 247.730 248.881 1.00 134.61 ? 9   THR P CG2    1 
ATOM   7578   H  H      . THR C  3  9   ? 322.481 250.868 248.299 1.00 78.74  ? 9   THR P H      1 
ATOM   7579   H  HA     . THR C  3  9   ? 323.940 249.166 246.770 1.00 91.66  ? 9   THR P HA     1 
ATOM   7580   H  HB     . THR C  3  9   ? 322.217 247.571 247.137 1.00 110.81 ? 9   THR P HB     1 
ATOM   7581   H  HG1    . THR C  3  9   ? 320.769 248.071 248.737 1.00 115.98 ? 9   THR P HG1    1 
ATOM   7582   H  HG21   . THR C  3  9   ? 322.852 246.986 249.324 1.00 128.55 ? 9   THR P HG21   1 
ATOM   7583   H  HG22   . THR C  3  9   ? 324.126 247.423 248.501 1.00 128.55 ? 9   THR P HG22   1 
ATOM   7584   H  HG23   . THR C  3  9   ? 323.472 248.423 249.534 1.00 128.55 ? 9   THR P HG23   1 
ATOM   7585   N  N      . THR C  3  10  ? 321.799 251.085 245.756 1.00 91.34  ? 10  THR P N      1 
ATOM   7586   C  CA     . THR C  3  10  ? 320.991 251.549 244.646 1.00 101.60 ? 10  THR P CA     1 
ATOM   7587   C  C      . THR C  3  10  ? 321.693 252.751 244.053 1.00 94.65  ? 10  THR P C      1 
ATOM   7588   O  O      . THR C  3  10  ? 321.095 253.814 243.888 1.00 112.55 ? 10  THR P O      1 
ATOM   7589   C  CB     . THR C  3  10  ? 319.583 251.913 245.121 1.00 123.79 ? 10  THR P CB     1 
ATOM   7590   O  OG1    . THR C  3  10  ? 319.676 252.912 246.143 1.00 153.56 ? 10  THR P OG1    1 
ATOM   7591   C  CG2    . THR C  3  10  ? 318.893 250.690 245.682 1.00 122.08 ? 10  THR P CG2    1 
ATOM   7592   H  H      . THR C  3  10  ? 321.950 251.690 246.348 1.00 93.95  ? 10  THR P H      1 
ATOM   7593   H  HA     . THR C  3  10  ? 320.926 250.856 243.970 1.00 104.41 ? 10  THR P HA     1 
ATOM   7594   H  HB     . THR C  3  10  ? 319.063 252.252 244.377 1.00 127.17 ? 10  THR P HB     1 
ATOM   7595   H  HG1    . THR C  3  10  ? 318.908 253.120 246.412 1.00 157.13 ? 10  THR P HG1    1 
ATOM   7596   H  HG21   . THR C  3  10  ? 318.000 250.922 245.983 1.00 125.61 ? 10  THR P HG21   1 
ATOM   7597   H  HG22   . THR C  3  10  ? 318.826 250.004 244.998 1.00 125.61 ? 10  THR P HG22   1 
ATOM   7598   H  HG23   . THR C  3  10  ? 319.397 250.339 246.432 1.00 125.61 ? 10  THR P HG23   1 
ATOM   7599   N  N      . ILE C  3  11  ? 322.979 252.598 243.759 1.00 62.21  ? 11  ILE P N      1 
ATOM   7600   C  CA     . ILE C  3  11  ? 323.826 253.709 243.350 1.00 64.77  ? 11  ILE P CA     1 
ATOM   7601   C  C      . ILE C  3  11  ? 324.741 253.214 242.246 1.00 66.09  ? 11  ILE P C      1 
ATOM   7602   O  O      . ILE C  3  11  ? 325.188 252.062 242.260 1.00 66.10  ? 11  ILE P O      1 
ATOM   7603   C  CB     . ILE C  3  11  ? 324.640 254.255 244.538 1.00 67.05  ? 11  ILE P CB     1 
ATOM   7604   C  CG1    . ILE C  3  11  ? 325.548 255.400 244.079 1.00 87.22  ? 11  ILE P CG1    1 
ATOM   7605   C  CG2    . ILE C  3  11  ? 325.457 253.136 245.165 1.00 67.87  ? 11  ILE P CG2    1 
ATOM   7606   C  CD1    . ILE C  3  11  ? 326.165 256.199 245.216 1.00 109.86 ? 11  ILE P CD1    1 
ATOM   7607   H  H      . ILE C  3  11  ? 323.392 251.845 243.790 1.00 59.88  ? 11  ILE P H      1 
ATOM   7608   H  HA     . ILE C  3  11  ? 323.275 254.426 242.998 1.00 62.22  ? 11  ILE P HA     1 
ATOM   7609   H  HB     . ILE C  3  11  ? 324.024 254.597 245.204 1.00 64.42  ? 11  ILE P HB     1 
ATOM   7610   H  HG12   . ILE C  3  11  ? 326.273 255.031 243.551 1.00 84.33  ? 11  ILE P HG12   1 
ATOM   7611   H  HG13   . ILE C  3  11  ? 325.027 256.013 243.537 1.00 84.33  ? 11  ILE P HG13   1 
ATOM   7612   H  HG21   . ILE C  3  11  ? 325.964 253.496 245.910 1.00 64.91  ? 11  ILE P HG21   1 
ATOM   7613   H  HG22   . ILE C  3  11  ? 324.855 252.443 245.478 1.00 64.91  ? 11  ILE P HG22   1 
ATOM   7614   H  HG23   . ILE C  3  11  ? 326.061 252.774 244.498 1.00 64.91  ? 11  ILE P HG23   1 
ATOM   7615   H  HD11   . ILE C  3  11  ? 326.722 256.900 244.843 1.00 106.97 ? 11  ILE P HD11   1 
ATOM   7616   H  HD12   . ILE C  3  11  ? 325.455 256.588 245.750 1.00 106.97 ? 11  ILE P HD12   1 
ATOM   7617   H  HD13   . ILE C  3  11  ? 326.703 255.605 245.763 1.00 106.97 ? 11  ILE P HD13   1 
ATOM   7618   N  N      . PHE C  3  12  ? 325.023 254.087 241.290 1.00 54.60  ? 12  PHE P N      1 
ATOM   7619   C  CA     . PHE C  3  12  ? 325.873 253.714 240.174 1.00 56.26  ? 12  PHE P CA     1 
ATOM   7620   C  C      . PHE C  3  12  ? 327.330 253.585 240.603 1.00 59.28  ? 12  PHE P C      1 
ATOM   7621   O  O      . PHE C  3  12  ? 327.773 254.195 241.582 1.00 60.68  ? 12  PHE P O      1 
ATOM   7622   C  CB     . PHE C  3  12  ? 325.759 254.756 239.063 1.00 57.40  ? 12  PHE P CB     1 
ATOM   7623   C  CG     . PHE C  3  12  ? 324.685 254.463 238.058 1.00 55.19  ? 12  PHE P CG     1 
ATOM   7624   C  CD1    . PHE C  3  12  ? 324.555 253.201 237.503 1.00 53.86  ? 12  PHE P CD1    1 
ATOM   7625   C  CD2    . PHE C  3  12  ? 323.806 255.454 237.667 1.00 54.71  ? 12  PHE P CD2    1 
ATOM   7626   C  CE1    . PHE C  3  12  ? 323.573 252.936 236.581 1.00 52.08  ? 12  PHE P CE1    1 
ATOM   7627   C  CE2    . PHE C  3  12  ? 322.815 255.194 236.744 1.00 52.92  ? 12  PHE P CE2    1 
ATOM   7628   C  CZ     . PHE C  3  12  ? 322.700 253.934 236.199 1.00 51.59  ? 12  PHE P CZ     1 
ATOM   7629   H  H      . PHE C  3  12  ? 324.735 254.897 241.264 1.00 64.28  ? 12  PHE P H      1 
ATOM   7630   H  HA     . PHE C  3  12  ? 325.583 252.859 239.821 1.00 65.43  ? 12  PHE P HA     1 
ATOM   7631   H  HB2    . PHE C  3  12  ? 325.562 255.617 239.463 1.00 66.56  ? 12  PHE P HB2    1 
ATOM   7632   H  HB3    . PHE C  3  12  ? 326.604 254.800 238.589 1.00 66.56  ? 12  PHE P HB3    1 
ATOM   7633   H  HD1    . PHE C  3  12  ? 325.142 252.525 237.756 1.00 63.04  ? 12  PHE P HD1    1 
ATOM   7634   H  HD2    . PHE C  3  12  ? 323.881 256.306 238.033 1.00 64.43  ? 12  PHE P HD2    1 
ATOM   7635   H  HE1    . PHE C  3  12  ? 323.495 252.085 236.215 1.00 61.42  ? 12  PHE P HE1    1 
ATOM   7636   H  HE2    . PHE C  3  12  ? 322.229 255.868 236.487 1.00 62.82  ? 12  PHE P HE2    1 
ATOM   7637   H  HZ     . PHE C  3  12  ? 322.033 253.756 235.576 1.00 61.30  ? 12  PHE P HZ     1 
ATOM   7638   N  N      . SER C  3  13  ? 328.087 252.761 239.846 1.00 144.86 ? 13  SER P N      1 
ATOM   7639   C  CA     . SER C  3  13  ? 329.539 252.729 239.932 1.00 144.31 ? 13  SER P CA     1 
ATOM   7640   C  C      . SER C  3  13  ? 330.132 253.804 239.032 1.00 143.74 ? 13  SER P C      1 
ATOM   7641   O  O      . SER C  3  13  ? 329.453 254.338 238.151 1.00 153.74 ? 13  SER P O      1 
ATOM   7642   C  CB     . SER C  3  13  ? 330.066 251.364 239.504 1.00 156.02 ? 13  SER P CB     1 
ATOM   7643   O  OG     . SER C  3  13  ? 329.400 250.321 240.191 1.00 171.99 ? 13  SER P OG     1 
ATOM   7644   H  H      . SER C  3  13  ? 327.765 252.208 239.272 1.00 126.24 ? 13  SER P H      1 
ATOM   7645   H  HA     . SER C  3  13  ? 329.817 252.899 240.845 1.00 125.16 ? 13  SER P HA     1 
ATOM   7646   H  HB2    . SER C  3  13  ? 329.921 251.256 238.551 1.00 136.43 ? 13  SER P HB2    1 
ATOM   7647   H  HB3    . SER C  3  13  ? 331.014 251.316 239.702 1.00 136.43 ? 13  SER P HB3    1 
ATOM   7648   H  HG     . SER C  3  13  ? 329.517 250.402 241.018 1.00 152.62 ? 13  SER P HG     1 
ATOM   7649   N  N      . PRO C  3  14  ? 331.405 254.142 239.221 1.00 87.28  ? 14  PRO P N      1 
ATOM   7650   C  CA     . PRO C  3  14  ? 332.041 255.115 238.317 1.00 96.12  ? 14  PRO P CA     1 
ATOM   7651   C  C      . PRO C  3  14  ? 332.116 254.643 236.877 1.00 95.38  ? 14  PRO P C      1 
ATOM   7652   O  O      . PRO C  3  14  ? 332.355 255.472 235.991 1.00 99.53  ? 14  PRO P O      1 
ATOM   7653   C  CB     . PRO C  3  14  ? 333.438 255.299 238.920 1.00 91.38  ? 14  PRO P CB     1 
ATOM   7654   C  CG     . PRO C  3  14  ? 333.284 254.907 240.354 1.00 89.99  ? 14  PRO P CG     1 
ATOM   7655   C  CD     . PRO C  3  14  ? 332.292 253.782 240.340 1.00 86.16  ? 14  PRO P CD     1 
ATOM   7656   H  HA     . PRO C  3  14  ? 331.567 255.961 238.350 1.00 93.73  ? 14  PRO P HA     1 
ATOM   7657   H  HB2    . PRO C  3  14  ? 334.069 254.717 238.469 1.00 88.56  ? 14  PRO P HB2    1 
ATOM   7658   H  HB3    . PRO C  3  14  ? 333.709 256.227 238.844 1.00 88.56  ? 14  PRO P HB3    1 
ATOM   7659   H  HG2    . PRO C  3  14  ? 334.138 254.609 240.705 1.00 87.40  ? 14  PRO P HG2    1 
ATOM   7660   H  HG3    . PRO C  3  14  ? 332.945 255.659 240.864 1.00 87.40  ? 14  PRO P HG3    1 
ATOM   7661   H  HD2    . PRO C  3  14  ? 332.737 252.939 240.163 1.00 83.83  ? 14  PRO P HD2    1 
ATOM   7662   H  HD3    . PRO C  3  14  ? 331.795 253.757 241.173 1.00 83.83  ? 14  PRO P HD3    1 
ATOM   7663   N  N      . GLU C  3  15  ? 331.928 253.355 236.609 1.00 132.64 ? 15  GLU P N      1 
ATOM   7664   C  CA     . GLU C  3  15  ? 331.950 252.840 235.250 1.00 133.45 ? 15  GLU P CA     1 
ATOM   7665   C  C      . GLU C  3  15  ? 330.564 252.602 234.684 1.00 131.96 ? 15  GLU P C      1 
ATOM   7666   O  O      . GLU C  3  15  ? 330.448 252.183 233.529 1.00 132.43 ? 15  GLU P O      1 
ATOM   7667   C  CB     . GLU C  3  15  ? 332.738 251.537 235.188 1.00 141.46 ? 15  GLU P CB     1 
ATOM   7668   C  CG     . GLU C  3  15  ? 334.212 251.731 235.375 1.00 174.34 ? 15  GLU P CG     1 
ATOM   7669   C  CD     . GLU C  3  15  ? 334.994 250.492 235.003 1.00 212.73 ? 15  GLU P CD     1 
ATOM   7670   O  OE1    . GLU C  3  15  ? 334.374 249.410 234.921 1.00 234.44 ? 15  GLU P OE1    1 
ATOM   7671   O  OE2    . GLU C  3  15  ? 336.222 250.602 234.784 1.00 222.22 ? 15  GLU P OE2    1 
ATOM   7672   H  H      . GLU C  3  15  ? 331.785 252.754 237.207 1.00 110.26 ? 15  GLU P H      1 
ATOM   7673   H  HA     . GLU C  3  15  ? 332.397 253.484 234.679 1.00 110.75 ? 15  GLU P HA     1 
ATOM   7674   H  HB2    . GLU C  3  15  ? 332.423 250.945 235.890 1.00 118.26 ? 15  GLU P HB2    1 
ATOM   7675   H  HB3    . GLU C  3  15  ? 332.598 251.126 234.321 1.00 118.26 ? 15  GLU P HB3    1 
ATOM   7676   H  HG2    . GLU C  3  15  ? 334.512 252.460 234.809 1.00 150.61 ? 15  GLU P HG2    1 
ATOM   7677   H  HG3    . GLU C  3  15  ? 334.391 251.935 236.306 1.00 150.61 ? 15  GLU P HG3    1 
ATOM   7678   N  N      . GLY C  3  16  ? 329.518 252.849 235.459 1.00 129.67 ? 16  GLY P N      1 
ATOM   7679   C  CA     . GLY C  3  16  ? 328.178 252.618 234.968 1.00 130.35 ? 16  GLY P CA     1 
ATOM   7680   C  C      . GLY C  3  16  ? 327.786 251.167 235.116 1.00 136.28 ? 16  GLY P C      1 
ATOM   7681   O  O      . GLY C  3  16  ? 327.462 250.495 234.132 1.00 152.32 ? 16  GLY P O      1 
ATOM   7682   H  H      . GLY C  3  16  ? 329.559 253.147 236.265 1.00 110.64 ? 16  GLY P H      1 
ATOM   7683   H  HA2    . GLY C  3  16  ? 327.549 253.163 235.466 1.00 111.71 ? 16  GLY P HA2    1 
ATOM   7684   H  HA3    . GLY C  3  16  ? 328.127 252.861 234.031 1.00 111.71 ? 16  GLY P HA3    1 
ATOM   7685   N  N      . ARG C  3  17  ? 327.842 250.665 236.344 1.00 117.85 ? 17  ARG P N      1 
ATOM   7686   C  CA     . ARG C  3  17  ? 327.326 249.346 236.664 1.00 115.16 ? 17  ARG P CA     1 
ATOM   7687   C  C      . ARG C  3  17  ? 326.686 249.394 238.044 1.00 118.27 ? 17  ARG P C      1 
ATOM   7688   O  O      . ARG C  3  17  ? 326.885 250.333 238.819 1.00 139.87 ? 17  ARG P O      1 
ATOM   7689   C  CB     . ARG C  3  17  ? 328.430 248.283 236.609 1.00 119.51 ? 17  ARG P CB     1 
ATOM   7690   C  CG     . ARG C  3  17  ? 329.107 248.165 235.252 1.00 128.38 ? 17  ARG P CG     1 
ATOM   7691   C  CD     . ARG C  3  17  ? 330.361 247.310 235.314 1.00 131.77 ? 17  ARG P CD     1 
ATOM   7692   N  NE     . ARG C  3  17  ? 331.358 247.904 236.202 1.00 131.02 ? 17  ARG P NE     1 
ATOM   7693   C  CZ     . ARG C  3  17  ? 331.605 247.508 237.448 1.00 128.08 ? 17  ARG P CZ     1 
ATOM   7694   N  NH1    . ARG C  3  17  ? 330.942 246.492 237.988 1.00 126.62 ? 17  ARG P NH1    1 
ATOM   7695   N  NH2    . ARG C  3  17  ? 332.530 248.134 238.161 1.00 129.77 ? 17  ARG P NH2    1 
ATOM   7696   H  H      . ARG C  3  17  ? 328.180 251.078 237.019 1.00 106.29 ? 17  ARG P H      1 
ATOM   7697   H  HA     . ARG C  3  17  ? 326.642 249.106 236.019 1.00 103.66 ? 17  ARG P HA     1 
ATOM   7698   H  HB2    . ARG C  3  17  ? 329.112 248.507 237.261 1.00 107.43 ? 17  ARG P HB2    1 
ATOM   7699   H  HB3    . ARG C  3  17  ? 328.043 247.419 236.822 1.00 107.43 ? 17  ARG P HB3    1 
ATOM   7700   H  HG2    . ARG C  3  17  ? 328.492 247.754 234.624 1.00 115.78 ? 17  ARG P HG2    1 
ATOM   7701   H  HG3    . ARG C  3  17  ? 329.359 249.049 234.944 1.00 115.78 ? 17  ARG P HG3    1 
ATOM   7702   H  HD2    . ARG C  3  17  ? 330.134 246.430 235.655 1.00 118.55 ? 17  ARG P HD2    1 
ATOM   7703   H  HD3    . ARG C  3  17  ? 330.746 247.238 234.427 1.00 118.55 ? 17  ARG P HD3    1 
ATOM   7704   H  HE     . ARG C  3  17  ? 331.821 248.561 235.895 1.00 117.67 ? 17  ARG P HE     1 
ATOM   7705   H  HH11   . ARG C  3  17  ? 330.339 246.082 237.533 1.00 113.53 ? 17  ARG P HH11   1 
ATOM   7706   H  HH12   . ARG C  3  17  ? 331.115 246.246 238.794 1.00 113.53 ? 17  ARG P HH12   1 
ATOM   7707   H  HH21   . ARG C  3  17  ? 332.966 248.791 237.818 1.00 116.33 ? 17  ARG P HH21   1 
ATOM   7708   H  HH22   . ARG C  3  17  ? 332.698 247.880 238.965 1.00 116.33 ? 17  ARG P HH22   1 
ATOM   7709   N  N      . LEU C  3  18  ? 325.901 248.364 238.339 1.00 84.41  ? 18  LEU P N      1 
ATOM   7710   C  CA     . LEU C  3  18  ? 325.237 248.196 239.626 1.00 81.69  ? 18  LEU P CA     1 
ATOM   7711   C  C      . LEU C  3  18  ? 325.961 247.081 240.363 1.00 88.07  ? 18  LEU P C      1 
ATOM   7712   O  O      . LEU C  3  18  ? 325.828 245.908 240.000 1.00 100.05 ? 18  LEU P O      1 
ATOM   7713   C  CB     . LEU C  3  18  ? 323.760 247.850 239.441 1.00 79.46  ? 18  LEU P CB     1 
ATOM   7714   C  CG     . LEU C  3  18  ? 322.709 248.965 239.366 1.00 95.01  ? 18  LEU P CG     1 
ATOM   7715   C  CD1    . LEU C  3  18  ? 322.594 249.672 240.710 1.00 124.33 ? 18  LEU P CD1    1 
ATOM   7716   C  CD2    . LEU C  3  18  ? 322.999 249.955 238.243 1.00 83.43  ? 18  LEU P CD2    1 
ATOM   7717   H  H      . LEU C  3  18  ? 325.732 247.725 237.787 1.00 77.23  ? 18  LEU P H      1 
ATOM   7718   H  HA     . LEU C  3  18  ? 325.306 249.013 240.144 1.00 74.94  ? 18  LEU P HA     1 
ATOM   7719   H  HB2    . LEU C  3  18  ? 323.683 247.345 238.616 1.00 73.16  ? 18  LEU P HB2    1 
ATOM   7720   H  HB3    . LEU C  3  18  ? 323.502 247.279 240.180 1.00 73.16  ? 18  LEU P HB3    1 
ATOM   7721   H  HG     . LEU C  3  18  ? 321.848 248.559 239.178 1.00 89.23  ? 18  LEU P HG     1 
ATOM   7722   H  HD11   . LEU C  3  18  ? 321.925 250.371 240.642 1.00 118.89 ? 18  LEU P HD11   1 
ATOM   7723   H  HD12   . LEU C  3  18  ? 322.330 249.026 241.384 1.00 118.89 ? 18  LEU P HD12   1 
ATOM   7724   H  HD13   . LEU C  3  18  ? 323.454 250.057 240.939 1.00 118.89 ? 18  LEU P HD13   1 
ATOM   7725   H  HD21   . LEU C  3  18  ? 322.309 250.636 238.238 1.00 77.51  ? 18  LEU P HD21   1 
ATOM   7726   H  HD22   . LEU C  3  18  ? 323.866 250.362 238.398 1.00 77.51  ? 18  LEU P HD22   1 
ATOM   7727   H  HD23   . LEU C  3  18  ? 323.002 249.480 237.397 1.00 77.51  ? 18  LEU P HD23   1 
ATOM   7728   N  N      . TYR C  3  19  ? 326.734 247.435 241.389 1.00 100.25 ? 19  TYR P N      1 
ATOM   7729   C  CA     . TYR C  3  19  ? 327.576 246.428 242.023 1.00 102.35 ? 19  TYR P CA     1 
ATOM   7730   C  C      . TYR C  3  19  ? 326.748 245.294 242.596 1.00 110.73 ? 19  TYR P C      1 
ATOM   7731   O  O      . TYR C  3  19  ? 327.110 244.120 242.456 1.00 138.61 ? 19  TYR P O      1 
ATOM   7732   C  CB     . TYR C  3  19  ? 328.432 247.057 243.118 1.00 100.82 ? 19  TYR P CB     1 
ATOM   7733   C  CG     . TYR C  3  19  ? 329.776 247.501 242.623 1.00 103.83 ? 19  TYR P CG     1 
ATOM   7734   C  CD1    . TYR C  3  19  ? 330.548 246.676 241.821 1.00 105.04 ? 19  TYR P CD1    1 
ATOM   7735   C  CD2    . TYR C  3  19  ? 330.267 248.755 242.942 1.00 136.60 ? 19  TYR P CD2    1 
ATOM   7736   C  CE1    . TYR C  3  19  ? 331.772 247.079 241.357 1.00 110.47 ? 19  TYR P CE1    1 
ATOM   7737   C  CE2    . TYR C  3  19  ? 331.495 249.173 242.485 1.00 148.99 ? 19  TYR P CE2    1 
ATOM   7738   C  CZ     . TYR C  3  19  ? 332.246 248.330 241.692 1.00 132.49 ? 19  TYR P CZ     1 
ATOM   7739   O  OH     . TYR C  3  19  ? 333.473 248.754 241.241 1.00 132.56 ? 19  TYR P OH     1 
ATOM   7740   H  H      . TYR C  3  19  ? 326.789 248.225 241.726 1.00 80.88  ? 19  TYR P H      1 
ATOM   7741   H  HA     . TYR C  3  19  ? 328.174 246.053 241.357 1.00 82.61  ? 19  TYR P HA     1 
ATOM   7742   H  HB2    . TYR C  3  19  ? 327.971 247.834 243.472 1.00 81.01  ? 19  TYR P HB2    1 
ATOM   7743   H  HB3    . TYR C  3  19  ? 328.572 246.405 243.823 1.00 81.01  ? 19  TYR P HB3    1 
ATOM   7744   H  HD1    . TYR C  3  19  ? 330.230 245.832 241.595 1.00 84.18  ? 19  TYR P HD1    1 
ATOM   7745   H  HD2    . TYR C  3  19  ? 329.761 249.323 243.477 1.00 116.32 ? 19  TYR P HD2    1 
ATOM   7746   H  HE1    . TYR C  3  19  ? 332.281 246.512 240.823 1.00 89.12  ? 19  TYR P HE1    1 
ATOM   7747   H  HE2    . TYR C  3  19  ? 331.817 250.016 242.709 1.00 128.23 ? 19  TYR P HE2    1 
ATOM   7748   H  HH     . TYR C  3  19  ? 333.629 249.531 241.522 1.00 110.77 ? 19  TYR P HH     1 
ATOM   7749   N  N      . GLN C  3  20  ? 325.631 245.618 243.241 1.00 85.68  ? 20  GLN P N      1 
ATOM   7750   C  CA     . GLN C  3  20  ? 324.854 244.570 243.883 1.00 83.16  ? 20  GLN P CA     1 
ATOM   7751   C  C      . GLN C  3  20  ? 324.265 243.610 242.865 1.00 103.82 ? 20  GLN P C      1 
ATOM   7752   O  O      . GLN C  3  20  ? 324.146 242.410 243.141 1.00 140.85 ? 20  GLN P O      1 
ATOM   7753   C  CB     . GLN C  3  20  ? 323.756 245.188 244.747 1.00 79.35  ? 20  GLN P CB     1 
ATOM   7754   C  CG     . GLN C  3  20  ? 324.285 245.834 246.015 1.00 82.12  ? 20  GLN P CG     1 
ATOM   7755   C  CD     . GLN C  3  20  ? 325.240 244.933 246.770 1.00 91.73  ? 20  GLN P CD     1 
ATOM   7756   O  OE1    . GLN C  3  20  ? 324.902 243.799 247.119 1.00 89.37  ? 20  GLN P OE1    1 
ATOM   7757   N  NE2    . GLN C  3  20  ? 326.452 245.428 247.010 1.00 104.12 ? 20  GLN P NE2    1 
ATOM   7758   H  H      . GLN C  3  20  ? 325.311 246.413 243.320 1.00 79.76  ? 20  GLN P H      1 
ATOM   7759   H  HA     . GLN C  3  20  ? 325.439 244.061 244.466 1.00 77.45  ? 20  GLN P HA     1 
ATOM   7760   H  HB2    . GLN C  3  20  ? 323.297 245.871 244.232 1.00 74.25  ? 20  GLN P HB2    1 
ATOM   7761   H  HB3    . GLN C  3  20  ? 323.130 244.493 245.005 1.00 74.25  ? 20  GLN P HB3    1 
ATOM   7762   H  HG2    . GLN C  3  20  ? 324.759 246.648 245.782 1.00 77.09  ? 20  GLN P HG2    1 
ATOM   7763   H  HG3    . GLN C  3  20  ? 323.539 246.040 246.601 1.00 77.09  ? 20  GLN P HG3    1 
ATOM   7764   H  HE21   . GLN C  3  20  ? 326.655 246.219 246.739 1.00 98.37  ? 20  GLN P HE21   1 
ATOM   7765   H  HE22   . GLN C  3  20  ? 327.033 244.957 247.435 1.00 98.37  ? 20  GLN P HE22   1 
ATOM   7766   N  N      . VAL C  3  21  ? 323.905 244.104 241.683 1.00 73.34  ? 21  VAL P N      1 
ATOM   7767   C  CA     . VAL C  3  21  ? 323.408 243.209 240.648 1.00 67.58  ? 21  VAL P CA     1 
ATOM   7768   C  C      . VAL C  3  21  ? 324.550 242.379 240.073 1.00 77.22  ? 21  VAL P C      1 
ATOM   7769   O  O      . VAL C  3  21  ? 324.350 241.220 239.694 1.00 93.58  ? 21  VAL P O      1 
ATOM   7770   C  CB     . VAL C  3  21  ? 322.680 244.018 239.563 1.00 68.31  ? 21  VAL P CB     1 
ATOM   7771   C  CG1    . VAL C  3  21  ? 322.163 243.102 238.470 1.00 71.61  ? 21  VAL P CG1    1 
ATOM   7772   C  CG2    . VAL C  3  21  ? 321.538 244.813 240.184 1.00 66.86  ? 21  VAL P CG2    1 
ATOM   7773   H  H      . VAL C  3  21  ? 323.940 244.934 241.460 1.00 73.13  ? 21  VAL P H      1 
ATOM   7774   H  HA     . VAL C  3  21  ? 322.766 242.598 241.043 1.00 67.24  ? 21  VAL P HA     1 
ATOM   7775   H  HB     . VAL C  3  21  ? 323.302 244.645 239.162 1.00 68.20  ? 21  VAL P HB     1 
ATOM   7776   H  HG11   . VAL C  3  21  ? 321.709 243.636 237.799 1.00 71.35  ? 21  VAL P HG11   1 
ATOM   7777   H  HG12   . VAL C  3  21  ? 322.913 242.635 238.069 1.00 71.35  ? 21  VAL P HG12   1 
ATOM   7778   H  HG13   . VAL C  3  21  ? 321.545 242.464 238.859 1.00 71.35  ? 21  VAL P HG13   1 
ATOM   7779   H  HG21   . VAL C  3  21  ? 321.089 245.317 239.488 1.00 67.37  ? 21  VAL P HG21   1 
ATOM   7780   H  HG22   . VAL C  3  21  ? 320.916 244.197 240.601 1.00 67.37  ? 21  VAL P HG22   1 
ATOM   7781   H  HG23   . VAL C  3  21  ? 321.901 245.418 240.850 1.00 67.37  ? 21  VAL P HG23   1 
ATOM   7782   N  N      . GLU C  3  22  ? 325.756 242.945 239.995 1.00 78.20  ? 22  GLU P N      1 
ATOM   7783   C  CA     . GLU C  3  22  ? 326.896 242.178 239.506 1.00 79.70  ? 22  GLU P CA     1 
ATOM   7784   C  C      . GLU C  3  22  ? 327.192 241.010 240.427 1.00 78.81  ? 22  GLU P C      1 
ATOM   7785   O  O      . GLU C  3  22  ? 327.401 239.880 239.970 1.00 78.95  ? 22  GLU P O      1 
ATOM   7786   C  CB     . GLU C  3  22  ? 328.129 243.077 239.385 1.00 91.73  ? 22  GLU P CB     1 
ATOM   7787   C  CG     . GLU C  3  22  ? 328.125 243.975 238.164 1.00 113.07 ? 22  GLU P CG     1 
ATOM   7788   C  CD     . GLU C  3  22  ? 328.105 243.190 236.860 1.00 135.97 ? 22  GLU P CD     1 
ATOM   7789   O  OE1    . GLU C  3  22  ? 329.158 243.138 236.184 1.00 139.01 ? 22  GLU P OE1    1 
ATOM   7790   O  OE2    . GLU C  3  22  ? 327.040 242.628 236.514 1.00 152.85 ? 22  GLU P OE2    1 
ATOM   7791   H  H      . GLU C  3  22  ? 325.936 243.756 240.215 1.00 76.91  ? 22  GLU P H      1 
ATOM   7792   H  HA     . GLU C  3  22  ? 326.689 241.826 238.627 1.00 77.77  ? 22  GLU P HA     1 
ATOM   7793   H  HB2    . GLU C  3  22  ? 328.179 243.645 240.169 1.00 89.47  ? 22  GLU P HB2    1 
ATOM   7794   H  HB3    . GLU C  3  22  ? 328.919 242.516 239.336 1.00 89.47  ? 22  GLU P HB3    1 
ATOM   7795   H  HG2    . GLU C  3  22  ? 327.336 244.538 238.189 1.00 110.76 ? 22  GLU P HG2    1 
ATOM   7796   H  HG3    . GLU C  3  22  ? 328.925 244.523 238.173 1.00 110.76 ? 22  GLU P HG3    1 
ATOM   7797   N  N      . TYR C  3  23  ? 327.219 241.270 241.733 1.00 80.95  ? 23  TYR P N      1 
ATOM   7798   C  CA     . TYR C  3  23  ? 327.491 240.212 242.699 1.00 81.76  ? 23  TYR P CA     1 
ATOM   7799   C  C      . TYR C  3  23  ? 326.375 239.179 242.729 1.00 85.18  ? 23  TYR P C      1 
ATOM   7800   O  O      . TYR C  3  23  ? 326.633 237.997 242.985 1.00 98.84  ? 23  TYR P O      1 
ATOM   7801   C  CB     . TYR C  3  23  ? 327.685 240.815 244.084 1.00 76.40  ? 23  TYR P CB     1 
ATOM   7802   C  CG     . TYR C  3  23  ? 328.864 241.752 244.209 1.00 78.74  ? 23  TYR P CG     1 
ATOM   7803   C  CD1    . TYR C  3  23  ? 329.843 241.825 243.223 1.00 82.66  ? 23  TYR P CD1    1 
ATOM   7804   C  CD2    . TYR C  3  23  ? 328.993 242.565 245.320 1.00 83.66  ? 23  TYR P CD2    1 
ATOM   7805   C  CE1    . TYR C  3  23  ? 330.916 242.685 243.352 1.00 89.87  ? 23  TYR P CE1    1 
ATOM   7806   C  CE2    . TYR C  3  23  ? 330.052 243.420 245.458 1.00 88.24  ? 23  TYR P CE2    1 
ATOM   7807   C  CZ     . TYR C  3  23  ? 331.010 243.479 244.477 1.00 91.22  ? 23  TYR P CZ     1 
ATOM   7808   O  OH     . TYR C  3  23  ? 332.061 244.344 244.638 1.00 93.08  ? 23  TYR P OH     1 
ATOM   7809   H  H      . TYR C  3  23  ? 327.084 242.045 242.082 1.00 78.16  ? 23  TYR P H      1 
ATOM   7810   H  HA     . TYR C  3  23  ? 328.313 239.760 242.450 1.00 78.82  ? 23  TYR P HA     1 
ATOM   7811   H  HB2    . TYR C  3  23  ? 326.887 241.315 244.318 1.00 73.71  ? 23  TYR P HB2    1 
ATOM   7812   H  HB3    . TYR C  3  23  ? 327.816 240.094 244.719 1.00 73.71  ? 23  TYR P HB3    1 
ATOM   7813   H  HD1    . TYR C  3  23  ? 329.775 241.287 242.468 1.00 79.20  ? 23  TYR P HD1    1 
ATOM   7814   H  HD2    . TYR C  3  23  ? 328.347 242.528 245.989 1.00 80.95  ? 23  TYR P HD2    1 
ATOM   7815   H  HE1    . TYR C  3  23  ? 331.567 242.728 242.689 1.00 86.16  ? 23  TYR P HE1    1 
ATOM   7816   H  HE2    . TYR C  3  23  ? 330.123 243.959 246.213 1.00 85.29  ? 23  TYR P HE2    1 
ATOM   7817   H  HH     . TYR C  3  23  ? 331.984 244.758 245.365 1.00 89.39  ? 23  TYR P HH     1 
ATOM   7818   N  N      . ALA C  3  24  ? 325.131 239.599 242.487 1.00 70.90  ? 24  ALA P N      1 
ATOM   7819   C  CA     . ALA C  3  24  ? 324.040 238.637 242.412 1.00 68.06  ? 24  ALA P CA     1 
ATOM   7820   C  C      . ALA C  3  24  ? 324.307 237.583 241.342 1.00 74.38  ? 24  ALA P C      1 
ATOM   7821   O  O      . ALA C  3  24  ? 323.922 236.421 241.504 1.00 90.41  ? 24  ALA P O      1 
ATOM   7822   C  CB     . ALA C  3  24  ? 322.722 239.363 242.141 1.00 66.31  ? 24  ALA P CB     1 
ATOM   7823   H  H      . ALA C  3  24  ? 324.900 240.419 242.364 1.00 66.43  ? 24  ALA P H      1 
ATOM   7824   H  HA     . ALA C  3  24  ? 323.961 238.183 243.266 1.00 63.80  ? 24  ALA P HA     1 
ATOM   7825   H  HB1    . ALA C  3  24  ? 322.006 238.711 242.094 1.00 62.62  ? 24  ALA P HB1    1 
ATOM   7826   H  HB2    . ALA C  3  24  ? 322.553 239.989 242.863 1.00 62.62  ? 24  ALA P HB2    1 
ATOM   7827   H  HB3    . ALA C  3  24  ? 322.792 239.839 241.299 1.00 62.62  ? 24  ALA P HB3    1 
ATOM   7828   N  N      . MET C  3  25  ? 324.975 237.963 240.251 1.00 76.90  ? 25  MET P N      1 
ATOM   7829   C  CA     . MET C  3  25  ? 325.333 236.993 239.225 1.00 77.95  ? 25  MET P CA     1 
ATOM   7830   C  C      . MET C  3  25  ? 326.239 235.906 239.787 1.00 86.16  ? 25  MET P C      1 
ATOM   7831   O  O      . MET C  3  25  ? 326.146 234.741 239.385 1.00 94.43  ? 25  MET P O      1 
ATOM   7832   C  CB     . MET C  3  25  ? 326.011 237.704 238.049 1.00 94.77  ? 25  MET P CB     1 
ATOM   7833   C  CG     . MET C  3  25  ? 325.209 238.852 237.477 1.00 102.67 ? 25  MET P CG     1 
ATOM   7834   S  SD     . MET C  3  25  ? 323.490 238.381 237.210 1.00 96.97  ? 25  MET P SD     1 
ATOM   7835   C  CE     . MET C  3  25  ? 322.871 239.823 236.348 1.00 104.70 ? 25  MET P CE     1 
ATOM   7836   H  H      . MET C  3  25  ? 325.230 238.768 240.086 1.00 74.54  ? 25  MET P H      1 
ATOM   7837   H  HA     . MET C  3  25  ? 324.521 236.580 238.891 1.00 75.08  ? 25  MET P HA     1 
ATOM   7838   H  HB2    . MET C  3  25  ? 326.863 238.058 238.348 1.00 91.58  ? 25  MET P HB2    1 
ATOM   7839   H  HB3    . MET C  3  25  ? 326.155 237.061 237.337 1.00 91.58  ? 25  MET P HB3    1 
ATOM   7840   H  HG2    . MET C  3  25  ? 325.228 239.597 238.099 1.00 99.91  ? 25  MET P HG2    1 
ATOM   7841   H  HG3    . MET C  3  25  ? 325.589 239.116 236.625 1.00 99.91  ? 25  MET P HG3    1 
ATOM   7842   H  HE1    . MET C  3  25  ? 321.933 239.690 236.144 1.00 102.79 ? 25  MET P HE1    1 
ATOM   7843   H  HE2    . MET C  3  25  ? 322.979 240.601 236.918 1.00 102.79 ? 25  MET P HE2    1 
ATOM   7844   H  HE3    . MET C  3  25  ? 323.376 239.941 235.528 1.00 102.79 ? 25  MET P HE3    1 
ATOM   7845   N  N      . GLU C  3  26  ? 327.120 236.265 240.722 1.00 99.57  ? 26  GLU P N      1 
ATOM   7846   C  CA     . GLU C  3  26  ? 328.037 235.281 241.290 1.00 123.91 ? 26  GLU P CA     1 
ATOM   7847   C  C      . GLU C  3  26  ? 327.305 234.274 242.163 1.00 131.45 ? 26  GLU P C      1 
ATOM   7848   O  O      . GLU C  3  26  ? 327.715 233.110 242.245 1.00 146.80 ? 26  GLU P O      1 
ATOM   7849   C  CB     . GLU C  3  26  ? 329.127 235.982 242.098 1.00 135.34 ? 26  GLU P CB     1 
ATOM   7850   C  CG     . GLU C  3  26  ? 329.737 237.169 241.393 1.00 138.93 ? 26  GLU P CG     1 
ATOM   7851   C  CD     . GLU C  3  26  ? 329.880 236.938 239.905 1.00 128.60 ? 26  GLU P CD     1 
ATOM   7852   O  OE1    . GLU C  3  26  ? 330.925 236.395 239.486 1.00 142.36 ? 26  GLU P OE1    1 
ATOM   7853   O  OE2    . GLU C  3  26  ? 328.934 237.286 239.164 1.00 103.02 ? 26  GLU P OE2    1 
ATOM   7854   H  H      . GLU C  3  26  ? 327.205 237.060 241.039 1.00 87.11  ? 26  GLU P H      1 
ATOM   7855   H  HA     . GLU C  3  26  ? 328.465 234.795 240.567 1.00 110.98 ? 26  GLU P HA     1 
ATOM   7856   H  HB2    . GLU C  3  26  ? 328.744 236.296 242.932 1.00 122.27 ? 26  GLU P HB2    1 
ATOM   7857   H  HB3    . GLU C  3  26  ? 329.837 235.347 242.281 1.00 122.27 ? 26  GLU P HB3    1 
ATOM   7858   H  HG2    . GLU C  3  26  ? 329.169 237.944 241.525 1.00 125.75 ? 26  GLU P HG2    1 
ATOM   7859   H  HG3    . GLU C  3  26  ? 330.620 237.336 241.758 1.00 125.75 ? 26  GLU P HG3    1 
ATOM   7860   N  N      . ALA C  3  27  ? 326.231 234.704 242.827 1.00 133.70 ? 27  ALA P N      1 
ATOM   7861   C  CA     . ALA C  3  27  ? 325.431 233.782 243.625 1.00 131.25 ? 27  ALA P CA     1 
ATOM   7862   C  C      . ALA C  3  27  ? 324.708 232.784 242.741 1.00 121.83 ? 27  ALA P C      1 
ATOM   7863   O  O      . ALA C  3  27  ? 324.411 231.666 243.174 1.00 126.63 ? 27  ALA P O      1 
ATOM   7864   C  CB     . ALA C  3  27  ? 324.419 234.558 244.463 1.00 140.38 ? 27  ALA P CB     1 
ATOM   7865   H  H      . ALA C  3  27  ? 325.948 235.517 242.830 1.00 123.45 ? 27  ALA P H      1 
ATOM   7866   H  HA     . ALA C  3  27  ? 326.012 233.292 244.227 1.00 121.23 ? 27  ALA P HA     1 
ATOM   7867   H  HB1    . ALA C  3  27  ? 323.896 233.930 244.987 1.00 131.02 ? 27  ALA P HB1    1 
ATOM   7868   H  HB2    . ALA C  3  27  ? 324.895 235.164 245.052 1.00 131.02 ? 27  ALA P HB2    1 
ATOM   7869   H  HB3    . ALA C  3  27  ? 323.837 235.059 243.871 1.00 131.02 ? 27  ALA P HB3    1 
ATOM   7870   N  N      . ILE C  3  28  ? 324.405 233.183 241.514 1.00 78.76  ? 28  ILE P N      1 
ATOM   7871   C  CA     . ILE C  3  28  ? 323.798 232.289 240.545 1.00 74.35  ? 28  ILE P CA     1 
ATOM   7872   C  C      . ILE C  3  28  ? 324.859 231.490 239.793 1.00 70.41  ? 28  ILE P C      1 
ATOM   7873   O  O      . ILE C  3  28  ? 324.605 230.351 239.388 1.00 71.17  ? 28  ILE P O      1 
ATOM   7874   C  CB     . ILE C  3  28  ? 322.924 233.124 239.596 1.00 64.44  ? 28  ILE P CB     1 
ATOM   7875   C  CG1    . ILE C  3  28  ? 321.812 233.806 240.398 1.00 76.57  ? 28  ILE P CG1    1 
ATOM   7876   C  CG2    . ILE C  3  28  ? 322.323 232.270 238.495 1.00 64.19  ? 28  ILE P CG2    1 
ATOM   7877   C  CD1    . ILE C  3  28  ? 321.135 234.928 239.668 1.00 96.71  ? 28  ILE P CD1    1 
ATOM   7878   H  H      . ILE C  3  28  ? 324.544 233.978 241.216 1.00 71.90  ? 28  ILE P H      1 
ATOM   7879   H  HA     . ILE C  3  28  ? 323.223 231.661 241.009 1.00 67.35  ? 28  ILE P HA     1 
ATOM   7880   H  HB     . ILE C  3  28  ? 323.477 233.809 239.189 1.00 57.79  ? 28  ILE P HB     1 
ATOM   7881   H  HG12   . ILE C  3  28  ? 321.136 233.145 240.617 1.00 70.61  ? 28  ILE P HG12   1 
ATOM   7882   H  HG13   . ILE C  3  28  ? 322.192 234.169 241.213 1.00 70.61  ? 28  ILE P HG13   1 
ATOM   7883   H  HG21   . ILE C  3  28  ? 321.780 232.832 237.920 1.00 57.37  ? 28  ILE P HG21   1 
ATOM   7884   H  HG22   . ILE C  3  28  ? 323.040 231.866 237.982 1.00 57.37  ? 28  ILE P HG22   1 
ATOM   7885   H  HG23   . ILE C  3  28  ? 321.773 231.579 238.897 1.00 57.37  ? 28  ILE P HG23   1 
ATOM   7886   H  HD11   . ILE C  3  28  ? 320.448 235.306 240.238 1.00 91.11  ? 28  ILE P HD11   1 
ATOM   7887   H  HD12   . ILE C  3  28  ? 321.794 235.606 239.451 1.00 91.11  ? 28  ILE P HD12   1 
ATOM   7888   H  HD13   . ILE C  3  28  ? 320.737 234.581 238.854 1.00 91.11  ? 28  ILE P HD13   1 
ATOM   7889   N  N      . GLY C  3  29  ? 326.056 232.054 239.627 1.00 104.00 ? 29  GLY P N      1 
ATOM   7890   C  CA     . GLY C  3  29  ? 327.107 231.349 238.915 1.00 118.14 ? 29  GLY P CA     1 
ATOM   7891   C  C      . GLY C  3  29  ? 327.481 230.036 239.571 1.00 131.43 ? 29  GLY P C      1 
ATOM   7892   O  O      . GLY C  3  29  ? 327.668 229.027 238.889 1.00 167.37 ? 29  GLY P O      1 
ATOM   7893   H  H      . GLY C  3  29  ? 326.278 232.834 239.915 1.00 84.31  ? 29  GLY P H      1 
ATOM   7894   H  HA2    . GLY C  3  29  ? 326.815 231.166 238.008 1.00 97.75  ? 29  GLY P HA2    1 
ATOM   7895   H  HA3    . GLY C  3  29  ? 327.900 231.908 238.875 1.00 97.75  ? 29  GLY P HA3    1 
ATOM   7896   N  N      . HIS C  3  30  ? 327.599 230.024 240.901 1.00 112.66 ? 30  HIS P N      1 
ATOM   7897   C  CA     . HIS C  3  30  ? 327.962 228.810 241.623 1.00 115.74 ? 30  HIS P CA     1 
ATOM   7898   C  C      . HIS C  3  30  ? 326.753 228.125 242.261 1.00 113.72 ? 30  HIS P C      1 
ATOM   7899   O  O      . HIS C  3  30  ? 326.901 227.424 243.269 1.00 116.98 ? 30  HIS P O      1 
ATOM   7900   C  CB     . HIS C  3  30  ? 329.039 229.113 242.673 1.00 128.09 ? 30  HIS P CB     1 
ATOM   7901   C  CG     . HIS C  3  30  ? 328.600 230.026 243.776 1.00 159.84 ? 30  HIS P CG     1 
ATOM   7902   N  ND1    . HIS C  3  30  ? 327.506 229.768 244.575 1.00 180.12 ? 30  HIS P ND1    1 
ATOM   7903   C  CD2    . HIS C  3  30  ? 329.138 231.180 244.239 1.00 176.30 ? 30  HIS P CD2    1 
ATOM   7904   C  CE1    . HIS C  3  30  ? 327.375 230.734 245.467 1.00 193.90 ? 30  HIS P CE1    1 
ATOM   7905   N  NE2    . HIS C  3  30  ? 328.354 231.603 245.286 1.00 186.68 ? 30  HIS P NE2    1 
ATOM   7906   H  H      . HIS C  3  30  ? 327.472 230.708 241.406 1.00 108.83 ? 30  HIS P H      1 
ATOM   7907   H  HA     . HIS C  3  30  ? 328.346 228.184 240.989 1.00 111.60 ? 30  HIS P HA     1 
ATOM   7908   H  HB2    . HIS C  3  30  ? 329.319 228.277 243.078 1.00 123.78 ? 30  HIS P HB2    1 
ATOM   7909   H  HB3    . HIS C  3  30  ? 329.795 229.530 242.230 1.00 123.78 ? 30  HIS P HB3    1 
ATOM   7910   H  HD1    . HIS C  3  30  ? 326.983 229.090 244.498 1.00 176.88 ? 30  HIS P HD1    1 
ATOM   7911   H  HD2    . HIS C  3  30  ? 329.891 231.611 243.903 1.00 172.70 ? 30  HIS P HD2    1 
ATOM   7912   H  HE1    . HIS C  3  30  ? 326.709 230.792 246.114 1.00 191.08 ? 30  HIS P HE1    1 
ATOM   7913   N  N      . ALA C  3  31  ? 325.562 228.298 241.688 1.00 78.85  ? 31  ALA P N      1 
ATOM   7914   C  CA     . ALA C  3  31  ? 324.363 227.618 242.156 1.00 80.63  ? 31  ALA P CA     1 
ATOM   7915   C  C      . ALA C  3  31  ? 324.082 226.383 241.301 1.00 92.22  ? 31  ALA P C      1 
ATOM   7916   O  O      . ALA C  3  31  ? 324.826 226.044 240.378 1.00 119.67 ? 31  ALA P O      1 
ATOM   7917   C  CB     . ALA C  3  31  ? 323.161 228.563 242.144 1.00 69.93  ? 31  ALA P CB     1 
ATOM   7918   H  H      . ALA C  3  31  ? 325.425 228.814 241.014 1.00 79.12  ? 31  ALA P H      1 
ATOM   7919   H  HA     . ALA C  3  31  ? 324.504 227.324 243.070 1.00 81.26  ? 31  ALA P HA     1 
ATOM   7920   H  HB1    . ALA C  3  31  ? 322.379 228.083 242.460 1.00 71.25  ? 31  ALA P HB1    1 
ATOM   7921   H  HB2    . ALA C  3  31  ? 323.345 229.316 242.727 1.00 71.25  ? 31  ALA P HB2    1 
ATOM   7922   H  HB3    . ALA C  3  31  ? 323.014 228.875 241.237 1.00 71.25  ? 31  ALA P HB3    1 
ATOM   7923   N  N      . GLY C  3  32  ? 322.978 225.709 241.615 1.00 96.73  ? 32  GLY P N      1 
ATOM   7924   C  CA     . GLY C  3  32  ? 322.647 224.472 240.928 1.00 100.15 ? 32  GLY P CA     1 
ATOM   7925   C  C      . GLY C  3  32  ? 322.317 224.708 239.464 1.00 117.48 ? 32  GLY P C      1 
ATOM   7926   O  O      . GLY C  3  32  ? 321.652 225.679 239.101 1.00 147.64 ? 32  GLY P O      1 
ATOM   7927   H  H      . GLY C  3  32  ? 322.411 225.946 242.216 1.00 94.04  ? 32  GLY P H      1 
ATOM   7928   H  HA2    . GLY C  3  32  ? 323.398 223.860 240.980 1.00 97.13  ? 32  GLY P HA2    1 
ATOM   7929   H  HA3    . GLY C  3  32  ? 321.881 224.058 241.355 1.00 97.13  ? 32  GLY P HA3    1 
ATOM   7930   N  N      . THR C  3  33  ? 322.781 223.793 238.615 1.00 82.20  ? 33  THR P N      1 
ATOM   7931   C  CA     . THR C  3  33  ? 322.552 223.912 237.183 1.00 86.89  ? 33  THR P CA     1 
ATOM   7932   C  C      . THR C  3  33  ? 321.080 223.711 236.851 1.00 96.67  ? 33  THR P C      1 
ATOM   7933   O  O      . THR C  3  33  ? 320.340 223.028 237.564 1.00 114.14 ? 33  THR P O      1 
ATOM   7934   C  CB     . THR C  3  33  ? 323.404 222.903 236.415 1.00 93.91  ? 33  THR P CB     1 
ATOM   7935   O  OG1    . THR C  3  33  ? 324.782 223.280 236.528 1.00 113.95 ? 33  THR P OG1    1 
ATOM   7936   C  CG2    . THR C  3  33  ? 323.016 222.844 234.925 1.00 79.13  ? 33  THR P CG2    1 
ATOM   7937   H  H      . THR C  3  33  ? 323.231 223.097 238.845 1.00 85.62  ? 33  THR P H      1 
ATOM   7938   H  HA     . THR C  3  33  ? 322.807 224.803 236.894 1.00 90.14  ? 33  THR P HA     1 
ATOM   7939   H  HB     . THR C  3  33  ? 323.280 222.020 236.798 1.00 96.40  ? 33  THR P HB     1 
ATOM   7940   H  HG1    . THR C  3  33  ? 324.897 224.047 236.207 1.00 116.04 ? 33  THR P HG1    1 
ATOM   7941   H  HG21   . THR C  3  33  ? 323.572 222.196 234.463 1.00 81.44  ? 33  THR P HG21   1 
ATOM   7942   H  HG22   . THR C  3  33  ? 322.086 222.582 234.835 1.00 81.44  ? 33  THR P HG22   1 
ATOM   7943   H  HG23   . THR C  3  33  ? 323.140 223.714 234.516 1.00 81.44  ? 33  THR P HG23   1 
ATOM   7944   N  N      . CYS C  3  34  ? 320.670 224.310 235.738 1.00 107.13 ? 34  CYS P N      1 
ATOM   7945   C  CA     . CYS C  3  34  ? 319.276 224.342 235.332 1.00 97.68  ? 34  CYS P CA     1 
ATOM   7946   C  C      . CYS C  3  34  ? 319.189 224.769 233.875 1.00 87.00  ? 34  CYS P C      1 
ATOM   7947   O  O      . CYS C  3  34  ? 319.418 225.940 233.555 1.00 90.92  ? 34  CYS P O      1 
ATOM   7948   C  CB     . CYS C  3  34  ? 318.493 225.300 236.230 1.00 103.84 ? 34  CYS P CB     1 
ATOM   7949   S  SG     . CYS C  3  34  ? 316.784 225.579 235.737 1.00 109.61 ? 34  CYS P SG     1 
ATOM   7950   H  H      . CYS C  3  34  ? 321.195 224.713 235.190 1.00 109.06 ? 34  CYS P H      1 
ATOM   7951   H  HA     . CYS C  3  34  ? 318.892 223.455 235.418 1.00 100.05 ? 34  CYS P HA     1 
ATOM   7952   H  HB2    . CYS C  3  34  ? 318.483 224.940 237.131 1.00 106.93 ? 34  CYS P HB2    1 
ATOM   7953   H  HB3    . CYS C  3  34  ? 318.942 226.160 236.229 1.00 106.93 ? 34  CYS P HB3    1 
ATOM   7954   H  HG     . CYS C  3  34  ? 316.274 226.342 236.510 1.00 113.28 ? 34  CYS P HG     1 
ATOM   7955   N  N      . LEU C  3  35  ? 318.889 223.830 232.984 1.00 84.75  ? 35  LEU P N      1 
ATOM   7956   C  CA     . LEU C  3  35  ? 318.721 224.131 231.572 1.00 78.54  ? 35  LEU P CA     1 
ATOM   7957   C  C      . LEU C  3  35  ? 317.321 223.749 231.118 1.00 65.87  ? 35  LEU P C      1 
ATOM   7958   O  O      . LEU C  3  35  ? 316.659 222.882 231.700 1.00 66.86  ? 35  LEU P O      1 
ATOM   7959   C  CB     . LEU C  3  35  ? 319.745 223.401 230.700 1.00 69.98  ? 35  LEU P CB     1 
ATOM   7960   C  CG     . LEU C  3  35  ? 319.697 221.870 230.733 1.00 79.15  ? 35  LEU P CG     1 
ATOM   7961   C  CD1    . LEU C  3  35  ? 318.640 221.237 229.806 1.00 72.75  ? 35  LEU P CD1    1 
ATOM   7962   C  CD2    . LEU C  3  35  ? 321.077 221.337 230.394 1.00 99.37  ? 35  LEU P CD2    1 
ATOM   7963   H  H      . LEU C  3  35  ? 318.777 223.000 233.178 1.00 83.54  ? 35  LEU P H      1 
ATOM   7964   H  HA     . LEU C  3  35  ? 318.833 225.085 231.434 1.00 77.16  ? 35  LEU P HA     1 
ATOM   7965   H  HB2    . LEU C  3  35  ? 319.609 223.673 229.779 1.00 67.82  ? 35  LEU P HB2    1 
ATOM   7966   H  HB3    . LEU C  3  35  ? 320.632 223.667 230.986 1.00 67.82  ? 35  LEU P HB3    1 
ATOM   7967   H  HG     . LEU C  3  35  ? 319.492 221.590 231.639 1.00 76.58  ? 35  LEU P HG     1 
ATOM   7968   H  HD11   . LEU C  3  35  ? 318.682 220.272 229.892 1.00 70.16  ? 35  LEU P HD11   1 
ATOM   7969   H  HD12   . LEU C  3  35  ? 317.761 221.555 230.066 1.00 70.16  ? 35  LEU P HD12   1 
ATOM   7970   H  HD13   . LEU C  3  35  ? 318.828 221.497 228.890 1.00 70.16  ? 35  LEU P HD13   1 
ATOM   7971   H  HD21   . LEU C  3  35  ? 321.054 220.368 230.413 1.00 96.04  ? 35  LEU P HD21   1 
ATOM   7972   H  HD22   . LEU C  3  35  ? 321.325 221.645 229.508 1.00 96.04  ? 35  LEU P HD22   1 
ATOM   7973   H  HD23   . LEU C  3  35  ? 321.712 221.667 231.049 1.00 96.04  ? 35  LEU P HD23   1 
ATOM   7974   N  N      . GLY C  3  36  ? 316.899 224.398 230.043 1.00 73.61  ? 36  GLY P N      1 
ATOM   7975   C  CA     . GLY C  3  36  ? 315.620 224.130 229.432 1.00 72.98  ? 36  GLY P CA     1 
ATOM   7976   C  C      . GLY C  3  36  ? 315.770 224.230 227.936 1.00 76.34  ? 36  GLY P C      1 
ATOM   7977   O  O      . GLY C  3  36  ? 316.487 225.099 227.434 1.00 90.78  ? 36  GLY P O      1 
ATOM   7978   H  H      . GLY C  3  36  ? 317.350 225.012 229.644 1.00 73.78  ? 36  GLY P H      1 
ATOM   7979   H  HA2    . GLY C  3  36  ? 315.318 223.238 229.665 1.00 73.39  ? 36  GLY P HA2    1 
ATOM   7980   H  HA3    . GLY C  3  36  ? 314.963 224.778 229.732 1.00 73.39  ? 36  GLY P HA3    1 
ATOM   7981   N  N      . ILE C  3  37  ? 315.113 223.335 227.211 1.00 55.91  ? 37  ILE P N      1 
ATOM   7982   C  CA     . ILE C  3  37  ? 315.266 223.244 225.769 1.00 57.97  ? 37  ILE P CA     1 
ATOM   7983   C  C      . ILE C  3  37  ? 313.878 223.160 225.151 1.00 56.63  ? 37  ILE P C      1 
ATOM   7984   O  O      . ILE C  3  37  ? 313.024 222.403 225.622 1.00 59.94  ? 37  ILE P O      1 
ATOM   7985   C  CB     . ILE C  3  37  ? 316.140 222.038 225.374 1.00 62.15  ? 37  ILE P CB     1 
ATOM   7986   C  CG1    . ILE C  3  37  ? 316.097 221.807 223.860 1.00 130.30 ? 37  ILE P CG1    1 
ATOM   7987   C  CG2    . ILE C  3  37  ? 315.704 220.797 226.132 1.00 62.87  ? 37  ILE P CG2    1 
ATOM   7988   C  CD1    . ILE C  3  37  ? 317.191 220.888 223.358 1.00 131.25 ? 37  ILE P CD1    1 
ATOM   7989   H  H      . ILE C  3  37  ? 314.564 222.760 227.539 1.00 60.77  ? 37  ILE P H      1 
ATOM   7990   H  HA     . ILE C  3  37  ? 315.695 224.049 225.442 1.00 62.39  ? 37  ILE P HA     1 
ATOM   7991   H  HB     . ILE C  3  37  ? 317.056 222.236 225.622 1.00 65.80  ? 37  ILE P HB     1 
ATOM   7992   H  HG12   . ILE C  3  37  ? 315.244 221.408 223.627 1.00 133.50 ? 37  ILE P HG12   1 
ATOM   7993   H  HG13   . ILE C  3  37  ? 316.195 222.660 223.409 1.00 133.50 ? 37  ILE P HG13   1 
ATOM   7994   H  HG21   . ILE C  3  37  ? 316.267 220.052 225.868 1.00 66.51  ? 37  ILE P HG21   1 
ATOM   7995   H  HG22   . ILE C  3  37  ? 315.796 220.961 227.083 1.00 66.51  ? 37  ILE P HG22   1 
ATOM   7996   H  HG23   . ILE C  3  37  ? 314.778 220.605 225.916 1.00 66.51  ? 37  ILE P HG23   1 
ATOM   7997   H  HD11   . ILE C  3  37  ? 317.103 220.788 222.397 1.00 133.64 ? 37  ILE P HD11   1 
ATOM   7998   H  HD12   . ILE C  3  37  ? 318.053 221.278 223.572 1.00 133.64 ? 37  ILE P HD12   1 
ATOM   7999   H  HD13   . ILE C  3  37  ? 317.101 220.025 223.790 1.00 133.64 ? 37  ILE P HD13   1 
ATOM   8000   N  N      . LEU C  3  38  ? 313.656 223.952 224.110 1.00 70.22  ? 38  LEU P N      1 
ATOM   8001   C  CA     . LEU C  3  38  ? 312.363 224.063 223.460 1.00 69.36  ? 38  LEU P CA     1 
ATOM   8002   C  C      . LEU C  3  38  ? 312.197 223.017 222.361 1.00 89.79  ? 38  LEU P C      1 
ATOM   8003   O  O      . LEU C  3  38  ? 313.174 222.516 221.800 1.00 98.13  ? 38  LEU P O      1 
ATOM   8004   C  CB     . LEU C  3  38  ? 312.214 225.460 222.871 1.00 67.34  ? 38  LEU P CB     1 
ATOM   8005   C  CG     . LEU C  3  38  ? 310.874 225.784 222.231 1.00 85.47  ? 38  LEU P CG     1 
ATOM   8006   C  CD1    . LEU C  3  38  ? 309.783 225.782 223.291 1.00 75.68  ? 38  LEU P CD1    1 
ATOM   8007   C  CD2    . LEU C  3  38  ? 310.983 227.117 221.523 1.00 112.35 ? 38  LEU P CD2    1 
ATOM   8008   H  H      . LEU C  3  38  ? 314.260 224.449 223.753 1.00 72.36  ? 38  LEU P H      1 
ATOM   8009   H  HA     . LEU C  3  38  ? 311.660 223.931 224.116 1.00 71.81  ? 38  LEU P HA     1 
ATOM   8010   H  HB2    . LEU C  3  38  ? 312.358 226.105 223.580 1.00 70.08  ? 38  LEU P HB2    1 
ATOM   8011   H  HB3    . LEU C  3  38  ? 312.894 225.576 222.189 1.00 70.08  ? 38  LEU P HB3    1 
ATOM   8012   H  HG     . LEU C  3  38  ? 310.660 225.105 221.572 1.00 88.59  ? 38  LEU P HG     1 
ATOM   8013   H  HD11   . LEU C  3  38  ? 308.934 225.990 222.871 1.00 79.44  ? 38  LEU P HD11   1 
ATOM   8014   H  HD12   . LEU C  3  38  ? 309.743 224.903 223.701 1.00 79.44  ? 38  LEU P HD12   1 
ATOM   8015   H  HD13   . LEU C  3  38  ? 309.993 226.451 223.962 1.00 79.44  ? 38  LEU P HD13   1 
ATOM   8016   H  HD21   . LEU C  3  38  ? 310.130 227.327 221.113 1.00 115.60 ? 38  LEU P HD21   1 
ATOM   8017   H  HD22   . LEU C  3  38  ? 311.217 227.800 222.171 1.00 115.60 ? 38  LEU P HD22   1 
ATOM   8018   H  HD23   . LEU C  3  38  ? 311.672 227.057 220.842 1.00 115.60 ? 38  LEU P HD23   1 
ATOM   8019   N  N      . ALA C  3  39  ? 310.944 222.697 222.053 1.00 102.02 ? 39  ALA P N      1 
ATOM   8020   C  CA     . ALA C  3  39  ? 310.623 221.712 221.023 1.00 94.40  ? 39  ALA P CA     1 
ATOM   8021   C  C      . ALA C  3  39  ? 309.423 222.223 220.228 1.00 95.78  ? 39  ALA P C      1 
ATOM   8022   O  O      . ALA C  3  39  ? 309.120 223.421 220.212 1.00 78.14  ? 39  ALA P O      1 
ATOM   8023   C  CB     . ALA C  3  39  ? 310.376 220.332 221.658 1.00 83.58  ? 39  ALA P CB     1 
ATOM   8024   H  H      . ALA C  3  39  ? 310.253 223.041 222.432 1.00 102.17 ? 39  ALA P H      1 
ATOM   8025   H  HA     . ALA C  3  39  ? 311.375 221.633 220.415 1.00 94.09  ? 39  ALA P HA     1 
ATOM   8026   H  HB1    . ALA C  3  39  ? 310.165 219.696 220.957 1.00 83.12  ? 39  ALA P HB1    1 
ATOM   8027   H  HB2    . ALA C  3  39  ? 311.177 220.054 222.129 1.00 83.12  ? 39  ALA P HB2    1 
ATOM   8028   H  HB3    . ALA C  3  39  ? 309.633 220.400 222.279 1.00 83.12  ? 39  ALA P HB3    1 
ATOM   8029   N  N      . ASN C  3  40  ? 308.747 221.305 219.530 1.00 118.20 ? 40  ASN P N      1 
ATOM   8030   C  CA     . ASN C  3  40  ? 307.473 221.569 218.872 1.00 113.15 ? 40  ASN P CA     1 
ATOM   8031   C  C      . ASN C  3  40  ? 306.311 220.856 219.533 1.00 104.92 ? 40  ASN P C      1 
ATOM   8032   O  O      . ASN C  3  40  ? 305.182 221.344 219.474 1.00 92.06  ? 40  ASN P O      1 
ATOM   8033   C  CB     . ASN C  3  40  ? 307.521 221.124 217.407 1.00 106.42 ? 40  ASN P CB     1 
ATOM   8034   C  CG     . ASN C  3  40  ? 308.403 222.003 216.559 1.00 108.04 ? 40  ASN P CG     1 
ATOM   8035   O  OD1    . ASN C  3  40  ? 308.235 223.222 216.522 1.00 102.49 ? 40  ASN P OD1    1 
ATOM   8036   N  ND2    . ASN C  3  40  ? 309.358 221.388 215.872 1.00 122.46 ? 40  ASN P ND2    1 
ATOM   8037   H  H      . ASN C  3  40  ? 309.021 220.497 219.424 1.00 108.30 ? 40  ASN P H      1 
ATOM   8038   H  HA     . ASN C  3  40  ? 307.295 222.522 218.894 1.00 103.56 ? 40  ASN P HA     1 
ATOM   8039   H  HB2    . ASN C  3  40  ? 307.867 220.219 217.362 1.00 96.26  ? 40  ASN P HB2    1 
ATOM   8040   H  HB3    . ASN C  3  40  ? 306.624 221.154 217.038 1.00 96.26  ? 40  ASN P HB3    1 
ATOM   8041   H  HD21   . ASN C  3  40  ? 309.889 221.843 215.372 1.00 111.30 ? 40  ASN P HD21   1 
ATOM   8042   H  HD22   . ASN C  3  40  ? 309.445 220.534 215.927 1.00 111.30 ? 40  ASN P HD22   1 
ATOM   8043   N  N      . ASP C  3  41  ? 306.572 219.710 220.149 1.00 138.22 ? 41  ASP P N      1 
ATOM   8044   C  CA     . ASP C  3  41  ? 305.550 218.876 220.757 1.00 152.79 ? 41  ASP P CA     1 
ATOM   8045   C  C      . ASP C  3  41  ? 305.495 219.064 222.258 1.00 139.12 ? 41  ASP P C      1 
ATOM   8046   O  O      . ASP C  3  41  ? 304.841 218.280 222.953 1.00 140.86 ? 41  ASP P O      1 
ATOM   8047   C  CB     . ASP C  3  41  ? 305.826 217.416 220.416 1.00 175.42 ? 41  ASP P CB     1 
ATOM   8048   C  CG     . ASP C  3  41  ? 306.119 217.219 218.945 1.00 201.75 ? 41  ASP P CG     1 
ATOM   8049   O  OD1    . ASP C  3  41  ? 307.204 217.655 218.499 1.00 205.46 ? 41  ASP P OD1    1 
ATOM   8050   O  OD2    . ASP C  3  41  ? 305.267 216.639 218.239 1.00 220.10 ? 41  ASP P OD2    1 
ATOM   8051   H  H      . ASP C  3  41  ? 307.364 219.386 220.229 1.00 114.00 ? 41  ASP P H      1 
ATOM   8052   H  HA     . ASP C  3  41  ? 304.684 219.114 220.390 1.00 128.82 ? 41  ASP P HA     1 
ATOM   8053   H  HB2    . ASP C  3  41  ? 306.597 217.111 220.920 1.00 150.81 ? 41  ASP P HB2    1 
ATOM   8054   H  HB3    . ASP C  3  41  ? 305.047 216.883 220.643 1.00 150.81 ? 41  ASP P HB3    1 
ATOM   8055   N  N      . GLY C  3  42  ? 306.169 220.078 222.760 1.00 85.10  ? 42  GLY P N      1 
ATOM   8056   C  CA     . GLY C  3  42  ? 306.276 220.316 224.178 1.00 78.77  ? 42  GLY P CA     1 
ATOM   8057   C  C      . GLY C  3  42  ? 307.542 221.099 224.451 1.00 84.36  ? 42  GLY P C      1 
ATOM   8058   O  O      . GLY C  3  42  ? 308.177 221.624 223.544 1.00 113.64 ? 42  GLY P O      1 
ATOM   8059   H  H      . GLY C  3  42  ? 306.586 220.659 222.282 1.00 85.65  ? 42  GLY P H      1 
ATOM   8060   H  HA2    . GLY C  3  42  ? 305.513 220.827 224.491 1.00 79.73  ? 42  GLY P HA2    1 
ATOM   8061   H  HA3    . GLY C  3  42  ? 306.313 219.473 224.657 1.00 79.73  ? 42  GLY P HA3    1 
ATOM   8062   N  N      . VAL C  3  43  ? 307.896 221.158 225.732 1.00 52.46  ? 43  VAL P N      1 
ATOM   8063   C  CA     . VAL C  3  43  ? 309.059 221.909 226.180 1.00 51.79  ? 43  VAL P CA     1 
ATOM   8064   C  C      . VAL C  3  43  ? 309.328 221.470 227.604 1.00 51.49  ? 43  VAL P C      1 
ATOM   8065   O  O      . VAL C  3  43  ? 308.400 221.203 228.367 1.00 50.26  ? 43  VAL P O      1 
ATOM   8066   C  CB     . VAL C  3  43  ? 308.807 223.435 226.080 1.00 48.96  ? 43  VAL P CB     1 
ATOM   8067   C  CG1    . VAL C  3  43  ? 307.582 223.814 226.899 1.00 46.25  ? 43  VAL P CG1    1 
ATOM   8068   C  CG2    . VAL C  3  43  ? 310.029 224.213 226.534 1.00 48.59  ? 43  VAL P CG2    1 
ATOM   8069   H  H      . VAL C  3  43  ? 307.472 220.765 226.368 1.00 58.31  ? 43  VAL P H      1 
ATOM   8070   H  HA     . VAL C  3  43  ? 309.827 221.682 225.632 1.00 57.59  ? 43  VAL P HA     1 
ATOM   8071   H  HB     . VAL C  3  43  ? 308.632 223.666 225.155 1.00 55.25  ? 43  VAL P HB     1 
ATOM   8072   H  HG11   . VAL C  3  43  ? 307.438 224.770 226.827 1.00 53.24  ? 43  VAL P HG11   1 
ATOM   8073   H  HG12   . VAL C  3  43  ? 306.812 223.336 226.554 1.00 53.24  ? 43  VAL P HG12   1 
ATOM   8074   H  HG13   . VAL C  3  43  ? 307.735 223.571 227.826 1.00 53.24  ? 43  VAL P HG13   1 
ATOM   8075   H  HG21   . VAL C  3  43  ? 309.843 225.163 226.461 1.00 54.80  ? 43  VAL P HG21   1 
ATOM   8076   H  HG22   . VAL C  3  43  ? 310.224 223.984 227.456 1.00 54.80  ? 43  VAL P HG22   1 
ATOM   8077   H  HG23   . VAL C  3  43  ? 310.780 223.979 225.968 1.00 54.80  ? 43  VAL P HG23   1 
ATOM   8078   N  N      . LEU C  3  44  ? 310.604 221.393 227.970 1.00 50.97  ? 44  LEU P N      1 
ATOM   8079   C  CA     . LEU C  3  44  ? 310.937 220.732 229.219 1.00 51.59  ? 44  LEU P CA     1 
ATOM   8080   C  C      . LEU C  3  44  ? 312.053 221.449 229.956 1.00 51.03  ? 44  LEU P C      1 
ATOM   8081   O  O      . LEU C  3  44  ? 312.976 222.002 229.349 1.00 51.77  ? 44  LEU P O      1 
ATOM   8082   C  CB     . LEU C  3  44  ? 311.307 219.253 228.985 1.00 55.30  ? 44  LEU P CB     1 
ATOM   8083   C  CG     . LEU C  3  44  ? 312.529 218.799 228.169 1.00 58.70  ? 44  LEU P CG     1 
ATOM   8084   C  CD1    . LEU C  3  44  ? 312.528 219.392 226.764 1.00 79.49  ? 44  LEU P CD1    1 
ATOM   8085   C  CD2    . LEU C  3  44  ? 313.866 219.067 228.876 1.00 59.49  ? 44  LEU P CD2    1 
ATOM   8086   H  H      . LEU C  3  44  ? 311.272 221.705 227.529 1.00 58.45  ? 44  LEU P H      1 
ATOM   8087   H  HA     . LEU C  3  44  ? 310.154 220.748 229.792 1.00 59.07  ? 44  LEU P HA     1 
ATOM   8088   H  HB2    . LEU C  3  44  ? 311.416 218.853 229.862 1.00 62.16  ? 44  LEU P HB2    1 
ATOM   8089   H  HB3    . LEU C  3  44  ? 310.541 218.840 228.558 1.00 62.16  ? 44  LEU P HB3    1 
ATOM   8090   H  HG     . LEU C  3  44  ? 312.464 217.837 228.061 1.00 64.80  ? 44  LEU P HG     1 
ATOM   8091   H  HD11   . LEU C  3  44  ? 313.314 219.080 226.289 1.00 85.43  ? 44  LEU P HD11   1 
ATOM   8092   H  HD12   . LEU C  3  44  ? 311.725 219.106 226.302 1.00 85.43  ? 44  LEU P HD12   1 
ATOM   8093   H  HD13   . LEU C  3  44  ? 312.544 220.360 226.831 1.00 85.43  ? 44  LEU P HD13   1 
ATOM   8094   H  HD21   . LEU C  3  44  ? 314.590 218.758 228.309 1.00 65.38  ? 44  LEU P HD21   1 
ATOM   8095   H  HD22   . LEU C  3  44  ? 313.954 220.020 229.034 1.00 65.38  ? 44  LEU P HD22   1 
ATOM   8096   H  HD23   . LEU C  3  44  ? 313.879 218.589 229.719 1.00 65.38  ? 44  LEU P HD23   1 
ATOM   8097   N  N      . LEU C  3  45  ? 311.925 221.444 231.280 1.00 63.73  ? 45  LEU P N      1 
ATOM   8098   C  CA     . LEU C  3  45  ? 312.962 221.902 232.187 1.00 63.52  ? 45  LEU P CA     1 
ATOM   8099   C  C      . LEU C  3  45  ? 313.631 220.698 232.819 1.00 71.61  ? 45  LEU P C      1 
ATOM   8100   O  O      . LEU C  3  45  ? 312.963 219.877 233.459 1.00 91.16  ? 45  LEU P O      1 
ATOM   8101   C  CB     . LEU C  3  45  ? 312.376 222.792 233.278 1.00 61.08  ? 45  LEU P CB     1 
ATOM   8102   C  CG     . LEU C  3  45  ? 311.940 224.178 232.840 1.00 58.09  ? 45  LEU P CG     1 
ATOM   8103   C  CD1    . LEU C  3  45  ? 311.244 224.854 233.990 1.00 56.25  ? 45  LEU P CD1    1 
ATOM   8104   C  CD2    . LEU C  3  45  ? 313.129 225.002 232.376 1.00 65.80  ? 45  LEU P CD2    1 
ATOM   8105   H  H      . LEU C  3  45  ? 311.220 221.168 231.687 1.00 58.71  ? 45  LEU P H      1 
ATOM   8106   H  HA     . LEU C  3  45  ? 313.628 222.408 231.695 1.00 58.48  ? 45  LEU P HA     1 
ATOM   8107   H  HB2    . LEU C  3  45  ? 311.598 222.348 233.649 1.00 56.72  ? 45  LEU P HB2    1 
ATOM   8108   H  HB3    . LEU C  3  45  ? 313.045 222.904 233.972 1.00 56.72  ? 45  LEU P HB3    1 
ATOM   8109   H  HG     . LEU C  3  45  ? 311.313 224.102 232.103 1.00 54.16  ? 45  LEU P HG     1 
ATOM   8110   H  HD11   . LEU C  3  45  ? 310.965 225.740 233.713 1.00 52.97  ? 45  LEU P HD11   1 
ATOM   8111   H  HD12   . LEU C  3  45  ? 310.471 224.326 234.244 1.00 52.97  ? 45  LEU P HD12   1 
ATOM   8112   H  HD13   . LEU C  3  45  ? 311.860 224.919 234.736 1.00 52.97  ? 45  LEU P HD13   1 
ATOM   8113   H  HD21   . LEU C  3  45  ? 312.817 225.879 232.104 1.00 61.59  ? 45  LEU P HD21   1 
ATOM   8114   H  HD22   . LEU C  3  45  ? 313.759 225.086 233.109 1.00 61.59  ? 45  LEU P HD22   1 
ATOM   8115   H  HD23   . LEU C  3  45  ? 313.551 224.553 231.627 1.00 61.59  ? 45  LEU P HD23   1 
ATOM   8116   N  N      . ALA C  3  46  ? 314.937 220.586 232.624 1.00 92.59  ? 46  ALA P N      1 
ATOM   8117   C  CA     . ALA C  3  46  ? 315.769 219.717 233.433 1.00 95.28  ? 46  ALA P CA     1 
ATOM   8118   C  C      . ALA C  3  46  ? 316.610 220.588 234.354 1.00 101.11 ? 46  ALA P C      1 
ATOM   8119   O  O      . ALA C  3  46  ? 316.962 221.718 234.006 1.00 97.44  ? 46  ALA P O      1 
ATOM   8120   C  CB     . ALA C  3  46  ? 316.660 218.832 232.561 1.00 99.88  ? 46  ALA P CB     1 
ATOM   8121   H  H      . ALA C  3  46  ? 315.370 221.013 232.016 1.00 86.99  ? 46  ALA P H      1 
ATOM   8122   H  HA     . ALA C  3  46  ? 315.206 219.145 233.979 1.00 89.31  ? 46  ALA P HA     1 
ATOM   8123   H  HB1    . ALA C  3  46  ? 317.200 218.266 233.133 1.00 93.14  ? 46  ALA P HB1    1 
ATOM   8124   H  HB2    . ALA C  3  46  ? 316.098 218.286 231.989 1.00 93.14  ? 46  ALA P HB2    1 
ATOM   8125   H  HB3    . ALA C  3  46  ? 317.232 219.398 232.019 1.00 93.14  ? 46  ALA P HB3    1 
ATOM   8126   N  N      . ALA C  3  47  ? 316.905 220.073 235.545 1.00 103.22 ? 47  ALA P N      1 
ATOM   8127   C  CA     . ALA C  3  47  ? 317.732 220.815 236.487 1.00 105.37 ? 47  ALA P CA     1 
ATOM   8128   C  C      . ALA C  3  47  ? 318.448 219.849 237.416 1.00 109.70 ? 47  ALA P C      1 
ATOM   8129   O  O      . ALA C  3  47  ? 317.876 218.840 237.837 1.00 129.73 ? 47  ALA P O      1 
ATOM   8130   C  CB     . ALA C  3  47  ? 316.897 221.806 237.304 1.00 85.57  ? 47  ALA P CB     1 
ATOM   8131   H  H      . ALA C  3  47  ? 316.641 219.304 235.828 1.00 92.96  ? 47  ALA P H      1 
ATOM   8132   H  HA     . ALA C  3  47  ? 318.402 221.316 235.996 1.00 95.22  ? 47  ALA P HA     1 
ATOM   8133   H  HB1    . ALA C  3  47  ? 317.481 222.279 237.918 1.00 76.17  ? 47  ALA P HB1    1 
ATOM   8134   H  HB2    . ALA C  3  47  ? 316.472 222.434 236.700 1.00 76.17  ? 47  ALA P HB2    1 
ATOM   8135   H  HB3    . ALA C  3  47  ? 316.223 221.316 237.801 1.00 76.17  ? 47  ALA P HB3    1 
ATOM   8136   N  N      . GLU C  3  48  ? 319.702 220.169 237.728 1.00 136.43 ? 48  GLU P N      1 
ATOM   8137   C  CA     . GLU C  3  48  ? 320.438 219.422 238.738 1.00 146.98 ? 48  GLU P CA     1 
ATOM   8138   C  C      . GLU C  3  48  ? 319.732 219.544 240.081 1.00 154.24 ? 48  GLU P C      1 
ATOM   8139   O  O      . GLU C  3  48  ? 319.228 220.610 240.441 1.00 147.95 ? 48  GLU P O      1 
ATOM   8140   C  CB     . GLU C  3  48  ? 321.872 219.951 238.846 1.00 156.09 ? 48  GLU P CB     1 
ATOM   8141   C  CG     . GLU C  3  48  ? 322.711 219.359 239.990 1.00 176.44 ? 48  GLU P CG     1 
ATOM   8142   C  CD     . GLU C  3  48  ? 323.777 220.319 240.497 1.00 190.63 ? 48  GLU P CD     1 
ATOM   8143   O  OE1    . GLU C  3  48  ? 323.427 221.259 241.241 1.00 195.82 ? 48  GLU P OE1    1 
ATOM   8144   O  OE2    . GLU C  3  48  ? 324.964 220.140 240.157 1.00 196.16 ? 48  GLU P OE2    1 
ATOM   8145   H  H      . GLU C  3  48  ? 320.146 220.812 237.369 1.00 127.64 ? 48  GLU P H      1 
ATOM   8146   H  HA     . GLU C  3  48  ? 320.472 218.485 238.490 1.00 137.90 ? 48  GLU P HA     1 
ATOM   8147   H  HB2    . GLU C  3  48  ? 322.334 219.757 238.016 1.00 146.65 ? 48  GLU P HB2    1 
ATOM   8148   H  HB3    . GLU C  3  48  ? 321.835 220.911 238.980 1.00 146.65 ? 48  GLU P HB3    1 
ATOM   8149   H  HG2    . GLU C  3  48  ? 322.125 219.142 240.732 1.00 166.73 ? 48  GLU P HG2    1 
ATOM   8150   H  HG3    . GLU C  3  48  ? 323.156 218.557 239.673 1.00 166.73 ? 48  GLU P HG3    1 
ATOM   8151   N  N      . ARG C  3  49  ? 319.691 218.443 240.826 1.00 151.00 ? 49  ARG P N      1 
ATOM   8152   C  CA     . ARG C  3  49  ? 319.197 218.472 242.201 1.00 156.61 ? 49  ARG P CA     1 
ATOM   8153   C  C      . ARG C  3  49  ? 320.372 218.851 243.088 1.00 149.40 ? 49  ARG P C      1 
ATOM   8154   O  O      . ARG C  3  49  ? 321.229 218.021 243.398 1.00 151.00 ? 49  ARG P O      1 
ATOM   8155   C  CB     . ARG C  3  49  ? 318.581 217.138 242.601 1.00 148.70 ? 49  ARG P CB     1 
ATOM   8156   C  CG     . ARG C  3  49  ? 317.147 216.964 242.112 1.00 137.75 ? 49  ARG P CG     1 
ATOM   8157   C  CD     . ARG C  3  49  ? 316.492 215.719 242.690 1.00 131.29 ? 49  ARG P CD     1 
ATOM   8158   N  NE     . ARG C  3  49  ? 316.430 215.768 244.149 1.00 133.81 ? 49  ARG P NE     1 
ATOM   8159   C  CZ     . ARG C  3  49  ? 316.483 214.704 244.945 1.00 149.25 ? 49  ARG P CZ     1 
ATOM   8160   N  NH1    . ARG C  3  49  ? 316.616 213.483 244.438 1.00 160.53 ? 49  ARG P NH1    1 
ATOM   8161   N  NH2    . ARG C  3  49  ? 316.420 214.862 246.261 1.00 154.46 ? 49  ARG P NH2    1 
ATOM   8162   H  H      . ARG C  3  49  ? 319.944 217.666 240.560 1.00 138.57 ? 49  ARG P H      1 
ATOM   8163   H  HA     . ARG C  3  49  ? 318.517 219.159 242.284 1.00 144.62 ? 49  ARG P HA     1 
ATOM   8164   H  HB2    . ARG C  3  49  ? 319.114 216.421 242.223 1.00 136.61 ? 49  ARG P HB2    1 
ATOM   8165   H  HB3    . ARG C  3  49  ? 318.577 217.071 243.568 1.00 136.61 ? 49  ARG P HB3    1 
ATOM   8166   H  HG2    . ARG C  3  49  ? 316.623 217.734 242.383 1.00 126.03 ? 49  ARG P HG2    1 
ATOM   8167   H  HG3    . ARG C  3  49  ? 317.148 216.884 241.145 1.00 126.03 ? 49  ARG P HG3    1 
ATOM   8168   H  HD2    . ARG C  3  49  ? 315.587 215.648 242.350 1.00 119.53 ? 49  ARG P HD2    1 
ATOM   8169   H  HD3    . ARG C  3  49  ? 317.009 214.939 242.434 1.00 119.53 ? 49  ARG P HD3    1 
ATOM   8170   H  HE     . ARG C  3  49  ? 316.353 216.540 244.520 1.00 122.34 ? 49  ARG P HE     1 
ATOM   8171   H  HH11   . ARG C  3  49  ? 316.659 213.374 243.586 1.00 148.34 ? 49  ARG P HH11   1 
ATOM   8172   H  HH12   . ARG C  3  49  ? 316.652 212.802 244.961 1.00 148.34 ? 49  ARG P HH12   1 
ATOM   8173   H  HH21   . ARG C  3  49  ? 316.337 215.650 246.596 1.00 143.06 ? 49  ARG P HH21   1 
ATOM   8174   H  HH22   . ARG C  3  49  ? 316.457 214.177 246.779 1.00 143.06 ? 49  ARG P HH22   1 
ATOM   8175   N  N      . ARG C  3  50  ? 320.417 220.125 243.481 1.00 198.91 ? 50  ARG P N      1 
ATOM   8176   C  CA     . ARG C  3  50  ? 321.555 220.637 244.232 1.00 197.04 ? 50  ARG P CA     1 
ATOM   8177   C  C      . ARG C  3  50  ? 321.818 219.792 245.465 1.00 197.62 ? 50  ARG P C      1 
ATOM   8178   O  O      . ARG C  3  50  ? 322.939 219.322 245.690 1.00 165.06 ? 50  ARG P O      1 
ATOM   8179   C  CB     . ARG C  3  50  ? 321.297 222.092 244.627 1.00 199.91 ? 50  ARG P CB     1 
ATOM   8180   C  CG     . ARG C  3  50  ? 322.475 222.759 245.290 1.00 200.22 ? 50  ARG P CG     1 
ATOM   8181   C  CD     . ARG C  3  50  ? 323.682 222.741 244.381 1.00 205.98 ? 50  ARG P CD     1 
ATOM   8182   N  NE     . ARG C  3  50  ? 324.748 223.593 244.886 1.00 207.51 ? 50  ARG P NE     1 
ATOM   8183   C  CZ     . ARG C  3  50  ? 325.864 223.868 244.221 1.00 200.66 ? 50  ARG P CZ     1 
ATOM   8184   N  NH1    . ARG C  3  50  ? 326.070 223.360 243.012 1.00 169.46 ? 50  ARG P NH1    1 
ATOM   8185   N  NH2    . ARG C  3  50  ? 326.775 224.657 244.769 1.00 223.91 ? 50  ARG P NH2    1 
ATOM   8186   H  H      . ARG C  3  50  ? 319.804 220.707 243.325 1.00 168.34 ? 50  ARG P H      1 
ATOM   8187   H  HA     . ARG C  3  50  ? 322.346 220.610 243.671 1.00 166.32 ? 50  ARG P HA     1 
ATOM   8188   H  HB2    . ARG C  3  50  ? 321.080 222.598 243.829 1.00 169.76 ? 50  ARG P HB2    1 
ATOM   8189   H  HB3    . ARG C  3  50  ? 320.552 222.120 245.247 1.00 169.76 ? 50  ARG P HB3    1 
ATOM   8190   H  HG2    . ARG C  3  50  ? 322.253 223.683 245.487 1.00 169.92 ? 50  ARG P HG2    1 
ATOM   8191   H  HG3    . ARG C  3  50  ? 322.698 222.284 246.106 1.00 169.92 ? 50  ARG P HG3    1 
ATOM   8192   H  HD2    . ARG C  3  50  ? 324.022 221.834 244.320 1.00 175.08 ? 50  ARG P HD2    1 
ATOM   8193   H  HD3    . ARG C  3  50  ? 323.426 223.063 243.503 1.00 175.08 ? 50  ARG P HD3    1 
ATOM   8194   H  HE     . ARG C  3  50  ? 324.648 223.941 245.666 1.00 176.51 ? 50  ARG P HE     1 
ATOM   8195   H  HH11   . ARG C  3  50  ? 325.479 222.847 242.654 1.00 137.58 ? 50  ARG P HH11   1 
ATOM   8196   H  HH12   . ARG C  3  50  ? 326.794 223.543 242.586 1.00 137.58 ? 50  ARG P HH12   1 
ATOM   8197   H  HH21   . ARG C  3  50  ? 326.642 224.986 245.552 1.00 192.40 ? 50  ARG P HH21   1 
ATOM   8198   H  HH22   . ARG C  3  50  ? 327.499 224.839 244.343 1.00 192.40 ? 50  ARG P HH22   1 
ATOM   8199   N  N      . ASN C  3  51  ? 320.789 219.593 246.281 1.00 226.13 ? 51  ASN P N      1 
ATOM   8200   C  CA     . ASN C  3  51  ? 320.899 218.762 247.467 1.00 219.13 ? 51  ASN P CA     1 
ATOM   8201   C  C      . ASN C  3  51  ? 320.674 217.312 247.084 1.00 183.19 ? 51  ASN P C      1 
ATOM   8202   O  O      . ASN C  3  51  ? 319.674 216.980 246.440 1.00 183.18 ? 51  ASN P O      1 
ATOM   8203   C  CB     . ASN C  3  51  ? 319.880 219.173 248.527 1.00 222.85 ? 51  ASN P CB     1 
ATOM   8204   C  CG     . ASN C  3  51  ? 320.131 220.555 249.074 1.00 217.50 ? 51  ASN P CG     1 
ATOM   8205   O  OD1    . ASN C  3  51  ? 321.076 220.775 249.831 1.00 218.06 ? 51  ASN P OD1    1 
ATOM   8206   N  ND2    . ASN C  3  51  ? 319.276 221.497 248.706 1.00 212.98 ? 51  ASN P ND2    1 
ATOM   8207   H  H      . ASN C  3  51  ? 320.008 219.933 246.165 1.00 194.78 ? 51  ASN P H      1 
ATOM   8208   H  HA     . ASN C  3  51  ? 321.789 218.849 247.843 1.00 187.68 ? 51  ASN P HA     1 
ATOM   8209   H  HB2    . ASN C  3  51  ? 318.993 219.163 248.133 1.00 192.04 ? 51  ASN P HB2    1 
ATOM   8210   H  HB3    . ASN C  3  51  ? 319.922 218.546 249.266 1.00 192.04 ? 51  ASN P HB3    1 
ATOM   8211   H  HD21   . ASN C  3  51  ? 319.374 222.303 248.990 1.00 183.05 ? 51  ASN P HD21   1 
ATOM   8212   H  HD22   . ASN C  3  51  ? 318.622 221.303 248.182 1.00 183.05 ? 51  ASN P HD22   1 
ATOM   8213   N  N      . ILE C  3  52  ? 321.608 216.455 247.476 1.00 147.13 ? 52  ILE P N      1 
ATOM   8214   C  CA     . ILE C  3  52  ? 321.406 215.017 247.422 1.00 147.15 ? 52  ILE P CA     1 
ATOM   8215   C  C      . ILE C  3  52  ? 322.020 214.431 248.682 1.00 139.60 ? 52  ILE P C      1 
ATOM   8216   O  O      . ILE C  3  52  ? 322.940 215.004 249.276 1.00 133.65 ? 52  ILE P O      1 
ATOM   8217   C  CB     . ILE C  3  52  ? 322.008 214.384 246.147 1.00 159.24 ? 52  ILE P CB     1 
ATOM   8218   C  CG1    . ILE C  3  52  ? 321.586 212.914 246.032 1.00 171.54 ? 52  ILE P CG1    1 
ATOM   8219   C  CG2    . ILE C  3  52  ? 323.525 214.535 246.134 1.00 166.54 ? 52  ILE P CG2    1 
ATOM   8220   C  CD1    . ILE C  3  52  ? 321.901 212.277 244.687 1.00 181.29 ? 52  ILE P CD1    1 
ATOM   8221   H  H      . ILE C  3  52  ? 322.378 216.687 247.782 1.00 123.16 ? 52  ILE P H      1 
ATOM   8222   H  HA     . ILE C  3  52  ? 320.455 214.829 247.433 1.00 122.81 ? 52  ILE P HA     1 
ATOM   8223   H  HB     . ILE C  3  52  ? 321.652 214.859 245.379 1.00 134.28 ? 52  ILE P HB     1 
ATOM   8224   H  HG12   . ILE C  3  52  ? 322.048 212.404 246.716 1.00 146.25 ? 52  ILE P HG12   1 
ATOM   8225   H  HG13   . ILE C  3  52  ? 320.628 212.854 246.170 1.00 146.25 ? 52  ILE P HG13   1 
ATOM   8226   H  HG21   . ILE C  3  52  ? 323.876 214.130 245.326 1.00 141.05 ? 52  ILE P HG21   1 
ATOM   8227   H  HG22   . ILE C  3  52  ? 323.748 215.479 246.155 1.00 141.05 ? 52  ILE P HG22   1 
ATOM   8228   H  HG23   . ILE C  3  52  ? 323.893 214.091 246.914 1.00 141.05 ? 52  ILE P HG23   1 
ATOM   8229   H  HD11   . ILE C  3  52  ? 321.605 211.354 244.698 1.00 155.44 ? 52  ILE P HD11   1 
ATOM   8230   H  HD12   . ILE C  3  52  ? 321.437 212.766 243.990 1.00 155.44 ? 52  ILE P HD12   1 
ATOM   8231   H  HD13   . ILE C  3  52  ? 322.859 212.316 244.537 1.00 155.44 ? 52  ILE P HD13   1 
ATOM   8232   N  N      . HIS C  3  53  ? 321.482 213.292 249.101 1.00 141.92 ? 53  HIS P N      1 
ATOM   8233   C  CA     . HIS C  3  53  ? 321.937 212.626 250.310 1.00 148.84 ? 53  HIS P CA     1 
ATOM   8234   C  C      . HIS C  3  53  ? 321.311 211.243 250.348 1.00 168.59 ? 53  HIS P C      1 
ATOM   8235   O  O      . HIS C  3  53  ? 321.037 210.656 249.294 1.00 178.10 ? 53  HIS P O      1 
ATOM   8236   C  CB     . HIS C  3  53  ? 321.567 213.442 251.555 1.00 130.93 ? 53  HIS P CB     1 
ATOM   8237   C  CG     . HIS C  3  53  ? 322.482 213.213 252.712 1.00 133.67 ? 53  HIS P CG     1 
ATOM   8238   N  ND1    . HIS C  3  53  ? 322.207 212.309 253.715 1.00 139.34 ? 53  HIS P ND1    1 
ATOM   8239   C  CD2    . HIS C  3  53  ? 323.682 213.761 253.016 1.00 139.16 ? 53  HIS P CD2    1 
ATOM   8240   C  CE1    . HIS C  3  53  ? 323.197 212.310 254.589 1.00 146.99 ? 53  HIS P CE1    1 
ATOM   8241   N  NE2    . HIS C  3  53  ? 324.104 213.184 254.189 1.00 148.41 ? 53  HIS P NE2    1 
ATOM   8242   H  H      . HIS C  3  53  ? 320.844 212.881 248.695 1.00 131.00 ? 53  HIS P H      1 
ATOM   8243   H  HA     . HIS C  3  53  ? 322.902 212.527 250.283 1.00 137.72 ? 53  HIS P HA     1 
ATOM   8244   H  HB2    . HIS C  3  53  ? 321.599 214.385 251.332 1.00 120.38 ? 53  HIS P HB2    1 
ATOM   8245   H  HB3    . HIS C  3  53  ? 320.670 213.199 251.833 1.00 120.38 ? 53  HIS P HB3    1 
ATOM   8246   H  HD2    . HIS C  3  53  ? 324.135 214.406 252.523 1.00 128.12 ? 53  HIS P HD2    1 
ATOM   8247   H  HE1    . HIS C  3  53  ? 323.245 211.790 255.358 1.00 135.88 ? 53  HIS P HE1    1 
ATOM   8248   H  HE2    . HIS C  3  53  ? 324.839 213.364 254.598 1.00 137.18 ? 53  HIS P HE2    1 
ATOM   8249   N  N      . LYS C  3  54  ? 321.086 210.703 251.541 1.00 166.16 ? 54  LYS P N      1 
ATOM   8250   C  CA     . LYS C  3  54  ? 320.169 209.581 251.681 1.00 155.96 ? 54  LYS P CA     1 
ATOM   8251   C  C      . LYS C  3  54  ? 319.356 209.693 252.965 1.00 164.33 ? 54  LYS P C      1 
ATOM   8252   O  O      . LYS C  3  54  ? 318.772 208.695 253.409 1.00 173.02 ? 54  LYS P O      1 
ATOM   8253   C  CB     . LYS C  3  54  ? 320.913 208.252 251.633 1.00 146.65 ? 54  LYS P CB     1 
ATOM   8254   C  CG     . LYS C  3  54  ? 321.983 208.060 252.686 1.00 148.59 ? 54  LYS P CG     1 
ATOM   8255   C  CD     . LYS C  3  54  ? 322.349 206.584 252.761 1.00 154.67 ? 54  LYS P CD     1 
ATOM   8256   C  CE     . LYS C  3  54  ? 323.047 206.222 254.058 1.00 159.24 ? 54  LYS P CE     1 
ATOM   8257   N  NZ     . LYS C  3  54  ? 323.311 204.755 254.156 1.00 165.51 ? 54  LYS P NZ     1 
ATOM   8258   H  H      . LYS C  3  54  ? 321.448 210.964 252.276 1.00 138.86 ? 54  LYS P H      1 
ATOM   8259   H  HA     . LYS C  3  54  ? 319.546 209.596 250.938 1.00 128.65 ? 54  LYS P HA     1 
ATOM   8260   H  HB2    . LYS C  3  54  ? 320.268 207.536 251.741 1.00 118.62 ? 54  LYS P HB2    1 
ATOM   8261   H  HB3    . LYS C  3  54  ? 321.342 208.173 250.766 1.00 118.62 ? 54  LYS P HB3    1 
ATOM   8262   H  HG2    . LYS C  3  54  ? 322.775 208.566 252.445 1.00 120.24 ? 54  LYS P HG2    1 
ATOM   8263   H  HG3    . LYS C  3  54  ? 321.646 208.342 253.551 1.00 120.24 ? 54  LYS P HG3    1 
ATOM   8264   H  HD2    . LYS C  3  54  ? 321.540 206.053 252.698 1.00 125.69 ? 54  LYS P HD2    1 
ATOM   8265   H  HD3    . LYS C  3  54  ? 322.947 206.368 252.028 1.00 125.69 ? 54  LYS P HD3    1 
ATOM   8266   H  HE2    . LYS C  3  54  ? 323.898 206.686 254.103 1.00 130.05 ? 54  LYS P HE2    1 
ATOM   8267   H  HE3    . LYS C  3  54  ? 322.485 206.479 254.805 1.00 130.05 ? 54  LYS P HE3    1 
ATOM   8268   H  HZ1    . LYS C  3  54  ? 323.720 204.571 254.924 1.00 135.72 ? 54  LYS P HZ1    1 
ATOM   8269   H  HZ2    . LYS C  3  54  ? 322.544 204.306 254.121 1.00 135.72 ? 54  LYS P HZ2    1 
ATOM   8270   H  HZ3    . LYS C  3  54  ? 323.830 204.494 253.481 1.00 135.72 ? 54  LYS P HZ3    1 
ATOM   8271   N  N      . LEU C  3  55  ? 319.317 210.877 253.574 1.00 83.85  ? 55  LEU P N      1 
ATOM   8272   C  CA     . LEU C  3  55  ? 318.402 211.163 254.665 1.00 82.98  ? 55  LEU P CA     1 
ATOM   8273   C  C      . LEU C  3  55  ? 317.296 212.130 254.275 1.00 77.55  ? 55  LEU P C      1 
ATOM   8274   O  O      . LEU C  3  55  ? 316.290 212.208 254.986 1.00 76.83  ? 55  LEU P O      1 
ATOM   8275   C  CB     . LEU C  3  55  ? 319.178 211.722 255.866 1.00 84.54  ? 55  LEU P CB     1 
ATOM   8276   C  CG     . LEU C  3  55  ? 320.234 210.740 256.368 1.00 90.40  ? 55  LEU P CG     1 
ATOM   8277   C  CD1    . LEU C  3  55  ? 321.191 211.400 257.338 1.00 91.80  ? 55  LEU P CD1    1 
ATOM   8278   C  CD2    . LEU C  3  55  ? 319.547 209.547 257.016 1.00 94.18  ? 55  LEU P CD2    1 
ATOM   8279   H  H      . LEU C  3  55  ? 319.822 211.540 253.365 1.00 103.08 ? 55  LEU P H      1 
ATOM   8280   H  HA     . LEU C  3  55  ? 317.983 210.333 254.944 1.00 102.76 ? 55  LEU P HA     1 
ATOM   8281   H  HB2    . LEU C  3  55  ? 319.625 212.541 255.604 1.00 104.37 ? 55  LEU P HB2    1 
ATOM   8282   H  HB3    . LEU C  3  55  ? 318.558 211.897 256.592 1.00 104.37 ? 55  LEU P HB3    1 
ATOM   8283   H  HG     . LEU C  3  55  ? 320.749 210.416 255.612 1.00 109.60 ? 55  LEU P HG     1 
ATOM   8284   H  HD11   . LEU C  3  55  ? 321.844 210.745 257.631 1.00 110.96 ? 55  LEU P HD11   1 
ATOM   8285   H  HD12   . LEU C  3  55  ? 321.638 212.135 256.890 1.00 110.96 ? 55  LEU P HD12   1 
ATOM   8286   H  HD13   . LEU C  3  55  ? 320.690 211.732 258.099 1.00 110.96 ? 55  LEU P HD13   1 
ATOM   8287   H  HD21   . LEU C  3  55  ? 320.222 208.927 257.332 1.00 113.32 ? 55  LEU P HD21   1 
ATOM   8288   H  HD22   . LEU C  3  55  ? 319.009 209.859 257.760 1.00 113.32 ? 55  LEU P HD22   1 
ATOM   8289   H  HD23   . LEU C  3  55  ? 318.981 209.113 256.358 1.00 113.32 ? 55  LEU P HD23   1 
ATOM   8290   N  N      . LEU C  3  56  ? 317.451 212.855 253.171 1.00 98.31  ? 56  LEU P N      1 
ATOM   8291   C  CA     . LEU C  3  56  ? 316.357 213.655 252.642 1.00 93.56  ? 56  LEU P CA     1 
ATOM   8292   C  C      . LEU C  3  56  ? 315.149 212.776 252.373 1.00 94.08  ? 56  LEU P C      1 
ATOM   8293   O  O      . LEU C  3  56  ? 315.274 211.591 252.055 1.00 97.58  ? 56  LEU P O      1 
ATOM   8294   C  CB     . LEU C  3  56  ? 316.769 214.348 251.350 1.00 90.55  ? 56  LEU P CB     1 
ATOM   8295   C  CG     . LEU C  3  56  ? 317.921 215.339 251.452 1.00 95.88  ? 56  LEU P CG     1 
ATOM   8296   C  CD1    . LEU C  3  56  ? 318.133 215.975 250.091 1.00 105.75 ? 56  LEU P CD1    1 
ATOM   8297   C  CD2    . LEU C  3  56  ? 317.637 216.391 252.509 1.00 102.02 ? 56  LEU P CD2    1 
ATOM   8298   H  H      . LEU C  3  56  ? 318.177 212.900 252.712 1.00 94.49  ? 56  LEU P H      1 
ATOM   8299   H  HA     . LEU C  3  56  ? 316.107 214.332 253.290 1.00 90.30  ? 56  LEU P HA     1 
ATOM   8300   H  HB2    . LEU C  3  56  ? 317.030 213.667 250.710 1.00 87.19  ? 56  LEU P HB2    1 
ATOM   8301   H  HB3    . LEU C  3  56  ? 316.002 214.833 251.008 1.00 87.19  ? 56  LEU P HB3    1 
ATOM   8302   H  HG     . LEU C  3  56  ? 318.732 214.866 251.699 1.00 92.42  ? 56  LEU P HG     1 
ATOM   8303   H  HD11   . LEU C  3  56  ? 318.866 216.608 250.149 1.00 102.22 ? 56  LEU P HD11   1 
ATOM   8304   H  HD12   . LEU C  3  56  ? 318.345 215.281 249.448 1.00 102.22 ? 56  LEU P HD12   1 
ATOM   8305   H  HD13   . LEU C  3  56  ? 317.320 216.434 249.828 1.00 102.22 ? 56  LEU P HD13   1 
ATOM   8306   H  HD21   . LEU C  3  56  ? 318.386 217.006 252.551 1.00 99.11  ? 56  LEU P HD21   1 
ATOM   8307   H  HD22   . LEU C  3  56  ? 316.829 216.869 252.268 1.00 99.11  ? 56  LEU P HD22   1 
ATOM   8308   H  HD23   . LEU C  3  56  ? 317.520 215.952 253.366 1.00 99.11  ? 56  LEU P HD23   1 
ATOM   8309   N  N      . ASP C  3  57  ? 313.966 213.376 252.477 1.00 98.51  ? 57  ASP P N      1 
ATOM   8310   C  CA     . ASP C  3  57  ? 312.735 212.608 252.394 1.00 107.30 ? 57  ASP P CA     1 
ATOM   8311   C  C      . ASP C  3  57  ? 312.070 212.679 251.027 1.00 98.85  ? 57  ASP P C      1 
ATOM   8312   O  O      . ASP C  3  57  ? 311.250 211.807 250.713 1.00 100.46 ? 57  ASP P O      1 
ATOM   8313   C  CB     . ASP C  3  57  ? 311.750 213.074 253.469 1.00 116.84 ? 57  ASP P CB     1 
ATOM   8314   C  CG     . ASP C  3  57  ? 310.775 211.981 253.879 1.00 143.18 ? 57  ASP P CG     1 
ATOM   8315   O  OD1    . ASP C  3  57  ? 311.162 210.792 253.853 1.00 133.73 ? 57  ASP P OD1    1 
ATOM   8316   O  OD2    . ASP C  3  57  ? 309.624 212.310 254.232 1.00 172.57 ? 57  ASP P OD2    1 
ATOM   8317   H  H      . ASP C  3  57  ? 313.853 214.220 252.595 1.00 109.67 ? 57  ASP P H      1 
ATOM   8318   H  HA     . ASP C  3  57  ? 312.941 211.677 252.569 1.00 118.63 ? 57  ASP P HA     1 
ATOM   8319   H  HB2    . ASP C  3  57  ? 312.246 213.346 254.257 1.00 128.76 ? 57  ASP P HB2    1 
ATOM   8320   H  HB3    . ASP C  3  57  ? 311.236 213.821 253.125 1.00 128.76 ? 57  ASP P HB3    1 
ATOM   8321   N  N      . GLU C  3  58  ? 312.394 213.682 250.211 1.00 147.57 ? 58  GLU P N      1 
ATOM   8322   C  CA     . GLU C  3  58  ? 311.994 213.693 248.805 1.00 160.45 ? 58  GLU P CA     1 
ATOM   8323   C  C      . GLU C  3  58  ? 310.482 213.538 248.647 1.00 153.89 ? 58  GLU P C      1 
ATOM   8324   O  O      . GLU C  3  58  ? 310.008 212.939 247.679 1.00 147.81 ? 58  GLU P O      1 
ATOM   8325   C  CB     . GLU C  3  58  ? 312.732 212.595 248.030 1.00 189.45 ? 58  GLU P CB     1 
ATOM   8326   C  CG     . GLU C  3  58  ? 314.253 212.620 248.217 1.00 202.20 ? 58  GLU P CG     1 
ATOM   8327   C  CD     . GLU C  3  58  ? 314.912 211.293 247.891 1.00 193.94 ? 58  GLU P CD     1 
ATOM   8328   O  OE1    . GLU C  3  58  ? 315.288 210.571 248.842 1.00 189.98 ? 58  GLU P OE1    1 
ATOM   8329   O  OE2    . GLU C  3  58  ? 315.048 210.974 246.691 1.00 185.70 ? 58  GLU P OE2    1 
ATOM   8330   H  H      . GLU C  3  58  ? 312.849 214.371 250.450 1.00 121.76 ? 58  GLU P H      1 
ATOM   8331   H  HA     . GLU C  3  58  ? 312.244 214.547 248.418 1.00 134.58 ? 58  GLU P HA     1 
ATOM   8332   H  HB2    . GLU C  3  58  ? 312.411 211.730 248.330 1.00 162.88 ? 58  GLU P HB2    1 
ATOM   8333   H  HB3    . GLU C  3  58  ? 312.549 212.703 247.083 1.00 162.88 ? 58  GLU P HB3    1 
ATOM   8334   H  HG2    . GLU C  3  58  ? 314.632 213.294 247.632 1.00 175.15 ? 58  GLU P HG2    1 
ATOM   8335   H  HG3    . GLU C  3  58  ? 314.453 212.834 249.142 1.00 175.15 ? 58  GLU P HG3    1 
ATOM   8336   N  N      . VAL C  3  59  ? 309.716 214.077 249.598 1.00 188.69 ? 59  VAL P N      1 
ATOM   8337   C  CA     . VAL C  3  59  ? 308.259 213.989 249.568 1.00 199.69 ? 59  VAL P CA     1 
ATOM   8338   C  C      . VAL C  3  59  ? 307.689 215.247 248.932 1.00 193.43 ? 59  VAL P C      1 
ATOM   8339   O  O      . VAL C  3  59  ? 306.591 215.690 249.284 1.00 198.49 ? 59  VAL P O      1 
ATOM   8340   C  CB     . VAL C  3  59  ? 307.676 213.788 250.979 1.00 194.16 ? 59  VAL P CB     1 
ATOM   8341   C  CG1    . VAL C  3  59  ? 308.233 212.521 251.604 1.00 199.27 ? 59  VAL P CG1    1 
ATOM   8342   C  CG2    . VAL C  3  59  ? 307.950 215.007 251.864 1.00 167.23 ? 59  VAL P CG2    1 
ATOM   8343   H  H      . VAL C  3  59  ? 310.023 214.504 250.279 1.00 154.18 ? 59  VAL P H      1 
ATOM   8344   H  HA     . VAL C  3  59  ? 307.998 213.231 249.022 1.00 165.61 ? 59  VAL P HA     1 
ATOM   8345   H  HB     . VAL C  3  59  ? 306.714 213.684 250.907 1.00 160.38 ? 59  VAL P HB     1 
ATOM   8346   H  HG11   . VAL C  3  59  ? 307.853 212.413 252.491 1.00 165.02 ? 59  VAL P HG11   1 
ATOM   8347   H  HG12   . VAL C  3  59  ? 307.994 211.763 251.048 1.00 165.02 ? 59  VAL P HG12   1 
ATOM   8348   H  HG13   . VAL C  3  59  ? 309.198 212.596 251.664 1.00 165.02 ? 59  VAL P HG13   1 
ATOM   8349   H  HG21   . VAL C  3  59  ? 307.571 214.850 252.743 1.00 133.83 ? 59  VAL P HG21   1 
ATOM   8350   H  HG22   . VAL C  3  59  ? 308.908 215.137 251.934 1.00 133.83 ? 59  VAL P HG22   1 
ATOM   8351   H  HG23   . VAL C  3  59  ? 307.538 215.788 251.461 1.00 133.83 ? 59  VAL P HG23   1 
ATOM   8352   N  N      . PHE C  3  60  ? 308.428 215.832 248.001 1.00 230.83 ? 60  PHE P N      1 
ATOM   8353   C  CA     . PHE C  3  60  ? 307.976 217.027 247.313 1.00 228.10 ? 60  PHE P CA     1 
ATOM   8354   C  C      . PHE C  3  60  ? 307.498 216.680 245.910 1.00 213.79 ? 60  PHE P C      1 
ATOM   8355   O  O      . PHE C  3  60  ? 307.772 215.602 245.377 1.00 216.14 ? 60  PHE P O      1 
ATOM   8356   C  CB     . PHE C  3  60  ? 309.095 218.066 247.225 1.00 245.33 ? 60  PHE P CB     1 
ATOM   8357   C  CG     . PHE C  3  60  ? 309.928 218.182 248.468 1.00 256.54 ? 60  PHE P CG     1 
ATOM   8358   C  CD1    . PHE C  3  60  ? 311.212 217.668 248.500 1.00 265.62 ? 60  PHE P CD1    1 
ATOM   8359   C  CD2    . PHE C  3  60  ? 309.439 218.816 249.595 1.00 253.16 ? 60  PHE P CD2    1 
ATOM   8360   C  CE1    . PHE C  3  60  ? 311.988 217.778 249.632 1.00 267.02 ? 60  PHE P CE1    1 
ATOM   8361   C  CE2    . PHE C  3  60  ? 310.214 218.927 250.731 1.00 253.33 ? 60  PHE P CE2    1 
ATOM   8362   C  CZ     . PHE C  3  60  ? 311.490 218.409 250.747 1.00 261.24 ? 60  PHE P CZ     1 
ATOM   8363   H  H      . PHE C  3  60  ? 309.201 215.553 247.748 1.00 183.54 ? 60  PHE P H      1 
ATOM   8364   H  HA     . PHE C  3  60  ? 307.234 217.418 247.800 1.00 181.19 ? 60  PHE P HA     1 
ATOM   8365   H  HB2    . PHE C  3  60  ? 309.687 217.825 246.495 1.00 198.35 ? 60  PHE P HB2    1 
ATOM   8366   H  HB3    . PHE C  3  60  ? 308.700 218.935 247.052 1.00 198.35 ? 60  PHE P HB3    1 
ATOM   8367   H  HD1    . PHE C  3  60  ? 311.555 217.242 247.748 1.00 218.04 ? 60  PHE P HD1    1 
ATOM   8368   H  HD2    . PHE C  3  60  ? 308.578 219.170 249.588 1.00 206.60 ? 60  PHE P HD2    1 
ATOM   8369   H  HE1    . PHE C  3  60  ? 312.849 217.426 249.643 1.00 219.37 ? 60  PHE P HE1    1 
ATOM   8370   H  HE2    . PHE C  3  60  ? 309.875 219.354 251.486 1.00 206.70 ? 60  PHE P HE2    1 
ATOM   8371   H  HZ     . PHE C  3  60  ? 312.011 218.481 251.514 1.00 214.07 ? 60  PHE P HZ     1 
ATOM   8372   N  N      . PHE C  3  61  ? 306.754 217.617 245.325 1.00 160.57 ? 61  PHE P N      1 
ATOM   8373   C  CA     . PHE C  3  61  ? 306.543 217.611 243.882 1.00 156.39 ? 61  PHE P CA     1 
ATOM   8374   C  C      . PHE C  3  61  ? 307.880 217.668 243.149 1.00 146.76 ? 61  PHE P C      1 
ATOM   8375   O  O      . PHE C  3  61  ? 308.109 216.928 242.186 1.00 131.97 ? 61  PHE P O      1 
ATOM   8376   C  CB     . PHE C  3  61  ? 305.658 218.802 243.505 1.00 150.07 ? 61  PHE P CB     1 
ATOM   8377   C  CG     . PHE C  3  61  ? 305.222 218.827 242.066 1.00 149.77 ? 61  PHE P CG     1 
ATOM   8378   C  CD1    . PHE C  3  61  ? 303.966 218.365 241.704 1.00 166.13 ? 61  PHE P CD1    1 
ATOM   8379   C  CD2    . PHE C  3  61  ? 306.049 219.346 241.083 1.00 127.94 ? 61  PHE P CD2    1 
ATOM   8380   C  CE1    . PHE C  3  61  ? 303.550 218.401 240.385 1.00 162.32 ? 61  PHE P CE1    1 
ATOM   8381   C  CE2    . PHE C  3  61  ? 305.639 219.385 239.763 1.00 128.41 ? 61  PHE P CE2    1 
ATOM   8382   C  CZ     . PHE C  3  61  ? 304.388 218.912 239.413 1.00 143.51 ? 61  PHE P CZ     1 
ATOM   8383   H  H      . PHE C  3  61  ? 306.363 218.261 245.739 1.00 141.07 ? 61  PHE P H      1 
ATOM   8384   H  HA     . PHE C  3  61  ? 306.086 216.795 243.625 1.00 136.73 ? 61  PHE P HA     1 
ATOM   8385   H  HB2    . PHE C  3  61  ? 304.859 218.779 244.054 1.00 130.95 ? 61  PHE P HB2    1 
ATOM   8386   H  HB3    . PHE C  3  61  ? 306.149 219.620 243.678 1.00 130.95 ? 61  PHE P HB3    1 
ATOM   8387   H  HD1    . PHE C  3  61  ? 303.398 218.020 242.355 1.00 147.11 ? 61  PHE P HD1    1 
ATOM   8388   H  HD2    . PHE C  3  61  ? 306.892 219.666 241.313 1.00 108.46 ? 61  PHE P HD2    1 
ATOM   8389   H  HE1    . PHE C  3  61  ? 302.708 218.081 240.154 1.00 143.21 ? 61  PHE P HE1    1 
ATOM   8390   H  HE2    . PHE C  3  61  ? 306.205 219.729 239.110 1.00 108.84 ? 61  PHE P HE2    1 
ATOM   8391   H  HZ     . PHE C  3  61  ? 304.112 218.936 238.526 1.00 124.12 ? 61  PHE P HZ     1 
ATOM   8392   N  N      . SER C  3  62  ? 308.779 218.540 243.609 1.00 129.15 ? 62  SER P N      1 
ATOM   8393   C  CA     . SER C  3  62  ? 310.107 218.722 243.030 1.00 125.37 ? 62  SER P CA     1 
ATOM   8394   C  C      . SER C  3  62  ? 310.873 219.780 243.821 1.00 102.64 ? 62  SER P C      1 
ATOM   8395   O  O      . SER C  3  62  ? 310.266 220.672 244.419 1.00 101.07 ? 62  SER P O      1 
ATOM   8396   C  CB     . SER C  3  62  ? 310.010 219.123 241.555 1.00 132.15 ? 62  SER P CB     1 
ATOM   8397   O  OG     . SER C  3  62  ? 310.894 218.358 240.755 1.00 138.59 ? 62  SER P OG     1 
ATOM   8398   H  H      . SER C  3  62  ? 308.634 219.056 244.282 1.00 134.22 ? 62  SER P H      1 
ATOM   8399   H  HA     . SER C  3  62  ? 310.597 217.886 243.086 1.00 129.97 ? 62  SER P HA     1 
ATOM   8400   H  HB2    . SER C  3  62  ? 309.102 218.977 241.249 1.00 136.65 ? 62  SER P HB2    1 
ATOM   8401   H  HB3    . SER C  3  62  ? 310.240 220.062 241.469 1.00 136.65 ? 62  SER P HB3    1 
ATOM   8402   H  HG     . SER C  3  62  ? 311.686 218.476 241.009 1.00 142.44 ? 62  SER P HG     1 
ATOM   8403   N  N      . GLU C  3  63  ? 312.204 219.702 243.832 1.00 144.00 ? 63  GLU P N      1 
ATOM   8404   C  CA     . GLU C  3  63  ? 313.004 220.653 244.598 1.00 163.40 ? 63  GLU P CA     1 
ATOM   8405   C  C      . GLU C  3  63  ? 313.176 221.974 243.857 1.00 138.70 ? 63  GLU P C      1 
ATOM   8406   O  O      . GLU C  3  63  ? 313.352 223.021 244.491 1.00 136.44 ? 63  GLU P O      1 
ATOM   8407   C  CB     . GLU C  3  63  ? 314.373 220.037 244.916 1.00 195.19 ? 63  GLU P CB     1 
ATOM   8408   C  CG     . GLU C  3  63  ? 315.076 220.586 246.159 1.00 204.90 ? 63  GLU P CG     1 
ATOM   8409   C  CD     . GLU C  3  63  ? 316.336 219.801 246.508 1.00 184.16 ? 63  GLU P CD     1 
ATOM   8410   O  OE1    . GLU C  3  63  ? 317.161 219.560 245.597 1.00 181.14 ? 63  GLU P OE1    1 
ATOM   8411   O  OE2    . GLU C  3  63  ? 316.492 219.417 247.691 1.00 164.07 ? 63  GLU P OE2    1 
ATOM   8412   H  H      . GLU C  3  63  ? 312.664 219.112 243.408 1.00 116.81 ? 63  GLU P H      1 
ATOM   8413   H  HA     . GLU C  3  63  ? 312.556 220.837 245.439 1.00 136.32 ? 63  GLU P HA     1 
ATOM   8414   H  HB2    . GLU C  3  63  ? 314.256 219.083 245.046 1.00 167.54 ? 63  GLU P HB2    1 
ATOM   8415   H  HB3    . GLU C  3  63  ? 314.960 220.191 244.159 1.00 167.54 ? 63  GLU P HB3    1 
ATOM   8416   H  HG2    . GLU C  3  63  ? 315.331 221.508 245.999 1.00 177.35 ? 63  GLU P HG2    1 
ATOM   8417   H  HG3    . GLU C  3  63  ? 314.470 220.535 246.915 1.00 177.35 ? 63  GLU P HG3    1 
ATOM   8418   N  N      . LYS C  3  64  ? 313.122 221.947 242.527 1.00 103.60 ? 64  LYS P N      1 
ATOM   8419   C  CA     . LYS C  3  64  ? 313.427 223.109 241.707 1.00 101.63 ? 64  LYS P CA     1 
ATOM   8420   C  C      . LYS C  3  64  ? 312.259 223.603 240.881 1.00 90.24  ? 64  LYS P C      1 
ATOM   8421   O  O      . LYS C  3  64  ? 312.283 224.757 240.445 1.00 99.82  ? 64  LYS P O      1 
ATOM   8422   C  CB     . LYS C  3  64  ? 314.571 222.798 240.733 1.00 102.94 ? 64  LYS P CB     1 
ATOM   8423   C  CG     . LYS C  3  64  ? 315.734 222.055 241.352 1.00 106.59 ? 64  LYS P CG     1 
ATOM   8424   C  CD     . LYS C  3  64  ? 316.648 222.990 242.108 1.00 110.25 ? 64  LYS P CD     1 
ATOM   8425   C  CE     . LYS C  3  64  ? 317.298 223.986 241.167 1.00 120.18 ? 64  LYS P CE     1 
ATOM   8426   N  NZ     . LYS C  3  64  ? 318.612 224.442 241.671 1.00 128.12 ? 64  LYS P NZ     1 
ATOM   8427   H  H      . LYS C  3  64  ? 312.905 221.251 242.071 1.00 100.42 ? 64  LYS P H      1 
ATOM   8428   H  HA     . LYS C  3  64  ? 313.714 223.834 242.284 1.00 98.52  ? 64  LYS P HA     1 
ATOM   8429   H  HB2    . LYS C  3  64  ? 314.223 222.252 240.010 1.00 99.20  ? 64  LYS P HB2    1 
ATOM   8430   H  HB3    . LYS C  3  64  ? 314.911 223.634 240.377 1.00 99.20  ? 64  LYS P HB3    1 
ATOM   8431   H  HG2    . LYS C  3  64  ? 315.395 221.392 241.973 1.00 102.35 ? 64  LYS P HG2    1 
ATOM   8432   H  HG3    . LYS C  3  64  ? 316.249 221.626 240.651 1.00 102.35 ? 64  LYS P HG3    1 
ATOM   8433   H  HD2    . LYS C  3  64  ? 316.133 223.482 242.766 1.00 106.08 ? 64  LYS P HD2    1 
ATOM   8434   H  HD3    . LYS C  3  64  ? 317.347 222.476 242.541 1.00 106.08 ? 64  LYS P HD3    1 
ATOM   8435   H  HE2    . LYS C  3  64  ? 317.434 223.566 240.303 1.00 115.89 ? 64  LYS P HE2    1 
ATOM   8436   H  HE3    . LYS C  3  64  ? 316.722 224.761 241.076 1.00 115.89 ? 64  LYS P HE3    1 
ATOM   8437   H  HZ1    . LYS C  3  64  ? 318.971 225.024 241.101 1.00 123.57 ? 64  LYS P HZ1    1 
ATOM   8438   H  HZ2    . LYS C  3  64  ? 318.514 224.836 242.463 1.00 123.57 ? 64  LYS P HZ2    1 
ATOM   8439   H  HZ3    . LYS C  3  64  ? 319.162 223.748 241.759 1.00 123.57 ? 64  LYS P HZ3    1 
ATOM   8440   N  N      . ILE C  3  65  ? 311.258 222.772 240.638 1.00 69.85  ? 65  ILE P N      1 
ATOM   8441   C  CA     . ILE C  3  65  ? 310.177 223.093 239.720 1.00 71.70  ? 65  ILE P CA     1 
ATOM   8442   C  C      . ILE C  3  65  ? 308.971 223.527 240.534 1.00 88.41  ? 65  ILE P C      1 
ATOM   8443   O  O      . ILE C  3  65  ? 308.375 222.732 241.268 1.00 109.16 ? 65  ILE P O      1 
ATOM   8444   C  CB     . ILE C  3  65  ? 309.858 221.902 238.813 1.00 71.53  ? 65  ILE P CB     1 
ATOM   8445   C  CG1    . ILE C  3  65  ? 310.942 221.831 237.748 1.00 70.35  ? 65  ILE P CG1    1 
ATOM   8446   C  CG2    . ILE C  3  65  ? 308.464 222.025 238.188 1.00 71.60  ? 65  ILE P CG2    1 
ATOM   8447   C  CD1    . ILE C  3  65  ? 310.895 220.611 236.961 1.00 72.86  ? 65  ILE P CD1    1 
ATOM   8448   H  H      . ILE C  3  65  ? 311.180 221.998 241.003 1.00 74.23  ? 65  ILE P H      1 
ATOM   8449   H  HA     . ILE C  3  65  ? 310.447 223.836 239.158 1.00 76.35  ? 65  ILE P HA     1 
ATOM   8450   H  HB     . ILE C  3  65  ? 309.890 221.091 239.343 1.00 75.80  ? 65  ILE P HB     1 
ATOM   8451   H  HG12   . ILE C  3  65  ? 310.837 222.581 237.142 1.00 74.05  ? 65  ILE P HG12   1 
ATOM   8452   H  HG13   . ILE C  3  65  ? 311.810 221.875 238.179 1.00 74.05  ? 65  ILE P HG13   1 
ATOM   8453   H  HG21   . ILE C  3  65  ? 308.302 221.254 237.622 1.00 76.24  ? 65  ILE P HG21   1 
ATOM   8454   H  HG22   . ILE C  3  65  ? 307.802 222.061 238.896 1.00 76.24  ? 65  ILE P HG22   1 
ATOM   8455   H  HG23   . ILE C  3  65  ? 308.426 222.837 237.658 1.00 76.24  ? 65  ILE P HG23   1 
ATOM   8456   H  HD11   . ILE C  3  65  ? 311.609 220.630 236.305 1.00 76.09  ? 65  ILE P HD11   1 
ATOM   8457   H  HD12   . ILE C  3  65  ? 311.009 219.850 237.552 1.00 76.09  ? 65  ILE P HD12   1 
ATOM   8458   H  HD13   . ILE C  3  65  ? 310.035 220.557 236.514 1.00 76.09  ? 65  ILE P HD13   1 
ATOM   8459   N  N      . TYR C  3  66  ? 308.621 224.798 240.405 1.00 76.56  ? 66  TYR P N      1 
ATOM   8460   C  CA     . TYR C  3  66  ? 307.382 225.324 240.942 1.00 60.47  ? 66  TYR P CA     1 
ATOM   8461   C  C      . TYR C  3  66  ? 306.372 225.474 239.822 1.00 58.34  ? 66  TYR P C      1 
ATOM   8462   O  O      . TYR C  3  66  ? 306.699 225.936 238.726 1.00 56.57  ? 66  TYR P O      1 
ATOM   8463   C  CB     . TYR C  3  66  ? 307.602 226.670 241.612 1.00 57.35  ? 66  TYR P CB     1 
ATOM   8464   C  CG     . TYR C  3  66  ? 308.632 226.595 242.685 1.00 58.73  ? 66  TYR P CG     1 
ATOM   8465   C  CD1    . TYR C  3  66  ? 309.975 226.603 242.371 1.00 58.57  ? 66  TYR P CD1    1 
ATOM   8466   C  CD2    . TYR C  3  66  ? 308.264 226.497 244.012 1.00 66.72  ? 66  TYR P CD2    1 
ATOM   8467   C  CE1    . TYR C  3  66  ? 310.928 226.525 243.345 1.00 72.16  ? 66  TYR P CE1    1 
ATOM   8468   C  CE2    . TYR C  3  66  ? 309.208 226.422 245.004 1.00 78.43  ? 66  TYR P CE2    1 
ATOM   8469   C  CZ     . TYR C  3  66  ? 310.545 226.437 244.664 1.00 91.08  ? 66  TYR P CZ     1 
ATOM   8470   O  OH     . TYR C  3  66  ? 311.505 226.364 245.646 1.00 121.78 ? 66  TYR P OH     1 
ATOM   8471   H  H      . TYR C  3  66  ? 309.099 225.388 240.001 1.00 72.47  ? 66  TYR P H      1 
ATOM   8472   H  HA     . TYR C  3  66  ? 307.024 224.706 241.599 1.00 56.98  ? 66  TYR P HA     1 
ATOM   8473   H  HB2    . TYR C  3  66  ? 307.902 227.311 240.948 1.00 54.23  ? 66  TYR P HB2    1 
ATOM   8474   H  HB3    . TYR C  3  66  ? 306.769 226.966 242.011 1.00 54.23  ? 66  TYR P HB3    1 
ATOM   8475   H  HD1    . TYR C  3  66  ? 310.235 226.664 241.481 1.00 54.82  ? 66  TYR P HD1    1 
ATOM   8476   H  HD2    . TYR C  3  66  ? 307.362 226.489 244.238 1.00 63.73  ? 66  TYR P HD2    1 
ATOM   8477   H  HE1    . TYR C  3  66  ? 311.830 226.537 243.119 1.00 68.25  ? 66  TYR P HE1    1 
ATOM   8478   H  HE2    . TYR C  3  66  ? 308.950 226.361 245.895 1.00 75.27  ? 66  TYR P HE2    1 
ATOM   8479   H  HH     . TYR C  3  66  ? 311.140 226.315 246.401 1.00 117.98 ? 66  TYR P HH     1 
ATOM   8480   N  N      . LYS C  3  67  ? 305.148 225.075 240.109 1.00 72.15  ? 67  LYS P N      1 
ATOM   8481   C  CA     . LYS C  3  67  ? 304.035 225.248 239.194 1.00 70.03  ? 67  LYS P CA     1 
ATOM   8482   C  C      . LYS C  3  67  ? 303.381 226.590 239.514 1.00 65.50  ? 67  LYS P C      1 
ATOM   8483   O  O      . LYS C  3  67  ? 302.962 226.826 240.652 1.00 64.78  ? 67  LYS P O      1 
ATOM   8484   C  CB     . LYS C  3  67  ? 303.082 224.068 239.359 1.00 72.99  ? 67  LYS P CB     1 
ATOM   8485   C  CG     . LYS C  3  67  ? 302.091 223.844 238.242 1.00 73.44  ? 67  LYS P CG     1 
ATOM   8486   C  CD     . LYS C  3  67  ? 301.203 222.644 238.575 1.00 104.85 ? 67  LYS P CD     1 
ATOM   8487   C  CE     . LYS C  3  67  ? 299.824 222.754 237.941 1.00 140.05 ? 67  LYS P CE     1 
ATOM   8488   N  NZ     . LYS C  3  67  ? 299.878 222.902 236.462 1.00 167.06 ? 67  LYS P NZ     1 
ATOM   8489   H  H      . LYS C  3  67  ? 304.930 224.692 240.847 1.00 65.66  ? 67  LYS P H      1 
ATOM   8490   H  HA     . LYS C  3  67  ? 304.359 225.265 238.280 1.00 63.75  ? 67  LYS P HA     1 
ATOM   8491   H  HB2    . LYS C  3  67  ? 303.611 223.259 239.440 1.00 66.72  ? 67  LYS P HB2    1 
ATOM   8492   H  HB3    . LYS C  3  67  ? 302.572 224.201 240.173 1.00 66.72  ? 67  LYS P HB3    1 
ATOM   8493   H  HG2    . LYS C  3  67  ? 301.528 224.628 238.144 1.00 67.21  ? 67  LYS P HG2    1 
ATOM   8494   H  HG3    . LYS C  3  67  ? 302.566 223.658 237.417 1.00 67.21  ? 67  LYS P HG3    1 
ATOM   8495   H  HD2    . LYS C  3  67  ? 301.624 221.836 238.243 1.00 98.62  ? 67  LYS P HD2    1 
ATOM   8496   H  HD3    . LYS C  3  67  ? 301.089 222.591 239.537 1.00 98.62  ? 67  LYS P HD3    1 
ATOM   8497   H  HE2    . LYS C  3  67  ? 299.319 221.952 238.144 1.00 134.12 ? 67  LYS P HE2    1 
ATOM   8498   H  HE3    . LYS C  3  67  ? 299.371 223.532 238.303 1.00 134.12 ? 67  LYS P HE3    1 
ATOM   8499   H  HZ1    . LYS C  3  67  ? 299.053 222.963 236.133 1.00 160.89 ? 67  LYS P HZ1    1 
ATOM   8500   H  HZ2    . LYS C  3  67  ? 300.331 223.637 236.247 1.00 160.89 ? 67  LYS P HZ2    1 
ATOM   8501   H  HZ3    . LYS C  3  67  ? 300.283 222.196 236.101 1.00 160.89 ? 67  LYS P HZ3    1 
ATOM   8502   N  N      . LEU C  3  68  ? 303.328 227.480 238.523 1.00 53.96  ? 68  LEU P N      1 
ATOM   8503   C  CA     . LEU C  3  68  ? 302.918 228.868 238.727 1.00 50.86  ? 68  LEU P CA     1 
ATOM   8504   C  C      . LEU C  3  68  ? 301.443 229.104 238.479 1.00 50.09  ? 68  LEU P C      1 
ATOM   8505   O  O      . LEU C  3  68  ? 300.883 230.076 238.993 1.00 51.89  ? 68  LEU P O      1 
ATOM   8506   C  CB     . LEU C  3  68  ? 303.686 229.799 237.781 1.00 49.35  ? 68  LEU P CB     1 
ATOM   8507   C  CG     . LEU C  3  68  ? 305.203 229.851 237.888 1.00 49.98  ? 68  LEU P CG     1 
ATOM   8508   C  CD1    . LEU C  3  68  ? 305.750 230.766 236.806 1.00 48.60  ? 68  LEU P CD1    1 
ATOM   8509   C  CD2    . LEU C  3  68  ? 305.602 230.324 239.271 1.00 49.76  ? 68  LEU P CD2    1 
ATOM   8510   H  H      . LEU C  3  68  ? 303.528 227.298 237.706 1.00 54.08  ? 68  LEU P H      1 
ATOM   8511   H  HA     . LEU C  3  68  ? 303.118 229.128 239.640 1.00 51.45  ? 68  LEU P HA     1 
ATOM   8512   H  HB2    . LEU C  3  68  ? 303.478 229.534 236.871 1.00 49.77  ? 68  LEU P HB2    1 
ATOM   8513   H  HB3    . LEU C  3  68  ? 303.364 230.702 237.928 1.00 49.77  ? 68  LEU P HB3    1 
ATOM   8514   H  HG     . LEU C  3  68  ? 305.567 228.962 237.751 1.00 50.00  ? 68  LEU P HG     1 
ATOM   8515   H  HD11   . LEU C  3  68  ? 306.716 230.797 236.877 1.00 48.47  ? 68  LEU P HD11   1 
ATOM   8516   H  HD12   . LEU C  3  68  ? 305.492 230.417 235.938 1.00 48.47  ? 68  LEU P HD12   1 
ATOM   8517   H  HD13   . LEU C  3  68  ? 305.380 231.655 236.928 1.00 48.47  ? 68  LEU P HD13   1 
ATOM   8518   H  HD21   . LEU C  3  68  ? 306.570 230.353 239.327 1.00 49.99  ? 68  LEU P HD21   1 
ATOM   8519   H  HD22   . LEU C  3  68  ? 305.235 231.209 239.419 1.00 49.99  ? 68  LEU P HD22   1 
ATOM   8520   H  HD23   . LEU C  3  68  ? 305.250 229.705 239.930 1.00 49.99  ? 68  LEU P HD23   1 
ATOM   8521   N  N      . ASN C  3  69  ? 300.821 228.243 237.692 1.00 67.54  ? 69  ASN P N      1 
ATOM   8522   C  CA     . ASN C  3  69  ? 299.513 228.462 237.126 1.00 67.10  ? 69  ASN P CA     1 
ATOM   8523   C  C      . ASN C  3  69  ? 298.988 227.065 236.814 1.00 81.36  ? 69  ASN P C      1 
ATOM   8524   O  O      . ASN C  3  69  ? 299.474 226.079 237.379 1.00 107.08 ? 69  ASN P O      1 
ATOM   8525   C  CB     . ASN C  3  69  ? 299.646 229.406 235.914 1.00 65.24  ? 69  ASN P CB     1 
ATOM   8526   C  CG     . ASN C  3  69  ? 298.332 230.005 235.474 1.00 77.72  ? 69  ASN P CG     1 
ATOM   8527   O  OD1    . ASN C  3  69  ? 297.351 230.017 236.219 1.00 98.13  ? 69  ASN P OD1    1 
ATOM   8528   N  ND2    . ASN C  3  69  ? 298.314 230.531 234.251 1.00 73.79  ? 69  ASN P ND2    1 
ATOM   8529   H  H      . ASN C  3  69  ? 301.160 227.487 237.463 1.00 66.64  ? 69  ASN P H      1 
ATOM   8530   H  HA     . ASN C  3  69  ? 298.933 228.875 237.784 1.00 66.51  ? 69  ASN P HA     1 
ATOM   8531   H  HB2    . ASN C  3  69  ? 300.242 230.135 236.148 1.00 64.62  ? 69  ASN P HB2    1 
ATOM   8532   H  HB3    . ASN C  3  69  ? 300.011 228.908 235.166 1.00 64.62  ? 69  ASN P HB3    1 
ATOM   8533   H  HD21   . ASN C  3  69  ? 297.592 230.887 233.947 1.00 73.47  ? 69  ASN P HD21   1 
ATOM   8534   H  HD22   . ASN C  3  69  ? 299.024 230.516 233.766 1.00 73.47  ? 69  ASN P HD22   1 
ATOM   8535   N  N      . GLU C  3  70  ? 298.024 226.960 235.916 1.00 95.69  ? 70  GLU P N      1 
ATOM   8536   C  CA     . GLU C  3  70  ? 297.665 225.662 235.371 1.00 99.05  ? 70  GLU P CA     1 
ATOM   8537   C  C      . GLU C  3  70  ? 298.272 225.455 233.992 1.00 99.64  ? 70  GLU P C      1 
ATOM   8538   O  O      . GLU C  3  70  ? 298.020 224.428 233.356 1.00 102.21 ? 70  GLU P O      1 
ATOM   8539   C  CB     . GLU C  3  70  ? 296.141 225.507 235.350 1.00 137.18 ? 70  GLU P CB     1 
ATOM   8540   C  CG     . GLU C  3  70  ? 295.509 225.682 236.746 1.00 167.25 ? 70  GLU P CG     1 
ATOM   8541   C  CD     . GLU C  3  70  ? 293.987 225.646 236.744 1.00 194.28 ? 70  GLU P CD     1 
ATOM   8542   O  OE1    . GLU C  3  70  ? 293.406 224.625 236.315 1.00 211.34 ? 70  GLU P OE1    1 
ATOM   8543   O  OE2    . GLU C  3  70  ? 293.373 226.644 237.186 1.00 195.42 ? 70  GLU P OE2    1 
ATOM   8544   H  H      . GLU C  3  70  ? 297.565 227.618 235.607 1.00 89.01  ? 70  GLU P H      1 
ATOM   8545   H  HA     . GLU C  3  70  ? 298.022 224.973 235.954 1.00 92.06  ? 70  GLU P HA     1 
ATOM   8546   H  HB2    . GLU C  3  70  ? 295.763 226.180 234.762 1.00 130.54 ? 70  GLU P HB2    1 
ATOM   8547   H  HB3    . GLU C  3  70  ? 295.918 224.620 235.027 1.00 130.54 ? 70  GLU P HB3    1 
ATOM   8548   H  HG2    . GLU C  3  70  ? 295.821 224.966 237.321 1.00 161.07 ? 70  GLU P HG2    1 
ATOM   8549   H  HG3    . GLU C  3  70  ? 295.785 226.538 237.108 1.00 161.07 ? 70  GLU P HG3    1 
ATOM   8550   N  N      . ASP C  3  71  ? 299.111 226.397 233.543 1.00 67.93  ? 71  ASP P N      1 
ATOM   8551   C  CA     . ASP C  3  71  ? 299.686 226.397 232.208 1.00 67.91  ? 71  ASP P CA     1 
ATOM   8552   C  C      . ASP C  3  71  ? 301.177 226.688 232.189 1.00 67.11  ? 71  ASP P C      1 
ATOM   8553   O  O      . ASP C  3  71  ? 301.773 226.684 231.107 1.00 67.00  ? 71  ASP P O      1 
ATOM   8554   C  CB     . ASP C  3  71  ? 298.996 227.449 231.330 1.00 96.96  ? 71  ASP P CB     1 
ATOM   8555   C  CG     . ASP C  3  71  ? 297.575 227.079 230.983 1.00 135.29 ? 71  ASP P CG     1 
ATOM   8556   O  OD1    . ASP C  3  71  ? 296.696 227.214 231.857 1.00 167.29 ? 71  ASP P OD1    1 
ATOM   8557   O  OD2    . ASP C  3  71  ? 297.336 226.663 229.830 1.00 141.83 ? 71  ASP P OD2    1 
ATOM   8558   H  H      . ASP C  3  71  ? 299.366 227.067 234.019 1.00 69.41  ? 71  ASP P H      1 
ATOM   8559   H  HA     . ASP C  3  71  ? 299.544 225.528 231.803 1.00 68.97  ? 71  ASP P HA     1 
ATOM   8560   H  HB2    . ASP C  3  71  ? 298.978 228.295 231.805 1.00 98.29  ? 71  ASP P HB2    1 
ATOM   8561   H  HB3    . ASP C  3  71  ? 299.492 227.544 230.502 1.00 98.29  ? 71  ASP P HB3    1 
ATOM   8562   N  N      . MET C  3  72  ? 301.794 226.949 233.335 1.00 64.83  ? 72  MET P N      1 
ATOM   8563   C  CA     . MET C  3  72  ? 303.156 227.456 233.358 1.00 63.65  ? 72  MET P CA     1 
ATOM   8564   C  C      . MET C  3  72  ? 303.889 226.924 234.573 1.00 64.87  ? 72  MET P C      1 
ATOM   8565   O  O      . MET C  3  72  ? 303.333 226.866 235.671 1.00 76.98  ? 72  MET P O      1 
ATOM   8566   C  CB     . MET C  3  72  ? 303.185 228.979 233.394 1.00 67.43  ? 72  MET P CB     1 
ATOM   8567   C  CG     . MET C  3  72  ? 302.540 229.618 232.192 1.00 98.48  ? 72  MET P CG     1 
ATOM   8568   S  SD     . MET C  3  72  ? 302.973 231.357 231.996 1.00 105.47 ? 72  MET P SD     1 
ATOM   8569   C  CE     . MET C  3  72  ? 304.766 231.303 231.931 1.00 143.25 ? 72  MET P CE     1 
ATOM   8570   H  H      . MET C  3  72  ? 301.444 226.841 234.113 1.00 66.24  ? 72  MET P H      1 
ATOM   8571   H  HA     . MET C  3  72  ? 303.617 227.164 232.556 1.00 64.80  ? 72  MET P HA     1 
ATOM   8572   H  HB2    . MET C  3  72  ? 302.710 229.284 234.183 1.00 68.94  ? 72  MET P HB2    1 
ATOM   8573   H  HB3    . MET C  3  72  ? 304.108 229.275 233.429 1.00 68.94  ? 72  MET P HB3    1 
ATOM   8574   H  HG2    . MET C  3  72  ? 302.826 229.148 231.394 1.00 100.09 ? 72  MET P HG2    1 
ATOM   8575   H  HG3    . MET C  3  72  ? 301.576 229.559 232.283 1.00 100.09 ? 72  MET P HG3    1 
ATOM   8576   H  HE1    . MET C  3  72  ? 305.105 232.206 231.825 1.00 144.54 ? 72  MET P HE1    1 
ATOM   8577   H  HE2    . MET C  3  72  ? 305.101 230.919 232.756 1.00 144.54 ? 72  MET P HE2    1 
ATOM   8578   H  HE3    . MET C  3  72  ? 305.038 230.757 231.177 1.00 144.54 ? 72  MET P HE3    1 
ATOM   8579   N  N      . ALA C  3  73  ? 305.141 226.556 234.364 1.00 41.04  ? 73  ALA P N      1 
ATOM   8580   C  CA     . ALA C  3  73  ? 306.035 226.189 235.443 1.00 41.81  ? 73  ALA P CA     1 
ATOM   8581   C  C      . ALA C  3  73  ? 307.280 227.054 235.366 1.00 41.48  ? 73  ALA P C      1 
ATOM   8582   O  O      . ALA C  3  73  ? 307.481 227.823 234.424 1.00 46.63  ? 73  ALA P O      1 
ATOM   8583   C  CB     . ALA C  3  73  ? 306.413 224.706 235.381 1.00 44.98  ? 73  ALA P CB     1 
ATOM   8584   H  H      . ALA C  3  73  ? 305.504 226.510 233.586 1.00 45.55  ? 73  ALA P H      1 
ATOM   8585   H  HA     . ALA C  3  73  ? 305.598 226.358 236.292 1.00 46.16  ? 73  ALA P HA     1 
ATOM   8586   H  HB1    . ALA C  3  73  ? 307.010 224.502 236.118 1.00 48.83  ? 73  ALA P HB1    1 
ATOM   8587   H  HB2    . ALA C  3  73  ? 305.606 224.172 235.450 1.00 48.83  ? 73  ALA P HB2    1 
ATOM   8588   H  HB3    . ALA C  3  73  ? 306.856 224.529 234.536 1.00 48.83  ? 73  ALA P HB3    1 
ATOM   8589   N  N      . CYS C  3  74  ? 308.119 226.929 236.382 1.00 58.41  ? 74  CYS P N      1 
ATOM   8590   C  CA     . CYS C  3  74  ? 309.397 227.607 236.356 1.00 57.25  ? 74  CYS P CA     1 
ATOM   8591   C  C      . CYS C  3  74  ? 310.348 226.853 237.266 1.00 64.79  ? 74  CYS P C      1 
ATOM   8592   O  O      . CYS C  3  74  ? 309.935 226.255 238.263 1.00 76.41  ? 74  CYS P O      1 
ATOM   8593   C  CB     . CYS C  3  74  ? 309.274 229.069 236.800 1.00 63.02  ? 74  CYS P CB     1 
ATOM   8594   S  SG     . CYS C  3  74  ? 309.734 229.338 238.520 1.00 74.19  ? 74  CYS P SG     1 
ATOM   8595   H  H      . CYS C  3  74  ? 307.973 226.462 237.089 1.00 61.00  ? 74  CYS P H      1 
ATOM   8596   H  HA     . CYS C  3  74  ? 309.755 227.589 235.454 1.00 59.60  ? 74  CYS P HA     1 
ATOM   8597   H  HB2    . CYS C  3  74  ? 309.855 229.615 236.248 1.00 65.84  ? 74  CYS P HB2    1 
ATOM   8598   H  HB3    . CYS C  3  74  ? 308.353 229.353 236.691 1.00 65.84  ? 74  CYS P HB3    1 
ATOM   8599   H  HG     . CYS C  3  74  ? 309.609 230.502 238.781 1.00 77.23  ? 74  CYS P HG     1 
ATOM   8600   N  N      . SER C  3  75  ? 311.622 226.882 236.898 1.00 64.76  ? 75  SER P N      1 
ATOM   8601   C  CA     . SER C  3  75  ? 312.687 226.315 237.707 1.00 66.28  ? 75  SER P CA     1 
ATOM   8602   C  C      . SER C  3  75  ? 313.629 227.438 238.099 1.00 64.42  ? 75  SER P C      1 
ATOM   8603   O  O      . SER C  3  75  ? 313.913 228.331 237.294 1.00 70.55  ? 75  SER P O      1 
ATOM   8604   C  CB     . SER C  3  75  ? 313.451 225.227 236.957 1.00 81.92  ? 75  SER P CB     1 
ATOM   8605   O  OG     . SER C  3  75  ? 312.653 224.068 236.795 1.00 93.89  ? 75  SER P OG     1 
ATOM   8606   H  H      . SER C  3  75  ? 311.900 227.234 236.165 1.00 68.32  ? 75  SER P H      1 
ATOM   8607   H  HA     . SER C  3  75  ? 312.312 225.930 238.515 1.00 69.50  ? 75  SER P HA     1 
ATOM   8608   H  HB2    . SER C  3  75  ? 313.700 225.563 236.082 1.00 84.46  ? 75  SER P HB2    1 
ATOM   8609   H  HB3    . SER C  3  75  ? 314.246 224.995 237.462 1.00 84.46  ? 75  SER P HB3    1 
ATOM   8610   H  HG     . SER C  3  75  ? 313.085 223.478 236.381 1.00 96.37  ? 75  SER P HG     1 
ATOM   8611   N  N      . VAL C  3  76  ? 314.100 227.397 239.338 1.00 55.36  ? 76  VAL P N      1 
ATOM   8612   C  CA     . VAL C  3  76  ? 314.888 228.480 239.893 1.00 54.22  ? 76  VAL P CA     1 
ATOM   8613   C  C      . VAL C  3  76  ? 316.349 228.056 239.964 1.00 60.33  ? 76  VAL P C      1 
ATOM   8614   O  O      . VAL C  3  76  ? 316.702 226.890 239.775 1.00 63.82  ? 76  VAL P O      1 
ATOM   8615   C  CB     . VAL C  3  76  ? 314.385 228.926 241.277 1.00 53.53  ? 76  VAL P CB     1 
ATOM   8616   C  CG1    . VAL C  3  76  ? 312.964 229.483 241.181 1.00 51.90  ? 76  VAL P CG1    1 
ATOM   8617   C  CG2    . VAL C  3  76  ? 314.468 227.765 242.267 1.00 87.42  ? 76  VAL P CG2    1 
ATOM   8618   H  H      . VAL C  3  76  ? 313.973 226.743 239.882 1.00 55.28  ? 76  VAL P H      1 
ATOM   8619   H  HA     . VAL C  3  76  ? 314.830 229.244 239.297 1.00 54.23  ? 76  VAL P HA     1 
ATOM   8620   H  HB     . VAL C  3  76  ? 314.959 229.635 241.604 1.00 54.05  ? 76  VAL P HB     1 
ATOM   8621   H  HG11   . VAL C  3  76  ? 312.672 229.756 242.064 1.00 53.00  ? 76  VAL P HG11   1 
ATOM   8622   H  HG12   . VAL C  3  76  ? 312.965 230.246 240.582 1.00 53.00  ? 76  VAL P HG12   1 
ATOM   8623   H  HG13   . VAL C  3  76  ? 312.377 228.792 240.836 1.00 53.00  ? 76  VAL P HG13   1 
ATOM   8624   H  HG21   . VAL C  3  76  ? 314.147 228.065 243.132 1.00 87.80  ? 76  VAL P HG21   1 
ATOM   8625   H  HG22   . VAL C  3  76  ? 313.917 227.035 241.944 1.00 87.80  ? 76  VAL P HG22   1 
ATOM   8626   H  HG23   . VAL C  3  76  ? 315.391 227.477 242.338 1.00 87.80  ? 76  VAL P HG23   1 
ATOM   8627   N  N      . ALA C  3  77  ? 317.199 229.037 240.252 1.00 95.70  ? 77  ALA P N      1 
ATOM   8628   C  CA     . ALA C  3  77  ? 318.631 228.823 240.389 1.00 98.47  ? 77  ALA P CA     1 
ATOM   8629   C  C      . ALA C  3  77  ? 319.153 230.052 241.115 1.00 88.63  ? 77  ALA P C      1 
ATOM   8630   O  O      . ALA C  3  77  ? 319.074 231.162 240.584 1.00 81.80  ? 77  ALA P O      1 
ATOM   8631   C  CB     . ALA C  3  77  ? 319.307 228.646 239.036 1.00 108.92 ? 77  ALA P CB     1 
ATOM   8632   H  H      . ALA C  3  77  ? 316.961 229.855 240.376 1.00 91.47  ? 77  ALA P H      1 
ATOM   8633   H  HA     . ALA C  3  77  ? 318.800 228.038 240.933 1.00 93.72  ? 77  ALA P HA     1 
ATOM   8634   H  HB1    . ALA C  3  77  ? 320.257 228.507 239.174 1.00 103.64 ? 77  ALA P HB1    1 
ATOM   8635   H  HB2    . ALA C  3  77  ? 318.921 227.877 238.588 1.00 103.64 ? 77  ALA P HB2    1 
ATOM   8636   H  HB3    . ALA C  3  77  ? 319.164 229.445 238.505 1.00 103.64 ? 77  ALA P HB3    1 
ATOM   8637   N  N      . GLY C  3  78  ? 319.642 229.856 242.321 1.00 84.99  ? 78  GLY P N      1 
ATOM   8638   C  CA     . GLY C  3  78  ? 320.161 230.949 243.104 1.00 84.79  ? 78  GLY P CA     1 
ATOM   8639   C  C      . GLY C  3  78  ? 319.932 230.694 244.587 1.00 82.53  ? 78  GLY P C      1 
ATOM   8640   O  O      . GLY C  3  78  ? 320.033 229.558 245.053 1.00 78.06  ? 78  GLY P O      1 
ATOM   8641   H  H      . GLY C  3  78  ? 319.684 229.091 242.711 1.00 90.96  ? 78  GLY P H      1 
ATOM   8642   H  HA2    . GLY C  3  78  ? 321.113 231.045 242.946 1.00 90.95  ? 78  GLY P HA2    1 
ATOM   8643   H  HA3    . GLY C  3  78  ? 319.716 231.774 242.855 1.00 90.95  ? 78  GLY P HA3    1 
ATOM   8644   N  N      . ILE C  3  79  ? 319.616 231.768 245.299 1.00 93.47  ? 79  ILE P N      1 
ATOM   8645   C  CA     . ILE C  3  79  ? 319.403 231.721 246.741 1.00 98.43  ? 79  ILE P CA     1 
ATOM   8646   C  C      . ILE C  3  79  ? 318.008 231.158 246.991 1.00 94.85  ? 79  ILE P C      1 
ATOM   8647   O  O      . ILE C  3  79  ? 317.009 231.828 246.721 1.00 100.61 ? 79  ILE P O      1 
ATOM   8648   C  CB     . ILE C  3  79  ? 319.557 233.115 247.355 1.00 91.52  ? 79  ILE P CB     1 
ATOM   8649   C  CG1    . ILE C  3  79  ? 320.922 233.701 246.969 1.00 82.38  ? 79  ILE P CG1    1 
ATOM   8650   C  CG2    . ILE C  3  79  ? 319.338 233.073 248.864 1.00 92.18  ? 79  ILE P CG2    1 
ATOM   8651   C  CD1    . ILE C  3  79  ? 321.120 235.130 247.409 1.00 81.28  ? 79  ILE P CD1    1 
ATOM   8652   H  H      . ILE C  3  79  ? 319.516 232.554 244.963 1.00 86.75  ? 79  ILE P H      1 
ATOM   8653   H  HA     . ILE C  3  79  ? 320.055 231.129 247.148 1.00 91.97  ? 79  ILE P HA     1 
ATOM   8654   H  HB     . ILE C  3  79  ? 318.872 233.685 246.972 1.00 85.39  ? 79  ILE P HB     1 
ATOM   8655   H  HG12   . ILE C  3  79  ? 321.619 233.165 247.379 1.00 75.84  ? 79  ILE P HG12   1 
ATOM   8656   H  HG13   . ILE C  3  79  ? 321.012 233.673 246.003 1.00 75.84  ? 79  ILE P HG13   1 
ATOM   8657   H  HG21   . ILE C  3  79  ? 319.442 233.968 249.223 1.00 86.31  ? 79  ILE P HG21   1 
ATOM   8658   H  HG22   . ILE C  3  79  ? 318.443 232.746 249.043 1.00 86.31  ? 79  ILE P HG22   1 
ATOM   8659   H  HG23   . ILE C  3  79  ? 319.994 232.479 249.261 1.00 86.31  ? 79  ILE P HG23   1 
ATOM   8660   H  HD11   . ILE C  3  79  ? 322.000 235.427 247.130 1.00 75.02  ? 79  ILE P HD11   1 
ATOM   8661   H  HD12   . ILE C  3  79  ? 320.438 235.684 246.997 1.00 75.02  ? 79  ILE P HD12   1 
ATOM   8662   H  HD13   . ILE C  3  79  ? 321.046 235.176 248.375 1.00 75.02  ? 79  ILE P HD13   1 
ATOM   8663   N  N      . THR C  3  80  ? 317.929 229.926 247.516 1.00 85.34  ? 80  THR P N      1 
ATOM   8664   C  CA     . THR C  3  80  ? 316.621 229.293 247.682 1.00 86.01  ? 80  THR P CA     1 
ATOM   8665   C  C      . THR C  3  80  ? 315.691 230.156 248.519 1.00 87.59  ? 80  THR P C      1 
ATOM   8666   O  O      . THR C  3  80  ? 314.472 230.118 248.325 1.00 93.50  ? 80  THR P O      1 
ATOM   8667   C  CB     . THR C  3  80  ? 316.742 227.912 248.331 1.00 119.73 ? 80  THR P CB     1 
ATOM   8668   O  OG1    . THR C  3  80  ? 317.726 227.128 247.648 1.00 161.59 ? 80  THR P OG1    1 
ATOM   8669   C  CG2    . THR C  3  80  ? 315.399 227.183 248.266 1.00 104.54 ? 80  THR P CG2    1 
ATOM   8670   H  H      . THR C  3  80  ? 318.599 229.453 247.776 1.00 84.18  ? 80  THR P H      1 
ATOM   8671   H  HA     . THR C  3  80  ? 316.215 229.177 246.808 1.00 85.17  ? 80  THR P HA     1 
ATOM   8672   H  HB     . THR C  3  80  ? 316.995 228.011 249.263 1.00 118.62 ? 80  THR P HB     1 
ATOM   8673   H  HG1    . THR C  3  80  ? 317.790 226.371 248.007 1.00 159.87 ? 80  THR P HG1    1 
ATOM   8674   H  HG21   . THR C  3  80  ? 315.476 226.308 248.678 1.00 103.70 ? 80  THR P HG21   1 
ATOM   8675   H  HG22   . THR C  3  80  ? 314.721 227.694 248.736 1.00 103.70 ? 80  THR P HG22   1 
ATOM   8676   H  HG23   . THR C  3  80  ? 315.126 227.073 247.342 1.00 103.70 ? 80  THR P HG23   1 
ATOM   8677   N  N      . SER C  3  81  ? 316.245 230.931 249.454 1.00 105.98 ? 81  SER P N      1 
ATOM   8678   C  CA     . SER C  3  81  ? 315.421 231.800 250.287 1.00 109.64 ? 81  SER P CA     1 
ATOM   8679   C  C      . SER C  3  81  ? 314.522 232.685 249.436 1.00 94.53  ? 81  SER P C      1 
ATOM   8680   O  O      . SER C  3  81  ? 313.301 232.736 249.635 1.00 81.12  ? 81  SER P O      1 
ATOM   8681   C  CB     . SER C  3  81  ? 316.322 232.660 251.177 1.00 111.29 ? 81  SER P CB     1 
ATOM   8682   O  OG     . SER C  3  81  ? 317.513 231.974 251.520 1.00 112.24 ? 81  SER P OG     1 
ATOM   8683   H  H      . SER C  3  81  ? 317.087 230.970 249.623 1.00 91.34  ? 81  SER P H      1 
ATOM   8684   H  HA     . SER C  3  81  ? 314.858 231.256 250.860 1.00 95.55  ? 81  SER P HA     1 
ATOM   8685   H  HB2    . SER C  3  81  ? 316.553 233.472 250.699 1.00 97.18  ? 81  SER P HB2    1 
ATOM   8686   H  HB3    . SER C  3  81  ? 315.841 232.881 251.990 1.00 97.18  ? 81  SER P HB3    1 
ATOM   8687   H  HG     . SER C  3  81  ? 317.994 232.460 252.008 1.00 97.64  ? 81  SER P HG     1 
ATOM   8688   N  N      . ASP C  3  82  ? 315.117 233.388 248.469 1.00 93.47  ? 82  ASP P N      1 
ATOM   8689   C  CA     . ASP C  3  82  ? 314.399 234.361 247.659 1.00 107.15 ? 82  ASP P CA     1 
ATOM   8690   C  C      . ASP C  3  82  ? 313.529 233.710 246.591 1.00 91.25  ? 82  ASP P C      1 
ATOM   8691   O  O      . ASP C  3  82  ? 312.610 234.359 246.080 1.00 89.67  ? 82  ASP P O      1 
ATOM   8692   C  CB     . ASP C  3  82  ? 315.405 235.314 247.014 1.00 135.34 ? 82  ASP P CB     1 
ATOM   8693   C  CG     . ASP C  3  82  ? 316.320 235.963 248.035 1.00 165.64 ? 82  ASP P CG     1 
ATOM   8694   O  OD1    . ASP C  3  82  ? 317.552 235.788 247.929 1.00 182.31 ? 82  ASP P OD1    1 
ATOM   8695   O  OD2    . ASP C  3  82  ? 315.806 236.639 248.950 1.00 172.64 ? 82  ASP P OD2    1 
ATOM   8696   H  H      . ASP C  3  82  ? 315.949 233.314 248.265 1.00 84.28  ? 82  ASP P H      1 
ATOM   8697   H  HA     . ASP C  3  82  ? 313.820 234.883 248.236 1.00 98.29  ? 82  ASP P HA     1 
ATOM   8698   H  HB2    . ASP C  3  82  ? 315.955 234.819 246.388 1.00 126.26 ? 82  ASP P HB2    1 
ATOM   8699   H  HB3    . ASP C  3  82  ? 314.923 236.018 246.551 1.00 126.26 ? 82  ASP P HB3    1 
ATOM   8700   N  N      . ALA C  3  83  ? 313.800 232.449 246.243 1.00 66.24  ? 83  ALA P N      1 
ATOM   8701   C  CA     . ALA C  3  83  ? 312.928 231.721 245.328 1.00 62.39  ? 83  ALA P CA     1 
ATOM   8702   C  C      . ALA C  3  83  ? 311.527 231.588 245.903 1.00 79.53  ? 83  ALA P C      1 
ATOM   8703   O  O      . ALA C  3  83  ? 310.533 231.856 245.220 1.00 103.85 ? 83  ALA P O      1 
ATOM   8704   C  CB     . ALA C  3  83  ? 313.507 230.336 245.038 1.00 67.58  ? 83  ALA P CB     1 
ATOM   8705   H  H      . ALA C  3  83  ? 314.477 231.999 246.523 1.00 68.41  ? 83  ALA P H      1 
ATOM   8706   H  HA     . ALA C  3  83  ? 312.868 232.206 244.491 1.00 64.56  ? 83  ALA P HA     1 
ATOM   8707   H  HB1    . ALA C  3  83  ? 312.915 229.868 244.429 1.00 69.22  ? 83  ALA P HB1    1 
ATOM   8708   H  HB2    . ALA C  3  83  ? 314.383 230.439 244.634 1.00 69.22  ? 83  ALA P HB2    1 
ATOM   8709   H  HB3    . ALA C  3  83  ? 313.582 229.845 245.871 1.00 69.22  ? 83  ALA P HB3    1 
ATOM   8710   N  N      . ASN C  3  84  ? 311.427 231.171 247.166 1.00 97.98  ? 84  ASN P N      1 
ATOM   8711   C  CA     . ASN C  3  84  ? 310.121 230.983 247.781 1.00 98.78  ? 84  ASN P CA     1 
ATOM   8712   C  C      . ASN C  3  84  ? 309.303 232.266 247.788 1.00 112.99 ? 84  ASN P C      1 
ATOM   8713   O  O      . ASN C  3  84  ? 308.080 232.207 247.942 1.00 106.85 ? 84  ASN P O      1 
ATOM   8714   C  CB     . ASN C  3  84  ? 310.286 230.460 249.206 1.00 120.27 ? 84  ASN P CB     1 
ATOM   8715   C  CG     . ASN C  3  84  ? 310.725 229.009 249.242 1.00 139.70 ? 84  ASN P CG     1 
ATOM   8716   O  OD1    . ASN C  3  84  ? 310.172 228.162 248.539 1.00 128.47 ? 84  ASN P OD1    1 
ATOM   8717   N  ND2    . ASN C  3  84  ? 311.728 228.717 250.063 1.00 169.12 ? 84  ASN P ND2    1 
ATOM   8718   H  H      . ASN C  3  84  ? 312.093 230.992 247.679 1.00 79.47  ? 84  ASN P H      1 
ATOM   8719   H  HA     . ASN C  3  84  ? 309.628 230.318 247.274 1.00 80.71  ? 84  ASN P HA     1 
ATOM   8720   H  HB2    . ASN C  3  84  ? 310.959 230.989 249.662 1.00 102.21 ? 84  ASN P HB2    1 
ATOM   8721   H  HB3    . ASN C  3  84  ? 309.437 230.529 249.670 1.00 102.21 ? 84  ASN P HB3    1 
ATOM   8722   H  HD21   . ASN C  3  84  ? 312.015 227.909 250.120 1.00 150.34 ? 84  ASN P HD21   1 
ATOM   8723   H  HD22   . ASN C  3  84  ? 312.091 229.337 250.536 1.00 150.34 ? 84  ASN P HD22   1 
ATOM   8724   N  N      . VAL C  3  85  ? 309.945 233.419 247.623 1.00 85.45  ? 85  VAL P N      1 
ATOM   8725   C  CA     . VAL C  3  85  ? 309.212 234.676 247.565 1.00 68.03  ? 85  VAL P CA     1 
ATOM   8726   C  C      . VAL C  3  85  ? 308.686 234.927 246.156 1.00 63.22  ? 85  VAL P C      1 
ATOM   8727   O  O      . VAL C  3  85  ? 307.491 235.182 245.960 1.00 57.33  ? 85  VAL P O      1 
ATOM   8728   C  CB     . VAL C  3  85  ? 310.108 235.830 248.056 1.00 59.23  ? 85  VAL P CB     1 
ATOM   8729   C  CG1    . VAL C  3  85  ? 309.371 237.157 247.960 1.00 57.20  ? 85  VAL P CG1    1 
ATOM   8730   C  CG2    . VAL C  3  85  ? 310.560 235.573 249.495 1.00 62.07  ? 85  VAL P CG2    1 
ATOM   8731   H  H      . VAL C  3  85  ? 310.798 233.499 247.543 1.00 84.90  ? 85  VAL P H      1 
ATOM   8732   H  HA     . VAL C  3  85  ? 308.448 234.619 248.161 1.00 67.94  ? 85  VAL P HA     1 
ATOM   8733   H  HB     . VAL C  3  85  ? 310.897 235.881 247.495 1.00 59.14  ? 85  VAL P HB     1 
ATOM   8734   H  HG11   . VAL C  3  85  ? 309.954 237.866 248.274 1.00 57.56  ? 85  VAL P HG11   1 
ATOM   8735   H  HG12   . VAL C  3  85  ? 309.125 237.316 247.035 1.00 57.56  ? 85  VAL P HG12   1 
ATOM   8736   H  HG13   . VAL C  3  85  ? 308.574 237.116 248.512 1.00 57.56  ? 85  VAL P HG13   1 
ATOM   8737   H  HG21   . VAL C  3  85  ? 311.121 236.308 249.786 1.00 61.96  ? 85  VAL P HG21   1 
ATOM   8738   H  HG22   . VAL C  3  85  ? 309.778 235.508 250.065 1.00 61.96  ? 85  VAL P HG22   1 
ATOM   8739   H  HG23   . VAL C  3  85  ? 311.061 234.742 249.524 1.00 61.96  ? 85  VAL P HG23   1 
ATOM   8740   N  N      . LEU C  3  86  ? 309.564 234.846 245.151 1.00 63.73  ? 86  LEU P N      1 
ATOM   8741   C  CA     . LEU C  3  86  ? 309.166 235.199 243.790 1.00 61.82  ? 86  LEU P CA     1 
ATOM   8742   C  C      . LEU C  3  86  ? 308.225 234.175 243.175 1.00 78.69  ? 86  LEU P C      1 
ATOM   8743   O  O      . LEU C  3  86  ? 307.396 234.535 242.335 1.00 104.40 ? 86  LEU P O      1 
ATOM   8744   C  CB     . LEU C  3  86  ? 310.394 235.361 242.896 1.00 61.67  ? 86  LEU P CB     1 
ATOM   8745   C  CG     . LEU C  3  86  ? 311.356 236.498 243.236 1.00 82.99  ? 86  LEU P CG     1 
ATOM   8746   C  CD1    . LEU C  3  86  ? 312.391 236.620 242.134 1.00 97.83  ? 86  LEU P CD1    1 
ATOM   8747   C  CD2    . LEU C  3  86  ? 310.622 237.818 243.431 1.00 89.92  ? 86  LEU P CD2    1 
ATOM   8748   H  H      . LEU C  3  86  ? 310.382 234.593 245.231 1.00 60.20  ? 86  LEU P H      1 
ATOM   8749   H  HA     . LEU C  3  86  ? 308.701 236.050 243.813 1.00 58.30  ? 86  LEU P HA     1 
ATOM   8750   H  HB2    . LEU C  3  86  ? 310.903 234.536 242.930 1.00 57.68  ? 86  LEU P HB2    1 
ATOM   8751   H  HB3    . LEU C  3  86  ? 310.087 235.509 241.987 1.00 57.68  ? 86  LEU P HB3    1 
ATOM   8752   H  HG     . LEU C  3  86  ? 311.819 236.285 244.062 1.00 78.97  ? 86  LEU P HG     1 
ATOM   8753   H  HD11   . LEU C  3  86  ? 313.000 237.343 242.353 1.00 93.35  ? 86  LEU P HD11   1 
ATOM   8754   H  HD12   . LEU C  3  86  ? 312.879 235.785 242.065 1.00 93.35  ? 86  LEU P HD12   1 
ATOM   8755   H  HD13   . LEU C  3  86  ? 311.939 236.810 241.297 1.00 93.35  ? 86  LEU P HD13   1 
ATOM   8756   H  HD21   . LEU C  3  86  ? 311.268 238.509 243.645 1.00 86.39  ? 86  LEU P HD21   1 
ATOM   8757   H  HD22   . LEU C  3  86  ? 310.155 238.043 242.612 1.00 86.39  ? 86  LEU P HD22   1 
ATOM   8758   H  HD23   . LEU C  3  86  ? 309.988 237.721 244.159 1.00 86.39  ? 86  LEU P HD23   1 
ATOM   8759   N  N      . THR C  3  87  ? 308.338 232.903 243.555 1.00 69.47  ? 87  THR P N      1 
ATOM   8760   C  CA     . THR C  3  87  ? 307.415 231.911 243.021 1.00 80.42  ? 87  THR P CA     1 
ATOM   8761   C  C      . THR C  3  87  ? 306.033 232.036 243.640 1.00 68.94  ? 87  THR P C      1 
ATOM   8762   O  O      . THR C  3  87  ? 305.047 231.628 243.017 1.00 73.71  ? 87  THR P O      1 
ATOM   8763   C  CB     . THR C  3  87  ? 307.946 230.496 243.246 1.00 113.41 ? 87  THR P CB     1 
ATOM   8764   O  OG1    . THR C  3  87  ? 308.185 230.284 244.643 1.00 131.92 ? 87  THR P OG1    1 
ATOM   8765   C  CG2    . THR C  3  87  ? 309.227 230.276 242.454 1.00 128.72 ? 87  THR P CG2    1 
ATOM   8766   H  H      . THR C  3  87  ? 308.924 232.598 244.105 1.00 68.82  ? 87  THR P H      1 
ATOM   8767   H  HA     . THR C  3  87  ? 307.327 232.048 242.065 1.00 79.77  ? 87  THR P HA     1 
ATOM   8768   H  HB     . THR C  3  87  ? 307.286 229.856 242.937 1.00 112.33 ? 87  THR P HB     1 
ATOM   8769   H  HG1    . THR C  3  87  ? 308.752 230.837 244.925 1.00 130.92 ? 87  THR P HG1    1 
ATOM   8770   H  HG21   . THR C  3  87  ? 309.558 229.376 242.602 1.00 127.09 ? 87  THR P HG21   1 
ATOM   8771   H  HG22   . THR C  3  87  ? 309.056 230.397 241.507 1.00 127.09 ? 87  THR P HG22   1 
ATOM   8772   H  HG23   . THR C  3  87  ? 309.904 230.911 242.736 1.00 127.09 ? 87  THR P HG23   1 
ATOM   8773   N  N      . ASN C  3  88  ? 305.934 232.599 244.838 1.00 86.36  ? 88  ASN P N      1 
ATOM   8774   C  CA     . ASN C  3  88  ? 304.633 232.872 245.419 1.00 86.31  ? 88  ASN P CA     1 
ATOM   8775   C  C      . ASN C  3  88  ? 304.106 234.246 245.049 1.00 85.62  ? 88  ASN P C      1 
ATOM   8776   O  O      . ASN C  3  88  ? 302.903 234.487 245.175 1.00 96.50  ? 88  ASN P O      1 
ATOM   8777   C  CB     . ASN C  3  88  ? 304.681 232.759 246.937 1.00 85.52  ? 88  ASN P CB     1 
ATOM   8778   C  CG     . ASN C  3  88  ? 303.311 232.850 247.550 1.00 82.86  ? 88  ASN P CG     1 
ATOM   8779   O  OD1    . ASN C  3  88  ? 302.898 233.907 248.032 1.00 90.61  ? 88  ASN P OD1    1 
ATOM   8780   N  ND2    . ASN C  3  88  ? 302.577 231.741 247.507 1.00 78.37  ? 88  ASN P ND2    1 
ATOM   8781   H  H      . ASN C  3  88  ? 306.601 232.830 245.330 1.00 77.55  ? 88  ASN P H      1 
ATOM   8782   H  HA     . ASN C  3  88  ? 304.000 232.214 245.091 1.00 78.00  ? 88  ASN P HA     1 
ATOM   8783   H  HB2    . ASN C  3  88  ? 305.066 231.902 247.181 1.00 77.36  ? 88  ASN P HB2    1 
ATOM   8784   H  HB3    . ASN C  3  88  ? 305.221 233.481 247.294 1.00 77.36  ? 88  ASN P HB3    1 
ATOM   8785   H  HD21   . ASN C  3  88  ? 301.785 231.737 247.843 1.00 70.65  ? 88  ASN P HD21   1 
ATOM   8786   H  HD22   . ASN C  3  88  ? 302.893 231.029 247.143 1.00 70.65  ? 88  ASN P HD22   1 
ATOM   8787   N  N      . GLU C  3  89  ? 304.969 235.154 244.616 1.00 57.70  ? 89  GLU P N      1 
ATOM   8788   C  CA     . GLU C  3  89  ? 304.505 236.405 244.046 1.00 55.58  ? 89  GLU P CA     1 
ATOM   8789   C  C      . GLU C  3  89  ? 304.222 236.290 242.556 1.00 54.83  ? 89  GLU P C      1 
ATOM   8790   O  O      . GLU C  3  89  ? 303.592 237.188 241.990 1.00 53.63  ? 89  GLU P O      1 
ATOM   8791   C  CB     . GLU C  3  89  ? 305.524 237.515 244.293 1.00 72.82  ? 89  GLU P CB     1 
ATOM   8792   C  CG     . GLU C  3  89  ? 304.987 238.889 243.968 1.00 108.01 ? 89  GLU P CG     1 
ATOM   8793   C  CD     . GLU C  3  89  ? 305.957 239.984 244.337 1.00 154.12 ? 89  GLU P CD     1 
ATOM   8794   O  OE1    . GLU C  3  89  ? 307.077 239.985 243.782 1.00 179.68 ? 89  GLU P OE1    1 
ATOM   8795   O  OE2    . GLU C  3  89  ? 305.603 240.839 245.177 1.00 167.60 ? 89  GLU P OE2    1 
ATOM   8796   H  H      . GLU C  3  89  ? 305.825 235.070 244.641 1.00 58.77  ? 89  GLU P H      1 
ATOM   8797   H  HA     . GLU C  3  89  ? 303.678 236.659 244.486 1.00 56.93  ? 89  GLU P HA     1 
ATOM   8798   H  HB2    . GLU C  3  89  ? 305.779 237.507 245.229 1.00 74.12  ? 89  GLU P HB2    1 
ATOM   8799   H  HB3    . GLU C  3  89  ? 306.303 237.358 243.737 1.00 74.12  ? 89  GLU P HB3    1 
ATOM   8800   H  HG2    . GLU C  3  89  ? 304.817 238.946 243.015 1.00 109.65 ? 89  GLU P HG2    1 
ATOM   8801   H  HG3    . GLU C  3  89  ? 304.166 239.035 244.463 1.00 109.65 ? 89  GLU P HG3    1 
ATOM   8802   N  N      . LEU C  3  90  ? 304.678 235.219 241.906 1.00 38.28  ? 90  LEU P N      1 
ATOM   8803   C  CA     . LEU C  3  90  ? 304.250 234.929 240.543 1.00 37.92  ? 90  LEU P CA     1 
ATOM   8804   C  C      . LEU C  3  90  ? 302.849 234.340 240.537 1.00 37.93  ? 90  LEU P C      1 
ATOM   8805   O  O      . LEU C  3  90  ? 301.981 234.799 239.789 1.00 46.25  ? 90  LEU P O      1 
ATOM   8806   C  CB     . LEU C  3  90  ? 305.221 233.963 239.864 1.00 38.81  ? 90  LEU P CB     1 
ATOM   8807   C  CG     . LEU C  3  90  ? 306.467 234.560 239.206 1.00 42.70  ? 90  LEU P CG     1 
ATOM   8808   C  CD1    . LEU C  3  90  ? 307.553 233.500 239.001 1.00 62.14  ? 90  LEU P CD1    1 
ATOM   8809   C  CD2    . LEU C  3  90  ? 306.085 235.203 237.882 1.00 38.30  ? 90  LEU P CD2    1 
ATOM   8810   H  H      . LEU C  3  90  ? 305.234 234.650 242.232 1.00 40.12  ? 90  LEU P H      1 
ATOM   8811   H  HA     . LEU C  3  90  ? 304.235 235.753 240.031 1.00 39.63  ? 90  LEU P HA     1 
ATOM   8812   H  HB2    . LEU C  3  90  ? 305.528 233.329 240.531 1.00 39.95  ? 90  LEU P HB2    1 
ATOM   8813   H  HB3    . LEU C  3  90  ? 304.735 233.486 239.173 1.00 39.95  ? 90  LEU P HB3    1 
ATOM   8814   H  HG     . LEU C  3  90  ? 306.828 235.251 239.783 1.00 43.50  ? 90  LEU P HG     1 
ATOM   8815   H  HD11   . LEU C  3  90  ? 308.324 233.915 238.584 1.00 62.37  ? 90  LEU P HD11   1 
ATOM   8816   H  HD12   . LEU C  3  90  ? 307.801 233.132 239.864 1.00 62.37  ? 90  LEU P HD12   1 
ATOM   8817   H  HD13   . LEU C  3  90  ? 307.205 232.798 238.430 1.00 62.37  ? 90  LEU P HD13   1 
ATOM   8818   H  HD21   . LEU C  3  90  ? 306.881 235.578 237.473 1.00 39.12  ? 90  LEU P HD21   1 
ATOM   8819   H  HD22   . LEU C  3  90  ? 305.702 234.527 237.302 1.00 39.12  ? 90  LEU P HD22   1 
ATOM   8820   H  HD23   . LEU C  3  90  ? 305.436 235.904 238.048 1.00 39.12  ? 90  LEU P HD23   1 
ATOM   8821   N  N      . ARG C  3  91  ? 302.615 233.322 241.372 1.00 44.15  ? 91  ARG P N      1 
ATOM   8822   C  CA     . ARG C  3  91  ? 301.283 232.737 241.492 1.00 44.42  ? 91  ARG P CA     1 
ATOM   8823   C  C      . ARG C  3  91  ? 300.225 233.793 241.766 1.00 48.62  ? 91  ARG P C      1 
ATOM   8824   O  O      . ARG C  3  91  ? 299.064 233.638 241.373 1.00 53.98  ? 91  ARG P O      1 
ATOM   8825   C  CB     . ARG C  3  91  ? 301.256 231.722 242.624 1.00 46.12  ? 91  ARG P CB     1 
ATOM   8826   C  CG     . ARG C  3  91  ? 301.891 230.405 242.315 1.00 48.36  ? 91  ARG P CG     1 
ATOM   8827   C  CD     . ARG C  3  91  ? 301.530 229.452 243.419 1.00 50.24  ? 91  ARG P CD     1 
ATOM   8828   N  NE     . ARG C  3  91  ? 302.314 228.227 243.383 1.00 53.38  ? 91  ARG P NE     1 
ATOM   8829   C  CZ     . ARG C  3  91  ? 303.473 228.066 244.014 1.00 56.34  ? 91  ARG P CZ     1 
ATOM   8830   N  NH1    . ARG C  3  91  ? 304.003 229.053 244.732 1.00 55.07  ? 91  ARG P NH1    1 
ATOM   8831   N  NH2    . ARG C  3  91  ? 304.112 226.908 243.925 1.00 59.07  ? 91  ARG P NH2    1 
ATOM   8832   H  H      . ARG C  3  91  ? 303.209 232.956 241.875 1.00 44.42  ? 91  ARG P H      1 
ATOM   8833   H  HA     . ARG C  3  91  ? 301.055 232.282 240.667 1.00 44.95  ? 91  ARG P HA     1 
ATOM   8834   H  HB2    . ARG C  3  91  ? 301.723 232.099 243.386 1.00 46.61  ? 91  ARG P HB2    1 
ATOM   8835   H  HB3    . ARG C  3  91  ? 300.331 231.552 242.862 1.00 46.61  ? 91  ARG P HB3    1 
ATOM   8836   H  HG2    . ARG C  3  91  ? 301.547 230.060 241.476 1.00 48.36  ? 91  ARG P HG2    1 
ATOM   8837   H  HG3    . ARG C  3  91  ? 302.855 230.501 242.284 1.00 48.36  ? 91  ARG P HG3    1 
ATOM   8838   H  HD2    . ARG C  3  91  ? 301.688 229.884 244.274 1.00 50.29  ? 91  ARG P HD2    1 
ATOM   8839   H  HD3    . ARG C  3  91  ? 300.594 229.212 243.336 1.00 50.29  ? 91  ARG P HD3    1 
ATOM   8840   H  HE     . ARG C  3  91  ? 301.982 227.548 242.973 1.00 52.94  ? 91  ARG P HE     1 
ATOM   8841   H  HH11   . ARG C  3  91  ? 303.593 229.807 244.795 1.00 54.53  ? 91  ARG P HH11   1 
ATOM   8842   H  HH12   . ARG C  3  91  ? 304.754 228.937 245.134 1.00 54.53  ? 91  ARG P